5DHAA

Crystal structure of cpeb4 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
206
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 59
structure length 206
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhaA00
2ZSBA 3CRMA 1V43A 4YDSA 1IY1A 4M9ZA 1R4AA 1GKYA 1OXUA 4Q1AA 3UMSA 5KTYA 2EFEB 3MRSA 3HYTA 3KFXA 4HDCA 3I72A 3CNNA 2OXRA 4YMUA 3QKSB 5KU1A 2VP6A 3VKWA 3W6NA 3BC1A 4OJKA 2DFKB 3X2SA 1SVKA 3ZZTA 3E5HA 3IBGA 3TUJC 3PJRA 5FR1A 1NVXQ 1W44A 1KNQA 1GKIA 3KTAB 3CF0A 2VP5A 1M7BA 4TZ6A 2YC2C 5TARA 3WXMA 1L8QA 2GEUA 2GJAA 3B9PA 3PEVA 4IOLA 3K0SA 4US2R 4DDWA 4X8MA 1EK0A 3UWOA 1XZPA 1MH1A 2WJHA 3ICEA 4MDEA 4EPYA 2ONKA 4BQSA 1J8YF 2ZRJA 4Q48A 1HTWA 2ZR7A 4AIIA 2YOGA 3BRWD 4DB4A 3L43A 4QBFA 4ZI3A 1EFUA 2BBWA 2Z0MA 3TAUA 2QORA 2WSSD 4RZ2A 3FMFA 2H18A 2D7DA 4Q02A 1YZLA 3WP1B 1S96A 4MYCA 5AUOB 2QU8A 4URZR 5FUVA 4E22A 2F3RA 3HU3A 4EPWA 2QAGC 2NGRA 3B1YA 1FUKA 1OXXK 1JI0A 1UEIA 1NF3A 2ZE8A 2ZYUX 4DDVA 2H57A 1WF3A 4RD2A 721PA 4DC9A 1ZM4A 3DM5A 5AJYA 1A1VA 1XJ0A 3K70C 1UJ2A 3RRNA 2ODNA 2VSOA 2ECKA 4RFVA 1Q20A 2VP9A 3ND8A 4XIGS 5EP2A 3S1AA 1FP6A 4GFDA 4DLTA 4URXR 5H8WA 3C16C 2Q9AA 5FPSA 1TQ6A 2QMHA 1E9FA 4I99A 1RFLA 2RB4A 2GNOA 2HCBA 2ZJYA 5HZHA 2JATA 1MO4A 3GFPA 5CJ2A 1PUIA 4Q4AB 3PUWA 1HE8B 1PVOA 3K9HA 1OFHA 2W6JD 1Z0AA 1KY2A 2GAOA 2QA5A 4G5OA 3K8YA 2FDCA 1VHLA 4CW7A 3OFNA 4PSKA 4OHWA 2VQSA 3U3JA 1JEEA 2YHSA 4XSHA 2YWHA 3V00A 3DL0A 4DLXA 5AUPB 3WP0A 3CO5A 3VX3A 2X1VA 1R0YA 3QG1A 1ZC3A 2IS4A 1QHYA 4U02A 4KBGA 4KU4A 1PJRA 1G291 4LJYA 1FZQA 1D2EA 3GJ4A 5TB5A 2ZJAA 5HCNA 4URVR 5JEEA 1OFTA 1E94E 4G5RA 1TAGA 2FGJA 2IXEA 3SI7A 2QN6A 2P2LA 4YXWD 3A1VA 3T5GA 5IK2A 2QG6A 1IJFA 1G3UA 1PUJA 3ICQB 3QF4B 3EZ2A 2QQ0A 2CK3D 2OESA 3P4YA 3TW8B 1G3MA 3Q85A 2OO7A 1IXZA 1ZJ6A 1E2NA 1ZP6A 2VP2A 1H8EA 1AS0A 2GKSA 2IL1A 4Q66C 3O8RA 1JQJC 1YJ5A 1Z08A 2ASEA 2JJ1D 2AWNA 1VCIA 1Z8FA 2ZRAA 1GFIA 1KJWA 3GP8A 1OB5A 3CRQA 5B30A 2OZEA 4QFMA 5B58C 5IRCD 3OIWA 2KI5A 1J99A 1EFHA 4HUTA 3PCRB 4HEJA 4TMTA 1T3HA 1E1QD 2D2FA 3LW8A 1L2TA 4BRUA 3VU9B 1NY6A 2ZAOA 3DPUA 4QKQA 4NP6A 1SVLA 1Z6YA 5L3VA 1MABB 3E1SA 3MD0A 4LJ6A 3QSYA 1W5SA 1W47A 2PZEA 5A0FA 5SZJA 4UXHA 3OIYA 4KFSA 1GRQA 3ND9A 3U3KA 3B9QA 2QM8A 4L4UA 4QJ3A 1T3SA 4B6FA 4PC2A 2IXGA 3VHXA 4Q1CA 4A0FA 3TJZA 1FOEB 3AVOA 4LI0A 4XD7A 3KJGA 4LC1A 2XITA 2UZIR 4GOJA 4OI1A 5C1BA 1RYHA 2XB2A 4ZCLA 2CXXA 3LXXA 3T12A 3NHBA 1FNNA 2ZI9A 1NI3A 5FH9A 3BH0A 3OHMA 4W5JA 3A4MA 1MRNA 3RC3A 1E98A 1ZD1A 4Q9KA 3WNCA 1KI6A 3DZDA 2EWWA 2F7SA 2IWHA 4KVAA 1DAKA 4DZZA 3FB4A 4LUCA 3W90A 1XNJA 4M9QA 5EE3A 3A1TA 4V0ME 1T9HA 1UBFA 1GITA 3TVTA 5JRZA 3FOZA 1KDPA 1A5TA 3RSOA 2WWGA 4PR0A 4IDNA 3UWKA 1P75A 3AUXA 2A9KA 3FHCB 3D7MA 2CVFA 1DVRA 3SC3A 3EA0A 2WKRA 3I8SA 4WZBE 4JL6A 4DLVA 2JLYA 2Z83A 1HURA 1XZQA 4TL6A 2OCAA 2RHDA 1S0UA 1T91A 3MCAA 3CONA 4MQBA 2ZI6A 4FMDB 1HH4A 4JLAA 1RVDA 2AL7A 4C9BA 1IN5A 5HKKA 1EWRA 3QEOA 4BPBA 1QHHA 1Z06A 1W0JA 2IYXA 4HB3A 1N6OA 3T1TA 1XCGB 1ZCBA 3UXMA 3WRYC 2J9RA 1CIPA 2IEZA 1CR1A 4PAQA 4WBSA 3ECCA 2GZHA 3A4NA 1JNYA 1II9A 2FOLA 3W6OA 2PJRA 3RC8A 2DFTA 4MDFA 3SOPA 1DS6A 2ZI7A 1ZNZA 2FNAA 5DGXA 4Z51A 1UADA 1YZQA 4FMBB 4ZKDA 3LLUA 5AUQA 4Q9HA 2O52A 1CJMA 3QJYA 2PJZA 3DOEA 4XWOA 5C2JB 5LD2C 4BLPA 2J41A 4PZYA 2ZVPX 2OFOA 4MGIR 1N5LA 1T3LA 2C78A 2O0JA 4Q5IA 4A1FA 5BXQC 3AVXA 4IHQA 1COWD 1BMFD 3VKGA 2QY9A 4R98A 1P7CA 1K5GA 2ZAMA 5J5CA 2ZI3A 1R5NA 3EC2A 1RYFA 1U94A 2F3TA 4B47A 5CB8A 1OJLA 2QQEA 2XTZA 1U8ZA 1NLFA 5GJWC 4KYUA 1ANKA 1GRNA 3CX8A 4MUAA 1BYUA 3KQLA 4ON9A 3IEVA 1M7GA 3WYFA 2W2VA 3GLGE 1E4YA 3E70C 3PR1A 3VFDA 4Q9JA 3ZQJA 1YR7A 3A8TA 4DSUA 3AGPA 3U7FB 2MSCB 4ASUD 3RS3A 1JJ7A 1PLJA 5H70A 3KB1A 4F7WA 4LV5B 4TMWA 1AKYA 4YMVA 1Q22A 4CT5A 1S9HA 1ETUA 4ITRC 4L9SA 3TR0A 4C0SA 2WOJA 1P9WA 3GLHE 4XTRA 2O8EB 1QHNA 1QVRA 2P6RA 2QTFA 1CBUA 2GA8A 4XWAA 1XD9A 3BB4A 2ZE7A 4PAMA 2ZJZA 2C2HA 4D4MA 3ZVMA 2O0HA 2VPPA 4GPTA 4HAWA 2GEDA 2PZFA 2Q3MA 4H1UA 4LYHA 3RANA 2ZJOA 4QGHA 3DOFA 4LZZA 3OEHD 4OQNA 2ZE6A 3T1QA 2BV3A 2BWJA 2BIFA 4LHWA 4Q1FA 4KBFA 4C2TA 3IHWA 4LBYA 4HB0A 1VPLA 1Z0KA 2GTPA 4V0MA 1I2MA 5EXXA 3ZS9A 4CEJB 1J2JA 1NIJA 4C0JA 4MKGA 5KPJA 4BUJA 2IYWA 2AX4A 5IK2D 3A6PC 1OT3A 3D6TB 3LW7A 5HPYB 3Q8XB 2XGJA 1GL7A 1FUUA 4KSBA 2P6UA 4LYFA 2C77A 2HDNB 1N3BA 3OESA 3WNBA 4QHTA 3NBXX 3VQTA 1IJEA 4ERNA 4JT2A 3VNUA 4EFMA 3EZ7A 3AF2A 5CLQA 4EKDA 4BLRA 4J0QA 1G7SA 3ZVRA 1GNPA 4LV6A 1E2HA 3TIFA 5JRJA 1KNXA 2IHYA 5E7IA 4PQRA 1J70A 4YLGA 1G21E 3RSLA 2EWVA 2GXQA 3SEAA 3T06B 3B2EA 1CULC 2P6NA 4OYHA 1SQ5A 4CRWB 4DLRA 1LTQA 2QT0A 1KI7A 3I8XA 3THYA 1VMAA 3SHFA 2CNWD 4NYJQ 3BS4A 2XTNA 4URUR 4P3YA 1OYWA 1D6JA 4FCWA 1N5IA 2F1RA 5J4LA 2E9SA 4JSTA 1E9EA 4ZDIA 4Q03A 3QENA 5C46F 2QTHA 1U81A 4HAXA 4TMXA 3ZZ0A 1NJGA 3M4YA 4MYHA 2GZDA 5H68A 2PMKA 1FTSA 1ZM9A 2PX3A 2GRJA 2YZ2A 3AV0B 1KY3A 3MAAC 1GUAA 5LDDC 2XXAA 5EE1A 1M1YE 2ZRMA 1Y3AA 1AA9A 1X3SA 1N5JA 2UVQA 2V8OA 3PFIA 5JSZB 2GJ8A 3KXIA 1KHTA 3TQFA 3L82B 3U44A 3ZD6A 1NN1A 1E0JA 5J4HA 3CH4B 2IS6A 4X8OA 2IW3A 3H1TA 3KQHA 2Z4RA 2I1VB 2SHKA 3AF3A 2Q21A 3AF0A 3B1VA 1N2CE 5BWMA 