1IC6A

Structure of a serine protease proteinase k from tritirachium album limber at 0.98 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a serine protease proteinase K from Tritirachium album limber at 0.98 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEINASE K
total genus 87
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ic6A00
1P8JA 3DVRX 4B5LA 1A2QA 1Y33E 2Z2ZA 1KDYA 1YJBA 1YU6A 1R0RE 1WMDA 1DBIA 4H6VA 4I0WB 4WOCA 1Y3CE 1HT3A 3DE6X 3QMPA 1Q5PA 2HD4A 5ARDA 1BFKA 3DW1X 5JXJA 1BE6A 2Z30A 1SBTA 4AKTA 3WIVA 1BE8A 2V8BA 3VTAA 1TMGE 2WUWE 1NDUA 2IY9A 5AQEA 3QFHA 5K7SA 1AF4A 1Y3DE 4ZARA 1TO1E 4NE9A 3I37X 3GT3A 2WUVA 5B1EA 1KE2A 4GI3A 1TM4E 1MEEA 1SH7A 2Z2YA 2DP4E 2W2PA 3DWEX 2XRMA 3GT4A 1GTL1 1TM1E 1Y9ZA 3BPSA 3DW3X 1XF1A 2GKOA 2ID8A 5B1DA 3I34X 1ZVKA 1NDQA 3DYBA 1CSEE 1PJ8A 1S2NA 4H6WA 2PWAA 1C9MA 2WV7A 3F49S 1S02A 1SELA 5AMXA 2XTJA 3P5BA 2Z2XA 2G4VA 1TECE 5FFNA 4H6XA 4OMDA 1GNSA 3WIUA 1KDZA 3DE0X 4MZDA 2QTWB 1YJCA 2PRKA 1SUCA 2PYZA 1PFGA 1WMEA 2SECE 1AH2A 1WSDA 1SCBA 2PKCA 3DE3X 4HVLA 1OT5A 5JMOA 3Q5GA 1SBHA 4YN3A 1SCNE 1LW6E 1EA7A 3AJ8A 5CW1A 3WHIA 5ARBA 1SBCA 2W2NA 1OYVA 1SPBS 2SNIE 1SIBE 3HJRA 4DZTA 3VV2A 1V6CA 3TI9A 2PMWB 5AVKA 1GTJ1 5JXGA 1MPTA 1SUEA 4LVNA 1SIUA 1Y4DE 3CNQS 1IAVA 1S01A 3DE1X 3EDYA 4DWWA 1Y1KE 4Z2AA 4ZOQI 1Y4AE 4CG0A 1AQNA 3DE7X 2E1PA 2PQ2A 1T1IA 3BGOS 3LPAA 5ARCA 3ZXXA 3TECE 3L1KA 5I9SA 1SCAA 1C3LA 2Z58A 3DVSX 2Z56A 1C9JA 1PEKE 2W2OA 5FAXA 2DQKA 1SBNE 3VYVA 3TI7A 1TM3E 1WVMA 3GCXA 3SQOA 1PTKA 3A3OA 1SVNA 3PTLA 1GCIA 1TK2A 3A3NA 4CFYA 5JXHA 3F7MA 1TM5E 1V5IA 3AFGA 1NLUA 3VHQA 4C3VA 1AK9A 3GCWA 3DE2X 1DUIA 3EIFA 2W2MA 2HPZA 4K8RB 1Y3BE 4M1ZA 1P7WA 3SICE 1R64A 3I2YX 3H42B 3LPCA 3Q40A 2TECE 3DE5X 1EGQA 1ST3A 5FBZA 3WQBA 4NE7A 1SUAA 1SUPA 1T1EA 4HX2A 4BWGA 3BX1A 1GA6A 1BJRE 4J94A 4KG7A 2ZRQA 4AKSA 1GTG1 3T41A 1ST2A 5AVJA 5JXIA 