5DHAA

Crystal structure of cpeb4 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
206
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 59
structure length 206
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhaA00
4NZYA 4PC3A 2GJKA 1KI9A 2YYZA 4GMXA 3GLGB 3VKGA 2ANCA 2IXFA 2WSSD 2XZLA 4B2PA 2REBA 1KTVA 2EFDB 5DSZA 3TSWA 1KI7A 2J59A 1T3SA 2ZAMA 4DIEA 1U94A 2ERXA 4QHYA 3MD0A 1E9FA 4NP6A 5FUWA 3Q9LA 2VEDA 2IWRA 2W6ID 5JHGB 5M04A 1DOAA 4PXAA 5L8VA 3K0CC 1GG2A 4QJ3A 5E95A 1YZLA 4IVPA 1TQ6A 4QNMA 1LS1A 5SZJA 5TMPA 1M2OB 2WJIA 1G64A 3QKSB 3W8NA 4ZCMA 3VNUA 4OQLA 2DY1A 4XH9B 5CM9C 3EZ7A 1Q12A 1TF2A 1SVLA 4M1WA 1KJWA 1MV5A 5CLQA 4A1FA 4DRZA 3SHWA 1BMFA 1KAOA 1OE0A 4BPBA 2ZU6A 4MRVA 3DOFA 2FN4A 3ZS9A 1DE0A 1R2QA 4KYUA 2J0UA 2AL7A 1ODFA 2RGAA 2Q9AA 3AF0A 2GEUA 2GZDA 1Q44A 2ECKA 2WSMA 2ZR7A 3RRYA 3N2EA 5L3VA 2WOJA 4HZIA 1DPFA 3QIAA 2Q3FA 2ZRJA 3MG9A 2ZVPX 2JLRA 1G16A 1BS1A 1DAEA 3A1VA 3OIYA 1G9XA 4L4UA 3TQCA 4B32A 2DB3A 4EPVA 2RB4A 1Z8FA 1XPUA 3LFUA 4RJLA 4L15A 2ZYVX 4B6FA 2J7PD 4EDHA 2IWHA 4CEHB 4LCBA 3ZH9B 4BLTA 1PZNA 3PG5A 4XWOA 3AVTA 3WP0A 1TTTA 2QENA 4A0FA 2QAJA 4EAQA 1BO6A 3BH6A 4TQAA 3LRPA 4RD2A 3WXMA 4B73A 1T8UA 1OXVA 1WRBA 4JLBA 4BRUA 4CEIA 2W6JD 5DI3B 1SXJD 1ZD1A 4PAOA 1H8HD 1T9HA 2XITA 4D26A 1CLUA 2GCNA 3AP2A 1P2UA 2UVQA 2OFOA 2OBLA 3BB3A 4LHVA 4BFTA 1U98A 4JSTA 2D2EA 1G21E 4WXPA 3ETLA 4KODA 4DLZA 4NPHA 2J87A 1NY6A 3QKUA 4PR0A 1YRBA 2ZRIA 1N25A 2JA1A 4MRRA 2IL1A 4H1UA 3RS3A 1A5TA 2GA8A 2CVHA 2ZYUX 3TKLA 2WJYA 1UJ2A 3LX8A 2RGNC 3K53A 4RFSA 5B58C 1OKKD 2MSCB 2W2XA 2N46A 3QEJA 2FFHA 4N0DA 1KO4A 3UG7A 3VMFA 3NBYC 1M6NA 1UFQA 2BKEA 2XB4A 4C0BA 4URUR 3WRXC 3TUIC 1IM2A 1II9A 1ZD9A 2GF0A 3EW9A 1XTSA 1M7HA 4UQOA 4CIDA 2F9MA 2ZJBA 3T06B 4PHTA 3WYGA 2AXNA 4KJZA 2FMXA 3DHWC 1E4YA 5B2ZA 4OQXA 2E1RA 4B2LA 2CL0X 3THWA 4KYIB 3H86A 4MRPA 4Q1DA 2JLXA 4M9SA 1A7JA 3SS8A 1M74A 2J0UB 4O2RA 1NL3A 2NIPA 2WBLC 2QMHA 4OHWA 2WMNB 3F3YA 2PEYA 2IYYA 4XSHA 1AK2A 2DFNA 3L8ZA 1ZMXA 4IDNA 3UKDA 1YVDA 5HZHA 1L4UA 1W36D 2F43A 2KBEA 2EYQA 5TDHA 1W2HA 5HZKA 3DVLA 3QY0A 2JGNA 5FPTA 3BERA 1HE1C 2FSGA 3KXKA 3LQQA 4IVQA 2Q9CA 1G291 1LNZA 4JLDA 4EPWA 4ON9A 2HEIA 4FMDF 3GLHE 2QY9A 4O2LA 5E3HA 2IA5A 1TU3A 3MMPA 4WZAE 3UWOA 2Z6VA 4Q4HA 1W4RA 2A7QA 1J2JA 1FMJA 1ZU5A 2ZVQX 3M1IA 5JEEA 5FBWB 2OCBA 2OAP1 2OILA 3M4YA 1N6IA 4CVNA 4LRWA 2JASA 5G3ZA 4DEYA 3AVPA 1FNMA 1IXRC 1XTKA 4LJ5A 1D2MA 5EP3A 5E7MA 3AF4A 3KKNA 4LV5B 3CRMA 4CEIB 3IIMA 4TT3D 4BUJA 4DZZA 5HCIA 5JCZA 5AK0A 4Q02A 2X1VA 4A6PA 1EFHA 5H70A 1G4AE 3SNHA 2ORWA 3VQTA 4IEEA 2OO7A 4MYHA 1G8GA 3WP1B 5JI2E 4JS0A 1VYVA 1GKYA 1E2NA 1SHKA 4TWZA 1D6JA 2HCJB 5JBQA 4OYHA 2IUSA 3MSXA 3GLIA 2FJUA 5LDDC 4TLDA 4CDGA 2JAQA 5EXPA 3UG6A 4RFSB 1TF5A 4C0LA 1QF9A 1ZM9A 2PMDA 3SN6A 1OSNA 2O8CA 4X8HA 3EC2A 3RS7A 2ZITA 3AKEA 1RRCA 4X8LA 2O0KA 1YR8A 4ZDIA 4CF7A 5FTKA 3QPWA 3FKSD 2F1RA 4DDUA 3AP1A 2QGNA 1A2KC 1W1WA 3RRMA 3U6KA 5D3MA 1EK0A 3TAUA 2CHVA 4DDWA 1ZU4A 2JEOA 1ZM2A 4LJAA 3SYKA 2WKRA 3UMFA 2YOFA 4OJKA 1X8JA 1LS6A 4PC7A 1OLOA 4WA7A 2W0MA 5LD2C 3B6EA 4BFUA 3B1YA 2RGNA 2NO0A 3SJZA 4NU0A 4HZUA 4EQ6A 3C14C 2NPIA 3THWB 3HU2A 1QHIA 3KFXA 3CIOA 3QBTA 4JL6A 3W9YA 4Q66C 4XOIA 4M1YA 2O8BA 3P26A 2ZRPA 1ZCBA 1VECA 2I4IA 2YC4C 4C7OA 3IQXA 4D81A 2GNOA 4Q5IA 5JSZA 3KTAA 4AC9A 2BV3A 5BQ5A 1QVRA 1U9IC 4A2WA 4BFXA 2F43B 2AKYA 4ZCIA 3GJ7A 2YZ2A 4XSGA 3AV0B 4JL8A 2GF9A 1OFTA 2A5FA 1E1RD 1QRAA 2NG1A 3MAAC 4PO1A 4ASUA 2JJ2A 4KLZA 1TUIA 4D6PA 3N70A 2J9RA 1SKYB 2YVUA 4KSBA 1WE2A 3MUFA 4Q4HB 4A82A 3L0OA 3REFA 4O3MA 3IEVA 3CH5A 2ZJOA 3SYNA 1T3LA 5UKDA 3SEAA 3SQXA 2WWGA 4G5GA 2OBNA 4CEJA 4Z1MA 2WTUA 4MKFA 3NIBA 3AVXA 2AD5A 2QNRA 4N3NA 2ZRMA 1CULC 3EAQA 2PCLA 1P2SA 1GVNB 4NONA 4ZIRA 2QI9C 1SQ5A 1SVWA 1CKEA 2J0VA 4V03A 5DISB 3VAAA 5DH9A 4E07A 4P32A 3D8BA 5J4LA 1IAQA 5HKKD 1KSFX 2GEDA 1NMXA 3OHMA 5BXQC 1FQKA 5B30A 5BW8A 1FPMA 1P60A 4HAXA 1GNQA 3BORA 2O5VA 1ELOA 1EXMA 1Q3HA 3AF2A 1SVMA 4BZXA 1E3MA 4Q18A 1Q1EA 1ZUNB 3QVVA 5EQTA 4ERNA 3GLIB 1Q3TA 4W5WA 1CF4A 4B3XA 4PPFA 3REGA 3GMTA 2O8DA 1LTQA 3FFBA 4LC1A 5FR2A 3C5CA 1FUKA 2ZUDA 4CGZA 5CM8B 4FD2A 1DTSA 2O8CB 1P2VA 2IYUA 2WIBA 3EC1A 4I99A 1JR6A 2OSBA 3SYLA 3ZVLA 3K9GA 1NIJA 2Q21A 2Q9BA 2RKOA 3DO6A 2WWFA 2EQBA 2J45A 1Z6AA 4JLNA 4I1SA 1YQTA 5D3MB 4E5UA 1NKSA 2PT5A 2J41A 2ZRLA 5FPKA 2IYTA 2PH1A 4BRWA 3FPAA 3OAAD 4LDJA 3H4MA 4HZUB 2NPFA 5C4GB 1RRGA 4EQ6B 4NCNA 3QKRA 4RCZA 3LBHA 2GXSA 2XSZD 1W49A 3B7GA 2O8BB 1FOEB 1DELA 3GLFA 2FSFA 4C7OB 1JI0A 2R65A 3ZDQA 4IOLA 2KI5A 4JYBA 3NHBA 5JSZB 3KTAB 1LB1B 4NCJA 4O0MA 4QBGB 5GJBA 1OIVA 2OCYC 1KI4A 2C5LA 3EX7C 1XBTA 2PMKA 4OQNA 4RZ2A 2FEMA 3AH8A 3ZVNA 1QHGA 3AVUA 3BWDD 3B78A 1DAFA 3NTUA 3RNLA 2R6DA 4ZI2A 5HTKA 1IY2A 4RD1A 2CVFA 3UK6A 4KI0A 2QU8A 1RKBA 4QJ4A 3QSYA 121PA 1Q0UA 3TH5A 2F1IA 1II0A 2KB0A 2SHKA 2JLYA 1NY5A 1S9DA 4AG6A 2HUPA 3K0SA 4D0GA 3K9LA 1KGDA 2BCGY 3ZZUA 4FIDA 8OHMA 1KZ7B 1U9IA 4CEJB 3ADKA 1U0HC 3QXXA 3ZLJA 3KUDA 3QG1A 1CJUC 5FBLB 4ZIRB 2H17A 1N6KA 2C03A 1BYIA 2P67A 1VMAA 4O25A 5D3QA 3WYFA 3KJEA 3EZFA 3U7FB 3U7GA 1R7RA 4PC2A 