3Q7QA

Crystal structure of rad g-domain q148a-gtp analog complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
146
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVEDGHTYDRSIVVDGEEASLMVYDIWEMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 146
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q7qA00
4TSFD 4C0QC 2FFAA 1IN7A 3P20A 5TB5A 2C2HA 2GJ9A 4W9MC 1AK2A 1OXXK 3W8RA 5E7JA 4URZR 3REFA 1JQLB 3JVUA 3KXLA 5JJIA 1M2OB 1II8A 4AKIA 5FPHA 5FBLB 2QEQA 2BJVA 2ODNA 2YHSA 4PXAA 5KTYA 2IK8A 1DS6A 4HDOB 4JVSB 2A5FA 1RE0A 4TYPA 4I99A 1CIPA 1FX0B 3I92A 3JVVA 4B2IA 1W4RA 4LJ9A 5KNCA 5CYPA 4DSTA 3OAAD 4OHXA 5HE9A 3IPXA 4V0ME 1BO6A 3MFYA 2L0XA 4EJSA 4FWIB 1W48A 4CRWB 1GDDA 4P33A 1N6RA 4OK3A 1RPZA 3GJ5A 3VKHA 1N2CE 3F8TA 1FL9A 1G5RA 1GFIA 3R9IA 1D9ZA 1ZM7A 2OXCA 5EXXA 5BN3A 4NTZA 2I4IA 1OHHA 2GJKA 2RH5A 1F2TA 4B35A 5L3QB 3EPHA 1RRPA 4GL2A 3WP1B 4KBGA 3LH5A 3U3KA 1E6CA 3WXMA 4MQBA 2R6AA 2XOKA 1N6KA 1JECA 1A7JA 2R62A 3AUXA 3DZ8A 4LPKA 3RAPR 1SVIA 3T34A 4RY2A 1XXHB 1XTIA 4AYTA 4TL9A 2J87A 4RZXA 3EC1A 1QHYA 2OSBA 4KFSA 4QM6A 5CK4A 1KOFA 3AVOA 3CRMA 4ZIRB 4JIMA 1OW3B 1N0UA 4LJ7A 1D2EA 3NHAA 1GVNB 221PA 4V0MA 1ZUIA 4F38A 2OAP1 2FZ4A 5GVSA 1ETUA 3BGWA 3R7WB 1N0VC 5EE5B 1P2TA 5CJPA 4AG5A 2FFHA 2IXGA 2VHCA 3KJEA 4FN5A 1W0JA 3SYNA 4B3CA 4BGDA 3EXAA 1KKMA 1VTKA 3VKGA 3L8YA 1DEKA 2A5GA 4A82A 3TE6A 2B21A 2BM1A 4Q9HA 2QBYA 2R6FA 2VHJA 3QXXA 4QGGA 4M1WA 2CJWB 1M34E 2FSIA 2QP9X 4XVUA 3GLFA 3THOA 1G18A 1SVOA 1OHHD 4ITRC 2ANCA 3ZJYA 4CW7A 2O8EB 2P6NA 4AY2A 3AVYA 2F55A 2GEDA 1RRFA 4JBYA 3HYRA 2FGJA 4US2R 2XOKD 2FX3A 2RHMA 4DIDA 4ERNA 4UXJA 4C4PA 1XPRA 1FTSA 4LHZA 3RRNA 2V1UA 3F3YA 3SNHA 2ZITA 1NL3A 1OSNA 2LKDA 2MMCA 3CX7A 1DARA 4AKHA 2WWXA 2WWHA 3SYLA 2Q3HA 4LPSA 1OFHA 2GF9A 5AR1A 1FX0A 1NMXA 1DELA 1T8UA 1G3UA 4M1OA 5JWRA 2OBMA 4HZUB 4Q03A 4M8NE 3FVQA 2Z43A 3GJ3A 3FMFA 4WW0A 5KPDA 1MV5A 3DKPA 5P21A 1UKYA 2GVZC 4A2PA 4LDJA 3K53A 2RCNA 2VLIA 3LW8A 1W0JD 5KSZA 1CR2A 2D06A 1PV4A 2VBCA 1YR7A 2BMJA 2E87A 2YWFA 3EIEA 3TK1A 3SYKA 4EAQA 3PCRB 5L3QA 1VIYA 4A4DA 1NMYA 2CLDX 2IYVA 5E4FA 3E2IA 4PX9A 1M74A 4EFNA 1ZM9A 2BVNA 2QT1A 3VFDA 4Q1EA 2GF0A 2ORIA 4DLTA 1XXHA 2JATA 1W46A 1U2RA 5KNDA 2J0VA 3OEEA 5CM9C 3BH7A 5BN5A 3NBFA 5JJKA 4YDHB 3GLHB 3NBXX 4YC7A 3QJYA 5JWHA 2WPDA 2IS1A 4ZIRA 2ZR0A 4UNQA 3B1ZA 3HR8A 1FQJA 4Q7MB 4DLVA 2WHXA 2YWHA 4V02A 5CYOA 2A3RA 2PT7A 3KJIA 1T4GA 5JS7A 4NYIR 4M9ZA 4D81A 2ZRKA 1CS4C 3X1XA 1GG2A 4Z1MA 2V3CC 4HYYA 4E03A 1NJFA 3RS5A 6Q21A 4LJ4A 1R8QA 2WAYA 4QFMA 1BYIA 3X2SA 2Q21A 3W6PA 3H2YA 5ANRB 3VR4A 3B1YA 1S2MA 1W0KA 2JJ8A 2HCBA 3K9LA 3OF5A 1U8AA 2CJWA 3AF3A 3DM9B 4BE7B 5FOWA 3NHBA 1DTSA 1N0WA 1VG0B 4DT1B 2O8EA 5KDDA 1JJVA 4GOXA 4PFSA 1T9HA 3HPQA 1G5TA 2HJGA 2UKDA 3T35A 5L8VA 2ONKA 1XJQA 1TADA 1ZNYA 3NG1A 1S3GA 3EA5A 2J46A 2ZJBA 4G1UC 4JLKA 2WWYA 1K5DA 3QUSA 4ZKEA 1SXJD 3OEED 4UKDA 2CMKA 1QBKC 2R65A 1YZTA 4MKIA 2AD5A 1JJ7A 2QSZA 5GJVC 3C15C 2A5DA 821PA 5HE8A 3SOPA 3B8HA 4PPQA 4HZUA 1GM5A 5CM8B 1R5BA 4OHVA 3ZD6A 2GEUA 4PQYA 2VO1A 1IJFA 4OJKA 3ZS9A 4A2WA 4FWTA 1R10A 4GBMA 4I1UA 4IEEA 4Z1MD 3AVXA 2HCJB 3T61A 4AIIA 3ZDQA 3IIKA 4GNKA 4C0KA 2C9OA 1DAMA 2Q9AA 4PPFA 2ODBA 2ZYWX 1OLOA 1VG1A 1XTSA 3MD0A 4ZDWA 4NP6A 1TEXA 2PCLA 2ZS9A 2ZETA 1XTRA 4B75A 4D0GA 1W0KD 4YQFA 2YINC 1YR6A 1EWQA 2HLDA 1LNZA 3DDCA 4MKGA 1DADA 4C30A 3ZYCA 2DFKB 3CRVA 1RZ3A 3PV0A 2R44A 1Z2CA 4MGZR 2I1VB 2YVUA 1FP7A 3SJBA 5E7IA 4C7OB 4C0SA 3B78A 2P5TB 3TR5A 4US0R 2HXYA 3ZZUA 1E0AA 3KQHA 1BIFA 1TUEA 3QKTA 4C2TA 3E70C 4RD4A 3GLHA 3ZIAA 4X8HA 2GKSA 3FDIA 3ZZ0A 4X8LA 2IS6A 2NTYC 1W36B 4MYTA 1P3JA 2A9KA 1S96A 4D80A 1JB1A 4B73A 4CEJB 3L0SA 3GJ6A 5JJLA 4D4MA 2JGNA 3CLVA 2FPMA 3NXSA 3TQFA 2WIAA 4IRUB 3WYGA 1QF9A 4W7SA 3DHWC 5SZJA 3K70B 1CR0A 1E0JA 1XTQA 1E2LA 3QEOA 3JZMA 3TVDA 1EXMA 5HCNA 1L4YA 2LWIA 1E94E 1P9NA 4JSYA 4LJ6A 3SJAA 4HLCA 5DI3B 1RYHA 3T15A 1VG9B 4AKGA 4P4TA 1KI7A 1TF7A 4JVNA 3TLXA 2ZM5A 3C7KA 1NSTA 4F93B 4DT1A 2HLDD 2QQEA 3SS8A 1DAIA 2WOJA 2Q9BA 2OFWA 3UWOA 1ZJ6A 4IDHA 2XX3A 3NWJA 4F4CA 3NC0C 4KVGA 1RJ9B 3D3QA 3AKEA 4EPVA 1E2IA 2HYDA 3N2IA 4Q66C 2DFLA 1DOAA 3CF2A 3I8XA 4POAA 2VYFA 4MGKR 2QMUA 1GSIA 4MRNA 3TNFA 3UK6A 4OQFA 4Q1DA 3GJXC 1IY1A 3O8CA 3VX4A 3ZIAD 5JHHB 2QGZA 2ZUBA 5DE3A 4BQSA 1J7KA 2VEDA 5HR5A 3GLGE 1GP2A 3AGQA 1DBSA 4X8OA 1GNPA 4OI4A 3LAWA 3ZVMA 4TMZA 3ECCA 2BMEA 3EZ2A 4L5BA 1UBCA 3ZZTA 1W44A 4HLQB 4DDWA 3AKCA 2VP6A 1JR3A 1RYFA 2WWIA 3IQWA 1OF1A 4RKFA 2AN9A 5E95A 3SDZA 5JEDA 5H8WA 3QXJA 1XU4A 2O8CB 2IYYA 4BLPA 3KL4A 1U81A 2FOLA 4Y0AA 2YOFA 4QBHA 4MDEA 2G0NA 1GTVA 5JSZB 3K09C 4AURA 1QG2A 5BYJA 5J40A 1XEWX 3DKVA 1KAGA 1W2HA 4MRRA 3C41J 4GOKA 4C7OA 1T3HA 3K9NA 1LS1A 3I61A 1MRNA 2VP2A 3BD9A 1KI1A 4R2IA 4B34A 4B3FX 2X2FA 1F6BA 4A9AA 1W7AA 3MJHA 3A4NA 3AF0A 4G3XA 1U8ZA 4XWKA 1UPTA 2OUKA 2C78A 4H1UA 3M4YA 3DL0A 1ZU5A 4DCSA 2B7BA 2ZE5A 5AJYA 2BC9A 2G83A 4NYMQ 3RVBA 2O0KA 4CEJA 2IUUA 4A0FA 2XB4A 4Q01A 3KB1A 1TPZA 3LVRE 1ZM2A 4D82A 1E9EA 1E2JA 1ODFA 3C5HA 1T3LA 1XJCA 5G53C 2YWGA 3RC8A 3ADDA 5E3HA 4O2LA 4DVGA 1VECA 1JR3D 2ZRCA 1SXJC 5BYKA 