5DHAA

Crystal structure of cpeb4 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
206
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 206
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhaA00
1RRFA 2O0JA 2HYDA 1GIAA 5K8LA 4DVGA 3OIYA 4PTLA 3RSLA 1MKYA 2FNAA 3HJNA 5DNYB 2XGJA 3C5CA 3FFAA 5J5CA 4MDEA 3KKNA 2VSOA 4JS0A 1P75A 1P2TA 1W49A 2VQSA 4HLQB 3IGFA 3CF2A 5J4LA 3QEOA 1E99A 3CNNA 3EPLA 1T8TA 4PC1A 5FTJA 5M04A 2A5FA 5FL7D 1W2GA 2VBCA 3H2YA 2AHOA 5IF9A 1GOTA 1XJ0A 3ADKA 1TQDA 3U61B 3ND9A 2ODEA 4IEIA 2WAYA 4NZYA 1XCPA 3W34A 4D81A 2FJUA 1B0UA 3IBYA 2HXYA 3Q3JB 4MGZR 5TVKA 3TAUA 1E3MA 2CDNA 3IEUA 1G41A 4BFWA 1AJEA 2HCBA 4C7OB 1ZYUA 3TUJC 1TL7C 2DWQA 2ZJ5A 4C9BA 4DLXA 1E9CA 2VLIA 5KTYA 1AZTA 1NBMD 5KSPA 3GQBA 4DSNA 1BMFD 3FGNA 3GJ8A 4J0QA 1MO5A 4Q5IA 3UG6A 4LJAA 2EYQA 2HF9A 1XDBA 3QY0A 3SJAA 1G18A 5J4VA 4US2R 1TF5A 3P26A 2OM2A 3EASA 2UZ3A 3OIUA 1ZC4A 4BLQA 5E7MA 1NVXQ 5BN5A 4TLEA 2NPFA 5AUOB 5CK5A 1DO2A 4GZLA 1ZM9A 4MRRA 1QHIA 2RHDA 2YOGA 2PLRA 5CJ2A 3MG9A 3EPJA 3U2QA 3SFVA 2JLXA 3QF7A 4Q9LA 121PA 3GEHA 1W4AA 3CONA 3PVSA 2WM9B 3CH5A 2JA1A 1CJTC 4EFMA 1OHHD 2VHTA 1IM2A 2O8FA 2AWOA 3HPQA 2ECKA 1VG0B 3KB2A 2A2ZA 4Z8XA 4G3XA 4Q1EA 1ODFA 3T35A 2F7SA 5CLLA 4AI6A 1SXJA 3EIEA 3GLHB 4O25A 3FTQA 2C9YA 1F2TA 1JXMA 1EFHA 1X3SA 1VIYA 4NCKA 4C0QC 1CEEA 4RD0A 3K09C 3TR0A 4E03A 1CLUA 1Z29A 2HEIA 5EUMA 3G5UA 4S35A 2JCSA 1QHGA 2ZR9A 2DB3A 4P31A 1XXHE 4QHTA 1PJRA 2PCJA 1NKTA 3SEAA 4O2LA 3L0OA 4EJSB 4IDOA 3TRFA 4B75A 4MRSA 1RRGA 1Z06A 4LBZA 2FMXA 2QI9C 2Q9BA 3SNHA 1O3YA 1G7TA 4CW7A 4OJKA 1WB9A 4KYIB 5B58C 4CEHA 3NG1A 1AIPA 5ELXA 1XPUA 4A36A 5DI3B 4ZIRA 3AVUA 5FI1B 4Q9KA 4DSTA 1GL6A 4LUCA 1BMFA 1NVVQ 4II7A 1J70A 1TEXA 2QN6A 2PL3A 3OIVA 2DY1A 2JAQA 3BJIC 3QKSB 3TVDA 4N0DA 3AVVA 2CCKA 4U00A 1NP6A 1GG2A 5TMPA 2PX3A 2XJ4A 2E9SA 4LJ7A 1KK0A 1E0SA 2OILA 3IQXA 4ILEA 4ARZA 3EZ7A 4HEJA 1DS6A 3E70C 3GJ5A 4PO8A 4AYWA 3NDBB 3FVQA 3LLMA 3L0IB 1E2GA 2IWHA 1WQ1R 4MRVA 1BO6A 2H7VA 4JKYA 3OAAD 4AD8A 2E1RA 5ANRB 1A2KC 3CZPA 3SN6A 5BN3A 1NG1A 2PCLA 2AD1A 1KJYA 4LSGA 3DEFA 1TUIA 3I72A 2R6CA 4NYJR 2GJ9A 1OHHA 4TQUS 3T12A 1E4VA 1QDEA 4OI1A 3AQ4A 4DWJA 3U60B 2EFGA 3N2IA 1E1QA 4BZPA 4MGIR 1MRSA 1AS3A 4D4KA 2ZVPX 1YKSA 2QAGB 4DLZA 4MGKR 1UKYA 3QKRA 1OLOA 4Q4HA 4GP6A 4TZ0A 4BEJA 3CR8A 1IXZA 4NYIR 1N6HA 1NG9A 1U9IA 2IBMA 2ZUCA 3AVXA 3LH5A 4ABYA 4F93B 1R0YA 3DMDA 2Z83A 3U44B 2HUPA 1D8TA 2HJVA 4A6PA 5FBRB 4YDHB 2OESA 5L3VA 1X8JA 3E5HA 2I1VB 1Z0IA 3OE7D 1OFTA 1WRBA 5K8TA 3E2IA 1D9ZA 2EFHB 2QTVB 3VKHA 4Q9HA 1DE0A 2GAOA 1RYHA 2WMOB 5JI3E 2CE2X 4V0LA 4B6EA 3WBJA 3Q8XB 3TVTA 5JS7A 3X2SA 1N0WA 3UK6A 3RSOA 1IN6A 3EA0A 4KV9A 2ZJYA 4QHYA 1E0KA 1CS4C 2QQEA 1VIAA 2I1QA 5KNDA 3LBHA 1Z6XA 3KKQA 3V9PA 1Z22A 3ZVRA 1OXVA 1GP2A 4M1OA 1G4UR 1G5TA 5EE9A 3VKGA 1C1YA 2ZI4A 2HT6A 4LHZA 3P27A 2BVNA 4URWR 4IVQA 3K0CC 2C03A 2BEJA 4JLJA 3VQTA 1Q3TA 4KU4A 4V0MA 2Z6VA 2FSGA 1KNXA 5B30A 2JASA 4CEJB 5IDVA 3F5FA 3KTAA 2GXQA 4N0EA 4YC7A 4OYHA 3GLGA 2JDID 1GNPA 3B1YA 2AK3A 3LRPA 1G16A 3RVBA 1OXSC 3I3SR 3I32A 5HE8A 2A5JA 2ZXUA 1KI2A 5TB5A 3WBKA 2QUZA 2BIFA 3WP1B 4D4MA 3ZVLA 3AUXA 2FH5B 5FPYA 1OH8A 1XMJA 3I62A 4HLDA 4JLKA 4URZR 2ZSDA 3JVVA 4RD3A 3Q5EA 2ONKA 3K9LA 2IUUA 2AWNA 2BOVA 4QBFA 4A0HA 1KI7A 2BMEA 3U3JA 1AGRA 1S4QA 2UKDA 1PZNA 3B78A 2VO1A 1R0XA 2P65A 1KAOA 2ZRHA 1M7HA 4BLRA 2R2AA 1IQPA 2YC4C 1FUUA 1Z07A 1EFUA 1KSFX 1XWIA 3EZ9A 4DCNA 2PJZA 2F9MA 1U0LA 4E22A 1KIMA 1T5LA 5FBLB 1PUJA 3T61A 1E9SA 4V03A 5EQTA 3ZZ0A 1TNDA 3WMEA 2NO9A 4ON9A 5FBWB 4NDZA 4C4PA 3ICEA 3CRQA 3ND8A 4DDTA 4YQFA 4QM7A 4WXRA 2FZLA 1E2LA 2FFAA 2H16A 3C7KA 4MKHA 2GRJA 1P9WA 1XTRA 1Z28A 1VDZA 4XD7D 1DTSA 1LS6A 4TL7A 1YR8A 3Q72A 1RE0A 5HR5A 2WTUA 5C4GB 3GFPA 4NCHA 2G0NA 4YMTA 3CWQA 2ZJ2A 1FQKA 2WKQA 1N6OA 2QMEA 4OI4A 1M7BA 2BBOA 2LKCA 1OYYA 5HTKA 2IWRA 1JAIA 3QKTA 3RLFA 2ZU6A 1KI3A 1UJ2A 5E95A 4BRWA 2ODNA 4M1MA 4HDQB 4EPXA 2EFEB 4Q1DA 5FOTA 2GDJA 3A4NA 1LFDB 2KJQA 1YQTA 3K0AA 4JLVA 4K81B 1JPJA 4XH9B 2O8CB 4NPHA 4PHHA 3TSZA 3W6PA 1Z83A 2HV8A 4DSOA 3A1WA 2VP6A 4G5OA 1CKEA 521PA 3BB4A 2C9OA 4TTPA 3A4MA 4TTQA 4YDSA 3THYB 1ZJ6A 2EW1A 1Q1EA 1G9XA 4P33A 1ANKA 4E09A 4IDHA 4AURA 1ZD9A 4GRAA 2VL7A 5FBQB 4B73A 2WJGA 1IAQA 3TGPA 5J4KA 2KE5A 2AFHE 2OEPA 4KFTA 3QXXA 2VF7A 2G9NA 3THWA 4Q4JA 2ZI3A 3BIFA 5G3YA 1X8KA 3AVQA 3WYFA 5CM8B 5JCZA 1XEFA 4B76A 3FHOA 1XTKA 4Q18A 3CLVA 4FXPA 4PHFA 2BMJA 2GVZC 2WJYA 3K09A 4NONA 1K8RA 3LD9A 4C0AC 2H92A 3ZS8A 3QQ5A 1PUIA 2VHQA 4JYBA 1P6XA 1S9DA 1GRNA 2B92A 2XZPA 4UKDA 5FUVA 4C0BA 1P9RA 3VR3A 3LDAA 1TUEA 2YNMA 3QI2A 4EQ6A 1G6HA 5DI9A 1ZNWA 4XD7A 1LNZA 2P6UA 3QPVA 2W0SA 2X2FA 1E2HA 5CLQA 1GRRA 2PZEA 3DKVA 3AV0B 4OJQA 1QF9A 4ZDIA 3LQQA 5FUYA 2JEOA 2O5VA 3KDSE 4MUAA 4BE7B 2D06A 1RPZA 1T5IA 1I4DD 1IJEA 2HLDD 2WMNB 4KFSA 4QBIA 4A0GA 2ZIAA 3ADBA 1KZ7B 1KO7A 2ERXA 4TL6A 3O8CA 1Z6TA 4V0NA 3MJRA 1XD2B 2EWVA 2ZJOA 3CR7A 4NU0A 2XNSA 4A2QA 4GL2A 721PA 2WICA 3H84A 2NOAA 1SXJE 2VHUA 3QXJA 5JSZA 1G7RA 4DCSA 4ITRC 4Z1MD 1FL9A 2FGKA 5A5GA 1T91A 4MKIA 4WW0A 1UBEA 1ZM2A 5J4YA 3H4MA 3K0FB 3CM0A 