3Q7QA

Crystal structure of rad g-domain q148a-gtp analog complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
146
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVEDGHTYDRSIVVDGEEASLMVYDIWEMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTP-binding protein RAD
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 146
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q7qA00
1Z3IX 2IEYA 1NP6A 3W8RA 3TR0A 3W8NA 1RPZA 1CULC 1Y3AA 1LW7A 3CW2A 5A4JA 2IWHA 2ZU6A 3ETLA 4LYFA 3FWYA 1DG1G 2NG1A 2CNWD 2A7QA 3IPXA 1TQ6A 4C4PA 4L16A 5AJWA 4LV6A 1O87A 2XB2A 4DIEA 1GKUB 2PX0A 3AUYA 5J5CA 2QE7A 3EZ2A 1G6OA 2FZ4A 2ZRJA 2JLVA 3EC1A 2QTFA 4LC0A 3WYGA 4DZZA 3NBFA 1J2JA 1ESMA 4AC9A 2PJZA 3W6NA 2VH5R 2VO1A 2GVDC 3EAQA 1OXVA 3GJ4A 3OE7D 1G7SA 2CCKA 1Z08A 1RRGA 4KHZA 1Z06A 2QM8A 3BFKA 3FYHA 5FOXA 4RKEA 2DPXA 1G3RA 1UKYA 4DC9A 2BEKA 2NO7A 4ZPXA 1QVRA 1FP6A 1M6NA 1XMJA 1GFIA 2RMKA 1E2HA 5CM9C 4BFWA 1GAJA 2ZS7A 3ZD6A 4IXNA 3TAUA 3AF2A 1DAKA 3M4YA 2GJ9A 1TNDA 1DE0A 4JMPA 4NU0A 1N6PA 5E3HA 1IXSB 5JHHB 4BRWA 3O8CA 3AUXA 3FKSD 3PV0A 4LJ7A 4Q18A 1S1MA 3UXMA 3K0AA 5CLLA 1E6CA 1MR3F 2QROA 4GSYA 4M9ZA 4A0HA 1OYYA 1E9DA 2HYDA 2RGAA 1IY2A 5J47A 1KNQA 3ND8A 3PUZA 4V02A 2V1XA 2F3RA 3RRMA 1MRSA 4WXRA 4DCUA 4Z51A 3EW9A 4URXR 1F6BA 2JEOA 3WHLA 2UVQA 2GZAA 2G6BA 1Q1BA 3AF3A 2ZXUA 1JPNA 2ERYA 2Z4RA 4WZBE 5GVSA 2HV8A 2ZJ8A 2PLFA 5FTJA 5DI9A 2QTHA 4NCJA 3VR4A 3R20A 1A2BA 4JLNA 2C5LA 3MWKA 2Q9CA 2YWHA 2FWRA 3EASA 3O47A 4ESHA 5JS8A 2VP9A 3EZ9A 4B2LA 5FOVA 3SJBA 1IXZA 2IK8A 4AK9A 4LJ4A 2PEZA 2HT6A 4MGIR 3HU2A 2YJTD 4CZ2A 3QBTA 1JALA 3QXCA 3OESA 2H7VA 3SBEA 2QMOA 4AY2A 2QAGA 2DWPA 1VG8A 3W34A 1FOEB 4EUNA 5JECA 1YZNA 3X1YA 2ZE5A 1W0JD 3F3YA 5KDLA 4D0NA 1NRJB 1F5NA 2IYYA 2V8OA 3FDIA 2AK2A 4AKHA 2GJKA 2IUSA 3BORA 4B76A 1ELOA 4DIDA 3DZ8A 5DO9A 5P21A 3RSOA 5KSOA 4WVFA 4PC3A 4BPBA 5CIWA 1Z83A 2H57A 4IOMA 1HE1C 2ZRPA 4EJSC 5AJVB 1UDWA 5L8VA 2PBRA 3E1SA 3SYNA 3NEJA 2GXAA 2CK3D 2ZRLA 2WKQA 5G3ZA 2X8AA 3HJNA 4QNMA 5SZKB 1U8AA 4YDHB 4C2TA 3K9NA 2BBTA 4MH0R 3EG5A 2HLDD 1XPOA 1AS3A 4TN1A 4BZXA 2C8VA 2BEJA 4NH0A 3U7FB 1XJQA 4DCSA 3LLUA 4B3DA 4Q1BA 2ZJ5A 3H86A 1C1YA 1QBKC 2ORWA 4XD7D 2O8DB 2DFKB 2BKUA 4PR0A 2B92A 4YDSA 3IPYA 3IBGA 3QG5A 4UKDA 3T12A 1GL9B 1EX6A 2ZRGA 4HZUA 4AKGA 2ZUBA 4P4UA 3I5XA 2NO6A 1OFTA 3AEZA 4ZI2A 2WSSD 3FHTA 1UBFA 1Z0AA 4BLQA 3PEWA 1VCIA 2FSFA 3BOSA 3KJIA 4NCHA 2WJJA 1R0XA 2O5VA 2FPLA 1TQ4A 3DOEA 1E9SA 2P5SA 4JLOA 3THYB 1YU9A 2NPIA 5DHAA 2ZRBA 1W2HA 4YXWD 1II9A 4Z1MD 3MLEA 1QF9A 3SJZA 2P6RA 3ZD7A 2ANBA 4PPNA 4HAXA 2XJ9A 3QXHA 2I1QA 1VG1A 2PLRA 1XCMA 2OLJA 4IDPA 3GLHE 3OAAA 2O0JA 1XTSA 4US0R 1J8YF 4B3GA 1LS1A 3K0FB 3FHOA 4PHFA 5DISB 4Q4HB 2V7QA 4D6PA 2BMJA 2QP3A 4LJYA 3T5GA 3B1ZA 3VR2A 2YOGA 2BM1A 1UAAA 2JJ1A 2CDNA 4OI4A 4Q5IA 4M21A 2V9PA 3WXMA 2W6IA 1EFRD 5EE5B 4DLZA 1E2IA 5M04A 1E94E 1XP8A 4RY2A 2O8DA 1GL6A 2FDCA 3NHAA 5AUPB 1H8HD 2YC2C 4KJZA 1UEJA 4M1YA 1VG0B 2ZM5A 2QRZA 2YWFA 4ACBA 4I1OA 4A82A 2LCFA 1IJFA 1PUJA 1YRAA 2PX3A 3ECCA 1G8HA 2ZRKA 4KCGA 4PANA 1G7TA 1RW4A 2FGKA 4JVMA 4V0MA 2QUZA 5J4YA 2J5XA 2QA5A 5JBQA 1XCPA 1T8TA 1BOFA 1KO7A 4BLTA 3I1FA 3THYA 5TMPA 4U02A 2CBZA 2WTUA 2FA9A 1JEEA 1X86B 4UJ3A 4MYCA 1FQJA 3NG1A 1ZUNB 3OFNA 1P9RA 2CHQA 3IDQA 2VLIA 1KO8A 5FTNA 2R44A 2EYQA 3CH4B 3FVQA 4QBHA 4M1KA 2GWHA 4QOSA 4LGMA 1T0HB 5SZHB 5GADl 1HURA 2ZE8A 4URWR 1N6KA 3RANA 3VNVA 4CGZA 4A0FA 3BB3A 2N46A 1MKYA 1JXOA 5KHOC 1G21E 2C98A 4BFXA 2OCYC 1LV7A 2BM0A 1BO6A 2IYVA 3K0FA 2KB0A 3UPUA 1GM5A 4MDEA 3IGFA 3B82A 2GKSA 4RD4A 3VR6A 4A0RA 3NH9A 4LJ9A 3AVWA 2VHCA 4MGZR 4D0LB 4GT1A 5EE3A 5BYKA 1U8YA 1M1YE 3ZDQA 1SGWA 5KOYA 1KKMA 4X8HA 1YZGA 2QY9A 5HPYB 2QM7A 2ZYUX 2OHFA 1YZKA 3MGCA 5KSZA 3NXSA 1J8MF 1RYHA 2NZJA 3GD7A 4PSVA 2OG2A 3L8YA 4KVAA 4IDQA 2WJVA 1E2MA 3U7HB 2MSCB 4YMSA 5FOUA 1LS6A 5KYKA 2FSHA 1VCMA 4WW0A 4KSBA 5CJPA 4XVRA 1SQ5A 821PA 3U7GA 4DXAA 4XWOA 1ZIOA 4F93B 2XOKD 4A8JB 4RFSB 1R4AA 1T0JB 2QP9X 1DOAA 4R71A 1GNQA 2WJHA 2PZFA 3CUEF 1IOZA 2G88A 5DHFA 2QN6A 1O3YA 5IDVA 4Q9LA 5AUOB 1CS4C 1SKYE 2QQEA 4LY6A 4OHZA 4D2IA 4D80A 2WWFA 2JJ2D 1MO4A 4IOKA 2AN9A 2OXCA 1R5OA 2OFXA 4HAZA 1PUIA 1SVLA 3L2OB 2J41A 1NVWQ 3TLXA 1R6BX 2OBMA 2ODNA 2V6IA 1TF7A 2ODWA 4ERNA 4UXHA 1HA3A 5JCPA 4FMBB 4TMZA 1ZD1A 3BERA 2IYUA 2B7BA 4HAWA 3VKHA 3ZIAA 3PCRB 1E9RA 1D6JA 1VYUA 5TXGA 3TUJC 2C99A 3W6OA 5IF9A 3KQLA 1VKJA 2WWYA 3U5ZB 2EQBA 4C9BA 4DDVA 1D2NA 1R2QA 2ZJAA 4LHWA 2GNOA 4IFEA 4IDHA 4Q4AA 1EFTA 2IYZA 4TYQA 5KSPA 5FBVB 3FMOB 3U44A 4DT1B 4KBFA 1ZU4A 4G5GA 4JS0A 3TBKA 5A5GA 3TUZC 4LHZA 4W7SA 2JDID 1DO0A 3B1YA 3P4YA 4IKEA 3H4MA 3U7EB 2D7DA 3I92A 4KFTA 2JATA 3I3SR 2EYUA 2J0SA 3RC8A 3EPLA 1NL3A 4LBYA 1FPMA 2ZI6A 1RRPA 3UMRA 2J0VA 1TF5A 3NDPA 4MKFA 2BJVA 2R9VA 3KX2A 4RVCA 3DPUA 1NNEA 4LC1A 2FGJA 3UMFA 2N42A 3F5FA 4JL6A 3K9HA 3FFBA 2NZ8A 2BCJQ 1NLYA 2GJ8A 1ZP6A 2KSQA 4BFZA 4MKGA 3D8BA 3GLHB 5TY0A 3SEAA 4I1SA 4DEXA 1N2CE 3Q7PA 3B5JA 5AJXA 4A4DA 1CRPA 1OT3A 2ATVA 4HB0A 4L4UA 4TTQA 3I4LA 1X3SA 5CM8B 4C0SA 1C4OA 2OV2A 4HEJA 5CDFE 5KNCA 1DEKA 1NG1A 3LBNA 4BFVA 4DSOA 4Q9KA 2PZEA 