3Q7QA

Crystal structure of rad g-domain q148a-gtp analog complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
146
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVEDGHTYDRSIVVDGEEASLMVYDIWEMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 146
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q7qA00
4AYWA 2ZJAA 5SZIA 1FTNA 4PHTA 1J8MF 4XWKA 2A3RA 1H8HD 2WM9B 4PTLA 3SHWA 2Z6VA 2E9SA 3U7HB 5FUVA 3C15C 4CVNA 1PUJA 3RS0A 4XVRA 3U4QA 3WRYC 1E1QA 1MO5A 2QGZA 4PZLA 1OH7A 3WMGA 4XJXA 1ZCAA 2FSHA 3EX7C 2YWEA 4XH9B 2A5FA 2KWIA 2J0SA 2IW3A 4TN1A 1GKUB 3TH5A 4R2IA 4HLQB 2CVHA 3GD7A 1KAGA 4OHWA 2ZR9A 2QSZA 3A1SA 3UG7A 4EFLA 3VKGA 4X8LA 1CTQA 2OBNA 3CBQA 1I4DD 3RLFA 2YJTD 4BQSA 4PHHA 1M74A 3AV0B 2DY1A 4LYHA 5G53C 5SZJA 1Q1EA 5HKKA 3Q72A 4MKHA 1E2EA 5J5CA 1LB1B 3IILA 1LV7A 4R98A 3MMPA 1LFDB 2KB0A 2BJVA 1IN5A 1ZCBA 3G5UA 4Z8YA 4W5WA 1QF9A 4JKIA 2RHMA 1U8YA 1OB5A 3HPQA 3S1AA 2DPXA 3FVQA 3OIUA 1P2SA 3A1TA 2X77A 2FMXA 3CPJB 3WBJA 4PSAA 4BLRA 3H4MA 3GJ5A 5D3MB 5KSYA 4IOMA 3AF2A 1XDBA 4NYIR 4LI0A 3T1TA 1X1SA 4BLTA 5SZKB 1CJUC 2V1XA 2JCSA 3GLFB 1Q21A 1IXRC 4EDHA 1D2MA 2IBMA 4Q9HA 1U99A 1ZNYA 2QENA 3OFNA 3D3QA 2DWPA 2G0NA 2QTHA 1RZ3A 2D62A 5DNYB 5CLLA 4D4LA 2BKEA 4U00A 1TF5A 2PZFA 1XJCA 3NHBA 3QXXA 5GJVC 4C3ZA 3AVYA 2F3RA 5CJPA 4M0LA 3P20A 4PQFA 2IXGA 4LV5B 2XGJA 4TYQA 4J0QA 3C41J 4A0HA 4BFXA 3IIMA 2VHJA 2ZSAA 2WV9A 1WCV1 3JZMA 1Z0FA 3RANA 3THXB 4IEIA 3TRFA 3SQXA 1XTJA 2F1IA 4M9SA 3D7MA 1E79A 1IM2A 4MUAA 3K9GA 3VU9B 4K46A 1W36D 1KK0A 4TZ0A 1AS3A 3U3MA 1ZU5A 5DHAA 4IOKA 2OCAA 2HUPA 3ZGXA 1QVRA 1DEKA 1LF5A 1WP9A 3T1VA 5FTMA 2QQ0A 2ZJBA 1ZNZA 2FZ4A 3U3OA 4DLUA 4QNRA 2GK7A 1MO3A 4NYMR 3LH5A 2W2XA 4JLDA 2QE7A 4IXNA 3T12A 1Z2AA 2RHDA 4ZCIA 4RKEA 4L4UA 3GLGB 2BHRA 1G3IA 4PAOA 4BASA 3LBNA 2QUZA 5IDVA 1I2MA 5EUQB 2CEAA 3VMFA 1GIAA 1U0HC 1CLUA 1QHSA 4MYCA 3I5XA 4A0RA 1XD8A 5JLJA 3LW7A 2P6NA 1Z47A 4NCKA 4GSYA 2RGGA 2IS2A 2JAQA 2FF7A 4HAYA 4CF7A 5A5GA 2WSMA 2IS1A 1OSNA 2BVNA 3EZ6A 5J4HA 1NKTA 3EPKA 2B7BA 4M22A 3QUSA 1G291 4R9UC 2NZJA 1T8UA 2WJJA 3OAAA 2HJGA 4QBHA 1HT2E 2P3SA 4KLNA 2QM8A 5G40A 4AWXA 4C7OB 3WYAA 4ZIRA 2BM0A 1IN4A 2FSIA 4HLCA 1Q0UA 3MAAC 1KO7A 3WYFA 5L3QA 1SHZA 2WWXA 1W44A 2F3TA 4EPTA 3A1VA 1DOAA 3MSXA 4PC7A 5HE8A 3B13B 3IEVA 4ZKEA 2W6JD 3UMFA 4ZDIA 4DT1B 2VL7A 4LBWA 2WWFA 1OIXA 3QPUA 4JLOA 1G9XA 1P5ZB 1G8YA 3NC0C 3AF0A 6Q21A 3AVTA 4JT4A 2IA5A 2VH5R 1Z0AA 2PMDA 3CRQA 3BBPA 1NSFA 2OLKA 3E2IA 3GJ3A 4EJSA 1G6OA 3KXIA 1C1YA 1P72A 2FX3A 4ESHA 3SFZA 1KDPA 2REXB 1PV4A 4GMDA 1KYIA 3IHLA 1DVRA 2G83A 2ZUCA 5GVSA 2PX0A 1R6BX 1XEXA 3B6EA 4LPKA 3U44B 1XJ0A 2JLRA 4AKIA 1JR3A 1I4TD 2CK3A 3K0EA 4YXWA 2QMHA 1KTVA 1S3SA 2PL3A 4IRUB 4OI1A 1KI6B 2R6GA 3CRW1 3SZRA 2CLCX 1FNMA 3NEJA 2CCKA 1EG7A 2CHQA 4KLZA 3FB4A 1QRAA 1TU3A 5KUTA 1FNNA 2JEOA 2UZ3A 2DFLA 2ZRMA 2ZRNA 4P33A 2OESA 1NKSA 4MGIR 4PC1A 5FL7A 2G6BA 1ZD8A 1E2DA 4PC6A 1FTSA 1NY6A 4DLTA 4EPYA 2J0UB 1UDWA 1Z0JA 4LWZA 3KJGA 5L3SB 4HB4A 2QPTA 1IOZA 3CX8A 2CNWD 1K5GA 4V0OA 1G7SA 2ERXA 1E32A 1KNXA 4TQAA 4M1MA 1XD2A 1US8B 2GJSA 1TEVA 5A4JA 1P7CA 4MYHA 4XTCS 2OFXA 1V5WA 4JYBA 2AK3A 4KAXA 3MUFA 4QGFA 4WAUA 1OH5A 2J59A 1NN5A 1MOZA 4TMWA 3B5JA 1LW7A 4EJSC 1GSIA 1YR6A 1Z8FA 3PVSA 1GAJA 4DHEA 2A5JA 2QPAA 1LS1A 3AF1A 1XXHA 3K53A 3CRRA 4A4DA 4BE7B 2F43B 1G5RA 4ON9A 4KBFA 1L4UA 4CT4B 4ASUA 3QG5A 1E9RA 4DDVA 1VYVA 1FQKA 1I4LD 3V00A 1UBGA 3HWSA 3NBFA 4A15A 1YR8A 3PUZA 3T1QA 5GVRA 4IVRA 4L9SA 4A8JA 1MT0A 1E2NA 4PC3A 4TL8A 2V7QA 2NO0A 1OKKD 2IYLD 2XOKD 5TARA 2W2VA 4ZO4A 4M1YA 1R5BA 2J7KA 4TZ6A 5IK2D 3AEZA 2NZ8A 2BWJA 4B3GA 1ZIOA 4M53A 1EGAA 4QGGA 3BB4A 1IN7A 2J45A 4DEYA 3IIJA 3Q3JB 4DRZA 4RY2A 1Q20A 2WZQA 1XCGB 4JVLA 4M1OA 1ZMXA 3IGFA 4TMVA 3L82B 1ZBDA 3DVLA 3AGPA 3DL0A 4II7A 3FMIA 4C2TA 1J8YF 1W0KD 1GDDA 2HEIA 3CIOA 2BBWA 5L8VA 1W47A 1JNYA 1IONA 1HT1E 3NWJA 3WBKA 3QKTA 4MITA 1MO6A 2BCGY 2J0QA 4TSFA 3VR3A 2OV2A 4LC0A 2N1BA 1E69A 1KI9A 3VTKA 1KZGB 4TYYA 3SYNA 2EFGA 2OFOA 5FI1B 2H7VA 4QXAA 3SU8A 2JIZA 2FPKA 4UNQA 1AS2A 1EFRA 1M2OB 1CEEA 4QNMA 2JATA 1ZW6A 4CEHA 4DLWA 2PEYA 1T0HB 1Z6TA 5CYPA 5JEDA 1KO1A 1E2LA 3GLFE 1Z6GA 3LXXA 1Z28A 3KFXA 1U94A 1QHGA 3Q8XB 3P27A 3QXJA 4DSTA 1NF3A 3DZ8A 2D7CA 1G4AE 4FMCF 1YKSA 3VHXA 5IHPA 1CKEA 4Q4JB 1SXJE 3L0IB 4LJ9A 3K0CA 5CM8B 3WRXC 4A8JC 4UNRA 1KK1A 2KSQA 2RCNA 4ZCLA 5KU1A 5BN5A 3I61A 4PQYA 1EFUA 1VCOA 3MJRA 4Q9JA 3F0TA 4XVQA 4MDFA 4QKQA 2V1UA 1HEIA 1VECA 3REFA 4C0SA 721PA 1G4UR 4AG6A 4S2EA 4A82A 2YOFA 1X6VA 3KKQA 4P32A 5KNDA 4KCGA 4TL9A 1MR3F 1A4RA 4IDPA 4B6EA 3QI2A 4NDZA 1P9NA 3QY0A 3QBTA 4LCBA 3HJNA 3PEVA 3CF6R 3IEUA 3EPHA 3SYKA 1XTKA 3SOPA 2PLRA 1YZTA 3E70C 4FMBB 1U9IC 2YWHA 3TR5A 4B3XA 1NLZA 3I72A 1VHTA 5FR1A 4OL0A 1OFHA 1VG0B 4JJZA 4NTZA 4URWR 4AYXA 5DN6A 3IBGA 4DLYA 3K0AA 2ZRAA 3CF2A 2YHSA 3VR6A 1QG2A 4UNSA 5DHFA 2QTVB 5H8WA 1SVSA 3HPRA 2VTKA 4JL6A 5K8UA 1UADA 4CYMA 1S0UA 4LJ5A 4U02A 5EP4A 1GNQA 1WE2A 2VYFA 3W6NA 2AXNA 3U4QB 2HLDD 4G0NA 2Q21A 2C03A 2DCUA 4M9QA 1R2QA 3KKMA 4MRVA 1Z83A 4GOXA 3RRYA 4JBYA 5GJWC 1KIMA 1C9KA 2VSXA 4KFSA 1ODFA 1XFAA 2P6UA 