3Q7QA

Crystal structure of rad g-domain q148a-gtp analog complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
146
Chain Sequence
b'SVYKVLLLGAPGVGKSALARIFGGVEDGHTYDRSIVVDGEEASLMVYDIWEMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
molecule tags Signaling protein
source organism Homo sapiens
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
total genus 47
structure length 146
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q7qA00
1G19A 2WJHA 2Z4RA 4PZZA 4ZIRB 2YHSA 4KJZA 2P65A 3C14C 3RAPR 4B3DA 4B44A 4BLQA 2GVZC 1GILA 2QSZA 2BHRA 4WVFA 4FMCB 1ZUIA 1AZTA 1KI4A 3V4RA 1NKTA 1NN3A 1E2JA 2C03A 3PEUA 4PAMA 1KJZA 5AUOB 1KO1A 4M1SA 5J4YA 3IUYA 3AVWA 1KMHB 3CB4A 4GOXA 5EZ6B 2OFWA 2EQBA 5J4HA 3TH5A 2VSOA 1KDPA 1FOEB 1W5SA 4KHZA 1KI6A 3CF2A 1XMVA 4S35A 1MO6A 3FTQA 1KZ7B 2D7CA 3QXHA 2CLSA 4DCVA 1WRBA 4H9GA 1IJFA 5EP1A 1ONBA 5DH9A 4A2PA 3EPHA 4V02A 3L43A 3QEOA 3K9HA 5EE3A 4U5XA 2H1LA 1VYVA 2ZYUX 2CE2X 5KYKA 1XMJA 3ZH9B 4OKSA 3CRVA 4F38A 4ZCMA 3J81k 1N0VC 1NG1A 3B1WA 1OHHA 1N2CE 5BWMA 4RFSB 1GITA 5JBQA 3BB1A 2OUKA 3Q72A 2QENA 2VLIA 4DEXA 3FVQA 1D9XA 3QJYA 2CK3D 1S3SA 2V1XA 5SZHB 5BN5A 1RFLA 3RRNA 1BS1A 4LHWA 1LF5A 3AVPA 1KI2A 3VTKA 4JL6A 3ZS8A 1D2NA 5JWHA 2HEIA 3W6PA 1UDXA 2XX3A 1XEWY 1R0YA 4IKEA 1MABA 3U3MA 1JNYA 2R6CA 4KFUA 2G1JA 4R2HA 5DN6D 3CNNA 5JI3E 1ZC3A 1JR3D 1FMJA 2P0EA 2QPAA 3OIUA 2V6JA 4JLPA 5IDVA 2FU5C 4V0OA 4D6PA 4KXFB 2IW3A 1XPOA 2ZS7A 1QHGA 5DGXA 3IEVA 3NBFA 1ZUHA 1KNQA 3IPYA 4LV5B 5J4LA 1ZD9A 4DXAA 2OXRA 4G1UC 3VFDA 4AURA 3KTAB 2XOKD 4Q01A 4GPTA 3PUZA 1WE2A 1Z0FA 2ORIA 4M9QA 1DARA 3LNCA 4RD3A 3SR0A 3KKOA 3UWKA 3O8RA 3IO3A 3KUCA 2K5UA 3U2QA 1GTVA 4Q9IA 5CIWA 1II9A 2I1QA 5C18A 1W49A 1YRBA 5KOYA 1U94A 1W0KD 2JLRA 1T8UA 2REBA 2VHJA 4PC7A 3NBYC 4QNRA 4US2R 1G8HA 5FBLB 3BBPA 2VH5R 1UDWA 2VYFA 3NTUA 4LJ4A 3B82A 1N5IA 2B8TA 2CCGA 3X1DA 5CLLA 5KDOA 4WXPA 4BLOA 3KQLA 3U44A 4C0JA 1KGDA 2ZRBA 4IXNA 2A5GA 1EFTA 3OESA 1E98A 1NI3A 1ZRHA 4OHZA 3FDIA 3THWB 1G1MA 1OH6A 4BEBA 2VPPA 2FEMA 2OCAA 2ANBA 3B78A 4DLTA 3GPLA 2JGNA 1OKKA 5HZKA 3H0KA 1GKUB 1GL7A 2GXUA 3K0AA 1LVGA 3VKWA 4XVUA 5FTLA 4TSFA 4QGGA 3F5FA 3U4QB 4GOKA 2ZJ2A 1IN7A 4TQ9A 2JLZA 1F48A 4PQFA 3T06B 1AM4D 1WA5A 2C98A 4UNRA 2W83A 4N1AA 5H8WA 3A37A 2GF9A 4EFNA 3FKQA 4KCGA 4BPBA 3BC1A 3EIHA 2ZYTX 4URXR 2V3CC 2W58A 2BBWA 3IIJA 1Q22A 2GXSA 2QA5A 1HTWA 4O2LA 2IYWA 4DVGA 2ZRGA 4DDWA 3NEJA 4TSFD 1KJYA 5DISB 2D06A 2ERXA 1E2FA 4CEIA 3TRFA 4JIMA 3UXMA 4AKIA 1G18A 3EC2A 2AK2A 3RRMA 1H8EA 1YR7A 4TL9A 4FN5A 1S9HA 3HP1A 2JLVA 3WP1B 1KKLA 4MGYR 4BEJA 4WBSA 4O3MA 1Z0IA 4IOKA 3AKYA 4RZ3A 1E0KA 1XJQA 3KFXA 1J90A 3EA0A 3CX8A 1M2OB 1US8A 3OFNA 1TU3A 2ODBA 2OBNA 1D9ZA 1ZM2A 2ASEA 4X8HA 1J70A 1QBKC 5LB2A 1NVUQ 1U90A 3C8UA 4GZLA 221PA 4F4IA 3AP2A 3RRYA 2A78A 5EP4A 5DHAA 2C9YA 1IQPA 1AS2A 4MKFA 4GFDA 1RRCA 1NN0A 4Q7LA 2QGNA 3VR3A 2XITA 1XF9A 2Q3MA 1R0WA 4EPRA 4Q5IA 5EXXA 4WZ6A 5JSZB 1OXTA 1N6HA 1SHKA 4M9SA 1DPFA 2FDCA 4OI4A 2RMKA 4Q19A 2VSXA 1IXZA 1UF9A 1V5WA 4LJ6A 2QRNA 4QJ5A 3GLIE 4A6XA 2FFAA 1J8MF 3D8BA 4X8LA 1EXMA 1A7JA 2CNWA 2WMNB 3TAHA 3NDPA 1VG8A 3FGNA 4B3FX 2YOHA 1DELA 2ZRCA 3MFYA 2G1KA 3B9PA 3BIFA 2VEDA 4FMCF 4DCSA 3ZVMA 1ZUNB 1W4CA 4X8OA 2YZ2A 3Q7QA 4BZXA 4M1MA 3MCAA 3OIWA 1S2MA 2J45A 4B32A 4MGKR 4UNPA 1ZNYA 2N1BA 5FUYA 2V9PA 2AK3A 4M2LA 4BGDA 1OHHD 1J99A 4MUBA 3TUJC 2WJGA 1DVRA 3C16C 3PVSA 3T34A 1KIMA 1AQUA 3U3JA 2PT5A 2ZSDA 4OQLA 4KFSA 4URUR 2RCNA 4U00A 1AS3A 3QENA 2OCYC 4JS0A 4Q9HA 4EQ6B 1WP9A 1CRPA 1KZGB 3ZIAD 5UKDA 1KTVA 3WRYC 1Z8FA 2WZQA 2IYQA 3LD9A 5D3QA 1GKIA 1SZPA 1RJ9A 3AKEA 4HB4A 4HYYA 4QJ4A 4IEEA 1TQ2A 4PFSA 5DN6A 1NBME 2ERYA 1EWRA 4PQYA 3NKVA 1N6KA 2BIFA 3IQWA 2HCJB 4IFBA 2UZIR 1E2KA 1ANKA 2DWPA 1NN1A 3ZVRA 3RYTC 2OLKA 2PEYA 2WBLC 3GJ7A 4DLUA 3CPEA 2CCJA 1T3HA 3GEHA 1TU4A 2HYIC 3X2SA 3A1TA 5GADl 3QUSA 4P32A 3RC8A 2YVUA 3WNDA 3EZ9A 2ZI9A 4Q7JB 4HI0E 4W7SA 4HZUB 1G3RA 2G0NA 2QP4A 1FW6A 3H1TA 2G83A 4QL3A 3NC0C 2BEJA 3M0EA 5A5GA 2WWWA 4NKRA 1E94E 1OXXK 4LUCA 5HTKA 4DHEA 5CB8A 4MRPA 1NBMD 4EKDA 5CDFA 1YR9A 3SZRA 2FG5A 4TLCA 2IXGA 3AF1A 3IHWA 3RC3A 3REFA 1MH1A 4GMDA 5G53C 2LKDA 2XXAA 2KBEA 1CR2A 3BH7A 2J87A 1U8ZA 4KVGA 4DLSA 5FR2A 2JLUA 1F2TA 2ZI5A 2WJYA 1R8QA 1YZUA 1ZAKA 4ERNA 4LJAA 1M7HA 3WBKA 4AYWA 2QBYB 2XGJA 1W36C 2QNRA 3QF4A 5H68A 1J7KA 3U44B 3IILA 5AJZA 3AVVA 2AFHE 4LYFA 3CX6A 2OBMA 2FA9A 3B2EA 4ZDWA 2W2TA 3VX3A 1G7CA 2IBMA 5DI9A 3KX2A 1XTJA 3T5DA 1F2TB 4K46A 2AWNA 2LCFA 1AJEA 2FJUA 2GCNA 1ZC4A 4P31A 1U9IC 3QKRB 2WTUA 3K9NA 1Y3AA 2ZSEA 4DRZA 1QF9A 3GCGA 2X2FA 4DCNA 4M1KA 4MKHA 2KI5A 2HT1A 1YVDA 1KI7A 2ZU6A 3K0CA 4Q4LA 2BWJA 5DLQC 3KL4A 2NO1A 3TSZA 2BKUA 1C4OA 4D4MA 2GZDA 1D5CA 3QXJA 4S2EA 1ESNA 1HEIA 1P9NA 1Q44A 2VQSA 3A1SA 2QG6A 3NBXX 4YDSA 2F3TA 4DZZA 5A4JA 3QXSA 2REXB 1VYUA 1IN4A 1KSJA 1QHYA 2F1IA 3DDCA 3QVUA 3T1TA 5DO9A 1JPJA 621PA 3ZS9A 1NVVR 4AG6A 4U7DA 4Q1DA 2QN6A 3AVUA 1DO2A 1IXSB 3EIQA 4EAQA 2VF8A 2XZLA 3U6BA 3HYRA 1RYHA 4N0DA 2XTNA 4EDHA 3HU3A 4GI7A 4DBLC 4B48A 3ZJYA 1R5BA 1HY3A 5FI0B 1L7VC 3BXZA 4JLAA 4KI0A 3A1VA 4PPQA 5EQTA 4A8JA 1CRQA 2NGRA 