1IC6A

Structure of a serine protease proteinase k from tritirachium album limber at 0.98 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEINASE K
publication title Structure of a serine protease proteinase K from Tritirachium album limber at 0.98 A resolution.
pubmed doi rcsb
total genus 87
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ic6A00
2IXTA 1Y3FE 3BGOS 1TMGE 2HPZA 1C9MA 1R6VA 1SIUA 1R64A 3GT3A 5JXGA 4K8RB 2ID8A 3CNQS 2PYZA 1SBIA 3T41A 4YN3A 2DQKA 1GTL1 1SCBA 2ID4A 5FBZA 4MZDA 3GT4A 3ZXYA 3DE6X 1TM3E 3A3NA 4ZOQI 5ARDA 4LVNA 1BE6A 1EGQA 4BWGA 1YJBA 2PWAA 5JXHA 2E1PA 2ZRQA 1Y48E 2HD4A 1ST2A 1WVMA 5I9SA 1BFUA 1BE8A 4I0WB 1BFKA 3VV2A 2IY9A 3DE2X 1AK9A 3F7OA 1TM5E 3LPDA 2WUWE 1OYVA 2WWTA 1SPBS 4LVOA 4CFZA 2Z57A 2SECE 1T1IA 1OT5A 3TECE 4FONA 2SNIE 1AF4A 1GCIA 1AVTA 1GA1A 1IC6A 3QMPA 3P5BA 3DE1X 5ARBA 1PJ8A 1TK2A 2W2NA 5AVJA 1TM4E 3I34X 3LPAA 1ST3A 1Y9ZA 4ZARA 3DW3X 3VYVA 4DWWA 1NLUA 2ST1A 1SH7A 1MPTA 2SBTA 1EA7A 1TO2E 1Y4DE 4WOBA 3AFGA 3DE5X 1JEAA 1S02A 1Y3DE 1P8JA 3DWEX 4NE9A 1SVNA 1LW6E 1S01A 3LXUX 3AJ8A 1C9JA 1KE1A 3WQBA 1AQNA 5AQEA 1DBIA 2QTWB 1SUBA 4Z2AA 4KPGA 1AU9A 4AKSA 3CO0S 3DVSX 4KB5A 1SELA 1Y3CE 2XRMA 5JMOA 1A2QA 5AVKA 2X8JA 3SQOA 4DZTA 3TI7A 5JXJA 4KG7A 4CFYA 4AKTA 4HVLA 3QFHA 2W2MA 3SICE 1UBNA 4H6WA 3HJRA 1SN7A 4DJ5X 3D9QX 1SUEA 1WMDA 1C9NA 1BJRE 2G4VA 3WHIA 1S2NA 1SBTA 2B6NA 1PEKE 1SCJA 3H42B 5ARCA 1ZVJA 1BH6A 1GNVA 3DE7X 2PQ2A 1OYOA 3BX1A 2Z30A 1HT3A 1KDVA 3VTAA 1XF1A 1PTKA 3L1KA 2XTJA 1SBHA 3BPSA 2PKCA 1GA6A 5B1EA 1THMA 2Z58A 3A3PA 1IAVA 1GTJ1 2DP4E 1PFGA 1Y3BE 1AH2A 3DE0X 5K7SA 4CG0A 1V5IA 3Q40A 1VSBA 5FFNA 1YU6A 1Q5PA 1Y34E 3Q5GA 3UNXA 1R0RE 1TO1E 3EDYA 4B5LA 2GKOA 3DW1X 2V8BA 5AMXA 2PWBA 4HX2A 3DYBA 1NDQA 1GTG1 4JP8A 3DE4X 3I30X 1MEEA 3LPCA 3F7MA 1KDYA 3VSBA 1YJAA 3F49S 4GI3A 3A3OA 4NE7A 4WOCA 1CSEE 3VV3A 4C3UA 1WMEA 3TI9A 1CNMA 2Z2YA 1AV7A 4OMDA 1TECE 3OSZA 1Y33E 2DUJA 2W2OA 3DDZX 2W2QA 2W2PA 3WIVA 1SUDA 4RYDA 3DVRX 2ZWPA 3D43A 1TM7E 1GNSA 1WMFA 5SICE 4M1ZA 3VHQA 3DVQX 3EIFA 1GT91 2X8JB 1Y1KE 2WUVA 2P4EA 1P7WA 4J94A 2WV7A 3I2YX 1KE2A 1SIOA 3PTLA 5JXIA 1SIBE 1SCAA 3DE3X 4C3VA 1C3LA 2ZWOA 1V6CA 5CW1A 5B1DA 3I37X 3QTLA 1KDZA 3GCXA 3WIUA 5FAXA 4H6XA 1WSDA 3EE6A 2TECE 4OV6B 1SUPA 3PRKE 3AJ9A 1P7VA 1NDUA 2Z2ZA 1DUIA 1ZVKA 1Y4AE 3GCWA 1SBNE 1T1EA 2SICE 4OMCA 1SUCA 2PRKA 3ZXXA 1SCNE 2Z56A 4H6VA 1GA4A 1T1GA 4NMXB 1SCDA 1SUAA 2Z2XA 1TM1E 2PMWB 1SBCA 1YJCA
chains in the Genus database with same CATH superfamily
3LTNC 4JXZA 3A6HA 2IP2A 2PY6A 3TQHA 4ZOBA 5KYKA 4CI9A 4QBKA 3M9LA 5K1ZA 1M2VA 1WY7A 1E2FA 2CFCA 4W5TA 1YL6A 2ZS7A 3QU5A 3L02A 2R751 4MPDA 4PF1A 5JZVA 1BOOA 1L3BA 5K4HA 3W8FA 1QOQB 1SRQA 3K30A 4IDGA 4JNKA 2C2YA 4OJKA 4JX9A 4ZAXA 5KBYA 1KZ6A 3VNQA 3VZBA 1X42A 4KRXA 5CNKA 4XARA 2AV6A 5KMGA 1TADA 4FFBA 2DHDA 1J7KA 4TV8F 3LC2O 4GP7A 2P9EA 1EA5A 3KPYA 4DLAA 2ZI6A 5B30A 3AGPA 2I3DA 4BFTA 1A5TA 1P0FA 1W19A 3ZQ6A 2H1WA 2OC4A 3BMOA 3DT6A 4HH4A 2W6ZA 2DZDA 2V03A 3ED1A 1AGNA 3FRJA 3ORSA 2WF7A 2CLOB 3I92A 3K1AB 4KQCA 3HUDA 5AM3A 3ZX5A 2YW2A 1HQDA 1TT5B 1DFGA 1PR9A 3QYAA 4NG5A 4MHOA 5JD3A 4F3CA 4YCMA 1OQAA 5BORA 1WV0A 2COEA 4BP8A 5EIHA 1PL8A 3G5UA 4GMHA 3R7AA 3FB4A 1IHDA 2C8VA 1NUPA 1QH1B 1HRKA 3GAFA 3IQEA 3NHZA 1RYFA 3DUWA 2AVDA 2BGLA 1FZQA 1YZNA 1Z2EA 2IYYA 4WUTA 4Y6LA 3EXHA 4EB8A 1FRFS 2PLRA 3D2CA 4R2KA 1GKKA 3DOCA 4EUSA 1N33B 3P0EA 1U5AA 1U02A 4C4ZA 5HGXA 3DSRA 1U99A 3TCKA 4HSGA 3TM5A 2FMTA 3MJTA 3JAWB 4ZT7A 3P96A 4B3SB 3EZNA 4LQDA 1WPRA 3L01A 3DZHA 3ANTA 4S04A 3G7SA 4I2NA 1IUKA 4AWAA 1A76A 2GAAA 3PFKA 2IYUA 4IV0A 3V55A 3KETA 2GB4A 4D2IA 3LGXA 4E33A 2EHJA 4XPIA 1QWOA 1GGVA 3FSGD 4ZDIA 3D6NB 3ZDQA 1O54A 2QORA 5DMXA 1ZI9A 1F51E 1F4LA 3C14C 1OROA 1SKAA 4IO0A 1UKCA 2MSCB 3U3OA 2BHRA 2W8BB 2A0WA 1YHZA 1PNVA 1UKBA 3OFSA 5EKTA 4IKOA 2NX2A 3AZOA 1J6UA 4P86A 1TTPB 3WL7A 1GP2A 3B6KA 5IM5A 5L95A 3VR1A 4AJKA 2CNDA 2Z5GA 1GSIA 3TUZC 1AXGA 2JFPA 1X7ZB 5IXJA 1U0EA 3FDXA 3ANLA 3CUVA 4FYJA 2HFKA 2E9SA 3HACA 5CGQB 3BHNA 4N9WA 5F2KA 2JIRA 3S2ZA 3RAEC 3RBAA 9MHTA 3T99A 5JAQA 3TQOA 1HKHA 3DNMA 5K4GA 2R6GA 4OQZA 2IU3A 4U7TB 5AR1A 5BT9A 5A9SB 3R7WB 2I9KA 1MBZA 4R8MA 3PTZA 3UK2A 3FNQA 1Z56C 3FTPA 4KQHA 5CYFA 1F8UA 1TW3A 3BRCA 3P5SA 2GHIA 5HCUA 1QV7A 1KI4A 3BMQA 2VRWA 5EZ5A 1NFRA 3ZZNA 5JFOA 2AUTA 4TXHA 5H80A 4XYBA 5FV4A 1NRIA 4NTZA 1EJ0A 2XUFA 5CJPA 5BNTA 3RU2A 3K1YA 3UWDA 4EO4A 5I48A 4H27A 3RS8A 2V0NA 2O1XA 2VT3A 1T5SA 5LNK6 2XYHA 3N2IA 4FR0A 4RSGA 3SDBA 4JV5B 3SC2B 5EFOA 4JUIA 4A26A 4EBFA 3WMEA 1PG5A 1IHUA 3I2JA 1NLUA 1NA5A 4MA5A 2X5NA 5A3VA 3KPWA 1DQRA 2G08A 1QIEA 4O5AA 2G6TA 4TKZA 3NORA 3U4IA 4HXEB 4BPBA 3D2LA 3OM8A 3B1WA 4CLEA 9LDTA 2IS1A 2W0SA 1H1LB 4Z4EA 3VBEA 1DAOA 3TR6A 4AZ0B 2TYSB 3IVAA 4GPD1 2XB2A 3AILA 1A9TA 3FAZA 4P2GA 2R5WA 1FDSA 1ORWA 1ANKA 2NXCA 1MO2A 2AYXA 2R62A 4L85A 2JAUA 4MVJE 3TBHA 5C37A 4RK7A 4BBAA 3LL7A 2RD2A 3QUCA 3DDUA 4JIMA 4EY5A 1C7JA 1OIXA 1TQDA 1PAUA 3JQFA 4FGKA 5DN6D 1E2LA 3LA8A 2EU8A 4Q9IA 3B6IA 3UT0A 1UT8A 1GQRA 4OYYA 5BRNA 3PE4A 1IE3A 3AVVA 1AHHA 1Q74A 4KBYA 1G17A 3JALB 2F48A 