3R9XA 1Q1QA 2GXQA 2EWVA 2QAJA 3NEJA 4NE2A 4S2EA 1JQJC 5DI3A 3TW8B 4F7WA 2IYUA 5A0FA 5C1BA 3RLFA 4ACBA 5TY0A 1AKEA 2ZSDA 3B7GA 1E2KA 5L3VA 4OI2A 1IHUA 4UXIA 5C4GB 1P6XA 2XNDA 2ZTSA 4CF7A 2PX0A 1RJ9A 2FE4A 3SR0A 2B92A 2AXNA 3HPRA 3PUZA 2HF9A 5TVKA 5FOTA 5FOUA 4PANA 5DNYB 5KOYA 1OFUX 3OHMA 3LLMA 2J1LA 2JLVA 3LRPA 1T0HB 4LX0A 2WJHA 4LYHA 1AGRA 4LRWA 3WYFA 3QXCA 1G9XA 2Z4SA 3TAHA 3VR2A 1W36D 2GAAA 1OH8A 3SQXA 2GJ8A 4G01B 1XTJA 2KWIA 2OCAA 3LW7A 3W5JA 3AM1A 2EW1A 1KI3A 2Z5FA 5TV2A 1YZNA 3K70D 1EK0A 1SVMA 3OEHA 1TMKA 4BZPA 1D8TA 5DYGA 3G0HA 2OV2A 2O8CA 1II9A 4RD2A 1EFUA 1SQ5A 3WMFA 2CK3A 1TQ4A 3VMFA 2WTUA 4ASUA 1KO7A 3PXGA 1M1YE 2F1HA 2W0SA 5UKDA 4EPRA 5JSZA 2ZAMA 1YZKA 5KU1A 3CO5A 2CVHA 5SZHB 3R8FA 2BOVA 4XVQA 3FMPB 4B6FA 3CZQA 4HSEA 1FNMA 1XEXA 3CR7A 5AJXA 1P5ZB 3RS3A 4OQLA 1Z07A 2XNDD 2JEOA 5EZ5A 4RFSB 3EIHA 2H57A 2DR3A 4PSKA 3M1IA 1KI4A 3RWOA 4NCKA 1XP8A 5CLLA 4Z8XA 3QF7A 1NVVR 2J3EA 3EPKA 1D6JA 2EVWX 3O8RA 3HU2A 1C4OA 3IKJA 2OCYC 3L0PA 3Q5EA 5HKKA 2GXAA 3A4LA 3WBKA 1XTKA 3OFNA 1GNRA 2JJ2A 3RDPA 3IHLA 1ZUNB 5FR2A 1XEFA 1WE2A 1ZRHA 3MSXA 4HZIA 1XD8A 2REBA 3FPAA 1NVXQ 4BEJA 4KV9A 1W49A 1ZAKA 1E96A 4XD7D 2C77A 2ZYVX 1AM4D 3ZH9B 2ZRPA 2ZVPX 3OEHD 3SZRA 4PPGA 3QVVA 4YMVA 3TH5A 3ICEA 1Q44A 1ZINA 2CK3D 2Z6VA 3O8BA 3C8UA 3R20A 3IO3A 1CKEA 1SKYB 4B74A 5L3SB 4M9QA 5B30A 3M0EA 4JKIA 4PAOA 4ZO4A 5KDLA 3MWJA 1X8KA 2FSGA 4JBXA 1WMSA 1Z3IX 3KQUA 4L9SA 3B2EA 2QA5A 2V55B 4Q1AA 2FPKA 3OIYA 2NG1A 2JLSA 4DEXA 3AB3A 3MAAC 4B71A 3IUYA 2W2XA 1U99A 3NH6A 5JMTA 1GNQA 1EFRD 3QG5A 5HKKD 3MWLA 2ZJ8A 1P2SA 3BFVA 3OFND 2IUTA 1P61B 2JJ2D 1Q3TA 3CM0A 1I4DD 2ERXA 4PO1A 2OFOA 2DFNA 3PFIA 1P62B 2C9CA 3A1SA 3LBHA 4BFZA 1DG1G 1TX4B 3QEJA 3EPLA 5B64A 2OEPA 2PL3A 1IXZA 2XEXA 2HT1A 2BBSA 4L8GA 2OILA 4MRVA 2W00A 4JVMA 5CK5A 1JEEA 1D9XA 1L8QA 1EFHA 2IYLD 3MWYW 1HE1C 3FFBA 5HZHA 5FUWA 3NH9A 2ZYTX 5KNBA 2ASEA 2NQ2C 3W3AA 2X77A 3L82B 1VPLA 2P2LA 4GRAA 4RFSA 1WBDA 2PZFA 1SHZA 2WIBA 1N6IA 5JRZA 1KAOA 3TW4A 2OO7A 3SBEA 1HT1E 1HH4A 2FG5A 4DXAA 2IS2A 4PSAA 1EG7A 3R8CA 2WMOB 3ICQB 1XWIA 3PEVA 4PHHA 4PC2A 1DO2A 2OT3B 3I73A 2G1JA 1RW4A 4PHFA 4OK5A 3OIWA 2JIZA 4QJ5A 2CHGA 2R8RA 2QI9C 2ZSAA 1NSFA 4KU4A 2V6JA 3T12A 3BC1A 4FCWA 4JZKA 1KMHB 3T06B 3UG7A 3IILA 4Q1BA 1FUUA 2W2VA 1KSGA 1E9BA 4E5UA 5HPYB 4HAYA 1JPJA 2B7CA 2F6RA 2CVFA 1BMFA 5J4HA 2ZUDA 4UJ3A 4LJ5A 2BDTA 3FWYA 4WXPA 2KJQA 2Z0MA 4DBLC 2V6IA 3K0EA 2YJTD 2VP9A 5L3SA 1OT3A 1NLFA 3BH0A 5GJWC 5GVRA 1OKKA 4MYCA 4OHZA 3TUIC 3LX8A 1E9RA 4DSOA 3RS0A 4TL7A 4QGAA 2ZJAA 4UNSA 2CHQA 4I1SA 3VR1A 1G3QA 3RS4A 5LBIA 3CPHA 2V7QA 2W6IA 1TF5A 1NIJA 2RMKA 1CJTC 4AKEA 5AUPB 3TGPA 1OYYA 4C3ZA 4C0JA 2OESA 3AP1A 3GP8A 4IDOA 2OLKA 4ABYA 5K8IA 3B1WA 1ZC4A 1U8YA 4EPWA 4IXNA 3LLUA 5JBQA 2PJZA 4IVPA 3H0KA 2JIZD 1K6MA 1OH7A 3K8YA 3PG5A 1E9AA 4Q19A 2NO0A 3UWKA 4XTCS 2ZRFA 621PA 5GJCA 2NO1A 2FDCA 1W1WA 5J4KA 1Z29A 5AUNB 5GADl 1BMFD 3FYHA 4I1OA 4W5JA 4HLDA 2ZRGA 3TRFA 2P5SA 1MKYA 4CGZA 3W90A 1KY3A 1ZD1A 3LO5A 5F2EA 4ZDJA 2C03A 4ESHA 2ZE7A 2EFEB 2WJGA 1AN0A 3QNUA 2ZI6A 3LDAA 2O0HA 4ON9A 1OKKD 4BPBA 4QBGB 1N25A 4EUNA 2JLUA 3GLFE 4DDTA 3RS7A 1IJEA 4YXWD 2NO7A 4PZLA 2CE7A 2V7QD 2W6ID 4CT5A 1X1SA 5IHPA 1ZVQA 2IHBA 2WAXA 2WKRA 1SXJB 4YLGA 5EXTA 1VIAA 2VIIA 1M7HA 4PC3A 3THYB 2J0UB 1GZSA 3CX8A 2KSQA 1N6NA 3CKLA 1ESMA 2RGEA 3CX6A 1XCGB 2J45A 3D31A 5IRCD 1Z28A 5BW8A 1X8JA 1DAEA 1YZLA 3OIUA 1KMHA 1BYUA 2ZRLA 4JLBA 4URVR 3LBIA 4OQMA 1CRQA 2E9SA 5FOVA 1P2VA 1MO6A 2OAQ1 3S1AB 1KK2A 2F43B 3ND8A 4W5HA 3ZVNA 4DLWA 1Z08A 3U4QB 1R0XA 1KO8A 4A8JC 2BKEA 3PJRA 1E0KA 4BLTA 1QHGA 2GBLC 3ZLJA 4KCGA 4DSNA 3PEUA 1Z0KA 1KDTA 1OE0A 4TYQA 1G8GA 1U9IC 2XSZA 2QP3A 4JLNA 4LJ8A 1VYVA 2XB2A 4GP7A 4Q18A 4HAVA 3W3ZB 4ESVA 4Q9IA 4G5GA 1I4TD 4FMDB 1QHXA 3PIRA 3KQNA 2FH5B 3LX5A 2BCJQ 3BERA 1E2DA 4ZCMA 1P9WA 1ONBA 3BAFA 2BIFA 3DO6A 1LTQA 1XCPA 3HDTA 1KYIA 2IYQA 3D6TB 1JPNA 4P0TA 2QROA 1XXHE 4GMXA 4E22A 4P32A 4BLSA 1GAJA 1NRJB 1SVKA 4GFDA 3T1VA 2ZANA 4LOAA 4M9SA 1SXJE 3AVUA 4QRHA 2WOOA 2TMKA 2FJUA 2PMDA 3K09A 1TF2A 2WJJA 4HB3A 3B85A 4KLNA 2EFGA 1DAGA 1VMAA 3AVPA 4GOJA 1L4UA 2MMGA 4Q47A 4MDFA 4NH0A 1YR8A 4DLUA 3W9YA 4DUGD 2GESA 1UF9A 2VSXA 2WZQA 4N3NA 2ZPTX 3ZQ6A 4BFVA 2HJVA 2ZR7A 3RABA 2D62A 1A5TA 1U98A 1NVUQ 5KUTA 1UBGA 2J41A 1P4SA 4XH9B 4F92B 4YMTA 4I81A 1J8YF 1JEDA 1QHIA 4LBYA 2XSZD 4I1VA 2NPIA 5J47A 3ETLA 4LV8B 2VF7A 2GNOA 3WNDA 1T5LA 1SXJA 3THYA 2Q9CA 1UADA 2J0UA 2AD1A 4IVQA 4DB2A 2V54A 4YONB 3CZPA 1IQPA 2C8VA 2OHFA 1YRAA 2B8WA 1TAGA 2VF8A 2BM0A 2XJ9A 3A1TA 3CPJB 5J5CA 4BFSA 3KJHA 2Q6TA 4KI0A 4P4UA 1OV4A 4IOJA 2GVDC 2YOHA 1P7CA 2WKPA 2JA1A 3KKMA 1ZNWA 5DO9A 2F43A 4QXAA 4DLXA 2Y8EA 4G5SA 3C5CA 1OH5A 4B44A 1VCOA 3C14C 4QL3A 3U4QA 1ZNXA 4K81B 1Q21A 2C95A 2HT6A 1M7GA 4Q9LA 5TMPA 3QKSB 3TIFA 1Z06A 1XMVA 4TMWA 2D7CA 3A1VA 1II0A 2O8BB 1E79A 4JL5A 3QKUA 4JLDA 521PA 4C2UA 5H68A 3O8DA 2GXSA 1VKJA 2EWWA 2NGRA 3AEZA 4DDVA 1SGWA 4JLMA 4K46A 4NU0A 3BK7A 1N5JA 3KFVA 1IN4A 1KDPA 3W5IA 1Q0UA 4EDHA 2WBLC 3P4XA 4KAXA 4MGYR 1Z0JA 3QOFA 3BFKA 1S3SA 4MA4A 4US1R 5JI3E 1CLUA 4NL4H 4JJKA 2FEMA 1FP6A 