4TLBA 1N6NA 3RWMB 2QP9X 2PCJA 3LFUA 4OYHA 1TF7A 3DEFA 2A5JA 2CE7A 1IAQA 3LO5A 3KKNA 3VHLB 1KKMA 4TMWA 4NYIR 2MSCB 3SS8A 2A5FA 3TUZC 2XNSA 3OE7A 4GRAA 3RS0A 5EZ5A 2FSGA 2JJ1D 4OK5A 2RGBA 3Q9LA 2JIZD 3QVVA 3EW9A 1CS4C 1L4UA 1R7RA 2IHBA 3WRXC 3I73A 1K8RA 3VKGA 4UXJA 4OQFA 1Z06A 1XZPA 4YMSA 4IHQA 2W0MA 4MA4A 1CEEA 2QPTA 4O2RA 3VR2A 5CDFE 3SBDA 5FOSA 1X8LA 4XJXA 1YZLA 1Z29A 4QBFA 5IHPA 5DE3A 2ECKA 1G291 1MO3A 2EU8A 1HQYE 4HAVA 5CLQA 4HAZA 5SZIA 2GCOB 4YMTA 1UKYA 4MITA 3AV0B 4IDNA 4ASUD 4ZO4A 1GRQA 4Q1EA 5AJWA 4D82A 4EPTA 1DAFA 3I3SR 4DSNA 1JXMA 2TMKA 1GKYA 3H86A 2CMKA 3PITA 4ZI2A 3B1VA 2WWXA 4I1VA 3QF4B 2WWIA 2ZIAA 5AJXA 1TTTA 1G3MA 1HT2E 1DTSA 3B8HA 3VKHA 4NCKA 3ZIAA 1ZM7A 1IHUA 1P2SA 2FSFA 3CRMA 2HJVA 4DT1B 2ZM5A 4C7OB 2NZ8A 2AKYA 5G3ZA 1XNJA 1H8HD 1XBTA 3I8XA 1IM2A 3Q5DA 3C4JA 5GJVC 2RGEA 1Z6GA 2P6UA 1IN5A 3NWJA 4CYMA 5JWOA 2DPXA 4BZPA 3FMPB 3LBNA 5KTYA 2F6RA 3BGWA 4D80A 1GWNA 2QU8A 1TQ6A 1W2GA 3IGFA 4LI0A 1W2HA 5DI3B 4ZKDA 5J47A 3SQXA 4FINA 2D7DA 1P9RA 2NZJA 2QMHA 1OJLA 3VU9A 3BFVA 2IXEA 4H1VA 1G4UR 3CZQA 4DLVA 3K0EA 1K5GA 2DFNA 4MQBA 3VQTA 3RS7A 2A5DA 3PEWA 5FPKA 2GJSA 3KJIA 1T9HA 4IOMA 1Z28A 2AFIE 2RB4A 5KSZA 1YR6A 3R7WB 2OSBA 1Q3TA 5EE0A 4N0EA 1SHZA 3EZ7A 4ITRC 1M1YE 2Q21A 5GJCA 1XU4A 2D2FA 3MWLA 1EWQA 3LWNA 1PVOA 1F2UB 1GL9B 4BFVA 3R9WA 1G3UA 4CVNA 3GLIA 1BIFA 2RGNC 4Q7MB 4CT4B 2FF7A 2QY9A 4MYTA 3R8CA 1E79D 5IF9A 4X8MA 3R20A 1XTIA 4RVCA 2ZE6A 1MV5A 1NIPA 5B58C 2ZXUA 4LY6A 1OFHA 4DDUA 4V0KA 2ANCA 5F2EA 4M4SA 2SHKA 3CNLA 1XEXB 2UKDA 4KSCA 1Z6AA 1I4LD 3H84A 4NH0A 5KSYA 1E6CA 2YWHA 4QRHA 2EYQA 1XB2A 3C5HA 4Q4AB 3IDQA 4KVAA 5EJEA 3CR8A 2R8RA 3A6PC 2W00A 4GSYA 4C0HA 3EASA 1G5TA 2E1RA 3RRZA 4BLPA 4JSTA 3MGCA 4RCYA 2YOGA 2OBLA 5HE8A 4I1UA 4AC9A 1YHNA 4C0BA 2J0UB 2B6HA 3V4FA 1G7SA 4CEJB 4OQNA 3VR4A 2FGKA 2QQEA 4PPFA 4TWZA 1XMIA 3F0TA 1XD2B 4D4JA 2GNOA 4JKIA 5K8IA 4QXAA 1QHXA 4A2QA 4HSEA 5JHGB 1T5IA 2A30A 5JLJA 1CJMA 2ZJ5A 3AM1A 1G3IA 4ZV4A 1CLUA 1XZQA 4EIWA 3ZVNA 2EW1A 3ADDA 3W8NA 5JWRA 1YZTA 1GM5A 2UZ3A 1KMQA 2ZRKA 4BFZA 1EG7A 3I32A 4F4JA 1OF1A 3U5ZB 3KFVA 2Z0MA 2XOKA 2O8EB 3VNVA 3DMDA 4G5QA 2XJ9A 2UVQA 2IEZA 3W3ZB 5GVSA 2EVWX 1X1RA 1OE0A 4JLOA 3GLHE 1BMFA 4ZKEA 4KAXA 1G8GA 1N6IA 2X77A 3AGQA 1SVMA 1KMHA 3U7EB 2ZRPA 3D6TB 2P2LA 4R9UC 2O52A 4US1R 1ZM3A 1IOZA 2R62A 2IYLD 4CDGA 2XTMA 1KAGA 3I5YA 2NO9A 1XD9A 5H70A 4L4UA 2V6IA 4W5WA 1E1RA 2IYSA 5EP2A 2QT0A 1H8ED 1E9AA 2ZAOA 4OK6A 4XWKA 1VG0B 2BMEA 4LOAA 2GTPA 1M34E 2BMFA 2IS1A 2ZI6A 2J7PA 2ATXA 3FKSA 4PANA 3ICQB 2GESA 3RANA 4L16A 4RZUA 1OB5A 1NLFA 4AYTA 5JZVA 5K8TA 1VECA 1Z07A 3PUYA 4AI6A 3U60B 1NG9A 3GLGE 3P20A 3TNFA 4KV9A 1WDTA 4JMPA 2DFTA 1YQTA 1Z47A 3MWYW 3GLFB 1K6MA 1U9IA 1KDTA 4A8JB 1R2QA 4PHHA 3ADBA 5JEDA 4QHYA 4PX9A 3K70C 3F3YA 4JLMA 4WW0A 2YWFA 2KBFA 2QTVB 3QE0A 5JJIA 4Q1FA 3FMOB 3B85A 5F3WB 3K0CC 3CW2A 1KSGA 2D2EA 3W9YA 3K09C 5CM9C 5EUMA 4LPKA 4P33A 4BLSA 4UXIA 2H57A 3CF0A 1L8QA 2P5SA 3BD9A 5B30A 2JJ2A 2FN4A 4JT2A 4TN1A 3GJ8A 1RW4A 2C9CA 3AVQA 3FHCB 2FPMA 1YZKA 2ZREA 2OAQ1 3KXIA 1JQJC 1E9RA 3ASZA 5DHFA 4MUAA 3KQNA 4BQSA 5EE9A 4B3CA 5AJYA 2J1LA 1W4BA 2AHOA 2VTKA 1FQKA 3SJCA 3WYAA 1G41A 2J46A 2Z4SA 3N2IA 2ZYWX 1JBKA 5CK5A 2WPDD 3GQBA 3QI2A 4URWR 5FOWA 4HATA 2CHGA 1NP6A 3OEEA 1UFQA 3RNLA 4TLDA 4WZBE 1RPZA 1VCNA 2AD1A 1YJ5A 3B1XA 4LC0A 1XP8A 4KFTA 3KJEA 1P6XA 2I1VB 3VR6A 4HDCA 1QDEA 1JB1A 1FTSA 1XCPA 2CHQA 3A36A 4NYJQ 2NPIA 4PO9A 4ACBA 2CLCX 2VP2A 2DHRA 4V0LA 3BH0A 3ZZUA 3SN6A 2OFOA 4A82A 1R6BX 2WWYA 4C7OA 2O8CA 2CJWB 3RHFA 1E1QA 4XOIA 2VHQA 1XFAA 2W6IA 1DOAA 4ESHA 2A2ZA 2GWHA 3KJHA 4FXPA 2IF2A 4Q4AA 4B75A 3THOA 1KNXA 2X2EA 1CJKC 3LRPA 3FWYA 4PQRA 3K8YA 2Q0HA 1CR1A 3LVRE 5CITA 5JEEA 4L8GA 3Q85A 2OHFA 4LBYA 2WJIA 2QL6A 4O0MA 4GMXA 4KFRA 2O8FA 2RGDA 3X1YA 2WICA 3U7GA 1G8YA 1U81A 3LXXA 4OBEA 4AK9A 1F2UA 2PMKA 4NMMA 3PFIA 4PPNA 3U3RA 3AF4A 2GK6A 2IYUA 2G3YA 1DG3A 3BJIC 5LB4A 3W6OA 1FX0B 1E79A 2YOFA 3K1JA 4Q9KA 4B2LA 4I81A 2CHVA 3O8CA 2GBLA 3IPXA 3EIEA 1ZCBA 1Z2CA 3CRQA 3ETLA 5EP3A 5TMPA 3BE4A 3CM0A 3ECCA 1ZM9A 4QOSA 1NSTA 3A58B 3NHAA 2V4ZA 2ZR9A 4KSBA 4U02A 1B0UA 3LV8A 3GLHB 2J5XA 4D81A 1CXZA 3B60A 4G5OA 1OPXA 2NO6A 1M7GA 4JLJA 5JFGA 3TAUA 4GP7A 1R10A 2PT7A 3P32A 1N6RA 4HAUA 2VIIA 5F9FA 1GUAA 1NBMA 2RHMA 3I4LA 3PV0A 1P73A 2H17A 2PLFA 1S1CA 1BYUA 1VIYA 2I3BA 3L82B 4YMVA 4UXHA 2C96A 3GFOA 4IRUB 1LTQA 1TNDA 2Q9CA 1WMSA 1SVOA 4KODA 1YZGA 4HLQB 5FOVA 1HYQA 2MMCA 4JVMA 4QHSA 5L8VA 2O8BB 1XD2A 2GRJA 2IL1A 1BH2A 4JLDA 3AUYA 1Q1QA 5FFMA 3EPLA 2EFHB 4HZIA 3TQFA 1L4YA 1DAKA 4KBGA 1EX6A 2HJGA 3AKDA 1WB9A 4QJ3A 2KWIA 4GP6A 5CIQA 4TYYA 5KNDA 4UQOA 1ZD8A 3DVLA 3M1IA 3THYB 4MKIA 2OILA 2OG2A 3LBIA 5FBRB 1GL6A 4PC1A 4BUJA 4AY2A 1R4AA 4FIDA 4LPSA 5JJKA 3QXXA 3GP8A 3GLFA 2VP0A 1X86B 1NVXQ 1NF3A 5GJWC 3SC3A 3LX5A 1CJUC 1YR8A 1U98A 4A2WA 1E2HA 1QVRA 4P0TA 3HR7A 3RVBA 1CJVC 1N3BA 1SXJC 2QZ4A 4BLRA 1GG2A 4CIDA 1PUIA 1P4SA 1KY3A 1UADA 4PXAA 4EFMA 4B2PA 3MMPA 3CPHA 1QG2A 1OXUA 2ZSFA 3FPAA 1W36B 3OZXA 1NMZA 3CWQA 2AL7A 3W5IA 4HAXA 4Q03A 5TXGA 3GLGA 4PZLA 1D6JA 2E87A 2KJQA 1Q20A 3ZLJA 2BM1A 1XTQA 5SZKB 2HF9A 