3A27A 1PLJA 5ED4A 3GJ5A 3KR1A 1H5NA 3WQBA 3DWIA 4MCIA 1SJ9A 5KYXB 5EJFA 2ON6A 2BV3A 3AR3A 1YACA 3CA8A 2CJPA 1G9TA 3Q85A 1GEEA 1XROA 4LK2A 4QD3A 2OHIA 2F9FA 3ZHBA 2X86A 1E2QA 1E1RD 1G6HA 1VSVA 1DX4A 2RC5A 3Q7IA 3WWOA 2FFHA 4ZI2A 5JDCA 5G1OA 3NEJA 1G3QA 1NBWB 3QF4A 4BV8A 5JD6A 4WESB 5ALSA 5EC8A 1W47A 1XA3A 2A88A 2C7GA 2EF1A 2Q99A 4JC8A 4LDZA 2V54A 3IDFA 3RRZA 3UCEA 5CJ2A 2DY1A 2OYCA 1RQXA 3MAJA 1KR2A 1UINA 1VFNA 2BC9A 2RI6A 4IFEA 4K03A 1RM4A 3R3SA 4HX9A 4OAQA 2ZANA 4RNCA 4XR9A 2WIGA 5AJXA 1UANA 13PKA 2GDJA 1AKMA 3U62A 1P1CA 5JYEA 2KS6A 4YBRA 5DXJA 3AY7A 3VC1A 5JYBA 4NCHA 3QNUA 2ZZNA 1E1RA 2O1EA 3E7XA 3FBGA 3HSSA 4GMXA 1YQQA 4M9SA 5FBLB 2GJ4A 3M6AA 3HLKA 2YV5A 4UW9A 4YRRA 2RB4A 3UAOA 2WAAA 4WAUA 3EGVA 4HR7A 2I80A 4J1TC 1RAHA 3GFFA 3ROPA 4O4LA 5DTEA 1BZYA 3IQGX 3FJOA 3KKQA 5KI6A 3WKDA 1Z9BA 2XWBF 2ZYTX 2VDWB 2FZEA 2JKZA 4EUHA 1ZN8A 5D6NA 1B41A 4AKTA 2CLMB 4TMFA 3UUFA 3OTGA 1Q7EA 1KH3A 5JBIA 2G1AA 4UM9D 3KELA 1NZDA 2UUAB 4F3TA 1GM5A 3RFVA 4EEXA 2KSQA 4R2XA 1WPXA 1R8QA 3MWEB 4TMWA 5A4FS 4ZOQI 3O8LA 1P73A 2CJFA 2B7LA 3WMWA 3D3QA 3H5OA 4JBXA 3QBJA 4PANA 3RS9A 1CXZA 2ZYIA 2GVNA 5IKXA 3PEWA 3O0TA 2PVCA 3UMSA 4LNAA 2Q0SA 4Y0VA 5J4LA 1G8FA 1DKOA 3AHCA 4HNSA 1EVEA 5CYPA 4U5XA 2OBYA 2FW0A 3NHMA 4I1IA 3BIXA 4MCJA 2H07A 4EI7A 5AOVA 2DTEA 3CR3C 4D02A 3D8UA 5HGJA 3M89A 4D3YA 1LFAA 4I5DA 3U1BA 1OI4A 1O94C 3LHKA 1OC4A 4OVKA 3K0SA 1E2BA 4BLOA 1Q83A 4ZVKA 3VPDA 4PTLA 2PGJA 4WBNF 1TPZA 3L6DA 2G7MC 1UM8A 2W48A 1QQ5A 3QPUA 1RRFA 2RHCA 3CFYA 2R5FA 4Z1MA 3AESB 3ZW7A 5ICEA 1KVUA 3SX0A 1KO7A 1D0SA 3GH1A 1OYOA 3A0RB 4QUIA 5FV7A 3T7EA 1V45E 2XLCA 3NOOA 4P80A 4N6NA 2HL6A 2YXPX 1ZZGA 2JGEA 2O14A 4U2CA 3I5UA 4M89A 2IWRA 3RSSA 3HKCA 5M2QA 1XF1A 5JIBA 3W8NA 4ZYXA 2O3RA 2YBEA 2CCKA 2SCUB 2XTJA 3L7JA 4MDYA 2C0CA 1XLTC 1ETUA 2LPMA 2W9XA 5EUBA 3ICQB 2HAEA 3SSNA 4CNBA 3OWOA 3BPSA 4CKZA 4U3JA 1BXRA 3MWYW 3ESXA 5BRJA 3Q8LA 1R15A 3W6ZA 5E38A 2GDZA 1ZGHA 2APJA 5C1DA 3PGA1 2VZEA 3TLGB 1RI4A 1DT3A 2XX3A 6GPBA 5FPKA 1DTEA 1JQ3A 1T4CB 1XXLA 4PYNA 4TL7A 1K86A 2CFSA 2D13A 5HE8A 1W9HA 4LJSA 2GCIA 4O4JF 1J0DA 1OXTA 1OY1A 4XW2A 4CV3A 1TFRA 1GQFA 4RWEA 1SVWA 5CVEA 3CLRD 4YK7A 1EWVA 1ZONA 3ADPA 4ID3A 1WABA 2BGUA 4URWR 3S7TA 3UJNA 3CZ4A 3ENKA 4TS1A 2E37A 1UKZA 3LG2A 1D7AA 2IUSA 3PDJA 3HO6A 4K86A 2GMWA 4D7AA 4DR3B 3RSFA 4DA8A 4DDUA 4ZCLA 1QC5B 1DEXA 3IT0A 4LV5B 2C4WA 3HADA 5KNCA 2RHTA 3RS0A 2JA1A 5CFRA 3AM4A 1ISRA 1Q5PA 3EA4A 3WR5A 4AUNA 3ZH9B 1T9HA 1P0MA 3RHSA 3K6RA 3GMTA 1YVEI 3HPQA 1V0JA 4Q3NA 2I3AA 3TSWA 2DUUA 2C88A 1F2TB 1UOPA 3AK4A 4MUJA 2AUNA 2REXB 1TW2A 3MRSA 4D9JA 2GZAA 2QT9A 3A2LA 2PXHA 3FWZA 4NZPA 1IB0A 3LGSA 1USWA 2KB0A 4LZPA 1CRWG 2F1RA 4F2DA 2BGWA 2OBLA 3MD9A 3NHRA 3V1YA 4WPGA 5ENDA 2REQA 1NY5A 1XQ1A 4HLNA 3IP5A 1O9BA 4XUGB 1LPNA 3FUWA 3MFYA 3A26A 4TS9A 4CIYA 1HLPA 1JPVA 1RLJA 2AXQA 2UUPA 3K9LA 3MB5A 1ZMOA 3NETA 3OWHA 3STHA 3SXPA 3W6OA 4A8JA 3VTFA 3VDMA 3E6AA 1UIMA 4TQ9A 3UKDA 4OLFA 3U1TA 5KUTA 2V58A 3A3YA 3LPCA 3MJEA 4HDKB 1W36D 4GWGA 3OEYA 3MRXA 1DQZA 3EVCA 3JWGA 4RH3A 4NV3A 1RAIA 1I32A 4IG4A 4YA6A 3BFKA 1NU6A 4JWTA 1JHOA 4ZQFA 5JJBA 5MF6A 4UQPA 4GKJB 1J1UA 4EAQA 1BCSB 1EPUA 2Z6AA 5AM1A 4QBFA 2GBIA 3GXBA 4LF7B 3MSCA 4E08A 5ALKA 4QEKA 1L9XA 5FL3A 1EVQA 3L9WA 2VJOA 5DM1A 1SHLA 1W52X 1ADBA 1GKYA 1PG2A 1GNLA 2JVKA 1M67A 4ENWA 3KZNA 3HJFA 2YYZA 1OW3B 5BR4A 6PFKA 5BQ5A 4CU2A 1A4RA 1T4GA 1UBUS 2ATVA 3EGXA 4ZOLF 1YMQA 4NCAA 1RBQA 2DFKB 2ZUDA 1V43A 3VV3A 4H7DA 1KIAA 3SY8A 3GLGB 1CNMA 2C0PA 3AO0B 1CUAA 2P2GA 3OICA 3SJBA 2JGAA 4OI1A 1X13A 2WSYB 4J8PA 4X95A 2VPWA 3Q9UA 3ZHZA 1W1WA 3K0CC 4DMHA 5ALVA 4WA7A 5FNVB 1CUWA 1JA9A 2WIBA 3Q1KA 4YVFA 3WLHA 3L6UA 2A4KA 3SDZA 2C3PA 3DDZX 4IKPA 1D4AA 1GFZA 1N2OA 1Y6RA 3O9ZA 5CBKA 2PEYA 2ZIVB 3PR3A 3GNQA 4WQMA 4ARVA 3REOA 4LISA 2IE0A 2FOIA 1IL0A 2I7CA 4ISCA 1VSUA 1RQNA 4ROTA 4D0GA 3GJ4A 3B5EA 1K75A 4L74A 4PLHA 2PLAA 3ESZA 3E53A 4CLHA 4BCCA 3N2LA 3PVSA 4HWKA 5DCLA 4RABA 2HHCA 2OGUA 3QUQA 3NJRA 2VQEB 1COWA 2Q4RA 4H31A 4E12A 2R6JA 4M0MA 5LWQA 4MQMA 1Y4UA 3ROMA 3O1JC 4HO1X 1ESEA 3BWMA 3PUWA 3RQSA 1DV2A 5K3BA 5D5HA 3TZHA 1Y1KE 1IZ8A 3DT9A 5DGCA 3EZXA 1JR3D 3EEFA 4OB6A 2A5YB 2PZKA 1J23A 4IIBA 2GBCA 4KQIA 5ALOA 4PO1A 1GRQA 5LYJA 4TX1A 4LYFA 5KB3A 3ZDFA 1A9SA 3N0TA 2LRHA 1M2NA 1ZJJA 1KSFX 3L6RA 3QX9A 3LHIA 4N7BA 4DV5B 4AY5A 3KD2A 5JEEA 3AYZB 3QLJA 4EA7A 5KAMA 4YR9A 3B1VA 3LV8A 4QT4A 5C8ZA 2VNAA 1II8B 16PKA 4IUCS 1R6AA 4UC0A 4XYGA 1WZCA 1P4GA 3E15A 3SR0A 3O73A 3T5AA 4MKZA 1T6XA 2PZBA 4KFUA 4ZMRA 2ERCA 4J1SA 1WUTA 3L4SO 4EF5A 2Y1XA 5LUBA 1OSNA 1OFHA 4IXDA 2YZKA 1GRNA 1VYHA 1CS0B 2G67A 4L3WA 4X1YA 1NMZA 3WWPA 4EJSA 4LHSA 1HWYA 1NXSA 3T3PB 3GJ7A 2JGIA 3TPZA 3L7MA 5JD5A 4OQDA 1ZSYA 1G21A 1MIOA 4TLDA 5ICSA 3KOWA 2PZ8A 3HC7A 3IO5A 5KS2A 1HLDA 1PCXA 3KSUA 4ABYA 3K70D 3EVTA 1WW8A 5J63A 3RFTA 1P0PA 2FPGA 1EUDB 4HJRA 5IULC 5JQGF 2XZLA 3ZTYA 2ZIWB 4KPYA 2ZT7A 1NBME 1TU4A 3DBOB 2VCHA 2Q8NA 3PHIA 4NNOA 1PWEA 2HWXA 3BEDA 3EY4A 2X3YA 4Q4HB 4CTMA 3TEMA 4ZHQF 4UJ5A 1THGA 2FR8A 2JS7A 4ALNA 4O2BA 1GV1A 1J56A 2PANA 2RH9B 4YYEA 3L8GA 4TQAA 4ETMA 5BN5A 1CYEA 