2QENA 4EFMA 3EZ7A 1U9IC 4KODA 5EXPA 3VTKA 4C0LA 4CT4B 1E1QD 5FBQB 1G5PA 3LVQE 2VRWA 1GTVA 1ZU5A 2VHQA 3T34A 1KDOA 5ANRB 5SZJA 4LSGA 3CPHA 4G5RA 1NF3A 4P0TA 1SKQA 2RHDA 1NN0A 2VHTA 3BB1A 3WNCA 4ASUA 1IN7A 2QTVB 3FGNA 4POAA 3GJ6A 4G3XA 2GEUA 2R6AA 1VPLA 2QI9C 2C9OA 4KSCA 2Z6VA 2ANCA 2OCAA 3QG1A 1ZNZA 1AQUA 4R98A 5JFGA 3I62A 1P6XA 1KDTA 5FUVA 4EJSB 3HU1A 1IJEA 1KK1A 1P9NA 2AXPA 1TQDA 2L0XA 3QF4B 3QXJA 4DLXA 4L5BA 3QQ5A 3Q5EA 1Z0JA 3B85A 4OL0A 5KO2A 1TUEA 4TL7A 1RC8A 4MITA 4ZCMA 3WMGA 1XF9A 2VP4A 2QG6A 3B9PA 3V4RA 3SBDA 4R2HA 2AD1A 1Z2CA 3DOFA 3KTAB 3DMDA 3KZ1E 4A9AA 1P75A 2ZSDA 2VP2A 1G8YA 2VPPA 2WKRA 3AKEA 3GLHA 2BBWA 2XITA 4GOJA 3TAHA 1CTQA 1II0A 5C1BA 1II8B 1IN6A 5EE1A 2DFLA 4KXFB 3KFVA 1FP7A 3T1TA 1CJTC 3AV0B 1NN1A 1IAQA 1JB1A 1KJZA 1YR6A 3V9PA 3OEHA 2ZYVX 1P61B 4LRWA 4HB3A 2ZJBA 2VYFA 2E9SA 4LV5B 5C46F 2ZETA 1COWD 3OIUA 2OFOA 3BH7A 3GFOA 4FWIB 5DN6D 4CEJB 4L8GA 1MABA 1GNPA 1HTWA 1GG2A 4DHEA 1AZSC 3CONA 1KTVA 4NYMR 4GDFA 2GEVA 3ZLJA 2D06A 2QZ4A 3I61A 1OKKD 3DM9B 5E7JA 2RKOA 2VIIA 2NOAA 1NJGA 2QE7D 5DGXA 2PMDA 5KDOA 5B30A 4ZCIA 3MWYW 5BXQC 3BD9A 1VTKA 4JZKA 2FZLA 4EDHA 3CX6A 3DVLA 3QF4A 1GRQA 1EXMA 1KZ7B 2YOHA 4FI3C 2IL1A 4GMXA 1D5CA 1T6NA 2XNSA 2F55A 3IKJA 1E2DA 1GRRA 1QHYA 1T5LA 2KBEA 5HKKA 2C2HA 1HQCA 3WP1B 4AURA 1R10A 2C03A 1Z6XA 1FW6A 1FNNA 1P60A 1S8FA 5JLJA 2V55B 3VU9B 3NBXX 1M7GA 3M6AA 2RGGA 2IS1A 2GCPA 1DO2A 3D3QA 2QL6A 3U2QA 1Z5ZA 4DLWA 4BFYA 2A5JA 4P3YA 4B6EA 4CDGA 3BB4A 2TMKA 1W36D 1TQ2A 2CVFA 1Q0UA 4II7A 1DAMA 4M1OA 3GLFE 2HT1A 1N6NA 1HH4A 4M1MA 2ZSAA 4HUQB 2ORIA 2I1VB 1OH7A 2ZR7A 2WPDA 4HB2A 4QBFA 2O0KA 3X2SA 2X2FA 1Z6YA 4LJ8A 1E9BA 1XD8A 4B3XA 1FUKA 1E98A 1GL7A 3KKPA 4EPTA 1MOZA 3S1AA 2XXAA 3KDSE 3TMKA 3AVUA 1MO5A 3R9XA 1XMSA 2YKGA 3OF5A 1XEXB 4U00A 4Z8XA 3AVPA 2JIZA 1KI2A 1IM2A 1Y63A 1P5ZB 2FEOA 3L0SA 1N3BA 1V43A 2IHYA 2PL3A 5LD2C 1F2UA 3EPJA 3KKMA 4AG6A 4DUGD 3WBKA 2D4HA 4BWYA 1Q1ZA 1VCNA 3GJ7A 1U0LA 4RSGA 4DWJA 3QVVA 4B74A 4TSFA 4Q4LA 2VP0A 4F92B 1MT0A 1P9WA 2AWNA 2XTNA 3DKVA 1YR8A 3DL0A 2F6RA 3ASYA 4JBYA 1KK3A 4E07A 3NDBB 4Q03A 1PJRA 1OXXK 1M2OB 4OK5A 3GEIA 4ZDJA 2OXRA 2Q0HA 4IJMA 3BGWA 3RHFA 2IUUA 3VU9A 2RGXA 1N0VC 3EA0A 721PA 4NYJQ 4D82A 5C18A 1OV4A 4NTZA 2ZRIA 5KDDA 1K8RA 3GJ5A 2JLQA 3K70D 2EW1A 1G3IA 2Q9AA 4Q21A 5JI2E 1W48A 4C7OB 3B78A 1SVKA 2LWIA 2GZHA 2GAAA 3JZAA 4QGAA 2W58A 4HUQA 5KPJA 5A0FA 3PENA 2WJIA 1ZM2A 3SN6A 3K0CC 3PITA 1CR2A 1E32A 2XNDA 2AR7A 2RH5A 2ZSFA 3K09C 3T1OA 3AVYA 3GP8A 2WAYA 2JA1A 5TARA 2A30A 1PLLA 3WBJA 5FPYA 4LOAA 1SVWA 2E87A 1KO1A 3SC3A 3P4XA 4WAUA 1GILA 3RS7A 1XEXA 2ZJ2A 3BC1A 1A4RA 2YV5A 2R6CA 4B43A 3QI2A 2Q3FA 1U90A 1OHHA 4H1VA 1DELA 3MRSA 2AX4A 2CL0X 2ODEA 3BH0A 3QPUA 4KLZA 2AKYA 2ZITA 2IC5A 4AG5A 2QT1A 4FMCF 3NBZC 2BBSA 5FUXA 5HCIA 1U8ZA 3QKTA 4CT5A 5CIQA 2PZGA 1SZPA 2WM9B 3B13B 3LW7A 2J45A 2YOFA 4G5SA 4A36A 2FSGA 2REOA 2FPKA 1AS2A 4HAYA 2XJ4A 2GK6A 1QG2A 4LPSA 1TL7C 1HYQA 1E9FA 2QAGB 2ZE7A 5CDFA 3SQWA 3CRMA 1PV4A 1A1VA 4DCNA 2ZI7A 2UKDA 4BEJA 1X1RA 2ZQ5A 2V7QD 4NL4H 4WZAE 4F4IA 3HPRA 1CJUC 1AN0A 2C95A 1UBGA 2KJQA 2REBA 4BFUA 5DLQC 1T8UA 1NBMD 2JJ1D 1NVVQ 5FOWA 1W0KA 4DCVA 3FKQA 3AVVA 3NKVA 2CHVA 1NVUQ 4GI7A 5B58C 4C7OA 4EQ6A 1G7RA 1IN5A 2VL7A 2VSXA 3KXIA 3L8ZA 4JL8A 1S0UA 2HF9A 2PCLA 2CCGA 2DFTA 2ZI3A 1BYIA 4W5HA 1E2QA 3A1UA 5BW8A 3U6BA 5IRCD 4GP6A 3KQKA 1D9XA 1JI0A 1I2DA 2W2XA 3IIMA 2VBCA 1EFHA 1T4GA 1WDTA 5BWMA 4JLMA 1G5RA 3SYKA 3PR1A 1W5TA 4FMDF 4JKYA 1DAHA 1EGAA 1BYUA 3A4NA 1E0AA 2A5DA 4LV8B 1ZC4A 4MQBA 4RD1A 1JEDA 3ZQJA 3TRFA 4BUJA 3VHXA 1NI3A 5TDHA 3KQNA 4M22A 5CYPA 4HI0E 3PJRA 4WIAA 3R7WA 4HZUB 2OM2A 4V0NA 1Q3TA 1ZCAA 3AQ4A 3QXXA 1SULA 4BQSA 3OFND 2OBNA 1HEIA 1ZNXA 4QL3A 2ERXA 2PEYA 3PQCA 4U7DA 4XSHA 3JZMA 3QE0A 3ZVLA 1SVMA 2ZVQX 1XMVA 3B2EA 1ZW6A 4AKEA 2FFBA 1ZVQA 3BAFA 3GLFB 3C4JA 3NC0C 4KYUA 4I99A 3DDCA 4Q19A 3NVAA 1G16A 5JCZA 3CNNA 4NYIQ 1UBEA 4BE7B 5L3SB 1ZM9A 2GEDA 3EWAA 4TMWA 2G77B 4I4LA 1XDBA 5HZHA 1RJ9A 2C9YA 1UADA 4DLRA 2ZI5A 3KKOA 2FFQA 2EVWX 3IO3A 4CEHA 4OQFA 3EXAA 5F2EA 4D4JA 3I8XA 4HYYA 2K5UA 3IQXA 3RS3A 1M7BA 2P0EA 4UNNA 1W4CA 2FH5B 2WIAA 4LJ6A 1OH8A 1L8QA 1WRBA 2NO9A 1IN4A 3BWDD 3ADCA 1VIAA 2FU5C 3CX8A 3T35A 2HYIC 4DEYA 1DTSA 1W1WA 3RSLA 4QBGB 4URUR 1GITA 2PCJA 4ZV4A 2C77A 5J4LA 3SS8A 2BC9A 3QF7A 4IEIA 3WNDA 4P4SB 1PZNA 3MFYA 3C8UA 4HB4A 1Z22A 4HAUA 3CH5A 1U9IA 4IRUB 2Z5FA 3AKCA 2FMXA 4KU4A 4Q7MB 4C0JA 2GA8A 4AD8A 2V3CC 5FTMA 4GPTA 3WRXC 4JLAA 1UEIA 2WWGA 5C2JB 4G0NA 3CR8A 5BN5A 3MSXA 4WZ6A 2W6JA 3V00A 3LBHA 1WCV1 2BVNA 1E2FA 2WMNB 1U99A 4LHXA 1J70A 1KI7A 3QEOA 3ND9A 1OIXA 5DSZA 3GLFA 4HLDA 4B73A 4TT3A 3PIRA 3H2YA 4X8MA 3WHKA 2QGZA 4PAOA 2NQ2C 3GEEA 4B3BA 3MG9A 5DIFA 2VEDA 1KK0A 5L3SA 1SXJC 1P62B 1B23P 2IXEA 1QHNA 1G9XA 2IA5A 1OFUX 2HXSA 2PT7A 3LRPA 4PAMA 4QJ3A 1Q1EA 5C4MA 1ODFA 4OI0A 1P2SA 3KB1A 4DB2A 3N2IA 4LWZA 1S96A 1P7CA 4EPXA 3THOA 4TYPA 4TTRA 2OLKA 3EPHA 4G01B 4RD3A 1Z6AA 1G3UA 1WQ1R 2GF9A 2V4ZA 4OHXA 1N5KA 1KSJA 4EAQA 1I4DD 3QEJA 2DY1A 5FBRB 5L3RA 1W4AA 2CNWA 4LBWA 2ECKA 4OI1A 3TUIC 4W5WA 4O2RA 4HAVA 5FOTA 3KXKA 4DBLC 3ONWA 2ZSBA 