2CLCX 1E1RA 2H17A 4D4JA 1JR6A 1G4AE 2HV8A 1Q0UA 3GMTA 4DJTA 5KNBA 5KPDA 1ZMXA 4EDHA 3RS0A 4NDZA 1GRRA 3C14C 4JVNA 4KODA 1LF5A 5EE5B 5FI0B 4TL8A 3TUZC 3FMIA 4B3XA 4ZIRA 2TMKA 2WZQA 2JJ1A 5KSPA 3SZRA 2ERXA 4HZUB 2FFHA 3GJ3A 3IO3A 2IS2A 2QI9C 4DXAA 3BBPA 2WOOA 3CPHA 4ZIRB 1E1RD 2WAXA 2GXUA 2C99A 1EG7A 3LQRA 4QJ5A 3REFA 2ZM5A 2CCJA 1R8QA 1AN0A 3KTAA 4K46A 1JR3E 4DLUA 4I81A 2IUSA 4A2WA 4W5HA 3K53A 5KSOA 4NE2A 3T35A 2QRZA 4QOSA 4B2IA 2I4IA 1JQLB 4PO9A 1EXMA 2WJVA 4GZLA 3CRW1 3FMPB 4NBSA 5CYOA 3R9IA 3B1WA 1NBMA 3X1XA 1XD2B 3LRPA 2ONJA 4CZ2A 3ZZUA 4C0LA 1XJQA 1S9DA 2WIBA 3LA6A 4NCJA 4XH9B 3R9WA 4QM6A 3HR7A 3CX6A 5KDLA 4OQXA 5HZKA 4YMWA 1KI2A 3NH9A 5IDVA 5JCPA 1ZCAA 2I1QA 4JT4A 3VR4A 2VA8A 2J7PA 1P2UA 4BE7B 5EJEA 1GM5A 1GSIA 1U9IA 1F2UB 3HU1A 2Q3HA 2JDIA 3W5JA 1AJEA 4M9SA 2IK8A 2ZIAA 2B8TA 1P3JA 2Z43A 5JFGA 3R7WA 4GMXA 5ELXA 4Q18A 4XWKA 4QBIA 4JVMA 3BJIC 2EFGA 5DHAA 4WW0A 3SHWA 1SHZA 4XVQA 1ZYUA 5B64A 4MYUA 1Z2AA 2ZE5A 5FOVA 4EJSC 3PEYA 2R65A 2XOKD 3AP3A 4BLSA 4DEYA 1GTVA 3WYAA 1XEFA 4ZDJA 5LBIA 2CHVA 3H2YA 2OFXA 1NMYA 2RGXA 4IDOA 3KDSE 1PV4A 4BFYA 2W0SA 2D62A 3KQKA 2WMOB 1E9CA 2Z5FA 3R8FA 1E99A 2FEOA 1VHTA 2BEJA 4JLKA 2WHXA 3SYNA 2WSSA 4L5BA 2XB4A 3NHAA 2NO9A 1WCV1 2EVWX 1M74A 3TBKA 1TX4B 2OCPA 2OV2A 1OXTA 3LLMA 3RS7A 4TL9A 4Q1DA 5DN6D 4C7OB 2C8VA 2XX3A 1E2PA 1NY5A 4V0NA 1NNEA 1I4DD 1N6HA 1F3OA 2AR7A 3IEUA 1DAHA 1Z22A 2ANCA 3UK6A 3LBIA 2V1UA 3QXSA 2W6ID 4B76A 1OFUX 3R7WB 3VNVA 4AURA 2A5GA 1JPNA 1N0UA 4ILEA 3KKOA 3U4QB 1XF9A 2GCNA 1DAFA 3MUFA 2JLSA 3VTKA 5K8UA 1P2VA 2IC5A 3GLGB 4V02A 1Z0JA 4PZLA 4RKFA 1G1MA 1WP9A 5KDDA 2XOKA 3D8BA 1P60A 1ZIOA 3O8CA 1N25A 2RGNC 4RZ3A 5IT5A 2FEMA 1SZPA 3PG5A 1GAJA 3KFVA 2R6DA 2BCJQ 4B3CA 2ZXUA 1ZUHA 1IY0A 3VR2A 1R5OA 2J7KA 3QG5A 3TNFA 4QGAA 4MITA 4NCKA 3L8YA 2RGEA 2ZRIA 4C30A 5JMTA 1HT2E 4D2IA 4A8JC 2BKEA 5FL7A 5CIWA 1BS1A 2FSIA 2J87A 2YOHA 2FFBA 4D0LB 2FSFA 1T6NA 1E0SA 3EPLA 1KI8A 4JL5A 4MGKR 1XD2A 1UEJA 3PXGA 3TR5A 2B6HA 2QBYB 4R2HA 4BLQA 3DDCA 5FPYA 2ZR9A 2X2FA 3UKDA 1D2MA 1IBRA 2AWOA 1GKUB 5L3SB 1JPJA 1XJCA 4QM7A 5JWHA 2HUPA 3C15C 2BJWA 1KJZA 4KHZA 1VECA 4HAUA 1G64A 3TKLA 4F4CA 4QGGA 4QHYA 2V55B 4YC7A 3LAWA 4JKIA 3LNCA 1ZIPA 3V9PA 4PC3A 4F4JA 3L8ZA 1G8FA 1AGPA 1G8YA 2FE4A 3NBFA 5K8TA 3IO5A 4RD0A 1RZ3A 2GK6A 1ELOA 2W83A 3OEHA 4C0HA 3RS2A 1IN8A 1KMHA 4YMSA 1W49A 2P5TB 1EX6A 1VCOA 2A7QA 3AVTA 4GP7A 3SJBA 3CPJB 5BN4A 2FGKA 3Q9LA 3B7GA 2CMKA 3V4RA 1K6MA 3BIFA 3A58B 4NYIR 4E09A 3K09A 4A15A 1SXJA 2ZRCA 2FSHA 2FPKA 2Q9CA 1HYQA 1E2IA 4XTCS 4V03A 2QBYA 5JLJA 3AVWA 1W0KD 3SN6A 2J3EA 1G41A 1L4YA 5BYKA 5EP1A 3CB4A 3LO5A 2ZETA 3U3OA 1XD8A 2V7QA 4M2LA 1G8PA 2HJGA 4DCSA 3EIEA 3GLIA 3MMPA 1AM4D 2R9VA 3UG7A 4OJQA 1KOFA 4Z8YA 4B75A 3EIHA 4PSVA 2ZVQX 2BBTA 4Q4HB 3THWB 4BZPA 3MWKA 2IYZA 1F60A 4EQ6A 2G0NA 1P9RA 5G3ZA 5A4JA 1RJ9A 5K8LA 4LYAA 2ZUDA 4B33A 4M1YA 5DHFA 1NG9A 3K70D 4QXAA 4B3BA 4B73A 2J0QA 1UAAA 2O8DB 4JLOA 1G5TA 1AS2A 1SVSA 2QP4A 1EWQA 4QJ4A 4P31A 2ZRKA 3T15A 4AK9A 3U6KA 1RJ9B 2E1RA 2C9CA 4B43A 2W58A 1Z83A 4HUQA 4TYPA 1ZAKA 2WVJA 4AI6A 5E3HA 1CS4C 5KNDA 3SYKA 4HB2A 3M6AA 1QF9A 1HE1C 1Z29A 1WRBA 3EX7C 1X1RA 2PMDA 4IJMA 1D9ZA 2OT3B 1W48A 3LWNA 1RRPA 3JZAA 4NCNA 4RD6A 4NPHA 1KI9A 3OF5A 1CR4A 5CB6A 4LBZA 1XTIA 3BK7A 4Q1BA 2PX0A 2VF7A 5HE8A 2BDTA 1UM8A 3QEJA 2QNRA 5JWRA 4PPGA 2GVDC 3NC0C 5DSZA 4DT1B 4ZV4A 4XSGA 4L8GA 4NCIA 3DMNA 1DO2A 3EPJA 3RNLA 4JIMA 2LKCA 2YV5A 3A37A 1FMLA 3OFND 4W7SA 4NMMA 1D8TA 1CEEA 3JVVA 1IN7A 3MG9A 4LWZA 3B78A 4C3ZA 4GL2A 2BJVA 4P0TA 2DYKA 3CIOA 4Z8XA 1N0VC 1KO8A 3CUEF 1F2TA 5GADl 2J0UA 3K0AA 3SU8A 4B44A 1XMIA 1S8FA 5L3RA 4H9GA 2ZPTX 221PA 4WIAA 5A5GA 2IA5A 2QENA 4L16A 1E2KA 4FCTA 4MYTA 1YQTA 2WPDA 3SJCA 3A36A 2RH5A 4B48A 5CIQA 3J81k 1YE8A 4IFEA 4OQFA 2GF9A 4FD2A 4TSFD 2BMFA 2KJQA 3ZH9B 4RJLA 5KSZA 2BMDA 1E79D 1OHHA 1HEIA 2ZRPA 3WYGA 1DELA 2H16A 2ZI4A 3AVPA 1MO5A 2YOFA 3IBYA 5DI9A 4AYXA 4D80A 4KITB 5DI3B 1UFQA 4OL0A 1HA3A 4PO8A 3B85A 1XWIA 3CR7A 2GDJA 2VO1A 3SE0A 4BLTA 1EX7A 1CJUC 1CJVC 3NEJA 121PA 5CDFA 1YRBA 4BASA 3TQCA 1Y63A 2V3CC 5EP3A 2VTKA 4PSAA 3VHLB 1Z28A 3U7GA 2E87A 3IPXA 3PVSA 4KLZA 1G6OA 4Q7MB 1TPZA 1KKLA 3ZIAA 3GLIE 3VR1A 1SULA 2V4ZA 2CHQA 2WTUA 1DAEA 1G8GA 1II0A 3EC1A 8OHMA 1NMXA 1CRQA 3HDTA 1QZXA 1KKMA 1QRAA 2GCPA 2R6AA 4OK3A 2QM7A 3UPUA 2EFHB 3BWDD 4EAQA 4CEIA 1W4CA 1J8MF 1E2DA 2QAGB 4I1UA 4KLNA 3IIJA 4NHOA 4UQOA 4PC1A 4D0NA 1OLOA 2FWRA 2O8CA 4G0NA 1LFDB 5FL3A 1GILA 4EQ6B 2G3YA 4HDOB 5GVRA 2ORWA 2H1LA 2QZ4A 3RWMB 2REBA 3RWOA 3GJ5A 1MO3A 1JAIA 2Z4SA 2IYRA 4B35A 3OEEA 2QPOA 3UATA 1MKYA 4Q19A 1NVWQ 3RVBA 3ZDQA 3M0EA 5CM9C 1GL6A 2GWHA 2OBNA 4HLCA 2G83A 1RRCA 1G3IA 4URWR 1KDRA 2PLRA 3QF7A 3CRVA 2A5JA 4GSYA 6Q21A 4MRVA 3RHFA 4QG7A 3L0IB 4LHVA 2OBLA 2WIAA 3WBKA 3H84A 4FW9A 2QROA 4P4TA 5FL7D 1U98A 3U7HB 3VMFA 2XZLA 1Q1QA 4HI0E 3HYRA 4JS0A 5P21A 2HT6A 4ARZB 1OF1A 1QBKC 3TVDA 1OE0A 4BFUA 1XU4A 5C18A 4RZUA 3T5DA 1SGWA 1ZM2A 4HLQB 2ZI5A 2J45A 2ZQ5A 4CDGA 1UBEA 3AF4A 4N0DA 1VIAA 5GJBA 4S2EA 1ZM7A 2JEOA 3OAAD 3WNDA 3DEFA 2O8CB 1P62B 1TUIA 4TYYA 4JLBA 