3EE6A 1TO2E 2W2QA 5SICE 3PRKE 1GA4A 4WOBA 2ID4A 1C9NA 4KB5A 1SCDA 3DDZX 3VSBA 1BH6A 3D9QX 4CFZA 1P7VA 1THMA 3A3PA 3OSZA 3UNXA 2PWBA 1OYOA 4KPGA 1GA1A 4DJ5X 3LPDA 1SCJA 4RYDA 2DUJA 3VV3A 1GT91 4JP8A 1CNMA 1R6VA 4OV6B 3AJ9A 1KE1A 2WWTA 2SBTA 4LVOA 1BFUA 1SN7A 1Y34E 1WMFA 3DE4X 3I30X 1SUBA 1TM7E 2B6NA 1AVTA 2P4EA 2X8JB 1Y3FE 3LXUX 1IC6A 2X8JA 2ZWOA 1ZVJA 3CO0S 4FONA 1SUDA 2IXTA 1KDVA 2ZWPA 1T1GA 1AV7A 1SIOA 1YJAA 1GNVA 2Z57A 1AU9A 2SICE 3DVQX 3F7OA 4OMCA 1SBIA 3ZXYA 1JEAA 4C3UA 1Y48E 2ST1A 1VSBA 4NMXB 3D43A 1UBNA 3QTLA
chains in the Genus database with same CATH superfamily
4KXVA 4RKEA 4MW6A 4GKVA 1RQGA 2BEVB 1MO6A 1CERA 3OLVA 3VVBA 1LRLA 1P77A 2Q3EA 2DSTA 2J33A 1M33A 4F7DA 1K89A 2ZI9A 1JA1A 3O3CA 1DX4A 1E99A 3HUFA 2FW0A 1BCRB 1X7GA 2QV7A 1P5FA 2WIFA 2V8BA 3EW7A 2VUSA 5CT8A 2DETA 3GLVA 4KQEA 4IIJB 1KQGA 3OZSA 1NJ2A 4ZCMA 3W0LB 1E9DA 4Z4GA 3FFTA 3FUWA 4UPVA 1GUZA 4C2TA 3L01A 4NCJA 1D2GA 3AI3A 1GTL1 1QIJA 1WX1A 1JR3D 1XX6A 2AUMA 3CLSD 3G82C 1BXKA 1CYDA 1MV5A 4CG2A 1E3WA 1Z16A 2Z5VA 3T1TA 4DV0B 2X5OA 2NYRA 4FSXA 4QT4A 1A9XA 1NLYA 2BJVA 5AK0A 5CJ2A 1E18A 3IJRA 5AO9A 3DBHA 3QWBA 4I3HA 4YGXB 4DNFA 1FUEA 1ZH8A 2VC2B 1X80A 3DGFC 4D8WA 2CXRA 3LZCA 2Z6AA 1B6GA 4U39A 3ZWCA 3SGLA 1IBSA 3SM9A 4YRAA 5C5EA 5CFPA 2F3TA 2F3RA 2PLAA 1T5BA 3LJKA 3JXEA 4YBZA 5GWXA 5H70A 4HVLA 1PJAA 2IPAB 3BDIA 1G7CA 4YP1A 1HT2E 5HSGA 4IMRA 2AJCA 2YJ3A 1UJNA 2VKTA 3RI3A 1BJTA 9MHTA 4RHYA 2H4HA 2VRNA 2X2OA 3RSSA 3E70C 4Q7MB 4F9TA 5J4LA 1KI3A 5FPHA 5BMVB 5M34A 4RH1A 1X1TA 3KP1A 5KC8A 4ITRC 5JSKA 1D0SA 1ZKMA 2H65A 5FOWA 5LC1A 1JGTA 1ZI8A 2DHEA 4F3CA 2NTJA 3DNPA 1FFXA 1G7SA 4BNIA 1M34B 1POXA 1COWA 3MZ0A 4KVAA 1ENPA 3I45A 3OQBA 4AY5A 4MWZA 2EJCA 2JIQA 1Z5VA 4ETMA 5ICCA 1Y7LA 1QOZA 2HRDA 5KX5B 4XQ9A 3TVDA 5FI3A 1JKIA 3BIOA 3VR5D 4LXIA 1Q22A 1YZ3A 1FEZA 4BNFA 1VLQA 1A9YA 1D04A 2ZG6A 2J3EA 1DC8A 2Q8NA 3A8TA 