4KBFA 2WJVA 5FL7D 2O8EA 1IBRA 3BRWD 4FI3C 3PUXA 4AWXA 2YWEA 1UKEA 2O0KA 3NDBB 4WA7A 3TVDA 4LJYA 4CEHA 4V0NA 3I1FA 1P61B 1P5ZB 3G82C 3EX7C 1TL7C 2EWWA 1VKJA 3PR1A 3LLUA 3LDAA 3U61B 2GILA 2GBLC 3MAAC 4XH9B 4BFSA 1L2TA 1SQ5A 1JALA 1NRJB 2W2XA 1IXRC 4UJ5A 3A4LA 4JBYA 4L9SA 2R6AA 3EZ2A 2QE7A 4RZXA 1XPRA 2GJ9A 1P2VA 2BMJA 2WKPA 5EUQB 2V54A 4TQAA 1ODFA 3HPRA 2GZHA 4CEJA 4ZCIA 2JJ2D 3AP3A 4KYUA 3VHXA 2XB4A 2X19A 4QGHA 4TL7A 2QUZA 2LWIA 1NIJA 2GEUA 2JIZA 5C4GB 4B35A 2OE2A 2PBRA 1UJ2A 2GJKA 3UIEA 4LV6A 4I1SA 2O8FB 2WM9B 2XSZA 3PQCA 4NHOA 1LS6A 5BW8A 1E4VA 1LW7A 4LHVA 1SKQA 3HU1A 5JECA 2WHXA 5D3MA 4WIAA 1GNQA 3WMGA 2FOLA 1G5PA 2VO1A 5IT5A 1XD8A 4I99A 1JR3E 5KDLA 2AR7A 5FTKA 2AX4A 3UANA 2O8DA 2FSIA 2ZR7A 4C3ZA 2IUUA 3E5HA 1F3OA 4Q02A 1Z63A 1FFHA 2PCLA 3ICEA 4XWOA 4LWZA 4LYHA 1QHHB 3M4YA 3WNBA 2DWQA 4BZQA 4JT4A 3RLFA 2F7SA 1A5TA 3SU8A 3DZDA 3IIMA 1GRRA 4M1WA 2O8CB 2EFDB 1S0UA 2JDID 2W6ID 5KPJA 3L0PA 4QBHA 3NG1A 1FQJA 2ZYVX 1BKDR 1EFRD 1NN5A 2GJ8A 3TR5A 2DR3A 1Q1EA 5FR1A 5E4FA 4OHVA 4E03A 3QIAA 3S1AB 2ZI4A 1E2GA 3SNHA 2WV9A 3VAAA 1EX7A 1PLKA 2IS4A 1Z5ZA 1ZCAA 5DYIA 1BOFA 1R5NA 3CRRA 1Z83A 3L2OB 5BYJA 4PSAA 3OFND 1T4GA 3EZ6A 1W36D 2QM7A 4RSGA 4QKQA 1KAOA 2J0VA 4DIDA 5E7JA 3OIVA 3X1XA 4L9WA 4OK3A 2JLSA 5JS8A 4DIEA 2QRZA 4R7ZA 4BFTA 2ZS8A 2CL0X 2ZE5A 3KKMA 4QM6A 2ODWA 3TIFA 2OFXA 1ZNWA 1GFIA 4OI0A 1VDZA 2D74A 2WKQA 3CR7A 3U3OA 1KSHA 4QFMA 2GEVA 1N5JA 2OEPA 2NMVA 2IWHA 3ND8A 1IN8A 1W44A 1G6HA 3N5CA 3GJ0A 3Q3JB 4JJKA 2VHUA 3CWZA 1QHNA 1SVLA 5E3HA 2OXCA 4QG7A 2ONJA 2ZRDA 2IYRA 2XZOA 4PHTA 2C78A 2ZU0C 5LBIA 3TE6A 1A82A 3BK7A 3DHWC 2ZE8A 1KO5A 1TF5A 4JL5A 1TX4B 3D31A 5FBVB 3WMEA 5FI1B 4LJ5A 3GFPA 1VIAA 4M21A 4PR0A 1I4DD 4XTRA 4B3GA 4B3XA 1ZIPA 2C9OA 3TSOA 2ZROA 3NC1C 4EJSA 1G21E 1KK0A 1ZNZA 2J3EA 4ZI3A 2O8DB 4DC9A 1JAIA 4ABYA 2EFCB 5HCNA 2Q6TA 3MJRA 5JRZA 1X8KA 1CULC 4LRWA 5L3SB 1PZNA 1U2RA 2NTYC 1PJRA 3WMFA 4GBMA 4FCWA 4C30A 1LV7A 1P75A 2QAGC 2O0JA 2ZRAA 4MRSA 4E09A 3LW7A 1VCMA 1X6VA 3CLVA 4Q7KA 4TMTA 4UNSA 3B5JA 4GDFA 2OT3B 1ZD1A 5J4KA 3UATA 1W48A 4A15A 4D2IA 4NCJA 1O3YA 1KHTA 3GJ6A 3CPJB 3I8SA 4V0ME 3CBQA 3LH5A 4IDPA 4PZYA 1N5LA 4LZZA 4V03A 4B74A 3LX8A 5AR1A 5EXSA 4AKGA 4ZPXA 2CEAA 2ZRJA 4CW7A 2NIPA 2CK3A 3GMTA 2ZSBA 2ZS9A 3MSXA 1Z6TA 1T0JB 2RAPA 1KI6B 5E7MA 2R6FA 2IA5A 1E2MA 4Q4HB 1X8JA 2X1VA 4TLEA 1SXJA 4HDOB 2KSQA 2ZEJA 3GJ5A 4PPGA 5CJPA 3TR0A 2ZJZA 2WAXA 4QGFA 1XDBA 1GSIA 3NXSA 4DWJA 2Q9AA 2ZRNA 1UEIA 1KOFA 4JVSB 3K70B 2IS6A 3K0FA 2BMDA 4Z8XA 5ELXA 2XJ4A 3I5XA 1P2TA 2W6JD 2C99A 1E2LA 1XJCA 2PEZA 1G5RA 2RGNA 2QAGA 2QGZA 4I4LA 1COWA 3UKDA 4D0GA 4HZUA 4Q18A 3KZ1E 1P62B 3NIBA 1RC8A 1QHIA 2WKRA 1JR3A 4DLXA 1YE8A 1W5TA 1S9DA 3C15C 1DE0A 4PAOA 3SDZA 3EZFA 3QKTA 1CR4A 1OFUX 4GOJA 4JLKA 4LJ8A 3RSLA 1G8FA 4PAQA 3SJZA 4OQXA 3IHLA 4ZIRA 1O87A 3VR5A 3THYA 4DCUA 1FZQA 4A9AA 4K81B 1A2BA 1JAHA 2KE5A 3OAAD 4Y0AA 1P3JA 3CONA 4YXWD 3BH6A 2HXYA 4ARZA 4UNNA 1T3SA 3HDTA 5J40A 2VRWA 2VA8A 1HE1C 1PLJA 2WOOA 2OM2A 1G8PA 4IVPA 3BOSA 1XJ0A 2QMEA 2QT1A 2F1JA 3TKLA 4LX0A 5TARA 4MH0R 4AG5A 5K8LA 2J0SA 1U0HC 2GXQA 3I62A 1G20E 1KI1A 1YKSA 1DAGA 1MABB 4XVRA 5AUNB 4CZ2A 4EJSC 1GRNA 4B6EA 2FZLA 4NPHA 3CNOA 1MKYA 1S8FA 1ZINA 4C0SA 3SJBA 2XTZA 2ZPTX 4JSYA 3TBKA 3AH8A 1D2EA 4B33A 2CVFA 2IXFA 2IHYA 3RS4A 4DLYA 4LJ7A 5EXPA 3K09A 5J4VA 3ZD7A 1UBEA 3B6EA 4D26A 2CXXA 4A6PA 3EA5A 1OH7A 2VHTA 1LS1A 3U7HB 1ELOA 2ZR0A 1Z6XA 2G6BA 2MSEB 4TZ0A 3TUIC 2GAAA 3UMSA 1N25A 4IJMA 1JEDA 2XNDD 3H4MA 3BORA 1Z2AA 2V7QD 5C1BA 2V8OA 2YJTD 3OEED 2AD5A 1E9EA 3I72A 4DDVA 1XTRA 4Q1CA 3T15A 4JYCA 5TY0A 3REGA 1CBUA 3P26A 3RWOA 3BS4A 3HPQA 4WZAE 3U3KA 4B43A 4IDOA 4B71A 2P5TB 3GJ3A 4OJQA 5E7IA 2BM0A 4F4CA 1N6OA 1CJTC 2QORA 4OQMA 1FX0A 2HF8A 2GAOA 4LK2A 4TTPA 4ILEA 1KSFX 1GVNB 1E2EA 1Z0AA 3EC1A 4BWYA 2HV8A 2BC9A 2FWRA 2YV5A 3T35A 2NQ2C 2RGCA 5D3MB 3QSYA 2Y8EA 3JVVA 3MRSA 4OHYA 1XXHE 3QY0A 1OXVA 3KTAA 1I2MA 1LF0A 2QQ0A 1LB1B 1G4AE 2RH5A 4D0NA 2ZUCA 1P2UA 4Q21A 1Q3HA 1EFHA 1Q21A 1NJGA 2WMOB 3AP1A 1S4QA 2F1HA 3JVUA 2QBYA 2PZGA 1KO7A 4PC3A 2PMDA 1OIXA 3WXMA 3ADKA 5FUWA 2VSFA 3UG7A 1VCIA 2P3SA 4A92A 1XMSA 4ZDIA 3AVOA 1JJ7A 4B47A 4F7WA 2WSSD 3Q7PA 2ODNA 5JRJA 3FHTA 2WWFA 2C2HA 4JL8A 3K0SA 4BRUA 3SHFA 4NL4H 5FBQB 3FMFA 4OHXA 4YDHB 1T91A 3CUEF 3DL0A 3L8YA 2DFLA 4QBIA 2J7KA 1WQ1R 2FX3A 4OJKA 1E3MA 3WYGA 1KYIA 2A9KA 4HLCA 1TF2A 4XSHA 4KITB 2GK7A 2ZRIA 1RZ3A 3AQ4A 5L3SA 2R44A 3MWJA 4IOJA 2G0TA 2C5LA 2RGXA 3SYLA 4GT1A 1KI3A 1SXJE 5J5CA 3K9LA 3FMIA 3QKUA 3EG5A 2ZJOA 3ZDQA 5AJVB 3AF3A 3MWKA 3QKSB 1E9DA 1XCMA 1XX6A 4G3XA 2Z83A 3VMFA 4CRWB 1IY1A 3A1WA 2H5EA 3WNCA 4MDFA 2W2VA 3AEZA 5TV2A 5L3VA 1HH4A 1NLZA 4RFSA 1JJVA 1KK1A 1DS6A 3RDPA 4R71A 1KY2A 1AQYA 2IF0A 3BAFA 3NBZC 4C4PA 1NLYA 1X1SA 3QQ5A 3THXB 1QVAA 2FZ4A 3KQHA 2PZEA 5B57C 4DLRA 4QHTA 2RKOA 2O5VA 1E2IA 3ADCA 3ASYA 1E96A 1R5OA 5FPHA 4B2IA 2IYTA 2ZUDA 1C1YA 5KNBA 3ZQ6A 3ONWA 4B76A 4W5JA 4LBWA 1UM8A 1XRJA 4K8OA 2NO0A 4A0FA 5FL3A 4JLVA 1AS0A 3SBEA 4BLTA 1IJEA 2FEOA 2DCUA 2FFHA 5TB5A 4NU0A 4LJ9A 5G41A 4Q4JB 2J0QA 1KI8A 1PLLA 4M9ZA 3R8FA 3PIRA 4FCVA 2FMXA 3JZAA 1UPTA 