3RLFA 1ZCAA 1KO1A 1JQLB 2NO6A 5IRCD 4DCVA 1W2GA 4C2UA 4QM7A 1XX6A 1W48A 2A78A 2ZI4A 4QFMA 1R8SA 3E5HA 1DG1G 4Q4JA 2E87A 3BXZA 5EUQB 3MJHA 5K8TA 2J46A 3ZD7A 2O8DB 4YMVA 3O8CA 2D62A 4UJ3A 3R20A 2C8VA 1HUQA 2Q3MA 4UNRA 2O52A 2ZRFA 3V00A 4OK5A 3HYTA 1WDTA 3CF6R 1AN0A 4NYJQ 3RDPA 4GNKA 1A4RA 3W6PA 5HE9A 1PV4A 2V6JA 2QSYA 1NBMD 1U8YA 3BB4A 1VPLA 1L2TA 3BK7A 2B6HA 3IILA 4YMSA 3WY9A 2XB2A 3NBXX 1DADA 3IPXA 5LBIA 1S2MA 2VF8A 4V02A 1KKLA 3LY5A 2I1QA 2B7BA 1UDXA 1AA9A 3EIEA 2PCJA 3GJ3A 3MWYW 3P4YA 4XD7A 4D4KA 1P7CA 1OIXA 5JHHB 3U2QA 1OFHA 2V7QD 2XOKA 3PFIA 3W34A 4CZ2A 4LSGA 1OHHA 2CK3A 5B64A 3QKRB 3CONA 3NWJA 4TMXA 1Y3AA 2QAGC 1XJ0A 1JR3A 4KLNA 3GLFB 3AVVA 2ZRAA 3IIJA 5JRJA 1KYIA 3AF3A 3NDPA 2P6NA 2CJWA 2AFIE 1Z0FA 1KMHA 3SJBA 2DWQA 2WJHA 3GEHA 2EW1A 5KNDA 4MGIR 4Q00A 4R98A 4QGAA 5BYJA 4B74A 1E2MA 2WAXA 4TL9A 5LD2B 1M1YE 4YMTA 1GKIA 2FV8A 1W5SA 1Q22A 2C04A 5K8UA 1XEXA 2R6CA 4V0LA 3TRFA 2ZSEA 1GM5A 4XVUA 4BLPA 5FFMA 2YV5A 2V3CC 2JJ8A 3PCRB 5CK5A 4FCWA 3LX5A 5FOXA 4B34A 4NMMA 3L0PA 5FUYA 1DAIA 1CJTC 3OFND 1FMLA 2XZOA 4IXNA 4OJQA 3I73A 3GJ0A 3CW2A 3IBYA 4D25A 1ZAKA 2HT1A 5AJWA 4MGYR 1U2RA 3QG5A 2CHQA 1QHYA 4HYYA 1EFCA 4IDQA 4QBHA 4B3CA 4YXWA 4RKFA 2D7DA 4MQBA 1E0AA 3GFPA 5F2EA 3U4QA 2VP5A 1SVIA 3B2EA 2IS2A 3L82B 2CHGA 2ZXUA 1WCV1 3BS4A 4EFMA 3I5YA 1N6OA 4AWXA 4D82A 4IJMA 2AHOA 1NMYA 5KHOC 2FFAA 1KNQA 3TIFA 4Q01A 3GJXC 1AJEA 1R8QA 2XXAA 4PQRA 1KKMA 1S4QA 1P73A 2LCFA 4KHZA 2UZIR 4Q4JB 4ZPXA 4AKHA 2ODEA 1KDOA 4G5RA 3EPJA 2GJSA 1NIPA 2X8AA 4XJXA 2VBCA 2JLVA 1Q1BA 3IEUA 4TLEA 2ZETA 1Z2AA 3QXJA 1IY0A 1WBDA 5BN3A 1OFUX 2FEOA 1Z06A 2GJ9A 2W2VA 3UATA 5KSOA 1BMFD 3P27A 2YJTD 4HLCA 1G3QA 4EJSC 4HDOB 4UXHA 4MYTA 4LGMA 1KZGB 3A4MA 2VF7A 4V0NA 4C4PA 4ESVA 4XTCS 2QRNA 1MR3F 3M6AA 3RSOA 1G3RA 1XZPA 3QPUA 4C0SA 5ELXA 2W58A 4G3XA 2GBLC 1TADA 1P72A 2GAAA 1P5ZB 4E09A 2RMKA 3PUXA 4HB0A 2OBMA 4EFNA 4YONB 1KI1A 1Q21A 4IVRA 4UNSA 2DCUA 4LJ7A 1W0JA 1O87A 2BJVA 1RJ9A 2MSDB 4ZCLA 1NI3A 1FP6A 4A2QA 1PLLA 1HA3A 4RD4A 1DG3A 1Z83A 4G5SA 1QBKC 3L8YA 5EZ5A 4M1SA 5EE5B 1YRAA 2DFKB 3H2YA 1IN4A 5FH9A 1U8AA 2CJWB 1KMHB 2VHJA 4P3YA 3BE4A 5KO2A 4LZZA 3RYTC 1RRFA 4KFSA 3FHCB 3L0IB 5CDFE 3OEEA 3SJCA 2V1UA 1RW4A 2V54A 4HLUC 4N1AA 4NE2A 2GVZC 1IN5A 1XEXB 1XWIA 2RHDA 2GETA 3ONWA 2QAGA 1GRNA 3ADCA 4BFVA 1GTVA 2BEJA 5GJWC 3VR4A 2ZRDA 3CB4A 4RFVA 3J81k 3QENA 4QNRA 5JJKA 2ZR0A 1KI8A 5EE3A 5K8IA 4OI0A 1G5TA 2OHFA 3K70C 4QRHA 4ACBA 3U3OA 1T8TA 1YHNA 2DR3A 2C9YA 2H8KA 1A82A 1JXOA 3O8DA 4MA4A 4JLKA 3U4QB 5JFGA 1KIMA 5AJVB 1NJFA 1CR2A 2GEVA 3DMDA 3LBIA 521PA 3KDSE 5AJYA 1EGAA 1LV7A 4KVGA 1LW7A 2ORIA 3IBGA 4BQSA 4F92B 1FX0A 4LOAA 1G7RA 1PLJA 1CTQA 2RGCA 2XXAB 4RD0A 5G41A 3T34A 4Q7LA 4NL4H 3SDZA 2RH5A 3HPQA 2FPKA 3GJ5A 4B3FX 3AUYA 4JBWA 1XTQA 2R8RA 4A4DA 4U00A 1RZ3A 1BYUA 3SFZA 1E6CA 1S1MA 2IYXA 3TVDA 1UF9A 3D6TB 3HPRA 3NEYA 4A0GA 4M53A 1Z6TA 5JJIA 1FW6A 4TTPA 5JEDA 5CJ2A 1HYQA 1VYTA 5FOWA 1VG1A 1E4VA 1Z29A 5CIWA 5JS7A 5F9HA 4WVFA 4DLSA 1OIWA 1J8YF 5L3RA 4OKSA 1E2LA 1QHNA 4OHZA 1RRPA 4JLVA 4QG7A 4TLAA 1JNYA 5G3YA 1Z47A 2VQSA 1I2MA 2J3EA 1RJ9B 4NYJR 2AFHE 1DAHA 1J8MF 3VKHA 4PZZA 5FL3A 3RANA 4DCTA 4EJSA 2XNDA 2HYIC 4E03A 2Z4RA 1MRNA 2ODBA 1COWA 1XNJA 4Q48A 2F55A 4KCGA 1EG7A 3U3RA 4C0HA 2AK2A 4KV9A 1D5CA 2ZM5A 2AR7A 2GBLA 3AB3A 3U5ZB 2JIZA 3EARA 3VTKA 4DSOA 2X2FA 2CE7A 2XZPA 2P2LA 5DNYB 4M9XA 2CEAA 5KDLA 2EFCB 2QAGB 2YINC 5J4YA 3U61B 3P32A 3WNBA 4KFTA 1RC8A 5AR1A 4QL3A 3RRZA 4PQFA 1CP2A 2VRWA 2W2TA 2VA8A 1N5LA 2GAOA 3OF5A 3KX2A 2N42A 5TB5A 3HJNA 1NF3A 2NO1A 4XVRA 4RZ3A 3CRW1 2GJAA 3AQ4A 4KSCA 5JLJA 3ADBA 4A9AA 5IHPA 1E79A 3TW8B 3RS5A 3Q7PA 1TMKA 5DO9A 4ZDJA 5GVSA 1OH7A 1XU4A 1WQ1R 4L16A 3AUXA 1DBSA 1XMJA 1KDRA 1NP6A 1E9EA 4PAQA 1YZGA 3D7MA 2GK7A 4FXPA 3X2SA 2IUTA 1JAIA 1FX0B 2CDNA 4JLPA 1PJRA 4IFBA 3W5IA 2ASEA 4MRSA 2ZSFA 4NCHA 1XD2A 4D80A 1MRSA 1G8FA 1H8EA 3SQWA 3PR1A 4AI6A 4GP6A 1GNPA 4EUNA 1QG4A 3R8FA 2P65A 4LY6A 4ZV4A 1N3BA 2XNSA 1HQCA 4M1MA 3THYA 1RPZA 3THOA 3NBZC 4JVMA 4G5QA 4D0NA 2FU5C 1NVWQ 4GRAA 4GDFA 1HTWA 1Z0KA 2O0HA 4DLRA 3OESA 3I32A 4TYYA 4NCKA 4R9UC 2QMUA 3IO5A 2QT1A 3VFDA 4C2TA 1CJVC 5FUXA 2C78A 1C4OA 2QMOA 5JZVA 4R2HA 3CRVA 4LBWA 2X77A 4GFDA 4P4UA 2G88A 1AS0A 2G9NA 4HAVA 5FTMA 5P21A 4LHYA 4GP7A 3K09C 4HAZA 3PEVA 5CB6A 5G40A 1NLZA 5B57C 3WNCA 3FMOB 5KDOA 4TL8A 2GESA 4JVLA 4CT5A 3K0CA 4ASUD 2DWPA 4IOMA 3S1AA 2JJ2D 4EJSB 1OT3A 2AK3A 3I62A 5FUVA 3C16C 1HY3A 4HSEA 5CITA 4Q9LA 2NO7A 4L5BA 4P0TA 2R6FA 4HEJA 4B3BA 4TMKA 3ZJYA 1ZNZA 3ZQ6A 4Z8XA 2J5XA 1W4AA 2BBWA 4BLSA 4Z1MD 3ZGXA 3UANA 1G8HA 1Z0IA 2GK6A 4Q1AA 3T5DA 3VR3A 4Q9KA 1VCNA 3WHLA 2OM2A 1U8ZA 1OB5A 2P6RA 3IUYA 4K46A 5E7JA 1GL6A 1W36C 1HT2E 1ZD8A 2C2HA 1J90A 4H9GA 3JZMA 1S1CA 1DVRA 4LHXA 2IT1A 3RC8A 4JLMA 3PUVA 4FMDB 4M8NE 3GD7A 5F98A 4DB2A 4BFYA 2W00A 1XMIA 2IYRA 2QQEA 4W7SA 2YNMA 2BM0A 2CNWA 4FCVA 3CKLA 1X3SA 1XMSA 1T4GA 3CWZA 4IKEA 1S3GA 2IF0A 4QC2A 3GLHA 4TQUS 2A5GA 2BBOA 3KZ1E 3Q7QA 4GZMA 4Y0AA 1UBGA 3TJZA 4KITB 4US2R 1EFRA 3QXCA 2VP2A 5DGXA 1SXJE 1VG9B 2JLQA 3KB1A 4Z54A 1XD2B 3F8TA 1G8PA 