1QC5B 2A78A 4XGQA 4NCNA 4ZCQA 3LRTA 5BN4A 7ABPA 2UU9B 1V5IA 5FA5A 5ALEA 3DZ8A 1J0DA 3AINA 4CE6A 3UW3A 3VX4A 1QIGA 1RSZA 3N2YA 3GZTB 4KODA 1KVRA 1L5QA 4YH1A 1EP9A 4PSCA 3T3DA 3IPRA 1JYFA 1USUA 2X5KO 3O0DA 3DLTA 2JARA 3R0XA 2CFOA 4DLWA 1P33A 2KMLA 2VVTA 2NVWA 3ID6C 1YONA 3VAAA 1U6IA 1X9GA 1TO6A 3MWEA 3JAWA 1N9KA 2IHZA 2ZE7A 2Q0SA 4JLDA 2PWPA 3A9UA 1U1EA 2PQ6A 4MV9A 3WLEA 4B44A 3I2FA 4D5GA 3MAJA 3LQQA 4EW3A 3I5MA 2RKOA 3I73A 5I7VA 3U39A 2OY0A 3OFVA 3UUGA 2GAIA 3OA0A 3IESA 4REQB 1NWCA 2IXBA 4HDSB 3E7FA 4B74A 2IGBA 3D5TA 1CVIA 1QLHA 2Q4BA 1IY2A 2FSVA 2Q4OA 2EC5A 3IX7A 1NE2A 4KLNA 2EFEB 1GTVA 3KG2A 2W11A 3T34A 1N5MA 4RJTA 3O95A 2PJRA 2QZ4A 2P8SA 2VYFA 3LOUA 4L76A 1W8IA 4IJWA 2AS0A 1HDRA 4D3XA 1YQ9A 4HBGA 4UM9B 4RHTA 1H3FA 2FV8A 1Y8RB 1A2QA 2QVCA 2RCYA 4GSLA 4BE9A 1WUKS 3QWFA 1GQOA 3ABQB 4MQ6A 1MD9A 3F8SA 2G9RA 4IHAA 4UAUA 4BLPA 3S81A 2XH8A 1TD1A 3D0QA 1EGVB 3HR7A 1L7BA 1Q5PA 4HRXA 6NULA 2Q2NA 1J1UA 3LLMA 2H1CA 2PY6A 2B4KA 2JF0A 4LTNA 1ZMXA 2NU6B 2DBYA 4H0FA 1AA6A 4MDEA 2H57A 5HIJA 1I80A 4EY3A 3K2IA 1ZD5A 2C61A 1FMFA 3USCS 5T6MA 2HHJA 1N1EA 3NALA 2VHWA 1T8PA 3OJLA 1E0DA 5EJ2A 5H02A 4UZEA 1LF0A 3RSCA 5DB4A 3ZW7A 1K63A 3EZXA 5IC6A 3VSCA 4WKPA 2FFJA 4OQDA 4M53A 2CVFA 1E1RD 2EHJA 1D5WA 2C2ZA 4PFQA 5CFRA 5IDWA 5JO0A 1ZAYA 4AIRA 3OLCX 1EFDN 1U0NA 2R66A 3PX3A 1WZEA 1FUUA 2VNJA 2R751 4PSAA 1CP3A 4FDAA 1KZHA 2AQKA 1GAJA 2O05A 4TUYB 4XR4A 4IR7A 1CJBA 1XDUA 5FHQA 2DXIA 1LW6E 1RM4A 1K97A 2QWXA 3STYA 3VDNB 4XARA 5DYNA 5BN5A 2SNIE 4MS4B 2JLBA 1IXRC 4M89A 2V7BA 4ZVRA 2ZJ8A 1BYUA 3WGOA 4RELA 5BVHB 2P67A 3CKLA 3N2GA 3R3JA 1JQAA 4NBWA 1JJBA 3CNQS 5JVDB 2EKZA 3O2QB 2Z83A 5EZ6B 4MEJA 5KSWB 1ICIA 3K5IA 5AUOB 4GMFA 3WY9A 1I7DA 4A0GA 3GLHB 4ZO4A 3CX3A 1UT8A 3KEGA 2BV3A 1ISHA 1QTNA 4Q5IA 1OHHD 4LC1A 5C5DA 1SBNE 1M7GA 2PJZA 1A88A 1LPOA 3KSMA 2FVXA 4G0YA 3RG8A 1LW7A 3ST7A 2C8LA 3EPHA 1KZ9A 