1EGAA 4OKSA 3NC1C 1VIYA 1WXQA 1XEXA 4QBGB 2OCYC 4AD8A 5DNYB 3LBNA 3NG1A 1WBDA 1UBGA 3CZQA 3O47A 5DIFA 3DVLA 1FL9A 3KKPA 4AG6A 3K0CC 4JBYA 1BYIA 2YNMA 1ZNYA 2A2ZA 1NP6A 2RGCA 2R6FA 4XVRA 4HAVA 4UXIA 4DWJA 4S35A 4MA4A 2HXSA 5DH9A 4TN1A 3RS5A 5CM8B 5FI1B 4F4IA 4M22A 4V0KA 2FPLA 3DKPA 3NH6A 5CDFE 4Z1MA 2CNWA 1R0XA 3FFAA 5JSZA 4X8HA 3VR3A 3X1ZA 4UJ3A 1EESA 2GXSA 2X19A 4MH0R 4M4SA 3E2IA 1S1CA 4TLBA 3G82C 4GNKA 2DFLA 1NKTA 1M6NA 2FN4A 4Q21A 1QVAA 4BZQA 4UNSA 1QHIA 4ZPXA 3W5IA 4P33A 4BEBA 1ZC4A 2ZRLA 2WPDD 3IILA 1ZNXA 2A3RA 5AR1A 2QEQA 1KO7A 1U9IC 2QAJA 3QXJA 1TTTA 5F3WB 5EE9A 4EUNA 5FUXA 2CCGA 2F9LA 2PEYA 4OK5A 3PITA 2QMUA 1NJFA 4KAXA 521PA 4DLYA 1BIFA 1NBMD 4KFTA 1X1SA 3F3YA 3CF2A 2JJ2A 421PA 1E69A 3N2IA 4BFTA 3BB3A 1AKEA 4WAUA 3SFVA 4UNPA 1YZTA 4W5WA 3QQ5A 3KQUA 2GCOB 4LX0A 1DG3A 3IPYA 1WB9A 1KO4A 4AKEA 2P65A 2BHRA 1TQ2A 3R9XA 1JXMA 3EXAA 2JLWA 1SHKA 3AP2A 4FMCB 1KSFX 1Z6GA 2BMEA 1RE0A 2WJGA 2JLZA 4WA7A 5DO9A 2MSEB 3W8NA 3THXA 1HT1E 4N1AA 5FOWA 4MRNA 1DAMA 1K5DA 1XTQA 4OI2A 2ZEJA 4P4SA 4AY2A 2EU8A 3SYLA 2VL7A 3QKRA 3QPUA 4BWYA 1CR0A 1E3MA 1ZINA 5AJWA 4KYIB 1XPRA 1H65A 2IYVA 1P5ZB 2J0UB 3K0AB 1FTNA 2ZRDA 5D3QA 2PH1A 2WWIA 2QRNA 4IFBA 3W34A 3WHKA 2CL0X 1HUQA 3SQXA 3Q7PA 4LHXA 4TMZA 3UIEA 2ZRHA 3EZ6A 5C4GB 1X8LA 2QE7A 4HLDA 4OHXA 1VG1A 2BKUA 2HLDA 4BFSA 2R6GA 3DZ8A 4DDTA 1A7JA 3GJXC 3I92A 3AUYA 1OIVA 3PUYA 3T34A 4IDQA 3AKDA 1XB2A 3QF4A 3CZPA 5CYPA 4V0LA 2G1JA 1WMSA 3B82A 4NZYA 1MRSA 1S4QA 1ZBDA 3PEUA 2NO0A 2ZYTX 4C0KA 4TQAA 3C7KA 4D25A 2F43A 2WSMA 4TSFA 5TVKA 2A5DA 2CE7A 1R6BX 1RRGA 2NQ2C 3ZVNA 3HJNA 3ZGXA 1DO0A 4D26A 4LJ5A 3ZVLA 2ZSEA 1OV4A 3C8UA 4TQUS 4B71A 2FJUA 1R5BA 1G18A 1NN5A 4M1KA 1R7RA 3ADCA 5HR5A 2HCJB 1ZU4A 2WM9B 5DE3A 3THOA 2VYFA 2YKGA 1MOZA 1X8JA 2ODEA 2QPAA 3ETLA 3PUZA 2JLUA 4ABYA 2OLJA 1DE0A 3GLHB 1P61B 2F43B 1YKSA 2X8AA 2L0XA 1DEKA 5FTLA 2H7VA 1T5IA 1H8HA 2J5XA 2PCJA 2PEZA 4TTPA 5FOXA 2H92A 2QUZA 1QHXA 1JECA 2HJVA 4BRWA 4L15A 2IXFA 3GLHA 3RDPA 4RSGA 3T1OA 4IXMA 4OK6A 2XAUA 4RD3A 3HU2A 1PZNA 3W6PA 4A4DA 2DR3A 4D6PA 2NZ8A 3KJIA 4KI0A 3ZLJA 5GJCA 4D4LA 1IXRC 2B7CA 2ZYWX 4GDFA 4O2RA 5CJPA 1BOFA 1SXJE 5FBVB 1MO6A 3PV0A 2R8RA 4EJSB 1PLKA 5JI3E 4MKHA 2ZSFA 1YHNA 2Y8EA 1S3GA 1Z6TA 2JASA 4R9UC 3W3AA 1KMHB 1YRAA 1B23P 1TF2A 1Z3IX 1VCNA 2D7CA 621PA 1G20E 1OSNA 4DCTA 2FPMA 2XNDA 4EFNA 1G6HA 3I62A 1IAQA 2F6RA 2ZUCA 1NVUQ 4JLDA 3GLFA 3U44B 3BB1A 1LNZA 3X1YA 4LV8B 3NBYC 5CK5A 2DFNA 4U00A 4LY6A 4QC2A 1JR3D 1UF9A 4YQFA 3FDIA 4IDPA 1LV7A 1NN3A 4R7ZA 3QVVA 3FKSD 4LK2A 3REGA 1NRJB 1KDTA 2B8WA 3FFBA 1CXZA 2DB3A 2G6BA 4DSTA 3QVUA 3BD9A 2I3BA 2O8FB 3EG5A 3CR8A 1YZKA 2O0KA 1WDTA 2XZPA 1FX0A 4TT3A 1BO6A 4AYTA 1TMKA 2X2EA 3MLEA 2OAP1 3DHWC 3I3SR 5AJVB 3GJ7A 1OKKD 2OE2A 2WJYA 2VSFA 5BN5A 2KB0A 2RGAA 4BEJA 4AKIA 1W0KA 4IVPA 4LJ4A 1DBSA 2AFIE 4TLAA 4F91B 1W5TA 3P20A 2ORIA 2NPFA 1T8TA 1E0KA 3BOSA 1UKVY 1KI3A 1Q21A 3C5CA 2W6IA 4OI0A 821PA 5G53C 3G0HA 1U8YA 2OUKA 1Z0FA 5J4YA 4JLPA 2RGBA 3K0FB 1D5CA 2IYLD 2JIZD 4M1MA 2FMXA 3BH7A 3U3MA 2VHTA 1II8A 3LD9A 2BC9A 3Q5EA 4GOKA 4M1SA 4M9XA 4BFXA 1QHSA 3A1SA 2DWQA 3GFTA 1SVMA 1YR6A 1Z0DA 3MWYW 4A8JA 1XMJA 1I2DA 3CW2A 3MJHA 5EXTA 1R0WA 1W4AA 5TXGA 3LQQA 2XXAB 2CL6X 1AS3A 4K81B 4LC0A 1N6NA 2FZ4A 2ZRFA 1XPUA 4HAZA 4A2QA 1Z5ZA 3EW9A 2G77B 2QPTA 5L3QA 2OHFA 3CM0A 2GK7A 3LVRE 3MSXA 4C0BA 1GNQA 5UKDA 1QG2A 2MSDB 4LYJA 4ESVA 2C04A 2W2XA 4G5SA 2ZYVX 3QKSA 2RHMA 1O3YA 3LXRA 3ONWA 4MKIA 4PO1A 5AUNB 1R8SA 3G5UA 2O8EA 2VHJA 2QGZA 1NVVQ 1ZU5A 1TEVA 1UKYA 3K9LA 3H4MA 2PT5A 4HLUA 3QKUA 1VYUA 3AKCA 4PQYA 3RS4A 3SS8A 3AGQA 2WKPA 4TQ9A 4Q4HA 1BKDR 5BN3A 3NBZC 1OH8A 4Y0AA 3GEHA 3CF6R 2IWRA 3KJEA 4AYWA 2J7PD 2FFAA 1NL3A 4KO8A 4MUBA 2BVNA 2KWIA 3RABA 4PTLA 4JL8A 4LJAA 5LB4A 1KI1A 1IY2A 1T0JB 4JLMA 4TWZA 1DARA 3ZQ6A 3QXHA 2JAQA 1G9XA 3UG6A 3LH5A 2AKAB 2BM1A 2JCSA 2IYYA 2GEVA 1L7VC 1XTKA 4FXPA 4D82A 4ZCMA 2FU5C 3JZMA 4Q01A 3SBEA 1NKSA 5FOSA 1H8ED 3BERA 2ZU0C 4NKRA 1N6LA 2KBEA 3R8CA 2D2EA 1UKEA 2OM2A 5FTJA 4HAYA 3QIAA 4DIEA 3RLFA 1ZM3A 5GVSA 4DSOA 5DYGA 1GVNB 3KKQA 3SNHA 2QL6A 1VCMA 4A8JB 4PX9A 3FPAA 2BMJA 3NDPA 5GJVC 1KAGA 1XCMA 3QUSA 3SJZA 5JS8A 4UNNA 1N6IA 3LDAA 4ZCIA 4AKGA 4GBMA 3FVQA 3QY0A 1LS1A 4RCYA 1U0HC 3KZ1E 5JJLA 2CK3A 4OQLA 4JSYA 2FZLA 1CR2A 3EPHA 2D3WA 3OZXA 4GOXA 3SJAA 4ZI2A 2C96A 4P4SB 2NO1A 2OILA 1Q1ZA 5KSYA 3CPEA 1IHUA 3S1AB 5FPKA 4EIWA 2LKDA 3CBQA 5E95A 1E2JA 3GJ0A 2JJ2D 3DKVA 3I73A 2IF2A 4IOJA 3TE6A 5FPHA 4WZAE 1XPOA 5B2ZA 1FX0B 2EYQA 1F5NA 5EE0A 4EPVA 4N3NA 3LFUA 3W8RA 2Z6VA 3B1XA 5AJZA 2V54A 2VHUA 1G17A 2DWPA 2HYDA 4YXWA 3U6BA 3GJ6A 1W1WA 3L0PA 3UMFA 4ZKEA 4NL4H 3TSWA 1RPZA 4UJ5A 5TV2A 3QXCA 1XTRA 1FNMA 4MGZR 3O8BA 2YJTD 4EFLA 1K8RA 1ZUIA 2JJ8A 4URYR 2CLDX 1A4RA 1UPTA 1RRFA 2ZITA 3N70A 1N6KA 2GF0A 3BORA 4LHZA 2Q6TA 1NMZA 1OYYA 4LJ8A 1KSHA 3TUIC 5FTMA 3GQBA 3THXB 4D81A 1MT0A 3N5CA 1S3SA 1QHHB 2PBRA 1U99A 4A2PA 1CF4A 3A1WA 4BFZA 5JCZA 5IF9A 1EFCA 3QPVA 1XXHE 2IYUA 4CYMA 2XJ4A 5SZHB 2A5FA 4U7DA 3CLVA 1NSFA 3L2OB 2FFQA 1UKZA 4KCGA 4JMPA 3KXKA 4RFSA 5FOUA 1R10A 2WWXA 3THYB 5KHOC 2DWOA 