2DBYA 5FOSA 3U44A 3HU3A 3EIQA 4TMWA 4B2IA 1KK0A 3PEWA 2YWFA 3K70B 2F1HA 821PA 4WZBE 2ATXA 4GOXA 4TSFA 2FE4A 4JMPA 4WZ6A 3WNDA 4PSKA 4Q4AA 3THYB 3WMFA 1XP8A 2IYWA 1W0KA 1H65A 2B92A 2VYFA 4EPYA 1ZJ6A 3KQUA 2WJGA 2XTZA 4QBIA 1UBEA 5BYKA 4BLRA 3IPYA 5TXGA 4DVGA 3CX8A 2IX3A 4ITRC 5IF9A 1G5RA 1R5NA 3I72A 5KOYA 3IO3A 2NO9A 3GPLA 1US8A 1NRJB 5FPSA 4GZLA 3RC3A 1A2BA 2BMDA 3VR6A 1G3UA 2EWWA 5SZHB 3OIUA 2HXYA 3EPHA 1DARA 1IBRA 2WICA 1D2NA 2JCSA 3Q5EA 4L9WA 3KUCA 2AKAB 3OIWA 3S1AB 3FTQA 1Q20A 2WWHA 3UMSA 2WHXA 3LDAA 4Q4LA 4DWJA 3WYAA 1TQ4A 2FWRA 5TY0A 1MOZA 1TEXA 3IGFA 4KFRA 4JT4A 5FOTA 3MWLA 4II7A 1V43A 1Z0DA 2C96A 2ZRHA 2IXEA 3F5FA 5J47A 5KPJA 4GL2A 3QJYA 3FE2A 1XF9A 2ANBA 2GDJA 3IHWA 3C8UA 4MYCA 5EJEA 5KU1A 1GILA 2CBZA 1ZNXA 2CLSA 3AF1A 4DLUA 2ZROA 5JMTA 3C15C 4TYWA 2H16A 3LA6A 2ODNA 1VCOA 4KO8A 2XX3A 4WXRA 4LBZA 4B3DA 1ZBDA 1F2UA 1R0WA 1P2TA 1OXXK 1XXHA 4X8OA 3GP8A 1E2EA 2ONKA 1Z08A 3HWSA 4FN5A 5EP1A 2ZS7A 3U7HB 4FINA 2F3TA 4EPTA 3CX6A 4DXAA 5FTJA 3TE6A 2FZLA 2G1KA 4U02A 4B71A 1ZUHA 2G83A 2LKDA 3B82A 3Q5DA 4RZXA 1XJQA 3SZRA 4DUGA 5HR5A 3AKDA 1XD9A 4HLQB 4JSYA 3GLHB 3O47A 1G18A 2IXGA 3UIEA 1IHUA 2NZJA 2R2AA 1FUUA 1PUIA 4C0KA 3CF2A 5IK2A 1G7SA 4F7WA 4PQYA 1TQDA 4PFSA 2ZE6A 3RABA 1X6VA 3U44B 1MO6A 3ND8A 1VCIA 1N5IA 4WOPA 5KYKA 1X1RA 1AGRA 5KPDA 1UKZA 3B9QA 4BECA 3FKQA 5A5GA 2JLUA 4BASA 2BDTA 2G77B 4XD7D 4Q4AB 2XEXA 1GP2A 1XB2A 1E9SA 2XOKD 2W83A 2X19A 3DDCA 1OHHD 2CK3D 2QSZA 1F3OA 5EXSA 4YMUA 2DWOA 3HR7A 3K1JA 4QOSA 2ZE8A 5J4VA 4YQFA 3SBDA 1JR3D 2NOAA 4ACAA 1UKVY 3ZYCA 3AM1A 4E22A 1US8B 2PJZA 4M9QA 1K6MA 1YR7A 4BLOA 2HJGA 1AS3A 1GUAA 2OCAA 2ZI3A 2BMJA 3FHTA 2YWGA 3B9PA 1OV4A 3U7EB 4URYR 2KSQA 1IQPA 1FP7A 1W47A 1SULA 3FDIA 3EZ9A 2JLSA 2RGEA 2XGJA 2VP4A 2AX4A 5K8LA 1WB9A 2WVJA 5FBRB 5KNBA 4JLAA 5H68A 4ARZA 4EKDA 3KQLA 4MYUA 2FNAA 1Q1QA 3FMFA 4RD6A 1CXZA 1N5JA 1T5LA 1NG1A 2IF2A 5FBQB 4Z51A 4LHZA 3HR8A 4A2PA 1KO5A 2VH5R 3B8HA 3TBKA 3DKVA 2YOHA 2VHUA 4OBEA 1EFTA 2H18A 2OESA 2KJQA 4BFZA 3X1DA 3W5JA 4YXWD 1YR9A 3FB4A 1FNNA 2WKPA 4DCNA 1JECA 1M8PA 5H8WA 2NZ8A 2UKDA 3QPVA 3LVQE 3HDTA 4EPXA 3DKPA 1ZUIA 3KXIA 2IYLD 2KBFA 1F2UB 3U3MA 2ZJYA 1XXHB 2FSHA 3EA0A 1G5PA 3OE7A 5EXXA 3LH5A 4W5HA 3T5GA 3R9XA 2JLWA 3AVQA 3I8XA 1II8A 2C9CA 4G0NA 1D9XA 1JALA 4QGHA 5CYOA 1ZM4A 4V0OA 4TLBA 3I3SR 4TLCA 1MABA 1KJZA 1KY2A 3ASZA 5DE3A 4B75A 4DCUA 2OG2A 4A15A 2QT0A 1E2PA 2FGKA 4C30A 2XJ4A 2DHRA 2B8WA 3IIKA 4A36A 5HE8A 3BFXA 3PUZA 3ZS8A 1NG9A 5FPYA 4AY2A 1KI6A 2C9OA 2QQ0A 2QP9X 1Y63A 2QMEA 1XJCA 2WZQA 2IEZA 4MUBA 4RCYA 3NEJA 4V0ME 1E0SA 1VG0B 3UWKA 3CNLA 4PC6A 2QTVB 2IC5A 2BMFA 5GJVC 4QBFA 4Q7JB 1W0JD 3TUJC 4AK9A 1TAGA 1HE8B 2VPPA 4M1TA 4KFUA 1P6XA 2BIFA 2EU8A 2A9KA 2OCPA 4MKIA 2ZRCA 2H5EA 4QXAA 3C4JA 1AS2A 3A1WA 5C2JB 2AXPA 4NYIQ 2HF8A 2QORA 1GDDA 2WMOB 5JI3E 4LK2A 5CJPA 4YMWA 1YKSA 1XCPA 1F6BA 1NMZA 3KFVA 3L0SA 4HAUA 4TTRA 3W8RA 3PQCA 2BMEA 4AKIA 1YU9A 2OZEA 2QN6A 3OEED 5KSYA 1JPJA 1JPNA 3KKQA 1DS6A 3W6NA 1CBUA 1E0KA 3LD9A 1T0JB 4A6XA 2G0NA 1Z6XA 4M21A 5LB2A 4OHVA 4DDTA 1JBKA 4ARZB 1UADA 4A92A 2OLJA 4FWTA 4JKIA 2OT3B 4I4LA 5DI9A 4PTLA 2PEZA 2IS6A 1G7CA 2V6IA 2E9SA 4OK6A 5A4JA 1G41A 5C46F 5AWFC 3ICQB 5JJLA 3QXSA 1YE8A 5J4KA 1ESMA 1ZIOA 3W6OA 5FL7A 2ZREA 1W4CA 2CMKA 1GKUB 2CXXA 3I4LA 3KKOA 1XTRA 1ETUA 3MFYA 3T12A 1AM4D 2ZUCA 1TX4B 4GOJA 3A8TA 1P75A 4QHSA 1B0UA 1DAKA 2I3BA 3BGWA 1UDWA 1M7BA 2OFWA 4Z8YA 4G1UC 5ANRB 4PHFA 4H1VA 2AN9A 3M0EA 2VSXA 3KQKA 4Q1BA 3P4XA 4IEIA 3TSZA 2FGJA 3DM9B 2QEQA 1CJKC 1II8B 4QGFA 4FWIB 2J0QA 2EFHB 3RS4A 4DLXA 1K8RA 1GL9B 1OXUA 4D4JA 1MABB 3CLVA 2H1LA 2H92A 3GJ6A 5CLLA 4FW9A 1EFUA 1OF1A 1OJLA 3CX7A 3X1XA 1E98A 4OQMA 1NN5A 4OL0A 3KQHA 3LQRA 1S0UA 5LPNA 1E9DA 4NH0A 1OH5A 3GLGE 1WMSA 3HU1A 5J40A 3V9PA 1KNXA 2CCGA 3N5CA 3O8BA 4XWKA 1EWQA 1BOFA 1E2FA 4FCTA 3O8RA 3E2IA 4P31A 5KSPA 2O8FA 3ZZ0A 2HCBA 1NSFA 3CR7A 4YDSA 1JEDA 1AQYA 1XPRA 4GI7A 2HJVA 1KI6B 2FSIA 4B6EA 4DBLC 3SJAA 2OEPA 3OIVA 3VKWA 2JATA 5AUNB 4DHEA 1AZTA 2JJ1A 4HLDA 4RKEA 3IDQA 1AIPA 1Z2CA 2EVWX 2Q0HA 2ZI9A 3EZ2A 3RHFA 4HB4A 2FF7A 2IYQA 2BBSA 3GEIA 1JEEA 1JQJC 3FHOA 4XWAA 4Q1FA 4B48A 3A58B 4RY2A 1R4AA 2G0TA 2BHRA 1S3SA 4LHWA 4R7ZA 2ZYWX 3WMEA 4OHYA 4CT4B 2XNDD 2BC9A 1GOTA 2G6BA 1BH2A 2QTHA 1COWD 5DIFA 2L0XA 2N1BA 4DDVA 5EUMA 4PSAA 1NBME 1Q1ZA 3CM0A 1XZQA 2X2EA 4GT1A 1TU4A 4LJ8A 1E9AA 2JIZD 4KVAA 4AKGA 2FPMA 1D8TA 621PA 1OXSC 3H1TA 4F4CA 1E96A 2A30A 4P4SA 2GXAA 3R9WA 1VIYA 1M7GA 1IOZA 1TPZA 2GZAA 3E70C 3TVTA 2WWWA 1S8FA 2R9VA 4DB4A 1YR6A 5DN6A 4L9SA 4PHGA 3QI2A 4G01B 1NLYA 1X86B 3CPEA 2J0SA 4BEBA 3EA5A 4BZQA 1CEEA 5C4MA 4UNPA 1Z63A 4POAA 1E79D 2CE2X 1JXMA 5FOVA 1IXZA 5L3QB 2MMCA 2C95A 3U3KA 4OK3A 3QOFA 3RRNA 1VHLA 4MKHA 5KDDA 4PSVA 3UXMA 1SVSA 4IOKA 1HT1E 4JZKA 3EPKA 1WBBA 5IT5A 4FMCF 3T1TA 2V9PA 1ESNA 4GOKA 1KY3A 4I1UA 4Q7KA 1F48A 4Q21A 2V55B 2PLRA 4JKYA 1R0ZA 1UKEA 3WBKA 1M34E 5CDFA 1E94E 1H8ED 2VO1A 5EP4A 2P5SA 3VR5A 2C99A 2OUKA 4PX9A 2ZS9A 3K70D 3AEZA 3BBPA 3SC3A 4GBMA 3U60B 5GADl 3MLEA 2RGDA 5JWRA 2I1VB 2PLFA 2F7SA 3FYHA 2ZAOA 1NSTA 2QRZA 3KKMA 2Z5FA 