1WDTA 2P6RA 2D74A 1HQYE 2JJ1A 5CDFA 2XNSA 4BUJA 1Z6YA 3GLHE 1NLYA 1PLKA 3D7MA 1D2NA 1ZMXA 1E4VA 1OB5A 2O8FB 4HEJA 4RCYA 2W2TA 1N6LA 2VP4A 3EASA 3KKQA 1KDOA 4E07A 1S1CA 2GEVA 4ZCIA 4M1KA 5FOSA 4B6EA 2QORA 2IX3A 4Q5IA 3ONWA 3I72A 4NONA 4PC1A 4DJTA 4R2HA 1YQTA 3A6PC 4JS0A 3SI7A 3L8ZA 2XTNA 2XJ4A 4TLBA 2YV5A 1E79D 1Z0AA 1N6OA 1W4CA 2ZRIA 2D4HA 1YZQA 2ZI5A 1DO0A 1JALA 1KI6B 2ZE6A 3JZAA 2OLJA 1S9DA 3BB4A 2BJWA 5DN6A 4OI1A 3UXMA 2OFXA 1XZQA 1HTWA 1W2GA 5FTNA 4LHXA 3FMIA 2ZS8A 5BN4A 2C5LA 2LCFA 2ZE8A 3BBPA 4OK6A 3THXA 3MLEA 4TZ6A 4UJ5A 2KE5A 4JVLA 2PJRA 5IT5A 1R0YA 2P67A 4PHGA 1RC8A 1E4YA 2JJ1D 4AC9A 3IO5A 2CE2X 3M6AA 1PUIA 4Z8YA 2VSOA 4HAUA 1AS3A 4JT2A 4IDQA 2A2ZA 4Q4HB 1UEJA 5B58C 1GL7A 5KO2A 1WB9A 3BJIC 2WJIA 4L4UA 4A0RA 5G40A 2CXXA 2V1XA 3QENA 3SEAA 2ECKA 2ZI3A 3Q7PA 5JS8A 2WM9B 1ZCBA 2ZVQX 3Q8XB 4OQNA 1IY2A 1W4BA 4M1TA 4B47A 4DIEA 1W5SA 3P27A 5F3WB 4HUTA 1JR3E 5EP2A 1LY1A 3QKSA 4TMTA 2HEIA 2JASA 4II7A 5H1YA 4DCVA 1HUQA 2O8BA 5DLQC 3NKVA 4IOKA 2WWWA 4JMPA 1B0UA 3LQRA 4LYJA 1N5LA 3BOSA 3RHFA 2BV3A 2IBMA 3AUYA 3GJ4A 2UVQA 2AFHE 4IKEA 2HXSA 3GJ8A 2O0JA 3R9WA 2DFTA 2J59A 1XFAA 2ZJ5A 2A7QA 2G6BA 4CT4B 5DN6D 4A6XA 2H1LA 1KNQA 4GSYA 4IOLA 4DLSA 3ADBA 2EFCB 5F9HA 5K8UA 5JHGB 1WF3A 4TL8A 3IEUA 1XDBA 2F1RA 2CCGA 3DEFA 3I8SA 1CJVC 1QRAA 2H16A 4AWXA 3EWSA 4BLRA 2O8FA 2OM2A 2F3TA 3LNCA 2QGNA 2R6GA 2QU8A 2XAUA 3VR3A 2LKCA 2GTPA 4NCNA 1Z8FA 5AWFC 1HA3A 4G5QA 1I2MA 1UBFA 3IDQA 4OQXA 4JL8A 5DHFA 2H5EA 3GJ7A 3HWSA 1ZD9A 1E32A 4JLPA 1G19A 3KTAB 1GL6A 2N42A 1HV8A 5K8TA 4R98A 3TKLA 2W83A 3MCAA 2JLRA 4U5XA 3AV0B 1U90A 3UATA 2VHUA 4XIGS 2RGBA 1P2UA 1ZW6A 1J70A 1KI6A 1OFTA 3I5XA 3WRXC 1AJEA 1XEXB 2AX4A 4Q48A 4WZAE 3KXIA 4EQ6B 1Q57A 4AYXA 3WNCA 3A37A 3Q85A 3B6EA 2JLXA 1LF0A 2AHOA 3KB2A 2GK7A 4A8JB 1S1MA 4L16A 4Q4HA 1XF9A 4PZZA 4FMDF 1MRSA 2G88A 4FCVA 5FUVA 3O47A 4TTQA 2QY9A 4BFYA 2GAOA 4IDPA 4NDZA 3VNVA 3Q5DA 1Y3AA 2ZEJA 4FCTA 5FTJA 5KPJA 4EPTA 4Q02A 3GD7A 4D4LA 3H84A 4LCBA 1LFDB 1GKYA 2UZ3A 2ZREA 1J90A 2C04A 4BFXA 5CIQA 2D3WA 2SHKA 3A4MA 1AQYA 2NIPA 1X1RA 3EC2A 2VSFA 4R7ZA 1G6OA 3CIOA 4PQRA 2NPFA 3KKPA 4PC6A 4ZDIA 2CL6X 2AR7A 2GRJA 3C16C 1CJKC 1NLZA 5EP1A 2P0EA 3AP3A 4D0NA 4M4SA 3UANA 1H8HA 5JWOA 4WA7A 3SN6A 1XZPA 1BH2A 1NI3A 1G7SA 4ACAA 3VHLB 3LV8A 5KDOA 4XWAA 2CBZA 3T1TA 4FIDA 3QE0A 3LFUA 3X1WA 1MR3F 3BORA 3BXZA 4V0KA 4CIDA 1IN5A 2A78A 2ZJOA 3KKOA 4GZLA 2ZR9A 4DZZA 4URUR 1E1RA 2PBRA 3AP2A 4URWR 2D7DA 2ZYUX 3T1OA 4QNMA 2FMXA 2FSHA 4HAXA 2PCJA 4QBFA 2WJVA 4TMKA 3UMRA 3DOEA 3GFPA 4TMVA 4XD7A 3L43A 1NKSA 2AKYA 5DSZA 4TL6A 1KNXA 2PT5A 4OJQA 2R6CA 2YC4C 2XITA 4NYMR 3KTAA 5TDHA 1MO5A 1RFLA 4V0NA 3NDBB 5HCIA 5FI0B 4D4JA 3FE2A 3N70A 3WHLA 2ERYA 3Q72A 4HATA 3QPWA 3SFZA 1WQ1R 4Q9JA 1YJ5A 5FTKA 2G1KA 5KYKA 1MOZA 3IQXA 3VKWA 4Z54A 1IXRC 3AH8A 3CRW1 3MG9A 3CRRA 1CP2A 4LJAA 3EWAA 1T6NA 1H8HD 2OBLA 2QM8A 3U3MA 4EQ6A 2JLWA 1E2PA 3NBYC 2NOAA 3H86A 4DCUA 1RKBA 1E1QD 2C99A 4ILEA 1F60A 2AWOA 2F1JA 2ATVA 1VYTA 2GZHA 4F4JA 3LXRA 1EFRA 5LD2C 4D25A 2V4ZA 4GPTA 2RGNC 3Q3JB 4A8JA 5FTLA 3FKQA 1E1RD 3QBTA 2EFDB 2GBLA 2C98A 1SHKA 1G3IA 1GITA 1U9IA 5EE1A 2I1QA 5JEEA 1CTQA 1KZGB 1Q1ZA 1NNEA 3IPYA 5A4JA 4JBWA 2GCOB 1XD2A 1R7RA 4XWOA 2N1BA 1EGAA 3QY0A 1M8PA 3HU3A 3GLIB 4KVAA 3L2OB 1DAFA 4BFTA 1E3MA 2R9VA 2ATXA 1ZM4A 1CULC 4U02A 3WMGA 4F4IA 4M1YA 4LUCA 4AD8A 5G3YA 1G16A 1XPUA 2C96A 2Q3FA 3EZFA 1VCNA 1Z2AA 3GPLA 4NCJA 1NN3A 5AJWA 4TYNA 5DHAA 2VA8A 3G5UA 1KO1A 2BKUA 2IUSA 3NEYA 3VQTA 5C4MA 2RKOA 1V5WA 4O25A 2HV8A 3L0OA 1A2KC 3LBNA 4A0GA 1Q20A 1TQ2A 1E69A 2D2EA 4LBWA 5G3ZA 3B1XA 2JCSA 3V9PA 3F0TA 3THWB 2QPOA 4M22A 1R0ZA 1GIAA 1OIVA 2PX3A 2DB3A 1NJGA 4BEBA 3FGNA 1T3SA 3W8NA 2GA8A 4WOPA 1LV7A 1UFQA 5EUMA 4MRSA 2VHTA 4KBFA 1EX7A 3MGCA 4DSUA 5B2ZA 3REGA 4HB4A 1EWRA 3AGPA 3U44B 3NDPA 3C4JA 5F9FA 1XRJA 1JAHA 3GFOA 4AG6A 1KO4A 2QRZA 1Q12A 4RCZA 4ZCLA 2QMOA 1IXSB 4V03A 5DISB 2QPTA 1OXUA 3MUFA 1ZNZA 2J0QA 3TMKA 1XJ0A 3HR7A 2CCKA 2ZRBA 4M21A 4DCTA 5AJZA 3PUXA 1AKYA 1G8FA 5B57C 3HP1A 5FTMA 1EX6A 1SKYE 3QI2A 3U60B 3B9PA 2X2EA 4UNRA 4Q4JB 1YVDA 2RGGA 3QPVA 1G20E 2WWFA 1G17A 4JJZA 4QGFA 3WRYC 2A5YB 3ZQJA 3K0AB 2DYKA 1Z47A 2NO6A 2XZLA 4NCIA 4KODA 2DCUA 3DM5A 1E2GA 3P1JA 3L0IB 1MABB 1UBEA 2JLQA 3TAUA 4LV5B 4NCHA 3ZGXA 4LHVA 4DC9A 4BLOA 4C0BA 3UG6A 121PA 1FNNA 1GKUB 1KJYA 3A1WA 3MMPA 3U3JA 2CNWA 4EFLA 2KBFA 4D0LB 2ZSFA 1NVWQ 1XMSA 1A4RA 2GCOA 5C18A 3FOZA 2ORWA 1FMJA 5C2JB 3GLIA 3BH6A 3QSYA 4J0QA 2AL7A 2FU5C 4H9GA 4X8MA 3ASZA 1ZD8A 5J4LA 3U6BA 4G0NA 2ZJ2A 3NIBA 4BECA 1TUIA 1AS0A 1KO5A 2UZIR 721PA 5FOXA 1G21E 1FFHA 2G9NA 5D3MB 1OYWA 5CJ2A 3CF0A 1S8FA 2PLFA 4QG7A 3UMSA 4DB4A 3E5HA 3BE4A 5JCZA 3CPEA 1ZYUA 2IL1A 4JLJA 1Y63A 4MYUA 2FV8A 1G41A 4M1SA 4PTLA 4RZ2A 1G8PA 1PLLA 1KDRA 4UQOA 3TSWA 4Q4AB 3KXKA 4KHZA 4YXWA 3BIFA 3FMOB 3BS4A 2IWHA 4WZ6A 4MUAA 3WY9A 1WXQA 3U7FB 2YOGA 3THWA 1WA5A 1D2MA 3KUCA 2G0TA 1SULA 3AF1A 1IBRA 4I4LA 3ADKA 4QC2A 2GWHA 3GJ0A 4LBZA 4TQ9A 3KDSE 5DI9A 5FPYA 5JCPA 2HYIC 4NBSA 2F3RA 3CNOA 5FUXA 1NBMA 3LA6A 1N6HA 1R8SA 4PPNA 4B3BA 3E1SA 3ZD7A 3B9QA 2CLCX 1C9KA 1QVAA 