4Q9IA 3ZIAD 1TUEA 2WICA 1W36D 3GLFB 3AQ4A 3HR8A 1Z6XA 3QPWA 3T61A 5F98A 1U2RA 2OSBA 5BYJA 5ANRB 2ZTSA 1Q3TA 4I1OA 4KFRA 5G3YA 4KFUA 1QG4A 1MABA 1IXSB 1WBBA 1LVGA 4O3MA 2R62A 2ZSDA 4TT3D 1EFTA 2FF7A 3K70B 3Q3JB 1XXHA 3H0KA 2NG1A 5DLQC 5H1YA 5IHPA 3HP1A 3TH5A 4A36A 1OHHD 2C95A 1UBCA 1Z0IA 3PEWA 1ONBA 2DBYA 2NTYC 1G5PA 4FWIB 1U0LA 2AN9A 5FOTA 4CEHA 5TMPA 4Q7LA 4A0GA 4WOPA 5L8VA 2P5SA 4LDJA 3SDZA 2X77A 1Q1BA 4MRSA 1OH5A 1E0AA 1E9RA 4H1VA 2UZ3A 4JKYA 4C2UA 4DLSA 1KK1A 3BFKA 1OIXA 1B0UA 3ZS8A 4IOKA 2FH5B 3IQWA 1YZGA 3TGPA 1OPXA 1XMVA 3FE2A 3ZYCA 3K0EA 2ZU6A 2YVUA 3X1DA 4OHVA 4F38A 4GT1A 5JHHB 4LGMA 2CE2X 4LRWA 2IT1A 1JB1A 1KK0A 1WA5A 4QBHA 4B3DA 3A1UA 1T4GA 4LBWA 2BOVA 3EWAA 5C4MA 3DM9B 4BGDA 3KB2A 1W4RA 1T0HB 2NOAA 2PLFA 1TF5A 1ESMA 2GHIA 2GBLC 2V1XA 2Q0HA 4PHHA 2IUUA 4A92A 3TAHA 4E03A 4LJ7A 2J0SA 2HF9A 4UXJA 2IS1A 3HWSA 4OHZA 4GI7A 5FBWB 3Q5DA 1OB2A 1J90A 4RZXA 4ESHA 1EFRD 2NZJA 2RMKA 4LPKA 4CIDA 4D4KA 2QE7D 3WY9A 1C9KA 4C0QC 1E96A 5FUYA 4E5UA 1XBTA 2QP9X 1XDBA 3IGFA 5CLLA 5E4FA 1SXJD 1NSTA 3Q72A 2CL7X 3CWZA 4QNRA 2HYIC 3ZD7A 1E4VA 3FYHA 2REXB 1XFAA 5CK4A 3GPLA 1T5LA 2VIIA 2IYSA 4OQMA 4QHSA 5D3MA 2GBLA 5F9HA 2AHOA 1KI4A 4FMDF 1NVVR 3OE7D 2K5UA 4Q9LA 2WWHA 1ZNWA 4WZ6A 3ADDA 5HTKA 5JBQA 3F5FA 5G40A 2VLIA 5E7MA 2N46A 1FW6A 3QKRB 3EAQA 1G4UR 1HY3A 2AK3A 5AJXA 4TLDA 1Q12A 1E9AA 4PPQA 5FR2A 1ZD9A 3AVUA 5BW8A 2EW1A 2WV9A 4M1OA 2Q9BA 2HT1A 1GIAA 1GG2A 2GJ9A 1HV8A 2FA9A 4C0AC 4IOMA 1KI6B 1VDZA 1MR3F 2O8BA 2JA1A 4JVSB 5DI3A 4ZO4A 5FBQB 2FG5A 4FWTA 4OHYA 1YR8A 2ZSAA 4NYMQ 1JEDA 4KVGA 1V5WA 5CITA 4DBLC 1JXOA 1P4SA 5SZIA 4NYIQ 1QHGA 3W9YA 1U8AA 1XEWY 2R6CA 4A82A 3EASA 2OEPA 2ZRBA 1IONA 4KJZA 1DTSA 1AGRA 3NWJA 2JLVA 1Z07A 4HZUA 3U2QA 2ZROA 1G3RA 3BFVA 1G3QA 3GLGA 4BLOA 4DLWA 1KSGA 1KZ7B 2GAAA 3FWYA 4US1R 2B7BA 3MWJA 2ZRGA 4G5GA 5EZ5A 2OLKA 3ZJYA 1SVOA 3NTUA 2G9NA 1UDWA 4IW3B 4KV9A 1F2TB 3FKSA 4FI3C 3NIBA 4M0LA 2H8KA 1AIPA 3BGWA 4Z1MD 1KK3A 1N0WA 3T1VA 5D3MB 2CHGA 4A6PA 4DRZA 3LY5A 3EARA 4YDHB 4R2IA 2EFCB 4KSCA 4LPSA 5JJKA 1CRPA 1HQYE 4ACBA 3OIVA 5BQ5A 1AZSC 2GVZC 4UKDA 3FHTA 2WWWA 2P67A 2OG2A 4QL3A 3KKMA 1ESNA 1KYIA 4HZIA 5EP4A 1W36B 1IOZA 3FGNA 3I4LA 1GOTA 3IQXA 1MV5A 4NYJR 3AH8A 4AC9A 2QTVB 3FMOB 5LD2B 1ZW6A 1P2TA 1CJKC 2C9YA 1S2MA 4I4LA 3ASYA 2WMNB 3GFOA 1OFIA 4PC6A 4ACAA 3K09C 4DLZA 4CF7A 1M34E 3OAAA 1G16A 2RCNA 2YYZA 4LJ9A 2IEYA 1KIMA 3IIMA 3EZ9A 3ADBA 4GP6A 3O8DA 4HYYA 3AKYA 1I4TD 1TU4A 2WJIA 4G01B 2QAGA 4AWXA 3UMRA 4POAA 2UKDA 4Q4JB 2PCLA 4C7OA 1YR9A 3C4JA 1LS6A 3FKQA 3VR6A 1US8B 1RIFA 3RYTC 1X8KA 2BM0A 2C98A 2GESA 3K1JA 1R0ZA 4NYMR 1WQ1R 3AVYA 1KAOA 2VP0A 1FPMA 1XXHB 4FN5A 5FFMA 2A78A 1JJVA 2IHBA 4ASUA 2JLQA 3GEEA 3AP1A 4FMCF 4JLJA 2XTMA 4DUGA 2GXAA 4F92B 2G88A 1F2UA 2XNSA 1SKYE 2VP4A 4P32A 4DKXA 2H5EA 3FTQA 3GLIB 1JAHA 2PL3A 3IDQA 2CLSA 1HQCA 5EZ6B 3B5JA 4W9MC 1XX6A 5EXSA 5KDOA 4IVRA 1SVWA 3L0OA 4CEHB 4LSGA 2ATXA 2F1HA 4MKFA 2RGNA 1P6XA 3B8HA 1GZSA 2JDID 5FUWA 4B2PA 5JHGB 2V7QD 1L4UA 1X86B 2OXCA 3GJ8A 4IEEA 4O0MA 4TTQA 2LCFA 4NCHA 1LW7A 2ZR0A 4JBXA 1AQYA 3KXLA 4P4UA 1ZRHA 3WMGA 4A9AA 2O5VA 2QMOA 2R44A 4YMTA 4V0OA 1OIWA 1U90A 1RC8A 1YZUA 2QSZA 3WBJA 1D2NA 2QSYA 4JLVA 1US8A 1Z2CA 3CKLA 1CP2A 4NONA 4Q4JA 5J40A 3SR0A 2DY1A 1XMSA 3R20A 1E9SA 1P73A 1G7RA 1VG8A 3W3ZB 3BH6A 4BFWA 5EUMA 2EYUA 3SFZA 3QI2A 3TSOA 4TYNA 3EA5A 1YZNA 2N1BA 2YC4C 2ZS9A 5JZVA 1W0JD 1M8PA 4TYWA 4G3XA 2N42A 4RKEA 2JLXA 4Q4AA 2ANBA 1KJYA 2FSGA 4ZDKA 2A30A 5L3QB 4I1SA 1VKJA 1OH7A 3MFYA 5FBLB 3EZFA 1DG1G 1IN6A 2NPIA 3OEED 1W2GA 2BBSA 1PLLA 4QRHA 1DOAA 2ORVA 5SZKB 3OIUA 1O87A 1E2QA 4PHTA 1UDXA 3LBHA 1XEWX 2ZREA 1Q57A 4UNQA 2G0TA 5J4KA 3EWSA 3N2EA 3I5XA 3B1ZA 3K0FA 3Q7QA 2XZOA 3JVUA 4RFSB 2QP3A 4LHYA 3HPQA 3B60A 1WE2A 4OBEA 4Q7JB 3WRXC 4NH0A 5JS7A 1SVIA 4MRRA 4IEIA 1E6CA 2NMVA 1SXJC 3LV8A 2R2AA 4LBVA 4RY2A 5AWFC 4D0GA 2MMGA 4BECA 4PANA 4PHFA 1KO5A 5KNCA 3BAFA 4E07A 1M2OB 1D9XA 4PPNA 2D4HA 2CEAA 3GEIA 3DMDA 1E2FA 2EQBA 1A82A 2VH5R 4TMVA 5KYKA 3GD7A 1JALA 5F9FA 2YWGA 4G1UC 4GRAA 4HATA 4L9WA 4RVCA 4PPFA 1GWNA 2B92A 1CTQA 1P72A 4WVFA 3KJHA 1W2HA 4C4PA 2ZANA 4XOIA 1OH6A 1P2SA 3C5HA 1TADA 3CNOA 3IUYA 1F6BA 4JZKA 1DAGA 4TMKA 2VBCA 3M1IA 4B6EA 5EQTA 1N5KA 5K8IA 4Q00A 2IYQA 2PZGA 1G7CA 2ZUBA 4KXFB 5FTKA 3WHLA 2QGNA 2ZRNA 1E1QA 3AF1A 4CEJA 4B3GA 1TQDA 2HXYA 3PENA 4LOAA 2J59A 3HPRA 1DADA 2F9MA 1YVDA 4GMDA 1NLZA 2GZAA 1E32A 3GCGA 3EIQA 4XVUA 4M21A 2J46A 3QNUA 4JBWA 5KUTA 2D06A 4PZZA 4JLNA 2P3SA 5TDHA 4K8OA 3KQNA 2BCGY 1GDDA 2VEDA 2QT1A 1J7KA 3NDBB 3CWQA 1N6RA 1JBKA 2YWEA 3GLFE 2GJSA 4RD4A 2GETA 2REOA 3U5ZB 5FPTA 2RGGA 1LF0A 1OKKA 4MGYR 4QNMA 2OBMA 4DSNA 1QDEA 4NU0A 1E2GA 3U7EB 1F48A 3SBDA 4F93B 3NKVA 1CKEA 1GL9B 1RKBA 1XRJA 3QKTA 1Q1EA 3A4LA 3K9GA 4O2LA 1XP8A 2ERYA 2DHRA 2IUTA 2ZJ8A 3KUDA 4XJXA 2W00A 4A6XA 4EPRA 4M1TA 3RRZA 3WMEA 4B32A 4ARZA 1KO1A 3CH5A 3ADKA 1KSJA 2NO7A 2CJWA 4JYBA 5G41A 2WKQA 4TL7A 1G8HA 4JYCA 4QGFA 3TLXA 2JIZA 2W0MA 1NBME 1ZD8A 3BXZA 1NIPA 1R2QA 3LVQE 4PFSA 1VYTA 2DCUA 5FTNA 3RRYA 4A0HA 3IKJA 2EFDB 4DCUA 3V4FA 1LY1A 3AKEA 3L0SA 4CVNA 