2C8VA 1GNPA 2VP5A 3VR1A 4KLZA 2BBOA 3GLFE 4I1OA 3SI7A 1HE8B 1W0KA 4R2IA 4UKDA 1SVSA 2D62A 1S1MA 4TYPA 4O25A 3R9IA 1II8B 3SYNA 2HDNB 1YZQA 3N70A 1N0UA 1HURA 1HUQA 2F43B 1Q57A 2DBYA 1WXQA 3D7MA 3EWSA 1OV4A 3KB1A 2GVDC 3PEVA 1CIPA 4QC2A 2QAJA 3PXGA 3LW8A 4TMXA 4BASA 3L8ZA 3NHBA 3EARA 3B7GA 1Z22A 2NG1A 1K5DA 2ZAMA 4KU4A 1NVWQ 1RRGA 2L0XA 3ZQJA 3RABA 2WIBA 4PO8A 1LNZA 3FFBA 1SGWA 3MUFA 3BERA 4Y0VA 2P6RA 2WWHA 2JASA 3SJAA 4HLDA 2OZEA 3KQUA 2ZJBA 3SEAA 2ORWA 3QG5A 5M04A 3PEYA 2RGGA 2I4IA 1NY6A 1N6PA 1FPMA 3DMNA 3K0FB 1VHTA 2ATVA 2B7BA 4LBVA 2QE7D 2GETA 2J41A 4KO8A 4BFYA 3THXA 4JVNA 4EPWA 1JECA 5F9HA 4KLNA 2VP4A 2CL7X 4MKGA 4XTCS 1E99A 5DNYB 1OW3B 2FFBA 3CX7A 3L0IB 3L0SA 4L15A 1M7BA 3UPUA 2CCKA 2IYYA 2MMGA 1Z0KA 3IQXA 1T3LA 2WJJA 3FB4A 4FMDB 1ZW6A 5CYPA 821PA 5JJLA 4F91B 1ZIOA 2D4HA 2E9SA 4QBGB 1N5KA 421PA 3DKPA 1AKEA 3CH5A 4RCZA 1MT0A 4MYCA 1XEXA 3HJNA 1IY2A 3BB4A 4YXWA 2Q9BA 2DB3A 4JBWA 3D3QA 3KKQA 1TQ4A 4NDZA 4HLUC 2OCBA 3SHWA 3B1ZA 4Q9LA 2GKSA 1TPZA 1OKKD 5JMTA 3W3AA 2GXAA 4PTLA 4F93B 8OHMA 4BFXA 3ND9A 2JDIA 3KXKA 2VBCA 3C41J 3IIKA 5AK0A 4TL6A 3MG9A 1T0HB 3UMFA 521PA 4M1YA 3X1WA 2GA8A 1AKYA 3LQQA 1VCOA 3OEHD 3FKSD 2CBZA 3I61A 1X3SA 1ZVQA 2EFEB 3HU2A 3KKPA 5DYGA 4ASUA 5KUTA 3VX4A 4TMVA 3KDSE 4MRNA 1Y63A 5ANRB 3TQCA 4CF7A 1E0JA 4HB0A 2BKEA 2VP6A 3IO5A 3QPVA 3NEYA 4IDQA 1EK0A 4Q00A 4TYNA 1KDRA 1Z0DA 2OV2A 1G9XA 3QKSA 5G40A 1MRSA 4PC2A 3DM5A 1GAJA 4TT3D 1BYIA 3QPUA 2ZVQX 1E32A 2XSZD 3THWA 3T1QA 1KO8A 1E0SA 3SQWA 1P60A 2IYVA 3PUVA 1DO0A 1A4RA 1G3QA 2ZJAA 3FYHA 2OESA 1SVWA 5SZJA 5JHHB 3H2YA 1M6NA 3IKJA 4WOPA 2GZAA 2P67A 2V7QA 3FHOA 1ZJ6A 3TW4A 3U7FB 4GL2A 4HDQB 4A1FA 2OAP1 1G6OA 5AWFC 2BVNA 4R98A 5DSZA 3W6NA 4EFLA 2FSHA 1XEFA 1NMXA 2BJWA 1OYYA 2ZVPX 1LFDB 2AKAB 1OLOA 4PO1A 2H8KA 4JLBA 5TVKA 4B34A 5C4MA 4M1TA 1NMYA 4L5BA 4TT3A 3K9GA 4YQFA 4XWAA 2JLYA 2AXPA 5P21A 1HT1E 1ETUA 3BFKA 3QXCA 3A4NA 1ZMXA 2H18A 2ZRMA 4DSOA 2HLDA 4DSTA 4ZDKA 5JSZA 3QNUA 2PZFA 2BBTA 4E07A 5KO2A 2D3WA 4NONA 4M53A 5HPYB 3SFVA 1Z0JA 2ZQ5A 3P4YA 1E9SA 1FUKA 3DZ8A 4G5RA 4BFUA 1E2PA 4LYJA 4CT5A 1NSFA 4G01B 4G5GA 4II7A 5KPDA 2VF7A 2FFQA 5DIFA 2JAQA 1F6BA 1MR3F 3CIOA 2RHDA 2ODEA 4ZCLA 1QHHA 2CNWD 4IVQA 4F92B 4DB2A 4LYAA 2B7CA 1UEJA 3QG1A 2IWRA 2ZRFA 4DJTA 4TZ6A 2XZPA 4RD6A 3QOFA 4RD1A 5FOXA 5C46F 3LAWA 1Z08A 1ZU4A 1TUEA 4HUTA 5CM8B 1JQLB 1CR0A 4G0NA 2QSYA 1YU9A 2H92A 5BYKA 1H8HA 1FP6A 1KJWA 2VL7A 2YWGA 4H1UA 4IVRA 3TK1A 3K53A 1OSNA 3TLXA 2KB0A 1XXHA 3PG5A 2Q3HA 4A4DA 2ZJ8A 1AIPA 3R9XA 4HAWA 1SVIA 2GDJA 2R6DA 4Q1AA 1J8YF 1RKBA 1SULA 4MGIR 5LD2C 1P9WA 1N0WA 2VHCA 3DPUA 4DSUA 4US0R 3K0AB 4Q47A 3G5UA 1E9BA 4IXMA 1KI9A 1XTKA 2QPOA 5FOTA 2CJWA 3X1ZA 1T5LA 3RS2A 2GHIA 2XXAB 2QMOA 721PA 2ZI3A 4B73A 2BOVA 3CKLA 1XXHB 2QP3A 2V55B 4RJLA 3TSWA 3GLHA 4XVQA 5CJ2A 5JCZA 2QAGB 1XCGB 4HLUA 1R0XA 2YINC 3EWAA 4QNMA 1G64A 3ZGXA 3MD0A 1F5NA 4MRRA 2C04A 2F3RA 2F55A 3LA6A 4FD2A 1YRAA 2JATA 2J9RA 3IEUA 1IY0A 4LBZA 1G17A 5FBWB 1FUUA 3RSOA 1AN0A 4D0LB 1UKZA 2BEKA 5HKKA 1LY1A 2ZUBA 1D2MA 3OAAA 4IDHA 1SKYB 3S1AA 2ZANA 1NY5A 1UKVY 3CH4B 3O8BA 5LDDC 1M74A 5IK2A 5KU1A 4NE2A 3I92A 2G9NA 2F43A 3MLEA 4EQ6A 3P1JA 1R8SA 3V9PA 2O0HA 4AKEA 5KHOC 2PJRA 4TL8A 1JXOA 4RFVA 4Z1MD 5K8UA 4XIGS 2AXNA 3GLIB 4TYQA 1VG9B 5CB6A 3VNUA 2G77B 5IRCD 2R2AA 1C9KA 3ZZTA 4TLAA 4NYMQ 2OLJA 3BFXA 1NVVQ 1RE0A 5EXTA 4OI1A 1QHSA 4PHFA 3B1YA 4ESVA 3EAQA 1ZNXA 2W6JA 2IYXA 3HWSA 3SYKA 3ZYCA 4URVR 3EPKA 5B2ZA 1COWD 1I2DA 4LCBA 4KYIB 2JA1A 1MOZA 4LHXA 4BECA 1ZYUA 2WOJA 4LV8B 3QBTA 2BBSA 3RS3A 4FMDF 1DAEA 4NYMR 3PENA 4DUGA 1ZU5A 1W0JD 1NKSA 2FGJA 1UBGA 2Z5FA 2ZRLA 1OFTA 3EXAA 4TMKA 4RY2A 3KUDA 1DEKA 2N42A 1W1WA 4AKHA 1U99A 2PL3A 2XEXA 2XNDA 3ZVLA 4DEYA 3KXLA 2IS2A 3QF7A 4DDTA 4YMUA 4TQUS 1TMKA 4PSVA 3OEHA 1GNRA 3AUXA 3GJXC 1AGRA 4TTRA 1S3GA 1R0ZA 2CVHA 2CLDX 4RKEA 1JEEA 2A3RA 2GF0A 3LQRA 4OHWA 1W47A 2QROA 1WCV1 3LXRA 3Q8XB 1BMFD 4YONB 1E0AA 1MRNA 3OE7D 3AGPA 2QTHA 2JJ1A 3DOEA 4CEHB 4RKFA 1B23P 1MO5A 5HR5A 5FTJA 4JZKA 1H65A 2JEOA 3DM9B 4DT1A 3QEJA 1TQDA 2JLXA 4HB2A 4HAYA 2J0UA 1DG1G 1E9CA 3F8TA 1CTQA 1E1RD 3TMKA 2MSDB 5EE1A 1ZBDA 1TUIA 4FCTA 4P4SA 1OH8A 4OL0A 4FWTA 5BQ5A 2EWVA 4DLWA 1QRAA 2GCOA 4W5HA 1GP2A 1RJ9B 1FL9A 3PUWA 2F9MA 3GD7A 4V0MA 3HYTA 4DLZA 2YYZA 4AIIA 4XD7A 2EFGA 3T1OA 4FW9A 3W90A 4B3BA 1VMAA 6Q21A 3WYFA 1N6LA 2BJVA 3UMRA 2WWGA 2NOAA 5GVRA 1Z3IX 4PSKA 2IEYA 2WSMA 1E2DA 1A1VA 1EFUA 4WAUA 1E1QD 4EJSB 5AUQA 2XB2A 1CU1A 2DWOA 1E69A 5A0FA 3K70D 1OFIA 2FPLA 4A8JC 1VYTA 4P4SB 3QKRA 2HLDD 4GZMA 1YZNA 4BE7B 5G3YA 3KJGA 3E2IA 3RS5A 3T61A 4E22A 1OH5A 3CF6R 1T8TA 2FV8A 3WP0A 3AKCA 5FOUA 3T12A 2BV3A 1FMLA 5TDHA 3LLMA 3PJRA 4M9XA 4RZ2A 4Q4JA 1ESMA 4XD7D 2YC2C 4Q66C 1Z6YA 2QI9C 4M22A 2WIAA 4IW3B 4NCHA 4LC1A 5KSPA 4QGAA 4JVLA 2HUPA 1IN6A 2DFKB 1E2QA 1OYWA 3GFTA 3GJ4A 4BFWA 1E9FA 4EPVA 3UG6A 2PLRA 2PH1A 2AWOA 1RRPA 5FUVA 1GIAA 4WXRA 3Q5EA 4JBXA 5FPYA 1TADA 4LSGA 2YKGA 3AB3A 5E95A 5BN3A 1W7AA 2FNAA 4NP6A 2FH5B 2ZETA 1SXJB 5DI3A 3DOFA 3A1UA 1Q1BA 3KQKA 3IBGA 4HEJA 4UNQA 4P3YA 1EFCA 3VU9B 1RYFA 4M0LA 4NCNA 3WY9A 3ZD6A 1DAMA 4MDEA 3QPWA 