3W90A 1P9NA 2V6IA 2ZI6A 3DZ8A 3TUIC 4NE2A 4BZXA 4XWOA 1XX6A 4Q4JB 1KI1A 3R9WA 1FNMA 2XSZD 2C78A 3SR0A 1W36D 3AKYA 2ZAMA 5FTKA 4TQAA 1OW3B 2CHGA 3B9PA 1WE2A 1GL7A 2IT1A 4RJLA 4C30A 4DIDA 4F38A 1B23P 2FPMA 1AKEA 1UDWA 1ZC3A 2IEYA 2QEQA 2WPDD 5EE5B 4R98A 5JS8A 1M1YE 2IYYA 4KLZA 4HAVA 2GILA 1XCGB 3ETLA 3R7WB 3K9NA 1SVWA 2IYXA 5DN6A 3EWSA 3AVYA 4TN1A 1Q0UA 1GZSA 3R9IA 1Q1BA 2O8DA 2R6DA 2JJ1D 1KDOA 2WHXA 1OXTA 4US0R 3QE0A 3I4LA 4I4LA 2LCFA 1KHTA 1OH5A 4Q21A 3WRYC 3KFXA 4R9UC 2V1UA 5D3MB 2WWGA 3EIHA 5SZIA 2AKYA 4UNNA 3VR2A 5H8WA 1NY6A 2BJVA 3MWKA 2EVWX 3AVTA 2D4HA 1ZIPA 4QOSA 5F3WB 1UEJA 1XTQA 1Z0AA 1R5OA 2TMKA 2RGNA 1Z0JA 1OIVA 1XD8A 4WZBE 1U94A 3U3MA 2IHYA 3C16C 2CE7A 3FMOB 5TDHA 4GP7A 2JIZD 3WXMA 1Q12A 3B13B 5CIWA 4BASA 4Q7MB 1OYWA 2OCPA 4UJ5A 1OH6A 1Z6AA 2I4IA 3NC1C 5FFMA 1MR3F 3C15C 3ZH9B 1Y63A 2RB4A 1JEDA 3A1VA 1N3BA 3NKVA 2CHVA 3P4YA 1V5WA 1E2QA 1Z2AA 1N0VC 2VP5A 2C96A 5DGXA 4Z1MA 2V55B 1QRAA 1WDTA 3K0CA 1F48A 4KBGA 2PZGA 3IO5A 2GESA 3QF4B 2PEYA 4QGAA 1XXHB 4TTRA 1MV5A 1EESA 3CF6R 1HYQA 1DAKA 1AN0A 3EZ2A 3NBYC 2BBWA 4WA7A 3W3ZB 2KWIA 4CEIB 2ATXA 3UWOA 5FH9A 1EWQA 4D82A 1N6NA 3QEJA 4JJZA 2YOFA 2IXGA 3TSOA 2FSIA 4DCUA 1IN7A 3L0SA 4LYFA 4UJ3A 4AKHA 1YR9A 2BBSA 2WKPA 4JYCA 5BXQC 1NN0A 5L3QB 4OI2A 2X1VA 2D7DA 4HAZA 2LWIA 3FFBA 4GFDA 1EX7A 4ZDJA 1QHXA 3EZ6A 3ZYCA 1U0JA 4P4SA 2I3BA 2JJ8A 2AFIE 2YHSA 3KXIA 1OIXA 3IUYA 4L15A 4QRHA 2WWWA 1KAGA 1LB1B 4EFLA 3GFTA 3TH5A 4B2LA 3HU2A 4DXAA 4Q19A 1N0UA 2C9CA 3VNUA 2ZANA 4P0TA 3LA6A 2DR3A 4OHVA 821PA 3U3OA 1IN8A 3SJBA 2FFHA 1YZLA 3VX4A 2FEMA 3VKWA 3ZDQA 2DWPA 4QM6A 3B1ZA 3O8DA 5LB2A 1FMLA 1A1VA 1Q1QA 1W44A 2ZYTX 5HCNA 4B3CA 3I1FA 3L43A 4V0ME 1MT0A 2IYWA 2CK3A 4HUTA 4CT5A 2IYLD 5FTNA 4RD2A 4ASUD 4HZUA 4DDVA 4XTCS 1BYIA 1NRJB 1U0HC 3GLGE 4IFBA 2XEXA 4Z51A 4BUJA 4OHYA 5HE9A 2Z0MA 4DEXA 3G0HA 3B60A 2P2LA 2GXAA 1N5JA 4XIGS 1BS1A 4JMPA 2W2XA 1J7KA 1CULC 1DAGA 2KB0A 2Q0HA 4LK2A 4TWZA 5CJPA 3GLFA 5DHAA 5KOYA 4DLRA 3T06B 1ZINA 4M4SA 3UPUA 5GJWC 1E9RA 2QMUA 3KXKA 5JRJA 1C9KA 4GI7A 2ZYUX 4M0LA 1R8QA 4DB4A 1RJ9B 5E3HA 4EPWA 2WAXA 3GEEA 1OKKA 4PC2A 5EP1A 4B48A 4PPQA 2G1JA 4AC9A 1U99A 2H57A 2GVDC 3U3KA 1NVWQ 4KVAA 3UMFA 3H0KA 4TLCA 5F9HA 2Q3MA 4NP6A 4Q1AA 4C0JA 1U98A 2C8VA 1ZIOA 3KJEA 3TQFA 5BN4A 3UIEA 4PSVA 3QIAA 3K0SA 3EPKA 3EIQA 3AF3A 5FTMA 1D2NA 1NL3A 4JIMA 1D2MA 3M6AA 2ZE7A 1OJLA 2GJKA 1SGWA 3K0EA 4RZ2A 5DLQC 2PT5A 5EE3A 2V8OA 1SQ5A 1JECA 1F6BA 1Z5ZA 2QORA 1E96A 1RVDA 2GHIA 2QPOA 2Z5FA 4I1UA 4A0RA 2GCOA 2PT7A 4AG6A 2BKEA 4HAXA 3X1ZA 4BFUA 5HZHA 2C2HA 2GXSA 3FYHA 3PEUA 3BWDD 3NXSA 3P20A 2XOKD 1W0JD 1QHYA 3NTUA 3CNOA 5EE1A 1Z8FA 1N6RA 2FSFA 2QPAA 2QP3A 2ERYA 4BFSA 4JLMA 2F1JA 3A36A 2OFOA 2ODWA 4ZDWA 1P5ZB 2P67A 3UATA 4YMVA 3F8TA 2RCNA 1F2UB 4QKQA 5KU1A 2O8EB 4DLUA 1E9FA 4IFEA 5FOXA 4ASUA 2PMDA 4ZO4A 1ETUA 1NIJA 4R7ZA 2ONJA 1S3SA 1W5SA 2IF2A 2JLWA 1HA3A 1YZTA 1VYTA 2ZRBA 1SXJD 1KDTA 2YWGA 4XSGA 3THXA 2ZETA 3W5JA 2BKUA 2R6AA 2J41A 1MABB 4Y0AA 3RRNA 4C0HA 2WIAA 2QMOA 1YJ5A 1ZBDA 1EK0A 1G8YA 3LW8A 1FUKA 1G8PA 5FOSA 4LHVA 1KGDA 5HCIA 2ODBA 4XSHA 1WBDA 1LS1A 2CL6X 3SBEA 4JVMA 1IHUA 4HYYA 2ZR0A 3WMGA 4BFZA 1P73A 4WZAE 2QGZA 2OFWA 1CTQA 1KI6A 2WJVA 4JBWA 4A6XA 1A7JA 4YXWD 2CMKA 1II8A 2OZEA 3X1XA 3AVWA 2GA8A 3KX2A 2QENA 4PANA 1SKYE 2W2TA 4HB4A 4NL4H 4H9GA 4Q4AB 5EJEA 2OAQ1 3IQWA 3BERA 3ADCA 4IKEA 2HDNB 3FHTA 1NVUQ 4XJXA 1PLKA 3ZQJA 4HLUC 4PAOA 1JB1A 3FDIA 2CL0X 3IIKA 4D4JA 2IXEA 4RD4A 2F3TA 2GJ8A 3P1JA 2WWIA 3AGPA 4PR0A 3CF0A 3PQCA 4M9SA 2XZOA 4BEBA 3HYTA 1QG2A 1FP7A 1NMZA 2XOKA 1W0JA 2IF0A 3B9QA 3PUVA 1GNQA 2ANBA 2GKSA 5DHFA 3IEVA 2FX3A 4D0GA 3K9GA 4QGFA 3G82C 3SOPA 4NHOA 4QHSA 5C18A 3CNLA 4OHZA 3MCAA 3KQKA 1K6MA 4JLOA 1GWNA 4TYNA 5TXGA 1D6JA 3SHFA 3MWLA 1E1QD 3GJ7A 2OT3B 4OBEA 1E0AA 5TY0A 5K8UA 4ERNA 4OK6A 3GD7A 1KKLA 5AJXA 3PXGA 4LPKA 4PO9A 4PPNA 3HPRA 2JLYA 2IS1A 2R9VA 2IXFA 3KJGA 3SC3A 2C5LA 4PHGA 2B7CA 2FU5C 1E2EA 2QAJA 4EPVA 3OHMA 4Q7KA 2DFTA 5L8VA 3M0EA 1FPMA 2GAAA 3KFVA 4JT2A 4OK5A 4M8NE 3W9YA 1D9XA 4IXMA 1ZW6A 3CRRA 2Y8EA 4HATA 1OSNA 2OE2A 1FX0A 4YXWA 1SHZA 4OK3A 2ZREA 4LOAA 4KLNA 4CGZA 2FFQA 3C14C 3LWNA 4TLDA 5C1BA 1G291 2FPKA 1HH4A 2HF8A 1XBTA 1US8A 1UM8A 2J7PD 3U7EB 3WYAA 2QL6A 1GAJA 1W4BA 2Q3FA 2ZS7A 1IXSB 2N46A 4LPSA 3SI7A 3KB1A 1GSIA 3EX7C 2IYVA 4KVGA 5AUPB 1P61B 1VCIA 2O0HA 4TL9A 4MYCA 3SJCA 2GZHA 4W7SA 2J7KA 2WIBA 2D2FA 5FR1A 2DHRA 3UMRA 4NBSA 1QHHA 4B3XA 4KAXA 2WV9A 1I4TD 1XJCA 1J8MF 1G21E 1I2MA 1OF1A 3NBXX 5FL3A 1FNNA 1G8GA 5FUXA 1LTQA 4WZ6A 4URYR 3K70C 2O8FB 3AVPA 2JLQA 2ZRMA 4RCZA 2CL7X 1SXJB 1UKZA 4G1UC 4G5QA 4IXNA 3U5ZB 1ESMA 2GF9A 1F2TB 1XU4A 1K5GA 1NI3A 3K1JA 3A6PC 4MDFA 4NYJQ 2BMFA 4D2IA 3DOEA 3CB4A 4P32A 1P2SA 1J90A 4YMSA 2J59A 1W0KD 1R5BA 5EP4A 1MOZA 2HJGA 1XP8A 4ACBA 1T3SA 3LVQE 3PENA 4NYIQ 2YWHA 4LJ6A 1TU4A 2Q9AA 2GCPA 5KNBA 2F43A 2F9LA 1SZPA 3K8YA 5KPDA 3FE2A 1MO6A 2WVJA 4CEHB 2P3SA 2FSHA 4B6FA 4HSEA 3VU9A 4ZIRB 3NHAA 1W1WA 4TQ9A 1EX6A 2IC5A 3ZS9A 3B2EA 4M9ZA 4BLOA 2C99A 4Q66C 5B2ZA 4BQSA 2G3YA 1DAEA 3REGA 1SVIA 4GPTA 2REXB 1E2KA 4HUQA 2J7PA 