2CNWD 3U44A 2CL7X 2REXB 3U6KA 5EP4A 1Z6XA 2ANBA 4WVFA 3VTKA 4D6PA 2XTMA 2ZXUA 1FMLA 4IHQA 2KBEA 3BWDD 3QQ5A 1QZXA 5DIFA 4BFWA 1F3OA 3ND9A 3U2QA 4C0HA 4JL6A 4AK9A 4XOIA 1PJRA 1Q1BA 1NN1A 1OJLA 2CEAA 4OKSA 4RD1A 3SJZA 3SJCA 1G8YA 3UPUA 1DPFA 1QHNA 4Q4JA 3WNBA 2NZ8A 4UNNA 1VDZA 3QIAA 2MSEB 1GKIA 3MRSA 2GJSA 4HDQB 5EUQB 3KKNA 3K0AA 3QBVA 2ZI9A 4FD2A 4R71A 4WBSA 4Q7LA 1P72A 5JI2E 4OYHA 1MABA 4P3YA 4GZMA 5DGXA 4KSCA 4Z51A 2FFBA 1E2MA 1TU3A 3PUYA 2GETA 3EARA 1TTTA 3NTUA 4O3MA 1CEEA 1F48A 2Z83A 3K9GA 1J8MF 1MH1A 2WKQA 1QHHB 1MT0A 4MYHA 1KMQA 1NBMD 1X86B 2WWGA 4NMMA 4HLUC 1AQUA 3K0CC 3SE0A 1TQ6A 3RSLA 4DUGA 1TQDA 3CNLA 2AK2A 3VX3A 3P26A 2DPXA 5KSPA 4IW3B 4C9BA 3VR5A 4DRZA 4EPXA 2RGXA 1RVDA 1SKQA 3X1ZA 4QKQA 4JSTA 2AWNA 4H1VA 1GWNA 1FTNA 4IOMA 3KQLA 2P6UA 5D3MA 4U7DA 4MKHA 2PMKA 1NKTA 3OIVA 2IYTA 1N6PA 2PEZA 2PH1A 2IC5A 2IF0A 3RRMA 3PITA 1C1YA 2PZGA 3SFVA 1M7BA 4PO9A 1SVWA 1XNJA 4Q4AA 3TUZC 2RAPA 3I62A 3I32A 5FL3A 2WV9A 4URXR 3KQKA 4BFUA 5IDVA 1RIFA 3GFTA 4MRPA 2QENA 2KI5A 2ZSEA 1US8B 1XD9A 5FH9A 4JLAA 3UKDA 4RD6A 2VRWA 3S1AA 3WMEA 4TLAA 1W47A 4GMDA 4B2LA 2HF8A 1E2NA 1Z6GA 4O0MA 2GCPA 1LF5A 3UMFA 4KFUA 5C46F 4F91B 2Q0HA 3CR8A 3PEYA 4TYYA 4CDGA 3AKYA 2X19A 2ZRAA 3EZ9A 2EYUA 4OHWA 4ZPXA 2H17A 1L2TA 4DLRA 1XPOA 3CH5A 3EZ7A 5FBRB 4NYIQ 2WICA 2ZIAA 4Q1FA 5BXQC 2ZROA 1S9HA 3PR1A 2CCJA 4MITA 5JFGA 1NMZA 3CRQA 1IONA 4K8OA 1KZ7B 1E0SA 1FW6A 2Q3MA 1H8EA 2NO9A 4LBVA 5LD2B 1GRNA 2VTKA 1SZPA 2BBWA 4JKYA 1G6HA 3EZ6A 3T5DA 1NY5A 3ZVRA 1E9CA 2BMFA 3VNUA 4IJMA 1CU1A 4BRWA 1NIPA 1H65A 2GXUA 1VHLA 4ZV4A 1IY0A 5KSOA 4HAWA 4NYJQ 1G7TA 1HE8B 1KJZA 1ZM3A 2QL6A 3PUWA 3THXB 1DE0A 3DOFA 1IN6A 1N5KA 2DWOA 1QHHA 4YDSA 1EESA 3I5YA 4HDCA 4IDNA 1Q3HA 2AXPA 3GEIA 3RANA 3OE7A 3PEWA 2ZU6A 5CDFE 4LWZA 4B3GA 4DCNA 2ORVA 5LB2A 2W0MA 3LXXA 3PVSA 2XTZA 1UKVY 2MSCB 1OXVA 1ZU4A 5JRJA 3AF2A 4QOSA 1E9FA 1ZIOA 2ZUCA 3B13B 4Q9KA 3A58B 3QG1A 1T0JB 3B1VA 1KI9A 1Q1EA 2IEZA 1ZIPA 4L15A 5DYIA 1NF3A 1P60A 3FHOA 2EFHB 2QZ4A 4TWZA 1GILA 3B5JA 2V8OA 2ZS7A 1H8ED 4RD3A 5EZ6B 2BHRA 2OBNA 1KK3A 1U94A 2J5XA 4EFMA 5FBVB 3R7WA 4LY6A 4TYWA 1O87A 2YC2C 4P4SB 4YMSA 1MO3A 1XMJA 1IN8A 4UNPA 3BB3A 4PR0A 2GZAA 3FHTA 4D4KA 1XEWY 1US8A 1E2QA 1KSJA 4XVRA 1LVGA 1CR4A 4KJZA 4NZYA 3N2EA 4XSHA 4DKXA 4V0LA 2V9PA 1S0UA 3WBJA 5K8LA 1JXOA 2BEKA 3W6NA 4KLZA 4S35A 1ELOA 2CHVA 4B2PA 1EFCA 4LYAA 5FUYA 1KJWA 3FTQA 4N0DA 4PHTA 3U7EB 3PQCA 2WVJA 2BMDA 3H4MA 4RKEA 5CB8A 1IM2A 4NYJR 3OE7D 2CDNA 4CZ2A 3TSOA 1E99A 2VPPA 2QAGC 1A2BA 3QKRB 3BB1A 4W5WA 4A2QA 2QRNA 4DWJA 1CXZA 4IFBA 3K0SA 2OCPA 1AZSC 2REOA 4PAMA 3RNLA 4QNRA 3F5FA 1Q22A 2BCGY 2WPDD 2RGNA 4HB2A 3TSZA 4XJXA 4TT3A 3EIQA 2QE7A 5JZVA 2Z4RA 4D2IA 3DMDA 1NP6A 4DHEA 2QN6A 3BFXA 2ONJA 1PLJA 3U61B 5FPSA 4GDFA 2VL7A 4PQFA 4CYMA 1TNDA 3H1TA 3KFXA 4NHOA 3LWNA 1CF4A 1DVRA 1IOZA 3EW9A 1AS2A 1QVRA 5TARA 3GQBA 2YKGA 1R4AA 3U7GA 1A1VA 3CBQA 2IT1A 3B60A 4QHYA 1K8RA 2C9YA 4ARZB 2OZEA 3K0FB 3CF6R 2DBYA 1SVLA 2GCNA 3FFAA 4KFTA 1DAKA 1Z22A 2JDIA 4UXHA 4LSGA 2GHIA 1KGDA 1W5TA 4GT1A 2I3BA 4CVNA 4EJSC 2A5JA 4HI0E 4LZZA 1KSHA 1HYQA 5IF9A 1G8HA 2D2FA 3V4FA 3RWMB 4WIAA 4FMBB 4PC7A 1P75A 4MH0R 2QTVB 2EU8A 4QHSA 1LS6A 4ZI2A 1QDEA 2RB4A 1WBBA 4D26A 3GLGB 5FBQB 5BWMA 3AVWA 1ZBDA 2O8DB 2QTFA 3ASYA 1M6NA 3HYTA 2ZRDA 3V4RA 2BBOA 5LPNA 4FW9A 4TT3D 4P4SA 2QM7A 5FBWB 3VR6A 2QE7D 2QUZA 4LC1A 5HZKA 4BZQA 2YNMA 5FI1B 5IK2A 2IYSA 3Q9LA 2B8TA 2IXFA 1VYUA 2WMNB 3CONA 3TUJC 4BLQA 3I3SR 5AJVB 1GOTA 4TZ0A 3CNNA 2G3YA 4Q00A 3AVQA 4Y0VA 1T5IA 2VP0A 5JLJA 4CEHB 1XCMA 3LY5A 1JR6A 1DG3A 3T5GA 1R2QA 3IIJA 1GRQA 4EIWA 2IW3A 3SU8A 2WSSA 2JDID 4TN1A 3BRWD 3TBKA 3HU1A 1NG1A 2EYQA 3RSOA 1OXTA 1UKEA 1I4LD 3QKRA 2IYRA 3GMTA 1AIPA 4JYBA 5E7MA 5G41A 1UEIA 1GL9B 4FXPA 4B3XA 4A0HA 4HAZA 3LQQA 2A30A 3CUEF 1E2HA 2IEYA 2ZRHA 1X6VA 4Q21A 4Q7JB 2AKAB 4U00A 2AFIE 1TU4A 4M1MA 1OPXA 4QM7A 1YZUA 3EAQA 4PAQA 5GJBA 2HUPA 1UKZA 5D3QA 5EP3A 2WJYA 1ESNA 2GZDA 4FMCB 4TQUS 5AUQA 2XZOA 2FWRA 3A8TA 3OESA 4KITB 1YRBA 5EJEA 4CEIB 3RS2A 5IK2D 2HDNB 3W6OA 3U3OA 2J9RA 3ZVLA 1ZP6A 2O5VA 1G7RA 1HEIA 4PO8A 2VH5R 5SZIA 2IYWA 1KI8A 4M9XA 2ODEA 4A92A 4EKDA 1CJUC 4ARZA 1TL7C 1Z83A 2F1IA 3K0FA 5M04A 1OXSC 1ZC3A 4DLYA 2X1VA 1L7VC 4TLEA 2XZPA 1G4UR 2MSDB 2QQ0A 2PEYA 3SHWA 3IBGA 2WSSD 1Z6TA 5HTKA 2OG2A 3MJRA 1R5OA 5LDDC 3EG5A 4EPYA 1XD2B 4LYFA 3GLGA 3IIMA 3IHWA 1ANKA 1E9DA 1WP9A 2DY1A 1F2UB 1NN5A 2J7PA 3VU9B 5KHOC 1U0HC 2O8DA 4LJYA 1KKLA 2GJAA 3I1FA 2JLYA 1WCV1 4RFVA 3A1UA 3PUVA 5EQTA 2X8AA 2R6DA 2NMVA 1YR9A 2BEJA 4GP6A 1AGPA 1G291 1Z5ZA 2H7VA 3MWKA 2W58A 3SC3A 1NG9A 3CB4A 4MKFA 5FR1A 4NKRA 3RYTC 1OFIA 1PZNA 4KYUA 2P3SA 2FNAA 1E1QA 5FL7A 1J99A 2RGAA 1OB2A 4A36A 5F98A 4C0AC 5EE0A 4TMXA 1GUAA 4DEYA 4B3DA 4PZYA 2XXAB 2ZJZA 4RZ3A 4N0EA 4CEHA 3IBYA 3GEHA 4G5OA 4P31A 4A6PA 4TTPA 5AK0A 3RRYA 2ZRNA 3Q7QA 1YKSA 2PLRA 3RC3A 1NVVQ 4BRUA 4TTRA 4OBEA 1UAAA 2E1RA 3QVUA 2FN4A 4E09A 4LHYA 2ZSBA 4GI7A 2KB0A 1F5NA 1YHNA 4A15A 1E9SA 1K5GA 1VG8A 1Z63A 1U0LA 1X3SA 3SQWA 2FPLA 3PENA 4RD0A 3I4LA 5FPTA 2H92A 3K9HA 4KSBA 1FQKA 4TLDA 4MGIR 2J7PD 4LV6A 3CWZA 