2PT5A 1VCNA 4P4SA 2AR7A 2ZRPA 4IVPA 4LHXA 1MABA 1YZLA 2ZJOA 3LA6A 1CJKC 2MSDB 1IXZA 1CRQA 3DOFA 1AS0A 4Q00A 4DC9A 4DZZA 4XVUA 3K70B 4XWOA 2F1JA 4BFSA 3LDAA 4UXIA 3RVBA 3U2QA 5P21A 2ORIA 3KDSE 2MMCA 4KSCA 1M6NA 1DPFA 4AK9A 3A37A 3SYLA 1R0XA 2FFQA 4MGZR 4JS0A 2CHVA 5E7MA 5DI3B 2Z83A 1XJQA 3MWJA 4PO9A 2AX4A 4TYNA 3PUVA 4LV6A 3S1AB 3NDPA 4RD3A 4GFDA 1G8HA 1E2QA 5EP1A 3K09A 4WA7A 2CE7A 4Q9LA 2ZTSA 4Q4HB 2G9NA 2IYYA 2RMKA 1OE0A 4RKFA 4M4SA 1VG9B 5C18A 3DM5A 1ZM4A 4PZYA 1T3SA 3Q5EA 4I99A 2WPDA 3AUXA 5BQ5A 3TAHA 4UNPA 1E2GA 2FE4A 4PO1A 3EZ9A 5G41A 3BC1A 1NBMD 5TDHA 1UM8A 1IY2A 4X8OA 3UMSA 2ANCA 2ZROA 3I8XA 3OE7A 2JJ1A 3K0SA 4D25A 4O2RA 3ZS8A 2OFWA 2GCPA 4M1KA 4TLEA 4GT1A 3K0FA 2ZSEA 4G5RA 1RW4A 2P5SA 1GRRA 3IPYA 3LW8A 3RHFA 4DB2A 2BOVA 1J7KA 3TVDA 3RYTC 4DCUA 2QBYB 4AYTA 4B48A 1KJYA 2IWRA 3K9LA 4Q48A 2HCJB 1ZIPA 4KSBA 4MKGA 2V55B 1IXSB 2AN9A 3AVPA 1A7JA 1G3RA 4HAVA 2FV8A 2XSZD 3TQFA 3UXMA 4LJ4A 3NEYA 2OUKA 1T3HA 4L9WA 2G1KA 4WZ6A 2IYRA 5LPNA 3W5JA 3KQHA 1E6CA 3EC2A 4CRWB 2FZLA 1X86B 5E4FA 3KB1A 3Q7QA 3ZZ0A 2EFHB 3D6TB 2NG1A 3QVVA 4HEJA 4OK5A 1X8KA 4POAA 2NPIA 2SHKA 2XXAB 1B23P 1B0UA 5TVKA 1QVAA 3UIEA 4ZDKA 5BYJA 1XEWY 4JBWA 4RFSB 2ZRCA 3R9IA 4YQFA 4Q1EA 4GMXA 3KQKA 3TUIC 1R0WA 2F9MA 3T15A 2Z4RA 1CJVC 1VIYA 3QKRB 4JLPA 1Z29A 2K5UA 4NYJR 3TIFA 4RJLA 2LWIA 4KVGA 5G3ZA 1F2UB 2BBSA 2F7SA 2DWOA 2TMKA 4A2PA 3ZD7A 1M34E 1CBUA 3BRWD 1N0VC 1CULC 4Q1DA 4AY2A 2A30A 3EZ7A 4LZZA 3RS2A 2J7PD 4Q4AA 2Q9BA 4QJ5A 4LJAA 3G82C 1ZYUA 5FL3A 4QRHA 4NYIQ 3SJBA 3OIVA 4MRSA 1P60A 1UF9A 3KXKA 2VHUA 1DAHA 5K8LA 5EZ5A 5TB5A 2O0KA 4M21A 5EE0A 1H8HA 4LK2A 3X1XA 1TNDA 1IY1A 3QKSA 4ZV4A 1P2TA 2V3CC 2FA9A 2D2EA 4N1AA 2ZYUX 4PHGA 1Q1BA 2G88A 2ZQ5A 3OESA 4D80A 2FSGA 1BMFD 1HQCA 1Q44A 3BAFA 2NQ2C 3M1IA 3MCAA 3RWOA 1KJZA 4BFUA 3NBXX 3EPLA 1ZNXA 3PCRB 2VP6A 3CZQA 5F98A 1XF9A 5F3WB 3VR1A 4JLMA 1E9AA 4OHVA 4XTRA 5E7JA 4WVFA 4GNKA 3Q7PA 3CONA 4FI3C 4C0HA 4X8HA 1E9EA 1LF0A 2IWHA 1UFQA 1DARA 1RVDA 2IYXA 1KO8A 1KI1A 3B1ZA 1R8QA 3LWNA 3M4YA 3IO3A 1X1RA 2CJWB 2YWGA 3KFVA 2QN6A 5HZKA 1QHNA 1AJEA 4QGHA 2PZEA 4OKSA 2ZRJA 4NYMQ 1Z08A 1UKVY 3EIQA 1DTSA 5DI9A 4TLDA 1DE0A 2UVQA 1ZP6A 2W2TA 4I1VA 3I5YA 1II9A 1VCMA 1N2CE 1BO6A 1S1MA 1EK0A 4B3BA 1N6IA 4MKIA 3KUDA 3GFOA 3SJZA 2A2ZA 1UBCA 1RJ9B 4PZZA 1XNJA 1VKJA 2QU8A 4BLSA 2QP3A 1O3YA 4HATA 2O8CA 1KI4A 4EUNA 1KMHA 2WJGA 1KDOA 3AM1A 1Z22A 2IHBA 4UKDA 5FTNA 1N25A 3HYRA 4TWZA 1GNPA 1GKIA 4QC2A 3L0SA 4CW7A 1UBFA 1JPNA 1BS1A 3TK1A 2AFIE 1D9ZA 4LBYA 3GLIA 4IOLA 2QQEA 4M1TA 5FOVA 2NMVA 3EASA 1W5TA 2H18A 4V0MA 5B2ZA 4L5BA 2B7CA 3TAUA 2EW1A 4GOKA 3WXMA 4TL6A 1N5IA 2H92A 4M1WA 1U98A 4QGAA 3ZLJA 1ZU4A 4R7ZA 2Z0MA 4URXR 4LY6A 1T5LA 3OEHD 4JZKA 1PVOA 3CWZA 2OCYC 1CR0A 3NBYC 1SVLA 1XTQA 3QENA 1LVGA 2DR3A 1XXHB 1G64A 5JHHB 3BWDD 1E94E 1JJVA 3GMTA 1QHXA 4DUGD 4JYCA 1RRGA 1E0JA 4V02A 5AR1A 4D2IA 4Q21A 5CK5A 1DAEA 3CNLA 4C0LA 1CXZA 1AK2A 4H9GA 1SVKA 2Z5FA 2V4ZA 5CLQA 1KZ7B 1G8GA 1YRAA 4JL8A 1ZVQA 3T34A 4I1SA 4YMWA 4A8JB 2BJWA 121PA 2Q9CA 1F2TA 4W9MC 1G6HA 3X2SA 2QAGA 1XMVA 5J4LA 1IN8A 3TKLA 2F6RA 4PSKA 4QG7A 4B3FX 1G1MA 4Q01A 4F92B 1Z0KA 1HY3A 2ZR7A 3FKSD 1NMZA 4UXJA 2OBMA 1OYYA 4KV9A 1J70A 4AC9A 1CP2A 2ZI6A 1GILA 3AUYA 2KBFA 3BFXA 3EIEA 5EUMA 4QM6A 4D4MA 2EFEB 1SQ5A 2I1QA 2C9OA 4G5OA 4TTRA 1P9RA 3C16C 3ETLA 3AKEA 4IHQA 3QG1A 4A0GA 3KL4A 1D2EA 3GJ8A 4JLVA 3EA5A 3AF4A 4U5XA 5AJVB 2IYQA 4F4CA 4YMVA 3VQTA 3ZZTA 5BW8A 2OO7A 3LX5A 2B8TA 3RDPA 2IL1A 1ZINA 4FCTA 3MFYA 4OYHA 5FUYA 1P4SA 3RS5A 2R8RA 4EPVA 2ZJ2A 1TF7A 2FFAA 3CZPA 1T5IA 3RRMA 1Q22A 2AL7A 1HA3A 2W6JA 3SJAA 3WHKA 4A6XA 4OHXA 2RGEA 4LYFA 3AQ4A 4Q1BA 2ODBA 2OE2A 4EQ6A 1OYWA 3Q9LA 5KNCA 4LJ7A 4DJTA 2GZHA 4JIMA 3ZVNA 1EXMA 4QFMA 4I4LA 4CZ2A 4QBFA 2O8EA 3AH8A 2VSFA 1N5LA 1OJLA 3H86A 1OLOA 5FPTA 4EFNA 5FOWA 1SXJB 3DDCA 1ZUIA 3TW8B 3B8HA 2GAOA 1NLFA 3TGPA 1M1YE 3OIWA 4D4JA 2F1RA 2XZLA 2C96A 2P5TB 3SC3A 3VX3A 2C9YA 3UPUA 1W0JD 3QXCA 2GJKA 4YC7A 221PA 1COWD 1Q3HA 4RCZA 1UDXA 3WHLA 1KI3A 4Z1MD 4LJYA 1E2JA 4TMKA 2CCGA 4D81A 4C9BA 3FDIA 3O8CA 3NXSA 5CIWA 3B2EA 1H8ED 2J0VA 1A5TA 3KKOA 2CNWA 2FGJA 1XP8A 1RE0A 3PUXA 1X3SA 2QTFA 4P31A 2BM1A 3TJZA 1Z07A 2DHRA 4U7DA 3CW2A 3RRNA 1F5NA 2IK8A 4JT2A 4BEBA 3TBKA 2XAUA 4B47A 1OIWA 4B32A 2IYWA 2HJVA 3SBDA 3AKYA 1I2DA 2YVUA 4P4SB 1QHHA 4P4UA 1II8A 4YONB 4E03A 1RC8A 2R6DA 4PC2A 4HAXA 4N0EA 3PUWA 2XJ4A 4OK3A 2GRJA 3QXSA 5F9HA 2WKPA 2ZETA 4UXHA 5HTKA 1XMSA 1T3LA 3CF0A 4PPFA 3B9PA 5FPHA 3KUCA 1HUQA 4AKHA 3TLXA 5F9FA 2JLYA 4I1UA 4URVR 1ZC4A 1M7BA 4ZDJA 4G3XA 2EWVA 2WOJA 1Q12A 4DDUA 4L8GA 3QIAA 3SE0A 4BFWA 1OKKA 1XTRA 2XOKA 4PFSA 2YWFA 2X19A 3BERA 4O0MA 5IK2A 3QXHA 3THWB 2PCLA 4FIDA 1EX7A 2VO1A 4LX0A 1Z0IA 2PBRA 1KI8A 3B7GA 3HR7A 1S2MA 4NP6A 1N6HA 3L8ZA 3P26A 1SGWA 4JLAA 3WMFA 4JVNA 3ASZA 3T35A 1E2FA 3ADDA 3X1WA 4FW9A 2IC5A 4AG5A 4C0KA 4KYUA 1D5CA 2GKSA 3ICQB 2YOGA 2R6CA 3K70D 1W0KA 3VKHA 1RFLA 5CK4A 2EU8A 1JR3E 3K1JA 4PAQA 4CEJB 1G21E 3QPVA 1N3BA 4KXFB 2ZE8A 3P4XA 3NKVA 3AVQA 4HYYA 4PSVA 3DOEA 3THYA 2WJYA 4Q9KA 3SDZA 5KTYA 4Y0AA 1KY2A 4E22A 1YZUA 3PQCA 2O8DA 3I3SR 