4JKIA 3W8RA 1U8YA 2JATA 1TQ6A 4QJ4A 4A0FA 3WHKA 1KO5A 1Z0KA 1OFUX 3H86A 4NCJA 2HT1A 5AK0A 5BQ5A 2MSCB 4ARZB 4MGYR 1IY2A 4CF7A 1W46A 2W6JD 2B6HA 4M1TA 3AKEA 4URUR 4AWXA 5FOWA 1R0ZA 5JJKA 4A8JC 1OH7A 2ZEJA 3CBQA 3PEVA 3V00A 1JJ7A 3DO6A 4JL5A 1FMJA 2J0VA 1T8UA 3U6BA 1E2JA 3MUFA 4DB2A 421PA 1ZUNB 5F9FA 4IOMA 1PVOA 3MAAC 3IPXA 4URXR 3R20A 4BLPA 4JVSB 4DT1A 5BYKA 4UXJA 2IYRA 1XTIA 2J0SA 3ZGXA 3QKRB 1VMAA 2NIPA 4Q4HB 1II9A 3T1QA 2DWOA 3GLFE 3BBPA 1NNEA 1II0A 2ASEA 3NH9A 2GF0A 3PCRB 2QQ0A 4LJ8A 2Q9CA 2BEKA 3V4RA 3RS4A 2WWXA 4RD6A 1W0KA 2ZRAA 3TW8B 3C41J 2RGXA 4RFVA 3U7HB 1T4GA 3BFKA 1V43A 4GMDA 1RW4A 5DH9A 4DCVA 4MA4A 2NQ2C 5JHHB 2X19A 3D6TB 1KNQA 3VAAA 1CP2A 2ZQ5A 1XZPA 2REOA 2OLKA 1HEIA 1GKUB 1G7SA 1Z47A 3N5CA 2YZ2A 4PC6A 4HUQB 1KMHA 1S1CA 3AF4A 1EFRD 4LJYA 1N6IA 2ZJAA 1JPNA 3SZRA 3PUXA 2A30A 1OXXK 2J3EA 4KODA 4GZMA 4RKEA 2IYUA 4GSYA 1ZVQA 2YWEA 4BFYA 1DAIA 4NKRA 1E2PA 1GUAA 4HAWA 4DIEA 2Q3HA 1Q21A 4AK9A 4DHEA 2B21A 3LY5A 2CCJA 3BH6A 4GOXA 2QPTA 5FUWA 2GTPA 4L5BA 2PJRA 4W5WA 2C04A 3L8ZA 5EZ5A 1AZSC 1QZXA 2R65A 2W6JA 1R4AA 2OO7A 4H1VA 4TYPA 3N2EA 4F7WA 2WZQA 1RYFA 2JLUA 3R8FA 1C4OA 1P2VA 2CHQA 3AKCA 3QXCA 1E2NA 4MYTA 1WP9A 3KTAB 3A37A 4EPYA 4PHTA 3GLGB 4FI3C 1JI0A 3Q5DA 4BLSA 2AKAB 3KKMA 4JT4A 1L4UA 4HLUA 1DARA 2XTMA 1CR0A 1I4LD 2FG5A 1NLFA 1U8ZA 2FV8A 2GWHA 2ZROA 4QNRA 4F92B 1OE0A 2IUTA 3GLIE 3AVOA 2ANCA 1VHLA 3P4XA 5CK4A 1JEEA 4KFUA 4OI0A 2EQBA 5JEEA 4LX0A 2ZM5A 2CJWA 2XTZA 1MO4A 1LVGA 4KSCA 5L3RA 1XFAA 4B32A 3K70D 3OFNA 3W3AA 4Q9JA 2DCUA 4OQMA 4UXHA 4BFVA 4DLTA 5EXPA 2QRNA 3LAWA 4OQLA 4IJMA 1KKMA 1A2BA 2VH5R 4X8HA 4CIDA 5JI2E 4PC7A 3IHLA 1JNYA 1Z0DA 3LLUA 1N5KA 2VP2A 1XTJA 4E07A 4PQYA 4Q47A 2CEAA 2P5TB 3B7GA 2OCAA 1M6NA 5L3SA 4TL8A 4YMUA 3VR1A 1T9HA 1NF3A 3I8XA 4HI0E 4DRZA 4KITB 3WNCA 1EFRA 5JJIA 4LCBA 5DO9A 5DN6D 4S2EA 5C46F 1FP6A 5G41A 3SJZA 1P7CA 4V02A 4AYXA 5C2JB 2MMGA 1OFHA 3LXXA 5FBVB 3B6EA 1RIFA 1L8QA 2RGBA 2VHCA 2ATVA 5AJZA 3VHLB 3IIJA 2CNWA 5GVSA 1SHKA 3CO5A 3LNCA 1YZKA 3RS3A 4M9XA 4RFSA 2BC9A 1T3LA 4KJZA 4FWIB 1E79A 3PUZA 1XZQA 2IW3A 5EP2A 2RGGA 2GJAA 2WKRA 1JR3A 4OL0A 2EWWA 3BAFA 4B74A 4QBGB 4ZDKA 3K0AB 1YZNA 4IEEA 2XTNA 3BD9A 1E9BA 4IDNA 4M22A 3SQWA 2ZRKA 3WHLA 1KZGB 3AH8A 2J0UA 1CF4A 4PZZA 3FB4A 1COWD 3M1IA 1KSHA 4XVUA 1KYIA 1LW7A 1JXOA 3MRSA 4ZCLA 1BOFA 3QBTA 1CIPA 1MRNA 2VP4A 2ZPTX 1JQJC 2V9PA 2QM8A 1E94E 3TQCA 2R6FA 2AN9A 1H8HD 1NMXA 1KK2A 3FMPB 4IOJA 1D2EA 2H5EA 3LVRE 1E2FA 2A78A 2QT1A 1BKDR 5J4HA 4IVPA 1AA9A 1IXRC 1W47A 3NBFA 4RSGA 4TYWA 2F1IA 3THWB 3PG5A 3A1UA 2QNRA 5LDDC 3U4QA 1E2MA 5KSOA 3SDZA 2Q6TA 3VX3A 4V0OA 4DJTA 4GOJA 4Q9IA 4FMBB 1LF0A 4FCVA 4D4LA 3OEEA 4DUGD 4A15A 1FOEB 2RGEA 4NYMR 2JLZA 1SKYB 5IK2D 3EC1A 1WCV1 1Q57A 2Q21A 1GDDA 3KZ1E 4EJSC 1YZGA 3CPJB 2G1KA 1HTWA 1P2UA 4M1SA 3PIRA 5CDFA 1VKJA 2C98A 3HR7A 3L2OB 4TLBA 2N42A 4YONB 1J99A 4EQ6B 5AWFC 4B2PA 4IDPA 3T34A 2GK7A 3AEZA 3GPLA 3DM5A 4LC0A 1X1RA 1YR6A 4A4DA 4D25A 3BFVA 1XEWY 1YZQA 2D2EA 1E98A 4JLBA 4X8MA 1KSJA 2DFNA 3I5XA 4P4UA 1NLYA 2DYKA 5JWOA 5AUNB 4Q01A 4EDHA 4F4IA 1DAMA 3RNLA 3PEYA 4HB3A 1ZM4A 1Z3IX 2CK3D 2J5XA 3FKQA 1SKQA 2E87A 2G6BA 3CIOA 1Z2CA 4DC9A 3RRYA 2BM1A 5JSZB 1COWA 2IYSA 3FPAA 4BZQA 4IOLA 2VSXA 4MH0R 2ORWA 4LV8B 3SS8A 3EPHA 1JQLB 2OG2A 3DPUA 5FTLA 4CYMA 1H8HA 2ZRFA 1UFQA 3MFYA 3RRZA 3W6NA 1AQUA 2C95A 1GNRA 4A8JA 1KSGA 2ZU0C 1CRPA 1CR4A 2ZRJA 4O0MA 3CWZA 4LYAA 4BECA 2NG1A 4ZCMA 5C4MA 1ZUIA 2AD5A 3ZIAA 1OKKD 2FA9A 2KSQA 1KJZA 4BWYA 1UAAA 1NN1A 2QAGC 3MGCA 4D6PA 4IHQA 3KKPA 3QNUA 4I1SA 2Z43A 1HV8A 5SZJA 2VHJA 3DHWC 4A9AA 4G5RA 3ZLJA 3W5IA 3B85A 3BGWA 2CCGA 3BB3A 4WXPA 4DUGA 3GEIA 1G8FA 4HDOB 4TYQA 4C2TA 2O8DB 5IK2A 4FCWA 3CUEF 2DBYA 2CVHA 3GJXC 2O8BA 3L82B 1KI4A 5AJWA 5JCPA 1EG7A 3MJHA 1G20E 3WP0A 5D3QA 1ZMXA 4DKXA 3AP2A 4POAA 2IK8A 4BFTA 3OEHD 1VYUA 1KOFA 3K53A 2R6GA 5DSZA 4QL3A 3DVLA 4OKSA 1R10A 2V6JA 4B34A 2VP0A 1TQ2A 5F2EA 3T1OA 4JL8A 1KO4A 4B3GA 2QY9A 1F60A 1HE1C 4URVR 2D62A 5KSYA 2WOJA 1M34E 1HURA 1UADA 4RKFA 3LV8A 1ZNYA 4XVQA 5GJVC 1AS0A 3CX7A 4DZZA 3WMFA 1LV7A 1ZNXA 1S1MA 3SFZA 5KDOA 4PX9A 3AF1A 2VA8A 1GTVA 4HZIA 4LC1A 3SYNA 1WMSA 1VCMA 3QG1A 4ZPXA 1QBKC 2QTFA 3GMTA 5UKDA 1W36B 4XTRA 3ZD6A 3AKDA 1NMYA 1YRAA 3S1AA 4US1R 3DKPA 3M4YA 1CRQA 5B57C 1P4SA 2NGRA 4PPFA 1G5PA 4PQFA 3BXZA 2P6RA 1HUQA 3RYTC 3X1DA 5FPTA 1NY5A 5JLJA 1QVRA 1OB5A 2YJTD 2AXNA 4HAUA 1TAGA 2ZRDA 4P4SB 4X8OA 1R2QA 3QOFA 1JJVA 1G4AE 1FTSA 5EUQB 1ZUHA 3I92A 3RS7A 3CZQA 4U7DA 4O3MA 2ZRGA 4IVRA 3BC1A 1N2CE 1U81A 2WWHA 2X8AA 5KO2A 5J47A 4V0KA 1KJWA 2YV5A 4K46A 4L8GA 3TAHA 1R0WA 5DISB 1XEXA 3QPUA 2F55A 3OZXA 3OEHA 3LO5A 5DYGA 4XOIA 2ZSBA 1RRPA 3PJRA 2IUSA 2VSFA 5DE3A 3NEJA 1G19A 3N70A 1T6NA 3KUCA 3NH6A 4MITA 3DM9B 2A5GA 1F3OA 2W83A 5CYOA 1E6CA 4JVNA 1BIFA 2J46A 2AXPA 4HZUB 4L9SA 2BCGY 4JLDA 4M1YA 4C0LA 3JVUA 2QT0A 1NSFA 1G3MA 4LJ4A 3CH4B 4JVLA 2ZE6A 1L2TA 2VYFA 4G01B 4PAQA 1E1RA 3HWSA 1PLJA 4C7OA 1XMIA 4QJ3A 2OBMA 4AY2A 4M21A 3AUYA 3ADDA 3GLFB 2QE7D 4AKIA 3PR1A 4D26A 4B35A 2VIIA 2XAUA 5AUQA 5H70A 4M9QA 1YR7A 2OCBA 2RHMA 4R2IA 3GLIA 