3LT0A 1A8QA 1JEYA 2VTVA 2VUSA 3CUTA 2WWGA 3PXCX 7AT1A 3DONA 3GMIA 1ULSA 3C48A 1E5TA 2R96A 3ZZ0A 4BV3A 1L5NA 1XLVA 3P45A 4ZK6A 1VTKA 2C2XA 3ILSA 2W2KA 3S44A 1IY2A 5DBGA 2W11A 2I55A 2ZWMA 5AW9A 1VSQA 4UFPA 1KBZA 3KX2A 4E09A 4YQZA 3C5HA 4PRLA 1SCIA 1VSTA 3L0IB 1F60A 3I12A 1KC1A 5EIFA 1SKYB 3H04A 2HWWA 2BGGA 1MEOA 2BD0A 3FB1A 2EP5A 2JLRA 2VSOA 3ND9A 3IEVA 5JAHA 4P7KA 5D7BA 3G85A 1Z13A 4P5EA 1DAPA 1ESCA 1JIQA 1BH2A 1KH1A 1L4BA 3PI6A 3OWXA 4BN0A 3AR7A 5E9WA 4KQMA 1CVLA 4Z4CA 5CA0B 2D7JA 2GLXA 2ID8A 2FW6A 2QAGC 3D6VA 4MKIA 5EHIA 3WL4A 3UWOA 4MLDA 5IM4F 2G0NA 4R2HA 3JXEA 4U2EA 4OX9B 2X0NA 3IE0A 4DABA 2Z4RA 5CX4A 1FLNA 1Z26A 3UIEA 4BKUA 1RR6A 3LDUA 5CDUA 2NWQA 1PV4A 5ECDA 5C35A 2A35A 4JEHA 5A4KA 5JS8A 3GDWA 2EF0A 4MQFB 2P6MA 4Q4AA 4XSGA 1ELOA 2SKCA 3ILYA 1ZNWA 3PQ5A 4II2A 4LMRA 2NV6A 3RHTA 4A92A 4BRUA 4V0ME 4DRXB 4QBIA 3CUSA 5E6SB 2FEXA 3D0QA 4IDPA 4QBGB 2GEDA 4N3BA 3FHTA 2QI9F 5J9FA 3P27A 4LDNA 4U7JA 3DUFA 3LCJA 3GPCA 1B0ZA 1YB5A 4QNMA 2OBNA 2NSLA 1T2CA 5B7NA 2IOFK 1J90A 2OLEA 3MT0A 2C5BA 1ZL0A 3NQ41 3OZUA 4QPCA 4DUYB 3A9SA 3PGMA 3QKSA 4IINA 1UOEA 2VRNA 4DIKA 1JEQA 1SCKA 3IUMA 5HJEA 2NUAB 2C4HA 3HHPA 2I22A 1OAOA 2AB0A 2F3TA 1J0AA 1G1MA 1TM5E 4Q7EA 2G9NA 3IQDB 4I55B 4E7PA 3WGGA 1IPEA 3RRMA 2MHCA 4PEVA 1V47A 4TT8A 1Y6ZA 3VR4H 3WO0A 1HE2A 2OP1A 4YCBA 3WLKX 5K03A 3VJRA 3PFFA 4HXGA 5JHGB 1UMCB 3ELBA 5LA6A 1TO6A 1X8XA 3SX4A 1N2CB 4EPRA 2GCNA 4EYGA 1ZWKA 1Q14A 3IQWA 3TTTA 4V0OA 4WCDA 3SSAA 4RULA 3G1UA 3C5CA 4N82A 4HTFA 5HRUA 1EHCA 3IFSA 1K3UB 3U7IA 3TGPA 3NKLA 1HTBA 5C3UA 1X87A 2H7YA 4CM5A 4I36A 3QMPA 3A4IA 5A5VA 4KO8A 1W4BA 3FPHA 2DYKA 2B7BA 2BUAA 2VAXA 1K89A 3NTLA 3P0IA 4FMPA 4Q12A 1Q0QA 4CUKA 4LPKA 3IP7A 4RJJA 3BCSA 1UZAA 2BP7A 4OLJA 4O4HF 1RYDA 2F67A 2CYAA 4LQ4A 4ER5A 3TZ6A 4G89A 4URUR 4C7VA 1TQ8A 2D4AA 1Z2DA 2OVFA 2VF2A 3PYMA 5AM2A 3KZKA 5DYGA 3NGMA 3IODA 4KQXA 4NFYA 3HYTA 1PE0A 2CDNA 2E4ZA 4QDJA 2ST1A 2ZTHA 3UQZA 5FNVF 1Z4OA 3BXGA 3JARB 4DCPA 1YFJA 3LWZA 1EVYA 2SBTA 3MJVA 4O2RA 1S9DA 1S9HA 2YHUA 4O4IB 4RY8A 5KWJA 2EBFX 4FUTA 2AMJA 3KO8A 5K0LA 3WB0A 3LQRA 4ZVRA 1E9AA 1GR1A 2ZTLA 4YREA 4EZBA 1KOGA 3UWPA 2PQMA 1NXVA 4ED9A 1DJQA 3INGA 2B1GA 1UQUA 1RAGA 3R7SA 3OKCA 5TQ2B 1S02A 4EVIA 2HQSA 2Y68A 4YUAA 1KYWA 5KOHA 4AUKA 2F4VB 4N6GA 4XEUA 3E9RA 2PWYA 3IR5A 3IQFA 1GCUA 3VZRA 1YCHA 3FSJX 3MOSA 1C0EA 1DAFA 5K0EA 2RE8A 4XB2A 3R7NA 4EFDA 2ZATA 3E0QA 2D2VA 3OE7D 4YUWA 2R0QC 4B3IA 1FNCA 1PS0A 2BFWA 1FFSA 2GNOA 1W75A 2VQDA 1ZQ1A 3CSDA 5G4KB 1C7ZA 4Z7QB 1HNWB 5HKOA 1NTRA 3ZCPA 4L9SA 2AJ8A 3VNBA 1QE0A 4JB0A 2VPXA 3RSHA 1VP3A 1E2DA 2HSWA 4KAJA 1UFQA 1WKBA 1RJGA 3B13B 3OLQA 4K46A 5B12A 4WERA 1VL1A 1TI7A 4DVJA 5KREA 4JSYA 1M5RA 3I28A 5J2TB 2Z3ZA 3QVGA 2ZUSA 1XZNA 3KG2A 1HDRA 3DAOA 3O4IA 3SSOA 2QGFA 3OE7A 5C51B 4H35A 3I4LA 4Z9XA 2OV1A 2QKYA 3B70A 4I50B 1BWSA 3OE5A 4NHOA 1JG3A 1OZHA 5GAJA 5IN4A 5DWVA 3DTVA 5BQOA 5JOQA 1G5TA 1OTHA 4ACAA 1S2IA 1XK7A 2G1JA 3NIGB 2ZK7A 2O7VA 3MJHA 3NKVA 1U8YA 3AMVA 1Y1PA 1JAIA 1U28A 1YULA 1U90A 4JMLA 1QAOA 1EUCB 3LNTA 5E95A 3W2TA 4LBVA 3V80A 3E9EA 5BQ3A 1ZICA 5BNIA 3LQYA 1KJ9A 2D2EA 4EHIA 5JDIA 3ZE9A 1KSJA 1ZK1A 2CXOA 5CCDA 3LUDA 4AF8A 5JG7A 4NMMA 1TM2A 2WTUA 4RA9A 1Z2AA 1GPDG 4HJXA 4MPJA 2NU6A 5CMLA 4CFYA 5C2JB 1GO2A 4BNMA 2PXAA 2ZSEA 4R6WA 3DZBA 1JSLA 5I7OA 1PVOA 1YFLA 1YIDA 2EDCA 5CXXA 4YCNA 4GXRA 4I2VA 1T2VA 1R4NB 3K35A 3I58A 2GZHA 4CM7A 3D6JA 4HQNA 4UZEA 3LKZA 3ZNQA 2P9YA 4R05A 5JZBA 1TU3A 4KXYA 4X92A 4W8GA 2O8EA 1F7VA 2HA5A 1TGVA 2ADOA 3E7WA 1RWVA 3QVOA 4BE7B 4DJ5X 1RYMA 4RENA 4CCAA 3TIIA 3STYA 3RC9A 3QNWA 1SC9A 1C9NA 5SY4A 5HOEA 1M8GA 4NSNA 3MGCA 2PKEA 1HDGO 5L3SA 2O2IA 4FDVA 3D3EA 1OBOA 3BDVA 4GLOA 2GK7A 2EV9A 1CIPA 2GZ2A 3M4YA 3W05A 4BKRA 5U1PA 2AN9A 3N0WA 3ZVRA 2EBHX 3ACCA 3DL0A 3CNEA 4ZXPA 1M10A 1VKJA 3RFCA 4AXXA 2YJGA 4B0OA 4AAYA 1MX9A 1ESDA 1AS0A 5LD2C 2BI8A 2B8NA 2WUDA 5A5GA 2GXSA 3WNVA 2AG6A 1UBRS 4GBJA 1XDSA 1C4XA 3FNFA 2QJRA 4YQEA 3OFVA 4YRCA 2JVJA 3NAZA 1KXJA 4RFSB 3SYMA 4DM4A 5T6MA 3IBTA 4YMUA 4D9EA 4C2UA 2UVPB 2Q07A 3VPHA 2XT0A 5CA0F 3JX9A 3HJBA 2E5LB 4NYIQ 1XD8A 2RJ3A 3W6UA 4GOXA 1JG2A 3QTBA 3FNHA 5AW5A 3RYIB 1UJCA 4MRPA 5JAIA 1XD9A 3QVMA 2Q1YA 4RTLA 3ZHTA 3U4DA 2GA8A 1MG5A 3FLMA 3AF2A 4GMKA 1UJ6A 4Y2PA 4JA2A 2X3FA 4F7WA 1Z7BA 2M2IA 2CCGA 2QMQA 3GOQA 2RGRA 1JQ5A 2VJCA 3BFJA 1WCV1 1ZVQA 2JFBA 3H13A 3IALA 1P18A 4HNRA 4R9RA 4R1OA 1HDYA 3VZQA 3CX3A 5CTAA 2J7PD 1U2GA 2HCRA 2ACVA 2JAXA 3FN4A 4PYIA 1T3LA 3L8EA 4XJVA 5TX7A 3W9UA 1PV2A 3RWBA 3I6MA 3QOXA 5L53A 1QIHA 1KMHB 4U39A 2WSBA 3DZCA 4AM8A 3HBAA 1B7GO 1DAMA 2Z9CA 3LP8A 2IS2A 1V5IA 4KIGA 4QPDA 3DFMA 4W6QA 3UFBA 4OJYA 5FA6A 1YU6A 2C42A 2G36A 1NI4A 1YOVB 1GCAA 1ECPA 1LDNA 2BAGA 3B1XA 1RXUA 3KJHA 3NBAA 1PJQA 3QE3A 1M8KA 1XZAA 4FFPA 4BYGA 1Z5WA 4JYCA 1XN1A 3GVCA 4IYRA 3PX3A 4HDNB 2EXXA 4LC1A 4QGHA 2YNMA 4W1SA 3LU1A 3FGZA 3WRXC 3MGBA 4BLSA 1U2EA 3C70A 4PN3A 3DGEC 2BR3A 3E5MA 4Q9DA 1UZUA 4H1VA 4PAWA 3ZCQA 5A7HA 4OJTA 4V1CA 1SRRA 2H2HA 1A72A 5DYTA 4EI8A 2GKSA 2W2TA 3EF3A 1ZFNA 1TRKA 2JFFA 3GZTB 4IMRA 3QKRA 1NX6A 2JNWA 1TYBE 4ZODA 5ILQA 2C59A 3NBKA 