1Q3HA 2XNDD 1E79A 1X6VA 4N0EA 3QE0A 3U60B 4HB4A 1E2LA 2ODWA 4DUGD 4IRUB 3P27A 3CNLA 1Q44A 4HLUC 2BBOA 2MMCA 2LWIA 1JR3A 2XJ9A 3TW4A 4US0R 4RD1A 4AG5A 4B34A 2J1LA 2C9OA 4M8NE 1E9DA 4TZ0A 5B57C 1VG0B 1FMJA 3I61A 2QMEA 1TNDA 2ATVA 2D74A 2YINC 3PUVA 1NN0A 4CT4B 1XCPA 3VKHA 1II8B 2WWFA 1E9BA 3SQWA 4CGZA 1E2MA 1KZGB 1SXJB 1AK2A 3KKNA 4EPTA 3LX8A 2ZJ5A 1S1MA 2W2TA 4PQFA 1OXVA 2C5LA 5TY0A 1CJTC 4WXRA 2VF8A 1A2BA 2P0EA 5HCIA 1XTSA 3BE4A 5HE9A 3U3RA 4BFVA 4EPXA 3P26A 3EPKA 2O8BB 2IBMA 4Q1EA 1C1YA 3MGCA 5M04A 3D31A 2KBFA 3F0TA 4DB2A 3B13B 3QBTA 3U61B 5DISB 2OFWA 5DYIA 4B3FX 1OW3B 3CRRA 2A5YB 1FP7A 4RCZA 1Z47A 2PT7A 3TMKA 2F55A 5KOYA 2WBLC 5JJIA 1ZVQA 1M7HA 4I1VA 5J47A 1TQ4A 1T8UA 1E2EA 5AK0A 3NXSA 3IHLA 3U4QA 2GCOA 4ZDWA 1LB1B 2VRWA 5F2EA 4EJSA 1W4BA 1CU1A 4U5XA 4XD7D 3PQCA 2V6JA 2OCBA 2CVHA 4B2LA 2XEXA 3F8TA 2J0VA 4A0RA 5KO2A 1CLUA 1IN4A 3DO6A 4JJZA 2HLDD 2ZS7A 3P32A 2DPXA 5E7JA 5JEDA 3AM1A 1KMQA 3TRFA 2C03A 4OI4A 1YU9A 2HF8A 3AVQA 3PUXA 4Z54A 4M1WA 2AD1A 3H86A 4DCNA 1ODFA 1G5RA 4IKEA 2HEIA 3FHOA 2O8FA 2VSXA 1TEXA 2WAYA 1AQUA 1NG1A 1DPFA 1W7AA 4GZMA 1COWA 3KX2A 2YWFA 5JWOA 3VR5A 1KDOA 1VG9B 3WMFA 1Z63A 3I5YA 1Z6AA 4DCVA 2RKOA 5LPNA 4BZXA 2O8DA 2AXPA 4DIDA 2RGDA 3PIRA 2V9PA 4II7A 4Q47A 3BFXA 4LCBA 4G5QA 1RW4A 3AB3A 3D3QA 2XSZD 4PAOA 2FX3A 5HKKD 1FQJA 1FFHA 1G19A 5EXPA 3UANA 1TL7C 3AEZA 4DEXA 4Q4LA 3VX4A 2AFHE 2BEKA 3QXXA 1BMFA 3K9NA 2ZJ2A 2JGNA 3B6EA 3VU9A 4DT1A 4UNRA 4X8LA 1N6PA 2CBZA 4HUQB 1KGDA 2ZJBA 1KTVA 4JVLA 1DAIA 3P1JA 5DN6A 1SKQA 1NLYA 1P9NA 1OXSC 3CX7A 5EUQB 4AKHA 3OE7A 4IDHA 3X1WA 3AVVA 1H8HD 2JLRA 1VTKA 1VYVA 1TF7A 1ZUNB 2AD5A 4WXPA 1XEXB 3QBVA 1IQPA 5JI2E 4CEIB 1W36C 2F1JA 2XSZA 4R71A 3K0CA 2CCKA 1GNRA 1TU3A 4TYQA 2CJWB 3P4XA 4B74A 1I4LD 2AK2A 2F1IA 1C4OA 3VAAA 3TSZA 4Y0VA 5JECA 4TTRA 4YONB 2WWYA 3MJRA 3C41J 2RAPA 4JJKA 4Q7KA 3I1FA 4IXNA 3RAPR 1KK2A 3MWLA 4M53A 2IF0A 1EFRA 2KSQA 3IIKA 4TLCA 2B21A 4IVQA 2OAQ1 4TLEA 2KE5A 4PXAA 4HDQB 4FCVA 2G1KA 2AKYA 1W46A 1XTJA 2WJJA 2IX3A 2W6JA 1AZTA 4PC7A 4FIDA 4O25A 3RRMA 2Q3FA 1U0JA 2GILA 2ODBA 2VHQA 3LX5A 1IM2A 1A2KC 2NIPA 1G7TA 5FBRB 5LB2A 4NTZA 2NO6A 5J4VA 1FQKA 2AXNA 2CDNA 4HSEA 4MRPA 3THWA 1SKYB 3NEYA 4DVGA 2VHCA 5L3SA 2IYTA 3NVAA 3I32A 4FINA 4DHEA 1BH2A 4PHGA 2GJKA 3TK1A 2V6IA 2ZS8A 3KL4A 3ASZA 3KUCA 1GP2A 2FV8A 4DDUA 3QOFA
chains in the Genus database with same CATH superfamily
1WSAA 1SIWA 4N7RA 2J85A 1QFSA 1V43A 5EVJA 1U2DA 4RA6A 1BDMA 4Q1AA 5KTYA 1O8BA 2QYSA 3D0RA 3MRSA 3VPBA 2KYRA 3L1VA 1VSTA 3IUSA 3FWNA 4OVKA 4EO7A 3QKSB 2J3QA 3LRTA 4YMUA 5KU1A 2O06A 3GYBA 3GT4A 3OZGA 1XZBA 5F73A 3BC1A 3ZWPA 4H6WA 4F3NA 3VNSA 3E5HA 3EAFA 3OQIA 4O2AA 3PJRA 2G4LA 4GOOD 4E31A 2FQXA 1GKIA 1OWMA 2P8JA 2Q5FA 3CF0A 3ITKA 1TMOA 3L4EA 1NDHA 1XL0A 2I6XA 1L8QA 2GJAA 3MGGA 4GZ3A 4IOLA 4WDRA 4A1OA 1IG0A 4DDWA 3PQ3A 5I7OA 1EK0A 5CU7A 3AUAA 1MH1A 5KMGB 4CL0A 1ORHA 4MDEA 4N54A 2ONKA 3DTNA 1V7QA 2Z1NA 1OX5A 1HKUA 2ZRJA 3AIKA 2RK6A 3OPQA 4Q48A 4QU5A 3V2UA 3FDXA 3CBGA 1JFRA 3PA6A 4AIIA 4HX9A 2CN1A 4DB4A 5SYAA 5WRFA 4CMAA 2WSSD 1ZOSA 2HBZA 3ZHSA 2H18A 2CVQA 2SKEA 2D7DA 4LFCB 3FTPA 2MSNA 4URZR 5FUVA 2X40A 2Z6AA 4I7EA 2F3RA 1WD7A 3ORHA 4EPWA 4UVHA 2QAGC 1MG5A 3OTGA 4P6VF 1OXXK 1GRVA 2FI1A 1NF3A 2XUOA 3QFFA 4RSRA 2SICE 3VM6A 1WF3A 1I4WA 3ZQUA 4DC9A 1ZM4A 2OV1A 2J4DA 3DM5A 2QJOA 4OAPA 4OKNA 1UINA 1GL3A 2GR9A 3D1LA 5FTWA 3SSAA 2IUEA 4CCSA 1JIUA 2ZW9A 3WWOA 4MYSA 1AMUA 3CUUA 3JAKB 1JIVA 2ODNA 4S05A 1FK8A 3DMFA 3C85A 4CQLA 1Q20A 3EXHA 4NOJA 2ZWIA 1C4XA 4CLOA 5EP2A 3ZY4A 2FSPA 1FP6A 1UCFA 1ZK4A 4JELA 4E5VA 4V3BA 1X7ZB 2DG2A 3L7KA 5H8WA 3UJ6A 1Q0TA 4JBGA 1MO2A 4JP3A 1TQ6A 2BFMA 1E9FA 1LSUA 2QMHA 2VQDA 3A32A 2HCBA 3OX1A 3TRHA 4AJLA 5I8PA 1H85A 1MO4A 1P1KA 1RTKA 3ANXA 2VJCA 3PSHA 4FCCA 5CJ2A 5C8VA 1QORA 1Y7PA 1M76A 1HE8B 1JQEA 2HNKA 3E4CA 1OFHA 4MB2A 5DFAA 4ZAZA 5K5EA 3A2KA 3TLJA 3E9ZA 1KY2A 2QA5A 3K96A 4L02A 2PKQO 1MVNA 1WNFA 4H7JA 4U2CA 4WK2B 1A98A 4X44A 4WZBA 1SXHA 2C4MA 3RNLA 4CW7A 5JEEA 1XDGA 1JF8A 4C01A 2AMJA 5U1PA 1ZW1A 3ZHCA 3HR4A 3WP0A 3UM9A 4BN4A 3OX4A 1IZZA 3HS3A 4LKOA 5DN9A 2Q5LA 2QG4A 2IOFA 4L4XA 2KQUA 2VAPA 1M1ZA 1R8YA 2QJWA 1GTMA 3I6IA 3N9IA 3OM0A 3QG1A 3UBMA 1PJRA 1G291 4X1YB 1ZY2A 3IH5A 1D2EA 4C6HA 1K6XA 1J24A 3QKWA 4ZQBA 4ARBA 4G5RA 3QLUC 1TAGA 2FGJA 1I5EA 1RTTA 4OHFA 1SB9A 5U9CA 3EHEA 1D04A 3HXTA 2CB9A 3MM4A 5TSDA 3KLNA 1KJ9A 2D1FA 2QG6A 2WSIA 4IEFB 1U0TA 3KQSA 4RK1A 1J0CA 5L6MB 3A9VA 1GTRA 5IVDA 3KR0A 4Y1FA 1NUAA 5LN1A 1W73A 2C3MA 1DMSA 4XEUA 3TQOA 3IE2A 2BONA 3FUXA 2GKSA 1TO6A 1KEVA 2ASEA 2AG8A 3JQRA 2HA6A 1IZ9A 3SZLA 1VCIA 1Z8FA 1GFIA 2VKTA 3GP8A 3EE6A 4MUJA 2QD4A 4S1TA 2I6TA 3OIWA 2KI5A 4EELA 5CVJA 1EFHA 2WAAA 3MQ2A 3ZUGA 4C4SA 4TMTA 2JFOA 1P4RA 4G8CA 3VSBA 3P8ZA 2WUGA 3M5WA 4WE3A 4BRUA 4M36A 3K7EA 2XLCA 1JG2A 3OC6A 2FRDA 3NP7A 1MABB 3E1SA 3E9MA 4Q3CA 3I12A 1EA7A 1U0SY 1ISJA 1W47A 1Y34E 2DT5A 2FPRA 2HK7A 4K6KA 5ESXA 1DDOA 3IX7A 3CYFA 4TUYB 4F21A 3U3KA 1JDNA 3QY9A 5JS6A 3O4JA 2CY0A 1T3SA 1JV2B 4PC2A 2IXGA 4EO9A 4A0FA 1P8AA 4HYQA 3PGXA 3QEMA 4GE3A 4RVHA 3AVOA 1ZCFA 