2NMVA 2VP6A 2O8FB 1QDEA 1NVXQ 1N6LA 4MGZR 5L3QA 3CH4B 1OH6A 1XCGB 1NVVQ 3QXHA 2EWVA 1LF5A 3KL4A 5JCPA 2ZRBA 2IEYA 2MMGA 4I81A 2GZHA 5EE1A 1G4UR 4MH0R 3C41J 2WAYA 2BKUA 2WJJA 3TW4A 4ZDKA 2HLDA 1CR0A 4IXMA 4QJ5A 2PBRA 3I5XA 3TR5A 1DO0A 1HH4A 1FTSA 3CRQA 3RS2A 2WPDA 3OEHA 3I1FA 3SR0A 1T5IA 2CL7X 2GHIA 1E2DA 3CNOA 1BKDR 4JJKA 1XEWY 4TMVA 4TN1A 4Q47A 4M1OA 2Q3HA 2QM7A 4NDZA 3SHFA 4P33A 1QVAA 1KDPA 4R2IA 3P20A 2DFLA 2ZI7A 4DCSA 1Z6YA 4WAUA 3VNVA 4LJ6A 4P4SB 1T3HA 1D2EA 2K5UA 3BOSA 1AQUA 4HUTA 4Q1CA 1UPTA 1JJ7A 4F4JA 4Q9IA 2ONJA 2PZEA 3FFAA 4F38A 1G7TA 3JVVA 4NYIR 4ESHA 4XTRA 1DAMA 3EASA 3T15A 2NQ2C 2KWIA 2ZI5A 5AUOB 2D74A 1G8YA 2CCJA 2BWJA 1YZUA 4B3GA 421PA 1XPOA 3GFTA 2IK8A 3PENA 5JWOA 3NH6A 4LYJA 3AGQA 3G5UA 2VSOA 3CNNA 2DPXA 2FH5B 4LV6A 2BCJQ 4Q03A 4F91B 2CNWD 4C3ZA 3QUSA 2XTNA 2VHCA 4V0KA 1AKYA 2V4ZA 2GWHA 4D2IA 1VHTA 3AGPA 4PPNA 2OAQ1 1EFRD 3DMNA 1GRRA 1RE0A 3B1VA 4YDHB 2P5TB 1KAGA 3W3AA 2PX3A 2OLKA 3IQWA 1VG8A 2ZI6A 4AD8A 4AYWA 3RS0A 4HLUA 1KK3A 1G6HA 1VYUA 3PV0A 4S2EA 2FDCA 5J5CA 4WIAA 1IXSB 2QL6A 1NN1A 4JLJA 1MT0A 2JDIA 4TSFD 1VIAA 4NCIA 3A4NA 1WXQA 1W0KD 3NC0C 1X8KA 1TQ2A 3CWQA 1KSGA 3ICEA 4PPQA 1OH8A 1E99A 1SXJC 3A6PC 3QF7A 1KO8A 4Q7MB 2BM1A 1EX7A 2WM9B 2GXQA 2ZEJA 1XEWX 2VHQA 1P4SA 4LYFA 2B7CA 2WWYA 4UNNA 4LYAA 2WWXA 4DSNA 2ZR9A 3MWJA 3R8CA 2IS1A 3LNCA 3PEUA 1X8LA 2F3RA 2FFBA 1PVOA 3A1SA 3X1ZA 3SE0A 2NTYC 2QE7A 1AGPA 1E9BA 4QGGA 2D4HA 1CRPA 1QHHA 1P61B 3DZ8A 1XCMA 4IDHA 2ZPTX 4KXFB 4URXR 5JWHA 2J1LA 3LAWA 4WW0A 2ZJZA 1HEIA 2PL3A 3ZIAA 1RYHA 2JLZA 3BIFA 3WMGA 3I61A 1N5KA 2ZTSA 3CPJB 221PA 1U99A 4HDCA 2WSSA 3K0AA 2W0SA 1YZQA 1F2TA 2ZIAA 3IHLA 3A37A 5AJXA 5BN5A 1ZINA 3BH7A 1W44A 4AYTA 3TSOA 4AYXA 2IYZA 2O8EA 1R0YA 3RAPR 2W6IA 1XMVA 2ZANA 2ZSAA 1C1YA 3CF0A 5KUTA 1SKYE 2YHSA 1DEKA 3TUZC 2V8OA 2YWHA 4M4SA 3B1WA 3GJ8A 1GZSA 2ZUBA 4TTQA 1AKEA 1ZM3A 4HAWA 5G53C 2IUUA 1ZNWA 2Z4SA 4DUGD 1F5NA 1JJVA 4Q19A 4DIDA 4M1KA 4N0EA 2ZJ5A 4DLTA 3QF4A 4S35A 2RGXA 3LXRA 3BC1A 5IK2D 3SOPA 1IN8A 4B35A 2XJ9A 3WBJA 1IJFA 1E9CA 1I4LD 3PVSA 3B13B 2QP4A 3DOEA 5L3SA 4HDQB 3TMKA 3RVBA 3TGPA 1SHZA 3JZAA 4OI1A 4D0LB 3I92A 1CR4A 3B85A 3AKYA 3TLXA 2PZFA 3Q85A 3KB2A 1B23P 4DT1A 4D4MA 3AVYA 4A8JC 3A1TA 2G3YA 4QM6A 1KHTA 2A5DA 4Q9JA 4B76A 2B21A 3GLIE 2IYSA 4LV8B 1SZPA 1Z3IX 3CUEF 3K9NA 4TL6A 4A0HA 1C9KA 2GCOA 2J7KA 2BOVA 1TF7A 3QQ5A 2VL7A 1F60A 4WBSA 3W3ZB 1T0HB 4BGDA 5J4HA 2AWNA 3RWMB 4LBYA 2F6RA 3TNFA 1R0XA 4HI0E 3MJRA 3AVOA 2J7PA 3CBQA 3ASYA 3KJGA 5FR1A 3MWKA 2GXUA 3N2IA 5A0FA 5C1BA 1G6OA 1TL7C 1IY1A 1P9WA 4IW3B 5E4FA 4FMBB 1LY1A 1XRJA 4US1R 2XTMA 2QP3A 1FTNA 2GVDC 2W6JA 4UXJA 4B44A 1QHHB 4PHHA 1R6BX 1SXJA 1N6RA 2A5YB 4DJTA 1NVVR 3LLUA 1H8HA 3C7KA 3R9IA 1E69A 1YZTA 1ZC4A 2B8TA 4NYMR 4YC7A 1VTKA 2HXSA 3DM5A 3Q3JB 4ZI3A 1MO3A 2HF9A 3DZDA 4TYPA 4BFWA 1A1VA 1GAJA 1KSJA 5FPHA 2FX3A 2VIIA 3B60A 2ODWA 3EWSA 3K0AB 4AURA 3LW8A 4M22A 1F2TB 1CS4C 1R5OA 4A0RA 5F9FA 2QTFA 1JAHA 3GJ4A 4OI2A 1FQJA 1MH1A 1KI3A 2ZE7A 4TZ0A 2OXCA 4W9MC 4DKXA 1OKKA 3E1SA 4DSTA 2BVNA 4IDOA 4Q1EA 2O8EB 2QM8A 1E2HA 4RD3A 2P6UA 3CO5A 4C9BA 3OE7D 2IS4A 1W5TA 1QHSA 1T6NA 1Z22A 3K09A 2EYUA 2Z0MA 3EG5A 4MGKR 4BFSA 3CR8A 5DYIA 3NH9A 4EIWA 1GL7A 1KDTA 2LWIA 3LV8A 4TZ6A 2GILA 2PX0A 1XXHE 1Q57A 1D9ZA 4LBVA 2QPAA 1OYWA 2WOOA 1V5WA 2GCPA 3QF4B 4L8GA 4IOJA 1GFIA 5FBVB 4MDFA 3B1XA 5SZKB 4Q9HA 4P4TA 2ZJAA 2C77A 4BWYA 4EPRA 4DLVA 3T61A 3LXXA 1GRQA 1K5DA 3PXGA 1Z28A 2LKCA 1YJ5A 5L3SB 2HDNB 4TYQA 3HYRA 1OPXA 1ZVQA 3FWYA 4CRWB 5JRZA 2DYKA 3T1OA 1EESA 4DT1B 2Z43A 4UNQA 1E2JA 1Z0JA 2DFTA 4M9ZA 3L2OB 3BRWD 2GRJA 3R7WA 1NVUQ 2GCOB 3FMIA 4PZLA 4MUAA 3FGNA 1ZW6A 1G19A 4AG5A 1N0WA 1RIFA 4X8MA 3PITA 4OI4A 2HYDA 1E2QA 1FZQA 2YOGA 4GPTA 1WA5A 2VLIA 3LO5A 4LWZA 4BZPA 3G0HA 3NHAA 4B33A 5FTLA 4MDEA 3WHKA 2P0EA 2R62A 4LYHA 2ZRGA 2QPTA 2VP9A 4A8JA 1TNDA 2R44A 2REOA 2A3RA 1XTIA 5H1YA 1HURA 4AKEA 4M0LA 1OFIA 4FI3C 4DSUA 2YKGA 3BH0A 4TT3A 4DC9A 1Z5ZA 5GVRA 1SXJB 3BFVA 3K8YA 1W7AA 4EFLA 2PT7A 2ZSBA 1NN3A 2Q6TA 3DL0A 4JT2A 2H57A 1ZP6A 2BEKA 1JB1A 3V4FA 1E2IA 2A5JA 2G1JA 2H7VA 2ZJ8A 4GMDA 4HB2A 3TAHA 3TK1A 1ONBA 3X1YA 3GLFE 3ZVMA 4US0R 3GFOA 4PANA 1N6HA 2VHTA 1KK2A 5EP2A 2Y8EA 3AP3A 5FL7D 4LPKA 1KI2A 5EXTA 4KBGA 4LJ9A 4K81B 4PZYA 1U81A 1G1MA 2ERYA 4PO9A 3PIRA 2ZRKA 2RCNA 3UMRA 1N0UA 4KAXA 3G82C 4LX0A 1CRQA 1S96A 1W4BA 5DHFA 5GJCA 3WRYC 5F3WB 1NLFA 4UXIA 4UKDA 1TUEA 3PUWA 3FKSA 5SZIA 4BE7B 4JL5A 4TYNA 2EFGA 3I8SA 4LPSA 1G17A 1MO5A 1NKTA 2YC2C 4B43A 4TQ9A 2IW3A 2OV2A 2FFQA 2QZ4A 2UZ3A 3MRSA 4CW7A 2F1JA 1UM8A 1XFAA 2QA5A 1EWRA 5TVKA 3IKJA 1R10A 3H0KA 3D31A 4M2LA 2D7CA 4ZKEA 5JS8A 1ANKA 4BEJA 2CLCX 4HUQA 5LB4A 3DPUA 1NJGA 1QHXA 1Z0AA 2OFXA 3T1QA 4F93B 2R6GA 2ZRNA 3RSLA 1NN0A 1SGWA 4JJZA 3SBEA 5DHAA 3FVQA 3NKVA 2IYVA 2JJ1D 3OZXA 4NTZA 4U5XA 5HCNA 4NHOA 4TMZA 3KQNA 1K5GA 5AUPB 4NKRA 2A2ZA 1W36B 4RVCA 1VKJA 4ABYA 3PUYA 3R7WB 5AUQA 1E1RA 3JVUA 3NVAA 1G20E 3CPHA 4C0AC 3K9HA 5FI1B 2FG5A 3ADDA 3VX4A 5TARA 1P3JA 3X1WA 1GNRA 1E1QD 1CU1A 2RGBA 4XIGS 1P9RA 4DEXA 3GQBA 3Q8XB 3L43A 2RAPA 5CB8A 3BFKA 3LLMA 1FL9A 4A8JB 