4HWPA 1UAAA 3L49A 4XM1A 2NP7A 5LQAA 1RI1A 1LJLA 3DDOA 3G89A 5K3FA 5IWAB 4V02A 2IUEA 2Q1TA 3GWZA 4J91A 5E7JA 3HGTA 4TYMA 2BE7A 3TOSA 4YMHA 3RJTA 3EDQA 5CVUA 4K2AA 1YF3A 1IB6A 2PCJA 3P19A 4R5MA 1MJHA 5FR1A 4BX0A 1N7JA 3FMPB 2VAWA 2HIMA 2EIXA 4PS0A 1KHTA 2FZVA 5FA8A 3SU8A 3FOZA 1E2EA 2YR0A 1YJAA 1USUA 1Q7GA 3JVIA 3KAPA 4G0QA 3RTEA 4F2PA 1G59A 4A6DA 1MR3F 5IUKC 4D5GA 3VDNB 1XA0A 1G5PA 1NN1A 4JBYA 4M22A 4TLBA 1NW8A 3SVTA 4QBHA 4A4DA 2P35A 3K8OE 4YP9A 4WNCA 3FVTA 5F7JA 2CJWB 1UMBA 5IT5A 3PEYA 2YXDA 3L4KA 3DBIA 1T6NA 5DYIA 4LS3A 4NOMA 4IGFA 3NIDB 2GZMA 1BGXT 1SVLA 1FS6A 4MIKA 2YHAA 4GAEA 1FTSA 2RG1A 4PXSA 4U6SA 2A92A 3AFMA 3QBVA 1EX7A 1MOSA 2C9MA 1H9BA 2BISA 4GRDA 5JALA 1XTBA 3M83A 5LQRA 2VDVE 1LC3A 1TCCA 4OH7A 1DG9A 1R5BA 1PDWA 2IHKA 3B78A 4ZT3A 1KTVA 4LJ9A 3T7DA 4R51A 3GLKA 4EG5A 2PKQP 2VO1A 1Z0IA 1NWCA 5KTKA 3O74A 2XRFA 1CUIA 2BFCB 2VKQA 1Y33E 4JAVC 1F8GA 2NZ2A 1JN0A 5KKCA 4CMAA 4NJMA 4ZCRA 1VXRA 2BFEA 3JU3A 5LQMA 5C0OE 3HCEA 2D1TA 2GN2A 3AVOA 3LW8A 4JL6A 1BQEA 1W94A 3MWJA 1W2GA 3THYB 1QZUA 3UV7A 2JFOA 2VHQA 4CYMA 1WMFA 3RV4A 3NT4A 1TEXA 2QQ0A 2FZLA 2WFMA 4Y9DA 1WHTA 4GUAA 1AXEA 1Q1NA 2JI8A 1HT1E 3TSZA 1YCDA 3DV0A 1HDEA 2GPSA 3AUYA 1NXQA 1YK0A 4UHHA 3C5EA 2J5QA 4Q03A 3EH2A 4TV9B 4N5LA 2ZWVA 1LPOA 4BTEA 5I4BA 1H66A 3Q7RA 1DKLA 2C5AA 3IPLA 3FKSD 1VPWA 4I50F 4ZRMA 1ZN9A 3A10A 2VVTA 2PM8A 3L6EA 1Y5NA 1X7WB 4BWFB 3B53X 3I2YX 1N9ZA 1CQIB 3AERB 4D41A 1N8TA 1R0SA 3RLIA 4QUKA 1KI7A 4XWGA 3X1KA 1HMPA 3M34A 4MMYB 3R5HA 5JXIA 1Y1LA 1XG5A 4FKZA 4ZQGA 4UEQA 1OLOA 4H18A 4R8VA 3FYTA 1UIRA 3C1TA 3QFFA 1PI3A 3FKSA 1DC3A 2CD9A 5BSWA 1O77A 4K81B 5GJCA 4CEHB 3TSYA 4DNPA 3WWDA 3H1FA 1UDCA 5HF8A 2C9DA 2FR0A 2DT5A 4RCZA 4L22A 3RKRA 4BFZA 3FCAA 4A2CA 2FW8A 3MWKA 2H11A 2WU8A 2XTNA 3IAFA 3IURA 2ROQA 4UNNA 5HK8A 1H85A 3WIUA 1Y37A 2Y99A 4J0HA 3AKEA 1U5BA 3LKBA 1AHPA 1TVKB 1TUEA 1BW9B 1OA1A 3H65A 1LJUA 1EK6A 1ZUD1 4G1CA 4J4HA 1I10A 4KIFA 4MWDA 5DO9A 4PIMA 4D80A 2QJTA 1Q6YA 2I4LA 2PLFA 3O3OB 3U2QA 3GLFB 3INRA 2V0CA 5JE8A 1ADYA 3AOEA 2UUBB 2NNWB 1S8OA 3NFRA 2C9YA 2P7HA 3HSYA 3LM8A 5JSYA 4GM4A 3WP1B 4AJHA 3Q7PA 2ZSJA 1EK5A 4TUYA 3PNQA 1PSDA 1CY0A 1USGA 5A7GA 4FFWA 3VHRA 2C54A 2EL9A 1IEWA 5REQB 4IFBA 2Q5LA 4GZMA 1XFDA 3QMVA 4F4FA 2CXSA 4LG1A 3RC3A 3IBYA 2C7QA 4ID9A 1Z8FA 4PC7A 4Y6PA 1ZOLA 4PIVA 3ZU4A 2PUBA 1UKEA 3D02A 4H6VA 4O8ZA 3A1SA 1G2QA 1YQXA 4A8PA 2AA3A 2NUBA 2ZP1A 1NJ5A 1CF2O 1PD0A 1Y6JA 3MFQA 4OQXA 2HNAA 4Q9LA 2JATA 4O1IA 3SYTA 3ONFA 4BNGA 2DFDA 1U1IA 3KVNA 1U1GA 1BN7A 2RHOA 3OBIA 4HX5A 1APBA 1JKMA 4RMNA 5F4ZA 4KNYA 3NDJA 3GJ6A 5HJ2A 1U3DA 1E1MA 2WSIA 1KBOA 1SA0A 3VKFA 3VTZA 1YIAA 1P81A 1TMGE 2R00C 2IHYA 2QL5A 1LI7A 1P2TA 3C7DB 4PYRA 5EIOA 3BTOA 1W6RA 1C3JA 2D5CA 3FFBA 4RVNA 5JFTA 5JMWA 1J1IA 3CMMA 5I8PA 4GX2A 1L5HA 5HR5A 1KARA 3SQXA 2B0JA 2BKLA 2GR9A 1E9CA 2TMKA 1YRWA 1K63A 2GN9A 2CLSA 3WLNA 3QV2A 5AOCA 5JECA 3WGTA 2BTQA 4NMHA 5GIOE 3ZPXA 2HSDA 3UA3A 2CY0A 1JHQA 3REFA 1R6BX 2QRGA 7REQB 4C7OA 5KX5F 1QPBA 4FCVA 4JGGA 4JI8B 1CEQA 1D2CA 3W3ZB 1MABA 2G3YA 4UHBA 1M7HA 2GM9A 3DXXA 4IRUB 4PPQA 5IK2D 1G20A 4DMMA 4MW6A 1AV6A 1ZI8A 2H7VA 1Q16A 1AQLA 1X9GA 3AI1A 1CIVA 4C9BA 2DOKA 1OYWA 4HNUA 1R3DA 3BD6A 2VSFA 2HFJA 2IPAB 3G8DA 1QH8A 4TYYA 1UPBA 2YH2A 2I4TA 2W58A 5CFPA 2G5PA 2Y92A 3H5TA 3N39C 1EI9A 4RAOA 3R3WA 4AY3A 2Q5JA 4ARIA 2AR7A 1J2JA 1X0XA 4K28A 5BYKA 2HV8A 2H85A 1LDMA 3OMLA 3NYQA 4HB3A 3MWDA 4RDCA 4HB4A 1UBCA 4YAWA 5IK2A 4KLZA 4UOZA 4M6WA 5KHOC 4TZ0A 1NV8A 2FQYA 3HLTA 4L0DA 4JUAA 4Y2TA 1ZM9A 5ALRA 4RZ3A 1JDUA 2XNHA 3OIYA 2JHPA 1X86B 1NONA 2IY9A 1PVDA 4QOSA 3IJEB 3IAS6 4BO2A 2B7CA 4F6RB 3NWJA 3TRFA 4EHJA 3MQFA 4W63A 4BLTA 5JH7A 2RKOA 4XOUA 1Q7TA 3GB9A 2HWUA 2R11A 3VPAA 1EXMA 3AGQA 2OCPA 1VJGA 3EZ6A 4YRGA 1F2UA 4XIGS 4JLSA 4Y0NA 4R2WA 1Z33A 3INTA 3PV0A 4EG8A 5A5FA 2NIPA 3HDQA 1SUFA 3H7AA 3U1VA 4M1KA 1JBKA 2R6DA 4HAVA 2DH6A 3SOZA 5EJIA 1GAEO 2AE1A 1DWPA 1PDVA 3Q9NA 1ZLYA 2FPLA 2ZB8A 4MO2A 4ER3A 5IZCA 2P27A 4OHYA 2JK1A 5A4IS 1JHYA 3FRHA 2JPDA 3HJAA 3C24A 1K97A 2IA5A 1J42A 2PL1A 3IGFA 3SX2A 4D81A 3V46A 4PCLA 5JCOA 4H1WA 1YBVA 3DE1X 2PTGA 1QFXA 3S40A 1BC5A 4DIDA 2UXDB 1M6YA 3KOZA 4NU0A 3KYBA 3OQIB 1OH5A 3D7KA 1TIPA 2BFBA 3CZMA 3K0KA 1PT7A 3LCRA 1JSZA 2M6KA 2ZIEA 5D87A 4D9MA 5CDTA 3EWNA 1YXMA 2BFFB 1EDDA 1T4BA 4QATA 3OEWA 1CDDA 1VGVA 1HQCA 5I7HA 3AF4A 3RDPA 2CUTA 1D2GA 1JKJA 3VYVA 3A06A 4IH4A 3ZK7A 4DCJA 5JZOA 5LMNB 1JLKA 1N7GA 4B35A 5BQPA 1OH6A 3IXQA 4OHWA 2QLTA 5CFNA 1M6VA 2PGDA 2HXSA 2VT7A 3NH6A 4D8VA 4DM7A 3OCUA 2B36A 1E9DA 2FX2A 1ECJA 3PKJA 1DZIA 3UMFA 4LZOA 2AWOA 2WAOA 4RDXA 1NATA 1C7EA 3DEHA 5DN9A 5BYBA 1TO2E 1OB2A 3NJ4A 4G5RA 3QJ5A 5A6SA 4DF3A 3Q7TA 1OPXA 2C20A 1QE5A 3ZVMA 3ASZA 2FRVA 3KPVA 1ZVMA 4QO8A 1FYFA 3ZE0B 4DLZA 4EGCB 1TAHA 1CUUA 5TMPA 1V1MB 3L4BC 2PJDA 4Z8XA 2QSYA 2O7NA 1NQXA 1AXRA 3AL2A 5FEUA 1KO1A 3LQ4A 2ZETA 4Y8VA 4RV5A 3QE9Y 4QUDA 4FYVA 2VZ0A 3C6KA 4Q4DA 3KC2A 3UKJA 2X1MA 3KOXA 2IYEA 1X74A 2Q9BA 1E4OA 1LBSA 4MP8A 4X62B 2VNIA 3W4JA 4WXEA 4MYRA 3WL3A 2C96A 4DLYA 2BHSA 5DXFA 3PT9A 2A9KA 3JQQA 4OOFA 3AF6A 3H1EA 4KTTE 4UPDA 4ZVVA 4WKPA 