3FMFA 1E2PA 4F4JA 4RZ2A 1FX0A 4Q66C 2O8BB 3W5IA 2H57A 3KJHA 4G5GA 2XNSA 2EYQA 1RYHA 3FKQA 4ARZA 4LPSA 3T06B 5EE9A 4KO8A 4RSGA 5EXPA 3NTUA 1JECA 1JAHA 5CYOA 3ZD6A 2AD1A 4DBLC 1YR9A 4LGMA 4B2LA 2WBLC 2JLSA 1DG1G 2V6JA 4NHOA 1W4CA 4CT5A 4BLOA 4KVAA 5JWRA 2QT0A 4C0BA 1OF1A 2FNAA 1E9SA 3TUJC 1YZQA 5DYGA 2CBZA 2VEDA 5KPJA 2QG6A 1PLKA 1A1VA 3NVAA 4YDHB 3REGA 2R62A 5J40A 1Q57A 2W58A 1NN0A 4RD4A 3GPLA 3PXGA 3B1XA 1EX6A 1N0UA 2KI5A 3C5HA 2BBOA 4LC1A 4KFRA 1NIJA 3W6PA 4I1OA 1W4AA 1K5DA 1XXHE 4HZUA 3P4YA 1N6KA 2DWQA 4MRNA 3I62A 3ADBA 2IYSA 1CR2A 2AWNA 3B78A 3RNLA 4C0JA 3B85A 1E99A 2GCOA 4ZCMA 2EVWX 4HLUA 1UEIA 3PEWA 3LNCA 5EP2A 3ZVRA 4Q1AA 2HDNB 2QL6A 2VPPA 5FBRB 5JFGA 1U8AA 4XWAA 2O8FB 1A2BA 1VIAA 2Q3FA 4IDNA 1NJFA 1XTSA 1PZNA 3LY5A 2A7QA 3OF5A 2HLDA 1PUIA 2OXRA 2IUUA 5JS8A 3FWYA 2FEOA 3IQWA 2H16A 3V4FA 4KITB 2QY9A 3GFTA 5H1YA 2A9KA 4XD7D 4OJKA 4NH0A 5AJZA 1CRPA 4GZMA 3UWKA 3T1OA 3GLHA 4GL2A 1F3OA 5GJBA 2ZSDA 2P0EA 1WDTA 3CRMA 2VRWA 3FE2A 1KY3A 2HV8A 3GJ7A 3LAWA 1TAGA 4V03A 1ETUA 5GADl 2ATXA 3GFPA 4LYJA 4NONA 1PLJA 2R6FA 2WICA 3SS8A 1S4QA 3BIFA 2VSOA 1YZKA 2OBLA 4TYWA 1N6OA 4PAMA 2GJ8A 1VG8A 3IUYA 4Q1FA 3MWYW 3RWMB 1HTWA 1ZJ6A 2RGDA 2FJUA 4NU0A 4RFVA 3NG1A 1XZQA 2GJAA 5DE3A 2ZEJA 4NYJQ 1U0JA 3VR4A 4LJ8A 1VCIA 3UWOA 4NCJA 1VMAA 3RAPR 4HLUC 2YKGA 3LQQA 1NRJB 4URUR 4JBXA 1TADA 1XX6A 4YDSA 5JJKA 5FI0B 2ASEA 3QEJA 3W6OA 1R0YA 3HU1A 1NBMA 1DAGA 2V8OA 1TPZA 3B1VA 1IJEA 2REBA 3AGQA 3BS4A 2XB4A 3N5CA 4OQMA 3W8NA 2VHQA 2ZS9A 3PJRA 5JJLA 1E0SA 1KDTA 2ZVQX 2W6ID 2XNDD 4OHZA 4Q03A 1U90A 2JASA 2FEMA 1AIPA 1WXQA 4PANA 1DELA 3Q85A 4B35A 5FTKA 1T9HA 4MH0R 2ZITA 4WZAE 1G7TA 2D4HA 2G77B 4Q7MB 3DMDA 1F60A 1G19A 2GF0A 3QF4B 3SNHA 4CEIB 1LNZA 2ZI5A 2ZANA 4IOJA 2W0SA 2XSZA 1DADA 3I92A 5JZVA 1OFIA 4A0FA 2QORA 4NE2A 4CDGA 5JSZB 1ELOA 4B6FA 2ZI4A 3DKVA 1UPTA 3ECCA 3TE6A 3CUEF 5FOUA 1GP2A 1G18A 2C77A 2YZ2A 3R7WB 5D3MA 4HDQB 1KSFX 2PJZA 1E98A 1UKYA 2HYDA 3TUZC 1R7RA 4WXRA 2GNOA 1SVWA 1CS4C 3CH5A 3GLFA 5JBQA 4MUBA 3KTAB 5EE5B 2PH1A 2AKYA 2AHOA 3HP1A 2QGNA 1GNRA 1O87A 2ZAOA 1JR6A 1DS6A 4GDFA 1VTKA 2L0XA 4ABYA 3TVTA 1FMLA 4MA4A 3F8TA 4B74A 3QBVA 4CGZA 2BIFA 3GEIA 2OLJA 3AKCA 2HT1A 3W9YA 1JPJA 2J9RA 5LB2A 1MKYA 2ZRHA 3SI7A 4PX9A 4V0LA 3C7KA 3DPUA 2J7PA 3HYTA 1ZD9A 1NVVR 3L0PA 3N70A 4M9XA 4P3YA 3THXA 4LHYA 3U6KA 2OAP1 4FCVA 1JXOA 4JLBA 5BYKA 2FFBA 4E5UA 1E2IA 2BEJA 1DAIA 2FWRA 3I32A 4O25A 3RSLA 3VU9A 4IDQA 1YJ5A 5B64A 2ZYWX 4OBEA 3W90A 4EPXA 3WP1B 2WWIA 3G0HA 1FMJA 2CCJA 4V0KA 3VHLB 2CHGA 5FPYA 1N6NA 3K0CC 4L15A 4A6PA 1OH8A 3ZYCA 5A0FA 3BXZA 1MRNA 1XEWX 2H8KA 3CM0A 2BCJQ 4QBGB 5TY0A 3R9XA 2FGKA 2IXFA 1AZSC 2IYZA 1BMFA 5AK0A 1S8FA 3HU2A 2F1HA 4WXPA 3TR0A 2EQBA 3L0OA 4UQOA 4DLVA 2GCNA 3BFVA 2EYUA 3EW9A 2C2HA 2AWOA 3FMPB 2WOOA 4AD8A 3GLGA 1WB9A 3BGWA 1OFUX 4G01B 3BOSA 3KQLA 4B44A 1CJTC 1N5JA 4FMDB 4G5SA 4HB2A 4EQ6B 3QPWA 4XSHA 4GP6A 3A1WA 4KFTA 3CLVA 3ZS9A 4DLZA 1L2TA 5CB8A 1KDRA 2B21A 2Y8EA 4NCIA 4C0QC 4NZYA 4AKGA 2G3YA 5JS7A 4W5JA 2O8EB 2DFTA 3KXLA 1YE8A 1BH2A 2WIAA 1OW3B 3O8BA 3CB4A 4D0LB 1G3UA 2C9CA 2D3WA 2EFCB 2ZJZA 3GCGA 4YMTA 5HR5A 2Q3MA 1GL7A 4BFYA 2QPOA 4HSEA 4B71A 1ANKA 3BH6A 4M1SA 1OPXA 2RGCA 3AP3A 2NO7A 3MG9A 2C98A 5FPSA 3X1DA 2N46A 3UANA 4C7OA 1L8QA 3PITA 2OSBA 2FH5B 2C04A 5G3YA 1E1RD 5EXXA 2ZI9A 3VFDA 5KYKA 5CDFE 3U7GA 3A1UA 2D06A 2OHFA 4M8NE 2XB2A 3DMNA 4A36A 5EZ6B 2IF0A 3BB3A 3FHCB 3M0EA 4KU4A 3F5FA 1QBKC 4RD1A 4OJQA 5H68A 4JSTA 4DT1A 2FSFA 1DAFA 1SVIA 2JJ8A 4IDOA 1AZTA 2DFKB 1BYUA 4BRUA 1U81A 1P61B 2NIPA 4A9AA 4HI0E 4GP7A 2D2FA 1P62B 3AP1A 2O5VA 4TT3D 3U44A 8OHMA 1GFIA 3LFUA 1IY0A 3F3YA 3E5HA 3KKNA 5B30A 3GEHA 1SXJD 3K09C 1GRQA 3CWQA 3OEHA 1KI6A 4K8OA 3MD0A 4K81B 2WTUA 4WOPA 1II8B 1GOTA 2VHCA 4QOSA 1LY1A 4IDHA 1JXMA 3PR1A 3R8CA 4JVSB 5JI3E 4DUGA 2WWWA 1TQDA 3FFAA 1L4YA 1M7GA 4Q9IA 1KNQA 3TMKA 4ACBA 4DSUA 1ZNWA 2OCBA 2O52A 1G3QA 1UJ2A 3AF3A 2IHYA 4MQBA 2J0UA 3D31A 3ZZUA 4ZKDA 5L3SA 3C5CA 3IDQA 2GEDA 2ERYA 3EXAA 3EPJA 4DCVA 3IKJA 4DIEA 1E9BA 3CRVA 5FOXA 1WRBA 1XBTA 3CR8A 2OEPA 4BFZA 2A5DA 3ZIAD 1ZAKA 4AURA 4ZIRB 4MDEA 2P67A 4D4KA 1KO4A 1HV8A 3FKSA 3QEOA 1NG9A 4F7WA 3LRPA 1DAKA 4EPRA 5L3QB 2YINC 2PEZA 1W2HA 2GESA 3WYGA 2B6HA 2ZE5A 1EWQA 2C5LA 2Q6TA 1OHHD 2GK6A 5BN3A 2NO1A 1FOEB 3B9QA 2OCPA 1RPZA 2F43A 2ZU0C 4DSOA 3QE0A 4N3NA 5KSPA 4EJSB 5LD2C 1XCMA 3WNCA 4R2HA 3FHOA 2VQSA 1UKZA 2R65A 5EE1A 5KSZA 1XEXB 4JLJA 1D9XA 2QA5A 4FCWA 3KB2A 1P75A 4TMXA 3VKWA 4QHSA 1EFCA 4EIWA 4TMZA 4ZI2A 1TMKA 4Q1CA 1VYTA 2GTPA 2LKDA 1T0JB 5CJ2A 3THOA 1M8PA 1N5KA 1NVWQ 2IYVA 2QMEA 1D6JA 3H84A 2ZRLA 2PLFA 4UJ5A 1C4OA 2FDCA 2J5XA 4YMSA 4Q02A 1F48A 1YRBA 2QSYA 2RH5A 3PIRA 3ASYA 4IW3B 3WY9A 1WA5A 2FPMA 3KJEA 4RZUA 2QROA 2WKRA 3ND8A 5FBLB 4HUQA 4QJ3A 1R10A 4UJ3A 2QMOA 5DISB 3GLIE 1P9WA 1WBBA 4V0ME 4FD2A 1W46A 3QVUA 4HAUA 4BRWA 5IRCD 3DHWC 4V0NA 2ATVA 5JEEA 5FBWB 1G5TA 1XD2B 4G5QA 1HE1C 4G1UC 4KODA 4DDWA 4F93B 2XEXA 5HZHA 3H1TA 2B8WA 1W0JA 4UNNA 3MRSA 1NNEA 1TU4A 1COWA 1GZSA 1S3GA 3MLEA 4Z8XA 1AA9A 4JJKA 2FN4A 4Z1MA 4B34A 4WIAA 3ZQ6A 1CR1A 5HE9A 1AQUA 4KJZA 2QP4A 