4QHTA 1GSIA 4C0JA 4W5JA 721PA 5KNCA 1UEIA 3A36A 1X1SA 2WWIA 2FA9A 5FTNA 4KBFA 4MKGA 4OQFA 1CJMA 1IN6A 2MSEB 2FZ4A 3FMPB 3KJHA 5HKKA 1GIAA 1Z6GA 4YLGA 5DN6D 5DYGA 2AD1A 4LUCA 2NGRA 4V0MA 1SVKA 2EFEB 1JR3E 4KU4A 1CIPA 5KTYA 2QUZA 5KSZA 3P1JA 2WJVA 1Z07A 1LFDB 1BIFA 1N2CE 2ZE5A 4PPGA 1KSHA 2RGGA 3QBVA 4RSGA 1RYFA 1T91A 3PJRA 3U6BA 1ZIPA 1E2GA 2GJ8A 4R71A 1SKQA 4URVR 4PC1A 1E2KA 2D3WA 2WKQA 3C5HA 4HATA 3QVUA 4PO8A 1I4DD 1LVGA 2PZGA 2QGZA 2VTKA 2FPLA 5CIQA 4DLYA 3MCAA 4OHXA 3LW7A 2CLDX 3ND9A 4LJYA 3VR1A 1OB2A 4IRUB 4JBXA 4TL7A 1W46A 1E32A 3BJIC 3LWNA 2QBYA 2PJRA 4URWR 2HV8A 3OAAA 4D4LA 2YWEA 1KO7A 3U3JA 2OXRA 3T1VA 4MITA 2GTPA 3A4LA 2XSZA 4HUQB 4LJ4A 4BLQA 2HT6A 2AWOA 3DEFA 5TV2A 4QKQA 4C0QC 2IHBA 1NNEA 1U90A 1ZM7A 3CRRA 5BWMA 2R6AA 5JECA 3THXA 1S9HA 1XEFA 1N0VC 1ZC3A 4IHQA 1OXTA 3NBFA 1U0LA 4IDPA 3LBNA 1L4YA 2C98A 3ZZTA 2REXB 2RHMA 2KE5A 4HB3A 1MO4A 2HLDD 1GWNA 2VSFA 3V4RA 1N6NA 1VDZA 3QE0A 3A1UA 3BB1A 2WPDD 3OEHD 4LI0A 3K0FA 3VU9A 3TQFA 2O0JA 1UEJA 2WV9A 3QKTA 3Q72A 3B5JA 1IJEA 3RWOA 2ATVA 3EWAA 3AVWA 3BD9A 3EPLA 1KOFA 5EE9A 4MRNA 3SI7A 2TMKA 3KKPA 4AIIA 3GLGA 1CR1A 1J99A 3B1ZA 4XVQA 4JYCA 4K8OA 1UBCA 4UJ5A 3BAFA 4J0QA 1DAGA 4PAMA 5AJZA 3EZ6A 2ZYTX 2IHYA 3KJIA 1E1QA 2ZJ2A 4TMTA 1ZNYA 2IBMA 2WIAA 1VCMA 3NXSA 3AKCA 4URZR 4ZDWA 4I1VA 3ZVRA 1N6PA 2V1XA 2ZQ5A 2ORVA 4JBYA 3EXAA 3GCGA 1HV8A 1AZSC 3PEYA 2D2FA 3CZQA 3QKSA 1I4TD 3UPUA 1L7VC 2ZU0C 3ECCA 3VX3A 1IONA 1P9NA 1PUJA 4RZUA 2D06A 4G5OA 3VR2A 1IN7A 5BN4A 1EX6A 1PLKA 6Q21A 3CZPA 5C18A 2Z83A 4DLWA 1RVDA 5FOUA 4JVSB 2BBTA 1XD8A 1GITA 4GSYA 1WF3A 1NBMA 4ZO4A 3ZD6A 5CYPA 5EE0A 1WP9A 3K0EA 3SFVA 4JVNA 2VP0A 2ZS8A 2OE2A 2F9LA 1P62B 1QZXA 2GKSA 1UKYA 4IFEA 3VHLB 1UAAA 1RFLA 3LVRE 5DLQC 2QBYB 1O3YA 1QG2A 1G3IA 1HQYE 2JDID 3NC1C 4JIMA 1MKYA 1I2DA 2V7QA 3MGCA 1J7KA 2QPOA 5EZ6B 3W90A 3QNUA 4CYMA 1L8QA 1OYYA 3EIHA 1YZKA 4I1OA 1J70A 3SU8A 4HAYA 1LF0A 4ILEA 4B47A 1E9RA 3FOZA 1DO2A 1XTJA 4NBSA 5FI0B 1U0JA 2FOLA 3NG1A 5HPYB 1KK1A 3THXB 3T35A 1UBFA 3H84A 4FMCB 3D3QA 3GEEA 1XDBA 2BJWA 4ZKDA 3KXLA 4CEHA 4LC0A 4JLOA 2ZSDA 3TR0A 2P3SA 3F0TA 5IDVA 2QG6A 2QE7D 5E7IA 3NDBB 2CCKA 3ZQJA 1G3MA 4U7DA 5DI3A 3VHXA 4F4IA 4NYMQ 1TEVA 1FFHA 2CL6X 3K0FB 1R5BA 3HP1A 1YZNA 3QEOA 3VU9B 4Y0VA 1KJYA 1ZRHA 3OFNA 2XAUA 1E0JA 1ZYUA 1OW3B 3ZIAD 1KMQA 1SVOA 2QROA 5CK4A
chains in the Genus database with same CATH superfamily
3O4RA 4RM3A 3DMTA 2GJKA 4GMXA 5EJ7A 3MTBA 4DWOA 2FX5A 4ZGWA 4KSYA 2XUAA 4XLZA 1KTVA 4N0QA 3YASA 4OLBA 5FA5A 3CUYA 3I6QA 2FMKA 1EJBA 1U94A 1W2WB 1UK8A 4RANA 4QHYA 3MD0A 2DCMA 3U7QB 5FUWA 2QLLA 3NOOA 5GV8A 5DCYA 4Z99A 5ARDA 5KYYB 3T7KA 1A9RA 2W6ID 1QE3A 1QRRA 1X9IA 3HSKA 4J0IA 3ZCTA 3SXUB 3AM3A 4OHUA 4QJ3A 1X1QA 1OWPA 1ST2A 4IVPA 2CUNA 1TQ6A 3WLNA 3BAZA 1LS1A 1QLWA 1XTPA 1M2OB 1SUAA 2WJIA 2C2ZA 3IQHX 1X7ZB 4Z4EA 4XH9B 2AJ8A 5K6RA 2ECOA 2HC9A 5CM9C 4M9UA 1UINA 1Q12A 1UMBA 1UQTA 1VMKA 2MYPA 3I30X 3IAM6 4QGBA 3H5VA 3RJ9A 3SHWA 3TDMA 2ZB4A 1KAOA 3JQGB 2XQKA 3Q98A 5BN4B 3VI4B 2O54A 1V7QA 2IUFA 4JBHA 4MARA 2OTCA 3N87A 5DULA 4RORA 3JRNA 1M2KA 2WZDA 5AHXA 5BUCA 4ND8A 3H87A 3N75A 2WB4A 1PX2A 4JUIA 4MR8B 4QRDA 1BHO1 3I0NA 4KK4A 3T52A 1ODFA 3QUTA 2Q9AA 4LRXA 1JHYA 1K27A 2WINI 4OMDA 4DLNA 2ECKA 2WSMA 1H4QA 3HXLA 1P19A 3ZDYB 4O4HF 1K88A 4Y2GA 5E8RA 1EEXB 3JQBA 2WOJA 2MWMA 4HZIA 4YN3A 3KVRA 5C34B 1GTMA 3HXPA 4NCBA 2FP4B 4KBYA 3H0EA 3QIAA 1QFMA 4GPAA 4HUJA 4KQ6A 3ZCVA 1ADBA 3VC7A 5IW8A 3VDMA 4Z3KA 4F9FA 1GRVA 1M2JA 2R6ZA 1L7MA 2EJVA 5KJFA 2PSHA 1SUFA 3A1VA 1WD5A 1JX6A 4BX8A 4JUFA 4RVDA 1FU4A 5FWXA 4TRJA 4NULA 3TQCA 4ZC8A 3PWZA 5HMMA 1PD0A 5JAPA 4NIMA 1FY2A 4TUYF 5EUCA 3I6IA 1XPUA 3AOEA 1GGJA 5CA0B 3LFUA 5IJWA 1WQ4A 3EOZA 1S02A 2VATA 4L15A 4RF4A 4RYLA 5FFFA 1T2AA 4Y2HA 1PG0A 3ZGNA 4DAOA 5FUMA 5KKCA 1RC1A 5D7NA 1HBJA 1F1JA 3C5EA 5TPWA 4A6EA 2WB2A 1PZNA 4JDPA 3AVTA 1DKLA 1WUKS 1KWGA 3FDZA 4B6RA 4J0FA 5GIOE 2BN4A 4Q1VA 1RRVA 3BH6A 3FR7A 3UJDA 4TQAA 3LRPA 3DUWA 4B73A 1BE6A 1T8UA 5IZ4A 2W6JD 5DI3B 5PNTA 5BVGA 5IX8A 4Y98A 2P5UA 3IPLA 2VVTA 4E5VA 3OPVA 3V2UA 1CUYA 3H9QA 3QSGA 2PQ0A 2OV3A 2I6GA 4OFXA 3OMLA 3AP2A 2GCEA 3COSA 1DCMA 5MFZA 4B6GA 2UVQA 1EDEA 3UV3A 1KYVA 3IUQA 1S7CA 4WXPA 2DKOA 4KODA 4DLZA 2H11A 2J87A 1NY6A 1ODTC 2WJAA 1TT7A 1JEQA 2JI4A 2YWBA 3QKUA 4PR0A 3TRJA 3TIIA 4H1UA 4EYEA 1JZQA 2DBQA 2ZYUX 2CVHA 4K0RA 3VH4A 1CQJB 3TKLA 1Q7BA 1SKUA 3CWCA 1QH8A 3LX8A 3RUDA 5IYZA 2XLCA 5E3JA 2BTQB 2C9MA 3E35A 3DCIA 1OKKD 1QIKA 2MSCB 3SVTA 1PG5A 3L5KA 4MR9B 2IH5A 4W9RA 3L4BA 2Y2UA 1OZAA 2VJNA 1JFVA 2RFLA 2BKEA 1RI1A 1WSBA 2Q6LA 4KNYA 3IT2A 2YVLA 2YXBA 3VISA 1Q0RA 4KHPB 2GF0A 4Y9TA 5E4JA 5CEEA 1EYZA 3SBOA 3C8HA 1L4EA 4CL2A 3IKVA 3RADC 5K7SA 1QDLB 1M7HA 3OT5A 4UQOA 4CIDA 4KX5A 5ALLA 2QNIA 2CYCA 2FMXA 1WLSA 3L1KA 2JFFA 2QTGA 4QT4A 1JSZA 1E4YA 1LZLA 1KEWA 1ESCA 1XCLA 4ZTZB 5JYCA 2C9BA 2QDXA 3KETA 1O95C 2CL0X 3THWA 4IJWA 4QEDA 4KYIB 4X54A 4GEKA 4MRPA 4Q1DA 4EYOA 3ZY5A 3L7DA 2J0UB 3H1PA 3KHTA 1BXGB 4IPTA 3E5RA 2X0FA 3UZUA 3W5SA 2ZKIA 4IIEA 4OHWA 4ETNA 2GSWA 3F3YA 3L7LA 4C88A 1YT5A 2ZFUA 5L4NA 1SC9A 3OJFA 