3X1YA 1BKDR 1G4AE 5SZKB 4FINA 5CIWA 1FOEB 3A36A 2OE2A 3QF4B 1U0JA 4QHTA 3U7HB 2FEOA 2IWRA 1E98A 4CEIA 4HLUA 4YMWA 3K0CA 1N5IA 1XBTA 4KFRA 2RGCA 4LGMA 3CH4B 4B33A 1Z6AA 5FL7D 2DHRA 2CLSA 3CWQA 1YZGA 4QJ3A 2J0SA 1Z0DA 2DWQA 1R5NA 4MUBA 1YE8A 5BQ5A 1N3BA 2GDJA 2ZI4A 1S4QA 4JLVA 2H8KA 1E2FA 4B48A 5CITA 1YU9A 1R0WA 2OXRA 2ZRMA 4FI3C 2ZAOA 3QPUA 4OL0A 5LB4A 3P4YA 1KSFX 1D5CA 5FFMA 2NZJA 3TR0A 3SBDA 4WZBE 2FA9A 4RVCA 3EPJA 4IVRA 5EXPA 2VHQA 2GILA 4PSVA 3G82C 1RRCA 1QHSA 2FF7A 3VAAA 1F2UA 3VU9A 1CRPA 2IA5A 1Z0FA 1G64A 421PA 1Z0IA 3CW2A 2ZU0C 2QSYA 1T91A 1V43A 1XB2A 2YWEA 3QXHA 1UDXA 1KK0A 4HUQB 4WXRA 3GEEA 2FFQA 3N5CA 4IXMA 3ADCA 1NN0A 2R2AA 4RSGA 1CJMA 3KX2A 1OIXA 1I2DA 1SVSA 2EQBA 3GCGA 1XMIA 4IEIA 2IYXA 2ZJYA 5TXGA 1COWA 1PVOA 3DMNA 2RGDA 1JNYA 3AVVA 4B43A 3D8BA 2QMEA 3HJNA 2XXAA 2QAGB 1TEVA 1OH6A 1OIWA 4B76A 4O2RA 1G5PA 2H18A 4ASUD 1KY2A 3OZXA 4BASA 3UIEA 5AUOB 1IAQA 2JLZA 2YZ2A 3DZDA 3KZ1E 5KSYA 5CLQA 3AKDA 2IHYA 3B82A 1DAHA 2VQSA 4B32A 5FPKA 5JECA 3IEVA 1E2EA 4KYIB 3EX7C 1P73A 3AQ4A 2FGKA 1AA9A 1HURA 2ZI7A 5EXSA 3RRZA 1HY3A 1PUJA 1O3YA 2XGJA 4QGHA 3NBZC 1JI0A 4L9WA 1KI2A 1A82A 3U5ZB 3LD9A 2F7SA 4ZKDA 3K1JA 1UJ2A 2IF2A 4TLCA 1II8B 4YMUA 4G5RA 4KO8A 1FZQA 3GLIE 2CL0X 2JAQA 2PZEA 8OHMA 1AZTA 2QG6A 2YYZA 3QXSA 4BWYA 1UM8A 3FHCB 2BWJA 4M2LA 3QF4A 3NC1C 4V0OA 3NVAA 3LVQE 1LW7A 4BZXA 3WP0A 2W6JA 1G7CA 3X1DA 1QG4A 1KK1A 1T8TA 1LB1B 1JBKA 1KIMA 3WYAA 5A5GA 2OCBA 4EJSB 3ZS8A 1G3MA 4TQAA 3FB4A 1P9RA 1COWD 4HB0A 2ZQ5A 3KJGA 3P32A 2K5UA 4LC0A 2QNRA 4NPHA 1B23P 5EE3A 2DWPA 3FKSA 4A1FA 2AK3A 3J81k 4M53A 1JXMA 1G1MA 4XTRA 2IYZA 2QP4A 4JYCA 2FSFA 2ZRJA 4RJLA 2P65A 2QTHA 4AI6A 1F2TB 4Q7KA 2ODWA 4LI0A 3KUDA 1UDWA 5J4VA 4TSFA 5CB6A 4IFEA 2BBTA 1GRRA 5L3RA 1NBME 4LHWA 4ZDKA 1FPMA 1X8LA 3SHFA 1NY6A 1MO4A 5DH9A 1VCIA 4M0LA 4R9UC 3TQCA 3IGFA 4LK2A 2WSMA 1VHTA 2B6HA 4URYR 2F9LA 3T1QA 4OI0A 3U3RA 2IXEA 1JAIA 4HUQA 4KXFB 1RRGA 3V00A 1J2JA 4OHYA 1VCMA 4WAUA 3DPUA 3OAAA 1BOFA 1EFTA 4DDUA 4ZI3A 4QBIA 1XX6A 2QT0A 2W6JD 4N1AA 5J4YA 2IS4A 2G77B 4C0LA 1R6BX 2FZLA 5ELXA 1HQCA 2QAGA 4JLOA 1W4AA 4Q1CA 1WRBA 1W36C 2QMHA 2RHDA 1FUKA 2F9MA 1KTVA 5H70A 1G3RA 4RZUA 4QJ4A 3VHXA 1KHTA 3AVTA 1BS1A 3WHKA 1ZCAA 5EE9A 4FMCF 2QBYB 4AYWA 3FKSD 1CR1A 2O52A 2QPAA 1HT2E 1ZUHA 3AF4A 4Q4LA 3TVTA 4DLZA 3K70C 1CBUA 3GLFB 4XSGA 3EA0A 2GK6A 2VP5A 4JT4A 2N46A 3W34A 3TJZA 2J7KA 3DVLA
chains in the Genus database with same CATH superfamily
4HH3C 4TSFD 3HKEB 2FFAA 1IN7A 2D1TA 4RTMA 4W9MC 2IOHA 1AK2A 1EH5A 1CHDA 5BQFA 1NYLA 1U9ZA 5AVWA 3JVUA 2GK3A 4J1NA 3EODA 5LDGA 4CE6A 2HL6A 3KWJA 3E3NA 4QUJA 4AKIA 3HDJA 4PX3A 1SOUA 5EIAA 3WQQA 2J30A 2QEQA 5KHLB 1E2BA 2BJVA 2L18A 3WL6A 2IK8A 2O54A 3AT1A 4JVSB 4X91A 5B3LA 3PX3A 3NHYA 4U3JA 2V3VA 4G41A 4XAQA 1H2RS 5KNCA 3C3MA 3IPRA 3UV3A 1FFCA 1UJ4A 1OJ7A 3KXPA 3OAAD 3KPUA 4XB1A 1JG7A 3AL2A 2J3MA 2WB2A 1HMYA 4QOHA 1RYNA 3MFYA 4GVPA 5CX1B 1EGVB 3B36A 4NFYA 4L0QA 1SCKA 4CI0B 1C9NA 3E22B 3PFHA 4KIGA 4CRWB 3VR0A 1QYXA 1GDDA 2J9GA 4J0HA 2FWMX 1HLFA 5CCDA 2OQ2A 2D1RA 2PKXA 3GJ5A 4HSGA 4QOEA 3F8TA 4J0EA 4QDKA 4W8HA 3DQQA 1JB9A 1G5RA 2X86A 5D5PA 4BNLA 1ST2A 4Q3NA 4QOFA 5IH3A 4O33A 3L1JA 5B3KA 3RIGA 3OLCX 2GJKA 4IG9A 1F2TA 2VDWB 3O0DA 4EZIA 5L3QB 3V3TA 3CLUC 1GA4A 4MS4B 3KWLA 5E4JA 1QIGA 5FULA 1MQ9A 2C2MA 2PH5A 2CHFA 1VCHA 1HDEA 2PA3A 1KYTA 1GLNA 1ORRA 2HM7A 4NBVA 1A7JA 4CHGA 5EIXA 4PGFA 1SVIA 1P5RA 2HBZA 4WXEA 1K7CA 1SEVA 1NV9A 3K2EA 4CM9D 1FXSA 1Y1PA 3EVCA 5GV8A 1N5OX 1U31A 3BTVA 5IN5A 3RHZA 1GSAA 2A0KA 1B8OA 2QTLA 1QHYA 4I9NA 4W1PA 1LRLA 5G0VA 4FHEA 2Q28A 4RENA 5KYXA 4QM6A 3TO5A 1TZCA 3GK3A 3FYDA 3N7TA 5BVGB 3AVOA 1M8KA 2DKNA 2Y1LA 4ZIRB 4KPUA 3UOAB 1O8CA 3NHAA 2VOJA 2X22A 5CVTA 1Q91A 5CH3A 3RAEC 4TUYB 1VPDA 1ZUIA 4F38A 3ITNA 1HE2A 3G8CA 2VF4X 3NPMA 1N0VC 3LT1A 4I4CA 2PGIA 4MEJA 5EE5B 4IAOA 2NXJA 1CQWA 5J5AA 3WGQA 2FFHA 3KJEA 1HXHA 2YYYA 1W0JA 1Z0UA 4FN5A 4FVTA 5E6RA 4B3CA 5F35A 4P84A 4TKUA 5IP5A 3DT8A 1NULA 4JYMA 4IP0A 7MDHA 4MQ5A 1JG6A 5BR8B 3VKGA 3G9ZA 3K0HA 3NRCA 3LKDA 4FBGA 4RZQA 4DUZB 3FMGA 3ILVA 1PJ3A 4QGGA 1V9LA 5ALZA 4P38A 2O6HA 3F4LA 2QP9X 4XVUA 3MC1A 3THOA 1SVOA 1OHHD 4G0UA 2W6MA 1RKQA 2P6NA 3DLHA 4ZHSA 2F55A 1ISHA 1YL6A 5T41A 2PN1A 3EGVA 3HYRA 4PFKA 2QRPA 4K0KB 5K3DA 1Q11A 4LYGA 2DUMA 1XRQA 2RHMA 1QRRA 3KO8A 2O2JA 4JA0A 4UXJA 5A05A 3V8MA 4ENVA 4YCMA 5JQGA 5JXWA 1FTSA 1IHXA 4AKHA 1JL3A 4Z0PA 3ADOA 3OQHA 3G3EA 4OLBA 2ZTUA 2WWHA 3LCVB 3SZOA 5EMHA 1SU4A 4FYKA 2GF9A 3FSRA 3N75A 4AICA 5B7NA 1FX0A 2AEMA 1DELA 4CMKA 1G3UA 4M1OA 5JWRA 3VU8A 5K0ZA 1UBUS 4N3BA 3ZU6A 3C3XA 4Q03A 1T0UA 2XKBA 1YTLA 4J43A 1EWTA 3BRCA 1Z45A 1Z7YA 3FMFA 5KPDA 1DG9A 5TNXA 2PHZA 2IHVA 1AB6A 4FONA 3DKPA 5P21A 1QZ3A 1SY7A 4LDJA 4UOEA 3AUTA 3G5TA 3OLVA 4GWLA 2YV4A 4MVJI 1JW9B 1KVUA 3KOUA 1UXJA 2I7DA 1YUBA 2D06A 3NAZA 2VI5A 1G98A 1YR7A 2VBCA 1LX6A 1Q50A 2BMJA 5A4AA 3TK1A 3SYKA 3WBFA 3A9VA 1MU0A 1H2FA 1DNPA 3PCRB 5CFZA 1C3LA 1Z25A 5IXSA 1NMYA 4MRMB 2IYVA 3C3AA 5E4FA 5HJ5A 4GNRA 3MINA 1R64A 5K09A 2IUFA 2X6TA 3RFUA 2X14A 1ZVVA 3EVAA 2WLTA 3OMXA 4RXUA 1RU3A 5GGXA 1CUDA 3TNYA 