4I1OA 5IHPA 1ZM7A 2ZS9A 3FHCB 2ZJBA 1DG1G 3QVUA 1FTNA 1G8HA 4KBFA 2FEOA 4FW9A 2MSDB 5HPYB 5GADl 2FPLA 2BJWA 4AYTA 1ZNZA 3OIWA 3P32A 1FZQA 2RKOA 4LYHA 3SE0A 2P5SA 3D31A 4TT3D 1Z6YA 4E5UA 4UNQA 4TLAA 4XWAA 4IW3B 2G77B 1XNJA 4PO1A 2AX4A 8OHMA 3QSYA 4FMCF 2VP9A 1SVOA 2CLDX 3OF5A 4FN5A 1T0JB 2NPIA 1XEXB 2GCOB 3AF0A 3QUSA 4TMKA 4B71A 3OESA 2A5DA 3GLHA 3K9HA 1Q22A 2BHRA 5EP3A 2YINC 3DZDA 3Q85A 3RS2A 3CX8A 4UNSA 1IONA 2BM0A 3DL0A 1P60A 2BCJQ 4PSAA 2G83A 2OLJA 2RAPA 4DBLC 3TK1A 4AKGA 4Q7JB 1JR3E 2OFXA 4OHWA 4EJSA 3LBIA 1Q20A 2XXAA 1SVSA 2D74A 4RD1A 4UXIA 5K8IA 4C0SA 1AQYA 1DVRA 4QFMA 3EC2A 1JBKA 4DSUA 1XEWX 2WWYA 2F1RA 3CRW1 1KDPA 3ECCA 4EPRA 2W2VA 3PV0A 5J40A 4LHXA 3THXB 4FMDF 4JL6A 3FMIA 2V1XA 5DI3A 3GLIB 1W48A 2QE7A 1N5LA 1RC8A 4KFRA 4OHXA 1KO1A 2BDTA 1M7GA 3R9XA 2HCJB 4Q4LA 3RWMB 2ZE5A 1E69A 4JSTA 4EIWA 5JRZA 3ZD7A 1TMKA 2OUKA 1Z0FA 2OXRA 4EKDA 1EWRA 3QKSA 2D3WA 2GXUA 1W4CA 3SBDA 3EA5A 3A58B 4Q1BA 3A4LA 4O2RA 1R6BX 4LI0A 3GJ3A 3SYLA 1OFIA 2WWFA 4MRPA 1PV4A 2FF7A 2PLFA 1KI9A 1Q3HA 1KI6B 1OXUA 1S9HA 2IX3A 4KHZA 3I61A 1II8B 1Y3AA 1E2IA 4TT3A 2IYZA 3MLEA 1UBGA 2FE4A 4X8LA 4DLVA 4A1FA 5CDFE 4M1WA 2Z4SA 4DEYA 1G3QA 3TE6A 4DLYA 2OBNA 3UANA 3W8NA 1DO0A 4RVCA 1D5CA 4JSYA 3C8UA 4OQFA 1EFCA 1DBSA 3A1SA 5JZVA 3VNVA 1E4YA 1KDRA 1TF2A 2H18A 2LKDA 2J1LA 2QAGA 4WAUA 4DDWA 5G3ZA 2O52A 4LV5B 5JWRA 2L0XA 5FL7A 1H65A 1P62B 2NO7A 4ZKEA 2UVQA 1GVNB 2W58A 1UF9A 4PSKA 1XRJA 2XXAB 1RZ3A 3C4JA 3UKDA 2W6ID 1VPLA 1KK1A 1A4RA 4TMWA 3U44A 1CR2A 3IO3A 5AR1A 1XMVA 4N3NA 1M74A 4B43A 3LQRA 2GCNA 3I5YA 1NVVR 2WSMA 1NBMA 2PH1A 1E9AA 1P72A 3RRMA 1TTTA 1HT2E 4DDUA 2VF8A 2QBYA 3IKJA 3O8BA 4F91B 3EAQA 2W0MA 1CJVC 1U90A 4CVNA 4XVRA 4F4CA 5CIQA 3GJ4A 4ZV4A 3QG5A 1F5NA 4KSBA 1W2HA 2BMDA 4TMTA 2O0KA 2QMHA 4WVFA 5H1YA 1K5DA 3TSWA 2ZI5A 4JLAA 4LV6A 4B3BA 1SVKA 3RDPA 1U2RA 4QNMA 3AP3A 1IY0A 3I73A 5JECA 4B3DA 2OV2A 1FX0B 3Q7QA 4KO8A 3SU8A 5IT5A 2IS2A 3BH7A 1AM4D 3T15A 5EXTA 1MO3A 1OV4A 1HQYE 1US8B 2X77A 3BRWD 4CEJA 2IL1A 3RANA 2RH5A 1LF5A 1ZAKA 2QSZA 3U7GA 4TYYA 2K5UA 1R5NA 4NTZA 2GBLC 5CM9C 1CXZA 5EXXA 1GL9B 3O47A 1CJUC 2WJJA 4Q48A 2ZYWX 1W7AA 3CRMA 1ZCBA 1VCOA 4L4UA 4QBHA 3F3YA 1A82A 3EG5A 5DIFA 3VR5A 1IN4A 4Y0VA 1IOZA 2ZRCA 3KQLA 3NBZC 1ELOA 1QHHB 2OSBA 2QRZA 2F6RA 4WBSA 4NMMA 2W6IA 2V3CC 4BRUA 4EFNA 1BYUA 3BORA 3FKSD 4PZYA 3ASYA 3CPEA 2RGNC 5FOVA 2V4ZA 2YC2C 1AK2A 2QBYB 3TUZC 4PQRA 3L8YA 3JZMA 3TBKA 1KK3A 3LXRA 2R44A 1G3IA 2G88A 1VCNA 2WSSD 5BWMA 4NCIA 1FW6A 1Z08A 1FFHA 3BS4A 2FFBA 1HY3A 2GEUA 4GMXA 1ZD8A 1QG4A 1WBBA 4ZKDA 4JBYA 1W4RA 3QBVA 3BH0A 4LJ9A 5DYIA 4KXFB 4A2WA 2F43B 3OFND 1N6KA 4LZZA 4U02A 1G3UA 3MD0A 5SZKB 3ZVMA 1CJKC 2IYTA 3OAAA 3QKUA 3VR4A 4CZ2A 2B8TA 2IHBA 3VU9B 2ZUBA 4JZKA 2ZJZA 5JWHA 1W36C 1E32A 4BLTA 1X8LA 1AS2A 1UPTA 1DAHA 4GOKA 2OBLA 3BFXA 4BFXA 4FIDA 2O8CA 4Q7LA 3B1XA 1VTKA 2FWRA 4QJ5A 3LBNA 1NN3A 5JEDA 2BWJA 3ZZUA 1YHNA 3ICQB 1U8AA 4ZI2A 4ZCIA 5LD2B 4EPTA 4IOKA 1GRQA 1T3HA 2H17A 2B8WA 3QXSA 4C2UA 2FN4A 3THYA 4WOPA 2CNWD 2ZSEA 1ONBA 1SVMA 1FQJA 2CLSA 5JMTA 3PITA 4B3FX 1E9EA 4I1VA 3H1TA 4D0NA 3DDCA 4B2IA 3PEWA 4G5SA 1GKYA 2GEVA 2RGAA 3R8CA 1E9DA 4PPGA 3OE7A 1ZP6A 2ZI7A 3HR8A 3MSXA 3ZQ6A 1E79D 1NJFA 3ZVNA 2GEDA 1XF9A 3FKSA 1JR3D 1DPFA 4DT1B 1DELA 1KTVA 1N6PA 1WA5A 4QGHA 2QROA 2ZRPA 5FPHA 3CKLA 1VG9B 3IILA 2B7BA 2DFLA 2D7CA 2ZRIA 4LWZA 3RHFA 4DLWA 4QXAA 2WSSA 2RMKA 3EXAA 2KBFA 5TV2A 2QZ4A 3TKLA 4UNRA 1VYVA 2NZ8A 3T5DA 1TU3A 1KMQA 1R7RA 5CB6A 4W9MC 1O87A 5FR2A 3UXMA 4A82A 2OCYC 5E7JA 4TMVA 1ZM3A 3RC8A 3J81k 2F3RA 2H1LA 2ZVQX 2IYQA 3RABA 2CBZA 2CLCX 5KPJA 1CU1A 1Z6GA 2MSEB 4XWKA 1KMHB 4PAMA 3WNDA 4F4JA 2ORIA 2GNOA 3PFIA 3OEED 1X6VA 2JDIA 4ACAA 4CDGA 4EUNA 4TSFD 4CRWB 4Q1CA 1IN5A 3RS0A 1M8PA 5HKKD 1XD2A 2J0QA 3GFOA 5G40A 3KL4A 4PC3A 5GVRA 3UMSA 5JJLA 3GLHE 2Z4RA 2OXCA 5P21A 1L7VC 5KSZA 3Q7PA 2QA5A 3THOA 2ZR7A 3EW9A 4BPBA 4NH0A 1Z63A 3K0FA 2PX0A 4FMCB 221PA 5IRCD 4PFSA 3TMKA 2AL7A 3Q9LA 2XB2A 2MMCA 5GJCA 3BOSA 4M1KA 2ZAOA 1TEVA 2BBTA 2CVFA 4YLGA 4PZLA 1E0JA 2GK6A 2J45A 1ZU4A 1YE8A 5AJVB 3B8HA 5A4JA 5KDDA 3BK7A 2QU8A 4RCYA 3NC0C 4C0KA 4MYHA 1HT1E 1UKEA 5B64A 2JJ2D 4KI0A 4IRUB 4QC2A 3R7WA 5CITA 3QXHA 3KKOA 3L0PA 2CJWB 2XNDD 2A9KA 4GT1A 4HAYA 4OQXA 1QHSA 1DAFA 3RC3A 1N5IA 1XMSA 2XITA 3WY9A 4AIIA 2R8RA 5D3MA 1DOAA 4LBWA 4MKGA 2ZTSA 1XPRA 3BB1A 4FMDB 2W00A 1EFTA 4R71A 3CRVA 1MH1A 3B1VA 4H1UA 3ZIAD 1S2MA 2NMVA 5KUTA 2FZ4A 3D7MA 5LBIA 4AKEA 3FMFA 2VRWA 1ZRHA 4CT4B 5L3SB 621PA 1RRCA 1CBUA 2V54A 1M2OB 4JJKA 1G17A 4R2HA 3UWKA 2A3RA 4RZ3A 1AGPA 3ASZA 2JLVA 4GBMA 1KO8A 2PBRA 4TSFA 3SYKA 1NN5A 1G3RA 1XB2A 1UKVY 1JAHA 3IPYA 4I81A 4NYMQ 3B5JA 5HKKA 2NO0A 1X1SA 4Q00A 2GETA 3GJ6A 1CR1A 1DG3A 1KY3A 2REBA 5FI0B 4HB0A 5F98A 1TX4B 1UEIA 4RFSB 2A5YB 1XCMA 5JFGA 3SQXA 3B82A 1N6LA 3NWJA 4N1AA 1RFLA 3QF4A 3DOFA 1XXHA 2H8KA 4A2PA 3LW7A 3TNFA 4MUBA 4Q02A 3FOZA 2XX3A 1S3GA 1TPZA 2AK2A 2J0UB 4CEIA 2NO6A 3B1WA 2ZSFA 3ZZTA 1NBME 2GBLA 1EXMA 1XJQA 3U6KA 3HDTA 5BW8A 1H8ED 2G0TA 4B44A 1OT3A 1G64A 2JJ2A 5JHGB 3QJYA 5LB4A 1G5RA 3RS5A 1AKYA 4HB2A 1N25A 5L3QA 2N1BA 