1YVDA 2YVUA 1XBTA 4MRVA 5KPDA 1X8KA 4JJZA 4P4SA 2GBLC 2KI5A 4Q4JA 2IT1A 2MSEB 5JJIA 3OE7A 2H18A 4TL9A 5H8WA 1FMLA 1SHKA 2IYSA 4QXAA 4KO8A 5CLQA 2VP5A 4CVNA 3Q3JB 4QRHA 2JLZA 4UNQA 2AXNA 1OFIA 4M53A 3TGPA 4PPQA 3GLGE 1CU1A 1XD9A 621PA 1WBDA 2DHRA 2HCJB 2GCOB 3FKSA 4JKIA 5LD2B 1CJKC 1E2NA 1E0JA 2RAPA 3VKWA 1AKEA 3LLMA 3WRYC 1S4QA 2BJWA 4OHWA 3I5YA 3W5JA 2GCNA 4D4KA 4A15A 4ASUD 2O8CB 2GZDA 1QRAA 1BS1A 2X2EA 3CNLA 2RGBA 3CO5A 6Q21A 3K8YA 4NDZA 2P6UA 1N25A 3NIBA 3TVDA 4DSUA 1L4UA 4QGFA 3U3MA 2BMDA 2NTYC 4GP7A 3BIFA 5FUYA 2F1JA 3VR5A 1E3MA 3HP1A 1JR6A 1Z0DA 4IW3B 4K8OA 4Q4AB 5EXTA 4D25A 1RIFA 5DYIA 1S3SA 1KAOA 4FINA 3U44B 2R62A 4DCTA 1FX0B 1BMFA 4XH9B 3AVTA 2OO7A 3EIQA 5FFMA 1CLUA 521PA 1A5TA 3MUFA 2B8WA 1NVXQ 1D9ZA 1W7AA 2JAQA 2D2EA 4K81B 3IEUA 3VR3A 4U5XA 2I4IA 2HJGA 2O8FB 4GOKA 3BFVA 3IQWA 4CEIA 3T1VA 3LNCA 1A7JA 5KU1A 2BHRA 4C3ZA 3FHCB 2QU8A 4IFBA 4CF7A 5E95A 5JJLA 1SXJE 5B57C 4NCNA 1TF2A 1KSFX 3A37A 2AD5A 3GJ8A 1XU4A 4B3FX 1R0ZA 1KMQA 2IYWA 2R8RA 1UM8A 3RS5A 2F3TA 4ZO4A 1KSHA 2FJUA 3EX7C 2OILA 4F4CA 1E79A 2XTZA 5J4HA 3Q8XB 1Q21A 3BXZA 4NE2A 3N2EA 1XXHE 4IHQA 3UANA 4TZ0A 4JJKA 1G6HA 1NKTA 1I4TD 1KHTA 3IHWA 2GCOA 3FMIA 2VQSA 4TYNA 1P2TA 4FCWA 3FTQA 1G8GA 4TLCA 4B48A 4E03A 1EK0A 2YZ2A 4D0GA 3CRQA 3ADDA 5TVKA 1N0WA 3G0HA 2O8CA 5K8IA 4PQFA 4QM7A 1IONA 5JWOA 3QSYA 5FPKA 3FMFA 5EE0A 2W0SA 4XD7A 4ZKDA 2IW3A 2WMOB 3A8TA 4B44A 4ESVA 3W5IA 1VG9B 1HT2E 4ZDKA 5KSYA 1IHUA 3MJRA 3QENA 4GZMA 3SQXA 4V0KA 3L43A 3CLVA 1CRQA 1GP2A 3TSOA 5EP1A 4MRRA 2ZRAA 3CF2A 4JLVA 421PA 4JL5A 1ESNA 1LF5A 1KI3A 3C16C 1FL9A 1FX0A 1K6MA 5BQ5A 3LXXA 2OE2A 3IO5A 4MYHA 1WB9A 3UG6A 1KDPA 1TPZA 1Z2AA 4HLUC 4EFLA 1XRJA 5FOSA 1MRNA 3OEED 1BH2A 4Z1MA 2WV9A 3N70A 5AJZA 3W90A 4IVQA 4MRNA 2O8FA 5CITA 1JECA 1CKEA 2JLXA 1QHGA 3P26A 1E2EA 1HUQA 3SE0A 1AZTA 2WOJA 3K0CA 3AGPA 3K09A 3B1XA 2XTMA 1N6LA 1LF0A 3O8BA 1G20E 1HE8B 2RGDA 4NKRA 4LHYA 5J40A 4M1WA 2O52A 5EXSA 4B3CA 1KAGA 2A5YB 3TJZA 1NN3A 4O3MA 3LX5A 3CB4A 4EIWA 4PX9A 1VECA 4KAXA 2WPDD 4DDTA 3FFAA 2CL6X 3O8DA 4W5JA 2IYQA 1IXRC 1VIYA 2BDTA 3C5HA 1QG4A 4EPWA 1A82A 4LYAA 4TZ6A 4KLNA 3UG7A 1OW3B 3SNHA 1G3MA 4OKSA 5LBIA 3K9LA 4I81A 4URZR 4C0BA 1EFRA 3PG5A 2FE4A 2QQ0A 2JIZD 4BGDA 2ODBA 4TYYA 2FF7A 4B33A 1UKVY 4MYUA 2ZRFA 2H8KA 4YMVA 1H8HA 2QNRA 3M0EA 3LBIA 1NVVR 4C0KA 3U3OA 3UATA 5JSZB 1MABB 2ZRDA 3IUYA 1PLJA 5FL7A 3RABA 3T1QA 3K70C 3RVBA 2WWIA 4TSFD 2O8EB 3OIYA 3QKRB 2FNAA 4OBEA 2J1LA 3A1WA 5CB8A 1ZNWA 2XX3A 1R7RA 3E70C 4M9QA 1UBCA 4FIDA 3PVSA 5CJ2A 5FUWA 2A78A 1JR3D 1OPXA 4RCZA 3K0SA 1Q12A 2VSOA 1ANKA 3FMPB 5HCNA 2JLYA 2G1KA 1W47A 4QFMA 1JAHA 3W3AA 3GLGB 4PZYA 1KOFA 4KYIB 2LKDA 2Z43A 2G0TA 1US8B 1OJLA 4B6FA 5KNBA 1AGPA 2ZRNA 4BZPA 3I32A 2CHGA 4LBVA 4LX0A 4TMKA 3I8SA 1ZRHA 1W49A 3B1VA 4P33A 1ZUHA 5DYGA 1FQKA 1YR9A 5L3VA 3BS4A 3LAWA 1OB5A 4MRPA 4Y0AA 3G5UA 2XNDD 4P32A 5DI3B 2MMGA 1UF9A 4QGHA 1JAIA 4OJQA 4LZZA 2IEZA 3F0TA 2QEQA 1MO3A 4KITB 1RE0A 3SHFA 4AYXA 2OUKA 1OHHD 1DBSA 5D3QA 4DDWA 2RGNC 5H68A 1NKSA 3C7KA 4M1TA 3DO6A 3BRWD 3B9QA 2Q6TA 1M74A 3D31A 3IBYA 1YKSA 3PEUA 2CVHA 4IOLA 3U3KA 3S1AB 4D81A 5JRJA 5KNDA 2XXAB 5JSZA 5EXXA 1U81A 4BASA 2F1HA 3X1DA 4DKXA 4RKFA 1W44A 2QPTA 3NWJA 2Q9BA 4Q1AA 2O8EA 1SXJB 3D6TB 3OIWA 2XOKA 3QKRA 2NPFA 3PUWA 1IY0A 3U3RA 3SDZA 1F2UB 2W0MA 3LQQA 1IBRA 4UNRA 3RWMB 5K8UA 2ZS8A 1OXTA 4NP6A 1P4SA 2LKCA 2WVJA 2ZSEA 2J7PA 2DWOA 4YQFA 1DAFA 2ATXA 4MYTA 3A1TA 4PO1A 1YJ5A 3R8CA 3GLGA 2E1RA 2V6JA 1SKYB 2WJYA 1DS6A 4OQMA 4TLAA 5HE8A 3KXLA 4FW9A 2GESA 4DVGA 1US8A 5IHPA 4PO9A 1ZM3A 4QG7A 4OK6A 3T15A 2ZS9A 3CRRA 4WXPA 4BFTA 5UKDA 1EESA 4X8LA 5AR1A 1TUIA 3DZDA 4GBMA 3GMTA 1GNRA 1WE2A 2ZTSA 3LO5A 1JQJC 1P2VA 3IIJA 3ZZTA 4TL8A 2BKEA 1EX7A 3CR7A 3FOZA 4KBGA 4XVUA 1E2JA 4LYJA 2Q3MA 3B60A 1ZBDA 2WZQA 2YYZA 1R8QA 1YRBA 5DI3A 2ZIAA 1JNYA 4R2IA 4HDCA 4M1SA 1XMIA 4M4SA 1F60A 2AHOA 1E2GA 4DLYA 3NBYC 2OAP1 2IHBA 4XJXA 3A36A 1HY3A 2CE7A 3VX3A 3TSZA 4NCIA 1CXZA 4M2LA 3RRYA 4FXPA 1OFHA 1WF3A 3ZH9B 2QPAA 1WXQA 1GDDA 2DR3A 5FTKA 1VYTA 4JBXA 1I4LD 4Q7LA 5EP4A 3SU8A 4BLOA 2Y8EA 4GMDA 4AYWA 3JVUA 3UWOA 3B6EA 1W4RA 2A3RA 5TV2A 1G8FA 4P31A 1PLKA 3B8HA 1DPFA 3Q7QA 4DLUA 3VAAA 1LFDB 2XSZA 3CRVA 3QKUA 1SXJA 2XZOA 1T5IA 1ZJ6A 2ZR0A 4JLBA 4PQYA 5EE9A 4AIIA 2G1JA 3Q72A 3TW4A 3AVQA 1ZUIA 4JIMA 3T61A 1KIMA 1ZM4A 1NMXA 4ZKEA 3V4FA 2AFIE 2Q21A 4NONA 1KI1A 4YONB 1XXHA 4LI0A 3P32A 4XWKA 4Q7KA 1E1RA 4ILEA 1N5LA 4DSTA 1TEXA 5ELXA 4PTLA 1XZPA 2DYKA 2CCJA 3AB3A 2QMUA 4DJTA 4QM6A 2GDJA 3UMSA 4UJ5A 2NIPA 2B6HA 5G40A 2HUPA 1E1QA 1KY3A 4KV9A 1VHLA 2GXQA 1XCGB 4PC2A 3HR7A 1ZYUA 3HYTA 3RS4A 2F9LA 1CIPA 5JWHA 2WHXA 3AVOA 4IEEA 4GZLA 5KUTA 1G1MA 1BIFA 1NBME 2O0HA 2CLCX 2GBLA 4LJ5A 5H1YA 5AUNB 5J4VA 4AKIA 3C41J 2RCNA 3SR0A 1M34E 4LCBA 4A6PA 2GJSA 3BJIC 4QHSA 4R7ZA 2ZR9A 2UZ3A 4EQ6B 1RVDA 4Y0VA 5DNYB 5AJYA 3QNUA 5HE9A 1EFCA 2YHSA 4RZXA 5F3WB 2CLSA 3J81k 4KVGA 2FFHA 1N5IA 3U6KA 3KUDA 2H5EA 1E4VA 2WAXA 3P27A 1QHXA 1RRCA 2Z83A 4TL6A 1GIAA 5F9FA 4FD2A 4N3NA 5EJEA 3F8TA 3LX8A 4FN5A 1QDEA 2W6JD 4JYBA 2QAJA 4F4JA 4E09A 2WKPA 2JLRA 4GNKA 4C2UA 2FFAA 5G41A 