2PEYA 4O02B 2FWPA 2DFNA 3AL2A 3GJSA 4MYSA 1YVDA 3BD6A 1L4UA 1W36D 3LYUA 4TXHA 5ILQA 5TDHA 4P5PA 4L8LA 1P2DA 1UBOS 2WHEA 3BERA 3CW8X 2FSGA 3KXKA 3LQQA 4IVQA 4RGYA 3WL6A 1G291 2VN8A 2VUHB 1NR1A 4EPWA 2XZTA 1BGWA 1D0VA 1XROA 4FMDF 5FV7A 2G04A 3GUCA 4EGCB 4AT1A 2XGSA 4EITA 3HFGA 1EE9A 2DSNA 3KPYA 3PC6A 4TXLA 1TU3A 3MMPA 4WZAE 3L0DA 3UJAA 1KVSA 1Z8DA 2FZEA 2Z6VA 1SBCA 1J2JA 2GZ3A 1Z18A 3OJWA 3M4YA 3FTPA 3NIFB 4L0CA 3L1IA 4LRWA 1EBFA 4RGVA 1FDVA 4Y6SA 3FWPA 1SG9A 4D44A 1E6LA 1XZIA 1RAEA 1DAPA 5E7MA 5C37A 3TL3A 4LDAA 2DFPA 2W93A 3ER8A 1F2DA 4BUJA 5HCIA 3O9MA 1Y8AA 5LZ5A 2GZMA 4A6PA 2DP4E 1G4AE 1U5BA 2X41A 3SNHA 3TOXA 4KR6A 3BXHA 1K4MA 3IBCA 4DMRA 3WP1B 1G8GA 1AXGA 3WGHA 3T95A 2FQXA 1Z4IA 5JI2E 1GKYA 4BAUA 3MHTA 3EWIA 4YBRA 1IU9A 2JCYA 1NI4B 3GAZA 4YP1A 5JBQA 2XE7A 2IUSA 3GLIA 2JK1A 2DX7A 4HX2A 3O8LA 2V7PA 4TLDA 4WT7A 4CDGA 5LDDC 5AIAA 3KRTA 5EXPA 5AVWA 1NASA 4YCCA 1J0XO 4RFSB 4QODA 5C35A 4DEVA 1ZM9A 4L3WA 4P84A 1QZ3A 2RKWA 4GAEA 2FR0A 4QDTA 4X8LA 5DTMA 4ZDIA 4CF7A 2F64A 3QPWA 3WLTA 1RXYA 4CE6A 3ISVA 2JFPA 4DDUA 3HJFA 3VU0A 1O6BA 1NW7A 2DUUA 1DT3A 2E85A 4PCAA 3RRMA 5JS2A 5IKXA 3CGGA 3OCXA 4FKMA 4I5IA 1EK0A 2CHVA 3MTDA 1ZU4A 2FWMX 4YB8A 3SYKA 4LFBB 4JUCA 1MD9A 3P0HA 4DXDA 1X8JA 4UHBA 1OLOA 2FPGA 2Q5EA 5LD2C 2P40A 2RGNA 2REQA 4NU0A 5IJ9B 1RZUA 3C14C 3ZJ4A 5EKSA 3B89A 5C9ZA 5C8YA 3CIOA 5JQWA 3QBTA 1E3QA 1ISFA 2BFFB 2ZWOA 4HJRA 1ZGGA 2BF4A 5JAZA 3NMUF 2OV1A 4M1YA 5CB4A 1VECA 1Q0SA 4J7CA 3RTBA 2P35A 4DF3A 4Q5IA 2OAGA 3W9SA 3R0VA 4PZEA 1PDVA 4AJLA 2BV3A 5BQ5A 4FB5A 1FMCA 1U9IC 2I0FA 1P7VA 3HCEA 3WIDA 1ZH2A 2FPPB 1CF9A 4PLYA 3IDOA 4M54A 4YI3A 4CQJA 1DBPA 3LCMA 1Y1KE 3O8NA 1FSSA 2A57A 1OFTA 2CMGA 2GF9A 3MAAC 4JL8A 1PNTA 4ASUA 4J0CA 4FHGA 5AVYA 1K7XB 1B6GA 1HQDA 3ZBUA 4CCSA 4GP9A 2DBVO 4H6WA 4D6PA 4DMFA 1E2BA 2P2NA 3LWZA 1AC5A 1SKYB 2R25B 2YVUA 3IHKA 4RLQA 3WYNA 1C3XA 3UICA 5GINE 2BEVA 2OFPA 4Q4HB 5LYJA 4EG1A 3L0OA 4PRZA 1ISIA 3CH5A 2ZJOA 3FH0A 3MT9A 3PA8A 1YNSA 1PGOA 1YZFA 3KR1A 4L7QA 3V7WA 4HX5A 3ZY4A 1Q84A 3QFFA 4FJ1A 3NIBA 4DDHA 5A03A 2QNRA 2EDAA 2ZRMA 1PK7A 3G0CA 4ICIA 5KNCD 4B84A 1P2SA 1GVNB 2W2KB 2C2OA 3GEPA 4NONA 1E6EA 3T7JA 2XD9A 4LXUA 3VDRA 2WTEA 2PUBA 2FVXA 4NY1A 4DZTA 1UC5B 2NPOA 1E1CA 4V03A 3V4VB 1U7UA 3KTFA 4JENA 4E07A 3D8BA 5J4LA 1IAQA 2NV0A 1TJ3A 5HKKD 2GEDA 1DWUA 1R4ZA 1D7OA 1NMXA 2I4LA 1J9EA 3EUWA 4OQPA 2DPYA 1CZKA 3WXBA 1FQKA 2E3JA 3TQRA 1GNQA 3IODA 3FZNA 3IXMA 3AF2A 5CA1A 1E3MA 2WC1A 2BUAA 3D6FA 1Q3TA 3RG8A 1QH9A 3DWFA 1VB3A 1HZZA 1CF4A 3GMTA 1GY8A 5K5EA 2E4UA 4UD2A 3ZU5A 1FUKA 5CBKA 1JHAA 5CM8B 3M5CA 3FPFA 3TZ6A 2VNKA 3WAJA 1PNOA 1GSAA 3AERB 3ILXA 3MCUA 1J5XA 2W6ZA 3SSNA 1IEXA 1MQ9A 3EC1A 3HVKA 4I99A 1OC2A 1JR6A 5EQFA 4WLUA 4U2BA 1PSZA 4KPGA 1JKXA 3OBIA 1NIJA 2FUG6 1KWKA 3AM4A 1Z6AA 4PRKA 4I1SA 5J58A 4KZPA 1SBNE 4E5UA 3ETNA 3H05A 2BEUA 4YYEA 5AVKA 4EG3A 4YR9A 1Z8HA 2PT5A 1VSUA 1T2CA 2A9OA 5CHYA 3TOZA 3ORYA 3QW2A 3ZI4A 4V1CA 3ZV6A 4TPKA 3EAGA 2ODPA 3O90A 2YASA 3OAAD 3HFJA 4QBKA 4NCNA 4IJUA 5IJAA 1FDSA 2P0YA 5AVSA 1Q14A 1ZVVA 1X3LA 2XSZD 2CBXA 1DEXA 2O8BB 1FOEB 1DELA 2XGOA 5F3RA 3GLFA 5KC8A 1JI0A 4BP3A 1XAGA 5MF6A 3K9FC 3BXPA 1RXSA 1VYHA 2V0NA 1EDOA 2IEGA 1BCSA 4JYBA 4MKZA 1UOQA 3M6MD 4RK5A 4QBGB 3F49S 3AEKB 3JYPA 3RYHA 2DG2A 1QCDA 3C1UA 3UJCA 3EX7C 5KTSA 3G6WA 3CH7A 4OQNA 5M2QA 3ZVNA 1SURA 1QHGA 2AB0A 2R751 3EN0A 3GRCA 2PWAA 4KTVE 4X1KB 3NTUA 2CWWA 3ZWNA 1CZHA 1T5BA 2R6DA 2XMGA 4FGWA 5ED4A 1LLQA 1IY2A 4DY6A 3H2GA 3H7IA 1HK7A 1D2AA 1WKCA 2CVFA 1C9EA 3FCCA 4FSDA 1W25A 4RD1A 3QSYA 1SUBA 3H1FA 1QPGA 3V7UA 3WLJA 2KB0A 2SHKA 3E7XA 5KB3A 2JLYA 4HWTA 5I47A 1NY5A 3D1VA 4AG6A 9ATCA 4Y6OA 2HAEA 2C7PA 3K0SA 3W2GA 4B87A 1V1MB 1MV8A 1EB9A 2C3YA 4DNOA 1DMRA 1M3SA 1R9NA 4FIDA 5TQ2A 3UT5A 8OHMA 2G70A 3W04A 5IDXA 1GPYA 2NADA 4DARA 3QXXA 4X85A 3ZLJA 2C4KA 3DZFA 3TEJA 3QG1A 4IM7A 2B1IA 4IMIB 4R9VA 1TTQB 5HZGA 4Q93A 3MJTA 1J0DA 3H2IA 3I9LA 5D3QA 2V65A 3WYFA 3A2LA 1S3IA 4CLOB 4HVLA 1ZCAA 2H7YA 2NO6A 3DBRA 4MQUA 5IRCD 3RQSA 5ALPA 2AC4A 2RI6A 4G4SP 2HHHB 2YFKA 1F8UA 2PNFA 4LDRA 3SXPA 3RRXA 2WTAA 3P9XA 4ER0A 1HQKA 2AG6A 2HQSA 4MQEB 3QJGA 4NZNA 1I10A 3WA6A 2VRCA 4R05A 4Q4JA 3EVCA 5I8ZA 3RJMA 4KVZA 4BCBA 2AOXA 5B53A 1GZ3A 5EZQA 3ZD7A 2J46A 3DEKA 2O8DB 4JP5A 1IK6A 2JGKA 3PQ8A 4UJ3A 5FO1A 1ZX1A 1HUQA 1U5AA 3CNEA 2ZRFA 4II2A 3TBFA 1K7SN 3V00A 3VJLA 4UNRA 2NU7B 3FB1A 1UPFA 4YP5A 1N2HA 3CF6R 4J16C 4ZOCA 2VXOA 4F3CA 4LDPA 4F7DA 1C29B 3WK4A 3W3AH 1A4RA 3FYTA 1GRCA 2P9JA 2V6JA 1E6MA 1NBMD 4UTNA 2BW0A 1L2TA 3BK7A 3IILA 4S12A 3WY9A 1NXVA 1HYGA 3NBXX 4KW7A 2QLBA 2VF8A 1X7WA 1DZIA 1KKLA 2XYVA 1GUZA 2I1QA 3RIHA 2J85A 1RC0A 1FW8A 2HLHA 4I5GA 1UDXA 1AA9A 3EIEA 3MWYW 3P4YA 4XD7A 4BBPA 5JHHB 4MWCA 1AQIA 1IZYA 5COQA 4R8KA 3SDBA 5KX5F 1OFHA 2V7QD 2ONJA 3FUCA 5A4KA 4R9RA 1E3IA 1U4OA 1C3OB 1KQOA 2O1XA 3I0MA 3PNQA 3FD8A 4LXQA 4U5QA 1IWPB 1FYFA 2Q4BA 1Y3AA 2QAGC 3OPYI 5BT8A 4E5PA 2Y27A 3TN7A 4DABA 3WB9A 7AT1A 2ZRAA 1YMUA 4E08A 1KYIA 2YL2A 1EVIA 3R6DA 2P6NA 2CJWA 4YT5A 1Z0FA 1VRVA 3L7CA 2VNJA 3SJBA 4ZHSA 5HKOA 5I4IA 1CETA 2EW1A 1Y4DE 3GRVA 