2QSYA 4KCGA 3MWYW 1OIWA 2XJ9A 4LY6A 4M2LA 2XNDA 2EYUA 4L16A 4U5XA 5HZKA 4JBXA 2WOOA 3T5GA 1QHNA 1RKBA 3K70B 1NIPA 1E2DA 2XB4A 4LHYA 5E7IA 4MYUA 1TF7A 1SXJC 2YKGA 3QPWA 1J2JA 1UDXA 2SHKA 2WJHA 5FPKA 1EGAA 2J9RA 3CW2A 1NJGA 3U4QB 1W5TA 2UZIR 1DADA 1IJFA 1BH2A 4FWTA 1OPXA 2FDCA 2QG6A 4K8OA 2HLDA 2YOHA 2XZLA 2P0EA 1YZUA 4AG5A 2A7QA 2J87A 1SVLA 2WBLC 4Z54A 4RZUA 2ZSAA 2HYIC 3ZJYA 4B47A 3CX6A 2KBEA 5TARA 3EWAA 2V7QD 4TMZA 4DLSA 4ESHA 2ZE8A 1P3JA 1GKIA 1YRBA 4MRNA 1X86B 1Q1ZA 4LHWA 1R8SA 2QP9X 3IDQA 1ESNA 2F1HA 4W5JA 3VR6A 2AR7A 3LX5A 4UNPA 4RZXA 5KYKA 1S96A 1VG8A 3I8SA 3IIMA 3WRXC 4FINA 3AGQA 4IDQA 4MKFA 3UG7A 3F0TA 2JGNA 2XSZA 5EE0A 1JR6A 2YVUA 3HP1A 3VMFA 3IHWA 2NTYC 3T1TA 5E4FA 1RJ9A 4Z8YA 4A92A 2ZRNA 1ZCAA 1TQ4A 3MMPA 2C77A 4P4TA 4YMWA 3LX8A 1WXQA 2WPDA 3FWYA 4FD2A 2HXSA 3KQHA 3NHBA 4JLNA 2PEZA 5A0FA 1A5TA 5CB8A 5FPSA 5KNCA 4BGDA 1GITA 3EARA 4KYUA 3VTKA 1E1RD 1H8EA 3NEYA 2JJ1A 1ZD1A 4QGGA 4W5HA 4C3ZA 3GP8A 3X1WA 1UBCA 3D3QA 3AF2A 4ESVA 1YU9A 4A8JB 2NO1A 3KJHA 4G0NA 2QM7A 4GNKA 4HLCA 1GFIA 4LGMA 5GJBA 3NVAA 3GJ0A 1TADA 2PMKA 3A8TA 2ZS8A 1VHTA 3U7FB 2QGNA 1QVAA 2QP4A 3T1VA 4M53A 4Q1FA 3DMNA 3W6OA 2DPXA 2JIZA 2RGCA 2P6NA 4I99A 4DCTA 3O8RA 1IBRA 1U9IC 1J8YF 3BE4A 1VG1A 2ZYVX 4D80A 4EAQA 1I2DA 3SHWA 4WIAA 3JZAA 3VHXA 1IY1A 1CJMA 5G53C 5CYPA 3AM1A 2EU8A 2VTKA 1S8FA 3D8BA 3E1SA 3HYRA 2KI5A 3TW4A 1F2UA 1PLLA 2ZITA 4D0LB 4PXAA 2O8EA 3QENA 4GDFA 2O8BB 3HU3A 1DEKA 3U3RA 1KI8A 3MWJA 4P3YA 3KQUA 4ZI3A 2V7QA 2QTHA 1VECA 3RWOA 1G1MA 2YYZA 3EZFA 2EFDB 4TZ6A 2FOLA 1HE8B 4HDCA 3WYGA 2PZFA 1JALA 1GILA 4FCTA 4QG7A 2ZRLA 3QVVA 1S0UA 3CPHA 3RAPR 2IA5A 5JBQA 1MABA 2CXXA 2IS6A 3TLXA 4LBVA 5FOUA 2JLRA 3HU1A 2BV3A 1NSTA 4LYJA 2GJSA 1L4YA 4TMXA 3X1YA 5LD2C 1G7CA 1WF3A 5BYJA 2OHFA 3NDPA 2OAP1 1NKSA 4OQNA 1LY1A 3LFUA 3NIBA 2WJIA 1G6OA 2GZAA 2RGDA 2VPPA 4LBYA 3IBGA 3KXLA 2IEZA 1ZU5A 3KJIA 5EZ6B 2JLSA 2VEDA 2ZUDA 2ZJ8A 3TR5A 1XPOA 1OB2A 1GM5A 2X2EA 3AB3A 3REFA 2DFKB 1XTSA 3WNBA 5AJYA 5H68A 1NLZA 2NZJA 3GCGA 5KDLA 5LPNA 4Q4AA 1T0HB 2GZDA 3AP1A 1SULA 1Q44A 1XD9A 5SZHB 1UBFA 4G5GA 4L9WA 4MQBA 4B33A 3KUDA 4UQOA 1HQCA 2FGJA 4LJ5A 4LRWA 3TJZA 3S1AB 3A1TA 3C5HA 3PUYA 5EXSA 3ONWA 4JLPA 2ZI9A 6Q21A 2IS4A 4Q03A 3TIFA 1YVDA 5KHOC 1KY2A 3PUWA 4NCNA 3KQNA 3V4FA 4RY2A 2YWFA 2ORVA 4LDJA 2R62A 2EFCB 3VFDA
chains in the Genus database with same CATH superfamily
1RRFA 3ST7A 3NOQA 4Z86A 5KX5A 1GIAA 4DTCA 1BDJA 2FP4A 2HW8A 2AS0A 3RSLA 6NULA 3H2SA 1CQIA 4NNOA 2O0LA 5K8VA 1MKYA 4MQMA 2XGJA 1O6ZA 2Y1CA 1BGVA 3C5CA 3KKNA 4M60A 3NEAA 5DHRA 2VT3A 2VHXA 4FR5A 1I1OA 1MC4A 1W49A 4L76A 2VQSA 2HAEA 3T95A 3HJRA 4HLQB 3CF2A 4IX1A 3G5LA 3CNNA 1K4MA 3FTDA 3M5CA 2X3UA 3EPLA 5FTJA 1GV0A 1W2GA 1ZNQO 3GYBA 1W9MA 1Y8AA 3D4LA 2IIQA 3FYUB 4JB2A 4IJVA 1AXGA 2ODEA 2D5IA 4KPYA 4TS9A 5ED0A 1SHUX 4NOKA 3ABZA 1S2DA 5AYVA 1V5GA 2FJUA 4L0MA 4JP5A 4E2XA 2Q4BA 4MGZR 1TO2E 5TVKA 5G0WA 3TB4A 2W6OA 1KH2A 1G41A 4QGSA 5B7PA 3ZIUA 2DWQA 5LYJA 1JDNA 4U8GA 2O2XA 3SIXA 1H9CA 1ODSA 2VLIA 1AZTA 4OM8A 3GQBA 3KLBA 4DSNA 3FGNA 3I39X 2JI4A 1K1EA 1ZOLA 4J0QA 3ZWVA 3RU7A 4DTIA 3KZMA 3WB2A 4LJAA 3GMIA 4BNKA 4TTIA 2YIMA 2JGDA 2QG4A 5J4VA 4L75A 3IEKA 3P26A 2FQYA 5ADHA 1F4LA 3OIUA 4R5HA 4Q37A 3V4LA 3G23A 5K3FA 1NVXQ 2IHZA 6CHYA 2ZXEA 5T7BA 1BVHA 4PLCA 2NPFA 2IITA 5CK5A 5G2OA 2OUIA 2P77A 4GZLA 4X9XA 3A9WA 5BVHB 4O4LA 3OU6A 3KR0A 4NF2A 2RHDA 4G25A 4AZTA 3AETB 3O9ZA 3MG9A 3U2QA 1V4BA 2WYOA 1KFJB 1UMKA 1XZBA 3UQZA 4IH9A 3OLYA 4TVSA 4KWTA 3D8SA 2JLXA 4Q9LA 1QU3A 3GEHA 4FZJA 3NBAA 3CONA 5ADWA 2PTGA 5ALLA 2NZ2A 2WM9B 2XYPA 3CH5A 1FMTA 2JA1A 4WN3A 4CM7A 4EFMA 3ND7A 4F21A 1OFUA 3RJZA 3HPQA 2I29A 3AEYA 4MTCA 3B89A 1XMQB 2R751 5A02A 3ONEA 5JYCA 3EEIA 3GJQA 4ZICA 3EIEA 2XT9A 1RI3A 3QFHA 1B1CA 1FYXA 4G81A 4DCCA 1F2TA 1JXMA 2W8BB 3QOYA 4NCKA 4C0QC 4RD0A 3K09C 4M99A 3TR0A 4QOIA 3UW1A 4DL9A 4E03A 1CLUA 2QD4A 4YCAA 1W76A 1Z35A 4OLHA 1IK6A 1BE6A 2H31A 1C3LA 3FJ1A 3M5PA 4O2AF 2JCSA 4S35A 3N87A 1I51A 5EUMA 4CF6A 3UFBA 4P31A 3VUFA 3VNAA 1YFLA 5T41A 1X80B 3MQ2A 4RAQA 4AJOA 3LUPA 4FNGA 2FRVA 4IDOA 4B75A 1L6RA 5KS2A 1Q17A 1XDSA 1RRGA 3KFLA 1G63A 3IURA 4B9EA 1H5NA 1U2DA 1UPUA 2FMXA 3DNPA 4Y2HA 4CDMA 5L4LA 1QPGA 1G7TA 4OJKA 2ZJFA 5IF3A 2J5BA 3K72B 3MT9A 1O5IA 1FA9A 4EKNB 3PX3A 3R2JA 1K3UB 3ITKA 5HIIA 4MPPA 2UV8A 1RC0A 1EJ0A 1XPUA 3Q12A 1CVRA 4DGSA 4ZIRA 3WRXA 4Q9KA 5JARA 4DC0A 3PLAE 5LQRA 3TOXA 1T3ZA 3CTPA 1WW2A 2A1UA 4N12A 1BVRA 3GI1A 1EX1A 5DNWA 4B8ZA 5KNDD 3AEXA 4H08A 3BXXA 2OOKA 5IARA 1D6SA 2CCKA 4U00A 4X3OA 3OEWA 1YS6A 1SAYA 1USIA 1KK0A 1IHYA 1MQAA 4YCMA 3ZWAA 4ARZA 1O58A 5ICEA 4HEJA 3PC2A 5MFZA 2JAHA 1E3LA 4NPAA 1L1RA 2I5PO 3E70C 3GJ5A 3NDBB 2ZSUA 3K9CA 3LLMA 2PRKA 3WJ2A 4MRVA 1BO6A 1LDYA 1F9EA 4KN9S 1LFAA 4TOIA 2TYSB 4LRTB 4QWMA 2JCVA 3VVBA 2O5EA 4LVOA 3ENQA 1O9BA 4TTTS 2FZWA 1QS0A 3Q88A 1ZUNA 1B8NA 1E4VA 1MENA 1QDEA 2ON6A 2QTRA 4OI1A 4MS3A 3ZXSA 1N8SA 1T5TA 1V3VA 2H1WA 1L3CA 1YKSA 4DLZA 1UKYA 2JW5A 5DWQA 4TZ0A 1V11B 4BEJA 3EQZA 2BFCA 3CR8A 1OLSB 1IYZA 1F0KA 1P0CA 4NYIR 5D6OA 5FLEX 4ND1A 1TLLA 4F93B 4LF7B 1LPMA 