1KO4A 4FMBB 3BWDD 1I4TD 1IONA 1II8A 4D25A 3TW8B 1NNEA 4Z51A 3SOPA 2PX3A 1E2NA 4GNKA 1HQCA 2R6GA 4RD2A 5BXQC 2WVJA 1G7RA 3L0OA 1FNNA 2ZITA 1UBFA 2JLWA 2C95A 4URYR 2GCPA 3C5CA 1XEWX 4MGZR 2JLQA 4QM7A 1Q1ZA 3WHLA 4IOLA 5BN4A 2YC4C 4DCTA 1UAAA 1OIVA 4JLNA 4ARZB 3T5GA 1W4AA 2F9LA 4IFEA 1ZP6A 4C0LA 4IEIA 1HV8A 3GEIA 1A2KC 4YMWA 5JS7A 5CK4A 1GOTA 5KNCA 5L3QB 4CEIB 1VG1A 3N2EA 1PUJA 1OIWA 4CGZA 2RGAA 1AK2A 1II0A 3R7WA 1VTKA 2DYKA 2ZTSA 4MRVA 5IK2D 2ZJYA 2IT1A 1Q12A 1RIFA 5B64A 2ORVA 3AF2A 4FWIB 2ZSAA 3NH6A 1E4YA 4Q1BA 4B6FA 4HUQB 2OO7A 4Q4HA 1CF4A 5FTMA 1W4RA 2ZI7A 2BCJQ 4C0KA 1WBDA 1SKYE 2HT6A 1GDDA 2H7VA 1AA9A 2A5YB 4PHGA 1AZSC 2J59A 1U8AA 1F60A 1S96A 5KDDA 2OCPA 4PC6A 1WBBA 2G88A 3LVQE 1CP2A 4G5SA 1JPNA 1D8TA 2NPFA 2ZRHA 1MO4A 3P27A 3MJHA 5LD2B 4C9BA 2NO7A 2FE4A 5C2JB 5FH9A 1NL3A 5FPSA 3DKVA 2XAUA 4JYBA 4EPXA 3CZPA 5CYOA 3ZZ0A 121PA 3BB3A 1FNMA 2Z43A 1JR6A 2V1UA 3AVTA 4DUGD 5H1YA 5F98A 2JJ8A 4ACAA 2WAYA 3DO6A 4P4UA 1KK3A 2DY1A 3W8RA 2IUTA 1U0LA 4MYUA 2B92A 4NYJR 4C0AC 2AN9A 4AYXA 1SXJD 5LPNA 2QM8A 5HE9A 5HKKD 3OHMA 2HCBA 3AVXA 2JCSA 3W34A 3QBVA 2J7PD 2B21A 1M8PA 4Z8YA 4NBSA 1QG4A 1SVKA 2IX3A 1U0JA 4C2UA 3O47A 5EE5B 1BO6A 4ZDJA 3OF5A 1FP7A 2EYUA 3CRW1 3FE2A 4Q48A 2BDTA 4A0HA 3TGPA 3LBHA 3U6KA 5JCPA 2PJZA 3SE0A 3PCRB 4D4LA 3O8DA 2ZE7A 3M6AA 1QZXA 4Z1MA 4HUQA 3IBYA 5GJBA 3G0HA 5FPTA 4A0RA 3WBJA 4LHZA 3JZMA 2IC5A 2X8AA 4A36A 2R65A 3A8TA 2P6NA 4EPYA 3E1SA 3SFZA 4TMZA 1EGAA 4RD0A 4M8NE 2H16A 4TTQA 4JJZA 4AD8A 4LHYA 4MYHA 1RVDA 3T1VA 2O8BA 5HCIA 2HXSA 1HA3A 1OT3A 1EESA 3FFAA 3C7KA 1TEVA 2GJAA 2ONKA 1DAHA 2QTFA 2B8WA 4NZYA 5FL7A 4POAA 3FOZA 2BCGY 3EPJA 1XWIA 5FTNA 1ZM4A 3AF0A 2LKCA 2R9VA 1W0JA 2HYDA 4XSGA 3WHKA 1U8YA 1T6NA 1GZSA 1V43A 3OIYA 4LGMA 4DKXA 4C2TA 1G7TA 2F1RA 2YNMA 1EFRA 2FPKA 3UWOA 3A4MA 2PX0A 4BRWA 4NCIA 1WF3A 3NH9A 4NTZA 2WPDA 4UJ3A 1VHLA 4DB4A 3TVTA 1FTNA 1KDOA 1OXSC 2CL6X 2GEDA 3HR8A 3LY5A 4M1OA 5HZHA 2QEQA 1DAIA 2A7QA 2W0SA 4HB3A 2REOA 3B9QA 2CDNA 3KB2A 4LDJA 1NJFA 4JKYA 4E5UA 1Q0UA 5L3RA 1G16A 1US8B 2IUSA 2QMUA 1XPUA 2Q3FA 4YC7A 5FUXA 4A0GA 4D4KA 2VP9A 3W5JA 4EUNA 3E70C 2WSSA 3NVAA 4Q9JA 1KK2A 4N3NA 1UBCA 3U4QA 5AUPB 1DADA 4NYIQ 3GLGB 2IYZA 4C0QC 4Z54A 4W9MC 3CO5A 4TYWA 1TEXA 2IK8A 4P4TA 2N46A 5JI2E 1OB2A 1AGPA 2Z6VA 4URZR 3TJZA 1PV4A 2C77A 1P72A 1VPLA 1J2JA 3GEEA 3B13B 4ON9A 1DBSA 4J0QA 5KSOA 3P4XA 4OI2A 1RRFA 5L3QA 3UK6A 1JI0A 1TAGA 4YLGA 1CKEA 1P7CA 3V00A 3AVYA 1XTSA 4RD4A 1W46A
chains in the Genus database with same CATH superfamily
2Z4RA 4ZIRB 3FN4A 5FI3A 1ZY2A 3EEIA 3UKJA 4BLQA 1K66A 1GILA 4UW9A 1L4HA 3TD9A 4FMCB 1AZTA 3V4RA 3T7CA 4M83A 2Z9CA 4PTZA 1ZOLA 1E2JA 3I2YX 1DWQA 3JW8A 4TM7A 2BLNA 4BMPB 2XAAA 4UE6A 4YP1A 4TUYB 4EHKA 4MVJP 5CU7A 3ZDZB 1KO1A 1SRQA 3NTQA 3VBEA 1P9OA 1I01A 2Q5CA 3GLRA 5EZ6B 4A03A 3WGIA 3UYLA 2BHNA 2HCTA 2VSOA 2Z95A 4S1WA 3ZDEA 4TMYA 3DONA 4UPVA 4FM9A 3N59A 4O5OA 4QDZA 3FTQA 1G0NA 3QXHA 2IXDA 2CLSA 3QJ5A 4WXYB 2WHQA 5CA0A 3GZTB 4ZVMA 1OGJA 5DH9A 4A2PA 2UVPA 2ZTHA 3L43A 4V02A 5AFSA 1JDJA 4U5XA 4OBXA 5EWMB 1WCWA 2XH8A 3G2PA 4OKSA 5LWQA 1QKKA 4OJNA 4L8LA 1KQFA 1IZZA 1QPZA 2Q4DA 4X1KB 1MFPA 2EC5A 1X39A 1FU7A 1OHHA 2K7ZA 3FPHA 3M4JA 3R0IA 1T6ZA 1VMDA 2SKDA 3K9CA 5KNBH 1CJBA 3OQVA 2QENA 2VLIA 5CJJA 1O1YA 5I4IA 4IDDA 2UXDB 2CK3D 5EJMA 2H59A 3SKXA 2V1XA 1XPRA 2I2BA 2YJNA 1RFLA 3DMTC 3IMCA 1YBVA 4HSGA 3WWOA 2X13A 1O54A 2BT4A 3AVPA 1ZXXA 3H4TA 1KI2A 5IWAB 4RMJA 1O97C 3C7CB 3VTKA 1ZIYA 3ZS8A 4C7MA 5JH7F 2V5UA 4G0MA 3OUUA 5I8WA 1PGOA 4N5IX 1NYQA 2BMWA 2XX3A 2D5CA 4Z4EA 2IYEA 3DBRB 3K4QA 5F7ZA 4IKEA 4KJXA 1WSWA 2DKOA 4R0MA 4J0CA 4JX9A 4C6TB 4KZPA 2G1JA 3EFHA 3G9XA 3ONVA 4KXUA 1J8FA 3UJ9A 4ER3A 3CNNA 2YVAA 1ND6A 5DN6D 1CZUA 2JANA 4WK0B 2VUSA 4L02A 5BQOA 1KP3A 4MR9B 5ICCA 4DLAA 1FMJA 1NF2A 2I3GA 3EGOA 4M0FA 3S8EA 2XA9A 2HMTA 2MYUA 3OIUA 3URMA 5SICE 5LKRA 2ECOA 3VISA 2WHYA 4JLPA 3M1AA 2FU5C 4V0OA 5C37A 2UZ1B 2ZLBA 3HZHA 4LYYA 5AT1A 1XPOA 4YFVA 2ZS7A 1QHGA 1T4MA 4J94A 2AN1A 3NBFA 4C43A 3IEVA 3MVEA 1ZUHA 2J8ZA 1SU7A 2WFLA 3DB2A 1VSVA 1QZZA 4EL5A 1H2YA 3DLAA 4G1UC 4QQNA 3KTAB 4YNBA 3IELA 2QQFA 1WE2A 2WM8A 3PUZA 1Z0FA 2ORIA 4M9QA 4BE4A 1P7ZA 4RD3A 3SR0A 2EHDA 2J30A 3NGMA 4OB7A 1GDHA 1ABFA 3WDSA 2V96A 2K5UA 3AERB 5ALJA 4HO1X 3FSJX 3HBLA 3WQBA 3LUJA 3F6EX 5CNMA 4PZUA 2VWQA 3GVPA 4XLTA 5CIWA 4Z7JA 2QUIA 4JCCA 2OY0A 4KZKA 5KOYA 3FOFC 4G1EB 5AVYA 4NX2A 1W0KD 3VYRB 1T8UA 2FSUA 2CNLA 2X1LA 1U7TA 2QTWB 1G8HA 3H13A 3KYIB 2LXNA 4US2R 3NTUA 1RBQA 1UDWA 2VH5R 3F47A 3R23A 4TVKA 1K88A 4BWGA 4BNGA 9LDBA 3X1DA 3DPSA 5JCXA 3KAQA 4OP3A 4WXPA 5KDOA 2HQSA 5H80A 4CIYA 4GBGA 2XTAA 1KGDA 1K2WA 4EFKA 3OESA 5A3JA 1B6GA 1E98A 1Y3BE 2G8LA 2ZJ3A 3L1JA 4X95A 4BLWA 1H2HA 4YAUA 4YT4A 3TRKA 2JIRA 1SBQA 2C5FA 2IIPA 2VPPA 3TTSA 1PG0A 2QVXX 4GE0A 4EUSA 4NEGA 2GO1A 3B78A 5CNJA 2ZBQA 3H8SA 5HK8A 3GPLA 2JGNA 1OKKA 1NATA 4MUGA 4D3XA 1Z5OA 4KQJA 5HRCA 5HZKA 1OC2A 1R4MA 5EERA 1QIKA 4NENA 4OD0A 4E46A 3U4QB 1O4WA 3OUTA 5IULC 1IN7A 4LSWA 2BGRA 2QLMA 1J8QA 3H1GA 4PQFA 2OBXA 1NTOA 3FCAA 1YH3A 1NXVA 1OWPA 3CJTA 2O57A 3SX2A 1WXEA 2GK4A 4P3OA 1Y6FA 1K8XB 