3ZY4A 4RJLA 3L7JA 2QGFA 4JA0A 4P3XA 1MRSA 4EY8A 1C7FA 3FPKA 4MP6A 3MOSA 5AKEA 4Q7QA 2PYDA 2AF4C 4ZI7F 1NKVA 3D7SA 2NO4A 4BO7A 3QSGA 3M3DA 4NNJA 4UDXX 4BIIA 4DPMA 1PLKA 4P8RA 2DB3A 5IKPA 3RV3A 4EA9A 1VCOA 4AO7A 1BWQA 3STXA 2R96A 3G88A 4KZPA 4M0MA 2ZB8A 3C6ZA 3CUVA 1OH5A 1RWVA 1I1NA 3W5SA 4II3A 3QLTA 1F1JA 2F43B 2D7CA 2A0WA 3AEQA 4KMRA 3V42A 1DV1A 2LBPA 4DQLA 4CDNA 4YALA 3KLPX 2YNMC 3X1JA 2C94A 2JI7A 3ZWPA 4CKEA 5J4HA 2PUGA 4KRFA 3FCEA 3OOWA 4Q1BA 4WLOA 3UWOA 5JV5A 3RDPA 1G8HA 4QC2A 3WLPA 3ZWXA 1GL9B 4COKA 4PC2A 4EUSA 3MC1A 3ON5A 1SVSA 1THGA 1NULA 1OHHA 3FHTA 2B21A 2ZRAA 3UJ3X 3BGVA 3LYUA 3VC1A 3H04A 1CJSA 3E0QA 4X7MA 2PXCA 4FUQA 5CK5A 2O19A 5TIIA 3ORRA 4MYSA 3ZWDA 4B9EA 5I9MA 4LF8B 4DR1B 4WK0B 3IJPA 2QMYA 4OKSA 4JI1B 2K7FA 2ZVQX 4IEEA 4X8HA 2OHFA 1SXJA 2QAGB 5DM4A 3TOXA 3QLUA 2GAOA 1H69A 2WVHA 3RVBA 2DH5A 3MMSA 1OX5A 3TTXA 2ZSDA 4UM7A 1PQUA 1JALA 4Y6PA 3BJEA 3TOZA 1HQDA 5AVTA 1XQVA 2H6EA 5BRNA 2BI4A 4KN8A 2QRLA 2N1MA 4H15A 3SC3A 1R7RA 2X58A 2QJWA 3EY4A 1JS1X 1SXIA 3O7WA 3QUCA 2WHPB 5B2EA 1IH8A 3IUQA 1L5KA 3PDCA 4DN6A 1TM2A 5EJEA 5I47A 2HMUA 1CK4A 3TQCA 3BPSA 1GLGA 3ADDA 3A06A 1QVZA 3EX7C 3L9XA 4N6NA 4OYYA 1ZMTA 1TYEB 4NK5A 3IULA 1XPJA 1PFWA 2H4XA 2Z5FA 5GTDA 1TECE 2I3ZA 2CV1A 3JWEA 2VZ9A 4Y9RA 3VR6D 1SXHA 7ADHA 2Q50A 4RX1A 5EOVA 2GT1A 4ITVA 1N4DA 2AYZA 3AOEA 2O8DB 1KYVA 3H2BA 2ZYAA 3JATA 3R3XA 5JSQA 4ZJPA 3R5XA 3OIFA 4EZBA 1V3QE 3OO0A 5HCUA 2ZUTA 1ODIA 3CKKA 1GXSA 2ENWA 3L7NA 3JVVA 1Q1AA 1N2XA 1PL6A 1ZIOA 1USVA 2BKAA 2R87A 4M22A 3CRW1 1GWNA 5SZIA 1VG1A 1C1XB 3DDCA 4G0ZA 3M3PA 3ROPA 5I4IA 4IEIA 1K8XB 3IXMA 4NAVA 3ZY6A 1ODLA 4F38A 1B6SA 4A8PA 2V5AA 3FCCA 4QBTA 2BGWA 4NSNA 4CLRB 2VRCA 3AP1A 2QE7A 5K05A 1P9NA 4YACA 1DOZA 4UM5A 4PGGA 4EVRA 3UANA 5FQNA 4MDYA 4FJ0A 1HRDA 5LQNA 3VNAA 4OXYA 4X7RA 4DLVA 1GZ5A 4I5DA 1NYRA 2OP1A 4F97A 5FV4A 2F1HA 3VPXA 4DR4B 3PE6A 1Y9DA 