5K8JB 5A5FA 3U44B 4Q3LA 1UJBA 3BCRA 4K9LA 2HJVA 3FYTA 3TW8A 4IJ5A 3RT7A 4RPHA 5KNCA 1DCKA 4OP2A 1R9NA 3ROTA 2G25A 3PR2B 16PKA 2WZCA 3CWCA 2WU3A 2GHTA 2XYVA 4C0WA 2EFHB 3N7UA 1DXHA 2QTVB 4E30A 4Q9HA 3VKHA 2GAOA 4YT4A 1YIDA 3DDWA 4KDFA 2ZYIA 2WMOB 5JI3E 1QFZA 5LDGA 2ONZA 2BMVA 3WWYA 1BA3A 5BR8B 1DP4A 1NX9A 2HA0A 1N0WA 3MTGA 4BWFB 4NRDA 2CY0A 2FPGB 5H59A 3RSOA 3ZUGA 2PY6A 4QHYA 4G56A 1E0KA 2AFIA 4UDNA 1CS4C 3OCXA 1VIAA 5KNDA 2HMVA 3N8IA 1FYEA 3KKQA 1TKBA 4EP1A 2V6GA 1KVQA 1BEUB 1G4UR 1F2VA 3VSBA 5DNUA 5EE9A 1J97A 3VKGA 2ZI4A 1ZGCA 1ISPA 4ZI5A 4LHZA 2B99A 3PC6A 4GKBA 1JAZA 1L7EA 3N39C 5LXTB 4MAAA 2I7XA 4J1SA 4V0MA 4U7TB 4PX5A 1HNNA 3K05A 2FSGA 4LAFA 1XTPA 1WMDA 3O03A 2C7PA 3DE6X 4ZRNA 4Z2YA 1PEAA 3ZZ1A 4BKUA 2VRNA 3F5FA 1CNEA 4IEFB 4YC7A 4FSXA 4OYHA 2HIGA 2P3OA 2AK3A 2Q5HA 4LHSA 3FGPA 5EIWA 5A3RA 2PQ0A 3AHDA 1OXSC 1EE9A 2PUAA 3I32A 5HE8A 3U7QB 3PQ6A 3OE4A 1G0NA 1UM9B 1Z7WA 3NTQA 2Y66A 2O2HA 4JGGA 3WBKA 3ZBUA 1IZZA 1V26A 3DBHA 4N8DA 3GRVA 3I37X 2J9FB 5CDGA 3AUXA 2X1HA 3PSHA 4U1RA 1EM8B 1VLMA 3EWNA 3EXG1 2ACVA 3AJEA 3NTRA 4LOJA 5FPYA 1SQ6A 3ZN2A 2E4AA 2RKBA 5KYNA 4F56A 4URZR 1KP9A 3Q5EA 1A5BB 2ONKA 1FSZA 1NOJA 3T7TA 2IUUA 3Q1LA 1IPFA 4DNOA 3LZCA 2BMEA 4FC7A 1P1KA 4L7VA 5ALYA 3KJXA 3HK2A 2UKDA 3GNSA 3PK0A 4A6EA 2Q4OA 1EUCA 4H35A 4U7HA 1SUWA 3AR4A 3QFSA 1I4EB 1S01A 2YJ4A 1IQPA 4KQ2A 3OE1A 5FWDA 1ZJWA 1Z07A 4OFXA 1NM5A 4EATA 2XMPA 5SY9A 5I01A 3LGXA 3FPFA 4F4DA 1ADCA 4MW4A 3SC4A 1JYEA 1KIMA 5DW0A 4Z9XA 3T61A 5IUJC 1Y9ZA 4ZCSA 5AIAA 1QYVA 4CNQA 3AK4A 2H0QA 3RH0A 5IT4A 3REQB 3KNZA 4C4PA 2ZBPA 1L4MA 3ND8A 4F3CA 4YQFA 4QM7A 3OURA 2YNMD 1I33A 2FFAA 3C7KA 5CLGA 1GNVA 1XTRA 4LXXA 1U8XX 2PFSA 5JBIA 1LS6A 3Q72A 5A2GA 1RE0A 4QFDA 4B3JA 1EXDA 2BFFA 3GFPA 1W8IA 4NCHA 5B1IA 5I7OA 2NU7B 4MQEB 3QBEA 2I3GA 2JI7A 2O2DA 3CWQA 4Q3CA 1FQKA 1X87A 5HTKA 1O97C 3LCCA 1DKLA 1N7JA 3DXFA 5H02A 4EO4A 3RVPA 4DUYB 2Z8XA 4IFIA 2ZR8A 3CJTA 3DVAA 3AR9A 2D3TA 3DT6A 3ZYZA 3RUPA 3VI4B 3LECA 1JSCA 2Y99A 2GZ3A 4WBXC 4AJKA 4EPXA 4F9FA 4OSEA 5IEBA 1YQTA 2YRWA 4JLVA 3AV3A 1JPJA 2I80A 3COSA 4HAIA 2O8CB 5FD8A 4NPHA 4PHHA 5JAHA 4KZPA 3ZWQA 3DOUA 3C4QA 1BHO1 1PTKA 3A1WA 4RY0A 2VP6A 1O77A 1STOA 2I2FA 2DRIA 1WZEA 1YJQA 3AERB 2CLLB 2OBXA 4YMGA 1GUDA 3JALA 4WNCA 3ICPA 3A0RB 3A4MA 2QBYB 2BR5A 1ZHOA 2XECA 2X41A 1ANKA 1K63A 4BY9E 4IDHA 4CLHA 4YCCA 1SKMA 4RDIA 2WG0A 4V24A 2VL7A 5FBQB 1ZH4A 3G88A 4R9RA 4ZQHA 2WJGA 2C5HA 2KE5A 3QXXA 5DRYA 1C9NA 3G2OA 5H9VA 4WOJA 4GZ5A 2FMHA 4J16C 4G86A 2ZI3A 2MOKA 3AVQA 3V8VA 2R68A 4GICA 4PM4A 5CM8B 3WYFA 2HCRA 5I7HA 1NXSA 1SBHA 2GAIA 4IQ4A 3FHOA 2BEVB 1H2YA 1SCBA 1XTKA 2QXUA 4XM2A 5DASA 1AMNA 4JJGA 3OH8A 1T36B 2AKEA 1BSVA 3FOEC 4C0AC 1P1RA 1UOQA 4ZA2A 5EIBC 4M0FA 2WWVD 3HGMA 4TQGA 3OSUA 3QQ5A 4Z99A 5T8KA 2VHQA 1ILWA 1XZIA 4OEHA 3K4QA 4UU8A 4W9NA 1RYMA 2IPNA 3JSXA 3N8GA 2Z3VA 1TUEA 2YNMA 1F9AA 4KRYA 3TTYA 5BSEA 2ZYSA 2YYSA 1G6HA 2R8YA 1Z36A 1PEKE 4OATA 4TUYF 3B9BA 3TYXA 4R8MA 4AMZA 4HDKB 2DHEA 3EXFB 2EF1A 3LUKA 1EVEA 4D44A 4XRGA 1X70A 3HCNA 2HGZA 4UZEA 3IVCA 1GARA 3TIVA 5F52A 5FUYA 4J0GA 4MUMA 2JEOA 4BE7B 4MUAA 3ANNA 3ZTWA 2D06A 3TE7A 4QBIA 1I4DD 1IEWA 4C20A 1JEQA 1V8ZA 2ERXA 3FUXA 4D98A 4JXZA 5DP2A 1NBOA 2WYIA 1XD2B 3A3KA 1PYOA 2ZJOA 3JD1A 3LY7A 3MJRA 5K0BA 3H84A 5F73A 3ER8A 3WGVA 2VDWA 4FB4A 3DFFA 1YDEA 3FXAA 4DCSA 1WABA 2CLIB 4ITRC 1ENOA 3F3KA 4Z1MD 5HIKA 2XYQA 1TK9A 1B6SA 1T91A 3SM3A 1U5CA 2G76A 3RTAA 4Q16A 3K0FB 3NALA 1H0RA 3EH1A 5FB3A 4CG1A 3PXUA 5ALKA 1P9NA 1JLMA 1U1EA 2DKFA 3BWEA 3QWHA 2QJTA 5AVKA 4HEA6 3H2KA 4HH4A 2I71A 1KMNA 4FNAA 3H5VA 2HPZA 2XSZD 4MR7B 4E2FA 1YBVA 2WFLB 4F85A 4JFAA 5FTKA 1RWBA 1PI3A 1W36D 3TL2A 2CHGA 2XVAA 3M9WA 4IVNA 4EMTA 4FGWA 1WE2A 1GL7A 2IUFA 4GECA 5FYDA 2E6KA 4C30A 1B23P 1EWYA 5CGZA 3R75A 2WU4A 4JI6B 4ZEVA 4O2AB 3OKFA 1J06A 1MNAA 5EE5B 3PDIA 5JS8A 4QOFA 1EH5A 4HAVA 4YMIA 4L4SA 2GPWA 3K9NA 4ZU1X 1L7MA 4QEDA 5FTWA 4PIMA 2IYXA 3PFHA 2XUIA 2AXEA 1C4XA 1QLJA 1T8YA 3IT3A 5YASA 3LOPA 1OXTA 2Q7XA 2H4JA 3B36A 3ZWCA 5ADUS 1SC9A 5FEUA 1PE0A 1RT9A 2V1UA 2PYIA 1L4GA 3HBJA 3IV9A 3QX3A 2QD1A 1RQGA 3UMVA 3LSTA 1Z16A 1QB8A 5EJMA 1E59A 2D4HA 2HA6A 3L1HA 3JARA 1ZS9A 2HGSA 3OU7A 4FX2A 3WOHA 1Z0AA 4QUDA 4TXMA 1R5OA 3LHFA 1E3MA 3RIHA 4DQVA 4ZU3A 1KP2A 3ROZA 4XR9A 2IHYA 4ZYUA 3QSGA 2QD3A 4UZFA 1ECPA 3BK2A 3VM6A 2Y1KA 1M2WA 4PAGA 2PPVA 2XCUA 4H1TA 5CIWA 1MEOA 5BV1A 5E9JA 2Q2OA 5T4EA 4Q7MB 1MC5A 4ZZ0A 3AUJB 5BUCA 1QGDA 4LGYA 1OH6A 4I4IA 2ZSJA 3UAGA 2I4IA 2G1AA 2I9PA 1K27A 3C15C 3NUGA 3R3ZA 4YPOA 4XWTA 1Y63A 4ALIA 1KF0A 1IZ8A 1ZMRA 2CHVA 2L82A 2VJPA 1TVKB 3LIIA 3U39A 1QIGA 2VP5A 3WGQA 2C96A 4Z1MA 1UC8A 2HU5A 4BQNA 3OF3A 1QRAA 1EJ2A 1JQEA 2GDZA 1S2NA 3HB1A 1YOBA 2DPLA 3K0CA 4MJ3A 4GX1A 4S24A 5BSGA 4DXDA 5TE9A 5JXWA 2H3HA 3IO5A 4KR9A 4AFNA 3MUNA 4ZT5A 1DZIA 2PEYA 4TTRA 1PX2A 1MV5A 3AFIA 2XWPA 1HYQA 3C98A 4WA7A 3HKCB 4BMCA 3AR6A 3W3ZB 1Y3DE 1PSZA 2KWIA 3BQMB 1EP9A 2NX2A 3EZYA 3UWOA 4BV8A 5FH9A 3MD9A 4OKIA 4YRSA 2J30A 3QEJA 4JJZA 4Y9SA 3JQCA 4YFYA 5U4XA 4UFNA 2QTBA 2IXGA 2XUDA 5A9SB 5CP8A 1RQLA 1E5LA 1ZKDA 4X20B 