1ZM7A 5EJEA 2NPFA 1XD9A 1RRPA 4Q7LA 1ZUNB 1AN0A 3EIHA 1H8EA 3PENA 5L3RA 2V54A 4PPGA 1VHLA 5DIFA 5EP3A 1AKYA 2ONJA 1MO4A 1UBEA 5IF9A 2WSSD 3DZDA 1P2VA 2FFHA 2J87A 1JQJC 4YLGA 3U7FB 4OI0A 2KBEA 2ZIAA 2WAYA 4H1VA 1JEEA 5ANRB 2WJVA 1Z0DA 5TXGA 3C8UA 2LCFA 3WNDA 3GJ4A 1WF3A 2ZE6A 2XTZA 5K8TA 3O8RA 4BWYA 1D8TA 2VP2A 1UAAA 4BZPA 3BH7A 3GLHB 5KHOC 1RYFA 1SZPA 5HCIA 3TSOA 1HYQA 821PA 1W4RA 1TQ4A 2PZGA 3GJXC 5AJWA 2GF9A 2QNRA 3U7EB 2HYIC 4NPHA 1N0WA 4GBMA 2JDID 1NN3A 4PHFA 4KHZA 2ODWA 1QG4A 2X1VA 3K9HA 3IO5A 1AGRA 2P6RA 2GETA 5KNBA 2ONKA 2P65A 1TL7C 1AM4D 5JECA 2YC2C 4Y0VA 1IQPA 4LJ6A 1F6BA 1SKYE 4N0DA 2QRNA 3AP2A 3IQXA 3B82A 3TW4A 5B57C 2JA1A 1S9HA 4NBSA 5JRJA 1J99A 3ICEA 3EWSA 3A58B 4DEXA 4F4IA 2J1LA 4B75A 3NBZC 2JLXA 4NMMA 1BKDR 4TLAA 1ZUHA 3D8BA 5CM9C 2ZRIA 3ZVMA 1QDEA 2JLWA 4DCTA 2A78A 4IFBA 2BMJA 4TYPA 1XRJA 4BLQA 2VP0A 4M9ZA 3KJIA 4GOJA 3B1YA 5E3HA 1W36C 2W83A 1J2JA 1FP7A 1BYIA 4Q18A 2XTNA 4OI2A 1II0A 1K6MA 4MKFA 2DB3A 2MSCB 3FMOB 2IYUA 4CEHB 4L16A 3U3RA 1Y3AA 1Q3TA 3JVUA 5C1BA 4EAQA 3OEED 1K8RA 3P1JA 2RGXA 2C99A 1DBSA 3LVQE 4ILEA 5FOSA 3TSZA 3FPAA 4NKRA 3V4RA 5FTLA 4JLNA 3ZJYA 1S96A 2A5GA 3SQWA 1NN1A 2P2LA 2GZAA 5B58C 5DI3A 2OAQ1 2AD5A 4BFVA 5C46F 2WAXA 1YZGA 2QAGC 3CKLA 2HF8A 3O47A 1SHKA 2C95A 1P2UA 4ITRC 3PEYA 2QT1A 3U5ZB 3SR0A 1CJMA 4KYIB 4Q4HA 2B92A 2BDTA 3TSWA 4ZDWA 4B3CA 2AKAB 1ONBA 4LDJA 2IEZA 4OI4A 3CR7A 3CH4B 1CR4A 3K0AB 2F9LA 3HR8A 1X8LA 4LSGA 1E9CA 3DKPA 3QNUA 3SFVA 4MGKR 3N2IA 4D6PA 2WVJA 1GITA 2RAPA 4RZ3A 2W0MA 1EESA 4B3DA 1S1CA 3ZH9B 1ZC3A 1ZRHA 3AKDA 2JJ2D 4IFEA 2QBYA 2ZRDA 3MJHA 621PA 2Z4SA 1E4VA 1HURA 1SVOA 1W2GA 5E95A 1G17A 3K70C 2FOLA 1G16A 3HU3A 4HAZA 5AUPB 4PO8A 1KSHA 2BC9A 5J4YA 1N6RA 1MABB 4IJMA 2CLDX 2IYTA 3KKPA 4XIGS 3FYHA 4E07A 1NI3A 4MYUA 4QHYA 1R8SA 1KAOA 1Z6XA 2GBLA 1JJ7A 5EE3A 2GAAA 4DDTA 2IT1A 2X2EA 4OQLA 2CL0X 2XXAA 1FW6A 2ZRGA 3T61A 5FOTA 1VPLA 4RFSA 2PJRA 2GVDC 1E2KA 2QM7A 2HXSA 5LB4A 1W48A 2GXSA 4B2IA 1HH4A 3QJYA 4XD7A 1TTTA 1NMYA 3QKRA 2FPLA 4AI6A 3GJ6A 2YC4C 4ACAA 2J3EA 3BJIC 1F2UA 1W5SA 4KFUA 4PPNA 3A4NA 5KPDA 1E1QD 2GWHA 3EAQA 2MMGA 3JVVA 5IT5A 1XPUA 2NO6A 1OIVA 1ESNA 5FR2A 2GZDA 2XX3A 3WNBA 1XB2A 4HUTA 3K9NA 1PLLA 2EWWA 1DAMA 3C4JA 2RKOA 3M6AA 2QI9C 3R9WA 3DM9B 4OQNA 3MWLA 4DLRA 4A92A 4RVCA 3SEAA 2REOA 3BD9A 4US2R 1NLYA 3LBHA 4LHZA 5HCNA 3K0FB 2QAJA 4HB3A 2YNMA 5M04A 2ZUDA 3LQRA 2YOHA 4Q19A 2ZJYA 5HKKD 2BMFA 5FTJA 5JWOA 2VP5A 4QBIA 3IIKA 1D2NA 2WJIA 3DEFA 2VLIA 3UKDA 2E87A 2XZPA 3EC1A 1Z6AA 2E1RA 4DLSA 1NVVQ 1KOFA 2GBLC 3B1WA 1AQYA 5J47A 5DO9A 1Z6YA 2MSEB 2PT7A 4FMDF 4WW0A 1Q1ZA 1U8ZA 3O8DA 1FUUA 2Q9AA 2VP4A 2Q3HA 4CIDA 1G8FA 1OXVA 3IPXA 3SJCA 2GEUA 4OQFA 1JI0A 2NGRA 2O0HA 5BWMA 1U2RA 1FZQA 2W6IA 4QM7A 5KO2A 4OHYA 2XNDA 5EXTA 1GRNA 4IVQA 4TTPA 2CJWA 2UZIR 5LD2B 2GVZC 2AXPA 3OFND 2GA8A 1DO2A 1QHIA 2OXCA 1E96A 1MRSA 4B73A 3GEEA 2JLUA 1M7HA 3CPEA 5JRZA 3CPHA 4A1FA 3ADKA 3TNFA 2C8VA 2BMEA 2VP9A 3Q5DA 2AK2A 2IEYA 4Q47A 4DSNA 2IF2A 3NIBA 3QSYA 1OH6A 2H1LA 2N42A 4Q4AB 1CIPA 1IAQA 1RJ9A 1XMJA 5KSOA 5L3VA 2WHXA 4P0TA 2I3BA 1Z63A 3L8YA 1E79D 3DO6A 3PV0A 4BLPA 2D7DA 1XPOA 1N6LA 4LHVA 3U61B 3NHAA 3X1ZA 4ZI3A 3QKSB 4LBZA 4TLBA 5CB6A 2XTMA 5FUWA 4JLKA 3EG5A 3GLHE 2QE7D 1NY5A 1PJRA 3VNVA 1Z06A 4C30A 1UKEA 1MV5A 1N6PA 1TX4B 4MRPA 421PA 3SBEA 3U3JA 2OZEA 2JLVA 2F55A 1XCPA 4HLDA 1CF4A 1XEFA 2G1JA 3VR5A 1QZXA 2CL6X 2JGNA 2ORVA 1H65A 4D0NA 2GXQA 4OQXA 3H2YA 4I81A 1JAIA 1IN6A 1R0ZA 2GXUA 2ZR0A 2ZS8A 1E0KA 2H17A 3AVOA 1ZM9A 4LHWA 5TMPA 2W00A 2OM2A 1YZNA 2ZI7A 2KE5A 2XITA 3BB1A 2DBYA 5FBQB 2YV5A 4Q5IA 4FXPA 3T5GA 5JCPA 1OV4A 1RIFA 1GL9B 3EWAA 1G20E 3OAAD 3KX2A 4IXMA 1G3MA 4X8MA 3UMRA 1GUAA 5FUXA 5FFMA 1A2KC 2GJ9A 3ZVLA 1T91A 4D0GA 3W8RA 1Z2CA 1NIPA 1NBME 1S9DA 3KZ1E 3NC1C 2R44A 2PMKA 4MGYR 2ZXUA 4KBGA 4HUQB 1EFTA 1SKQA 4FN5A 2O8CB 1KMHB 1OFTA 4URZR 1U9IA 1JB1A 1U0LA 4OK6A 1NMXA 1KHTA 5J4KA 1FP6A 1KI2A 2WWGA 3LO5A 5JJIA 4EFMA 1JALA 3P32A 5C4MA 2AFHE 2VBCA 4MRRA 3GLIB 2IS6A 1G5PA 5AUQA 5J4VA 2QMUA 2V6IA 3E1SA 3RSOA 4O3MA 2HF9A 1ESMA 2BEKA 1E1RA 4DVGA 3GP8A 3UG6A 1E4YA 1JR3D 2GDJA 1OXTA 4NCNA 5C4GB 3SN6A 4EKDA 2CK3D 3W3AA 4YXWD 3C14C 4IEEA 4GI7A 3B60A 1BOFA 2CXXA 4HZIA 1W36B 4BFTA 1QHYA 2RGNA 4LV8B 3OHMA 4MYTA 1WMSA 1HQYE 4Z51A 4AKEA 1R5NA 4H1UA 1XTIA 2OILA 5KDLA 2J41A 1GWNA 3NH9A 3V9PA 5FL7D 1GM5A 5DH9A 1VG1A 5UKDA 4TT3A 5JMTA 2ZRFA 3BK7A 4AIIA 5FPKA 1GVNB 4TTQA 4A2QA 4BPBA 1SXJA 2ZM5A 1YR7A 4NL4H 3FOZA 3OZXA 4DXAA 1BIFA 3RRZA 1E9DA 1F2TB 3W3ZB 1FUKA 2QAGB 4Q4LA 1MH1A 4R71A 2IUSA 3BFKA 1SULA 5JHGB 2ZS7A 4IKEA 3AVVA 1Y63A 2ZI3A 4P4TA 3WMEA 2R6AA 4BZQA 1ZD1A 2KJQA 5JI2E 3EZ2A 3CNOA 4WZBE 2VF8A 4GZLA 3RC8A 4LBVA 5JCZA 1R4AA 1W49A 4LRWA 4JL5A 4WBSA 1XZPA 1W4BA 2EFDB 3FHTA 1E3MA 2HT6A 1YVDA 2C78A 4ASUD 4QHTA 2G0TA 1KK2A 2ZAMA 4TLCA 5TV2A 1P6XA 1SKYB 3J81k 3X1YA 3ZIAA 1EFHA 521PA 3GLGE 1TQ2A 3EZFA 3AB3A 1E2MA 4E09A 2X2FA 3QF7A 4XSGA 3LXRA 2ZREA 4O2LA 2RGNC 5KDOA 5BN4A 1OHHA 4M2LA 2V7QD 1KSJA 1E9FA 3BH0A 3CO5A 2ZSFA 2IXEA 2CMKA 3NDBB 5SZHB 1NSTA 2X8AA 3I4LA 4B33A 4GPTA 2OT3B 2I4IA 1TQ6A 1VYUA 