3UG6A 4BATA 5ADHA 1VE7A 5JXHA 5BPHA 1K9SA 1ZFNA 2X5JO 4XR9A 4XVHA 3RF7A 1Q2XA 5CFLA 4QQFA 4P82A 4BMNA 4G8DA 4JJZA 5FUXA 3ME5A 4A91A 3NAMA 2RH5A 1UUFA 5JD5A 2O2IA 1BO6A 5MGNA 4AWBA 2YJ4A 2QD2A 3CZCA 1J2JA 3AXTA 1G20E 1MDBA 3EH2A 5I3ZA 2H1RA 3OTHA 1TLFA 4J0CA 3IDOA 4NZMA 3GLQA 4HVCA 2FDXA 1PR4A 3RYHA 4QEDA 3PVSA 4C6TB 2JJ2A 2IYPA 2P90A 3ANNA 4KL8S 2ZJ1A 1ZY2A 2Y67A 3ACCA 5A4IS 2ZATA 2ECPA 5CLJA 3VVLA 2QGNA 4KPEC 1ISGA 1JXQA 1AUOA 1V48A 2W4IA 3HUUA 4JROA 4KQHA 4LVOA 4X94A 5EIFA 4YLYA 3QEBZ 1QV6A 1YTLA 4JOQA 4X24A 3UMMA 4UCWA 3I83A 4FONA 5A05A 3U7RA 3UJDA 1OFHA 1XQ6A 4UQLA 1BHQ1 3PXEA 3L1IA 4QOHA 3HN2A 3U5ZB 3VC2A 4CMBA 1FK8A 1QH8A 2YHUA 4RTKA 1BDBA 1E89A 3BHNA 4HQKA 3RUPA 3U7GA 2ENUA 3IKVA 2D6FA 1R3UA 1J0XO 4C0WA 1DTEA 1QCCA 4L3OA 1AZTA 4UNRA 1WZ2A 2O06A 2EKBA 1SA0B 3R0ZA 2PJUA 1DWQA 2GAJA 1A7KA 1WZCA 5EI5A 4CU5A 1T3TA 4AI6A 5AUPB 5C8ZA 2O07A 2PUTA 1Z06A 3BREA 3DV0B 2J48A 5JD3A 3UGQA 4BZWA 3F7NA 3TRFA 3DLHA 3RS7A 3FHJA 4NFSA 4JR1A 5FD8A 3RJ9A 1Z12A 1QKIA 2YJNA 3OLQA 2H5JA 4QGSA 3QVTA 1SBZA 1XKTA 5IXSA 5IDQA 4N0QA 3FKQA 5E4FA 5HRAA 1TM1E 4IM7A 3ZCSA 1TW2A 5B1DA 2WLTA 3V97A 2NSLA 5THQA 3TR6A 4F4JA 1NVUQ 3DMTA 4DV1B 3NTXA 3OFSA 3ROFA 1SZDA 1UOEA 2AUNA 3UMVA 2EATA 1NJSA 1U7ZA 4B83A 3L8DA 5CX4A 5AW2A 2K4MA 4V0MA 2D5LA 1OLUB 3U3ZA 4QOIA 1W2WB 4NK4A 2XA1A 3CV3A 4XQEA 2P9EA 1IM5A 2PKCA 2HBQA 4BWFB 1EP2B 3ANTA 5JFOA 3IP1A 4YO8A 3T94A 4HDNB 3BICA 1J00A 2ISCA 5A4KA 4KIWA 1NN0A 4B6JA 5J23A 5JW6A 2REQA 1RS0A 3FYUA 1YAHA 3IPXA 4PSVA 3EMVA 4ZRNA 5EJIA 3TQHA 4MV5A 4QUDA 2JI9A 3MMNA 2RE8A 2AA3A 2ZLBA 3JAKB 4CN8A 3UV6A 2Q45A 1MABA 1FBTA 1EIWA 1MHTA 2JGIA 1A9ZA 1CKEA 1D9ZA 2PM8A 2RHOA 4DSOA 4MQEB 4TTJA 4WLFA 2BEUA 3OZEA 1EQUA 4D9JA 4KW7A 4MV1A 4XSGA 2IZ0A 1Z4LA 1ZK4A 2R68A 4EPVA 4RGBA 1D2MA 1DMRA 3NNDA 2W37A 2XNJA 2QRNA 5HFAA 2A1UB 3DCYA 4YRZA 5KTSA 3H5VA 4IEFB 2OCDA 3OEEA 2IITA 