4C7JA 2C1ZA 5EJ5A 4LYFA 3M2TA 2NZYA 1NNSA 4HADA 3AF6A 4Q82A 3T1HB 2J4FA 1YR9A 2BBSA 3EFEA 3KAQA 1LDMA 3KSUA 3I76A 3WDLA 1ETHA 1RQRA 2BSXA 2FPOA 1Q1NA 4EVSA 5L3QB 1TLFA 4REQA 1E6UA 5FI5A 1IMOA 1VIVA 1U0JA 4P4SA 4QUHA 1HDCA 2GUGA 3QU2A 2JJ8A 2AFIE 2OYSA 4YGXB 1M2GA 2E4VA 5JMPA 3T6KA 4ZZIA 2NADA 2WWWA 1HQDA 1KAGA 1LB1B 2WHPA 3A7DA 1IEQA 3GFTA 4RXMA 1TB4A 5CDYA 4DXAA 1TEZA 1TTHA 4Q19A 1N0UA 2CMFA 2QS9A 3RM3A 3VNUA 1TEHA 4ZHQA 3U3XA 4KYTA 2I2XB 2W6PA 1IN8A 1LBQA 5J1TB 3TD2A 3ELDA 1V7ZA 5E9AA 1VLJA 3T5MA 5EZSA 3TXXA 2DWPA 1OWLA 3VX4A 4BE4A 3B1ZA 5AW0A 3DCJA 4QM6A 2H2DA 3UAZA 1FMLA 4C5CA 2IW1A 5HCNA 3JTMA 1JT9A 1JP7A 1BW9B 2WLTA 4V0ME 1CUYA 1V9CA 3ZXIA 3Q3CA 1XZJA 2NU9A 2BM8A 2QRLA 4RVNA 4V0SA 3Q10A 4CT5A 3F97A 2A59A 3ED5A 3KTOA 5FTNA 5CNJA 4B5KA 4XTCS 1BYIA 2BISA 3ES9A 1OZGA 3CZCA 3KO8A 4FVTA 4JUIA 4PPYA 1RM5A 1IRIA 3LKDA 3DQQA 4Y9TA 1UPCA 3NBMA 3OCVA 3QGMA 1L5HB 3KS9A 4JLUA 3G2NA 4DEXA 1HYEA 3G0HA 1N33B 1P8AA 3RD5A 1WCYA 2O1EA 3BA6A 4XIGS 1WDMA 2DETA 2W2XA 1Z88A 4K6MA 1DAGA 1SWVA 2PQMA 5C53B 1J1IA 4EW3A 2H7CA 4QJIA 1Q0SA 1X7WA 1UXIA 4WUTA 5I7EA 5DHAA 5KOYA 4D25A 3D6NB 2EAUA 2R84A 4QVKA 1T4MA 4D7AA 4QOGA 5AIBA 4RGBA 1B6TA 3UPUA 5HQ3A 1ST2A 3KXKA 3ZK9A 2EBUA 2NXWA 1SIWA 4GI7A 4M0LA 2WV7A 3BDAA 3LOUA 5CHYA 3WB9A 5CDHA 2WAXA 2Y6UA 4EUHA 3Q40A 3U48A 4D4IA 4ENVA 3MIIA 1SN7A 1Y5NA 2G1JA 2FPSA 2IHJA 3G2JA 3IJRA 1QANA 2EBWA 4MAMA 1JSLA 3T4UA 2GVDC 4DMKA 2Z2YA 1EP3B 2PL5A 4KVAA 1KDZA 3RRJA 5JAIA 5BORA 4ZOAA 1ULSA 4P58A 3U13A 1DHRA 4C0JA 2EXXA 2HQBA 1ZIOA 3PUKA 1ADBA 4PSVA 3HQ4O 4UAVA 3K0SA 2R79A 3EIQA 5JH7F 3AF3A 4FC6A 1SXQA 1D2MA 4UE2A 3ZH2A 1ESEA 2Z4TA 1UOPA 2EIXA 1KYTA 3K0EA 4RZ2A 1W5FA 2PT5A 4AZ3B 1SQ5A 4MW9A 1F6BA 4B6RA 2BW0A 1E96A 1N0IA 4RZQA 5KQMA 1IBLB 4FYHA 1QFMA 4YP5A 3VZSA 4YJDA 1L8LA 4R0MA 4WNAB 1XELA 3WXBA 3NHSA 1MB4A 1GKKA 3T5AA 1A8PA 1NPTO 3FYHA 2OV8A 1JFRA 3PEUA 3BZWA 4J7CA 5FADA 3SC6A 3P20A 1NVMB 1A7KA 2JFZA 4LCJA 3NTUA 1G55A 4KIFA 2H1SA 1W59A 4C2AA 4EF4A 5I7RA 1N6RA 2FSFA 3IQDB 2DWCA 3VHXB 1PR5A 3MOIA 3BMCA 2XEDA 4LRYA 1O89A 1FZTA 1UBTS 1JDBC 3RFVA 4ARIA 4ESEA 1Q7GA 1TMYA 1ZLXA 2P67A 4KE6A 3I0NA 2RCNA 3UFXB 1UIMA 4QKQA 3C3XA 4YMVA 4DLUA 4MCJA 4LA4A 2AOUB 3MVEA 1C9EA 1YS1X 4RJKA 4X44A 3IVRA 1L5VA 4ZO4A 5J5AA 4R7ZA 2HK7A 2XT0A 2GNPA 2SNIE 2AC7A 3WGYA 5I47A 2IF2A 4U3JB 4IRXA 4RTNA 2IPAB 1HA3A 4WFKA 2ZRBA 3CNBA 1KDTA 3L07A 5IC6A 2ZETA 3ILSA 4M36A 5AK3A 4BTLA 4G24A 2OHVA 1MABB 2VN8A 5AHKA 5LBTA 1WD7A 1RSZA 3BKXA 4NOLA 3RRNA 3C7TA 4C0HA 3U1TA 3RAEC 2QMOA 1HKUA 1XMPA 3OX3A 5GV8A 3OQHA 4KWIA 2QW8A 1G8PA 4KQIA 5FOSA 4R8SA 3NB0A 1IOVA 3KT3A 5LQDA 4MR9A 6AT1A 2NYUA 4XPZA 5KEIA 1WBDA 2CL6X 3SBEA 3N7TA 5K0LA 1SM4A 4B6PA 3T54A 3WRWA 3EN0A 1A5AB 4OGWA 4D9IA 4CKZA 4AS1A 4U39A 4X65B 5F5LA 1WSDA 3L8CA 1YIOA 1KZ9A 4JBWA 2H65A 3RVKA 3AVWA 4GR4A 3DDZX 2O6HA 4PANA 1LCIA 5I8WA 5IULC 2W2TA 1C41A 3G2QA 4HB4A 1UXHA 2QSUA 2CLEB 1G9TA 2UZ1B 3F46A 1K98A 4TV8F 1UMDB 3P94A 2C2GA 1KIAA 3CLTC 1B15A 3F3MA 1NVUQ 1MOSA 1RBYA 4XJXA 1KQNA 3FHTA 1KS2A 1DTEA 3RR2A 2CL0X 4D4JA 4RD4A 3NKFA 4JT9A 1SCIA 4TM8A 3JQBC 4MTLA 3H9UA 2MCFA 2GJ8A 1EG2A 3OOJA 2YJNA 3DZIA 4G6ZA 3CF0A 4PR0A 3MSCA 1X1AA 4M9SA 1XNHA 4PLYA 4XUEA 5KINB 1NMZA 2V6MA 4QYSA 3B9QA 2COKA 1RXIA 3M6VA 1GNQA 1HF3A 4E1BA 5KTNA 4AQYB 1C3EA 3ORSA 4JXKA 2FX3A 2Q2VA 1Y4UA 3A6DA 1ATZA 3ZK8A 2WUEA 3G82C 3L1VA 4TKVA 3G5MA 4KUEA 1HR0B 3BXEA 3DKKA 1CY4A 4TUYB 1RM4A 3MJVA 5P8WA 3WRYA 1Y9DA 5JAOA 3MCAA 1U80A 2BLLA 2HDOA 3DG9A 1AXEA 2Z5LA 3E15A 1K6MA 3AZQA 3DBLB 1ACMA 2CJYA 5ERYA 1I7SB 3NRCA 1VKRA 2VJLA 3I8OA 1J0XO 1LI7A 4W1SA 1RHMA 3BWMA 2JCGA 1JVBA 3GVHA 4MKRA 3W1VA 5JYDA 1JFVA 3WICA 4CLOB 1E0AA 4P08A 5KYUB 3S5JA 3QUTA 4JX9A 3PXGA 5ELLA 2P2GA 2FY8A 4HX9A 3ZU2A 4PVDA 1U3GA 4LPKA 4U0JA 3HPRA 5FBZA 2OWEA 3U31A 2WRZA 4M0UA 2R9VA 2IXFA 4L4XA 3FAZA 2ZWMA 1DC4A 2AJDA 2QSJA 3EGDA 4JN6B 4R2MA 4RHXA 3OHMA 5EIOA 3WYDA 4EPVA 2P9GA 3OFVA 2DFTA 2QRVB 3KWLA 2CVQA 1OR8A 3M0EA 4N54A 3BX1A 4Q9AA 4JT2A 4QDUA 5C8YA 4M8NE 3W9YA 5J43A 1F38A 4KJXA 1ZW6A 2Y8EA 3BRQA 5DPMA 2QI9F 2OE2A 2QV7A 4KLNA 2QV0A 3LWNA 4TLDA 3OHSX 4ZEWA 5HKBA 4G4IA 3UJ6A 2F8SA 1G291 5TJ9A 8LDHA 1HH4A 5GV7A 1UM8A 1DXOA 2XWBF 1UKCA 4R1TA 3WYAA 2X8JA 4AZWA 3OHPA 1W4BA 2Q3FA 4G4JA 1FSSA 2N46A 4DHWA 4R8VA 5BRAA 4AS2A 4QQKA 1WHTB 1B14A 2DERA 1P0IA 1LTHR 2UZ0A 4WQMA 4HDRA 6REQB 2PUFA 3KALA 3GFQA 1GN9A 4CCWA 3MCVA 3HB5X 4BO9A 3IX7A 1XHLA 4C6TB 4KN5A 2DBRA 1U1FA 1CUCA 3DZKA 1RLTA 3ZWBA 4DR3B 5JJ5A 3HEMA 5JR3A 2J7KA 1ABFA 3V97A 2XGOA 4BXOB 2VSNA 3LHKA 1H2FA 5DK4A 3BFJA 3UB3A 1XJCA 1CUFA 2AHRA 3EOZA 3NBXX 3R3XA 4L5IA 1FNNA 1PIWA 1XZLA 2WF8A 4UFOA 3TWOA 5FDFA 2AR9A 3K70C 1P7PA 3E48A 1DUVG 2VQ6A 1OI7A 1V7QA 3AVPA 4URYR 4D45A 2VTBA 3AHGA 4N5IX 3M6XA 3QFCA 1SXJB 3VOTA 4G5QA 3L6UA 1JG3A 2XZTA 5EJFA 1GQYA 1S2OA 1FSFA 2AYXA 4NYJQ 1O94A 2BMFA 3JR7A 4HNTA 4MDFA 4HDNB 3DOEA 1EP1B 1A8IA 3CB4A 3D0KA 3RFXA 1IUPA 4R9VA 4BVLA 4AJIA 4QLBA 4P32A 4L8YA 4MO9A 2OTCA 4KRGA 3USCS 3DEYX 3RJMA 2QQGA 2UZ4A 1WQ4A 1RAGA 3RVNA 1RCTE 5LZ7A 2HIMA 1R5BA 4L07A 5DK6A 3CO0S 