1P4AA 1PGNA 2GF9A 4L3OA 4WEQA 1AC5A 4BGIA 1Q11A 3D6FA 2X0KA 4HRAA 3KEGA 1OAKA 2BBWA 5CVCA 1SAYA 4RH0A 1ZONA 1N2CA 3N8KA 4R01A 4JB2A 2FPPB 1GAQA 3RHZA 5HDBB 1DINA 4PCLA 2IHUA 4YPOA 2IYWA 2UYHA 3ZHQA 2AC7A 5FNVA 1UBKS 3P2OA 4TSFD 2O8VA 3F49S 1PT6A 1AUPA 3IUPA 3T4UA 3ISVA 3GFBA 4DV4B 4HRYA 2RHOA 4CEIA 2B1JA 4DA7A 1UPFA 2QDXA 1G18A 1KVRA 2AK2A 3LJKA 4AKIA 4DUPA 4TL9A 3HZOA 3IJPA 1V3QE 4YRLA 1GTJ1 3KJNA 3HP1A 5GY7A 5BUSA 4CDMA 4I3HA 2VXBA 2Y77A 4IGFA 5C0OE 1JR2A 3KFXA 1J90A 1WXHA 2Q5HA 1L4NA 1MAUA 2QTBA 1US8A 1H9CA 3PD1A 4JH0A 3ED5A 3N87A 1O9HA 2B98A 2E7ZA 3MRTA 4I46A 4BLUA 1H2XA 5LB2A 4MW2A 5JH7B 4YXFA 3V4LA 1U90A 2HIAA 5ALHA 2NNLD 5KC9A 5G0UA 4CL8A 4F4IA 1H5NA 3KR2A 4HH1A 2A78A 2KHZA 3CSDA 1IBLB 4EYSA 3F4BA 4KE9A 3BAZA 2AEEA 2N75A 1I7QB 2EJTA 1EFPA 1YXMA 1UL1X 2H48A 2QGNA 1IZYA 2QVLA 2XITA 2YS7A 4PLHA 2OK8A 1M2NA 2C4KA 1XF9A 1HDXA 2J9YB 3RSFA 2I2FA 2JVKA 4EPRA 3LPAA 4J16C 4XYGA 5TQVA 4U9IS 4E7OA 5JSZB 2H11A 4F4HA 2NAPA 4XM1A 3VH4A 4ZT2A 3DFKA 3QWFA 3HCCA 1V5WA 1W8IA 5T7BA 5F7OA 1GO2A 1IDN1 4DV6B 2CDAA 2G04A 3M33A 2DTDA 4NI5A 4TKVA 4QJ5A 1GTG1 1FMTA 1DXQA 1PSDA 3CZ4A 3IKVA 2FFAA 1J8MF 1C14A 3E8SA 3VAYA 2X41A 1EXMA 1NDHA 2CNWA 2O3JA 2Y4OA 3ESRA 4EVRA 3QNMA 3FGNA 1KA9H 2YBEA 1BJTA 2V6BA 1AKNA 1JSZA 3C3PA 3PQ4A 3ELYA 1HT3A 2D0OB 5EIAA 4FYJA 2Q7DA 4DCSA 3ZVMA 2VDKB 1V3TA 2YZ7A 3OIWA 1UOQA 2O2YA 4RIFA 2I91A 3Q3EA 3WDMA 1HOXA 3EXG2 1ZNYA 2N1BA 1SVUA 2R60A 3GGOA 4O59O 4EUHA 5ICGA 3DDHA 3O4FA 2V9PA 4GIBA 1MNAA 3ZU6A 1KDZA 3M1YA 2WJGA 4OH7A 4IQFA 1I4WA 1KY4A 5CBPB 3PFCA 4ZO8A 5DWQA 5JW6A 4OA8A 1KYQA 2NO4A 3U3JA 2A59A 3WB2A 5ED0A 4KFSA 5EWMA 2CB9A 2BRUA 3QENA 2Y2VA 1WP9A 2XYHA 1CRPA 2PX4A 3JAMA 1ULBA 4BV9A 4MEJA 1JHPA 4UDXX 1EIWA 1NP7A 4DUYB 1T8SA 2W2LA 1XZCA 1Z8FA 3EZYA 5LU9A 2IYQA 5LD2C 5D3QA 1R3UA 2AB0A 2JAWA 5JALA 1I10A 1FYWA 1RJ9A 1CRWG 4M1QA 1FPQA 1VFPA 4IEEA 1TQ2A 2YWBA 3K6KA 4LF5B 3V4SA 1EWRA 1SOWA 1U0RA 5IARA 5B4TA 1CQJA 2ZKLA 3CUYA 5JNTA 5AKXA 3IQWA 1GR0A 5FJJA 1NZDA 2X9LA 1WPGA 2IIBA 2Y67A 3HBNA 1PJ2A 2D4AA 1K08A 4OYLA 4QYIB 3ROEA 1LWOA 3QUQA 2ZZNA 2OLKA 2PEYA 2Q0XA 5JISA 3NDIA 1UOOA 4W6QA 1P2BA 2CFCA 1S8OA 3GJ7A 1NU6A 2GN4A 1EK1A 3NKFA 3LBYA 2X23A 3W9BA 4DRYA 4JASB 1H4SA 2A67A 4U7TB 3RJMA 1FFBA 5K51A 2QX8A 3GEHA 4G81A 5TT0A 3NC4A 1G8SA 4P4LA 2FR8A 5GADl 1X1QA 4JGBA 3QEMA 2BFWA 2Z8YA 1CFJA 3A6KA 3CG4A 3O84A 3SHOA 3VR4D 1RMYA 3OC6A 5HFAA 2ZZKA 2EL7A 4QICA 2LZ0A 3RFXA 4BV3A 3DQQA 4ZWNA 1WWKA 1G3RA 1J24A 4Y3UA 1X38A 4LOIA 2ZM6B 3IVXA 1FW6A 3NC0C 3S2EA 3HCPA 5JU6A 4MIOA 2IU4A 2KM1A 1E94E 2CNBA 4LUCA 4QRDA 4RPCA 1ND5A 4UHBA 3S3TA 4RTLA 4W5RA 2O05A 3G1WA 3ZHRA 2C94A 1X7XA 1X80A 2RGYA 2VDVE 3H1FA 5DRTA 4XB1A 3STYA 4NZOA 3IHWA 1MH1A 4YJGA 3GZNB 2J87A 3H7IA 5COBA 1U8ZA 1OLSA 5DOVA 2X2OA 1XELA 4OJTA 1NQWA 5J59A 3ZI7A 1UJNA 4CMJA 4DLSA 2JLUA 1OYOA 1F2TA 4GF5A 4X61A 2FZCA 4ND1A 1CT9A 1QO0D 4MJ3A 1R8QA 4XFDA 1XTVA 4PYOA 1YZUA 2WQ6A 4ERNA 3T4PA 4RF2A 4LVOA 3JD0A 4BKUA 2W98A 5C8VA 5LLTA 4EA8A 5IUJC 1SQGA 1V8BA 3GU3A 5BQFA 4GQIA 5L53A 1S89A 1J7KA 2DMRA 2JVIA 4LJSA 2Q6IA 2CYBA 4UZSA 3ZK8A 5I7SA 1VJRA 1YK1A 1APBA 5B6JA 4C76A 1NUHA 4JLWA 3RREA 3O93A 1N4AA 3B2EA 5CH5A 1CY0A 5AJTA 4AW9A 4ZDWA 5MF6A 2W2TA 3KHUA 4DIOA 5A4KA 1AF7A 1LTKA 3F4LA 1F0PA 2SKCA 3T5DA 3UUFA 3AHCA 4K46A 3ZWYA 4E2ZA 4ZQIA 2EF1A 1BOOA 2JGDA 3UK0A 3NHZA 4WLNA 1R4MB 4HDRA 2FJ0A 2A9QA 4OQQA 5T6MA 2ZSEA 3GCGA 3ZJTA 1DMSA 2DQSA 2E2WA 5NLLA 1DQNA 4WCFC 2ZU6A 3K0CA 3KL4A 4UUQA 2VJOA 2ID4A 3KLBA 1N2OA 3E7XA 4KQKA 1RP1A 2OGSA 2QUAA 2AXEA 2VQSA 1ZO8A 1YOBA 1MEEA 2QG6A 4ZPJA 5AW9A 4FC6A 5BOSB 1SU8A 3DE5X 4XA8A 2REXB 2ZIUB 1VHDA 3NFRA 1QHYA 1O0SA 2G9UA 3QVUA 1RABA 4QYWA 1KBZA 4MVJE 2IDZA 1JPJA 5E4TA 1SPXA 1TOAA 3CKMA 4Y1RB 1JYEA 4JITA 5E7QA 4LGCA 5JE8A 5KCMA 2G80A 5A1JA 4U7DA 2Q3CA 1ENOA 2I2AA 1ITZA 3KO8A 5L7YA 1DCFA 2FOIA 3AVUA 2NZYA 3EIQA 3PDUA 3U6BA 2RGWA 3QU2A 3K5PA 1RYHA 3TLAA 1RRKA 4F04A 4G63A 5B6IA 1R9JA 4A2CA 4C5BA 1TKCA 4F56A 3QXGA 1R50A 2GF2A 4BMSA 1C0IA 4B48A 2IHVA 3WB9A 1UXKA 1AHHA 5DW0A 1R5BA 1HY3A 2ECQA 4XCVA 4S3MA 1KC3A 5DTRA 5LA6A 1L7VC 4AZVA 3BIXA 1FC0A 1UJBA 3A1VA 3I6BA 4UCWA 5B5SA 2GYVA 3LQ1A 4J1TA 5KI6A 5DWDA 1ZMTA 4NCAA 3WKDA 4A5SA 5IAAA 2B3TA 1Q0QA 4JJGA 3RWMB 3H3XA 1YCHA 4FD3A 5DX0A 1TF7A 2EQAA 2A5JA 2Q5LA 5CT9A 3LO5A 3ICWA 3DULA 3EVDA 5DNEA 4ZAWA 2JFOA 2VDUE 3IOCA 4I9GA 5A71A 1JV2B 4HQ6A 5EZ5A 2JJ1D 3EQZA 1IMJA 4DYHA 2JIZD 4BYMA 1J5EB 2P9GA 1WQ3A 1QG0A 4RK6A 2DH5A 1K8RA 3VKGA 4UXJA 1LBEA 1TQ8A 1Z06A 2D1TA 2XWBF 3HVJA 5BV1A 1RPTA 4YMSA 1W29A 1MB3A 3ZD8A 3CWCA 4MA4A 2RBGA 2QPTA 4QQ8A 4C9BA 1TYAE 2VF4X 3ZDBA 3SBDA 1F0KA 1CEEA 1PBTA 3UFBA 1X8LA 4A6DA 2H6EA 3ER9A 3W5UA 2G06A 3LOUA 3RYIB 2ZYDA 5CLQA 4HAZA 1O5OA 1BAPA 5I7WA 1BFDA 3HHEA 4IMJB 2I29A 1TK2A 4ZO4A 1M1NB 5AJWA 5SY4A 4BC1A 4D82A 2C2ZA 5KAPA 2ATCA 5ADHA 4JELA 4LXXA 5KYTA 4PG7A 3BWMA 1CDZA 1RQRA 3B1VA 4ZV7A 2MCFA 5AXBA 2ZIAA 2O2DA 3NWOA 1ZN7A 1G3MA 1HT2E 3IV7A 3B8HA 4IG4A 3W2IA 4E3ZA 3BZUA 5TQJA 2PANA 4OB8A 3JX9A 5ALNA 1KOJA 1YC5A 2DT8A 5K0JA 3EB9A 3UK2A 3MB8A 1BE0A 2FSFA 3CRMA 3C43A 3KKZA 4D4HA 2ZM5A 3CLHA 