2BVNA 2NU6A 2QT1A 1Z2PX 3V9AA 2GF0A 4ALNA 2ORIA 1BVHA 2PGJA 3PDCA 5EPOA 1W46A 1BGVA 2VSYA 1P39A 3ER6A 3CS3A 3OJOA 4LNUB 1V9CA 5KNDA 3T5AA 1JU3A 1CEXA 5CM9C 4HXGA 1JTEA 4R2KA 1XTBA 3E1GA 1QGUB 2RGUA 1D8AA 5CVDA 3GLHB 1J0EA 4D8VA 1EUDA 1GTZA 2SICE 3GLVA 2R8BA 3QPAA 1GZ7A 3B1ZA 4UZEA 2HRBA 4KP7A 3E7WA 4V02A 4L4ZA 1R00A 1TC2A 2A3RA 2PT7A 2WUVA 5ADWA 3FCEA 1VBFA 3R7LA 1J5XA 1R6TA 4P92A 2WHRA 1CS4C 3AIOA 1H05A 1GRCA 2JHCA 3PFGA 1ECBA 2FSVA 3EFEA 4PNEA 5F2OA 3DS8A 4UVEA 1WDMA 3NTRA 1ZIYA 4LJ4A 2JHFA 4YK7A 4RTPA 3V1KA 2OHXA 3EOAI 4TWRA 2Q21A 1I2CA 2A8YA 2I54A 3PDHA 2DB3A 1QK4A 4GSKA 1R9JA 3AFMA 1YZYA 4TXHA 5H9WA 4Y2UA 4II3A 3K9LA 3CN9A 1U8AA 1QJCA 1QIHA 4HDAA 4LMPA 1ZIXA 3AF3A 1MN6A 4IQ0A 3D43A 2X5NA 4KOEC 4BE7B 1ZPDA 2P4QA 4J1QA 5LQAA 2O8EA 5KDDA 4WLNA 3IMGA 4GOXA 3ZNNA 2E6KA 1ISPA 1CS0A 2XQVA 3JQ7B 1T9HA 2GTIA 3K8ZA 4HNSA 4LOLA 3W2FA 3HPQA 4YRIA 1G5TA 5A4FS 2UKDA 2E49A 3UOGA 3T35A 3A4VA 4KMMA 3UJNA 1DXYA 2ONKA 1BRTA 3BL6A 2WM3A 2JBWA 2XXJA 2J46A 4G1UC 2OYSA 2VKTA 2VTVA 3OEED 1QK5A 5IDQA 1QBKC 4L8VA 2H1OA 3MQ2A 4EABA 1BFUA 1MQ8B 3PRKE 1VI2A 1OILA 2QSZA 5EWMA 5GJVC 2V7UA 821PA 5AOCA 3A4TA 4Y2QA 5HE8A 1XCOA 3PJFA 1GM5A 5JJBA 1W88B 1OT5A 5CM8B 1FRNA 5CAEA 4IX9A 3OJXA 4YJHA 4TSKA 1H94A 2GTHA 2VO1A 3L3BA 2UVPA 4C43A 5KYUB 2IZ1A 1XCLA 4I1UA 2I3GA 3IOBA 3WAGA 1I7DA 2F17A 3ZTWA 4BVBA 2H2AA 2WIGA 4HC4A 5KSWB 1X7ZB 4BO7A 1DAMA 1JSCA 1VG1A 2SKEA 4RKQA 3IB3A 2WU4A 4YP7A 4NP6A 2O07A 5I8PA 3AKZA 1SXQA 4EEKA 1JYEA 5K3CA 4B75A 4YMGA 2Q2VA 4YQFA 2YINC 1YR6A 2HLDA 1LNZA 2PZBA 4W82A 3TD2A 1K8QA 4C30A 3CRVA 4BWVA 2R44A 1Z2CA 3CZMA 1SOMA 4MGZR 4OXRA 4QTXA 1E3WB 1UJMA 1EP2B 3DT9A 3TTTA 3VOSA 4ESOA 4EYSA 2Q8QA 1X94A 3UH1A 3SBXA 4LF9B 4IUCS 4R8LA 1IZYA 1NP7A 3B78A 5DLDA 3TR5A 3LBYA 3BCUA 3H5AA 5M3BA 1KOGA 3MEQA 2COUA 5JCOC 3QKTA 4JI5B 4DA4A 1ZN9A 2IDZA 2XMCA 2GKSA 3A26A 2HFKA 3ABOB 4ZOBA 1HK7A 2JW5A 2IS6A 1P19A 1U63A 1ZDMA 1TLTA 4UDNA 4CHTA 1UODA 3IODA 2QZZA 4D80A 4B73A 4FMPA 1DIGA 1LZLA 2XEDA 1K9VF 3DE5X 3GJ6A 1AQLA 5BV2P 3R0VA 1FRVA 2FPMA 3LI2A 3LHIA 3TQFA 5C8YB 4P0PB 4QGSA 3KZXA 2PLAA 1E0JA 4IV0A 5A5DA 2BEWB 3OQNA 3OJWA 1E2LA 1DIAA 1UKBA 3I12A 3JZMA 1CUCA 1IJKA 1KEZA 3KJNA 1JBEA 1E94E 1P9NA 3PTLA 4KTTE 1U5BB 2XVZA 3X0DA 4MW5A 1XZKA 3IPLA 3PP8A 4I9GA 2LGJA 3EWNA 1AKQA 4PVCA 1RYHA 2VPYA 5IJ9A 4BB9A 1J21A 4B0PA 3E7XA 4P4TA 3PNYA 4PLGA 3ZCSA 5BWOA 2Y1EA 4F93B 1NSTA 2ODPA 4G9GA 4N6NA 2IVZA 1PO7A 3JR7A 1DAIA 4LCJA 2Q9BA 4MWZA 5EMMA 2OFWA 3U49A 4J94A 3UWOA 5AHXA 1ZJ6A 4K6OA 4ZCTA 2XX3A 3S6JA 1FX1A 1ZCZA 2WT9A 3NC0C 4WZAB 3ZHYA 1RJ9B 5HFNA 2EG5A 2QVYX 2XVMA 1ML3A 1I3LA 1LSUA 3AKEA 5FJJA 2Y4NA 4N49A 4UCFA 5TEWA 3QA9A 4QDOA 1DC3A 1JHQA 3I8XA 3SIXA 1U8EA 1K7FB 2CYBA 2GN1A 3H17A 3B12A 2QMUA 3TNFA 4ENWA 3OKFA 4RE6A 4MPPA 3A27A 4OQFA 3QLUA 4Q1DA 3V33A 3UKJA 1MGOA 1P0QA 1U7OA 3ED1A 3H4IA 4KIFA 1NDHA 2DX7A 5A9SA 2EFJA 3ZE1B 5DE3A 3LWBA 4WFKA 3GLGE 2RH8A 1GP2A 2GAIA 4HNRA 4K03A 1DBSA 3VOBA 5LU9A 1NPYA 1AMUA 3P9IA 3ECCA 1J0DA 4N18A 3ZZTA 4HLQB 5D7NA 4AJ1A 1W581 3Q12A 4N39A 2IEIA 3RC2A 4HPJB 2EX0A 3GGSA 1OR8A 4H15A 1EHIA 2VDNB 2ZSIA 1PFUA 4RKFA 4UMEA 4GBJA 1EVYA 1E7WA 3RG8A 1KZ9A 2R8PA 2HSDA 3K4HA 2B69A 1XU4A 3ANYB 3OD1A 4ALJA 2YCBA 1NQAO 4P34A 4Y0AA 4QBHA 2QD1A 3O82A 4PZUA 1R0LA 3FAKA 4BMNA 3IDOA 4EGQA 5FPPA 2QUAA 5A6SB 3RH0A 3I2HA 3OSZA 1Z6PA 1PNQA 2C5AA 2RGYA 3C5EA 3TQOA 1QG2A 3BVPA 5BYJA 1UMKA 2VXYA 3DKVA 4BX0A 2DQYA 5KVVA 1L4FA 3UOWA 2VNKA 1GZUA 1RQGA 3Q4GA 3COSA 4RF2A 5DF1A 4YRPA 2X2FA 4B3FX 1F6BA 1GY8A 1MJGM 2WF7A 3ORHA 1JBQA 1MAUA 1YV9A 2BMVA 2M1ZA 4G3XA 4P82A 1BVYF 1JHRA 2Q3JA 4UE2A 5EA2A 1BGXT 1JSXA 2PWYA 3EZGA 4H1UA 3LKVA 3TB4A 4CLDA 2B7BA 2C88A 2ZE5A 3QVGA 4DJEC 1D2HA 5ED4A 5IMBA 4GL4A 4D9FA 1NRWA 3OT1B 4BAUA 4QEKA 5ILOA 1UK6A 3MWGA 3MAJA 1YS9A 4CR7A 3K2IA 2FAXA 3DEHA 4D9JA 3AJEA 3ZDYB 1UXHA 5G53C 3IT1A 3WGNA 2GB4A 4G86A 2RGWA 2TSYB 1JR3D 3F5SA 5HA5A 5HK9A 3DMTA 3B2NA 2EF0A 3BGDA 2EWVA 2AN5A 1A1SA 4NFHA 1QV9A 2QAJA 5BY2A 3HJUA 3F6CA 4S2EA 5GZ6A 4RKWA 3LY8A 4GOND 2IYUA 5C1BA 2I71A 5C34B 6LDHA 3E7FA 2OCKA 4F6LA 4OI2A 3OTOB 1TECE 3OT5A 4ZU3A 5C4GB 1N9GB 3P2IA 4MMYB 3KYDA 1F20A 2XNDA 5ECGC 1TJPB 2PX0A 5CFNA 2YV3A 1M0EA 2B92A 1A8UA 2AXNA 3HL0A 1SQGA 5TVKA 4I7EA 2FF5A 3RASA 3V55A 3ZHXA 4KWIA 3M6XA 2ID9A 3KSDO 5TPWB 1OFUX 1TD9A 3KTFA 4PG6A 4UDYX 2O20A 3TX2A 2R7KA 3LRPA 1PZHA 1CRLA 1WXXA 3H5RA 4MW7A 4R4JA 3ON5A 3H9GA 4RDHA 5ESDA 5IBRA 2WJHA 4ZU1X 4LYHA 1AGRA 3WYFA 4OKIA 1EQAA 3L93A 5EJ4A 5I7OA 4X6UA 4R5HA 5EJ9A 1SIUA 3D6NB 4JUDX 4MWEA 5D01A 3PX7A 2OCAA 3AM1A 3LW7A 4MW9A 1PG0A 1RM3A 2LVBA 5A7FA 4B80A 1XVTA 2Z1DA 2R6R1 2XY4A 3FOWA 4YRFA 3MIIA 5L7YA 1CZLA 4LXGA 4PLTA 7YASA 3OEHA 4Q3AA 3N7UA 3SLGA 4BZPA 1AUPA 4YRKA 2ZWPA 5DYGA 3RBVA 3G0HA 3O84A 5KMGA 2GBFA 4H59A 4OA5A 3H87A 3EJWA 4I08A 1NF2A 5DGIA 4DG5A 2P11A 3PXGA 1ZBQA 2F1HA 3OTGA 4CI9A 1LC3A 3CTPA 4EPRA 1YQGA 5KWVA 5KU1A 3CO5A 1WZNA 1IPEA 4X1YB 3R8FA 1G4HA 1JG2A 3JRXA 4N12A 1ORWA 4B6FA 1ODCA 2VPIA 3CZQA 1ECFA 4HSEA 4TVKA 3GAFA 1A27A 1NWHA 3DZCA 3MELA 2G04A 3IT2A 1TVMA 3O2JA 3P97A 2PMEA 1B0ZA 