1BD3A 1PX0A 4JVOA 5F23A 2B20A 5IUJC 1GU7A 2HEGA 2QTWB 5EWMA 4N54A 1G3MA 1VL5A 1ISJA 3NAGA 1UPAA 1L7NA 5EFZA 1PJAA 3ZUPA 2VUHB 4RD6A 4X94A 4RV4A 4RHUA 2FDCA 4DNXA 1B3RA 4ZDJA 4QODA 4F60A 5FYQA 3W06A 5IDQA 4O5OA 5D84A 1VGRA 1DX6A 4E5SA 1V4VA 3H75A 5TY0A 1QVZA 2Q5EA 3C98A 4JXXA 2FP4A 4JYBA 2HT1A 2YN2A 1I1QB 5EXSA 3Q41A 4S24A 3B5IA 5C8VA 1BS2A 1O8BA 4MR8B 2MIIA 2V65A 3RLFA 2PT5A 3I09A 2WTNA 1SKQA 3Q11A 4JKOA 4P3NA 2B69A 1Z2OX 3HY6A 3DG9A 1F7UA 3B1YA 5KVVA 4HVLA 2QD4A 4D98A 2WHPA 4H3VA 2B30A 3EOAI 4NYJQ 3SICE 3Q9LA 4UNRA 5JJKA 3HN2A 2V7QA 2QMYA 2QMZA 2XQGA 3IV7A 2KYRA 2ZIXA 3KJIA 2PZFA 4HP8A 2VPQA 3IP3A 4FSHA 1BEUB 5KINB 2C57A 5IAOA 1ZOOA 3I32A 2FWRA 3I04M 1LDGA 3IHWA 5EWJB 3AUFA 3KR9A 2AFIB 5BW8A 4OREX 3QE0A 5F5NA 2BI4A 3SJUA 3ZGLA 1YR3A 4L9AA 1BGVA 4M7PA 4KRYA 3K2BA 1AZTA 1RBMA 1F1BA 2Y1CA 3ADOA 1VYVA 2I3ZA 1KAMA 2QTVA 4G9BA 1CCWA 3BC1A 4TXMA 3TRIA 1X9HA 5K8CA 1IONA 1FOEB 2P2CA 3AJAA 4JFAA 3TLMA 5LZ5A 2WWYA 4DCOA 1PDOA 3DDCA 4QJ4A 4LYHA 4O29A 3QPWA 4YAOA 3TZBA 4BNDB 2XH8A 3JAMA 1C9YA 2R8XA 4LE2A 1KEUA 3MUEA 4Q21A 2DR3A 3PQDA 4GE0A 4PLTA 4B9EA 1U7ZA 4FBGA 4I81A 5BW6B 2Q4BA 4CQMD 5HZGA 3NUZA 1U0FA 1EFRD 4NYMQ 1U2SA 2JH9A 4IWNA 4B6SA 5HK9A 4GKVA 5H7XA 1BEZA 1FP4B 2XMGA 3SVLA 2XA9A 4H0NA 4OFXA 5TVKA 2Y6VA 4X93A 3T7AA 2A0YA 2QN3A 1E4EA 5IYZB 1FQOA 1U8ZA 4PAGA 1K7EB 2ATEA 3SNKA 4MV0A 4ATNA 1WULS 1YIOA 3AETA 3GFSA 3A32A 3GFVA 3O8DA 3QUBA 4ZO4A 5FWXA 3VTAA 3ZWMA 2EGGA 1YONA 3BTVA 3HYLA 4KXWA 1PTKA 3AB7A 1HYQA 1JU9A 4KR0A 5H3LA 5EJ4A 2W6CX 3LY5A 3PLRA 4KUEA 3ZY5A 3KLNA 5F1KA 1I0LA 4CQMA 5IF3A 2HU8A 3BM5A 3TFQA 1EFRA 1RJ9B 1OPRA 2JW5A 1NG1A 1WCXA 3AB3A 3I2KA 3ZKWB 3EGDB 4M36A 3ZWNA 4RSHA 5K45A 4MHTA 4UCWA 4D8XA 4Y1EA 1RWQA 3TR0A 1GAXA 1H2HA 2IEGA 2PPLA 5IBRA 4QG3A 3LCVB 821PA 3E3NA 2YCLA 3E22A 4FMBB 1TFUA 5EZYB 1PG0A 2OG1A 2QROA 4H7EA 3L41A 4D9HA 4M9UA 2CZGA 1Y3BE 2WG0A 4X7PA 5HQTA 1TZBA 3KKEA 3JTEA 5BO5A 2RHLA 3R75A 3WYBA 2H1LA 2D0IA 5EY5B 1VLHA 1XRPA 4LOAA 1UMKA 4WDRA 1QHHA 4PLVA 2AN4A 1Z5ZA 2FEWB 1XTJA 2NXWA 2ZPTX 1IN8A 3A1VA 4Y7DA 1K4MA 3EH1A 4QXRA 5FBWB 5TT0A 3TPCA 1OD6A 4TKLA 1M74A 1JFTA 1N0HA 2AS0A 3QV1A 3UV6A 5KDDA 5C52B 2R8YA 4QU0A 5T8KA 1B15A 5CX1A 5GV7A 1I01A 1W93A 1F0NA 2FN3A 3R5SA 3P4YA 5BVGA 4TTQA 4C04A 4U2GA 3LT2A 3QM1A 3UXMA 3WLOA 3TNDA 2LBPA 2PVPA 2XA1A 1GUFA 2H0AA 2HJSA 3BHMA 2RG7A 4RA6A 4BV9A 1EZ4A 4D8UA 4EA6A 1Y82A 1Z16A 4YB8A 1B8UA 5J1TB 2IHVA 3GLQA 5LU9A 2GAJA 1JMKC 4WOJA 3GLHE 1KYZA 1T25A 2FNAA 4ZVQA 1A9XB 5EJEA 3DYBA 4I4CA 2QU8A 5K3AA 5BR7A 1GTG1 4JP8A 1SXJD 2GK3A 4BDTA 3TLKA 3NM6B 1QGZA 2BHLA 4BVGA 1MEEA 2JHCA 4UZSA 4GMDA 2CUNA 3DOOA 3KOYA 5E7QA 2XTMA 4TSFD 3KYCA 4XWYA 3CT4A 1KC3A 3GJ0A 3IT1A 4JODA 2FSFA 3VNUA 3UJDA 4G8JA 1W4RA 2XWJI 1J8VA 3BCRA 2FK7A 2XUGA 3TIGA 4QSMA 4JT8A 2DAPA 2DHEA 4UEWA 3ZI0A 2D1YA 5DP2A 3KWJA 4NAVA 1G5RA 4DADA 3RYCA 2CL7X 5KVCA 2F3RA 1Q2XA 1SXJA 1RYBA 4AC9A 3G7UA 4DW8A 4ROSA 1JKIA 1YH3A 4MNTA 2LUOA 2JA2A 5JTUA 2OZVA 1ISSA 1Q95A 1CUXA 1E9EA 1OKKA 2NSHA 4DNOA 1JI3A 4YP1A 3NZEA 2Y8EA 2C03A 1HBJA 2JIMA 3FDJA 3ESDA 3PNYA 2J0VA 2ZSFA 1S0UA 3H0CA 2OXCA 1PU2A 3JATB 2C58A 2RONA 4AJLA 1QQTA 2HNBA 4ZJZA 1N4DA 4KYIB 2FWPA 3O7WA 4DMRA 1C7RA 4YR7A 4EYQA 4MP6A 1KYXA 1GAJA 2YZNA 2QM7A 5DCUA 3CEAA 4JYMA 1SXPA 1ZW6A 2H1VA 5BP7A 2B8TA 5DGHA 4XWOA 3LYLA 4H3HB 2G9UA 5FTJA 2GZSA 3ETEA 3LYAA 3QTTA 2GBPA 4CKCB 2CEAA 1OI7A 3HBJA 2CHEA 3SYNA 1KAEA 1QTRA 3PIDA 5NULA 4HKTA 2VSQA 4CPDA 2VEOA 2W2QA 3K9QO 3WK4A 4DUGD 5L8VA 4M53A 3VO1A 2F3SA 3QOFA 1C0IA 1W76A 3A7DA 1V3TA 4CMHA 3KTFA 2Q4DA 2EFCB 3CN7A 1Y9JA 2FPXA 3R5JA 3SHOA 3WWZA 5CFMA 5L40A 5LLDA 3WQQA 1KJQA 4KXLA 1BXGA 1AB6A 3JQGA 3EFBA 1N6IA 4XYLA 1E5QA 2GPNA 3PI7A 3O8OB 3EX7C 3KKNA 4WW0A 5AI8A 2ZJ2A 2IYFA 2NUPA 3NNSA 3M81A 5KYYB 2B3TA 4OSOA 5L4SA 4DUGA 1Z06A 2RHBA 1LSUA 5CG1A 5C8YA 3HA3A 2XZPA 1IQ0A 4CKBA 4DCMA 1RI3A 3JD1A 4LDJA 1IBSA 3KWLA 5EMKA 3E2PA 3ZV4A 2OWDA 4ARZB 3U4QA 2A5GA 1GR0A 1IZYA 2WT8A 4L9WA 4B17A 1DTWB 2WV7A 3AEUA 2AT1A 2QGNA 1K9VF 2QPLA 3GRUA 1CG6A 4P0TA 1FRNA 2V96A 5EKUA 4ZVPA 4ARAA 4EHHA 4Z7OB 5LU8A 5CJJA 2O0MA 2PX3A 2EDAA 2JL1A 3VH3A 1CUCA 1SIOA 2IODA 3WGHA 2G04A 1C14A 4C3VA 3O4FA 1C3LA 3M0EA 2H5JA 4P3XA 3RVLA 1E1KA 1B2LA 1P29A 1QYXA 1YI1A 3E3MA 4GBED 4PNHA 2BI7A 1E0JA 5F64A 1Z4NA 2J9FB 2QMEA 3WA6A 1PWZA 1Z6YA 4YRBA 1N8NA 2N42A 2VK1A 2JLAA 4FQ5A 2WVHA 2YCBA 1ZS9A 3D4IA 1F1JA 1R9GA 4FOSA 1WDLA 5DDIP 3SLGA 3RUFA 3MGKA 2OUKA 3IT2A 3UXHA 1KKUA 4MRMA 4X00A 2UDPA 2C5EA 5JJCA 3N0XA 4CM4B 3AXSA 4HNVA 3WFIA 2HSGA 3DC2A 4DS3A 1PR6A 3A6JA 2FN7A 4Q3AA 1NVXQ 3F9IA 2QR3A 1NDUA 3H5RA 2KWIA 3IILA 4U7WA 3FJYA 1GD1O 3ICPA 1ZVKA 3DZGA 2AOUA 3FWYA 4WKCA 4NF2A 2AOTB 4FB4A 3CW2A 1NUUA 2AXNA 4QRDA 1XKQA 4RMJA 3BG5A 5DVZA 2DLCX 1G38A 4E70A 3KALA 5DK4A 1GFSA 4HVAA 3O8BA 3E8MA 4DSAA 3K09A 3MT9A 4RIHA 4HNAA 2HSJA 1UJ5A 4YRIA 2X5JO 3A37A 1A82A 2QRPA 3PL5A 2NPIA 4JT4A 1IXKA 5BN3A 4KOEC 2ZSKA 2QZPA 3GJXC 5KKNB 1FE8A 5JWOA 1TVEA 4UXJA 2WU4A 3MUOA 4G1EB 3HZZA 4G8CA 5EHXA 4JI2B 1HPLA 2G25A 5TS2A 1P19A 1E7RA 5EIXA 3T3DA 1YQ9A 4QDTA 3AUTA 1XZJA 3BJEA 1T2FA 4DREA 