2LV8A 4J1TA 4XD7A 4YIKA 5I3ZA 3EGCA 5KQGA 3IRUA 2UZIR 4GOJA 3B6IA 4OI1A 4YWJA 1DWQA 4IWNA 3UQYS 3T8YA 2XA2A 4HMPA 3WL5A 1FNNA 4MIYA 1L7MA 3HBNA 4ZZ0A 2BUBA 2BI4A 2IH2A 2IU0A 5FH9A 4E08A 3BH0A 3OHMA 2GZ2A 3P0EA 3Q3CA 3TXYA 1CETA 3RC3A 1E98A 4LOKA 1BKYA 2P9CA 4E33A 3WJ1A 1KI6A 4BKPA 4EO4A 1K1EA 2EWWA 2F7SA 4LNAA 3PGMA 2IWHA 3TQRA 2DH5A 1KQNA 3R7DA 3KVVA 2I4OA 1LDNA 4PFQA 2Q7DA 4CUJA 1YXMA 4E4TA 1JKJB 3TLYA 2X4LA 2G1UA 8ADHA 1UBFA 2H1FA 2R1TA 5JRZA 4OYLA 1A5TA 1C30A 3RSOA 4PR0A 2Q6IA 5B37A 4M38A 3W1VA 4IMRA 2A9KA 2Z3ZA 4UD2A 5JMPA 3D7MA 4EG8A 3SZUA 4DV5B 2FLKA 2I34A 5IVKA 4G65A 2WKRA 3SX4A 1UKBA 4WZBE 5CH5A 2QTMA 3RIXA 1CP3A 4DLVA 1WX1A 2JLYA 2Z83A 3O3CA 4TKUB 1FVHA 3F90A 4WFQA 2XKJE 2RHDA 4RADA 1T9ZA 3MCAA 4GM4A 3TQTA 4AMUA 4EABA 1REQB 1HH4A 4NE9A 4DRYA 4R1TA 5HKKA 1IN5A 3QH4A 1ZQ9A 1CUCA 1IUNA 2AYZA 3QEOA 1KVTA 1QHHA 1U2TA 3B3FA 1P1RA 4JUBA 1MT3A 3KJNA 4RK4A 4QOEA 3WGTA 1CB0A 1B3BA 1PS9A 4NC9A 4BO6A 2IEZA 4P3PA 2XYVA 5KVSA 5LOVB 4YHHB 1ADYA 4C14A 1II9A 3IODA 3K5IA 3REOA 5AP9A 2HKIA 4YLYA 4TKZA 1ODSA 1ISPA 2DFTA 2PA3A 2XNKA 3B2NA 4YJKA 5K0LA 4E14A 1NC1A 3SOPA 1IJBA 1DS6A 4FZ5A 1ZNZA 3VAZA 5HQ3B 5DGXA 4YP6A 4Z51A 2Q5CA 4X41A 2B8JA 2GYVA 1GG5A 4MMZB 3KPYA 3R6TA 2Q3EA 4R2LA 4RZQA 4Q9HA 5AUQA 1CJMA 3ZWNA 3W7VA 4UAJA 4HXEB 2PH3A 1E3EA 4BLPA 4LTNA 2ZVPX 1EFPB 2OFOA 1N5LA 1ZCJA 2O0JA 4IHAA 4Q5IA 3PUIA 5LQRA 3J80A 4IHQA 2QLNA 4V1CB 1IWBB 2P7HA 3V42A 2XA9A 3ZHZA 2CSUA 3A2MA 5LQMA 1AKUA 4NSNA 4FM9A 1NAIA 4O5OA 2EARA 3P9RA 4CE6A 2R85A 2ZAMA 3G7NA 3AEKB 2IH5A 4XYLA 4NFYA 2ST1A 1E4OA 1VGRA 3Q2IA 1ACMA 2XTZA 3KHUA 3WK7A 1IM5A 1L6RA 1NLFA 4KYUA 4CIAA 1GRNA 4EGQA 1J21A 3U9TA 4MUAA 4XCXA 5IKPA 3I9LA 2IHKA 4ON9A 3DDHA 1NYRA 3PC7A 4XIJA 5IVPA 3GLGE 4E5SA 4QUHA 1H2HA 1M2NA 3GNQA 5CGQB 2VAXA 4RKQA 1Z62A 2MSCB 3BJMA 4CV1A 2DQ4A 3H9QA 3MA0A 3PFNA 5H70A 2APJA 3PL5A 4ND6A 1DC4A 3VO2A 1Q22A 1S9HA 4L8WB 5BPFA 4XB6B 2OO5A 3G89A 3P9YA 5BUZA 1JZQA 4WRRA 3D2LA 3VR6H 5C3MA 2P6RA 2Q1XA 2UZ1A 3OZTA 3WGZA 3BHMA 3D4NA 3SIXA 4XWAA 3MVEA 1AX9A 2ZE7A 2ZJZA 3C1UA 1Q95A 4MP8A 2O0HA 2VPPA 4GZ5A 3GJTA 4GPTA 2GEDA 2PZFA 3JSAA 4G0ZA 4PG6A 2GN0A 4X7PA 5TVGA 2ZJOA 3U49A 5A2GA 1AT1A 1VL8A 3DULA 3VNRA 1PU2A 3OEHD 3AT1A 3NDRA 3ZWWA 2BWJA 1RM5A 2BIFA 3D7NA 4Q1FA 5JROA 4V0MA 1RPJA 3PSAA 1VPLA 1N1DA 1Z0KA 3QPAA 1QZ3A 1Z2OX 3I5MA 4F46A 2IYWA 2V59A 1P2FA 2OUIA 1OT3A 2OCIA 3Q8XB 1GL7A 3KM0A 3TTUA 4LYFA 1PR0A 2OKCA 3AHHA 4DPLA 3EZLA 1V3TA 3PFCA 3P0HA 2XODA 1O94D 2Z4TA 3HDHA 1AQIA 2GCIA 1IJEA 2IU4A 4OIFA 4JT2A 4YT8A 4W1QA 4MVJM 1U8CB 3N6RA 3OC0A 4Q3KA 3WGJA 3UWMA 4BLRA 5ICCA 1U0BB 3ESYA 1ZFNA 2ZVJA 2ZWPA 1KETA 3FHJA 1GTSA 1U2ZA 2XYRA 1A96A 1SO8A 1HFEL 3TIFA 3ZHQA 2RIPA 5JRJA 1TE2A 1B8UA 3ABQB 5IAEA 4RANA 3KLPX 2P9GA 1JJAA 4G24A 4MVXA 5E7IA 4PQRA 4YLGA 1G21E 2CZCA 3GPDG 3RSLA 3SEAA 4EY5A 4HRVA 1C9JA 1WY7A 1ZN7A 4JJGA 4WFJA 3WYBA 3CUKA 4A5SA 1JHVA 2A7XA 1ZHFA 2VWHA 3L1HA 2ZBGA 4FYVA 1SQ5A 4J0FA 4BU1A 4DLRA 4DG5A 2QT0A 1KI7A 3WKEA 4RORA 5FXMA 3RARA 2CNWD 1QONA 2WD7A 3BS4A 4IUDS 4NYJQ 5TC4A 2D5CA 2IEIA 4FFNA 4B6SA 5KSWB 1OYWA 3NAQA 4B3MB 2B36A 4IJKA 4BNIA 2F1RA 4MWBA 1GA6A 4ZDIA 5C46F 1USVA 1E7YA 3QENA 2FN9A 5HZHA 3BWVA 4LYDA 3GB9A 5JAHA 3F8SA 4HVTA 2WE8A 2GZDA 2Q4BA 5DMHA 1SHJA 1FTSA 3AV0B 3KSRA 3OX3A 4TT8A 5CEFA 3RC1A 3RBVA 3KUXA 1AV7A 2Y92A 1KFKB 2P7IA 2XCIA 3GDFA 2CXRA 3NDJA 4P1ZA 4MW7A 4RAQA 2GEJA 4WPGA 1N5JA 3PFIA 1H2AS 1GPNA 3L82B 4B85A 3CUWA 1LI4A 3U44A 3CH4B 4I36A 3F3KA 1DPGA 1N9KA 1ORIA 1N2SA 2PBLA 5DX1A 2SHKA 3AF3A 4KI7A 4MYDA 1N2CE 3N2GA 2ID4A 5J23A 4HXGA 5EFOA 1XTTA 4D4JA 3MHPA 4RS4A 3JQ6A 4DJTA 3W5AA 2DM6A 1D1PA 1UXJA 4JVNA 3GMSA 3RWBA 3TUZC 1U7DA 2YNMC 2JFQA 1Q1AA 1Q0PA 1S3IA 2P9FA 4A8PA 1Y80A 4CTNA 1KFEB 2WZQA 3ESRA 3HI4A 3S27A 2ERXA 3T7TA 4Z3KA 1JLRA 2X14A 3FFWA 3GJ3A 4EGAA 3L0BA 4RMIA 4UBLA 3FVVA 3EDYA 2EKPA 4YR7A 5IT0A 4R05A 4QUGA 1E1RD 3L9WA 4QJ5A 1E5LA 2ATIA 2IP4A 1R6AA 1CUBA 2ISSD 3VU8A 4WGGA 2FW7A 2OD2A 4GI2A 1IK4A 2VDLB 1CY6A 3O7MA 1LBIA 4DLUA 4L0MA 2IUSA 3GGPA 3HVJA 3ZW9A 1BAPA 4NE2A 3PNBA 5CCDA 3R3UA 3HACA 1XFDA 2QRZA 2AEEA 5FUQA 5LXTF 2Q5EA 1JQLB 3LSTA 4WN3A 5I9NA 3OCCA 1K8ZB 3WB0A 4JP1A 5MHTA 1KGSA 4CZ2A 1ETHA 1UANA 2EZUA 4H0FA 4XH9B 2B34A 1XLTA 2EBUA 3ETCA 4EOGA 3HJAA 2Q6OA 3MTIA 4RHEA 3JU3A 2W4IA 1FNBA 3QVXA 1CZUA 2H4HA 1MZVA 1ZCAA 4JT4A 2ZQYA 4P92A 1N78A 4DLKA 3EVGA 3T7KA 5EJEA 4NPCA 2QD5A 1GSIA 2XUFA 1GM5A 1NZJA 1AJEA 3UEOA 3UWPA 4IKOA 1DP4A 3K16A 7GPBA 5JFGA 5EQFA 1K5PA 1O0SA 4RLSA 1BMQA 2AMFA 3OURA 4OXYA 1OFUA 5A3RA 4XYEA 4XWKA 2PRZA 2WIFA 4JVMA 2EFGA 2I22A 3D8RA 1Y9ZA 2LIVA 4JI6B 5EQDA 1CRZA 3DH0A 3R0JA 2X7HA 1GPH1 4KVZA 1IUPA 3TZLA 4DEYA 2Q7XA 4XGIA 2ALJA 1X7YB 3H9BA 3O4IA 4HADA 4O0LA 4ZDJA 4G5XA 2H51A 1MX3A 3DKIA 4OG2A 3RUAA 4WL0A 1YVRA 2VUUA 2CHVA 4HRAA 2DKOA 2KHZA 3SZGA 3E22A 3KDSE 5HKOA 2ZM6B 4BFYA 2D62A 2P0YA 3EHDA 4WOJA 5EMKA 5B36A 2WMOB 1OASA 5JNSA 1V1JA 1ZH0A 2YJ6A 5K45A 3MCVA 1RWMA 3R8FA 4JLKA 4EUKA 2IITA 2Q2NA 3L07A 1D4OA 2ONYA 1C1XA 1I9CA 2XB4A 2Y1XA 4S1OA 1WCV1 3O8LA 2EVWX 3HI6A 5KI6A 2YN2A 1Y9JA 3LLMA 4HS4A 