2A5YB 4JMPA 1SXJC 2ZJ8A 5CIQA 5FH9A 2GILA 5DGXA 2H5EA 2ZE7A 2J46A 3AVXA 3LBIA 4US1R 3JZAA 3T5DA 1YHNA 4KI0A 3AVUA 2LKCA 4RZXA 3ONWA 1KMQA 1L7VC 1NG1A 2DYKA 3FGNA 3IBYA 2NOAA 4TMTA 4TSFD 2FU5C 3THWA 4JSYA 4BEJA 4FWIB 1R5OA 4LYAA 4US0R 4LUCA 1T8TA 1G41A 3HDTA 4BGDA 2JIZD 4D82A 3MGCA 4DLXA 2VA8A 4NCHA 4B76A 4YMUA 4PXAA 1AKEA 1EFRD 1KJWA 2XZOA 4FWTA 5AJXA 3MWKA 1JEDA 1OXUA 3PG5A 1W1WA 4C2UA 4BZXA 3CX7A 2DFNA 2VF7A 3QKUA 1E0AA 4W5HA 1YU9A 1P3JA 2ANBA 1WBDA 4CEJA 5AUOB 5DYIA 2WIBA 2JLZA 4F91B 4TQ9A 3SHFA 4F38A 3UK6A 3RS4A 1OXXK 4Q7KA 5C2JB 3U3KA 2ZRBA 3U60B 1TF2A 1G7RA 1NVUQ 1NJGA 2CDNA 2ZYTX 2Q0HA 3A4LA 4FINA 5EXSA 2BV3A 3QOFA 5CDFA 4HDCA 1JQLB 2O8BA 1IJFA 1QHHB 2GHIA 2QEQA 2IX3A 1CU1A 1XU4A 4ZPXA 4BECA 1LS6A 1J90A 2ZVPX 5E7IA 1TUIA 2WSSA 3BE4A 4Z54A 2O0JA 2BKUA 2QZ4A 2ECKA 3I1FA 1LTQA 2V9PA 1UEJA 3AVWA 2ZSBA 1FQJA 5CITA 5DN6D 2CL7X 2QP9X 3W34A 4JKYA 3EA0A 2PCJA 4EPWA 3K8YA 5AUNB 2GEVA 4HDOB 1SVMA 1HE8B 4DIDA 2HCBA 2ODEA 3FTQA 3ZQJA 3BORA 1US8A 1XMIA 3QQ5A 4QL3A 1GL6A 4TQUS 5GJCA 1TUEA 4A2WA 1KI7A 1KKLA 1ZM2A 1GTVA 3A36A 2ORWA 2JDIA 4DKXA 1V43A 5D3QA 1YQTA 3U6BA 1KSGA 4W7SA 1W7AA 3R20A 2CVFA 1DG3A 1X8JA 2WKQA 4DCSA 5ELXA 4DB4A 2BMDA 4LOAA 3RS3A 1KO5A 4ESVA 2O8FA 4RD6A 2WJHA 2CLSA 3GJ0A 4C4PA 2OG2A 5H70A 3I73A 3NH6A 4URYR 3LVRE 3LLUA 3THYB 5JWHA 3EARA 1WQ1R 2ZJ5A 3GQBA 1XWIA 4ERNA 5BXQC 3KQNA 2O8DB 2ZYVX 3A6PC 4RD2A 1FX0B 3LV8A 5AJYA 5LBIA 2D74A 4DWJA 1GG2A 1NVXQ 2ODNA 4ARZB 4JVMA 3OEEA 3RS7A 4Q7JB 4PQRA 3A8TA 5KOYA 4FMCB 1IHUA 3VR2A 2ZPTX 3LX8A 3H0KA 5AWFC 2R2AA 2WPDD 5DLQC 3CNNA 2R9VA 3CX6A 2BBTA 1P73A 4B2PA 1IBRA 3VX4A 2UKDA 1KGDA 4TL7A 3KQUA 2VHTA 3LD9A 3PEUA 5KDDA 3A4MA 1G7CA 2RGAA 3OE7D 4QJ4A 2IUTA 5EQTA 2JJ1D 4DCNA 5F2EA 1Z5ZA 2WMNB 1KKMA 4RD0A 4RCYA 4HAWA 1OB2A 2QRZA 3L43A 1T6NA 2RB4A 2WMOB 3RABA 2ZUBA 3ND9A 2NTYC 2PX3A 2IS4A 2RGBA 2HXYA 2Z43A 4HB0A 5HPYB 1NL3A 1FPMA 3N2EA 4GRAA 4HZUB 2I1VB 1T4GA 3VNUA 1A82A 4D26A 2GCOB 2YYZA 3ADCA 2WWHA 1DO0A 4BUJA 2XJ9A 3I8SA 2JLQA 4C0AC 1FFHA 1VDZA 2FG5A 3PUYA 3WP0A 1OXSC 4PPQA 4Q4JA 1FL9A 1EWRA 2JJ2A 3VAAA 1E2HA 3IHWA 3ZDQA 3R8FA 3QF4A 4PR0A 3TQCA 4CEIA 1OT3A 5DSZA 2ZRKA 2CE2X 2VIIA 1RRFA 5JSZA 3OIYA 2ZU6A 5LDDC 3RC3A 1Q1QA 3R7WA 3L2OB 5FBVB 1GKYA 1JBKA 1G8PA 4B43A 2GXAA 3LLMA 1NP6A 3UATA 1KK3A 2WWYA 1RRCA 5K8IA 1TEXA 4S35A 3KTAA 1AGPA 1Z3IX 3FFBA 1ZM3A 1XPRA 2NO9A 1RKBA 3PFIA 4XOIA
chains in the Genus database with same CATH superfamily
3VC7A 4TS9A 2JGMA 3COSA 1E66A 5SZIA 4XA8A 1J8MF 1L7PA 4QTZA 2CDAA 5AKLA 5LU9A 4IX9A 1H8HD 2WM9B 3ECSA 2UUPA 3HBJA 3PI7A 4Y2QA 2E9SA 3EF0A 5B4TA 1TCBA 5LR6A 5L7WA 3C7TA 4CVNA 1PUJA 2HU2A 3SP1A 4DMFA 2WJAA 1ZJYA 4IS3A 5D8DA 5ALLA 3WRYC 5IDQA 4KR7A 1OH7A 1CJCA 3BKWA 4DLLA 1J0BA 4R6WA 1ZCAA 6PFKA 3NYQA 1QGED 4XH9B 5K3AA 5ALMA 4Z4QA 1QSGA 1M54A 2BGJA 5ALXA 3S70A 3H65A 5LBUA 3VRHA 3ZK8A 4BB6A 5CDSA 1ZGHA 2JJYA 2IW3A 1Q6ZA 4KE6A 3X2FA 3L7JA 2C2GA 1J7JA 3COWA 1TPYA 2I76A 3PTLA 5TPZD 5IWCA 1N8NA 2NXCA 2XYRA 3MXOA 5C5CA 5JMOA 4GIBA 5TMBA 3A1SA 5K51A 1H42A 1CTQA 1R6VA 1QO9A 2NZYA 2OBNA 1M2VB 1SCDA 1ZZEA 2WKWA 1G66A 2VZEA 2QW8A 1DLIA 4RQBA 4PHHA 1CEXA 2EZUA 2DY1A 4XGIA 1NXSA 5SZJA 4B3SB 4MP8A 1Q1EA 2P2NA 5HKKA 5A4FS 5HGXA 3Q72A 5J5CA 4RYLA 1CQJA 1LB1B 3TX6A 4D3YA 3MMPA 2WWTA 3ADOA 4OP1A 1LFDB 2BJVA 4FQ5A 3G5UA 2V5VA 3E9CA 4CL3A 5JY6A 1K3UB 3LI2A 4KACA 4W8GA 4RAOA 2X7HA 3S1AA 3AR3A 4KTTE 5AJHA 1TJ4A 3STTA 3V2GA 1TT5A 3OIUA 2B1JA 1C4KA 2I8CA 4RS3A 1Q7BA 3SXUB 3EXG2 1Z7YA 2H4HA 4PSAA 4BLRA 1ZD5A 5D3MB 4ZO7A 2R4UA 4JUBA 3C6QA 3Q11A 4B40A 3C3YA 1CJUC 1I30A 2JCSA 1Q21A 2HREA 4ZRDA 3H4IA 4JHLA 4Q9HA 3WJ2A 1RAHA 2QENA 2QRVB 3V4VB 1R15A 1MUUA 2ET6A 2GM5A 1LXCA 2VXCA 3H8SA 3KQSA 3K2IA 1RZ3A 2B30A 5GOTA 5DNYB 3DVAB 1PL7A 4RV5A 5CLLA 1G2PA 4F5ZA 2PX8A 4ZAGA 1XJCA 1GXSA 2AJBA 3NHBA 2JFYA 4XQ0A 3UHFA 4PHCA 1B2RA 3B3GA 1ORIA 1TT7A 1XEAA 2C3UA 3ITEA 1RKUA 2H4JA 3OQPA 4PQFA 2XGJA 3FFWA 3M6UA 3FRJA 3LUKA 1C0LA 3C41J 2YHAA 1T2AA 3GZNB 3HM2A 4M8IA 1NDQA 1PDOA 3HP7A 1FQOA 4H6WA 3IIMA 4MPPA 3SSNA 4BFXA 4OHYA 1RWNA 4LJSA 2D0PB 4W9NC 3RANA 3SQXA 1KH2A 3REOA 2FW9A 5F7ZA 4E30A 1CE8A 3O82A 1UMCA 2JEYA 3P4UA 4U9IS 4UVIA 5DYTA 2PZLA 3DYVA 3G3EA 4K46A 4QUHA 3VU9B 4DOMA 1CETA 3ROXA 2BP7A 3LC1O 4C4AA 2XUDA 1CF9A 4MW7A 3ZZMA 5I4CA 1Q95A 4YO8A 2JFOA 3LUCA 3E4CA 1WUKS 4DTIA 2RSLA 3BDVA 1LF5A 3JQFC 4FDVA 3EVZA 1XRLA 1RYDA 1ZNZA 2FZ4A 3FDXA 3O7WA 3BHJA 4CNQA 3HL4A 3JQBC 5CU7A 3STWA 1P0QA 3WO0A 4O4IA 5DTEA 4IXNA 3RIYA 2QX8A 4XRGA 1Z2AA 1L7AA 2ZKIA 3E3LA 4WADA 3CKMA 4L4UA 4DNQA 3A6FA 3GLGB 4JWTA 1R6XA 4FSXA 4MLDA 5HEKA 4AF8A 3IAXA 4BASA 4LSWA 3JQEA 3VH4A 1I2MA 3GUHA 1CC1S 2CEAA 1E1LA 4JQCA 1GIAA 5EUQB 1U0HC 1EFVB 3GN2A 1CLUA 1QHSA 2XRMA 4BO6A 4A0RA 1U9CA 4G8JA 2P6NA 1FU8A 4K5QA 4DYHA 1TQ8A 4NCKA 3EXHC 2IS2A 1T0PA 5ARCA 2FF7A 1Y33E 4HAYA 4CF7A 1SG0A 3C6YA 2AFRA 5CA1B 5A5GA 2WSMA 2IS1A 1SWWA 1V96A 3EPKA 1QV6A 2R8EA 4L74A 2B7BA 3H9QA 1PKXA 2EZ9A 1XFDA 3LQ1A 2XYVA 2WJJA 4OFBA 1JGTA 4QBHA 4Z2YA 1ZFNA 4ZDIA 2X5JO 1BZYA 2Z2JA 5JD4A 1RWXA 5JSUA 4CG2A 4MP3A 3CZMA 4KLNA 4ZTZB 4R3WA 3O94A 4C7OB 