4K9PA 5A4MS 1MH9A 2AF3C 1KMMA 2V6MA 4QXQA 5GV7A 4DTCA 3AM5A 2QY6A 4I9FA 5CDYA 1XYYA 5LD2B 5AW2A 4H27A 2M9MA 3CJRA 1Q22A 2BFDB 3MT7A 1QS0B 3HDVA 3P7MA 4KO1S 4CQMB 4Q82A 5K8UA 1B1CA 2R6CA 2GPTA 4P81A 3FBGA 4WASA 4LY9A 1V8DA 3KOMA 3ORRA 4X71A 3AYXB 3KEOA 3QW4B 3SWWA 4D9CA 1OWNA 4FCWA 4N0MA 5BNZA 1AU9A 1HDXA 4YR7A 2W2NA 1DAIA 1Q95A 5TT0A 4ECEA 3OFND 3GLSA 3B36A 3DV0B 3MXTA 4IXNA 4IQ4A 4YFVA 3IBYA 3HU5A 1E8NA 4RCVA 2VPTA 3CH6A 3MRTA 5CA1B 1IJKA 1YB4A 2O8VA 5HCUA 3TTVA 3QG5A 4TRNA 4BN4A 5CD9A 4HYYA 1USWA 3L7AA 3F3SA 5DGDA 4RKFA 1PVDA 1ZONA 3ADPA 5GOZA 4YXWA 5H3CA 2D7DA 1E0AA 5F2EA 1XVLA 2UDPA 3U4QA 4EHLA 1SVIA 1LPNA 4YRSA 2IS2A 1Z5OA 4IIDA 2CHGA 3SQMA 3V1YA 1MFPA 3BWVA 1CDDA 3I5YA 3DB1A 1ZL2A 3FPBA 5BWOA 4K9OA 2H4WA 4A73A 3KE8A 4OHKA 4AJ1A 3GJXC 4DYDA 2WJWA 3EIFA 4OQYA 2EGUA 3M1AA 4LRUA 1AJEA 1P3Y1 1Y0BA 4PQRA 4BWVA 5IJXA 3EGXB 4DA9A 5KVSA 1O1YA 1P73A 3N58A 4C87A 1PJ4A 1X1EA 3CSDA 4ZPXA 4G5RA 3V55A 1J2TA 3EPJA 3ZDDA 4B6SA 2SKEA 3HB5X 1NF9A 1Q1BA 5F1OA 3X1MA 4FGLA 1G20B 2JAOA 5K0LA 3ZXSA 3RVOA 3B70A 3DE7X 3KDAA 3QXJA 2H9AA 4TLEA 1SKAA 1OFUX 2EJTA 4ZT5A 1YZ3A 3DBLA 4JAVC 3UATA 2GBCA 2G7ZA 1XPJA 5JATA 2DHQA 1UJNA 3G8CA 4HLCA 4UMVA 3U3DA 4V0NA 4MYTA 4LGMA 5B6IA 4MP3A 3A6JA 1CUJA 4WNAB 2QRNA 4ZO6A 1WF6A 4FDTA 4R83A 2PDAA 4C0SA 3LG2A 1CE8B 1ECFA 2WHQA 4G3XA 3RV4A 4U9UA 4IGAA 3H7AA 4IIJB 3DDSA 3FUUA 1UP4A 2HWYA 5BOSB 1K7FB 3PX2A 1AMOA 3G9UA 3KVNA 2OBMA 3C3XA 3PUXA 4HB0A 1IG0A 4YONB 4D3XA 3WTBA 4MV5A 1BDJA 3FYUA 2UYCA 2ZYSA 3GPDG 1JU4A 1V16A 2GMWA 3ILSA 2D0DA 1V9SA 3L8CA 1QFXA 3UK0A 1Y81A 4NHEA 3AOGA 4C1NA 1C7EA 1RHMA 4X3PA 1OXBB 3DVAB 2OA0A 5EZ5A 4M1SA 1Y4SA 4EY5A 3EBLA 3JQ9A 1U8AA 3LDFA 1J8DA 1V7PC 2PVSA 4XQEA 3HZRA 2LCQA 2GFHA 3AVWA 5KO2A 1GG9A 2G7MC 3C6KA 3ND6A 2OXFA 1RRFA 1UBHS 1NPTO 3EF0A 4KFSA 3L0IB 4ZGGA 5CDFE 1PYDA 1Z38A 3FTEA 4OGWA 1EB8A 3K35A 4KRGA 4LOLA 2J9YB 2Y93A 3CFYA 3UJBA 1RAAA 4ARBA 2G36A 4RK0A 2X8JA 4FFOA 3VPFA 2RAFA 1IN5A 3A27A 3R6WA 3K0BA 3QKIA 4HCJA 1VJ5A 1SU6A 4NX2A 4UARA 4IINA 1DNPA 3DTVA 5ICSA 2BEJA 2EKBA 1BDHA 5K0GA 1FE8A 2JEZA 3WSWA 1E4EA 2RJOA 4YFYA 3T3IA 1FUEA 3JQPA 5IC6A 1YRWA 4BO4A 2J0EA 5CFZA 3OQVA 3QENA 5JJKA 2ZR0A 3H3JA 1K4KA 1K7CA 1U7XA 3RI3A 3A1DA 3C7TA 2NVUA 4XYMA 4D92A 2X2OA 1MN6A 1T8TA 3DT6A 5CT9A 1LCIA 2DR3A 3TW8A 4BB9A 1O9GA 1JXOA 4MA4A 3FVWA 1CK4A 2B69A 1D03A 4FLMA 3C5VA 1RWWA 3WFJA 4XZ3A 3O4HA 4DMGA 2PKRA 3EXFA 1SCKA 1CR2A 3PHHA 3AUKA 3LBIA 4KAJA 521PA 5AJYA 3RUAA 1EGAA 1LV7A 3Q9NA 1LW7A 4KVGA 3TLAA 2ORIA 3OTWA 4F92B 1FX0A 3L7YA 3DV9A 1FDWA 1G7RA 4K1LA 1RJFA 1CTQA 3R3VA 5K8VA 2XXAB 1Q74A 4RD0A 3FUVA 5C51B 3T34A 5DOVA 2G5TA 3RIXA 3ZHUA 1RI5A 3QQPA 1HT0A 4HXYA 2DSTA 2X9LA 3ZWAA 3AUYA 4RA6B 4PSCA 2DERA 2Y6VA 1W5EA 1G5QA 2PZBA 5L6LB 1KJNA 4A4DA 2J3MA 1G2OA 1BYUA 1TFUA 2JFWA 5HRUA 1RTKA 1YB5A 4NFHA 3KL2A 4L73A 4YYZA 2RI1A 4LWPA 2IE8A 5K4GA 1UF9A 3D6TB 5AK3A 1QIMA 3EZXA 4M53A 3DD5A 5JJIA 1YJBA 4O4JB 1Q7EA 2C88A 4OV6B 1GLGA 4XRRA 5L40A 2AQ8A 4QLOA 1E1NA 3CZMA 1VG1A 1Z29A 3E03A 5F9HA 4WVFA 2EBHX 2DM6A 4IHJA 4NEHB 4HT3B 1B23P 3GEGA 4HNRA 1T35A 4KH0A 1I7NA 1P2FA 4IV0A 1FJXA 3OE5A 4CBVA 1JNYA 3D4IA 4W7HA 5G3YA 2YZMA 4X90A 4OO3A 1Z47A 2D8MA 2VQSA 3SZGA 3BXFA 1LK7A 2XCUA 3LVBA 3A9RA 3WQHA 4OGGA 1EGMB 1J8MF 3K6SA 3VKHA 5CLFA 4Z0TA 2VDOB 2VJDA 5P8WA 4DCTA 2YRWA 3GZNA 2FX2A 3KNZA 1OA1A 2Z4RA 2ODBA 4YJ2F 5EL0A 1CUSA 2OOSA 2WD7B 5A6SB 1QYXA 4KCGA 3IALA 2FCRA 4C0HA 2ZM5A 3PSAA 2IDMA 3AB3A 4R1UA 5KYUB 3U5ZB 3A28A 2JIZA 3ZLVA 2CNBA 2GN8A 2VUIB 3DWEX 1T1EA 4OSEA 4OLHA 3ZXXA 1YDFA 1LX7A 1UM9B 3S40A 4Y18A 1ZN2A 4MV3A 2XZPA 3EFOA 2ZJ4A 1A97A 2CNOA 2CLMB 1C1XB 1V6CA 1M10A 1XU9A 3DFKA 1DBWA 3W2TA 3FGPA 4RJIA 4M9XA 3WIVA 4ZYTA 5LOVF 3PXEA 5J4YA 2QAGB 2YINC 3GJQA 1P18A 2QT9A 3PJGA 4ITUA 1WHTA 3LP8A 1RC8A 5AR1A 4UE6A 1DRWA 2PQ6A 3QU9A 4QL3A 3C7CB 4G1MB 3EG9B 2NVOA 1DOZA 1SK9A 4ETMA 4GXQA 3KX2A 3OZSA 3HJNA 4DPLA 4BNUA 3VO1A 1LPSA 4K9QA 4N47A 1DLIA 1NFQA 4KSCA 1KFKB 3RF7A 2FYTA 4A9AA 1YQUA 2VTBB 3NIGB 2GR9A 3I1IA 5A6VA 5A9SB 2M6KA 3HWX1 3GNTA 2W4MA 4DW8A 5JT1A 1K7EB 3Q4GA 3SSMA 4BO0A 4OLFA 3AUXA 3G2NA 3TINA 4BO3A 1TRHA 5A05A 4EY6A 4Z5XA 1I3NA 3S99A 3TSCA 2EATA 5BPHA 2MR6A 3A1FA 4JJGA 4P4GA 1R6UA 3X2SA 2GK7A 1FYVA 4GECA 2CDNA 1I8TA 3H2KA 3OZAA 3QUAA 4IFBA 3D5EA 1SC4A 3QEAZ 3RU9A 2N47A 3HWRA 4XUDA 4NCHA 1XD2A 4D80A 1YK1A 4D9BA 3SQWA 1F8GA 2G1AA 2DH5A 1IN1A 2YHAA 3G1TA 4AI6A 3KM0A 3QFSA 4MQFB 4BVBA 1FP4A 3X1KA 4PLTA 2MU1A 2WQZA 5K8JB 2WA1A 2P65A 3PHLA 5CW1A 4ZV4A 1N3BA 4P58A 1CG6A 4M1MA 3THOA 3NBZC 2WTBA 3UT6A 2FU5C 2J4FA 3NGXA 1OBCA 4FYVA 4B45A 5JCJD 4JB0A 4GDFA 4TYYA 1AKUA 1V9CA 4R9UC 4GC5A 3E3LA 1PTJA 3AZPA 4C2TA 4J9UE 1CJVC 5FUXA 4ZZ3A 1JEOA 3R4VA 1C4OA 4UCWA 5EIBC 3ROKA 2PYZA 5IXJA 2HOQA 3PFGA 3USZA 1BDBA 2X77A 1SQGA 2G08A 2G88A 2GPJA 2OQ2A 3F8WA 2QQFA 4HAVA 2G9NA 1M2EA 3EVEA 2QX6A 4GM0A 4WX2B 1SBIA 4KO4S 1KBOA 4LHYA 5CB6A 3UN1A 3JQDA 4UHJA 5AM1A 5G40A 4DYVA 4RY0A 3MAJA 3GDOA 5LBTA 3WNCA 1ZOLA 1FZTA 4M38A 2CVPA 1W52X 4IP0A 4JVLA 2XXBA 1U2DC 2VCEA 3ESBA 3K0CA 2NU6B 4NBVA 4Y8VA 5DT9A 5H82A 5FFNA 