3IMFA 3O3OB 5C7IO 3UMCA 2XT6A 5G3ZA 2FW6A 3DDNA 5D7NA 4DF3A 1TYDE 1WB5A 3NHYA 4CUZA 5EWLB 5IVPA 3GDHA 5KSWB 3JAWB 4IUDS 5IBCA 2HMUA 3DZJA 2YUTA 1Z6GA 1F51E 4B6RA 4BO9A 2YWXA 5MDHA 2PWBA 5JWOA 2DPXA 3FMPB 2P3LA 2R7NA 3E3OA 3H11A 1C0KA 5ALGA 2F6RA 2H4HA 3D8HA 1GWNA 1T6YA 3ZXIA 5J47A 3LMKA 3JQPA 1JHOA 4FINA 1ZJJA 4OGGA 2PLWA 3BFVA 3B6JA 5CRIA 4MQBA 5IUKC 1L6IA 3VQTA 2A5DA 3L4JA 2IVFA 1TB4A 3PEWA 3WVNA 2C5AA 4ME6A 3P9NA 5MN4A 2IEIA 3FVVA 2W93A 5FP0A 4YT8A 2HWYA 2OSBA 4OHUA 4E3WA 4JROA 2SKEA 1CUYA 1RI3A 1SHZA 4MARA 3REQB 5ALXA 2PHZA 3EZ7A 4ITRC 3KJXA 5LZ2A 2OYSA 1PVOA 3M6IA 1W76A 3DTTA 4PONA 4YACA 4EG6A 4QXMA 2RGNC 2XQVA 4Q7MB 4BTEA 4CT4B 2JFUA 3N05A 5AVZA 4DFDA 1ZSVA 4PM4A 4MYTA 4QGSA 5HOQA 1G42A 3ANNA 3CZMA 1Z26A 4XPZA 2BP7B 4F8EA 1YFZA 1YJBA 3H87A 3LUDA 4JSRA 4ZARA 2B25A 1IOVA 1L5OA 1BEZA 1H2AS 1AU9A 3H6KA 2MJLA 3C7TA 4UC0A 1W34A 4Z7QB 3J81A 1MD9A 4UBJA 3OH8A 5B58C 3W7BA 4DDUA 1GEGA 4OLAA 1HNZB 1JQEA 3EQ8A 2IV3A 4RHCA 1I8TA 3E0QA 4ZAZA 2SHKA 4IIHA 1QYRA 1VBNA 1XRMA 1OWOA 3JQ7B 3NQ41 4PLYA 1PFGA 2XF8A 5FQNA 2X9NA 3LDHA 3JPYA 2NADA 4O4JA 4X24A 4FB5A 2WWTA 3C5HA 5IM5A 2X4DA 5IC4A 3A6PC 3GXOA 1GYPA 1QIEA 3CVOA 4L28A 2J3MA 5HRUA 3I83A 4A7PA 2FXVA 5I7AA 3HZZA 3HADA 2O20A 3HJGA 3HJHA 4JSTA 3UEOA 3VNBA 4RCYA 4BNTA 1DEHA 2Z2KA 4X60A 2HRBA 2X5NA 5EWJA 1HYBA 1ISSA 3V1UA 1ZR2A 5KYWB 4H1HA 4OQEA 3IPLA 4MYDA 4YJ2A 4EVIA 2B6HA 4LVUA 4CEJB 3VR4A 1JDUA 1NYRA 2NX2A 2Y1DA 3BD6A 3PQ3A 4RENA 5FPQA 3VBCA 4TWZA 2R0QC 4FI3F 3V32A 4LI3X 2EJVA 2VT3A 3AEUA 4GNRA 2D8AA 3NTRA 4YJGB 1B76A 4C4OA 4FJ2A 2D1SA 2GN0A 3D6AA 1TJYA 3G9QA 3PQ2A 4FSDA 1AXGA 1SXGA 1E77A 3L79A 4JKIA 4QXAA 5JQGB 3PGMA 1E1DA 3L1KA 5KQPA 1CJMA 2ZJ5A 1G3IA 4U2GA 5LSAA 3ZNNA 5DSTA 3ZVNA 3ADDA 4G23A 1A9OA 2ATEA 2BM9A 2AMLA 2P9CA 4ROTA 3BIOA 1EJ0A 1SEPA 1Z5UA 2RONA 3ANXA 3RARA 5DGCA 1GTMA 1KMQA 2XT0A 3BXXA 3RQSA 3ZWBA 3D8SA 3U5ZB 4Z2AA 1USIA 2XOKA 3UUWA 3WWZA 2NXWA 3L06A 3R44A 2CT8A 2G7MC 3AONB 1C5KA 1RAEA 2UVQA 3JQ8A 3W3ZB 5GVSA 4M6WA 3W05A 3EUWA 3FTFA 4RU1A 1GA6A 1CQPA 1OE0A 2BONA 3LHKA 3WQHA 5CDSA 1ID1A 4RWZA 4ZO7A 4O63O 2X77A 5DM60 1CRLA 1KMHA 3DEZA 3EH2A 4RDIA 4M9CA 3SICE 1J5PA 4U7JA 4X1IA 5D1NA 1PWZA 1HRKA 2PUJA 4QEZA 2IYLD 1TFRA 2CWWA 3PXXA 1ENPA 3K6RA 5LLDA 2YDXA 1GUZA 1XD9A 2JA2A 5CA0B 1L4KA 3JATA 1XV5A 4PYQA 3ZNOA 1M0SA 1E1RA 3G0DA 4RUKA 2QT0A 5EP2A 3DE2X 4IV5A 3P2MA 2RIRA 3R2JA 2ZAOA 1OA1A 2GS9A 3DD1A 1CNMA 1PGPA 2BMEA 3HCRA 1M34E 2M1ZA 4HCJA 1MJGA 3GEBA 3TLGB 3VKVA 5AVSA 2QPLA 5ICEA 2ATXA 4PANA 1TKAA 3IMGA 3PI7A 3RANA 3PD0A 4L16A 3S2ZA 3DO5A 4KQXA 5CFPA 5I7OA 1NG9A 3M34A 1WDTA 2AZDA 3A3PA 4KV9A 1EM8A 5BP7A 2DFTA 3GLFB 2J9FB 3W3AH 1I14A 1K6MA 2Q6KA 3WLOA 1I7PA 5KKCA 3A7DA 1E3SA 4X6XA 1PEKE 3DXXA 1BC5A 3QNWA 5JEDA 1DEOA 3FPFA 4QHYA 1JEJA 3PPYA 5DGDA 3P8ZA 1XQXA 1J1IA 2JFQA 1QVZA 3DB1A 3PDHA 3HO1A 4PLCA 4JLMA 3QMWA 3QE0A 2QTVB 4RK5A 4CV2A 2JAOA 3HBMA 5JJIA 2W37A 2V4MA 3FMOB 4HWGA 3VO9A 1Y8RA 3H5VA 3DE6X 5T67A 2D2EA 3IPCA 3WC4A 5JUWA 1SOVA 2EL9A 2XKAA 1GGHA 4KO2S 2HIHA 5EUMA 4JYPA 1TJNA 3I5MA 2H57A 1UINA 1L8QA 3CF0A 3EXEA 5LZ7A 3G7NA 4L72A 2FN4A 4JT2A 3BJZA 1RW4A 4DJDC 3FHCB 3GGJA 4GLJA 1Q91A 3KXIA 4N8EA 3KQYA 4BNVA 1B3RA 1E9RA 3ASZA 3DTVA 2DETA 3T7RA 4ZEVA 4W1PA 1BHJA 1RCFA 5TJHA 4B7CA 3H42B 3O73A 4U39A 4JN6B 4HQOA 5EPUA 5AJYA 3S27A 1W4BA 2VTKA 1H0HA 3FDZA 5D3KA 3O8OA 3UB4A 3A2LA 3WYAA 4C7JA 1M1YA 5KQMA 1JNXX 4BNMA 3JR3A 1BS2A 5IBPA 2WPDD 4Z4FA 2XOEA 2H7XA 4HATA 4KMOA 1PTKA 2CHGA 4URHA 4ADSG 2DPGA 3L40A 5FULA 1MIHA 4HK4A 2AD1A 3CMCO 3B1XA 4LC0A 2VF5X 3PTZA 4W9NA 1M2GA 4YMLA 3D7KA 3VR6A 4KAFA 3E84A 2QRLA 4FYKA 4NLLA 1NVGA 3A36A 1ENYA 4GOMD 4NYJQ 2NPIA 4ACBA 4V0LA 4XIYA 5JJBA 3ZGOA 3TIGA 4TSRA 1V16B 4R7TA 3GG9A 3RHFA 1RAFA 1XFAA 3JQFC 3KCNA 2Z6UA 5JSKA 3OZVA 2CVZA 3HEBA 5I6DA 1N57A 4HDKB 4K6KA 2FFRA 4IBOA 3TFOA 4AXBA 2I7VA 4FOSA 3LRPA 3HUFA 4O4IB 4U0KA 5EAIA 4MRAA 4GX1A 4QELA 1Q0HA 1ZI9A 1PF7E 2OP1A 4R68A 2FLKA 5DBOA 2BI8A 1JDTA 3NZEA 4Q3NA 5DBGA 5GWXA 3DEAA 5IJXA 1WTAA 5K6TA 3ASVA 3I0MA 3ROKA 1QB7A 1MXHA 4Y2RA 3W6ZA 1E7QA 3U7GA 3OFVA 2HZBA 4B4WA 2PMKA 1VQ1A 4NMMA 3BUSA 5TX7A 4QECA 4QOJA 4ZJZA 5A04A 4EGJA 1IBKB 4X1OA 1YTUA 3BJIC 4AT1A 2R79A 4M7WA 5LB4A 3P9KA 1KR2A 3W6OA 1MVOA 1PK9A 4DG5A 4A27A 5IVKA 4JBIA 4LF4B 1FDTA 4KRXA 4GPEA 1YO6A 1E6LA 4NEHB 4CKEB 5JYDA 3EIEA 4XDYA 2X8BA 3FA2A 3REQA 1Z2CA 3ASUA 3L02A 3RTEA 5HQ3B 3BE4A 3ECCA 1ZM9A 4CL2A 1XN4A 2IP2A 3TCKA 1NSTA 1QJCA 3FRJA 1ISPA 4RMIA 2V4ZA 4U02A 5CW2A 4HEA6 3B60A 2ZBEA 4H17A 3SM3A 1Y3DE 2H2FA 1M7GA 2NO6A 4ZOBA 3WLEA 4L6CA 3UGKA 4J0JA 4GP7A 4L9AA 3VKUA 3P32A 2EATA 2H54A 4KW7A 1Y1LA 4RHFA 4HAUA 1NBMA 3MMNA 2NUBA 3R5TA 4FONA 5ADVA 4DQVA 1H1DA 2PLFA 3NAZA 1BYUA 5E6RB 2QX9A 2I3BA 1M66A 4I9HA 4F21A 4UXHA 3CTMA 3OCWA 5KYXB 3WAKA 1M83A 3EIWA 3L7JA 4Z9AA 1DXOA 3WO0A 3G85A 2O14A 1S2DA 3BXOA 4H0CA 5BSUA 1HYQA 1TO2E 3K7EA 3U4IA 4MLDA 4QG3A 3WIVA 2GRJA 5E9WA 1BH2A 3LHSA 1ZH2A 3KOWA 1T2CA 4F2HA 3CLUD 2H2IA 2JFVA 2P5UA 2WYUA 3H8VA 4NEQA 4BMZA 4PSDA 1QZUA 2VBFA 4AY6A 1OLXA 1ES9A 4ZQEA 3KTFA 2OV4A 3UGJA 3MPUA 5KNCD 4QJ3A 2DUMA 1EFPB 1L4BA 