2D2FA 4IOJA 2VA8A 4ARZA 3EA5A 4PQRA 1UDXA 4XOIA 4O2LA 4ON9A 3R7WB 2YC4C 3ZS8A 1ZIPA 3A6PC 3NHBA 5FPTA 4FCTA 4MKIA 4KFRA 3QPWA 3EZFA 2GHIA 2EFCB 2GETA 5H70A 1IN8A 2HF8A 2ZPTX 3NC1C 2QP4A 4TMVA 5GVRA 5IK2A 5HTKA 1YZUA 4A8JC 3A4LA 2P6NA 3ZVRA 1EG7A 1AK2A 2VF7A 3LFUA 1Z6GA 1N6OA 2GVZC 3WYAA 2HCBA 2DWQA 3PUXA 4V03A 1ZNYA 3KQHA 2REXB 3OAAD 4NCKA 1VHTA 5FL3A 5JI3E 1XPUA 1MV5A 1U94A 3WMFA 1W4BA 1COWA 4P4TA 2V1UA 1R0WA 4A1FA 1G4AE 2WSMA 5DN6A 5F9HA 3RLFA 1LVGA 4DB4A 1DVRA 3X1ZA 1Q57A 1X1SA 2BBOA 1Q3HA 1RJ9B 3SYLA 4QJ5A 2J3EA 1XTKA 3DHWC 3ICEA 5K8LA 1R5NA 2W6ID 4CEHB 2OCBA 1R8SA 3WNBA 5FBWB 1OKKA 1FUUA 3CKLA 5GJWC 5JMTA 1CEEA 2XZPA 3M1IA 3SFVA 1QHSA 3Q85A 1BKDR 2P3SA 3A4MA 2FOLA 1OB2A 1TU4A 2QGNA 1AA9A 1G291 2G9NA 3RDPA 4DLTA 4M0LA 2ZRCA 1KZGB 3TVTA 4QNRA 2A9KA 2UZIR 2ZYWX 4TQ9A 4HATA 2F7SA 3IIKA 3REFA 2IBMA 4W9MC 4MA4A 1XTJA 4E22A 2PMKA 3GFTA 4B75A 1TMKA 3LQRA 4HUTA 1H8EA 2F1RA 4ABYA 1D2MA 1U0HC 1D2EA 2QORA 2QSZA 4UXIA 1KO4A 3AKDA 3U4QB 2P2LA 1N6IA 2BIFA 2WWWA 1OIWA 2ZANA 3VFDA 3GFPA 4MUBA 1XTQA 2EU8A 2ZI9A 4RZUA 4RZ3A 4LJAA 3H1TA 4JSTA 4QC2A 4M9XA 3T5DA 3K70B 3VNUA 2OAQ1 2OEPA 4RD0A 3A1VA 1WA5A 2A5GA 3C5CA 3VQTA 3CNOA 3P20A 3I73A 1EFUA 1KYIA 4DRZA 2QRNA 1F48A 2EFHB 5BN3A 2CEAA 2IF0A 1A2KC 1B0UA 2EWVA 4HLUA 4M9SA 4XTRA 2Z0MA 4TQUS 4FWTA 1OXUA 3VMFA 2DB3A 1JJ7A 3CWQA 2D7CA 3K0EA 3QBVA 1J90A 121PA 2W83A 4AWXA 4PC1A 1KMHB 4BEBA 4JBWA 4MRSA 4JVSB 1BMFD 2ZEJA 4NPHA 1DAEA 3PEVA 2WOOA 1SVSA 1GOTA 3NTUA 4GRAA 2QMHA 4IDNA 3L82B 4DUGA 1ONBA 3GJ0A 4DSNA 1Z07A 1TAGA 4UQOA 1FFHA 3KJEA 4I1VA 3VX4A 2GXUA 4PHHA 4BRUA 4A0GA 2VHJA 2WBLC 1ZINA 2OESA 1RRFA 2ZU0C 1OH6A 2DCUA 4YMUA 1E79D 2C78A 4CIDA 3GLIE 2JJ8A 4NYMQ 1OXSC 1NSFA 2GILA 2IXFA 4JVNA 3UIEA 4Q4JB 1TU3A 3HWSA 3U4QA 2ZUCA 3RRZA 1DAIA 1OIVA 3LWNA 2F43B 4JLDA 2J87A 5SZIA 2PH1A 2X1VA 1E9CA 2FX3A 1Z8FA 4HDOB 4KFSA 1E2PA 3B1WA 1E96A 5JEEA 2F9MA 1E2KA 4B34A 4X8OA 1NLFA 1G19A 4Q48A 2IS6A 3OZXA 1K5GA 3C15C 4Q01A 1SVOA 1NN5A 1U98A 2V54A 2IXGA 4WOPA 3RS2A 2CMKA 4JT2A 3Q9LA 1LNZA 1J7KA 3HDTA 1GKIA 1UPTA 3MJHA 3GJ3A 3EPKA 2R6DA 4O0MA 3ZIAD 1SVIA 3FPAA 4Q7JB 4TQAA 3PUVA 5AWFC 5JWRA 1XB2A 4UXJA 4EPVA 3SJAA 2P67A 3AP3A 3CM0A 4L9WA 4WA7A 3W9YA 1VYVA 4CYMA 1KMHA 1X8JA 1TX4B 2G83A 1I2MA 1AQYA 1RZ3A 1TTTA 1E9AA 5FPSA 1YQTA 4IVRA 1ZC3A 2ZJZA 3LY5A 1ZD8A 2NO1A 2VF8A 4XVQA 3A58B 1QVAA 5GJBA 3P1JA 2FPMA 1NMZA 3U3JA 2JCSA 1AS0A 4B32A 4PO8A 2BMEA 3PXGA 3AKYA 4LDJA 1JJVA 1QHHB 1N5JA 3CIOA 1FTSA 3U61B 1QHIA 4XSGA 1F2TB 1WBBA 2G0NA 4JVLA 2EWWA 1S9DA 1S3GA 4US1R 3RYTC 3SOPA 5EP3A 4PSAA 4Q47A 1WMSA 3BFXA 4QHTA 5B2ZA 2XZLA 4JYCA 1T3SA 3LH5A 4TMXA 2IS4A 4CEIB 1W46A 4QBIA 1JBKA 4LPKA 2AK3A 2F43A 2WWXA 1P2UA 3CPEA 3TR5A 1OE0A 2RGNA 4GOXA 4N1AA 1GKYA 2AWOA 3LXRA 4EFNA 2CJWB 4Z8YA 2FG5A 2VHUA 3TE6A 1Q44A 1NBMA 3QKSB 3TK1A 1ZM7A 3EARA 2EFGA 1M7HA 2GTPA 1AM4D 3AF4A 3CF6R 3SI7A 2QT0A 2IYLD 4US2R 2GK7A 1T3LA 4QGGA 4MUAA 4Q02A 4B2IA 3MCAA 5FTLA 1NIPA 1NG9A 2AFHE 1CJVC 2EFEB 4NHOA 1ZCBA 5FL7D 5LB4A 5HZKA 2BWJA 4YMWA 1J99A 2B8TA 3EZ6A 3RRNA 2F1IA 3MWJA 4ZCLA 2CL7X 3CPJB 1Z0KA 1N6RA 1GVNB 4TWZA 4HLQB 2D62A 4PPFA 1XJCA 4V0LA 5E4FA 1KK2A 3MWLA 2G3YA 4RJLA 2IWRA 4YC7A 4TMTA 1QHHA 4OQNA 3SHWA 1X8LA 5CB6A 3OIVA 1F2TA 4E5UA 4B47A 3JVVA 1C9KA 1XFAA 3AP1A 1G64A 3QPVA 3QIAA 2VP6A 4Z54A 1YE8A 4ZI3A 5JS7A 4ZDWA 1Z29A 2J59A 1OF1A 3K9GA 5AUQA 1W0JA 4Q4HA 5EP2A 3FB4A 3VHLB 4BFSA 3AM1A 1KI9A 2XGJA 1EWRA 5CYOA 2SHKA 2CJWA 5EZ6B 4Q1EA 2IYTA 1YR7A 4Q9IA 4HSEA 4JT4A 1QZXA 4MKHA 3QKSA 4B71A 5J4KA 2P5TB 2C04A 4C0QC 4J0QA 1Z0FA 1D8TA 2KWIA 4XTCS 3OEHD 2CK3A 3KUCA 1UFQA 2ZVPX 3TH5A 2IS2A 1XWIA 1ETUA 1E9EA 3A1SA 3BK7A 1KJYA 3X1WA 2HLDA 1NY6A 4M8NE 1RKBA 2FSIA 4L15A 1NJFA 4MGKR 3LVRE 4MGYR 2D74A 1CBUA 1KI6B 4ZIRB 2J7KA 2WWHA 3B7GA 5EZ5A 4D26A 3EIHA 2QSYA 3CZQA 4NYJR 1HT1E 4F7WA 1KJWA 4CW7A 2PT5A 5D3MB 2GRJA 2JASA 2A5FA 5DE3A 3GLIB 1W36C 1XNJA 3RC3A 2J7PD 3DKPA 2WIBA 2YWEA 2WSSA 1G8PA 2ORVA 4Q9HA 1T3HA 5GJCA 1G5TA 4S2EA 1JR3E 5BN4A 2ZJYA 2H17A 3D7MA 4DLSA 1Q1QA 4G5OA 1VMAA 3CRW1 5HKKD 4ACAA 4YXWA 2R2AA 3THXB 2XAUA 3VR1A 4IVPA 1CF4A 2BCGY 2W00A 1XEFA 1GSIA 2ZE6A 3SZRA 3G82C 2KE5A 4UNSA 4LBZA 1OH5A 2DFNA 1NMYA 1T91A 4A92A 2IX3A 1NLZA 2BMFA 3QXSA 4OHVA 4OI2A 4PPGA 4D4LA 2QAGC 2J0UB 1XPRA 1KGDA 1XJ0A 1XD2B 2AKAB 3H0KA 2YNMA 1MH1A 1UJ2A 1OSNA 1Z47A 4OQLA 5L3QB 4OJKA 1S2MA 1SHZA 4GFDA 1NSTA 4PSKA 2J0QA 2ONKA 2XEXA 3HU3A 3QY0A 3MMPA 3EIEA 4PZLA 4JLPA 5KTYA 2B7CA 4RZ2A 2XSZD 1KI6A 4ZIRA 1SXJD 4A8JA 4KI0A 4RFSA 4IXMA 2RGCA 3THWB 3IEVA 1FTNA 1N0UA 1AIPA 4LYHA 4B35A 5D3MA 2CLDX 3QJYA 1JXMA 2ZRHA 4EKDA 4XIGS 3GLIA 1AJEA 5G3YA 3FE2A 4AYTA 3OHMA 1E1RD 1KKLA 4RCYA 1KI8A 3ZVNA 3WMEA 3E5HA 4JLKA 1ZD9A 4H1UA 5B64A 1L2TA 2FV8A 3KJHA 1P3JA 4IDOA 2R65A 3QVUA 1YZQA 1OLOA 4KFUA 2OFWA 2YWGA 2GJAA 1ZAKA 5C4GB 4OQXA 2H1LA 3AH8A 3DM5A 3THXA 2OSBA 1WP9A 2BOVA 1G3QA 1KNXA 3L0OA 1EWQA 4PC7A 4OYHA 5BYJA 3UK6A 4TYWA 4OHYA 5LB2A 3GPLA 4BECA 5JZVA 2XB4A 3KKQA 2W2VA 3DMNA 3I72A 4DT1A 4Q00A 4YMTA 2H92A 2D3WA 2ASEA 1L4YA 2Q3HA 3WY9A 2GXSA 1H65A 3ZYCA 3ADKA 2YINC 1DADA 2J0UA 4QHYA 3K53A 