3WYAA 3E3NA 3LHIA 4JITA 2DX7A 4HLCA 1L4KA 2ACKA 3LCCA 2O48X 5DOVA 8LDHA 3MAAC 2B8EA 4HNQA 2ZBUA 2DTXA 3HO6A 2ZJ4A 1VA4A 4HFNA 4D8VA 3A1VA 1DOAA 3G1TA 4PC7A 1KZ1A 5HE8A 1XHEA 3B13B 3IEVA 3P0JA 3UB4A 1L7NA 3VXKA 3NVKI 1A5AB 3WZLA 1SQSA 4RE6A 2VL7A 1YXMA 1BCSA 1Z68A 2A9RA 3ORHA 4LBWA 3SEQA 4LHSA 1KH1A 1P5ZB 2ZPAA 5TNXA 1MXHA 1H2YA 1HDIA 2IA5A 2QSJA 3GV0A 5C37A 5C8YB 2PMDA 7YASA 2FG7C 3E2IA 5KNCD 3O92A 3UWPA 4O4JA 3Q8MA 1P72A 4GEKA 4HDMA 1IWBB 1KDPA 3AFMA 1XLTA 1ZONA 1PNTA 5KTSA 5LLSA 3W6ZA 2PUTA 2J0EA 1IFXA 1Y1RA 4AKIA 1XJ0A 2VDVE 1G21A 1V7PC 5A3QA 3DLCA 3K0EA 1KQPA 4LOHA 1DCMA 1KMNA 3IUPA 2XKKA 2CLCX 1A8UA 3NEJA 1SCUA 4BS9A 1MGPA 4J2HA 4KLZA 3RC7A 1QRAA 3G0GA 3G0BA 4J94A 5KUTA 3CEAA 1EBUA 1W8IA 1UXHA 3A28A 5E7QA 4P33A 4CKCA 2VKQA 1I6MA 1ENOA 1RC1A 5BWOA 1P1JA 2GAIA 3OLYA 4H31A 2KPOA 5EPOA 1H2ZA 4AJ2A 2GHTA 1ZD8A 1IZ9A 4EI2A 2VNKA 4U2DA 2J0UB 2ZLBA 5EMJA 1Q3KA 4BKRA 5HFJA 4EPYA 1JFFB 1WP4A 3HR4A 5CVEA 3KOYA 2CNWD 3EXEB 1ONOA 1G7SA 2ERXA 1E32A 2QI9F 1TCCA 2O2ZA 4GL4A 4TKUB 4FHZA 4WLVA 4TQAA 4M1MA 4XIFA 1JIQA 2XV1A 1US8B 1IY8A 3WX0A 1DXQA 4QRIA 3WLJA 2OSVA 4RIHA 1TIBA 3INYA 2Y3IA 1U5CA 3W2FA 1BX1A 2LZ0A 3K2QA 3L6UA 4LVCA 4XTCS 2QLBA 1X1AA 1FJHA 1V5WA 4ID9A 5FUBA 2VK1A 3MUFA 4QGFA 2DMRA 4WAUA 1OH5A 4JEIA 1MOZA 3WXBA 1NVKA 3B5JA 1Q7RA 4FK8A 2COUA 1LW7A 2IZZA 3PVSA 2NSYA 1L7XA 3KVVA 3BK2A 2GHRA 1LS1A 4BE7B 3M82A 1M76A 2F43B 4NX2A 2VT3A 1L4UA 3C43A 2FR8C 1X7DA 4ZT7A 1ESZA 5TX7A 5KQMA 3L9XA 3OQHA 4E4TA 1U3WA 5BRAA 3DNPA 1ZOIA 4LOJA 4XEHA 1JA1A 1YUMA 1FQKA 4UHDA 2H9IA 3CLKA 3MC1A 4TVBA 3VPSA 1WDLA 3H2BA 3VPHA 1UT5A 5I45A 1CUIA 3PUZA 2P75A 1P5JA 3KNZA 1SUWA 5GVRA 4L9SA 2PIDA 4DIBA 2OZPA 2PQMA 2V8BA 4N5LA 3U81A 4YXFA 4R0NA 4RIFA 2C7PA 2V7QA 4OU5A 2P4QA 1B7GO 3PNMA 4QJBA 4A16A 4C5AA 2WUVA 5IJ0B 2GT1A 3UHAA 1BXGB 4MGHA 1X0XA 5BSRA 4HVAA 3AEZA 1CUSA 1JL3A 1T10A 4BNWA 1SU6A 4G4SO 3ZKAA 4WH0A 1RCFA 2GAJA 3BB4A 4TX1A 3ZE2B 2BE7A 1YZVA 4DRZA 4C7OA 1PGJA 4JOCA 4JVLA 2V7TA 4EI9A 1CT9A 3AU8A 3L82B 3PT9A 1PR2A 4BO5A 3A9RA 2VNAA 3VYVA 1XOIA 1JG2A 4DA9A 4G9BA 5D84A 4Z2AA 1JFLA 3ZXSA 3C5VA 1QZTA 2FOXA 2NM0A 1IONA 1BCRB 3NWJA 4L95C 3AXSA 1VB5A 1W5FA 2DSNA 1MO6A 2XDAA 4HTFA 5F64A 3E0XA 1M2NA 3CGGA 1P8JA 5DYNA 3TLBA 4PX5A 2HN9A 4LC0A 3CZCA 2HSZA 3RI3A 3JQ7B 3TD6A 1IY9A 4ZT4A 1LFAA 3VTKA 1JH9A 3JTMA 2WLSA 3WNQA 3SYNA 1IRXA 4NJMA 5FI1B 5K3BA 1ZEJA 2UXBB 2ZGVA 2G36A 4UTZA 3X1MA 5K0GA 1SUSA 2OGSA 2RK3A 4EG6A 1U11A 1V5GA 3MTAA 1B0ZA 1PEYA 4KGVA 1BN6A 4CEHA 1M2FA 5LA6F 1L7DA 4F97A 4B85A 1W96A 1E2LA 1WD5A 1YMQA 1R27A 2RARA 3FY4A 1U94A 3LXXA 3Q8XB 3QXJA 1XG5A 3VVBA 3S4YA 4DSTA 3DZ8A 4FMCF 1YKSA 2N47A 2W9XA 4YMIA 4X1IB 3PX7A 1TZBA 1CKEA 3NYRA 2DAPA 2PTHA 3L0IB 4LRSB 4L50A 4MUXA 5CM8B 4CQLB 3WRXC 1CUZA 5J59A 5ARBA 1KK1A 1I3NA 2RI6A 1NDHA 1ESEA 1VCOA 3MJRA 4Q9JA 3FTFA 1HNXB 1QE3A 4XIYA 3VV2A 2X58A 3DULA 5DX1A 4UAVA 5AKXA 3ORRA 2G9RA 3G2OA 1P17A 3Q3GE 1IWPB 3BGSA 3IVXA 1U63A 4R8MA 2DPLA 3GG9A 3LECA 3NGXA 2QN8A 2UAGA 3N7UA 1A4RA 4KCGA 1PVVA 4TL9A 3QI2A 4KOAA 2B1GA 1IAVA 4NDZA 3UFBA 5JXJA 4MQUA 2B35A 3UW1A 3HJNA 1WNTA 3PEVA 3HFJA 3IEUA 4FYKA 3QWAA 5I5GA 5IKEA 1U0BB 1GFSA 3E70C 3TM4A 1G60A 1XYGA 1NLZA 3TR5A 1VHTA 4GO1A 1GKLA 4AYXA 4JJZA 1DG9A 5I8ZA 3JALA 1P4RA 2Y2VA 3I2HA 3KUUA 3AEUB 1KEVA 1N3LA 2X5OA 2FX5A 3TSCA 3VR6A 1SRQA 1SC6A 4E3WA 2PZKA 1TRHA 2Y6VA 8ABPA 3AETA 5IN4A 1BDHA 2O1XA 2DWUA 4C4TA 4BDTA 1O6GA 2VTKA 1N5DA 4CYMA 1S0UA 4LJ5A 4U02A 1BE1A 2PGAA 4KAAA 3BG5A 4LISA 5ALRA 4L5CA 3MJFA 1K2VN 3VOSA 2XI4A 1Z37A 2HLDD 3M34A 5LQMA 5MGBA 5KWEA 3QY9A 5JQGB 2DCUA 7MDHA 1NJ2A 5BV1A 3L6CA 3ZYZA 1OASA 3OX2A 3F7MA 2AZ4A 3I9MA 2F9FA 2VSXA 3LXMA 3F98A 5G1PA 5DXAA 2ZAIA 3PC6A 4TV9F 2P6UA 2PT5A 1VCNA 4P4SA 5BWNA 2AR7A 2W2OA 1JA0A 2ZRPA 3A4IA 1M73E 2P9BA 1GHTA 3UK2A 1CJKC 4Q00A 2RHRA 3DEAA 1HSZA 1Z74A 3FR7A 4BFSA 1CFZA 3L6BA 3A14A 1PGPA 2G4VA 2I0FA 2C9ZA 2ORIA 4TQGA 3RUEA 1KDZA 3WL4A 5CD9A 3OG9A 5HW0A 1O95C 4AK9A 2B4YA 3A37A 3VYTB 1EM8B 1QKJA 2SKEA 1CSEE 2VZLA 1A2QA 5EA2A 5BYBA 2ES4A 3LT0A 2OORA 2FX2A 4KN8A 4QFBA 4HXYA 3JYLA 5IYZA 3RFUA 3JQDA 4TYNA 2NSDA 2ACVA 3DBLA 3PUVA 3JQGB 1EDBA 1I3CA 2V96A 3MXTA 1GGVA 3STYA 4LDNA 4R0MA 5EP1A 1OVGA 2ADFA 2HA6A 1Z7BA 4E0BA 2JJQA 4Q9LA 3TLCA 1MH9A 1SC4A 2IYYA 3VR4D 1AUPA 3F4KA 4M4SA 1XRMA 3IP8A 3DM5A 4P80A 3QKUA 3GCXA 3T8YA 3ROEA 4ZGGA 4YO7A 4TKLA 4BNFA 2WJ6A 2HCRA 1H3NA 3RBAA 3V42A 3FF4A 4F72A 3PXBA 4TV8A 1IY2A 5A06A 2HQSA 2OY0A 3UMSA 3EXHB 4M49A 2ANCA 3LL4A 4R16A 5FOQA 1JR4A 1DEXA 3DPSA 4O2RA 2GYWA 1W6RA 3N8KA 4WESB 3RVKA 2ZSKA 4TLEA 1BFUA 5A3JA 3K71B 2ZSEA 1TB4A 4KR3A 1NASA 4JIGA 1RW4A 1KHHA 2BM8A 3AG5A 3UNXA 1YAHA 3JQ8B 1AF7A 2JKVA 1J42A 1ZMBA 2BI7A 4RJJA 2PR2A 3JAMA 1YF3A 1DIBA 2Z5GA 3CH6A 4DCUA 4RYDA 1TVEA 1KORA 3DE1X 1GLVA 1Z56C 3EAFA 5FD8A 1Y3CE 3D8UA 1R9MA 1ZIPA 4KSBA 3UHJA 4BJ1A 1ECPA 4DF3A 2EX4A 3BTOA 3IMFA 4OJMX 3OQVA 2Q5QA 1PQYA 3NEYA 3UUGA 4BX2A 2OUKA 4BE9A 1NW5A 3EW7A 3VPBA 1POWA 1Z4LA 2IYRA 1CDEA 4BWVA 1MZVA 3Q8LA 1E6CA 2HRCA 2FZLA 5E4FA 3ILHA 1TKRA 4KRYA 3NDIA 5ERXA 3DE3X 4ETWA 2NG1A 1GR0A 3QVVA 1VA5A 