3PGKA 3PGLA 2AOTB 2C8VA 2XX3A 5DN6D 1E2PA 1DUSA 4FJ2A 1Y6GA 1NY5A 3STTA 2A0FA 3KWMA 3GZNB 2J9ZB 1G2IA 4DCGA 4FX5A 1P6UA 1QQBA 3DMPA 1X15A 5EZYF 4MJLA 4EG5A 2XRFA 4MWTA 3LBIA 2EJWA 4HNTA 1L4KA 3I2GA 4B76A 1XEAA 2O7QA 3OFKA 3EW7A 2WLTA 3LKBA 4XGQA 4IIJF 4UHHA 4PINA 5JZOA 4ILEA 1N75A 1ZO8A 1U3TA 2VUTA 3F1KA 1YDWA 1KC3A 3M2PA 3TQSA 5BMVF 3ZWQA 3GLGB 3DE7X 3I0MA 3IQHX 4NR0A 2ZTVA 3UUWA 3JX9A 2QMZA 2YDYA 4PZLA 5AXCA 3ACCA 4BNVA 4RUKA 4F5EA 2H7XA 4RPJA 4MQUA 1P60A 1ZIOA 3GWZA 4XQ0A 2RGNC 1ZK1A 1EFAA 3PG5A 2FLVA 5CNMA 3UOGA 3JQQA 5KNCH 3AKZA 5T3YA 4KN9S 3O93A 1IY0A 1QM5A 3RYIB 3VR2A 3QEBZ 2J7KA 2CLHB 3GDOA 4LOHA 2QRVA 3LK6A 4L74A 3L8YA 1IBCA 3BIJA 3FCCA 4HTFB 4X45A 5E6SB 3ZK7A 1WZCA 3KQTA 4ER6A 5CIWA 1BS1A 5ED0A 2YOHA 2UUAB 3FVWA 4PBTA 5AKLA 1JU9A 1V2GA 1H3EA 1GGVA 3FJYA 4MA0A 1BX1A 5F12A 1ZN9A 1H1DA 2P9TA 2RHJA 3A27A 3ENVA 1JA1A 4RDCA 5EFZA 3T7RA 4ZVKA 5I4BA 4F0JA 4JL5A 3HUDA 4MGKR 4BVKA 3PXGA 5KYXB 1HDXA 1QAOA 1THGA 2Z2ZA 1HO3A 1EDEA 4BLQA 2WJ6A 1B1CA 2JFHA 3F5QA 5AOAA 4E3WA 2ZR9A 4RO0A 4JENA 3LCMA 1VE7A 3AU8A 3JWJA 2JAXA 2O5CA 1T9BA 3RTEA 3GAMA 3G2OA 1JPJA 3FFTA 4FYHA 4YRAA 4MVYA 5JWHA 3GNLA 4D02A 4CQMA 5A0TA 1TMGE 2PWZA 4FYWA 1OLUB 4XPZA 3MZ0A 3H75A 1E8NA 3EOZA 3NDIA 4HAUA 4F4CA 1K4MA 2VI5A 2I2CA 4P35A 4L5CA 4RQTA 2GM4A 3LUBA 4QHYA 1RWNA 2V55B 1L4FA 3MTBA 4YC7A 3HXQA 4JKIA 3SMQA 1ATZA 4EG0A 3IQGX 3L49A 4G97A 1AGPA 2GPNA 1YQDA 3C3EA 2WC1A 3T9AA 3N7AA 4RD0A 2DUNA 3PQFA 4UC0A 3TCKA 1UKAA 1FRNA 1R5JA 2GK6A 2W83A 2CDAA 2YV4A 3OEHA 3ZWKA 4C0HA 4CU2A 4PU0A 5AESA 2LCQA 2G04A 2QL7A 4YMSA 1IBLB 2P5TB 1C50A 1M66A 2HREA 3A2LA 4HGPA 5JE8A 1Z7BA 4JUAA 2AW3A 4UUBA 3CZ4A 1PT9A 3CLRD 3CURA 5COBA 3ROMA 4FBGA 4F3CA 5KX5A 3ZHRA 2Q46A 1SHUX 3B7GA 1K6MA 2IW1A 4JKOA 2Y2VA 4E09A 4Z4IA 3TSYA 2ZRCA 1LRJA 3RUIA 2FPKA 4PZ0A 3S2GA 1HE5A 4PX2A 4V03A 4HFMA 3FW1A 1W0KD 2C57A 2WVGA 3CT6A 2JAOA 3LT4A 4NOLA 3ZHBA 2CBGA 3G7UA 4DG9A 3CB4A 2NU7B 2AQKA 4A7PA 5AW2A 4TKLA 4N18A 2C5BA 4RPIA 4ZO7A 5TQ2B 3HB0A 2IZ1A 4DCSA 4BNDB 1SU8A 3KJQA 1EAMA 1VMDA 5FQNA 4BE9A 3GCZA 3V32A 1A76A 3ICWA 1AM4D 1QGED 4F6RA 4HTFA 4LA4A 1KOFA 4LDZA 3EBLA 5AVUA 2NYRA 4Z8YA 4MEBA 3ED1A 3KSZO 4PSVA 3WADA 4RVDA 3THWB 2R96A 4ER5A 4RLFA 1EP9A 1MUUA 1F60A 3KSUA 2G0NA 5A4JA 4FFRA 5K8LA 2QMYA 3ND5A 2G9QA 3NW9A 3QEMB 4Y9UA 4LYAA 4JLWA 3WLOA 1GTL1 2QLFA 1JMYA 3IB6A 4ISBA 3IPRA 4U1RA 3GJYA 4XA8A 3FSJX 4YDQA 2QUJA 2O8DB 4IV8A 2FEPA 4JLOA 4K7JA 4U8GA 3SC2A 2NU8A 2H1HA 2QP4A 2P8SA 3OJLA 1EWQA 3KYDB 4P31A 1RWQA 2E1RA 1VE6A 2C9CA 1P39A 3G9QA 4B43A 1H42A 4R5HA 1BGVA 1GPWB 1AHNA 4HUQA 1TCBA 3U4GA 5IDXA 1BN6A 3IP1A 4KRGA 4AI6A 1A9TA 2QSUA 3CSDA 3EXHC 1A72A 5CT9A 5KNDA 5IH3A 1NXPA 4HNRA 5JAOA 1CRWG 4F2HA 3MFQA 3GX1A 4MI3A 4IJMA 4Q37A 3F2IA 1QGUB 1D9ZA 2PRIA 1NXOA 2CHEA 4OLFA 5IBRA 2IIBA 1RRPA 2BP7A 4RD6A 4MPDA 1BDIA 4J49A 1NV9A 1UT6A 8AT1A 4BX3A 4C5AA 2PNJA 1W4LA 4UUAA 3OF5A 3MUEA 3OLXA 4WECA 1PL7A 2GFHA 4HQLA 1SMKA 5DEIA 5B53A 4AKSA 4JBNA 5CB6A 4OGWA 2X42A 3TOZA 2OV6A 4K5QA 4Q1BA 2GMWA 3GHHA 2PTHA 4EKNB 1CY8A 5HE8A 2BDTA 1UM8A 5JWRA 2VHWA 3EGIA 2JKYA 2GVDC 3KQPA 4QICA 3DE2X 2YW2A 4HVLA 2DQZA 2XIQA 4KIWA 1TT7A 2ZPUA 3DMNA 3DV0B 3HYLA 3EVBA 2HA2A 1Z0UA 3EDCA 3DTYA 2LKCA 4H1HA 2WT9A 2YV5A 5T64A 3R9KA 4FR2A 3QLUA 2G8LA 2QF7A 4HBZA 2PZJA 1FMLA 4MS3B 3OFND 5ENDA 5BMOA 4HOYA 3ZDXB 3FBWA 4XWGA 3I2YX 2XEDA 4R54A 3H1EA 2EKBA 1SKMA 1IN7A 2ZAIA 3FYUC 4LWZA 3B78A 5H0IA 1RAIA 1IFXA 1C3VA 3BSYA 2BJVA 3QVGA 4FVTA 4KBYA 1MV8A 4P0TA 3TW0A 2REQB 2WY2D 3C8DA 1VL6A 3NBAA 4B44A 4L5YA 4J94A 5J59A 1M0SA 4CIYA 5I4IA 2ZIVB 1VMIA 2ZPTX 3TIVA 4QPDA 2FEKA 1TAUA 2PUAA 3KQOA 5JARA 2IA5A 2XCQA 3E9RA 3PEFA 4FGZA 4I50B 1U3VA 4PLTA 3CZRA 2CV2A 2GPJA 1ADJA 2VHXA 2DR0A 1YQTA 2AJ8A 5NULA 2C7RA 2PO7A 2BGLA 2RAVA 3G9TA 4UBKA 3UNXA 2GN2A 4TMFA 1OLXB 4KWTA 1AE1A 4PWZA 3UC5A 2FUEA 2RH5A 2XCRB 4XASA 4B6GA 5BOSA 2JBWA 4DJDC 2XPCA 2A35A 4C3UA 2BMFA 3DOUA 3STWA 1E79D 5IARA 3GBPA 2QJTA 3GMDA 3WYGA 1R66A 4EL5A 4NPAA 5L4SA 5B3JC 1GAWA 3BZWA 3DPSA 1MC1A 2R87A 3UGTA 3L84A 2YOFA 5DI9A 4AYXA 3Q9NA 2ONCA 4PO8A 4RIIA 5BP7A 3UJPA 1XWIA 1O0CA 4DAEA 1EX7A 4DYDA 1CJVC 2FZGA 1YRBA 2FR8A 4TROA 1Y63A 1N1GA 1IEVA 4MTCA 1N2HA 1TO1E 2DSTA 4OLJA 3KSDO 3DAHA 2VTKA 4ZPJA 3H1FA 3VHLB 5JS2A 1Z28A 4YAJA 3U7GA 1E5TA 2UVPB 3HN2A 1Z5VA 2AG0A 1M9NA 4K6CA 3CSSA 3ELBA 4RIEA 2QQ5A 4FS8A 4UU7A 5G0VA 3ZIAA 6CHYA 1ESEA 4AF6A 3FCSB 3FDZB 4CV3A 3AWDA 1RWOA 5CYGA 1FFAA 4ZTUB 4ZVVA 3N7TA 4JXJA 3UQZA 1RPNA 2MOKA 2QD3A 1CRQA 3LC2O 3HDTA 3G5MA 3ML1A 2GCPA 2R6AA 1G38A 2IYNA 5J2TB 2QM7A 2VFAA 5CP8A 2AF3C 2B69A 1UP7A 1RHQA 2EFHB 3E4DA 3Q41A 4GC9A 4GRIA 2EC5A 4AN1A 4CM3A 1W4CA 1J8MF 5KYTA 2FPIA 3UUFA 1E2DA 4I1UA 1PEYA 4LCEA 3IIJA 4NHOA 1UMDB 2PT6A 1JSCA 3ZU2A 4R69A 1LPOA 5ALFA 4D0NA 3WG9A 1TK3A 5DASA 1JQDA 4MLZA 1JWAB 4Y2VA 5B1DA 4DIMA 4RTJA 4FGKA 2EDAA 1GR1A 1NR7A 3A70A 1R6UA 4DZRA 4EHLA 1ZJJA 2I6SA 4M1ZA 3JSXA 5DP2A 5ADWA 1ENPA 1J0AA 1VLZA 3GJ5A 4PGHA 3TJZA 2WJPA 3NNSA 2Z4SA 2XCSB 1RZVA 4C0XA 4F86A 4K9SA 1QANA 3RHSA 3WDMA 2PUFA 2AF4C 5A9RA 1GUDA 2NACA 2WRZA 1VL5A 4NAUA 