3D7RA 4OGWA 3R9WA 4Q6BA 3WWCA 4R98A 3CVVA 1DC6A 3SXUB 1IK4A 1AKYA 5DTIA 3N76A 5JO9A 1T2AA 1TTHA 2DU8A 1NT4A 3HGQA 3DFUA 3QU2A 4FLFA 5JSZB 2XUPA 2VJQA 3TZEA 4DV4B 1SIUA 1R64A 2YN4A 4FTWA 4C21A 2GETA 4JBIA 3WWYA 4YJ3F 4LI0A 1MZVA 4O63O 3IB3A 4HADA 4X61A 4BX3A 4IJKA 1NVMB 4Y1GA 4E31A 3V9AA 5LQNA 4CGZA 4DG9A 1KA9H 3OJCA 3N8IA 2Z1NA 1M66A 5M3BA 2CLFB 5GM1A 3PFCA 5EZYF 1DC5A 4KLCA 1NJ1A 1ZJ6A 3BB4A 4MUEA 2P3OA 5BN4B 4MWTA 5JBQA 3JVUA 2VSYA 3OJFA 5FT9A 2ZVDA 3V8MA 1LEHA 1V48A 5C31A 3RNLA 5DNYB 1YL5A 3IB6A 5LQKA 2UUCB 4KCGA 1FVOA 2JCSA 3Q3EA 3F8SA 2YQ4A 4Z9YA 3SHVA 3WK9A 2L69A 5JJLA 1KMNA 1H4SA 4CLXA 4XLZA 1I4OA 1UKAA 1XBTA 2A9FA 3VAZA 4WK4B 1C4WA 2HI0A 4FC6A 1L7XA 2VHUA 2JAHA 5FBVB 3FKJA 3NDBB 2FMHA 4X54A 4CMIB 3VU3A 2QTHA 1CQJB 1FU8A 3JD3A 4HPXB 1W8IA 1FMFA 3FUXA 4NI5A 1JDJA 1Y48E 4H4CA 3VR0A 1ISIA 1Q19A 3CZPA 1X7XA 3LWNA 1MA0A 4BRSA 1F0YA 4PG6A 5FO0A 1BFUA 1HEYA 1P44A 1E69A 2Q5QA 5GONB 2IW1A 2P4HX 1MRZA 4JP5A 3HNOA 3CZAA 5EE9A 2FUEA 1AK9A 4JZYA 5MN4A 1Z7EA 3Q2KA 3L7BA 1C50A 1WP4A 3RANA 5ESDA 5T57A 3PF9A 2IQ5A 1IVYA 1HDXA 4PYMA 2FSPA 3AOGA 1B8NA 2B94A 3F97A 1XWFA 4F72A 2FF7A 3PB3A 4IGIA 3VSDA 1YR7A 2SECE 4EGJA 4G2NA 2P30A 1EP9A 5KMGB 3ZQJA 1Z47A 1E6UA 2ODBA 1Y9EA 4ACBA 5BPFA 1EWTA 1YCGA 3LQKA 2BJVA 4B79A 1SEPA 3IE2A 2C4KA 1ORHA 4UOQA 3TECE 2AI3A 3NIFB 4HLUC 3SS8A 2C4MA 2OCXA 1DOHA 3QGMA 5HUJA 3K6SB 4N4AA 4FYPA 1W5BA 3NEPX 5EMMA 4PG5A 1CT9A 1E1QD 1GCIA 2NZXA 2V6MA 3GEHA 3GR6A 3TZCA 3K2EA 3THOA 2QG9A 1GQ2A 4GP9A 2OHJA 4LN1A 4IILA 1ZIDA 2YWHA 5IC5A 1FYXA 1HRDA 3M1LA 4GQIA 4BLWA 4B6EA 2BZ0A 4H16A 4OATA 5GOTA 4XIIA 4AS2A 4G0WA 1K7SN 2LDXA 2WHYA 4YT2A 5CB0A 1Y8ZA 2BEKA 2ZTVA 2YWBA 4WINA 3EAGA 1WXDA 3G0DA 1E1QA 4B4KA 4EJSC 2LP4Y 3EXFA 4W8OA 5EUQB 1WKVA 3ZWCA 3JQBC 1QIMA 3M5DA 4MYDA 3AV3A 1TIBA 3N74A 2QRNA 4DY6A 5HOQA 1B23P 2HWYA 3ISJA 4WZBA 4JJEA 3ZQ4A 4BN4A 1B76A 1XT6A 2FHSA 1ZMXA 3E18A 2PA0A 4FYMA 3U3ZA 2BGNA 1EMDA 1GGKA 1RPZA 2P6RA 1OZGA 1ZMBA 4X97A 1YR6A 1VIDA 2DFVA 4QJ3A 3KLPX 4YMLA 1THZA 2X6RA 2CLIB 2G76A 1SZCA 2XUAA 2Q2QA 4YMVA 1PZEA 3QEJA 4O2AB 1JEAA 2I71A 1NFFA 4IHJF 3ZHCA 3AR5A 1ZG3A 4RLHA 4FW9A 3TFWA 3PXUA 4D3XA 4JI6B 1YCFA 1NR1A 3E03A 1X1BA 4LNHA 5HVNA 4C6SA 2IX3A 2J0UB 3SC4A 1K8YB 1CY1A 3HKEA 3EC1A 4Q9NA 4NK4A 4O08A 5JJ5A 5HDBB 3L1VA 1HEIA 1UCFA 3HYNA 1XVIA 1X1AA 4AF6A 3BORA 2NYUA 3VKWA 1TUGA 2NOAA 3HCWA 1NM5C 1R6TA 1ZGCA 5GM2A 3UICA 5K0ZA 5GINE 1XTIA 1ZHHA 1DSSG 1V2HE 1R9MA 1GNRA 2FZWA 1QPGA 4DLXA 4FI3C 5B64A 1NXOA 2XPCA 3HCAA 4MWGA 1ADJA 2DQZA 2NZWA 2WSSD 4MK4A 4L08A 4LRQA 4N65A 2CJYA 5DNCA 3OJOA 3C3EA 3P9ZA 4AN0A 4C5AA 3TQCA 2XR1A 1TZMA 3BMQB 2QVCA 2ZLBA 4XDZA 4A2PA 1YQDA 1Z3CA 4P38A 1KI9A 3HB9A 1RXIA 4KE8A 4UBJA 4YI3A 3L04A 5TIIA 1JVSA 4NONA 2O57A 4FHFA 4GO1A 4WEQA 1XYYA 3OD1A 3ZJ5A 1WX1A 1KIMA 1CRPA 2EKQA 2C2HA 3P8ZA 3TW8A 1M72A 2D2XA 4C2TA 3ACBA 4ML3A 3RSZA 3K0AA 2PK3A 2WSSA 4MV4A 4R2IA 2IOQA 4BAZA 5JUWA 3P71T 3K8ZA 5LP6B 1ZBQA 2YUTA 1IVSA 3ZI7A 3M6IA 1GPMA 3G1TA 3AVQA 3R0IA 3VR2D 1CY2A 1NQAO 2V7EA 3SQOA 3BB1A 4ZAVA 1C1HA 1F4VA 1QWSA 1NVGA 5KKAA 3TLAA 1M75A 1CDZA 2CDAA 2F43B 1DBVO 1PJSA 3NOQA 3P9CA 4J16A 3ZWDA 3ZJYA 4IH1A 3VUEA 1NY6A 1P8AA 3GLIA 1KJ8A 1HE1C 4FJ2A 2YIVX 2CUKA 3PPIA 4I1UA 4FZRA 4RAQA 2M6SA 3LX4A 4LXQA 2WD7A 4LZWA 1IEQA 1ZWLA 4FCTA 5IJ0B 1WBDA 1AJEA 1SN7A 4H7HA 3B3QA 3RBVA 3AUKA 3MM4A 4IJ5A 4Q4JA 1D6MA 2XB6A 5LBTA 1Z83A 2Q46A 2R6HA 3ZZTA 4EZEA 3BB3A 3BGVA 3ZGVA 2VBFA 4KXMA 2MINB 3WP0A 1C81A 1HLFA 3FPSA 5LQCA 3LQ2A 2ZG6A 1ETHA 1TRHA 2G80A 3C4QA 1UC8A 3MCWA 2JLVA 4KSBA 4MGIR 1NUQA 4GR9A 5LBIA 2A5FA 1PGOA 3U31A 2Y2VA 2FDXA 1O6BA 3SR4A 1PFQA 1XU4A 1Z34A 2VHYA 3KPUA 3KXPA 3OT4A 4HGRA 2F7SA 3I8SA 4MVJI 4IPTA 4QYTA 4YROA 3SFZA 4WK0B 3W5HA 1YE5A 3D5TA 4ZO7A 5JLAA 2HQRA 1YZHA 4WX2B 2V9PA 5JSKA 3P9KA 3Q9SA 4WWHA 3T1OA 4TSRA 4Z86A 1XHLA 2CNKA 5EQFA 4YMGA 3UBTA 1TZ2A 2H00A 1U3UA 2GJ8A 3AHDA 1UWCA 1QP0A 3BCUA 1DG1G 1AK2A 2ZRJA 2MOKA 2JLQA 3MW8A 4I4TA 4M1QA 1FW8A 2G07A 3JSXA 4E6PA 5ALIA 3BX1A 1J9GA 1OXBB 4JLPA 3TM4A 2AEFA 1JALA 3V7WA 4O4LB 4F1WA 2QG4A 3RSGA 1KTIA 2O6HA 2JIPA 3W5CA 2DM6A 1PT6A 3T15A 3KJZA 4GYKA 3IUBA 1I2MA 3GA0A 2M98A 3HCCA 4YDHB 1KEEB 1QMGA 3HU5A 3PXEA 3PWZA 1QZ3A 2O7SA 3RTDA 1JU4A 1CULC 4BMOB 1NPDA 4Y9SA 2PT7A 4OBWA 2HZ7A 4N7RA 2ZR7A 3A6FA 1GGNA 4MI3A 3CVYA 2QBYA 2H59A 4LNUA 3IDZA 2PVSA 4L4SA 4L3VA 4QFDA 4WGGA 5EERA 5LQDA 3EFEA 1NNI1 5AH0A 3GRFA 3C74A 5DZSA 2FI1A 1YT5A 2JIBA 1QVVA 1RKVA 4P7JA 4UMVA 1RE0A 2AOXA 4BAGA 3OM9A 3R3XA 4D46A 1UWLA 2X5OA 1XQ6A 4DTCA 1AH2A 2G82A 3EXAA 3M3DA 5HRCA 3CKLA 1MVOA 3OZDA 4EZIA 2FKNA 4BNKA 4ENVA 5L9AA 4Y7CA 2FCRA 4XD7A 4MUMA 3AU9A 3ZGZA 3IOMA 4BU1A 3UGQA 1JR2A 2B1QA 5AOBA 5FFNA 1WMAA 3DZJA 4Y2SA 4WJKB 4DFDA 4DRYA 4ZTZB 2OO5A 1QK3A 1FUUA 1Y34E 2OGTA 3I04A 1RTKA 2ERYA 2XF2A 2E7ZA 3QPCA 1E9RA 2GHTA 2QE7A 1G7SA 4NPAA 2C07A 2CK3D 3U4GA 1PBTA 3OQVA 1QIKA 2J4CA 2V4UA 3DXFA 3K1AA 3EG9B 2OCDA 4CN9A 1UJ4A 1M5UA 3UWSA 5ALGA 1T3GA 1NHWA 3ZIDA 1KFCB 3RSQA 1VCHA 2XXAB 2YWEA 3HI4A 1MO5A 1BMQA 2WNIA 3CCCA 1IXZA 1PFKA 4MQBA 2NU9B 4DLPA 5J1SB 5IXYA 1QCYA 3EDMA 1QH1A 1V7PC 