1XD2A 3W3ZB 2IYRA 2ZI4A 5L3QA 2JLUA 1FMJA 2JLWA 1TADA 3CZPA 4EPRA 2GAOA 2NGRA 2OBLA 1G18A 3CX7A 3RAPR 3PEYA 5EUMA 5FI1B 4O25A 3UWKA 5FPHA 4PXAA 3KKNA 3AGQA 2J9RA 1UKZA 3U60B 1RYFA 1W5SA 3THWA 3ZZ0A 4NYIR 1JQLB 4DLVA 1N6HA 3AF0A 5FBLB 4URYR 1P72A 221PA 4URVR 3TNFA 1CP2A 1T9HA 3KB2A 1E0KA 2ZREA 1KY2A 2NO0A 2QMEA 3EC2A 4PHGA 1X6VA 2OT3B 2X77A 5IK2D 3K1JA 1AKYA 1KI4A 3E2IA 8OHMA 3IILA 4EPYA 1HV8A 4NBSA 2R6FA 4LK2A 4BZQA 1KO5A 2MSDB 1XX6A 3ZVMA 1Q22A 2HXYA 1DAGA 1XXHB 2JJ2A 1YHNA 1FZQA 2KBFA 4PAQA 5GJVC 2OCPA 3WYFA 2Z4SA 3LV8A 2EFDB 3WP0A 4BLPA 2A2ZA 4B2PA 4ZDIA 3R9WA 4C30A 2WJGA 1Z0IA 1GWNA 3ZZUA 3PFIA 1XZQA 3RWOA 3BH6A 5EUQB 5F98A 1W0KD 3LD9A 2FEMA 3ICQB 1LTQA 1MO6A 2IUTA 5FI0B 4PHTA 3UKDA 2B21A 4TLDA 1G17A 1TEVA 3GJXC 3SJCA 1YZLA 4ITRC 1Z28A 2DBYA 5E7IA 4EJSA 1M8PA 2JLSA 3CWZA 3HYRA 4WBSA 3KL4A 5LDDC 4R9UC 1NIJA 3ZGXA 2QBYB 4UNPA 2QPOA 1NY5A 4HZIA 2HEIA 3HPQA 2CXXA 1CJMA 1CR1A 1G41A 5EQTA 4BLSA 5DH9A 1XEWX 4FMCB 3AF1A 1XEWY 1P73A 2ZYTX 3VKGA 1KDRA 2ZAMA 4S35A 2ONJA 2RGEA 5JHGB 2JDIA 4Q1CA 2ZRMA 2C96A 1Z63A 1H8ED 2RB4A 2H16A 2OZEA 4Q1DA 3OEEA 4NMMA 3KTAA 3MD0A 1GRNA 1IY1A 4D4MA 1S9HA 4A2QA 1LB1B 4DDUA 2P65A 3AP2A 4JSYA 2RHMA 1II8A 3ADBA 3GQBA 4HDQB 1F3OA 3C14C 4Q1FA 1R0YA 3X1XA 1HQYE 3W6PA 4L9SA 4ARZB 1R5BA 5CK5A 3DEFA 3QOFA 1E69A 1GUAA 2I3BA 1CR0A 3L0PA 5FR2A 3R9IA 3CBQA 2NMVA 1E0SA 3TQCA 1KSGA 1U0JA 3RNLA 2ZJOA 2ZUDA 3GCGA 3Q5DA 4C0AC 2FN4A 1YZTA 3HR8A 2X19A 2N1BA 4NZYA 4RD6A 3KFXA 4RFVA 2IYXA 4N0EA 4BLRA 4MDFA 4CEJA 4AI6A 5LPNA 4G1UC 2JGNA 4RD2A 2O8BB 1W2GA 1XTIA 3LDAA 3TW8B 1S1CA 1G4UR 2J46A 3CF0A 3BBPA 4FCVA 4A2WA 3N5CA 4FMDB 5JJKA 5G53C 3EWSA 1L7VC 5HR5A 3KQUA 4PC6A 3AVXA 1PVOA 3H84A 3O8RA 4QJ4A 2HDNB 4A2PA 3NH6A 3ZS9A 4JLJA 2PJRA 2QBYA 4V0OA 2AL7A 4A6XA 1CR4A 4Q9JA 1DARA 3ZJYA 5JEDA 2GF0A 3GEHA 5FH9A 5IT5A 1OYWA 3NEYA 4HLCA 4F38A 4H9GA 5E7MA 4QKQA 2MMCA 1E4YA 1ZMXA 2VTKA 2BV3A 4Q66C 2HJVA 4TLEA 1JR3A 3KJGA 1GZSA 3RS0A 1VDZA 4G5QA 4PFSA 2W2TA 4V0ME 3TKLA 4XWAA 3TQFA 4TLBA 4C0HA 2CE2X 3LW8A 2ZAOA 1UKEA 3L0IB 3LA6A 3REGA 3TIFA 3SFZA 1FNMA 3PUYA 2ZROA 4YLGA 1XTRA 5FR1A 3BE4A 5TB5A 4OK3A 4LUCA 5AK0A 1LY1A 4PZZA 1DG3A 3K0AB 4TTPA 1Q20A 4LHVA 4F91B 2IF2A 3IHLA 1G7CA 1Z6TA 4TT3D 3ASZA 5CK4A 3R8FA 1W36B 1VCOA 1RFLA 5K8TA 1IQPA 3ZQ6A 2C9CA 4GL2A 2VSFA 1JPJA 3MAAC 4K46A 4N0DA 2O8BA 1U2RA 4CRWB 2WICA 5JRZA 3T06B 1K5DA 3TSWA 3QUSA 1V5WA 1E2LA 1E99A 1AGRA 2R6GA 4I1UA
chains in the Genus database with same CATH superfamily
1HLPA 1ZOIA 2CVQA 2PKYX 4E5SA 1Z3IX 1BFUA 2PH3A 5BW5A 4JJ6A 1D0IA 2I7VA 4MAMA 3LT2A 3LF1A 5A4JA 4PGMA 2IWHA 4LYFA 1X9HA 4C5BA 1D09A 2ZUSA 3AFIA 5F1KA 1TQ6A 2HO4A 3LRXA 1A9XB 4L16A 4F6LA 1NJ1A 3N8IA 3NANA 4F6RB 4QO7A 4N9QA 3PHCA 4G1CA 4DIEA 5D7BA 1B8VA 4CCYB 1IPHA 2JEZA 3AOEA 1J24A 3ETDA 1PU2A 1G6OA 1VE3A 3EZ2A 4M99A 2FZ4A 2ZRJA 4N6OA 4FZ3A 2JLVA 4EUHA 3WYGA 3MCUA 1ZJ5A 4WOBA 1J2JA 4AC9A 4MKZA 4R3UC 1I5EA 2VH5R 3EAQA 4URHA 4H7HA 1G7SA 1YZ3A 2CCKA 1F1JA 2CWWA 3EHDA 3ND6A 2H5IA 5JXWA 2QM8A 1CY1A 5C31A 3N0WA 2DPXA 1RPTA 2W6MA 4C1BA 4DC9A 1X94A 1HT3A 1FP6A 1M6NA 1XMJA 2QS9A 2OPHA 1TJYA 5EGSA 2HQBA 3PWSA 4RANA 5FPPA 1RZVA 5KX5A 2EBWA 1GAJA 2ZS7A 3UCFA 1EP2B 4RAOA 2FRDA 1VJ1A 3G85A 3NGXA 3HADA 8ADHA 3GN2A 2EKQA 4ZALA 4OXIA 3QJ5A 1IXSB 3W1WA 4BRWA 3O8CA 3L46A 4QTTB 4KOEC 4BBZA 1S1MA 2XCUA 3HSSA 3K0AA 2QROA 4MRAA 5CLLA 3ZWYA 3MRVA 1OYYA 4L22A 2IZOA 1WUYA 2PVCA 2QLJA 3KYIB 5ALPA 3PUZA 5BOVA 1O6ZA 3NAMA 2V1XA 2F3RA 4LGCA 2R8BA 3D64A 4LXYA 2JHAA 3NHSA 4R2WA 3RRMA 5DNCA 2JBHA 2JVIA 1NU6A 1UBOS 2ZUVA 5CXXA 4DQKA 4Z6KA 1SD5A 4XAQA 4MVWA 3AF3A 4FHEA 4BUCA 1TGYA 1G9SA 1JPNA 3OJEA 3PR3A 5ALEA 5B4TA 5JNTA 2JCYA 5GVSA 1R6DA 1UODA 3GH3A 5FTJA 3WK9A 4D6YA 2HU7A 3NRBA 4FQ7A 3EXFA 4ESHA 3MWKA 4C1NA 1ODKA 3A1NA 3EASA 4PGGA 5ICFA 2R8EA 3EZ9A 5THQA 2YY6A 3K16A 5FOVA 4RVDA 1YAJA 2IK8A 2QMZA 3KEFA 4AK9A 2IU4A 2PEZA 1ZR4A 4NOJA 3EEOA 3HU2A 5FJIA 3TE7A 3NU1A 4CZ2A 4JUAA 4HWTA 4MUMA 5JASA 3B36A 1OTXA 5IC4A 2QAGA 2O8NA 2ZSHA 4PYIA 2YVQA 4YR7A 1E7SA 1WXXA 1FOEB 2Q9UA 2BUBA 4ID3A 5FEMA 4BO3A 4F9FA 2VNAA 4YRDA 2PA0A 3KQMA 1PJAA 4D3YA 2MJLA 4R0MA 3R75A 1R6TA 1Y8ZA 1NRJB 2V8OA 3FDIA 4ZZ2A 3TB6A 5JD6A 3HVKA 1SXHA 3SP1A 4BEVA 4DZTA 4R7TA 4AKHA 3MJCA 5B7GA 4K6CA 3IMEA 4KIFA 3W04A 2M6KA 2FJ0A 4RJJA 1B6TA 3OZCA 3KZOA 4PC3A 3UUEA 1PK7A 1IBCA 2GEJA 4GI1A 5LFAA 4BPBA 4JB2A 1PGOA 1Z83A 3MS4A 3O4IA 5CIWA 4IQFA 3TMAA 1UDWA 4GC9A 1JU4A 2GXAA 4GX1A 4WN9B 3DEJA 2WP8J 3FTPA 4FEEA 4J1NA 5BWNA 2H1CA 3WL3A 3LUKA 1LNSA 4CMJA 2BBTA 4ZA2A 2KX7A 1PW7A 3M3HA 4X1IA 1ZKDA 2HLDD 3S70A 1IPFA 1XPOA 3GARA 2CL5A 5FT9A 2PSEA 2C8VA 4AMVA 2BEJA 1U1DA 1EUZA 1U5BB 2P2CA 1ECJA 1C1YA 1QBKC 2ET6A 3OT4A 3A6FA 1FBTA 1L7OA 2BKUA 2QD5A 4PR0A 4AG3A 5A1TA 4DLBA 1BDIA 1QX4A 1SIOA 2V65A 2RSLA 2XQGA 2ZRGA 4O63O 2ZUBA 4FGZA 5EJ6A 1IK4A 4R1UA 1IY9A 2WSSD 5DLPA 3X1KA 1UBFA 4K26A 4RORA 2Z5LA 4FMPA 5AVOA 4B0OA 4MS3B 3D3NA 2FSFA 1TTPB 3P0JA 1W5BA 5LNK1 5TT1A 3U4CA 5L8VA 3OPXA 2X8WA 2L2QA 2D6FA 3BDAA 4JLOA 1YU9A 3DE5X 2ZRBA 3T3IA 1LC3A 4IFTA 3V4PB 2P11A 2YJ4A 1H2RS 3MLEA 3D1LA 4GYYA 3SSOA 