3DDSA 5COAA 2NPIA 3REQA 2XXAB 1B23P 4KQHA 1XLUA 2PZ8A 3VPAA 4AN0A 1DZ3A 4W8OA 4ZU6X 3TPZA 4JBWA 3RNOA 1D1TA 2VXYA 4BU0A 1NXXA 4YQFA 4GMXA 1WSDA 1YK0A 5I4KA 2NWQA 3N6VA 3T15A 1Z29A 2K5UA 3H2IA 4P34A 4HTAA 1ADBA 1PQWA 1B3BA 3BSWA 4M8KA 3HJTA 1VHQA 5CYFA 4AXXA 4B4VA 4N41A 1F2UB 2BBSA 3GGCA 4KQ2A 3RSFA 3USES 5HJEA 5HS4A 1ISJA 3BRWD 1PI3A 3OMXA 3THSA 2J7PD 4M8SA 2WHEA 1N7GA 1LDEA 2J32A 3TNLA 4LJAA 5CBPA 2CZCA 3G82C 4UCWA 1A69A 4YT5A 5FL3A 5FJJA 1KU6A 1M1XB 4NYIQ 2P9HA 3ENVA 4QULA 2HDWA 3D8RA 4EQZA 3RYCA 1DAHA 1SXHA 2LV8A 3DZFA 3UJNA 1EE1A 2CKDA 5EE0A 1H8HA 2DPGA 4GR5A 2E4XA 5EKTA 4ZI5A 3EK2A 3IODA 5EJFA 1TNDA 1IY1A 1YDEA 2YRXA 1QIKA 3SE7A 2FMFA 4CLXA 1WDMA 3O4RA 3P9XA 4F71A 4R54A 2PTGA 2ZYUX 5BW5A 1UBUS 3D7SA 3UK7A 2QTTA 3QFSA 2A4MA 2O57A 2ZQ5A 1LWNA 3PEEA 3H2GA 1RBMA 1HQCA 1RQPA 3NTOA 2PG3A 3RWOA 2VKTA 3NBXX 3K0KA 3QITA 4HVTA 4F1KA 2X4DA 1PT6A 3CZQA 3GYBA 4FDUA 4UULA 1PZFA 1E1KA 2F1OA 1BS9A 5FRDA 5F98A 4DRXB 4GD3Q 3DLPX 2YN2A 3PD7A 4R9RA 4Z9FA 1T5SA 5ALQA 3W2GA 1QR2A 4R40A 3K0HA 3QMPA 1YFJA 5TPZA 4C0HA 3Q15C 4OSPA 2C5FA 3OWXA 5LU8A 1E61A 2FZKA 3FYSA 3GVCA 3IUJA 4C4XA 1KVTA 3F71A 4XYEA 5A9SB 4JN6B 5K4GA 1KO8A 1Q19A 1SIOA 2FEAA 1HQDA 1JNXX 2VT7A 3N58A 4J03A 2ECOA 3DWEX 5CTAA 1D1QA 4UHCA 4Q39A 2OD9A 3WWPA 2H2WA 1QHNA 1UKAA 3Q2IA 3I9LA 2ZRJA 4B6GA 1S3IA 4M60A 1Z08A 3SC2B 1UKVY 3IAM6 3L7NA 4GMKA 1YIOA 4IH1A 5DI9A 1WNFA 5A03A 1Q2XA 1U7OA 5L51A 1DE0A 1E62A 3M7IA 4G5XA 5A4DA 1ZP6A 4DUPA 2I2XB 2W2TA 5LQUA 1WX1A 2PKWA 1DSSG 2JHGA 1X14A 1DOHA 1S1MA 4LOLA 4AJ9A 1OLUB 1YOVA 3M5CA 4PYIA 5KJ6A 1I6KA 2WMDA 3SJZA 3OWHA 1SKAA 3FCAA 4MARA 3HHEA 2LR0A 1XNJA 4FZJA 1OA1A 2EBUA 5ETJA 5FQNA 4WN3A 3NPMA 2DLNA 4HATA 1C8LA 5DHRA 2VJPA 4EUNA 1OU4A 2Y92A 4CN8A 1X70A 2COKA 2IHBA 5FTNA 4QC2A 4CW7A 4OO3A 3N0WA 1VL1A 3ZKWB 3SQDA 3B9BA 2BFEB 4YEDA 1ADGA 3GLIA 1UWCA 3DAHA 1FMCA 1YJCA 3AUJB 4IOLA 1W5TA 2H18A 3CE6A 3G23A 4Y2YA 4EJ6A 4EVIA 5L4SA 1N2OA 1BQ4A 1ND5A 4B46A 5JS1A 5ALSA 3JV7A 1ISRA 5AJTA 5J2UF 3DWIA 4BO1A 2HR1A 4QGAA 3HUFA 1ZU4A 4EHBA 3UVEA 3LWBA 3Q7TA 1X7ZB 1P1IA 1T5LA 3B3AA 3OEHD 3QU2A 3RFCA 3CWZA 5ES4B 5JSHA 4GEGA 1BWSA 2ZWVA 3GBPA 2A35A 5JNVA 3RC2A 1LH0A 5ALPA 1LVGA 4JP2A 1XXHB 4QOEA 5GQSA 3CJQA 5JHHB 3L4BA 1POXA 1E94E 1TLTA 3PIDA 4IDBA 4DUGD 8OHMA 1IRIA 1VGRA 1B8PA 4CQMD 4NV1A 3ER8A 1RRGA 5ICSA 4V02A 4YRPA 4J4TA 3ETCA 3RU2A 4Q21A 4D2IA 3R0XA 3L4KA 2WTMA 1CXZA 2PSFA 1AK2A 4JOQA 2ZBRA 4YH1A 1PQPA 3OFJA 5CLQA 1KZ7B 1ISPA 1YRAA 3KOOA 3OZFA 4NBVA 1QB7A 4L5AA 1VRVA 3SJUA 3RADC 3T34A 1EHYA 2BJWA 4LZWA 2Q9CA 3TRHA 1NX6A 4B6SA 4DJFC 4F2PA 3QE9Y 1L5SA 1PX2A 5A5VA 4IDDA 4RPCA 3MWDA 5F1PA 4W9MC 1G6HA 1NBAA 3AF6A 1XMVA 3A1CA 4KK4A 4B3FX 3M8KA 2FSPA 4Q01A 4JP3A 1PZGA 4KO2S 1Z0KA 2F8SA 2ZR7A 4MV4A 3TFWA 4AJ1A 1NMZA 4TRNA 2V7VA 4GNRA 2O8VA 3NJRA 5CX1B 4C78A 2BUAA 4N5HX 4CGYA 1WTAA 2RCYA 3MW8A 4AC9A 5DTQA 1K63A 3ZD8A 2I4OA 3LXUX 1QH0A 3HDGA 4ENQA 5EUMA 1M8FA 2Z3VA 3ISVA 4QM6A 1N2HA 3EWIA 4EW3A 1Q11A 1HQKA 3DZKA 2ZZNA 1SQ5A 4FN4A 4BV3A 1TGVA 1P9RA 3SHVA 1N2IA 4LF7B 1WL8A 1G8JA 4P58A 3AKEA 3ZG6A 3QG1A 4RY9A 1D2EA 3GJ8A 1QMPA 1A76A 3OPYA 4U5XA 5AJVB 3PLAE 3BMXA 3UKJA 2GPWA 5BW8A 3O4GA 3UAGA 2WTBA 4IGFA 4EAAA 1UWKA 1ZOLA 4FEAA 3RDPA 3OCUA 4ZO8A 3HADA 3V8NA 3RWBA 2HHJA 3T7SA 4NE7A 2R8RA 2ZJ2A 1TF7A 3T5CA 4BAZA 1X7XB 1JIIA 1TYDE 1VL8A 1T5IA 2B34A 3H04A 1HA3A 2QQGA 2J07A 1TTPB 5EERA 4LK3A 3BEDA 3GBVA 3O2JA 2ZT6A 1VKRA 4X62B 1GA4A 2OE2A 2R8ZA 4O2AB 2G4LA 4MJ3A 1B41A 1M33A 5KNCA 1CYEA 2VHVA 4LJ7A 4DJTA 4ZYXA 3OCYA 4JIMA 3ICPA 3OKFA 4BVJA 4HS9A 4Z4GA 3DMYA 1W52X 4I4LA 4FYMA 4QFMA 1EXVA 1JVBA 2JIQA 2MR6A 1XRPA 4BX8A 4AY6A 1A9PA 5FPTA 2PHZA 4UVEA 1XLWA 3CVUA 4D92A 1Y5LA 2O2GA 3BZUA 1ZUIA 3DDCA 3DWFA 4LYYA 1AUVA 2GAOA 1GNLA 3NMUF 5GZ1A 1OREA 2DFPA 3QLVC 5JO0A 4P9NA 3QX8A 4D4JA 2F1RA 4IZHA 3LYLA 2C96A 4M0MA 1AO3A 4G0QA 3M1LA 3VX3A 1CZHA 4DCCA 3UPUA 4O0LA 5LKRA 2GJKA 4E6EA 1J21A 221PA 3FDFA 4OG2A 5TQ0A 1KI3A 3CO0S 3ZD9A 2XUIA 4K3VA 1HFJA 4JGIA 3HRHA 4M98A 2HQOA 4XARA 3KELA 3O1JC 5BMOA 4CIWA 1NAHA 3EEYA 1XAIA 2ZB7A 4W5TA 3EFEA 4RPKA 1H8ED 2J8ZA 2QUHA 5CT5A 4CMHA 3I05A 4F6CA 3ZEAA 1REQB 1I7PA 2CNWA 3FNEA 4Z0PA 4ZMBA 4WK4B 4YMGA 3IEXA 2H48A 1RE0A 1A7KA 1EBFA 3NHJA 3EEBA 4L27A 5AKHA 4M1EA 1FBNA 3V48A 5ITZA 4P31A 2FP4A 3TJZA 1Z07A 1N8TA 5GM2A 4J9VA 3QZUA 1RYEA 2PKYX 1ND6A 4PS0A 4DG8A 4OX9Y 2IK8A 2PRJA 4RY8A 2NZXA 4E5KA 2XAUA 4B32A 1A1SA 3VU0A 5H5JA 2B8JA 5G0WA 3QUAA 3AKYA 3FM9A 1XTUA 1ZGBA 4FYIA 5BN4B 1CDZA 2OV3A 3TSYA 3TXXA 3PFHA 1BAPA 1K4KA 2R6DA 2O4CA 4LQLA 5EMNA 2Q5EA 1LSOA 4ODIA 4PVDA 4DR2B 5F9HA 3PBKA 3FBTA 3V1KA 2ZETA 3BM5A 4AP5A 3OQ1A 3DJFA 3IJEB 4HGQA 5I7VA 4IZIA 1SZDA 1P29A 4YFYA 2AEEA 2WB4A 3OIDA 3GEPA 1R0SA 5FPHA 1VSTA 4JUFA 3WKCA 5A4KA 1YT5A 1HUQA 3KUCA 4FBMA 5F9FA 2VF4X 4EKYA 3LT1A 4DA7A 1EM6A 4QA9A 5DNVA 3UB3A 2EEPA 1JIXA 4NBWA 5INTA 4ZGBA 2NP6A 2NNWB 3ONNA 2WOJA 3O2QB 4X95A 4NNOA 3QIAA 3IAFA 3WK6A 2CBXA 2ZIXB 3V1TC 3V4OA 1FTYA 1GUFA 1JQ3A 1VLQA 1XTRA 4LG1A 4PU0A 4YAIA 2D5IA 1DKOA 3RVNA 4QPPA 1QRUA 3QXHA 1D0IA 2AG0A 2V0NA 4YT2A 3HJGA 4JBIA 3OQNA 