4BNWA 3T0FA 3LPMA 3ZBTA 3SSMA 3JVIA 1NLUA 1OLSA 1AQIA 4FNGA 2HREA 1J09A 4KE6A 4B87A 4XOIA 3S55A 2BGIA 1TCAA 4TQAA 5JZSA 1PP4A 3FPFA 1Y5RA 1B42A 5H81A 2P9BA 1CG6A 1E2FA 2PGIA 2Q5QA 1WXHA 2C0QA 2HRQA 2QQFA 3KHUA 4G1EB 3W4KA 1J8MF 4D74A 2NP7A 4AJPA 3S5UA 5CVVA 2D0DA 2P3QA 1EVIA 2W2LA 4JJKA 5SY6A 3VOBA 1W581 4JOCA 1KPGA 1U28A 2B4QA 1P9LA 3NNSA 4W99A 3MD9A 4A15A 1RI1A 2JIOA 1R27A 3T5MA 2H1WA 1MOPA 3QEMB 1H4VB 3CRRA 4NFLA 3CJQA 3V3KA 4BCDA 3W34A 2EP8A 2ZRNA 2QTVB 3CF4G 3INYA 3PHBE 1RBQA 1UP4A 2QLTA 4HH3C 1JR6A 4LYDA 1BS2A 2I4RA 3CG0A 3DTVD 2PCLA 1YQGA 4BE4A 2CXTA 4BCBA 2R1ZA 1WCV1 4U9UA 1TMKA 2WZCA 1AXRA 1YTUA 1DCKA 3HFGA 5JECA 2FN3A 2HXGA 1MO3A 1QHSA 1RKVA 1ZM4A 1MOZA 2J3JA 2OFOA 2WHQA 3CWQA 3FYDA 1N2OA 3ILXA 3MWFA 4NJMA 4PYQA 4XCVA 4EBFA 4EG7A 5KAMA 5TJ9A 4QLOA 1U7XA 1UBLS 2WQZA 4UHDA 3LT2A 3NHLA 1EFRA 3NYQA 4AS1A 2BLLA 2OHXA 3MT8A 3VFDA 1IPHA 4J03A 2IYWA 3ZS8A 5FEUA 3AIOA 5DMXA 2A3RA 2W6QA 3T9EA 2VQEB 3WYCA 4AKTA 1EFLA 3PEVA 1P73A 5FOXA 3NIFB 1C3VA 2YCLA 3QFHA 1ENZA 2J0UB 4AZ0A 5IZ4A 2AYYA 1I7SB 2LVBA 5SV2A 1QE0A 5EIAA 5BSTA 3LZDA 4D43A 1AGPA 4PYNA 3MQ2A 3QLUC 2ZRIA 5AVWA 1E6LA 1IK4A 1N3BA 3OZDA 4L02A 4H1WA 3P52A 2X19A 1L7XA 3DEYX 1X94A 2FE4A 3O2JA 3PIRA 1JXMA 2CL6X 4RVDA 3C8ZA 4LWPA 3VYSB 1K7EB 3WGUA 4BE7B 5JANA 3H2GA 3IUSA 4MH0R 4X65B 1I7PA 2PX5A 3P0EA 1DTWB 1RYFA 2JB9A 2QTVA 2QTWB 4ND7A 4JDPA 5DXFA 1T91A 4HX9A 4QPJC 2YW2A 3ZW9A 2C2HA 2ZBQA 3L7MA 3WG9A 5A7FA 2XUDA 4KXWA 2GNAA 1QBKC 3EFHA 1HTTA 2AOUB 2XD9A 3Q10A 1ZN8A 2P9GA 1WZNA 5DGHA 4O08A 3WC4A 4F8JA 4OHZA 5KQSA 4PHFA 2P1DA 3VV2A 2G8NA 1GPBA 3A2MA 1HV8A 1U3WA 3QJ5A 1H23A 1E2KA 3ETNA 3MT7A 3TMKA 2R8BA 2KBEA 1MPTA 1Y6RA 4OHRA 2R5FA 4WBNA 3K9CA 5HKAA 3NHSA 1OBFO 4XX1A 4NCBA 2E4UA 1WAMA 1VIYA 3C7DB 3B6KA 3BERA 1BQEA 4E5KA 2RJNA 1XZJA 1JX6A 1AC5A 3G1UA 4XPZA 3DVSX 3FVVA 2V8OA 2UYOA 1T6XA 4BGUA 4MWEA 1IUKA 1GXSB 