3SJZA 4XUCA 3H2GA 3WA7A 2ANBA 3AC0A 2R79A 3FETA 2MWMA 3UJAA 1QE0A 4KR3A 3QXHA 2AC2A 4X65B 2P62A 4ND5A 1VJCA 1K4YA 4WNYA 1YK0A 1V26A 4C7XA 1HTBA 1P6QA 5HIIA 3QITA 3KDPA 2V4UA 3N6XA 3N1UA 2B2XA 3MLBA 2YIMA 1KJIA 1XTSA 4US0R 4YCJA 3RVSA 1IMJA 1T3TA 3FHOA 1N36B 1MBZA 4MPJA 5DISB 3HBLA 2V7QA 1QR2A 4D6PA 5BURA 3A11A 3A2NA 1YZYA 4FT4A 2GKOA 1F12A 5DTRA 4JC4A 2YOGA 4ZAYA 2VDWA 3U4MA 2CDNA 1HQDA 4OI4A 1LWNA 1O4VA 1ISSA 2PZAA 1QB7A 2V9PA 3VNBA 3NJ4A 2W6IA 6GPBA 3ZV4A 2XDQA 3EIFA 2IUEA 3OG9A 1E94E 1QE3A 1XP8A 1ZAYA 4J43A 5HS4A 4YV1A 2X5OA 4AULA 4R1TA 1GL6A 4CG3A 3I2JA 5AUPB 5B7NA 4C4AA 1E66A 3HVHA 4M1YA 5U1PA 2NV2B 2DBZA 5BR7A 2QRZA 2L18A 2YWFA 5K0LA 1PT9A 2Q4EA 4NU5A 1NRWA 3GFBA 2I6FA 2CSXA 3TCXB 2ZRKA 3TZ6A 1C1DB 2HCRA 4EFDA 2QTTA 2YMQA 2J5XA 3BILA 2IH5A 5GV7A 1XCPA 3DNPA 4ER6A 3ZCXA 4D79A 1UMBA 3FNHA 4WBNA 4U7HA 2QIOA 3I1FA 3U0BA 4CUZA 1B2RA 4OAPA 2CBZA 3JQ9C 1I7PA 2FA9A 2QM0A 4MHTA 2B94A 4KZKA 1X86B 3ENZA 1BKSB 5DLDA 2I6UA 2BDEA 3W3AD 1FQJA 9GPBA 1ZUNB 2CHQA 4YA6A 2PGIA 2QDKA 3PNLA 4QECA 3OCYA 2EYQA 3IP7A 4MQ6A 2X9NA 3MCWA 2HRZA 4ZO8A 2WP0A 1MLDA 1U2QA 3E5MA 4M1KA 4QBHA 4QOSA 3TTYA 3V4ZA 4CM6A 1T0HB 5SZHB 4TM7A 4DLKA 4YAKA 2P3LA 1WULS 2ZE8A 3VMMA 4CQMB 1NXWA 4RWEA 4CM1A 2AGVA 3VNVA 2NP6A 1HYEA 3BB3A 3F4KA 1XLTA 2WIJA 1KXZA 2HIAA 2C98A 2OCYC 4KN9S 1LV7A 2BM0A 2GT1A 1UDRA 2P2DA 2XV1A 2JH8A 3FYUA 4FEGA 5FIUA 4D9MA 1XQ9A 3WS7A 4MDEA 5BVGA 4ZJZA 4RD4A 5IXYA 2XGOA 3H97A 4GBGA 5HTOA 2H7YA 3ANMA 2GPAA 4D0LB 2NSJA 1UJBA 4GT1A 4NOLA 3DLIA 5DBEX 1QH8A 1M1YE 2WRZA 3EF0A 4M3NA 3ZDQA 1KKMA 4S1TA 1YZGA 1Z33A 3G88A 2F00A 2UYHA 3VAZA 3NLLA 3I5AA 4NJMA 1F9AA 1CQPA 2O2YA 4CUJA 2WJVA 1E2MA 2EZTA 1JFLA 2JZNA 2SNIE 2V3WA 2W4QA 1O9GA 1RXCA 4KZPA 4LRYA 2X9GA 5C35A 4RYDA 2GN8A 3DBLB 4XVRA 4DXAA 2I4RA 1Q83A 2OD9A 2AI2A 1FTQA 3BCHA 4I55B 4RS3A 1ZN9A 3RUFA 1HMPA 4LMAA 2X1MA 4LQ4A 4X1KB 1XK7A 4RFSB 3LP5A 3MT7A 4ZQCB 3AR2A 1Q77A 4CL0A 2JAUA 1XRPA 2WJHA 2HNBA 1GKLA 1M1NB 4EEXA 1J1ZA 3EDYA 4ZT3A 1CS4C 2JFHA 4D80A 3ELUA 2PKRA 1MO4A 2KW5A 2IVFA 4L9RA 5MF6A 4KR2A 3PNKA 4D92A 1K3FA 2BM9A 2GN9A 3DQPA 5CTJA 2G4VA 4HAZA 4QU0A 4FPXA 4ENVA 3LDFA 1PUIA 4JP8A 4TN5A 3K35A 4HVLA 1NVWQ 2ODNA 1TF7A 3OPNA 3ELYA 2ODWA 4WUVA 4YV0A 2ZB8A 2CSUA 3ZOKA 4Q3OA 5JCPA 3U4HA 4FMBB 1CUJA 4QOGA 3K1AA 1YD7A 1W1UA 1REQB 5KREA 1Y3CE 1EIZA 3BERA 3MJ4A 1DIOB 2COUA 2FQWA 2ISCA 1E9RA 3PCRB 2ZIXA 1KEPA 1VYUA 5FP0A 4ZVLA 3S3TA 1VKJA 2WWYA 2EQBA 1R2QA 4IFEA 1YIOA 4C2BA 2JGAA 1GV0A 4QYIA 3LBFA 3C3KA 5CFNA 1IG0A 1BXGB 4KBFA 1S89A 1ZU4A 4JS0A 3TBKA 5A5GA 7REQA 4LHZA 1RBMA 4KQ2A 1R00A 2JDID 3ID6C 1IEXA 2D7DA 4Z4FA 3H4MA 1KVSA 4RXUA 3U7EB 2PUDA 3BZWA 1JQ3A 2JATA 4KFTA 3RC8A 2J0SA 4JUBA 3EPLA 1SB8A 1EUYA 1NT2A 1Q0SA 1GYRA 2ZI6A 4MS1B 2X5KO 4OFXA 3A27A 4MVJE 2FPIA 3GGCA 2BJVA 5KYWA 2IOHA 1FJXA 1XAIA 2ZULA 1EVQA 1UMDA 3KELA 3K1TA 4F3YA 5BMVB 4OXYA 5AVZA 1PS0A 3FVWA 1D6SA 2OSVA 5A4FS 3M1AA 5HUJA 2PXXA 2PR7A 3N2KA 1GA6A 1LI7A 4QFCA 3SBOA 1DLJA 3ANYB 3FFBA 4A5SA 4F3RA 2BP7A 4ZJPA 3QBEA 4XYEA 5A5FA 3RK0A 1HEUA 1E6EA 4FILA 3TRHA 2KSQA 4ENWA 1NE7A 3RG2A 3UBTA 2VDKB 1EEHA 3D8BA 3RT9A 4WNIA 2RC6A 3RJZA 3ZI7A 3FNQA 3QOWA 4S1WA 3L1HA 5AJXA 4NCAA 3OZWA 1E7QA 1NM5C 2K7ZA 3L6CA 4ITUA 1M33A 4AS1A 2ATVA 3P5BA 3OE1A 3W7BA 4L4UA 4ENRA 4A8PA 4LDZA 2ZYGA 5GGXA 3CQ9A 3R6LA 4HEJA 4YUYA 4TS4A 1RHKA 5CDFE 5KNCA 2OV4A 4KOAA 1TAUA 1GQOA 3X44A 1K68A 1ZOOA 2ZJ0A 1RQ7A 4G5HA 4IJWA 4Q9KA 3HBNA 3QVMA 4ZYXA 5FBQB 4W8OA 3DXXA 1QQAA 1DBRA 1Z88A 4H3VA 4PLZA 2ST1A 3I37X 1HDRA 5ILOA 3IOYA 3TIXB 3WKCA 2FEAA 1QGUA 5GZ3A 4UPVA 2C2BA 1NF3A 2VUTA 2O57A 1Y7TA 1YB5A 4A0QA 5C5EA 1IUNA 2E21A 2YXEA 1NN0A 2B36A 1P4AA 4KMRA 5EJ9A 3RJTA 4EYKA 1IN7A 2HJRA 2WU1A 1GPMA 3SZMA 4POAA 3ZQKA 3GJ6A 4G3XA 4UOQA 2GEUA 2IP4A 2C8LA 2QI9C 3MN1A 4S1PA 2C9OA 3NBMA 5KMGB 2JBAA 3UJCA 4W5OA 2HSDA 3UC9A 3QG1A 3RNOA 1AQUA 3OOSA 3OWOA 4R98A 4ATNA 1H4VB 5C9ZA 5K3AA 1IAVA 2UVPB 2XZTA 1FUIA 5AOAA 2BEWA 2H4JA 5LXTA 3DBOB 4N6GA 1IJEA 1KK1A 1P9NA 3PCTA 1QB8A 2R5NA 2DSTA 3OOYA 4OMUA 3GFVA 4OL0A 1DGQA 16PKA 1QQ5A 1TUEA 3O21A 4PLGA 1RC8A 2CUZA 2VUUA 5KVVA 1Y4SA 2NU7B 3MXTA 1FNBA 3OQJA 1SBZA 4J2HA 3SBDA 2I87A 1CJBA 4NQZA 4I19A 1Z2CA 3EF3A 1C1HA 5TQ0B 1JAZA 4U8GA 1MX1A 4C01A 4DAEA 1CF2O 3AW9A 5ADWA 3KTAB 3DMDA 4FOTA 4OMCA 4B6RA 2VP2A 1G8YA 1Z37A 2W2MA 3GLHA 3OECA 2DFPA 4GOJA 5I7AA 1GPDG 2CNBA 1D4AA 5ECGC 4E5KA 1CTQA 2G1PA 2GVNA 3L7AA 3O73A 3SS7X 3UO8B 1P74A 3KZVA 4FUTA 3H87A 4K2HA 1WABA 4YEDA 5EE1A 5IABA 1YA8A 2XRZA 2RK3A 2ID7A 3ZHQA 1JG2A 4RVUA 2ABWA 1JFTA 1R6VA 3CN9A 1V5IA 1CJTC 3AV0B 4IO1A 2OA0A 4Z99A 2FE1A 1KJZA 1YR6A 1S2LA 3HB0A 2QJWA 3V9PA 2XIJA 1D3AA 5FLKA 3T94A 2WB2A 3MMZA 4LRWA 2YJNA 2V6GA 1C3XA 3UC5A 2VYFA 1ZEJA 1K6EA 2E9SA 3PGXA 3F1LA 3VPAA 5G02A 2B3DA 3D43A 2CMDA 1COWD 3NEAA 4PLPA 3FGPA 4UE2A 5DGTA 1T6XA 3GFOA 4EHIA 3FNGA 3LP6A 4L8GA 1GNPA 4KX5A 1KQNA 2A59A 3HR4A 3S44A 4AZ0B 4NYMR 5DYNA 1QDUA 1E1DA 1JDJA 2QTVA 3NTRA 3G7SA 4DA6A 5AW6A 3ZLJA 3R0QA 3QI7A 3VSAA 5AIAA 2DR0A 1EP9A 3S2GA 3UJ6A 2FW6A 1WNTA 2RKOA 1HXHA 1XZEA 4FYYA 4JWKA 4J1TA 1DTEA 1KEKA 3HCOA 1P1FA 1QF7A 