2CZGA 2PBRA 3B7GA 4JJ8A 4NP6A 4U2EA 5IBRA 1SGWA 4JLAA 3H5NA 2HK8A 3BCSA 1OLXA 4YY3B 3G02A 3T9DA 4B9EA 4X63A 1XJ5A 2GKSA 5EYPB 3DVRX 2WFLB 4KIUA 5JARA 4LYEA 1Z8NA 2AOTB 4B6EA 3K70D 1G6KA 1QIEA 1LJUA 2VDWB 3D0KA 3E2PA 3GJYA 3OLCX 4RIGA 5IS2A 1JR3E 3K1JA 4PAQA 4CEJB 2WWVD 3KAKA 1NQ5A 1PFYA 1J20A 2C2OA 3V7YA 1PYDA 1DKUA 1J24A 2QYOA 3IOMA 3P4XA 3OTIA 2A9PA 4Y6PA 1K0FA 3D6UA 3ENNA 3AI7A 2PGNA 3OQ6A 3VHRA 4Q9KA 1RM3A 2RH4A 4G9GA 2WRZA 2O2SA 5GZ3A 3ZWQA 1NOKA 1KY2A 5IUKC 1OTHA 4MI3A 3TLJA 4AQYB 4DRYA 4F4JA 5LA6A 4Q66C 2O8BB 4ZCQA 3W5IA 5K3EA 1SBNE 3RU7A 2XNSA 1VHWA 1E7QA 2HO4A 4PTYA 3STHA 4I50B 4ARZA 1K6XA 3T06B 1H0RA 1ONSA 1FP1D 3NTUA 2Q3LA 4R3NA 1Y7HA 3GAAA 2BCEA 2JCYA 1QU3A 4BGEA 2AJ8A 4LCEA 2AD1A 2ZB2A 3COYA 4RA9B 1FUIA 2GK4A 3QVXA 5TLSA 4NJEB 3MN1A 1ZIDA 4A7PA 1FZTA 4EUFA 5CD1A 3OZ7A 4TWAA 2WVHA 3VNRA 1JG7A 3X43A 2I91A 1BDMA 2V6JA 1FNCA 2AOXA 4KVAA 3USCS 5JWRA 4RU1A 1VLVA 2QT0A 1X7WB 1OF1A 3QHPA 2OCDA 4B6FA 4BO8A 1R6DA 4BQRA 5JCXA 1V3VA 2ZUUA 2MTBA 1VPDA 1GN8A 2G9ZA 3I1YA 3REGA 1YL7A 5K6AA 5J40A 1X1BA 5CG1A 2KHZA 3LCJA 4B8YA 4RD4A 3GGDA 1EX6A 5BR8B 1F0YA 5I3ZA 1M1ZA 4ZT3A 1BDBA 3DFIA 1ZJ4A 4KFRA 3THRA 1XSEA 4I1OA 1GV0A 3C6XA 4D42A 1XXHE 2Y1WA 3E7WA 1GT6A 1JDTA 3OEWA 3P4YA 1E4EB 4HZUA 5ALYA 4F2HA 3LPMA 2IYSA 2AWNA 1NAIA 3B78A 5AKJA 1VJ0A 3P94A 1XZAA 3IJ5A 4XGQA 3RNLA 5KX5B 1DRWA 2O1EA 2EVWX 4F4HA 3UOGA 5GONF 1N8SA 3PEWA 2BT4A 1F7VA 4OHKA 2BD0A 2VPPA 5DLDA 5FBRB 4XDHA 1EDOA 4QQKA 1PZNA 5C7LO 2V65A 3AUKA 2A7QA 4ISCA 2HLDA 1XA4A 3DR5A 3PQDA 4IPTA 2PGDA 4M87A 3D6AA 1KARA 3I9V6 4KX5A 4WOKA 5BT8A 1AVTA 5JMWA 2FW7A 2XB8A 5JS8A 3ZXUB 2H16A 3FNIA 3V4FA 3RYHB 1PFQA 2Q5IA 3CNEA 2JBHA 3CN9A 1KFCB 3K5IA 1IC6A 3H5OA 4Q4DA 4TS3A 1FYWA 2A9KA 4TV9A 3UMJA 2V0GA 3HXLA 3E8MA 4GZMA 4BIIA 4IH4A 1F3OA 4UARA 5GJBA 2ZSDA 1DKMA 1JN0A 3FLEA 3IEIA 3LAWA 2I87A 3GJ7A 1P91A 4FFRA 4J75A 3WNVA 1ZQ1A 4WEOA 4AJLA 2HIGA 3OWOA 4WVLA 5DV9A 4DMRA 3KVYA 1Y8ZA 4BLVA 5K0EA 3DE7X 5BQFA 3NB0A 1UH5A 3NCHA 1RHJA 1A7AA 5KAMA 3N2NA 3S1SA 4NU5A 5LQSA 1XZFA 3VZCA 1KZ6A 4TYWA 1N6OA 1UXIA 1PIWA 3I39X 4MS4B 5I48A 1K5PA 1K27A 2RAUA 4QYXA 2GCIA 4Q1FA 5L95A 1X7YB 1HTWA 1VJDA 1YBVA 3JPWA 1ZI9A 3Q0IA 5EIBD 3ZVKA 1AKRA 1Y1SA 3U9LA 1BWRA 4RULA 2ISCA 4RFVA 2VJBA 1V9LA 2GJAA 3HYSA 3LE8A 4OLAA 1QZUA 1SG9A 2ZEJA 4P7BA 2C4TA 1G20A 2JD1A 3NORA 4K03A 3T7CA 3H5IA 2OP1A 1P39A 3VR4A 4LJ8A 4CLRA 3KQWA 4L3WA 2D6FA 1MXFA 4OD0A 3IHTA 3LQQA 3AERA 2ETXA 4ICIA 4FFSA 4URUR 4V2IA 4FR0A 4WCDA 1D4FA 5IARA 4D0SA 5JJKA 4QUEA 4QOIA 3EB9A 3DNMA 5EESA 4PNEA 1GPJA 3E05A 1FVXA 3NU1A 3BS4A 1UPAA 3N5CA 2HNBA 1IJEA 2REBA 3AGQA 4OQMA 3V2UA 2IY8A 1XQ6A 2GOYA 2XUKA 4L0CA 2JLAA 5HX7A 2XCQA 3R3VA 3PJRA 3NHPA 2AXEA 1E0SA 5JJLA 2ZVQX 1JJAA 1ZK3A 2LGJA 2XQVA 2WFMA 1Q77A 4MQ6A 1KPHA 4QXMA 2BM9A 3WAJA 3GPDG 1HG1A 1WXQA 3LWZA 3G89A 3FJOA 5FTKA 2ESRA 4YJ3A 2XWPA 4CJXA 1S8AA 1Y6ZA 2Z04A 3L93A 1V11A 1G7TA 4GMGA 2D4HA 4N40A 4PG7A 1AK1A 3VV3A 2RAVA 3QF4B 2DQ4A 3K72B 4BY9E 3R5HA 2GZ1A 2DFVA 4UFNA 2IYAA 2ZANA 3E48A 3EQ9A 2W0SA 2C1XA 5JZVA 3CSDA 5JSZB 2WNIA 4NH4A 4NE2A 4A0FA 2O5CA 1ELOA 1Z2DA 5AOCA 1PL8A 1UPTA 3NRCA 3TE6A 3ESYA 3QPAA 3DMPA 1GP2A 4WMLA 3VDQA 3ICCA 2X0DA 3AB8A 1E98A 2HYDA 2TMDA 4Q1VA 5C32A 1FLDA 1R7RA 3DBHB 1BE6A 3CH5A 3MYRA 3P2OA 3QHAA 4MUBA 1FLNA 1T0BA 2QRKA 2WDZA 5DCLA 4CF3A 4F46A 2AKYA 4Z9AA 3ZE0B 1SA0B 5HF5A 4DMCA 1P19A 1GNRA 5FCDA 3R7NA 4MUFA 3ZHVA 1KXJA 2NAFA 2BI4A 2EW2A 4HY3A 4A3SA 5HVNA 1LSUA 1UMBA 3CKYA 4WJZA 3QBVA 1NW4A 3PYXA 3CVWA 4J0CA 1VLZA 3PD1A 1SM4A 2EWMA 3RC1A 1OWOA 2XDQA 3BBLA 3GEIA 3KSUA 3TEMA 3TEFA 4EY7A 1JPJA 2ZAGA 2J9RA 3L3BA 5LB2A 3QOYA 3BRWA 5LZ8A 4XGRA 4AMZA 4MA5A 1TECE 4WXEA 3SI7A 3DS8A 5IG2A 2J7PA 2BKLA 1ZD9A 4M9XA 4TROA 1UJMA 4X00A 4DJAA 3S68A 1NFRA 5IT4A 1V6SA 2Y1CA 4FCVA 4IL5A 2WHQA 1CZOA 4JI0B 1KRXA 1SC1A 2FFBA 4ZAFA 1Q7CA 3H7IA 1AHIA 3DD5A 5CM2Z 4E5UA 3VR5D 3MRXA 1F0PA 1LRJA 1YJ5A 1RVV1 4EPXA 2Q41A 1SK9A 3OX4A 4W99A 3W4JA 1FMJA 4BWGA 5FPYA 1JMKC 2IYOA 4L8VA 4ARCA 4L15A 2UUOA 4MLZA 3LM8A 4FHCA 4WOJA 4URFA 3BXZA 3KZVA 1ECJA 2LE0A 4JUAA 4MGEA 3AL3A 3W2IA 3EIFA 3CM0A 4TUYF 1GUZA 2VTEA 3DHVA 2IXFA 1O4VA 5AK0A 2P6MA 4CPDA 2X9LA 1CS0B 5AKKA 1T9AA 3EFOA 1THGA 2HQRA 1EUYA 3BGOS 2J33A 3BUSA 1J2YA 2ONYA 3WAKA 2GCNA 3BFVA 1A77A 2C2HA 4CV0A 5LP6F 4HRYA 1U0TA 3E1GA 1E6LA 3RUCA 1WB9A 2Z6UA 4JU8A 3BOSA 2C8JA 2DY0A 2I4NA 1ZJZA 3U3DA 1J6UA 3RV3A 1H3EA 4EQ6B 4L28A 4ZJUA 1K0UA 1RC0A 2GN4A 3A1WA 3CLVA 3ZS9A 1YCGA 4G8CA 4LE0A 2EZTA 2Y8EA 1HZZA 4RLHA 3V4PB 1YR1A 1KJJA 4XRRA 5JS7A 4MR8A 4W5JA 2YJZA 2H11A 3E03A 4KR6A 1ODKA 4P5PA 3O8BA 2JIOA 3TKAA 2J3QA 2GVNA 2QD1A 5HR5A 4U2FA 1WHSB 4GPZA 4TS1A 2P9QA 2I9KA 4FM9A 4OX9B 4B71A 3BH6A 1OPXA 1QM5A 1XNHA 3ABSB 1M2KA 3GAMA 4X1KA 2FN9A 1UAGA 3R0JA 2A88A 4MV7A 4DY6A 5KOJA 1L8QA 3AFOA 2YZGA 1LK5A 3B7WA 5KYKA 1OY1A 1YQGA 2ZI9A 5CDFE 1R5JA 1KVUA 2C3MA 1DNPA 1WSAA 2D06A 2F64A 2OHFA 4FR5A 4M8NE 1AXEA 4R1TA 3BB3A 4P3NA 5EZSA 5BUZA 4H3VA 3M0EA 1TIKA 4KLCA 3TR6A 4KU4A 1GZ3A 4DR5B 4P98A 5H68A 3IUMA 4DT1A 2GPAA 3NFYA 2PLAA 1SVIA 3R6TA 4IDOA 4REQB 5FLEX 5GONB 4YHHB