3I12A 3L0YA 4WN9B 5K0SA 4AXXA 1T2UA 3ZE0B 1SUPA 1ULSA 2V97A 5BSKA 1HFEL 4GPD1 2MT9A 2OILA 2OG2A 4NR0A 3LBIA 4YBRA 5A0TA 3TE7A 3BYZA 4I2VA 2J6HA 4YJ3F 3S5UA 5CXSA 4GVPA 4LPSA 3SKVA 1VE9A 3H17A 1YI0A 5H82A 1T13A 1AB6A 1GGKA 5AM0A 3GLFA 3KB6A 1P5RA 1NVXQ 1U3WA 4NNPA 5GJWC 1NF9A 1W5FA 2VWGA 2I78A 2BZGA 2HFKA 1FBTA 2YS6A 1XDDA 1Z8NA 3HR7A 3I1IA 2IODA 1SXJC 1V11B 2HA4A 1ODCA 4R1NA 1E8MA 1PUIA 1T8PA 1JP7A 3PC6A 4AZSA 4DDKA 2GYWA 2YVQA 1ESDA 4B2PA 4EFMA 3QVWA 1OXKB 2F3SA 4QREA 3MMPA 2Y1CA 4CKWB 2BFFA 2OVBA 2PSHA 3DZCA 4P6VF 4CF3A 4IIJA 1XZFA 1Q84A 2JBAA 2Y0BA 2ZSFA 3FPAA 4MA0A 3HB7A 1AX9A 2AL7A 4HAXA 4KR7A 1TW3A 3ECSA 1ZVMA 1Q74A 4RDCA 4XDHA 1SCKA 1HORA 2K2QB 2VG8A 4KBFA 2O8EA 3G0CA 2K2WA 4KN6A 4PU0A 1GAEO 4JUAA 2O0KA 1G2PA 2O9JA 4DR2B 4CEHA 1P0QA 1P5ZB 1WV0A 2WT9A 5DTEA 1TL7C 1Y5MA 3OBIA 3RFCA 3T0FA 2PMEA 5AKGA 4FT4A 5TF0A 4DMMA 2HJSA 1XMXA 3I42A 3PPXA 3TLMA 3NBAA 4R2XA 4KREA 3QUBA 4U2KA 1YR3A 3FNRA 4K9LA 1KJNA 4QDXA 2CSUA 1J0EA 3QFFA 4Q3CA 4ZYYA 1JALA 1NRJB 4UJ5A 4MPRA 1VSQA 3QYAA 2GYUA 2GDZA 2HRQA 5GZ3A 1P2VA 2H4ZA 2WKPA 1CHDA 4Q82A 2V54A 4TQAA 3DDUA 2ISCA 5EUQB 1GDTA 1GRCA 2V98A 1B1AA 2YVKA 3V34A 4ZCIA 5BNWA 1DL5A 2M98A 1RE1A 4KAAA 2XB4A 3RG2A 3QWBA 5DM0A 3K31A 2HAEA 2JIZA 1CCWA 3ZHBA 2ZT7A 2PBRA 1TAUA 4WCDA 1SCIA 4HGZA 8ATCA 1EJ6A 3OJFA 2XSZA 4WJZA 5IT4A 3ZIUA 3OE1A 4MUEA 4LMRA 1LS6A 2JFXA 3NT5A 3P94A 2Q7OE 4YJFA 4BATA 2PV0A 3H2HA 5BW8A 2ATIA 5HFNA 4HNAB 5JECA 1E4OA 2WHXA 4FHDA 4ENSA 1GNQA 3WMGA 4GR4A 2Y0DA 2XQGA 4Z1OA 5IT5A 1I36A 1JR3E 2D1RA 4DC1A 1FB5A 1X3LA 3Q15C 2AR7A 4IJ6A 2BHTA 3AR4A 3UANA 4C3ZA 3S1LA 3C85A 4FOPA 4KQWA 1ODKA 3T9EA 1KR5A 2VDJA 4PVDA 2PAAA 3S2GA 3E22B 4R51A 4QX6A 5L6MB 3WNBA 1QHHB 3HRHA 3M4YA 1I30A 2MINA 3GBSA 4JT4A 4OTZA 3RLFA 1WSAA 1F0NA 3IVMA 5FWYB 1QMPA 2FQYA 1GFSA 4BUZA 4UOEA 2H4FA 3LF2A 1D4ZA 2JDID 3WZMA 2W6ID 3RKSA 5KPJA 4QBHA 3NG1A 2FR8C 3EXIA 4S12A 1FQJA 1GNSA 1BKDR 5F5LA 3TR5A 5K0GA 3P45A 1HE4A 4JR2A 1E18A 4ZO9A 4E03A 3QIAA 3S1AB 1Y7HA 1E2GA 1VKNA 2F3UA 2I2DA 3SNHA 3VH2A 3KK0A 2ZUUA 5DHQA 2XHEA 3CRRA 4ZTBA 1CDEA 1LVUA 1Z5NA 4TVOA 3U1BA 2WYHA 1H94A 2CC2A 4FCWA 5K7SA 1P18A 2CN1A 3KHSA 1U7WA 4LZWA 2ZIZA 2C9BA 5I4KA 1AG9A 5E7JA 4R3NA 1GZVA 3DDSA 4Q9DA 4L9WA 1DJQA 2JLSA 3EIOA 3FJYA 3KR0A 5FD8A 4GRIA 4MV0A 4OGWA 4R2WA 3D3JA 4R7ZA 4QM6A 2CL0X 2PBZA 2ZE5A 5JMWA 2ODWA 4U2CA 2IOFA 1ZK4A 1Q7GA 5JLAA 3ZDDA 3T5CA 3EGEA 5JPIA 1AK9A 2CB0A 3DBOB 3PPVA 1KEVA 3CIFA 4G1CA 5A6SA 1P2DA 2NYRA 2NU7B 3GV0A 2IWHA 3ND8A 4N7JA 4WJLA 1W19A 3DFZA 3LI2A 4JQOA 2LV8A 4WUTA 5FV7A 5BV0A 1G6HA 1MAWA 1ULHA 2HTEA 2I6SA 3C7DB 5CFZA 1DTEA 3Q3JB 2Z08A 3IBTA 3AM4A 4JJKA 4XVHA 4IEFB 1WL8A 1BXGB 3RGGA 4BNYA 1GTZA 1KYVA 1HGXA 4JT8A 3E48A 4QG7A 1QFSA 2ZRDA 2ONJA 5K8JB 3PXDA 2XZOA 2ZU0C 3KKKA 3PUJA 4MV7A 1P5FA 3UH1A 4DILA 2HKIA 3S28A 1E6WA 3DZHA 4P81A 1TF5A 1J09A 4H7JA 4L2IA 1A97A 5FBVB 1K6JA 3RUEA 1HETA 2WFLB 5FI1B 4LJ5A 2YIMA 4XTRA 1I4DD 4B3GA 2VPWA 4RDXA 1ZIPA 2C9OA 3QVGB 2IH4A 4KO3S 2VJQA 1IYZA 2J3EA 4ZI3A 2BP7A 3O4IA 2O8DB 4DC9A 3RFVA 1SIOA 1JAIA 1FXUA 4ZMRA 5HSGA 2XYGA 2EFCB 4ABYA 3FM9A 2I66A 1XAGA 3A6JA 3SWWA 2DULA 2I67A 1T35A 2IPMA 4RXTA 4BP8A 4C6TA 4YRMA 5L3SB 3NIGB 2G4LA 1CUHA 1SD2A 2J0EA 3GJSA 3LUCA 4P7FA 2HPAA 4C30A 3R3ZA 1DJNA 1O6FA 1FXWA 2O2CA 5ICMA 2ZRAA 5GOZA 3OP1A 4QEDA 1TVKB 1X6VA 4DLNA 1DIAA 4GDFA 3GQBB 2FWIA 2FY8A 1ZD1A 5J4KA 1CZKA 4BV2A 4WPGA 1FYFA 1HDZA 2COKA 3ROPA 1DKQA 1H6BA 2XBUA 4N6OA 3BE5A 3U0BA 3AFIA 4V0ME 1EDZA 3LH5A 4IDPA 1SCBA 3DE3X 4PZYA 1SXQA 2X6RA 3WQQA 3SOZA 1CNEA 4RAQA 1F38A 2ETXA 4AKSA 1GCGA 1Y0BA 3LCMA 4W5NA 3LX8A 5HQJA 3K0BA 1K4KA 3Q7TA 3WSTA 1Q7BA 2P8JA 3R6TA 3VNRA 4G41A 4CLRA 2IP4A 3R3JA 1AUOA 1X2BA 3G0IA 3R09A 4MW0A 4YJKA 2JGEA 4AUKA 1JIVA 2C31A 2YV4A 3GXBA 4JHLA 1TUGA 4MQEA 4JI3B 2R6FA 2IA5A 3VJMA 1XK7A 4Q4HB 1NVEA 4WSOA 4ZAGA 1X8JA 1G8AA 1PNTA 1U9YA 4LZAA 4QGFA 4TXMA 5CJPA 1GSIA 2WMYA 4DWJA 3VR0A 3ELUA 2Q9AA 5E1DA 1UEIA 3VHLB 2XGOA 3A9CA 3WIEA 2O48X 3HNOA 3Q3HA 1P2TA 2RHWA 4O1MA 1XJCA 3OOHA 2PEZA 3UKDA 4D3ZA 1TJPB 2QGZA 1COWA 4D0GA 2IZ1A 4HZUA 3BL6A 3IBSA 3PR3A 4Q18A 2D0IA 1P62B 1Q7TA 1TECE 3KZ1E 2EZ9A 3MXTA 3NIBA 4JUDX 1JR3A 1ADJA 1YE8A 3IESA 1S9DA 1WXFA 3HN2A 3FDFA 3D2BA 4DM3A 4DLXA 3EZFA 4MO2A 3QKTA 3NBUA 1UJMA 5KYYA 1W9HA 1OFUX 4F8JA 4GOJA 4JLKA 3OOEA 1R8JA 1FDSA 2YQ5A 3LOPA 3OZIA 4RAOA 3RE1A 1M75A 3DBVO 2W6OA 2Q3LA 1XVIA 3HLTA 3QOYA 1G8FA 1M2VB 2MINB 2OD7A 2QN7A 5EIBC 3ULKA 4OJYA 3UJHA 3THYA 4A9AA 1Z2OX 1NQXA 1A2BA 4Y0AA 3A05A 4FTWA 5F35A 3CONA 4KIUA 1C8LA 3M70A 4I50A 5LA6F 2HXYA 2H1VA 1V25A 4RBNA 1ATIA 4IF4A 2V7TA 2PGAA 3HDTA 3Q5GA 2VRWA 1T4BA 3SF8A 1HE1C 4RLFA 3RVOA 4B0OA 3TJRA 1G8PA 3JQ6A 5IWCA 4QGBA 3EGXA 3LP6A 3MQ2A 1SOAA 3RBVA 4GKBA 3BDIA 4I6JA 4E5MA 2RGRA 1O6GA 2WHRA 4CUJA 5IKMA 4Y9UA 3K16A 4FHGA 2GXQA 3NYRA 1QR6A 1TZCA 4DA4A 2HOQA 1E7YA 3FDXA 1DAGA 1OU0A 2VQDA 5ILQA 4PO3X 5TGZA 3SS9X 1GRNA 2DKFA 1VHJA 3FYSA 3QGMA 5DCLA 5EIBD 5FA5A 4DV1B 1N5RA 1KYWA 4TWAA 1MKYA 5AXCA 5ENVA 2DLCX 3L07A 1P1HA 4C0SA 3HLYA 3QVMA 4G0UA 5GGXA 2XBLA 2QD4A 4JXKA 5JD5A 2CVFA 4EW3A 2IXFA 4Y6LA 1N5MA 2EJWA 3GA7