3JX9A 5KDOA 5B30A 3TMYA 1M2VA 5BXQC 2HDOA 3TL2A 1G5QA 1VTKA 2RHCA 2WZBA 1Y5LA 2FZLA 3AIMA 1NOKA 1TM1E 2X6RA 3QF4A 4I9NA 5B1IA 4EDHA 2WNHA 2YOHA 3RC2A 5ARCA 3T8YA 2IL1A 3OEYA 1QVVA 4ZOEA 1D5CA 1T6NA 2WF8A 2ZTMA 1G66A 3KWMA 3R4VA 3G3EA 4JXKA 4CV0A 3PB3A 3QMMA 2WAAA 4IS3A 4KXQA 4RVNA 3KV3O 3OFSA 4W9NA 5TGTA 5CVCA 1PEDA 1H94A 1Z6XA 4I1IA 4NJOA 4W99A 4CKCA 1S8FA 1FW6A 1EJ6A 1K7CA 4EO7A 2V55B 4E4YA 3RBVA 4OAOA 4PIMA 2QRVB 3RC7A 3V8VA 2BYTA 2IS1A 1UMCB 1Y37A 4CN9A 3QE3A 1Z5ZA 4MB2A 1EJ0A 1G21A 2FEPA 4P3YA 2AUNA 4CDGA 4UAVA 4E32A 5JQWA 1GTSA 1NA5A 4XQCA 4MUNA 2Y0EA 5DNEA 2C4KA 5A3VA 5C8XA 3VPBA 4BV2A 3UXEA 4M1MA 5F5XA 1FYWA 2CFRA 1Y9JA 3PJFA 4RO0A 3ORHA 5LA6A 5M34A 3ESCA 1K1EA 3NORA 2HUNA 1G8MA 1F4PA 3PHBE 3IEXA 2ARKA 1SRQA 5KYYA 3OCVA 1QYCA 4KMSA 3VDMA 1SAYA 2CD7A 4EBBA 1T36B 4CV3A 4UFOA 4EPTA 4MTCA 3S1AA 1YRYE 5EPOA 1MO5A 3CEPB 1AO0A 3R9XA 3G8CA 2YKGA 3DLBA 3QM1A 4X1YB 1X15A 2ZFUA 3URKA 1FBNA 3VR6H 1KI2A 4UAGA 2FEOA 3L0SA 3PGKA 3E4DA 1ECFA 3ET4A 5DPMA 3JWEA 1H0HA 1MTZA 4XUDA 3WBKA 3VJMA 4AG6A 1N2XA 2YVAA 1CVLA 5I7FA 5KTNA 1TA4A 3KWLA 2HMYB 1RHMA 1PFUA 3KOXA 4U9IS 1UK6A 1EVLA 1I01A 1WMEA 4QDZA 4ZOQI 1PVDA 3Q6NA 3T5TA 4Q4LA 5A3RA 2VP0A 5AQEA 4YNBA 5AXAA 3GRRA 2XTNA 1YR8A 4NARA 3D0OA 4E07A 1FB5A 5LLTA 2H3HA 2J9XB 1PJRA 1ABEA 1HKUA 4JR0A 2BI7A 2BMVA 4JI2B 1TYCA 2CNOA 4BNTA 3GEIA 3D4IA 1LLUA 2KLHA 2OXRA 2Q50A 5BMOA 3M6FA 1MJ5A 2FN8A 4IJMA 3IVMA 2IUUA 1QGYA 1N0VC 3EA0A 2V98A 3RBAA 2XHZA 721PA 4LXTA 4YJHA 4D82A 4GS5A 3QWHA 2A4KA 2AMLA 5CEFA 1V1RB 2IHVA 5ALIA 5KDDA 1K8RA 4WRRA 3V3KA 4HWSA 1G3IA 2DVMA 2Q9AA 1XTUA 3IUBA 1W48A 4Q21A 1P0PA 4CLRA 5JI2E 3IRUA 3B78A 5E1OA 4XQ9A 4CMIB 3D5QA 3HCBA 4EGAA 2IHUA 3IVRA 3QXGA 3WKDA 4DIMA 3MIIA 3SN6A 3K0CC 3PITA 1CR2A 1E32A 2XNDA 2ZB7A 3K09C 3WOVA 1QFJA 2AHRA 2OGTA 3O91A 2FWAA 5K3FA 2WAYA 3WISA 2RC5A 4Q93A 2JA1A 4E5DA 4CM3A 1S3FA 1EEXB 3MYRA 1V96A 3TSYA 1A0OA 3P4XA 4JNCA 4WAUA 3MK31 1ETHA 1GILA 4CLDA 1A4RA 2GLTA 2QAIA 2RG1A 4CETA 1R4MB 2Q3FA 1OHHA 1U8CB 3MRSA 2NNWB 3D7SA 3RD5A 3DO5A 1TKRA 4D3DA 4OQDA 2O2IA 5IJ0B 3BRWA 3X2FA 3AI7A 1AVTA 1JHQA 2QT1A 4P7BA 2XI4A 1J9GA 3EZXA 4UUMA 2J09A 2PZGA 2NO4A 1LZKA 1M3SA 3HB9A 3B13B 2OL4A 2J45A 2YOFA 2P9FA 4G5SA 3AM4A 3R7DA 4POOA 5CFQA 4RTRA 1N2CA 3PZRA 1AS2A 4RDIA 2EEPA 4DTIA 3CVVA 3UJ7A 1T6YA 3KL2A 5LU8A 1RPNA 1KQPA 1XZGA 2G80A 2AMFA 1QVWA 3GR6A 3SHQA 3UUFA 2Q5CA 3ACDA 1N33B 2Y4NA 5FWYB 3TJRA 4KAJA 3D6NB 5AI8A 1GZDA 1SZJG 3HCRA 4DCNA 3Q3CA 4UEKA 1RCUA 1J0AA 4W5RA 4NL4H 2V7QD 2Q1TA 4WZAE 5DSXA 3QIVA 5G0UA 4YUWA 1SVUA 1LRKA 1Y6QA 5ED0A 2C95A 3H8VA 1UBGA 3BWMA 1LPSA 1UXIA 5AHRA 4BFUA 5ESXA 1EDEA 1FDVA 1T8UA 3L7JA 3DWFA 3UM9A 3K6RA 3AVVA 3MT9A 2CHVA 4RZIA 4GI7A 4AFNA 2D0OB 1EI9A 4EQ6A 4MUYA 1IN5A 1QG6A 2HF9A 2PCLA 3A3YA 3IOCA 2ZI3A 3IVCA 3SSNA 3KAJA 4BS9A 2XAAA 1RM3A 4R16A 4P4NA 5BW8A 5IRCD 1HFJA 3E5RA 3OURA 1U7PA 1D9XA 1JI0A 2FWPA 4X7RA 3C43A 1ZICA 2VBCA 3OZEA 4QPJC 5BWMA 1NVTA 3TBHA 3WWDA 3SYKA 4BAUA 1W5TA 1H6CA 3R3HA 1A88A 4ARIA 1EGAA 1M76A 1IZYA 5AI4A 4JP2A 4LV8B 3OMXA 1JQEA 4NFLA 5IHXA 1JEDA 4L85A 2QN1A 3OHSX 1E1YA 3ZQJA 3TRFA 4LDNA 3HWX1 5KVAA 3JD1A 4CMEC 4E11A 2LDXA 4FEAA 2FPGB 2P9QA 5CYPA 1GY8A 2AVDA 4XIYA 4WIAA 2LV8A 5T67A 4C4OA 2OM2A 2IPAB 1L8LA 2R7LA 2JKZA 3AQ4A 3EGIA 3F6YA 3U7RA 1L7RA 4M9UA 1WXWA 1Y8QB 3W4KA 4MARA 4A73A 3WWPA 1N7IA 4Y6SA 1NFQA 3QRWA 1EWYA 4KNVA 3KHKA 4Y1RA 5ICEA 4U7DA 1XZ8A 1SVMA 2BFAA 3TKYA 1WDLA 4IFIA 4IX9A 5JSZB 3B2EA 3GPIA 1YK1A 3KB8A 3OA2A 1ZW6A 1ZO8A 3WI7A 4CIXA 1IRXA 3W6ZA 4I99A 2H59A 4UU7A 2WFAA 3WGOA 1E3EA 4WI1A 1BN6A 3R6TA 4AJOA 4DGSA 4X95A 3LUJA 3M5CA 4JI1B 5E2AA 3WB9A 2DR2A 3PDCA 3CNNA 4UEOA 4C6HA 4Y2SA 3GBVA 3ER9A 1ZM9A 2HIHA 1GZVA 1GGFA 4I4LA 1XDBA 1T6ZA 3DOOA 4QZVA 1LX7A 5L95A 4Y9UA 2C9YA 2VPQA 2A33A 3OF3A 2AC7A 2EVWX 1X87A 1OWOA 2OHHA 3CVJA 1MC8A 3B89A 3SZ3A 4P3PA 1IK6A 2V4MA 4LJ6A 3WLIA 1OCEA 2NO9A 1CC1S 4XWWA 2IH4A 3BWDD 1LDNA 4ZAFA 1MAUA 8AT1A 2Y4OA 3CX8A 3HEBA 3K4PA 4DA8A 1PR3A 2ZDQA 4HF7A 1DTSA 1W1WA 1XAHA 3E35A 3IQDB 4I5IA 4M0MA 3RJ9A 3N58A 4URUR 4ARBA 4ENUA 2ACEA 4ZV4A 1GUDA 3QVOA 2X4GA 2PAAA 3UT0A 4MXDA 2B98A 2FKNA 3QF7A 1Y33E 4IEIA 2UUAB 1R0CA 3FOFC 4P4SB 3EQZA 3WYNA 1JHMA 3MFYA 3GDHA 1JG7A 1ZK2A 1MOQA 1Z36A 5JYCA 1IVSA 2DERA 2H11A 1PG5A 3AKCA 4H7FA 4Q7MB 3S81A 1N2BA 3G2IA 4AD8A 1VI2A 2V3CC 4GPTA 1W30A 3LBAA 3IP6A 2BW0A 5C2JB 3QVTA 3PWTA 3VKVA 3CR8A 3ZDRA 2R1TA 3MSXA 5GM1A 4JCCA 1RADA 3DDWA 5DM2A 5DGDA 2VHXA 4AQDA 3BRSA 4ZYUA 1JPUA 3S29A 1U99A 1H2AS 4S2UA 4HXFB 2O23A 5JVDA 4PX2A 2XT9A 4UPEA 2PFGA 1OIXA 3F7NA 5K01A 2OWEA 2HLPA 4P6VF 4BLVA 2LE0A 3V3TA 1RLUA 1JX6A 5BSVA 6ABPA 3H2YA 3KSDO 4TWBA 2TYSB 1T15A 1JHAA 5J1TB 1VGQA 1SHTX 4RIFA 2E3JA 3F5DA 3AI2A 5KJCA 2ZSIA 1B23P 1L5VA 2CBGA 2IXEA 4XPIA 2IPOA 3AZOA 1L7XA 3JALB 4UCQA 3F1KA 1XPJA 2HXSA 3LRPA 3EXHB 2YQ4A 5IYZA 3G1WA 3G17A 1P2SA 3UA3A 2I6TA 3KB1A 1VRVA 3N2IA 4H4CA 3HABA 4Q4DA 1NLUA 1P7CA 1W8DA 4QEKA 4LVUA 3B1JA 4YASA 3ER8A 3J7AC 4P7JA 5K1ZA 2HZBA 2VK1A 4Y2PA 2PFSA 3EPHA 2WYVA 1E5LA 3MB8A 3D7NA 4G81A 4F2WA 4JLSA 5JMWA 1LTHR 2KS6A 3H18A 1CUVA 2F62A 5LP6A 