1RSZA 4RFSB 5EZ5A 3NCHA 5H82A 4IJWA 4D41A 1CP3A 3RWOA 1KI4A 3AUJB 4NCKA 1CT9A 3ME5A 5HRUA 2OB1A 3QF7A 4RK1A 5K3EA 3EPKA 1D6JA 2C4HA 5DP1A 4EW1A 2WG2A 3F7MA 1E8MA 3Q5EA 4NR0A 3L92A 4TWJA 4MUIA 3NC4A 5HKKA 2BKAA 3ZU4A 5IJZA 3AHGA 1GADO 3LDUA 5H5JA 2H8GA 3JAWA 4YAJA 4DIOA 3OF3A 3OFNA 2JJ2A 3GZ4A 3JTMA 1AC5A 5EQDA 4W63A 1SCNE 3VR2D 4HZIA 1XD8A 3MMZA 1BD4A 2JNWA 1SELA 1NVXQ 3AJ9A 1NDQA 1GPUA 4IIJA 4B7ZA 2XDYA 4BEJA 4BNKA 4KDCA 3PXAA 3EAFA 3H2KA 4X3CA 1VIDA 3I4CA 3ONFA 1ZGHA 2ZRPA 2ZVPX 3CVJA 2YL2A 1W59A 3L8FA 4U2EA 1B4DA 4YMVA 1GV0A 2YXPX 5DNUA 4Q9AA 4FYIA 3UHFA 5CFMA 4OX9Y 1ZHHA 1X7WA 3BRSA 3HB7A 1ZINA 5MGNA 5GGYA 5K9ZA 5LN1A 3C8UA 1JXAA 1R37A 2P4UA 3IO3A 4CTJA 1CKEA 1VJRA 3QBDA 1D4AA 4GYJA 1AK9A 2ZPAA 5B30A 3WZLA 4JKIA 1ESZA 1LPAB 2JI6A 3MWJA 4H77A 4UHHA 5KDLA 4R40A 1NPTO 1X8KA 3G88A 3HMKA 4XRRA 2CSUA 2C9BA 3GJTA 3MJVA 3L7YA 3MWEB 1KL7A 4FS8A 3JYHA 3LUGA 4WMLA 2B98A 3KQUA 4B9AA 4CKYA 3B2EA 1U0FA 2JZOA 2QA5A 1Z4LA 2V55B 5L4NA 1IAVA 2BUBA 4X60A 2G9VA 2JLSA 2QRMA 3AR3A 4PCVA 1GDTA 3KJFA 3MWDB 4TV8F 3LY7A 2O2IA 3VJLA 3NH6A 1TK3A 1BWPA 2Q6LA 3HCCA 1K88A 1JIUA 1GNQA 1SBIA 5E2AA 5E1OA 3RI3A 1YUNA 3OPMA 2OPHA 4B3IA 4OY3A 3Q0EA 3W7VA 1NYRA 1P2SA 1PJCA 1VBMA 2W6ZA 4V1CB 3W1EA 1Q3TA 2AJ8A 2I33A 5NLLA 1QYRA 1TZBA 2OFOA 1QKKA 2CFCA 3BL5A 3ZD9A 3LBHA 3DH0A 1K08A 3CUWA 3WX0A 1GJRA 1UC5B 2P4EA 5C0OE 1XU7A 3L8GA 3EPLA 1IXZA 4B82A 2P91A 4D9MA 3B3JA 3E8SA 3NBUA 2OILA 1E59A 4PXSA 4O3FA 4WK6A 2VBFA 3ELYA 1XK6A 3GUCA 3PJGA 4NV1A 4JVMA 4MGHA 3WKAA 1YS1X 5FDFA 1JEEA 1CNFA 5K0FA 2CD9A 3COPA 4IDCA 4E6EA 1OXMA 3GU3A 3I5UA 3H5TA 4QGBA 3WWZA 4EVSA 1J20A 4N9QA 2JHAA 3PPIA 1RPAA 4HQKA 1QQTA 1T1GA 3GT3A 4ZI7B 4YR9A 5HUQA 3AC0A 2WV7A 5DT2A 2O2GA 2HX1A 4D43A 1KAOA 3MCTA 5ULLA 3DNMA 3DE7X 3SM3A 5A4IS 4XVHA 2Y67A 3RUIA 3GT0A 4MA5A 5JNSA 1N9KA 2TECE 5DGTA 3WLFA 2WMOB 3L1HA 2A9VA 2HU7A 1CNEA 1B8UA 1SBZA 3F7NA 3H6KA 3PEVA 4QATA 3ZC3A 4IG4A 2HIMA 1DO2A 5CD9A 4PHFA 3I73A 3QELA 5IJAA 1PS0A 4A8TA 5E9JA 2NVBA 1J2TA 4DJFC 3NRBA 3N0WA 2FVYA 3OOHA 1QDLB 4IXDA 1IVYA 1THGA 2R8RA 2QI9C 4OBBA 4ZKDA 4B7XA 3NVDA 4FCWA 4JZKA 1KMHB 4Q34A 2VRCD 3ZUPA 1DWUA 3F9RA 2W2VA 4OAQA 3P71T 1M2NA 3IMEA 4PY2A 1XF1A 4AN4A 1F7VA 3WTBA 3MK31 3DLBA 2AI1A 4YYZA 1GZDA 4GXTA 2JFYA 5G4KA 1X74A 2Y1KA 4LJ5A 1LLUA 2F48A 1H22A 3CQ9A 1DJLA 4IHJA 2WF6A 2P2SA 4JBIA 2YJTD 2VP9A 3ZV3A 3QWIA 2HCTA 5L3SA 1X92A 1PJLA 3BH0A 3R0JA 4KQXA 1RRMA 2OZLA 4LGVA 4CF3A 4JN6B 5ENZA 3CLSD 3ZTTA 2HMSA 3I39X 3ZWNA 5DGCA 3ZXSA 5HSGA 1W93A 1NUHA 4FLFA 1E2UA 4QGAA 2Z2IA 1N8TA 3UAGA 4L1KA 3EEBA 4MUHA 4OHRA 3DR3A 1V5IA 2O2EA 1HFEL 2ZUUA 3CPHA 2N1MA 3FCYA 5LBIA 3ZD8A 3NHMA 3LXMA 1UMBB 1NIJA 2WW8A 4G8CA 4GI1A 3N8NA 1CJTC 4AKEA 4EZBA 3FSGD 4FYXA 5B2FA 5LIRA 1RBZA 4UE6A 5IKEA 4XPIA 4C0JA 3PYLA 5BOSA 5HJ7A 3TQSA 2J6BA 1PZGA 2OLKA 3QU9A 3WL5A 3JD1A 1ZC4A 4IXNA 1CJCA 3NASA 4IVPA 3H0KA 3VDQA 3WVNA 1RIIA 1U0EA 4LF5B 1FSZA 4HN9A 4R2XA 4JEUA 1YBAA 3G2MA 5CDTA 4H1WA 1EVJA 3W79A 2NO0A 3U4AA 3DE1X 1G38A 2ZRFA 3NO4A 4OJYA 621PA 1SXIA 9LDTA 3IE2A 3HEMA 1PJAA 1W1WA 2GO7A 2PBZA 1PWHA 2OP1A 1ZH8A 3IBFA 3QY9A 4XUCA 4DZRA 2FX2A 1BMFD 1G21A 1R4ZA 2MWMA 5FO0A 5JCOA 1PV1A 3LZCA 4X65B 1QQAA 3FHJA 2XUKA 5F21A 2ECQA 4M8SA 3TRFA 1FFWA 2DKFA 5EAIA 1MKYA 1QYDA 5J2TF 3SCZA 3W90A 1E20A 1KY3A 4E2ZA 4N76A 2HK7A 4CGZA 4ZDJA 2WRZA 1PW5A 3DFUA 4IIJF 2XQIA 1CDDA 1FLDA 2FPPA 2ZI6A 3LDAA 5CHEA 3PHCA 5IZCC 3K6JA 1OKKD 1T9GS 3NTXA 4A5SA 1SBCA 1TJ5A 2JLUA 1PTJC 4RVNA 3GLFE 1PGNA 1VXOA 1Y37A 3K6KA 3SPXA 3GBVA 4HFMA 4YJGB 3RS7A 4R1PA 4NFSA 3TJMA 2DTXA 1QCCA 2CE7A 2V7QD 1LPPA 2W6ID 3MCZA 4CT5A 4ZVMA 2BF7A 4C0XA 1ZVQA 3FB1A 1SXJB 2YY6A 4PRYA 4PC3A 1GZSA 1R16A 3CGGA 2LD4A 4TKVA 5MN4A 3CKLA 1EB8A 3VH2A 2FYTA 2H7CA 2W98A 2RGEA 5ALUA 1XCGB 3D31A 1Y4UA 2R00C 5AXAA 3MTGA 2ODQA 4CQLB 5KQGA 4YT2A 4PRLA 3GXBA 3DAHA 1EU1A 2I3AA 2ZRLA 3JARA 3QW4B 4DPKA 1N8KA 4PYJA 1PDWA 2XCLA 4OQMA 1CRQA 3FFXA 2E9SA 1U5AA 4BNTA 4EG4A 1ACJA 2ENWA 2OAQ1 3KEMA 4I14A 1Y5IA 1QO0D 4GYKA 1Q7CA 1V39A 4PAGA 5DYWA 3UICA 1P9LA 5JVDA 1R15A 2AW3A 3STHA 4A8JC 2O1XA 5F1OA 5T4HA 5KI6A 2GBGA 3PJRA 3KDAA 3WL8A 4BLTA 5I45A 3IUPA 2ZFUA 2GBLC 2X0RA 4CKBA 3ZLJA 3PEUA 2LNDA 4L50A 1KDTA 1OE0A 1RWOA 3GAZA 1RPJA 3GWZA 3MJTA 4JLNA 4TYQA 5ES3A 1NBIA 5JBNA 3KAJA 3QWHA 5EUBA 1BEEA 2JHGA 4Q9IA 5KB3A 1FFYA 1AKUA 4G5GA 4K40A 1OA1A 2QAIA 1U0TA 2EJTA 1A8IA 1YQ9A 1CUYA 3KQNA 5K03A 1XRRA 1Y4ZA 1E2DA 1ONBA 1Y4DE 3BAFA 2X7HA 3BUSA 4OCZA 2XGGA 1N0HA 3ZBQA 3DO6A 3KLPX 3BTUA 3ZXUB 2QLLA 3G17A 1BMTA 4IGAA 1JPNA 2GBCA 4Y9UA 4ADSG 1XXHE 2V7VA 2O8NA 2V58A 1MFPA 2QDKA 1F8UA 2SCUA 1GAJA 1NRJB 1QQ7A 1SVKA 1YOVB 2XHZA 1CUUA 1NUTA 1P7ZA 3ITKA 1RAEA 4LKOA 5HILA 1WUYA 4Q6BA 4EHJA 1T0PA 4F5WA 3AVUA 2YWBA 5KWJA 4HDMA 2ZIXA 4MXDA 1TLFA 1E4EB 1E3TA 4GH5A 3GY0A 3SR3A 1BHO1 3B85A 3PXUA 4KLNA 2EFGA 3L0BA 1TYEB 5BNIA 5LMZA 5CVJA 1L4UA 2ATCA 1PQPA 4MDFA 1JGTA 3SM9A 4CMAA 4DMKA 2X9GA 4DUGD 2DT5A 3MMXA 4Z4CA 1GCIA 4IH4A 3AXTA 3GFSA 2WZQA 1QVWA 1TDJA 4FE4A 4YUZA 3PNKA 4BO3A 4K05A 3A31A 5TR9A 4DJ5X 4XM0A 1U98A 1DDOA 1OAAA 1A69A 3Q7RA 3QEKA 1KS9A 