3ZY3A 4ASUD 3FTFA 1G0NA 1U1FA 2XT6A 2GPBA 3I34X 3I62A 1C0EA 1GDHA 1L7BA 2GEFA 4RHEA 4FCCA 4HSEA 4MJ7A 4C3OB 4WBNA 3CXRA 1NF8A 1OD6A 4RSMA 4MYDA 4HNSA 4PHCA 1FPQA 2CXQA 4L5BA 1H5NA 5AICA 3W05A 4QG3A 3QVXA 2ADOA 2DQ4A 5HFAA 3OZIA 3WGKA 4JCCA 2XI4A 3ZJYA 3B9RA 5C7OO 2J5XA 2BBWA 1E77A 2SCUB 2LBPA 4ITVA 2OV4A 1QK5A 1FXWA 1PJSA 1Y82A 3E9EA 3EQZA 3SCZA 1VHQA 4LQ4A 4EVQA 5JADA 1KZ1A 2HQRA 4FS8A 5CNJA 2A92A 2B1GA 3T5DA 1VCNA 3UMMA 4WUVA 4M86A 2OM2A 2OYCA 2BH2A 5BXYA 5JSUA 2K87A 4B6QA 2W8BA 5HQTA 1OAOC 4WADA 4JY7A 1HT2E 1ZD8A 4ZARA 4I55A 2VDLB 3RC8A 4PLWA 1U3WA 1CS0B 1V2GA 1H2HA 1LD3A 2NUPB 2R87A 2PZJA 3CLRC 3FLMA 4IF6A 5K3FA 1G55A 4BFYA 4DB2A 3CXUA 3VPCA 4WPGA 2XWSA 3S6JA 2LXNA 2W00A 2QMYA 2YNMA 4JJ6A 3LPNA 4FCVA 3CKLA 5J1TB 4GYWA 4OAPA 4WEOA 4YRCA 3EGDB 3U0VA 2G40A 1NXWA 4YDQA 1WB6A 2BEWB 5LXTF 1OLXA 3KZ1E 3Q7QA 1JJBA 2E5FA 4GXTA 2ATEA 2ES4A 1AVTA 4X94A 4BMCA 1YTLA 1JMVA 1AHIA 3LUGA 2Y4OA 3HBNA 4OGLA 1NV8A 2G71A 3BXOA 3OSZA 3SGLA 4Z54A 1P5HA 2ON6A 3DAHA 3TNDA 5FOSA 4DANA 1I4WA 2RAUA 5SYMA 2OKGA 4B2IA 1KK0A 3PEWA 1J5PA 1C9MA 4ED9A 4BZZA 4C4TA 3JV7A 4GOXA 4BU0A 2V8BA 4JMPA 2NUBA 2J8ZA 4OCZA 4PSKA 3SSOA 5JARA 1X15A 1YB7A 2I6QA 2B92A 4ENVA 4HQLA 4UD6A 3KQUA 3Q7EA 3HS3A 1Q2UA 4K2AA 3BXXA 3R6LA 5AI0A 1XA0A 2PUJA 3SD7A 2IUYA 4C43A 2PGOA 3IPYA 1B16A 4NJMA 3WJ2A 1G21B 3I04A 5BWCA 4U2FA 3OCZA 1P29A 1VKNA 1U8UA 2X5XA 4MZDA 3QPBA 5IF9A 3I72A 5CH3A 1ZGAA 2NO9A 3QMPA 5D7BA 1WDLA 1US8A 3Q40A 1NRJB 1Y3FE 2AF4C 2AQKA 4MEAA 2E4VA 2PV7A 3ZU2A 4AROA 2WJ3A 3WJ7A 2WR8A 3TRDA 3VR6A 5ICMA 5SZHB 1XZNA 2LDXA 2YMMA 2R1TA 3JQ7A 3OIUA 3U4CA 1OQAA 2HXYA 2YN2A 2UYQA 3I2KA 2C9DA 1IBRA 2K7ZA 4DMCA 3STTA 5DHQA 2Q5JA 1FRZA 1YHYA 3N3AC 4MO2A 3V4SA 3FTQA 5TIIA 1PJLA 1MB2A 2I8AA 3I01M 3WRXA 4QTUB 3ANLA 3BCHA 4I8IA 4KQFA 4TROA 5FJIA 4F60A 2R1VB 1UKAA 3P96A 3HCFA 1D1TA 4KFRA 4NR0A 4JT4A 3ZNPA 1Z0DA 2ZRHA 4UM9D 5KPJA 3QJYA 3FE2A 1P1HA 4QYTA 4G9GA 2GDJA 3LUHA 3DBHA 1CRLA 2B78A 2COUA 4OTZA 2IKSA 3PVCA 2CBZA 1MUUA 2YR0A 2ZROA 3GUVA 1UBLS 3SJ7A 2D59A 2PKWA 4Y2UA 5ICEA 1TYEB 3LA6A 4JBLA 4CM4B 4KO8A 3QWAA 3P0RA 4LBZA 1Z5UA 1DQSA 2H7XA 2DQSA 4YLYA 1P2TA 2ZJFA 3H83A 4W7IA 1IH8A 2OHGA 2XKBA 5D86A 2G1UA 4WWHA 1L5KA 1OAKA 4ZQCB 1WVMA 1Z4PX 1JSRA 3ZQUA 4CJXA 1H2WA 4FHZA 1QRDA 2VRCD 4CLRA 2B1RA 4DXAA 3EVBA 3C24A 2A14A 2FZLA 2G1KA 4B71A 3L41A 4C29A 5CT5A 5IJ0A 1CQZA 3SZRA 4E46A 1DKOA 5HR5A 1XD9A 1KZ6A 4EEKA 3CEPB 4ZALA 1UEXC 2IXGA 4EG6A 5J63A 2ZCJA 1WDWB 4L27A 4N8EA 3FW1A 1FUUA 2G9QA 2XE8A 2XF8A 1C7FA 4C0KA 2ZTLA 2W48A 3U48A 3QY9A 4PWYA 1EGVB 3IUEA 3AEXA 4KPEC 2NNWB 1NRIA 3RABA 3U44B 3GA0A 4EKIA 3WWCA 5A3RA 3Q88A 3I3OA 1AGRA 3GGOA 4M0KA 5FLKA 5JZBA 4BECA 4MP6A 5A5GA 1IWBB 3CINA 5KPDA 2QTVA 4E5NA 4XD7D 1L4BA 1SUDA 2LP4Y 4G8CA 1AXEA 4X45A 4ZT6A 2VOJA 3D64A 4D9IA 2ZWMA 2XEXA 3WOHA 1GP2A 2RE8A 4LF6B 5B7GA 2I6TA 1C30B 2H54A 2A94A 3B3AA 3DDCA 1IPEA 3EF1A 4BU1A 1R18A 4ZMSA 1J56A 2D7JA 3K2QA 1YULA 2OPBA 2JLAA 4NE9A 4YQFA 2VPZA 3B1JA 4F46A 1FX1A 1SK8A 3F1KA 3OJLA 3H2ZA 4ACAA 1OBVA 3LC0A 3COPA 2DU8A 4LOKA 4LXXA 4E22A 2XMBA 2JBAA 3L7BA 1YR7A 3ZDCA 1JJIA 2OBFA 4KQWA 3D59A 3RFFA 3NWPA 4LRTB 1OV4A 1IQPA 3FDIA 3FVTA 1ZD3A 1CCWA 2K6GA 2XF2A 3EZ9A 1HEUA 4UATA 1UPAA 4ZT2A 3ZE6A 1EHYA 4CI0B 5H68A 2Y9PB 1PO7A 2IXDA 3OBBA 4MUYA 4YJ3F 1Z37A 3U4DA 2JHGA 3FMFA 2ZB8A 2PS3A 2EGGA 1ENZA 3K0HA 5L53A 1CXZA 1T5LA 3H5WA 3SSAA 3LZDA 4RTKA 2JVJA 4QU5A 4Y7DA 2CLIB 2HGSA 3GK3A 5TMDA 3TBKA 3T41A 4K03A 4YNBA 4WL0A 2OESA 4OBXA 2CLOB 4K9LA 4HO1X 3X1DA 4UUQA 3LUFA 4YXWD 4EW2A 1LQTA 4X3CA 1FNNA 2WKPA 3GF4A 3Q8KA 5I3ZA 3I9NA 1W19A 1N9GA 2GBPA 2NZ8A 4FKZA 4ZT4A 4GPEA 2WDZA 3JU3A 4LZWA 2ZBUA 1XL0A 1U2GC 2I7CA 2XW6A 1QIEA 3EA0A 4KWTA 2F48A 3GV0A 3MMXA 1G5PA 4UHHA 5BSFA 1CY0A 4GR4A 3INGA 3LH5A 2V59A 2B20A 2ERCA 5CFMA 2ZZMA 1II8A 3PU6A 4G0NA 2CUKA 3V7NA 5MGBA 4FTWA 1OA0A 2AIRA 1EAYA 2JKZA 3N2LA 4TLBA 4PYJA 5BORA 1S7GA 1XUOA 2A33A 5FWNA 3BQ9A 4MROA 4A15A 5B55A 1AGXA 4L3OA 4B75A 1ECBA 3BXEA 3BGDA 1QB8A 1NQVA 1U7ZA 2R11A 4L9RA 4OBBA 3MCVA 7YASA 1E2PA 2FGKA 4HPWA 2LDBA 2EW2A 2QWXA 3DV2A 2DHRA 2B8WA 2H4JA 5LNK1 3VU8A 2W22A 2BGLA 3BFXA 1NXXA 3CKMA 2WWRA 2XCSB 2AUTA 1QFZA 2ZUVA 2OD2A 1VE1A 1UXJA 3ITNA 4YI5A 5FPYA 3SIWA 4F4UA 2PKEA 1MOSA 2WG0A 3B48A 3QEMA 3VJMA 1JEYA 1Y63A 3NFYA 5CITA 3UWKA 1A9YA 1B14A 3NEJA 3SS7X 1LDGA 4AO8A 4V3BA 1A9TA 4WESB 4D42A 2IC5A 2VF4X 3MPUA 1C0LA 2ZR8A 4Q7JB 3BRWA 1JS1X 3DVRX 4II3A 3NW9A 5ARCA 3A3OA 3JCZA 3COWA 5DLEA 2FWIA 2C1XA 1PZHA 2VPPA 3N9IA 1O6GA 2D6FA 3ZWWA 5AHRA 5ELMA 4QPZA 3WTCA 1UCFA 1V96A 2DTDA 3DL4A 3FOCA 4MKIA 2P1RA 4Y7CA 1KERA 2PKQO 3C4JA 1KYZA 1Z13A 1RAIA 2DPGA 3OUZA 4D98A 5LQUA 2XVZA 3A1WA 5C2JB 3PL5A 4NYIQ 1LNSA 2HF8A 5JI3E 4LXGA 2C3UA 1X1DA 2ZIEA 4YMWA 1XCPA 2SKCA 3C7AA 3QGMA 4L5CA 1DJNA 2O1SA 4TTRA 5T4HA 4YRNA 1XRQA 5E6UB 2GZ1A 2QN6A 1PR6A 3GQVA 5KSYA 1U7WA 1HYBA 2L17A 3W6NA 4I4IA 3W2EA 9LDBA 3HJGA 4RIFA 4M21A 1N2ZA 3NHMA 4OHVA 3QLTA 1UADA 2RC6A 4H6XA 1CV2A 4IUDS 4XCXA 4EF6A 2OT3B 3DTVD 2O57A 4EG8A 3I45A 4I4LA 4YJHB 2ZYRA 4J2HA 4EB0A 5JNLA 2XRZA 2PEZA 4C04A 4K5QA