2BSQA 3TUJC 4KQ1A 1W4AA 2IUYA 2BI4A 4LBWA 4PGHA 3TUIC 4C78A 1YKGA 1ONOA 2VWGA 3EISA 2PQ6A 3VU0A 3ZKAA 2SKCA 4DQDA 3WTCA 4YAJA 1G8KA 3G23A 1SCIA 1NU8A 3PUJA 5A4MS 1XBTA 4RDHA 2B1GA 3D81A 5KPDA 4I3GA 3V1LA 1YHYA 4WLNA 2VSQA 4MUIA 3OP4A 4YJ2B 2G82A 2GBLC 1DC6A 2JFFA 3H11A 3LX6A 4IIJF 2FK8A 4WASA 4XA8A 5AKJA 4GM0A 2RHBA 3ZHCA 4YCNA 4G0OA 4IRMA 5KYTA 3T1YB 4TL9A 2HV9A 2W6OA 4UBOA 1SHKA 4OSEA 3IPCA 1JXQA 1MV8A 2JCBA 2DBQA 4PTZA 1ZN7A 5SYMA 1VL5A 5CLQA 1WXFA 5BWCA 2H9AA 4UNQA 1EVKA 1M66A 4Q6BA 3FF4A 1P0CA 3HCCA 4PAWA 1CU1A 1V16A 1IEQA 4RE5A 4TTAA 2W93A 2GCOB 3FKSA 4JKIA 2V96A 2G71A 1O94C 3JQRA 1T1EA 1AKEA 4ML3A 3BE6A 4OKNA 3L41A 1S4QA 2MDTA 4OHWA 3W5JA 3WGGA 1EVEA 2RH9B 3D3WB 3GJRA 4NBTA 4D4KA 2AUMA 2GZDA 5LM3A 1VIVA 2RBKA 4M83A 3ZGYA 1C29B 3CNLA 1RRMA 3GBPA 2CKMA 3RYCB 3GCXA 5BSMA 1O9BA 1ZN2A 2X41A 1PX2A 3KT8A 5EIBD 3PXCX 3DF7A 3FNRA 5IAJA 3WGKA 4DQLA 3AIKA 3LC2O 4NSNA 2ZUTA 3QU7A 2BMAA 4FQ8A 3S55A 2WM8A 3U3MA 2VRNA 3OI7A 1WKBA 2EKPA 2C5GA 1XMXA 1EJBA 2R2GA 3ZNQA 4DR4B 1E3MA 3KE8A 1JR6A 3L9WA 3PGMA 4IW3B 4Q4AB 5EXTA 4WACA 2HAEA 4D8XA 5EJ2A 1JBEA 1OXMA 2D1YA 1FX0B 1BMFA 1TFRA 2P4UA 2XMBA 3KVRA 4XH9B 3ZJ4A 3RVNA 3FSJX 2OO7A 2XQJA 3F2VA 3O8QA 5HKBA 1A5TA 2B8WA 4XYBA 1EUCB 1A7KA 2JAQA 3H8SA 3A28A 3KJXA 1RAEA 1BQEA 2K4MA 1OLXA 1QNLA 3IEUA 1EFKA 2YZ7A 3IAM1 4U5XA 3VR3A 2A7XA 3BF8A 4GW3A 1I7NA 3HKEB 4PNPA 2AMVA 3K8ZA 3ZV6A 2BHRA 2C2ZA 1YR1A 4K6FA 3FHCB 4R6WA 5ALWA 3OUUA 1A95A 3RSGA 4EYOA 2FYTA 5E95A 1TF2A 4E14A 1C4WA 3RW9A 4II2A 5CB4F 4B3FX 1RKVA 1XU4A 4MRMA 4PZ9A 3KSUA 4GOLD 4KYVA 2R8RA 1DRUA 2FCRA 5F2OA 3RS5A 5A6SB 5AKHA 3HB7A 1JEQA 1E79A 5DM60 4F4CA 4I1PA 4HFJA 2ZPUA 1GZ6A 1WU7A 1TMYA 1TM4E 3L84A 3OPYB 1LDYA 4IHQA 4LVCA 5AK3A 5EWMA 4JJKA 4ZWNA 4EGFA 1KEWA 1NKTA 2H00A 3IHWA 1KHTA 1E1LA 1IHOA 2PIAA 3U4IA 4RW0A 5U4QA 4AJ4A 4DC0A 5DV9A 4FCWA 3FTQA 4TLCA 2VNKA 3GG9A 4TT8A 1YV9A 1XF1A 1BU8A 2O8CA 1YQ9A 1I3LA 3FOWA 4GMKA 5C53B 3AETB 3ZDDA 1SUPA 2P91A 4GYWA 3QSYA 3NS7A 5EVJA 4LF4B 2QWXA 5DLEA 3FMFA 3RC9A 4HDSB 2JK0A 2W0SA 4HYQA 2WMOB 5LOVF 1OI7A 1OAOC 1XZJA 2IGTA 2Q4BA 1VG9B 4L8WB 5KIAA 1A1SA 4ZDKA 1IHUA 4GZMA 2XKJE 1HE5A 4C03A 3F78A 1T4CA 5C5CA 3QZUA 1AF7A 1CRQA 2JZCA 1Y6ZA 4NV1A 1DHTA 3PIIA 5ALLA 3UYKA 3SBXA 3PHLA 4CG2A 5EP1A 4MCAA 4MRRA 4RHYA 3GCZA 5GTDA 1M6EX 1NQVA 1LF5A 5A9SA 4OMFG 1KI3A 4B2YA 1FL9A 1K6MA 1V8FA 2Z8ZA 5HFAA 3S7ZA 1NDUA 4XM2A 4C05A 3U49A 2QD3A 3DFKA 4XDGA 3WDMA 1PK9A 3CVWA 2FY8A 1L5MA 1XRSB 1XRJA 5FOSA 1MRNA 3JWHA 1BH2A 3LC7O 1Y7PA 2O8FA 1USVA 1P0QA 1IZ7A 1KFJB 1U7UA 2PG3A 1Z0SA 3AGPA 1TZBA 2WF7A 1Q84A 3G2PA 2BRUC 3M6WA 4XUEA 4ZODA 4O08A 2R00A 3O8BA 4V3BA 1G20E 1HE8B 3I1YA 5CLFA 1KZ9A 1T2UA 4NKRA 3GN1A 4M1WA 3VPGA 4C6TA 1BG6A 2IZ1A 2NXEA 2AMJA 4B3CA 1P4JA 2JIOA 1YF3A 3TJZA 5JDCC 4DLWA 3DZFA 4KEAA 4EGSA 3REOA 4O3MA 1H85A 2JGMA 5H4HA 2GYWA 3BSWA 4RENA 3GD5A 4F5EA 4KAXA 2ZBEA 3IOMA 10MHA 4K9LA 2VBIA 5M3BA 2CL6X 5A4KA 5KJ6A 2IPLA 1IXRC 1TZJA 3H2JA 4RGQA 4YP7A 3C5HA 3WAKA 3ZE1B 4EPWA 3SE7A 3EIOA 4H08A 4M46A 4L5YA 2ICAA 4IR7A 4N0MA 2A9JA 2EP8A 3DEYX 1JHOA 4OHBA 1G3MA 4RGYA 1L4NA 5KCMA 2VQDA 1P2DA 3K9LA 4L51A 1R9GA 4RH3A 4XX0B 5LBIA 4KPFC 1EFRA 1EDOA 3F6EX 3IQFA 1DCKA 3Q2IA 2BKLA 4NBKA 3FPLA 4BGDA 2NU9A 2ODBA 2H5LA 3RAFC 4TYYA 1KFEB 1V4BA 4DL9A 1PYDA 4B33A 1UKVY 1RS0A 3EGXB 4NBVA 5GINE 3EXG2 2ZRFA 2H8KA 4YMVA 5JO0A 3DV9A 3GJTA 3MWEB 4ARAA 1ISHA 3LBIA 1NVVR 3ABIA 4C0KA 2Z6AA 1YTUA 2ZRDA 2JIBA 2XBLA 2LW7A 2OCXA 2JHPA 2BFFA 5JXHA 3RVBA 4DMFA 1CUYA 1Z0ZA 4Q3KA 8ABPA 4XX1A 1RTTA 3NTXA 3ONEA 3GZNA 2WFZA 3A1WA 3PPXA 5CB8A 2XX3A 2YXDA 3RADC 1EE1A 1R7RA 4G4GA 3E70C 1R4NA 4KI7A 5CJ2A 2A78A 3QFFA 1JR3D 1OPXA 2YHIB 1OGIA 3GGJA 2J85A 3NB0A 4RCZA 5KTPA 2JLYA 1E5DA 1IDN1 1LQ2A 1NW4A 4YUZA 1OFVA 2ZVJA 3BGIA 4I55F 3GXBA 4YI3A 3HCNA 1A7AA 1V9SA 4INJA 4PZYA 4R1NA 2HWKA 2XB6A 2BLLA 2G0TA 3JYLA 1US8B 1OJLA 5AXBA 1E2BA 3TLGB 1XK6A 2PRKA 4BZPA 3I32A 1FFYA 1Q16A 5DNAA 4LX0A 5IUKC 3RVLA 3DHNA 3OJLA 3SF8A 4CCWA 3C70A 5ELMA 4NNOA 3W77A 1H2WA 2V6BA 2OO5A 3JV7A 1QZ3A 5I45A 3KVOA 4BO0A 4IMJB 3WL6A 2WSYB 1FQKA 1UP4A 4YJDA 1BFDA 3ICOA 1JG1A 3BS4A 5L3VA 2XNDD 1M83A 3MOIA 3ZCPA 4O5OA 4R40A 3PPYA 2MMGA 1TJNA 5K45A 4NZMA 4LZZA 2VHZA 5ER6A 1ZEMA 1O03A 4UC0A 2XE6A 1BXRA 2QU7A 5JXGA 3PQ2A 3C4VA 3OLZA 4LHSA 1QTQA 4GGOA 1XZBA 3DULA 3TYXA 3I23A 2VT6A 2Y1CA 1G60A 2CYBA 4HOYA 4KITB 3W5CA 2OUKA 3FX2A 3AINA 3R2JA 1OHHD 2F4VB 1N1DA 5BQPA 1SCKA 3VA7A 1Z8NA 5TE9A 1J2RA 1NKSA 1V5GA 3GEDA 1WUKS 1R0SA 2NUBA 4M1TA 3BRWD 1V0JA 2W2LA 2Q6TA 3D31A 2O14A 2OORA 3O82A 3PEUA 4WECA 1WL8A 2YTZA 3MYYA 2CVHA 4JMLA 3SD7A 4DIUA 4HO1X 5DULA 3U3KA 1RSZA 4HNVA 2F1HA 3X1DA 2P90A 4KQMA 1RYMA 1SXJB 2QVYX 3LKZA 2XOKA 2DWUA 3M1LA 3HQ4O 4CKBA 1JA1A 3DZBA 2ZYDA 2LRHA 4FBGA 5L7YA 1EMDA 3K6SB 3U3RA 5EHGA 3MF4A 3FCSB 1F2UB 3SDZA 4W82A 2W0MA 4KRFA 3LQQA 1COZA 1IBRA 3R5TA 4KWHA 4NP6A 4GLOA 4S0XA 4DJEC 3BMOB 2OV3A 2WVJA 3OIFA 3E1GA 1ISRA 2UUOA 2J7PA 2VNSA 3HNOA 3MW8A 4WKCA 3AEYA 3V7FA 2AYYA 1N2HA 4YQFA 1HWYA 3GLGA 4X20A 4MI9A 4CQLA 1NJ6A 4F0JA 1SKYB 2V0NA 4BP8A 3D3EA 3KXLA 1OZ0A 4K2AA 5LZ9A 4RJTA