3ZDQA 1DAPA 4CODB 1I13A 4KUEA 3DV2A 3HL4A 4HLCA 4P5DA 1EBBA 4RMJA 1YJAA 5TJ9A 5MN4A 2G83A 1JEOA 4J4HA 2OBBA 3R1IA 5CVVA 2FEAA 2BRUA 2GZSA 1OTXA 3U4DA 1U1IA 4LHVA 3HADA 3HVHA 3GAFA 2ZYDA 2JLBA 4YP1A 5FL7D 1GFWA 2JH9A 2IVFA 3AF6A 5CT6A 2P68A 1SB8A 1N7GA 1IY9A 2LTAA 1T8RA 4HI0E 3THSA 3FXAA 4JS0A 3PPXA 5EL0A 5P21A 4F8EA 1OF1A 3NNDA 4H59A 1OE0A 1DG9A 1JTEA 1XU4A 2QL5A 4WCVA 1LZKA 1R9NA 1SGWA 4JU8A 1NF8A 5K6AA 2VP3A 4NENB 1W88B 2X1LA 4N0DA 3WICA 3N8IA 1YC5A 5KZMB 3WFZA 4BX0A 4IQ4A 5DTJA 3ENNA 3ITDA 4NESA 1TCCA 1FMTA 4JP5A 3GGOA 4GPZA 1A77A 1GQSA 1XYYA 5EHGA 3NC1C 1N0IA 4QBGB 2B82A 4CTKA 4D97A 4AD8A 5DNYB 5F21A 4IINA 4YAGA 5HYVA 5B7GA 3I2KA 5J2UA 3H9JA 2GN1A 3CUSA 4FFBB 4PAWA 5GPBA 5AVVA 3K0CC 2KPOA 1AHPA 3DTVB 3M3PA 5FV4A 4RH0A 2A2ZA 2RCYA 1I5OA 5T3UA 2RGCA 3IVAA 3W6ZA 2QQFA 1QMPA 2XRYA 4HAVA 1NC3A 4DWJA 4H1WA 4MA4A 5IC4A 1G6KA 2HXSA 4TN1A 5DH9A 4I66A 3RS5A 1TM3E 3DE5X 2FPLA 2ZSKA 4Z1MA 3WISA 1DJLA 3RV4A 1IVSA 1K8YB 1OI7A 3OUZA 3M1LA 3FFAA 2H2DA 3DXZA 1G2PA 1KJIA 2HCTA 2PHZA 2QZSA 1XVAA 3CW8X 1D0VA 4X8HA 4G1VA 4LMAA 4CIXA 1EESA 2XD4A 2GJ4A 3PC8A 1E6LA 4X71A 2MU1A 3TOCA 4JI2B 1MQSA 2PNFA 3QEAZ 4JUCA 3E2IA 3RK4A 5JPCA 1V0JA 1S1CA 1WUIS 2ZP1A 1BVUA 1G9SA 3CUTA 1D1SA 3C3MA 5E38A 1Z25A 2I5PO 1WZNA 2QZJA 3R8XA 3VZSA 3U4HA 4BKOA 1M6NA 5LQKA 3C8ZA 1ZVKA 1M1YB 1YT5A 2PFKA 1UPXA 1L5FA 2J6HA 5JZ9A 4IIYA 2H9YA 3IILA 4P54A 2OO3A 1G0OA 1UWCA 3B3JA 1LBSA 3HA7A 3QPCA 2GFQA 4X7BA 3WKAA 1KO7A 4ARUA 3QXJA 1ZXLA 3IJEB 4PVCA 2C9MA 5JH7F 3JV7A 1R18A 2C0CA 3AL2A 1HWYA 4EUNA 2VZ8A 3G8BA 2VHEA 3PITA 4KAXA 1NJFA 3WGHA 1ZR4A 3D6HA 1BIFA 2VDWB 2ZUEA 4PN3A 1X1SA 3F3YA 4Y6SA 3G0OA 3UVEA 2AQ8A 421PA 1D09A 3CG0A 3Q4GA 1E69A 3M83A 3N2IA 3BB3A 3EUWA 3NV7A 1AKEA 3WBBA 3ESQA 4ZT3A 3SXUA 1AQNA 4RCVA 2HU5A 1K92A 4PYRA 3SHVA 1T6ZA 1KO4A 5A1JA 3NS7A 2BHRA 3BFJA 1Z4IA 5EWLB 1O1YA 1DV1A 1JXMA 1SHKA 1SU7A 3AP2A 1KSFX 4EG6A 3UCXA 1C14A 3DBHA 3H9GA 5DO9A 3NCHA 4P58A 3THXA 2EKZA 4GLBA 3VH3A 1E18A 3DEIA 2ZDHA 1M0TA 4QT0A 2PVCA 4OXKA 1AD2A 2PH5A 2E4XA 2PS0A 4P4SA 3I9KA 3L3BA 1UBKS 4OJMX 5CEJA 1X19A 4BWYA 1CR0A 2I65A 3P2IA 2NP7A 1ZINA 5AJWA 1XPRA 1VHWA 3KAPA 4G0YA 2P35A 3I2JA 2ZRDA 1RZUA 4MRMA 4HQFA 3LUKA 3OPVA 4UREA 3WHKA 5TEVA 4D3FA 5FF9A 4BXOB 3KOUA 4ZK6A 3SQXA 2UV8A 4GX1A 1JMVA 1KU0A 2I66A 1OTYA 2QUIA 3CVOA 2B99A 3H5OA 3L4BA 3OZ7A 3Q7PA 4TMZA 5H81A 5CFPA 1UXIA 1X8LA 5MFPA 2BKUA 2HLDA 2R6GA 5EKDA 2XUPA 4YRIA 4TKMA 3RB8A 4XUCA 2PVSA 2CXPA 4XM2A 4C6TA 1UFOA 2ESRA 1CQWA 2RAUA 4FC7A 5EIWA 1RLJA 1Y1QA 4FGUA 5DT2A 3UICA 2YYAA 1HYBA 1LWNA 3WQBA 1A97A 1A95A 4YRPA 3PNYA 1W94A 2VTVA 1LVHA 4V0LA 1Y82A 2A67A 4NZYA 4YJHA 1JL3A 5F51A 2VCHA 1SBQA 3M8KA 3LUCA 3W77A 2GD0A 2PV7A 3MIIA 2BFAA 4FDUA 4TQAA 4M8IA 5BWNA 2OKGA 3RIMA 2CE7A 4D26A 4LI3X 2HW8A 2IS2A 3HJNA 4Q24A 5HF8A 2XDQA 1DKNA 4LJ5A 1PJQA 2HRDA 1Z33A 1XTBA 1ZSYA 3IXMA 5EZYB 3DO5A 4B79A 2XVYA 3WA6A 1G18A 3ADCA 4YRBA 5HR5A 4BMOB 2EZ9A 1CG6A 2ZSHA 1LX7A 1EEXB 3GVHA 3LYHA 4HY3A 2B4YA 3CLHA 5AHRA 2YKGA 3L6OO 2ODEA 3PWSA 3DOCA 4TWBA 4QSHA 3TB4A 2QTBA 3C1AA 3O2JA 1LDEA 2NSHA 2V4MA 5IABA 3LSYA 5CB4A 1BHJA 2F90A 2L0XA 2X8AA 1Y6JA 2P75A 4HWOA 4MLPA 5DLDA 1J1UA 1PVDA 1T5IA 2Q6LA 2Z3VA 5FOXA 2H92A 2HN9A 1M2WA 1WCYA 2QUZA 1OUMA 3BEDA 4PYLA 1CF2O 1K08A 2DVMA 4FB5A 4WBXC 1KIAA 4FP9A 4YGXB 4BIIA 4L15A 3C3XA 4CMEC 3FYDA 1XU7A 5D5PA 3I30X 1BFUA 3RDPA 1X3LA 5K3SA 4H3HB 1ISFA 5JY6A 2D54A 4BX8A 5CW2A 3F6YA 3JRNA 4KQKA 2BTQA 2M6RA 4OK6A 4RM3A 4QYMA 2RGRA 4QDOA 2DX7A 3Q9UA 2WWTA 4D6PA 5KHLB 1F9AA 4B6PA 5C81A 3AFOA 4L7VA 2YBDA 4D4LA 2YASA 2JZCA 2INGX 5FORA 1CE8B 3HSYA 4YJ2B 3P96A 5B55A 3IR5A 4JT9A 4NMWA 4LVUA 1BJTA 2J3KA 1BOFA 1SXJE 4RLHA 2COEA 1PR3A 3CSUA 3WWEA 5JI3E 3GK3A 1F0PA 3PE3A 4MCIA 2J30A 3BWXA 4MKHA 1CQPA 3FZQA 5TGDA 4BMZA 2XVAA 2Y8EA 3QE3A 1TB4A 4G4GA 3W3AA 2LIPA 3AJDA 4UMEA 1B23P 1ES9A 1WS6A 1FDOA 2N9UA 1OSNA 3BE5A 621PA 4MV4A 4EFNA 3PF9A 1Y48E 1LLQA 3O21A 1MG0A 4LV8B 3GRYA 5CT8A 5KJ6A 2X9LA 5TNXA 1FB5A 3G2QA 4QC2A 1A9XB 1NWHA 2UVDA 3HCCA 3RSHA 5A4KA 4WERA 4BGUA 4R7ZA 3FSGA 1WXFA 1C0KA 3OF3A 1GNVA 2PX2A 1KDTA 3STXA 2DXIA 2GD2A 2P9HA 2ZSIA 2DB3A 2GI4A 4DSTA 2I3BA 3NWOA 3EG5A 1OLSB 4YWHA 4CKXA 1KYXA 4IFIA 2YZMA 4NCXA 5AI6A 4ADSG 1IEWA 2CDCA 2JGAA 4L0CA 4MUXA 5L7YA 3S1LA 4EY7A 4B83A 2OG1A 1BQEA 4LMBA 5CA0A 3H9CA 4AYTA 4I4TF 4QELA 1HT0A 3HXKA 3TN7A 3I3SR 2VKQA 5ALMA 3BXXA 1QPBA 4F1KA 3A6EA 1KMCA 1PTKA 3EA4A 3KD3A 4N0MA 4Q9AA 4UM5A 3TRJA 5JU6A 3QITA 5BN5A 2WEKA 3CLSD 1Y3CE 2KB0A 2XMPA 4NJEB 4QTTB 3P0RA 4LY9A 1JXAA 1JVBA 3LF1A 1NYQA 2ORIA 1PNVA 3SWWA 2PZ8A 3TG8A 1OAOA 2W2QA 1PR9A 2X8BA 2XNHA 5K6RA 3C5CA 3O3NB 4J4BA 3AUJB 4OI0A 3SM9A 3UUEA 5G53C 3TKYA 1BJKA 1QVVA 3LQ4A 1T25A 2ZUFA 5J4YA 2XCTB 2RGBA 5HS4A 2AMYA 1DUIA 2QTRA 4XWTA 4PRKA 2JIZD 4P22A 3R6WA 4RJIA 2FMXA 5FAXA 1J2EA 5KJ1A 4NBRA 3OT4A 3LD9A 3Q5EA 4M1SA 4M9XA 2ZCJA 4BQOA 5KAPA 3L8DA 1T5BA 4D45A 3T1YB 3LP5A 3OTOB 4AUKA 2YWBA 4G4IA 4DC0A 1XMJA 3EVZA 3Q88A 3ZWAA 1MP0A 3CW2A 3LCUA 3TLEA 4AZ0B 3K8ZA 3OHSX 1WMFA 3CLUD 1WBJB 3LQQA 4E1BA 1JBEA 2AFHB 2V3VA 1SZDA 2EJBA 4J9UE