2J5RA 1RXWA 3PQ4A 3P97A 1XNGA 3WLEA 1G9XA 2MSDB 4I1SA 4BBPA 1LBHA 3SC6A 1SVIA 3KB1A 4BVAA 1ZGGA 2CK3A 4QO7A 5DHQA 4LV8B 3RKUA 1JDTA 3SBOA 1WZNA 2QNIA 1P2SA 4DZZA 3GOHA 3JAWA 5JC1A 4CMGA 2YZ2A 4HZGA 2HSZA 3L8CA 5E4TA 2FZGA 3PDHA 1A4XA 3GBVA 4X1OA 1OA0A 1J97A 2ID7A 4G0ZA 2X8WA 2VZLA 1BYIA 4Q1CA 4TTSA 4YDRA 2O8FA 2XYPA 3LW7A 3RUIA 2F8TA 1R18A 4D6XA 3OFND 1MNQA 3TMYA 3IAAA 4GRIA 1U28C 2IEZA 4QFCA 5K09A 5C7YA 3L77A 1O57A 2W8BA 3DPUA 4OQLA 4Z8YA 5IKEA 2GFHA 2RGCA 1WDTA 1MU0A 1XNQB 1E62A 2OK7A 2ETVA 4GI1A 3JZMA 1S3FA 1PGNA 2QMOA 1K6MA 3QUTA 4R9UC 5A06A 3EVZA 3QX8A 3OAAA 1R4MB 3GLTA 1QTNA 1W0KD 4IP0A 1FDOA 1KETA 2ZBGA 2Y1OA 5E9AA 1SZJG 1XUOA 1I14A 3F6BX 3MLEA 1CQZA 4GEKA 3CPEA 5ERYA 1W6UA 3KU1A 4NCXA 1XRLA 5BR8B 1JZSA 4UBOA 1AN0A 4QOEA 1JMVA 1U0HC 4EHNA 2WBLC 4ZRNA 5A9SA 1S2DA 3R7WA 4HAZA 2AR9A 1QFJA 3OSZA 5A02A 1QBKC 4YRZA 3H2ZA 2IS4A 1ULUA 5BWBA 1TTTA 1E6MA 1FP1D 1H2XA 1NC1A 1IWPB 5CH5A 5EIBC 2R7MA 3B9RA 1PK7A 1KH2A 2C83A 3HZHA 2Z2KA 4PGHA 4E5DA 4DRZA 1A8UA 3HB7A 2O2YA 3PDUA 4GLJA 3EW9A 3WDKA 1TAUA 4XQ0A 1V16B 1ZAKA 4POOA 5FUQA 3SC2A 3ZDZB 4LWPA 4ER0A 4LFBB 5FOTA 1SHUX 3PQ8A 3AL0C 2B3DA 1NJ8A 1KGDA 1A4IA 1X15A 4J0GA 4ETNA 1XC7A 1JJAA 1WSWA 3KQUA 2ACWA 2XGOA 1T15A 4RFVA 3NHPA 4NZZA 1A95A 5HE9A 2YJ6A 3VNSA 4KH0A 1ZD1A 4EO9A 5CDSA 2GEJA 2GD6A 3RUEA 1IDOA 4LHZA 2J3LA 3GFRA 4URVR 5KSWB 4AZ0A 4B8WA 4BEBA 1W25A 1DEAA 1RC8A 1XNRB 2CL6X 4KXNA 1PUJA 1OAKA 3WRYA 2JIZA 1ZUHA 1RAAA 1II0A 4CKEB 4MW2A 1R6XA 3H7IA 3HKDB 3RAGA 3YASA 4OBEA 1LRLA 1NSYA 3EA5A 1R1DA 2BRUC 2X9LA 4BKOA 2HU7A 4F5ZA 1V9SA 4KZPA 3I0NA 3JASB 3E8XA 3F9RA 3JALA 1S8AA 2LCQA 1Y1RA 4WOPA 2QJOA 4NU6A 1FRVA 3LLMA 4IS3A 1PGPA 1VZ2A 3PIRA 5HZMA 1J4AA 1GGJA 1JQEA 1POXA 3UGTA 4BCDA 2WJIA 5KYXA 3O1LA 2BGTA 3VNVA 1D04A 1P39A 1CUSA 2JIQA 5AHXA 3F3SA 5AJWA 3TAUA 3IRUA 2A86A 3P9IA 3GCXA 2FE4A 3KUXA 4QWMA 4WESA 2B37A 1MRSA 3FDFA 3GRYA 5JPDA 2AD1A 2YHIB 3WGLA 1FFDA 2P3LA 1JYFA 1F0KA 4KBGA 4RD4A 5F3RA 3JRXA 4ENSA 2IXFA 1CU1A 1L5KA 2ZDHA 2W71A 3J81A 2P67A 2AH5A 2O4UX 3KVOA 5BN1A 4TSKA 5IS2A 1INLA 3A8TA 4G85A 2WQZA 3DLTA 2P1ZA 2I4OA 1G3RA 2AF3C 2V98A 4HRXA 1Y81A 4OXXA 4E3WA 5H0IA 1DO0A 3LIIA 3I72A 2BL4A 2ZRGA 3MCZA 2Q28A 1FS5A 3GPIA 4PSCA 3B6MA 3MGAA 5CB8A 4BLPA 1ZITA 2X22A 1QG6A 2ZI3A 4X0EA 1M2EA 2WK1A 4CL2A 4F91B 1DU4A 4DLBA 1ZDMA 4BMZA 4H59A 3GCWA 1QGYA 1FNMA 2VDWA 4HOYA 4J2OA 4OMCA 4RXTA 4INOA 4KXUA 2PRIA 2P0YA 2HRCA 3ECCA 1A71A 1VIYA 1SCNE 2GXUA 2RHWA 3L7LA 3MELA 1JLHA 4BE4A 1GA4A 1XAHA 4MVJG 3SN6A 2D2IA 2ZUBA 2DLDA 3DMPA 1CS4C 1KFKB 1VE9A 2P5UA 3ENZA 3KLOA 3OLCX 4XFKA 2D1QA 4OMFG 2ANBA 2IE8A 1JSRA 3DWGA 5SY9A 3RAPR 1RZUA 4O4LF 5I7UA 1VYUA 1X8KA 1DI0A 1FFXA 2PGOA 2AMVA 3R1IA 4Q34A 3VOAA 2PSEA 2CSUA 2HPZA 3R9IA 4PU0A 5B2FA 1R6VA 5KJ1A 1JLSA 2Y77A 2OP0A 1UBMS 3TLJA 3I83A 4R0NA 1WA5A 1T2NA 4AD8A 3VM6A 3CRMA 4MYCA 3GAAA 3ITNA 5HUQA 1U2ZA 2E6UX 3P0FA 4FSXA 2ODAA 4NBWA 1QG4A 5JCZA 1K66A 4OXYA 1Z39A 2IEIA 4LF6B 2Z4SA 1SC4A 4MEAA 3M6XA 2X2EA 3AESA 3RVOA 1L5SA 1XKTA 1J09A 3IVCA 4YJFB 2HMVA 1EK0A 1OU4A 4WKGA 1FVXA 3NJ8A 2H29A 2ZUTA 4LXIA 3U0BA 4WK6A 4XWWA 1PV1A 1Z0UA 3CIOA 1HSOA 4NDAA 3ME5A 4W5WA 3WYDA 1XO1A 4CMJA 3DE6X 1QYIA 1V4NA 3FZQA 1TM3E 1RI5A 2AKAB 1QIJA 4PQFA 2QHXA 4RHEA 1E8DA 3UB4A 1L4LA 2SCUA 4RVCA 3NBQA 3U4HA 3W1WA 3CVUA 1QRSA 1RYNA 2Y6UA 4LCJA 3ZGOA 4RKQA 3H18A 3OI7A 1BVHA 5TF4A 2R4TA 3SE0A 3D1VA 1Y80A 2E1PA 4XGQA 3R9KA 3W7VA 1JH9A 3HJHA 1GGMA 3ANSA 4RLFA 3TLGA 5FBKA 5CBPB 3NVMB 1NBIA 2BW0A 3TE7A 4RJLA 2QTLA 3WS7A 1UH5A 2R85A 1T4CA 1JR3E 1KJJA 1D3AA 3JWPA 5L45A 2N1MA 1LWNA 4JA0A 4PQEA 4LKOA 1K8XB 2EERA 3PWTA 1YZTA 4CCWA 3D8RA 3DLCA 4JHLA 1VMIA 5KWEA 3PICA 1BCRB 3DOFA 1OWNA 2WJHA 3E84A 4XCXA 2MSNA 4YMWA 3UFXB 4CFZA 4NP6A 5G0WA 4DHWA 1RRKA 4JC0A 5DULA 5TQVA 1QC5A 1AZWA 2WKPA 1EQAA 5THXA 1PWYE 1QU2A 3WGYA 2JGKA 3E5RA 1PFWA 1Z2PX 3OT5A 4YIHA 1FNNA 5T3YA 4UVEA 4JU8A 3NR2A 1K5PA 1QONA 2ZRDA 3A4LA 3DDWA 2A9VA 4IXNA 3TCNA 2AMLA 5EQDA 1XNJA 1JFFB 3CVOA 4GR4A 4ETIA 1ZH0A 3ZD6A 1CDOA 3JVDA 1AKNA 5G53C 2F8MA 1IC6A 3ABZA 4QOFA 3HBFA 3EFHA 1D6JA 3BUSA 4HUJA 4AZ3B 4H1UA 5A71A 1B8PA 2EJCA 4MDHA 3V7FA 2WR8A 3SLRA 1TK2A 3ETHA 2WF8A 1KNQA 1MCZA 2FRXA 1TM4E 2Q0XA 3VVBA 1V7CA 1Z17A 4B3FX 4PX3A 1H2YA 4RTOA 4YCCA 3SIPA 4B76A 2VRCD 2OSVA 2QYOA 5C8DA 5IHPA 2HJGA 1REQB 1JJIA 2Q4EA 4DEYA 1HZZA 3IUPA 4EKNB 4HDKA 4L50A 1C9KA 1CR0A 2B25A 2OO3A 3GRPA 3UT6A 4KRFA 4YT4A 3UK0A 3VAYA 1ENOA 4UREA 5K6AC 3RFFA 1B6GA 4RF4A 1QOZA 1BCSA 4M0EA 4MSUA 4XRRA 1SO8A 5E8JA 2JJ1A 3HFJA 4ASUA 5K6TA 2CF6A 3T3OA 4D57A 5TGTA 3FGNA 1N9GB 1A8HA 1HE3A 3BQNB 3KXDA 3LUHA 4JH0A 3N86A 4OUKX 4QXPA 3AZQA 5GTDA 1H5UA 3AFNA 3UV3A 3O9VA 2ZITA 3VI4B 1HH4A 1NYTA 2G72A 3DDSA 5DOVA 2UZIR 4L6CA 4BNUA 4LCBA 2ODPA 4WTOA 5AKKA 5KC9A 4KPEC 4XUDA 2CYCA 3WB9A 2IS6A 3TW0A 4N41A 3Q3GE 2R47A 2GBFA 3GUCA 4WKNA 4CMEA 2ZOSA 4DTIA 5KSZA 3WDLA 3KTOA 4X3OA 3BK1A 3GLGA 1NRXA 1QAQA 2F1OA 2QYSA 4ZPJA 1UQTA 5AHKA 4EBBA 3WJAA 4RF3A 5AKXA 4RVUA 3WTBA 4MJLA 1U63A 1Q0TA 1NQUA 1QR2A 4AI6A 5KQRA 5DM0A 4COKA 2DMRA 3P9XA 2HNKA 4DWJA 4PO9A 3A9UA 1QHNA 3A1EA 1H93A 