1RM0A 2AJLI 1PW7A 4F92B 2FWAA 1JFRA 5CD1A 1CNMA 2VS1A 4I1VA 5KC8A 3SQDA 3PKJA 2XB6A 3TXAA 5GOTA 4OV6B 2RK4A 2VF7A 4LV8B 1UKAA 3JWHA 2HY7A 3A9SA 5REQA 3WNDA 3ENQA 2AUTA 4U2DA 4EYGA 3NKFA 3THYA 2QUJA 2Q9CA 4ZOQI 4IHJF 2J0UA 4C22A 4KK4A 4A73A 2DEUA 4R7TA 3IQGX 5ENVA 1YRAA 1XJWA 1TAGA 2RH9B 3JYOA 1B00A 2XV1A 2BM0A 1ZG3A 3ACDA 5A02A 1UBLS 2EHJA 3M4ZA 4CDNA 3WRWA 1CYEA 3M6UA 2A0XA 1EM8B 2V03A 4IOJA 4OHUA 1QCYA 1OLSB 2WKPA 4PYMA 1SRQA 3QGMA 4E13A 3GUHA 3KKMA 4G09A 5DO9A 4Y2XA 3H11B 2F43A 4Q7QA 4G5SA 3C5CA 4YT5A 5ELLA 1XMOB 4TPKA 3DFFA 3FFWA 1UMCA 1LDEA 1XA0A 3LQ1A 1XYVA 2VPZA 3ABQB 1V7ZA 2YYAA 4JB2A 1O5TA 2C95A 2NTEA 4AJEA 3FCXA 1E61A 1M7GA 4DWOA 3QKSB 2BFBB 3VAYA 2VYCA 4YALA 1V8PA 2RHTA 3NAGA 4EGFA 1NOIA 1VKJA 3T9CA 4JLMA 4W5TA 2PFKA 3P9KA 3FBWA 2OV8A 4PHCA 3EGDA 1DV2A 5T3UA 1U1CA 2AUNA 2DG2A 1UK7A 2V6MA 4Q24A 1LQ2A 1Q0UA 4EDHA 2HSZA 2GNPA 3L5OA 3ZNQA 3P4XA 4MGYR 3VZPA 1ACLA 2FPXA 3KLBA 3BFKA 2EAUA 4IWXA 4EY5A 4YUAA 4US1R 5D6NA 4ARVA 1BXRA 3R9KA 4JJKA 4X45A 4AY6A 1FP6A 1WDTA 4KLRA 2P6RA 1TM4E 4UVIA 5LC1A 1YI8A 1Z6ZA 2Q62A 1NFQA 2AHRA 1FQWA 1X1TA 4ARSA 4LRQA 3MJSA 1X2BA 1JIJA 1NLYA 2YJZA 1PLKA 1R6VA 1D2NA 1ZMXA 3D7MA 1K7YA 2G4VA 3RUHA 3INGA 5YASA 4GYWA 3EASA 4EEZA 3KKQA 3AZQA 4OXXA 4EL5A 5DWQA 3NZEA 3Q6MA 4HGOA 1S1CA 2GEVA 2VJCA 4P35A 2QQGA 2O2ZA 2HHHB 1QKJA 1BE8A 4M1KA 3L01A 4DGSA 4LTMA 2IX3A 1IMJA 3A1CA 3ESRA 4Q5IA 5A5EA 3ONWA 4BMVA 1VI5A 4I5FA 3T7TA 4RVUA 4DJTA 3ZX5A 5C7IO 3TL3A 1NNLA 2MOKA 3SI7A 1IZ8A 2D2IA 2X9VA 4KE9A 4NXNB 1AG9A 2YV5A 4HS4A 1SWVA 1L5RA 1Z0AA 2PMWB 1PBNA 4BO4A 4DREA 2D4HA 5JNUA 2XTJA 1SO8A 1H1LB 1S9DA 3JZAA 5DN6A 4OI1A 1KZ6A 3UXMA 4BUCA 4FHCA 1NI4B 4YTEA 2J6CA 5F2KA 5BPHA 3D4IA 1N1EA 1W2GA 3MNFA 5FTNA 4AULA 1GAWA 1ZIDA 3FMIA 4MR9B 5C52B 3IJPA 5BN4A 4UHKA 3CRNA 1N57A 2UYQA 2ZJ1A 2A33A 2ZE8A 4KVFA 4U2KA 3VZDA 2F1KA 1V11A 2HF7A 4PHGA 1NVEA 1T1SA 4FOSA 1NMQA 3IO5A 4YQZA 4AC9A 3M6AA 4JB0A 1FBNA 3N28A 4HAUA 4RQTA 4JT2A 2VUHB 1P2FA 2A2ZA 1WB9A 2VJAA 5EY5B 1L5ZA 1XZCA 2K6GA 3IVRA 4LDNA 5G40A 1EFPA 1KFEB 1TM5E 1E62A 2ZI3A 1POWA 2WM9B 2QE6A 2ZVQX 3M1LA 2OYCA 1TMGE 3TQIA 1DCTA 1IY2A 1C7RA 1ZITA 3TRJA 3P27A 1POXA 4BKMA 1BCRB 1EJBA 3BWBA 1KFBB 1NVGA 3ONEA 3S2ZA 3CXRA 1C2TA 5AM2A 3LBFA 1JR3E 1Y6FA 2QUIA 1IFXA 1XJ5A 4DCPA 2HEIA 2NQTA 4I5IA 4DCVA 1HUQA 1YS6A 1KKUA 5DLQC 3WLNA 4JMPA 2WWWA 4HS9A 1B0UA 3AYZB 3LQRA 4J49A 2HK6A 4A6DA 3DE3X 1N5LA 1TZMA 3RHFA 2BV3A 1E7QA 2FPGB 2AFHE 2AE2A 4N47A 2O0JA 4XGIA 1N8NA 2Z8ZA 4XB2A 2PXXA 1HSOA 1PX2A 2Z6AA 3KAKA 3HH8A 2IV2X 3GAMA 2H1LA 1VP9A 1Z4IA 4JENA 3B3AA 3ADBA 4PG7A 2ISCA 2EFCB 4OTZA 5JHGB 4N5HX 3IEUA 4N0MA 1DO8A 3W9BA 1MLDA 2C5EA 3DEFA 1GUYA 5JE8A 3TPFA 1EYZA 3S29A 1UJNA 3PD7A 4GR4A 4H4DA 5AT1A 3O2QB 2QU8A 1L4KA 3ZDAA 3GIWA 1JEAA 3RBXA 1BW9A 3R3YA 3OTIA 1HA3A 3P0RA 3C1UA 3S4YA 3IE1A 1EVEA 3EVTA 4LMRA 4MAMA 3W5HA 3ZNOA 2FHPA 4AP5A 3V2GA 5CA1A 2JFQA 3DVRX 2RHHA 2O48X 1AMOA 1H4QA 1W8DA 3CO0S 1HYEA 1G19A 1JHDA 4JLPA 4JY7A 3HDQA 3ODGA 3ZU3A 4B3SB 5K8TA 2QVGA 2PS9A 3FWZA 4U63A 1YI0A 2JLRA 3V2HA 5FLKA 3K31A 4IPTA 1I9CA 1KEWA 2G67A 3N0TA 5C8DA 2HLNA 2X3UA 3KELA 2D59A 4E4TA 5EJ7A 2C9MA 3JZDA 1K6EA 1YR1A 2AOUA 4MRAA 1AJEA 1I4WA 4RS4A 5AKLA 3KRTA 3ANTA 1BHJA 4BMSA 2ZBUA 3RKSA 2DF8A 1YVPA 1PYOA 1Q57A 1J49A 2QRKA 3EXIB 4HBGA 3C3WA 3U39A 1B8VA 3FVWA 2H7XA 3GH1A 4KE8A 3RUCA 1QP8A 3GCWA 3UUWA 3S40A 4JC0A 3D6FA 4RA9B 3NOOA 3IXQA 4N0QA 5F9MA 4LHSA 2GK7A 2ORED 1UK9A 1N2HA 1XALA 2WUFA 1WMAA 3PC2A 3FNHA 3K5IA 4RC9A 3DMRA 4FCVA 3D4OA 5CFLA 3BCRA 4TTQA 2FMKA 2WUEA 1Y3AA 4F06A 3T4UA 5DNWA 3WB0A 1XZNA 4R1QA 4WKGA 2BEUB 5E6UA 4ZCRA 3GD7A 2UZ3A 4BFXA 2C04A 2QW0X 1U1DA 2YV2A 4P3OA 2D3WA 3JQ9C 3A4MA 3ZI4A 2BTQB 1FUEA 2CYAA 3EC2A 4DS3A 4PQRA 2OL4A 6REQA 3KKPA 3AI2A 1BZYA 1CZHA 2E21A 4CWAA 3M2PA 3SK0A 2CL6X 2AR7A 2X7JA 4QVGA 3C16C 5GINE 4DV0B 4GX5A 1BVRA 3EEFA 4B1FA 2JKVA 2Y77A 3I09A 4K6HA 2BN4A 4M4SA 2IIBA 2M6RA 2NV0A 4MR7B 3IP9A 4AN0A 5SY4A 4QULA 4BTVA 1NI3A 3WGVA 3BSYA 1G7SA 3PNQA 3VHLB 1GGVA 1QQ5A 1R8XA 1KYQA 1VJ1A 2YYSA 3EQ7A 3LV8A 4UVDA 4E7OA 1I8TA 1PZXA 2FUCA 2JVJA 4HK4A 3C97A 4AJNA 3X1WA 3GGJA 4EYKA 3ISJA 4V0KA 5K3SA 1CUZA 2CMDA 3KKOA 4ZOAA 3DNPA 3AEQA 4YJDA 3JWEA 4QARA 4AUMA 2A0FA 2OXFA 4Q15A 4UTNA 5JJCA 5KZMB 3AJAA 3I23A 2PBRA 1UBJS 3AP2A 3NHKA 1CWUA 2ZYUX 3AOEC 3NP9A 1SUBA 4WFIA 2QRVA 4XFDA 3T1OA 1PYDA 2W6NA 3WGYA 2FSHA 2IU0A 5HGXA 2FWNA 2WJVA 1SHLA 5EMNA 3UMRA 4E5DA 5IZCA 4XD7A 4JA2A 5BPFA 2NP6A 3L43A 2VBGA 4CCYA 1NKSA 4Q4DA 2AKYA 2JJMA 4Z7QB 5DSZA 5IN4A 1GPAA 3M82A 1PTJA 2PT5A 2QUKA 2O23A 2R6CA 5DM0A 1IBLB 3PHIA 3K20A 2YHBA 2A9RA 3MGBA 2XVYA 1KMIY 2ZYDA 2CNDA 3ND6A 4C7MA 3ERCA 4BEWA 1O9HA 1MNQA 2P2YA 4N7RA 5L3ZA 2P1RA 3I0ZA 3WHLA 4LC9A 1PFKA 2ERYA 2ZWMA 3Q72A 4HATA 4YFYA 4UQPA 1WQ1R 4Q9JA 3G8AA 3L0ZA 5FTKA 4MVXA 1MOZA 3GRFA 3VKWA 5T6MA 1B73A 1SXHA 2UYOA 2R00A 1Z6QA 3DLIA 3NX4A 4PGGA 2P8JA 2NU9B 5G0SA 3VISA 3EGIA 3OC6A 2DU8A 3WNVA 4YAKA 2RC5A 4LZPA 1DINA 1IVNA 1UR5A 2H4HA 2YWDA 3RROA 4PBRA 3NBYC 4GLLA 2H85A 1JQAA 3EYWA 3F49S 1HT0A 4NS4A 2ZT8A 1O6ZA 4HRAA 3ESCA 1NW9B 2AWOA 1GUZA 1TXGA