3HXMA 2XKJE 3CKYA 4ACBA 4F8JA 4QXRA 1BXZA 1T3SA 1C7FA 1T10A 5HA5A 4MIOA 3VJKA 3IAEA 2V59A 1Y33E 4H77A 1GZUA 2VKQA 2A3NA 5KNBA 1YC2A 2PUBA 4YHBA 2F9LA 1DRJA 4S0XA 3ZTYA 1V6SA 4OXYA 4BATA 1VQ1A 2OZKA 4NK5A 2D5CA 4IHJA 5IKMA 3H11A 2AMVA 4CEHB 3PFGA 4ZQIA 4CBVA 1TYDE 2HFJA 3PNLA 4TQ9A 4M9ZA 2MYPA 4UBLA 1EI9A 2MHCA 3DBOB 3QJGA 1XZ8A 3CZ5A 3REGA 1SVIA 2LPMA 2REXB 2N47A 2NVOA 13PKA 3IXQA 4PBTA 1Z82A 2QR3A 4JKIA 1I6KA 2MTBA 1GPKA 3RHZA 2ZB2A 1VBFA 3BXOA 1RZRA 1OFUX 4UUMA 1DEHA 2GH1A 3N3BC 5ESRA 5BQ5A 4E31A 2W2KB 1DQYA 5LQMA 2OP1A 4JP2A 1IY2A 1LSOA 1NZDA 1UK6A 5F3RA 1W46A 2W6JD 3T0FA 4BQEA 1QVVA 1Y37A 3AKEA 2JFHA 3PGA1 4M1TA 4MPRA 4URUR 3DE1X 3LT1A 5FOWA 3WS7A 4AWXA 4CR7A 1DCTA 1JRLA 1CEYA 3AI2A 3C3YA 5AJHA 3OD5A 3V00A 3ZWDA 1I6MA 4CQLB 2VC2B 1KPHA 4QQFA 1E2JA 3LUDA 1R12A 3D8RA 3CEAA 4QUJA 5F9FA 4IOMA 1F1BA 2BGKA 3JATB 4BMPB 4URXR 3D9QX 3VC3A 3WSWA 3MERA 5ERXA 4FEAA 1O6FA 1XQ6A 3KYBA 4JVSB 2DC1A 1UT8A 5BYKA 3I9LA 4KIJA 1YRYE 1YI1A 3ZGXA 2NIPA 2ZIXA 4Q4HB 3T1QA 2DWOA 3Q4GA 4EB8A 6ABPA 1GZ4A 1VIMA 2B34A 1CQWA 1XZMA 2J9GA 4K28A 3O8NA 2I6GA 2VJAA 1NRXA 4TMFA 5BV8A 1U5BA 3IJPA 1KEEB 2A9FA 2Q1UA 2VPZA 5BW4A 4RDXA 3TRDA 1NUPA 5HJ2A 2GYYA 3V4RA 1GZ7A 3AEUA 1E92A 1PL0A 2BZ0A 3QFTA 3AWIA 3U7HB 4C4TA 3FYSA 5HM6A 4WY8A 5T4BA 1H4SA 5B3JC 1C30B 1T9CA 4L4RA 4RK6A 2HADA 1UPBA 1JV2B 2X19A 4PBRA 3K2IA 2VAPA 1CP2A 2AQKA 2ZQ5A 4NV0A 4TRMA 5EPUA 2ZT6A 4AJ4A 4LK3A 3VC1A 1QRSA 1G7SA 4GLLA 5JXHA 4RTPA 2CFCA 2GBIA 4HCJA 4DMLA 4Y2SA 2G63A 1MGOA 2V03A 2VDUE 4CKBA 2AYYA 2GCEA 1S1CA 3AF4A 1EFRD 4MDHA 4BO7A 3KG2A 3L40A 4WLNA 3BTSA 1T4CA 2IGBA 2ZJAA 1JPNA 4K9MA 2QNIA 2DWUA 4YV1A 4O5AA 2VXBA 3Q87B 2J3EA 1OXXK 4GZMA 2H2AA 2IYUA 4GSYA 4PLTA 1DAIA 1WNFA 1N2CA 3QLTA 2C2XA 4NKRA 4COKA 3DBVO 2PBFA 4S1NA 5DM2A 3FMGA 2H7XA 2Q3HA 2XV1A 2C8JA 4IO0A 3V8NA 4WKGA 5FOQA 3TOSA 2PJRA 1P5FA 1YO6A 2IEAA 2R65A 2W6JA 3WKEA 2OO7A 1ZJ5A 3M82A 3SXUA 1T1RA 2AE2A 4PWYA 1L7RA 1RYFA 1UBSB 3OQBA 3G9TA 2XUFA 1C4OA 2DHCA 1V35A 1Y7TA 3PSAA 4OHKA 1NC1A 2X9GA 4RKRA 1K6XA 4G1BA 1WP9A 1CW2B 4GGMX 3KTAB 1U3WA 1YTLA 4LOHA 3G2PA 3GLGB 3CLSC 4I66A 4FI3C 5JSQA 2AKAB 3AFHA 3KKMA 3LWDA 1K3FA 1EA7A 1L4UA 5FXMA 3CVYA 2IZ5A 3L7BA 3QVGB 2O5RA 1CR0A 4YRFA 2FG5A 4DLKA 5AVYA 1NLFA 3S2IA 4PWZA 4DCGA 3UJBA 4H1WA 2NVWA 5EMKA 3HZOA 5L6LB 3GLIE 1VHLA 4BKPA 2CEKA 1WKCA 1A4IA 1F8YA 1TKCA 1YDGA 3GWZA 2ONCA 2ZM5A 1IHPA 2XTZA 1JZSA 2NV2B 1IFXA 5L3RA 1ZD3A 2H0AA 4JMLA 2I7DA 1TOAA 2YUIA 2YTZA 1M2VB 4MA0A 4OQMA 4Q9JA 5ALHA 4D4GA 2XDWA 5EXPA 3LAWA 2OQVA 4HPXB 3TG8A 1GPNA 1EVKA 5ALXA 3PIDA 3PQ4A 4PC7A 3BJEA 4PCVA 3GLTA 3GMSA 3I9FA 3OTIA 1XVUA 4WGFA 2JL1A 1L7QA 3I2HA 4NV3A 5IEJA 1S8AA 3F8SA 4EMSA 1EBBA 4YK7A 4Q47A 1M54A 2C4TA 2EARA 3EIFA 3QK7A 3DZCA 4JVOA 2WFZA 1SOUA 1FF9A 4HI0E 4JJAA 1O8CA 4KITB 4O1IA 2JVIA 4JP8A 1QWOA 1EFRA 2DQ4A 5JJIA 4KQFA 1E0DA 2ZJ6A 1P2BA 1CJCA 1QYRA 2GKOA 2WNIA 3GUYA 1V2GA 4OA8A 5LA6A 3WIVA 4D56A 4DAEA 1OFHA 3HM9A 4L78A 4KOAA 3QVKA 1RIFA 2XDQB 4TZKA 3BCHA 3OCYA 3A1CA 5IU6A 1OZ0A 3VHLB 1LVUA 3COZA 3I04M 3O26A 2ENUA 3FNBA 4LMBA 5DU2A 5EQFA 1O6GA 3VR2D 1B93A 4S1OA 1N2XA 1T5HX 3L77A 4M9XA 1H6DA 4N9QA 4RFSA 3EQ9A 4TV8B 1FDIA 3ZV6A 5JS1A 4RH0A 2UVDA 3D81A 4BMNA 1Y6FA 4LS3A 3F9CA 4RABA 1XZQA 4R9SA 1QPBA 3DFZA 3DLTA 4FX5A 4P3KA 5REQA 1DJNA 3IAUA 1JR3A 3ESQA 3KXDA 3BAFA 1U2QA 3MTAA 2YL2A 3QITA 4QQNA 1YZNA 2R3SA 1YZYA 4IEEA 4M22A 4YECA 4MMXB 2ZIFA 5EE3A 4Z7NB 4X71A 3AH8A 1CF4A 2C8LA 2OSVA 1JIKA 3FZEA 4I4TB 1COWD 3M1IA 3WISA 3LK7A 4AZSA 1KYIA 4HFRA 1NZFA 4I5IA 4REMA 5E6RA 2FE1A 1XDWA 2HQRA 1GRVA 1ZK3A 2ZPTX 2V8BA 4GM1A 2O2JA 2AN9A 1H8HD 2PR7A 1KK2A 2R6FA 3FMPB 4P98A 3ZJ4A 5HIMA 4QLAA 3OIFA 1U7PA 2Z8ZA 5K0JA 4UDOA 3HYCA 4RVFA 4DC1A 4IHAA 1YCGA 2ZWPA 1UBLS 4N3AA 1FJHA 4W1QA 1IXRC 2D1SA 2QYHA 4WSOA 3R7LA 5LJIA 1IG0A 4RSGA 1DUSA 1YQEA 2F1IA 5DIZA 4LF4B 4TYWA 1I2CA 1O95A 4NY1A 3KKLA 4JR2A 3GXOA 3ZCQA 4AY6A 1EBFA 3NO4A 4KQKA 4Q12A 3SDZA 4CI0B 3VX3A 1M2HA 2CXHA 4V0OA 4CMJA 4GOJA 1FLNA 4IS3A 1ZH2A 1MIOA 1LF0A 4G8BA 4J4HA 2V9ZA 1WX1A 3O83A 4XLLA 5IJ9B 5LP1A 1ICEA 4IZHA 3TR6A 1A0OA 5A4DA 4WXEA 2RGEA 2FW7A 3O94A 3NATA 3PRHA 4D3XA 1RQPA 5IK2D 1UT5A 1P91A 1TZMA 3KZ1E 4PRZA 4XQEA 1BMDA 1HTWA 4O29A 5CDFA 1NDUA 1DEAA 4WNYA 3ETJA 4EG0A 2C98A 5AM1A 3O73A 4OQDA 2VDKB 1N3LA 2O8NA 4NNPA 2AR0A 2ID7A 4YONB 3C45A 5AWFC 3W5AA 5AP9A 1Z3CA 3T34A 1S2LA 1WXIA 2G40A 3WO0A 4CCYB 2HNBA 3CMMA 10MHA 3DM5A 3DDUA 5FAKA 4Y1EA 2R25B 3BFVA 3AUFA 1JAYA 3RKUA 2D2EA 1SZJG 2N0SA 4JLBA 1KJ8A 1KSJA 4X8MA 5BN1A 3PYLA 5BSKA 1RABA 3G7UA 1NLYA 1WDKA 1E3SA 3TLYA 4WCFC 3QE3A 3FG9A 4Q01A 3UWPA 1AGNA 5HJEA 1AHPA 2XMRA 3O1LA 3W0LB 1TT5A 1DKMA 1QB7A 1JIXA 3JWEA 4PTZA 4FLMA 3SIPA 3AYXB 4HB3A 1YUBA 2UUBB 5CEFA 1ZM4A 2PUHA 3RYIB 3T9AA 2XNHA 1HNZB 3ABQB 4EOGA 1SKQA 2FMIA 2NACA 3I4CA 4FJ1A 2B61A 4LVUA 4B85A 4CIBA 1ENPA 3C5WP 3RRYA 3VHQA 2E85A 2VH2A 3IUPA 4GZ3A 3TXYA 4CMIA 1COWA 5DF1A 4N82A 2XQIA 2C2YA 2VSXA 3OP1A 4L8VA 4MH0R 1YMQA 5LP6F 1S89A 4QQRA 7GPBA 2I1WA 4E5KA 1UDAA 1JQLB 3DPUA 2G9QA 5JC8A 3DXXA 1H8HA 2ZRFA 4OAPA 3W6NA 3B48A 2D1YA 2BEUB