1M8FA 4KR6A 2EC5A 3FY4A 4ZFNA 3UH0A 4ZREA 4BFUA 4CM9D 2BP7B 1OWOA 1ZOIA 4C4RA 4Z2AA 4K2HA 2ZYWX 3RUAA 4Y0AA 1XAGA 3H16A 2QQGA 2F90A 3TRKA 1U8EA 2QX8A 3ZV7A 3EG5A 3OECA 3EIOA 2OMKA 2W83A 4F46A 3VVCA 2QLNA 5EMHA 3AQ4A 3U3DA 3U9SA 2XGSA 1NKSA 4XYEA 2QENA 3B6EA 3KBBA 1PZMA 4BQRA 1RE1A 1A2OA 1G7RA 1IZ0A 4UXHA 3PA6A 3SVZA 2GJSA 4CM9A 4NR0A 4EFLA 1B93A 2D5IA 2EP7A 4MLCA 1VRCA 1EP1B 1Y5RA 3UCFA 1Q0SA 1EFPB 3L82B 4X6YA 5JV5A 2J3EA 3LIPA 2W6MA 1K3FA 1N77A 1AA9A 4HFMA 3IXMA 3UYLA 4KG7A 1ZXXA 4N7MA 4L75A 2RAFA 4AVYA 1XCBA 4S2EA 5FEMA 1JDSA 1ONPA 1CWUA 1K88A 1KI8A 3MBIA 4FYIA 1ZR2A 3VSEA 3VU1A 5IAAA 1E1CB 3ZD7A 5C1BA 3KZXA 4RXUA 1A5AB 1QE3A 3ABSB 3F71A 2REBA 2I91A 3VYRB 5TMBA 4PYJA 1DHRA 1II8A 4MV8A 2QM3A 3IP8A 2ODNA 4R5HA 4N0MA 4GZ5A 4FC7A 4J9VA 2A8YA 1U3TA 3II6X 3OZWA 1Q12A 3QIAA 1GL6A 4PCAA 2HJVA 4KAXA 5I9MA 3U37A 4QBTA 4CL0A 1C29B 2BFMA 3EEBA 1PUIA 3LSYA 4LBYA 4M7OA 4LOJA 2JLUA 2QUKA 1H94A 4J2TA 2XT6A 1CS0A 4GF5A 1Z15A 2QAGB 4L8GA 2GFIA 2P40A 5E1MA 5FP0A 3V3TA 2PTHA 4IIJA 5EJ7A 1EFHA 5JAUA 2V6IA 2AG0A 2FH5B 7YASA 2ZREA 2ARKA 1WD5A 2O2XA 1M34E 2VK4A 3QI2A 2JH3A 2UV8A 3KZVA 4JVLA 1T1SA 2WJWA 2JFUA 1UJBA 4LGCA 1P9NA 3ZNOA 3LT4A 5JVDB 4PAMA 1EUDA 1P33A 4DQ0A 3HBMA 2QX7A 4UBMA 3HJGA 3SQLA 3BCHA 4Q4HA 3GIWA 2QF7A 4B82A 2FZKA 2ILTA 3IAM1 3N07A 4XTRA 3QBEA 5JANA 4LZZA 5NLLA 3ROXA 1MZPA 2XADA 1IMJA 3P2MA 4RHFA 1TK3A 1U98A 4QL3A 2O2CA 3C1UA 1OBVA 4XM2A 1ZSVA 5I4CA 3QLUC 2HBZA 2WF6A 1LBEA 4WL0A 1GZ6A 3ZNPA 2CXXA 1UK9A 2ZYVX 3LS2A 4AX4A 1E9SA 5DCYA 1AQJA 2B4QA 5EP4A 2PUDA 4XFJA 1ZI6A 2P77A 4MYHA 5F2OA 3L0ZA 4GOND 2DFPA 4B6JA 2JFNA 4K9LA 4GBGA 2BSXA 2WJ4A 1JTEA 5AUNB 4FYWA 4NH0A 3PXGA 4RORA 1OE0A 2GPWA 3E2MA 4X90A 4Y3UA 4WLNA 1OFIA 3EZGA 1XCGB 2PH5A 2YJ3A 1AB5A 3QLTA 4I4IA 4L73A 5JNVA 1IAVA 3CNOA 1UC9A 2FW7A 3AJRA 4WHMA 3UC9A 4F2GA 3QSYA 4EATA 3EMVA 5KHLB 4PVCA 4EGSA 2FMXA 5FR2A 3CTPA 4EJ6A 3PNLA 3VOSA 1OFVA 1LW7A 3KL2A 4FEAA 1RWBA 2XQKA 4M60A 2ONZA 1Z5OA 3R6LA 4FBMA 4DLWA 2BEUB 2E85A 2FFAA 4PBSA 1EESA 2INGX 1WM1A 1GYQA 4UKDA 1JDBC 3IRVA 4IDOA 4ZYWA 4KDCA 5A9TA 4YASA 4W5RA 4GD3Q 1I4TD 3MCUA 3OA2A 4FE3A 5DX0A 4KVGA 2AG1A 4IV5A 4EFKA 1JAHA 4PZUA 3LFHA 3STTA 5M7EA 1TJ3A 3IKLA 1TA4A 3C5WP 4Q4LA 4MQFA 3ZXIA 4PTZA 1LTQA 3V2IA 1UPTA 1B1AA 4L4YA 4OGGA 1XDZA 3RFUA 5L6LB 4BVKA 2YWFA 2HLNA 4PYLA 3DMRA 1X7DA 4DRXA 2V6JA 4CT4B 4OFZA 5E6SA 3HXQA 3S99A 3CJQA 3SM9A 4L8VA 3RBXA 1GPJA 3NTQA 4DVGA 2N46A 3BULA 1LBQA 1GKIA 4UAUA 2EWVA 3Q15C 4A5OA 4DQXA 4RH1A 3ADDA 1BHJA 5E8RA 1MV8A 4ZHSA 4PR3A 1VE5A 3T54A 4HG2A 5SY6A 2BSAA 3SHQA 3M70A 2GO7A 3F8WA 5HIIA 2YDXA 4ZU3A 3VSBA 2DUNA 3STXA 2IIVA 2IH2A 1UBSB 3SF0A 3TSCA 2JH8A 1NVVQ 1ZY2A 4PCVA 5CFLA 4I55A 3F2VA 4V3CA 3F74A 3JWIA 2O2DA 3FKQA 2PO5A 5HW0A 4BIMA 5A62A 4YNBA 1EUZA 2Z09A 1U9IC 4YV1A 3K0FB 5JAOA 4GDMA 1T6YA 3QP9A 1UMCA 1HZJA 4BB6A 4XSVA 4M1WA 1V6AA 1A69A 3QOWA 1N2CA 1N0VC 4U02A 1NI4B 2VK8A 2YICA 4H77A 2J32A 2ZUCA 4GI2A 5E6RB 2Q5FA 3NAMA 4TTTS 5AI5A 1EB9A 3K4PA 2XWPA 1H4VB 1ADCA 3VTKA 3W5VA 2JFGA 1EE2A 3OPVA 3ZWQA 3MA0A 3FTEA 2W6ID 3GGSA 2DC1A 4KXQA 4ZTBA 5LB4A 1CC1S 2GYYA 1E8NA 4WIAA 3TD2A 2OBMA 3DCIA 4FDAA 4MGKR 5TC4A 1SU4A 3URMA 4C3OB 4RK0A 2VF4X 4PHFA 3VR3D 1TF5A 4I5EA 3LLSA 4J03A 5LA6F 1J99A 2ZJZA 2W2OA 2P65A 1NPTO 4LHXA 4P3YA 2FZ5A 3FFAA 4JT2A 4LOHA 421PA 3HB1A 5LMUB 4ZAGA 3U5TA 1M33A 3A25A 4QLOA 4CGYA 3GMDA 3F3KA 3F5MA 1SY7A 2W6IA 1L4EA 4JSTA 4QTXA 3NV9A 4YRAA 1IQUA 4Q9JA 4WJLA 2A5DA 2B2CA 1ODTC 1BQ4A 4Q00A 4D82A 2C2MA 3AW8A 2B5WA 1E92A 1R0LA 1E32A 4TMYA 3V6LA 3UZUA 3VR3A 4ZN6A 3JARA 2GXQA 1YDGA 2HBYA 4O4IA 1A88A 3GP5A 5H3HA 2R84A 1DWUA 3EASA 1HFJA 5FORA 5FPQA 4E14A 2HDNB 5TEWA 2W42A 2WA2A 1Z6GA 1OXMA 1XX6A 3GUZA 3M49A 2FXIA 2XIJA 3PQ2A 3K9CA 3LLCA 3UGJA 2JCXA 1UMBB 5CAEB 3NLLA 4S1NA 3ZQUA 2ZIUB 2IEDA 4HAIA 5AM4A 4HNGA 1YGPA 4OHKA 4JQYA 1UXKA 1ABBA 4KGVA 5T64A 4RK4A 1HE4A 5FYDA 4AQYB 3EVGA 3EYWA 3OZBA 3D7NA 2TMYA 4RHYA 4R31A 4U7PB 1SIBE 4C0HA 1RRGA 3CH7A 3PPXA 4GXTA 3PFNA 5G4KA 3V1MA 2DQSA 4Y9TA 3ZJTA 3OZFA 1DKMA 3LT1A 4N0QA 3O0DA 3BSWA 4ZIRA 1QP8A 4KV7A 1R4AA 1QGUB 1U11A 2Q5CA 4UUAA 2A3NA 2FP3A 2NM0A 2PSJA 3DDNA 4KQGA 4NJMB 4WMLA 4QPJC 1R5OA 2J6HA 5FHRA 3VZDA 1AGXA 3W4KA 3ZDXB 4AJPA 1GXSB 3EDOA 5J2TA 3EODA 1YE8A 1OREA 1KYVA 3PQCA 3AVPA 2OZLB 3HVHA 4LYYA 2CHFA 4H6XA 4ZYLA 3A58B 2OBFA 1U7PA 4NZOA 1U2DC 1XP5A 2FPUA 3QJGA 4UVIA 3VH4A 4Q0MA 3RGWS 4XE5A 2IRWA 4TWBA 4WFKA 4LYDA 3T5DA 3NB0A 3OU6A 3UANA 1TJNA 4OQYA 4LGVA 2V3VA 3CLSD 1Z62A 3COZA 3DV0B 1Y4AE 4OQFA 1EUCA 2I2CA 1E7WA 4B2PA 4BFXA 2EKBA 1M6HA 4FILA 2DXIA 2J0QA 1LWOA 3EC2A 4GI5A 1NUSA 3PK0A 2X4IA 1N6KA 3FHJA 4YT8A 3WYAA 1ARZA 1ZC4A 3EEYA 2IYTA 1H0SA 3AR8A 1W2WB 4G0YA 3PFWO 4C88A 1VZ3A 1OGIA 4K87A 2VDOB 4YDSA 4I3FA 5BPHA 3FOWA 4XQ9A 3PPYA 3KKPA 1QF6A 1R4NA 3OOEA 1XTKA 2O20A 3T1YB 5FI0B 4H60A 5DISB 1IM5A 2JF0A 5FI3A 5B36A 2Q3EA 2PUGA 2C5SA 2ZBRA 4HN9A 2QQ5A 1K4YA 1H23A 3TO5A 4DQVA 4F71A 5FFMA 1NN3A 1E77A 1ZH6A 2PX6A 4B73A 3KSMA 2EFGA 4LGMA 1EUYA 1U7XA 1XZDA 2BGKA 4UAGA 2I1VB 2OV4A 1W2HA 2PLWA 1MXFA 5KNBD 2Y9MB 2ZR9A 5FOVA 4BMXA 4UASA 3UTCA 1HA3A