3L7AA 3N87A 5E1DA 4N41A 3SQOA 4WN3A 2GF0A 3BH7A 2DEUA 4EK9A 1KWKA 5IWAB 1FP4B 3LGSA 3DMNA 3O90A 1OFGA 1FFGA 3HCOA 1K7FB 3F7MA 3HXKA 4P3YA 4PBRA 3WDSA 2CDNA 3EDMA 1YRQA 2RH8A 4B7UA 4ZJYA 4YY3B 1IM8A 3UTDA 4EKEA 4FWTA 4I3GA 4F46A 2ZIZA 3AXSA 3DBRA 4D4GA 3FI0A 1KAGA 3ESQA 1PTJC 4G89A 5CD1A 1T6ZA 3AM3A 1X1SA 4GMGA 4RKYA 2GDJA 4EHHA 2B92A 1RWPA 4FFDA 2B69A 1Q7EA 1EHYA 5AR1A 5TVKA 1SOVA 4RAQA 5C1OA 2ZJFA 1NZFA 4JB2A 4FOSA 1ZMRA 3RS4A 2QI9F 1L9KA 1T5SA 1E7RA 2DUNA 4AL4A 1R6VA 3KHTA 5LNK6 1G21E 5KOIA 1NOKA 3S1AB 3S5JA 1OH6A 3HM9A 2OXRA 4LQ4A 1XXHB 4HAZA 5AJHA 3B53X 1ZHOA 3IR6A 5HEKA 1WY5A 3WSTA 4CUZA 1F7UA 4EUFA 3CONA 1NZDA 4AJKA 2PMEA 4KDCA 1NQXA 3C98A 3HK2A 4HC4A 1L7AA 4NZ9A 4C4YA 4TTAA 1WSWA 1P4GA 1X7YB 1Z2DA 1V4BA 4HAYA 1L5MA 3EAQA 3OPYB 5CDSA 5FX2A 4I5IA 4UEQA 4AZSA 5J1TB 1JR2A 3OJWA 2PSDA 3GA5A 3FGZA 3R3WA 2GWHA 3SFVA 1KFKB 4RD0A 4YXWD 4XB2A 2ZS9A 4QJBA 3WBKA 2XF8A 1S2DA 3IVMA 4TXNA 2O3TA 1EHCA 2JG3A 1SEVA 1U0HC 4J0IA 3PPVA 1KQNA 2BGTA 1C14A 5F64A 1NTRA 3DZJA 4MYHA 4NENA 1CB7A 1LLUA 2EX4A 2HPAA 2R1UA 1FMLA 2QL5A 1VIDA 2XF2A 4RY2A 1QHYA 1QRAA 1TM4E 4CKBA 2WG2A 1QGYA 2R86A 4DCMA 4CLOA 4TRMA 4C4SA 1PN3A 1P1HA 2BT4A 2C9MA 2LKDA 3E61A 4UVDA 5A5VA 3U61B 4AJHA 1GFZA 4EW2A 5HZMA 2QRGA 1Q0UA 1SVUA 2G4VA 2FUG1 4CNBA 4ZA2A 1CEQA 3MS7A 4PSUA 3N7AA 3CVWA 1HFJA 2QN9A 4Q48A 4W5NA 1JB9A 3K4HA 3MGGA 4BJ5A 1NMSA 1JHOA 1OJ7A 3JQ7B 4K6FA 4QUHA 5CLFA 3V6MA 5HP4A 4I6GA 5DTIA 4TYQA 1I4WA 1N8TA 3NIWA 2PL5A 1ESEA 1H6BA 4K7JA 2YJGA 3NBMA 5LNK1 1MXHA 1XZMA 3D8RA 4FMCF 4UBOA 3D6TB 5BNWA 3GPCA 2PKEA 3QVMA 5BQXA 5EEHA 3OAAD 2XSZA 1P4AA 2GWRA 4ESEA 3UT5B 2RJOA 1NBEA 3EXIB 4LVNA 1N5DA 1DUSA 2ERYA 4E2YA 4B81A 1UPUA 2NACA 4R2JA 3U13A 3UAVA 4PU0A 3T38A 3LU1A 3NVDA 5LYJA 2XTAA 3ZXXA 1OLUA 1QE5A 3KEOA 4ZU1X 5LYYA 4J9VA 4MW5A 4LXQA 2G5CA 2LTAA 3E15A 4BQRA 1T8WA 4RZHA 3K9GA 3GCXA 3L8EA 3PDHA 3SJAA 2B8WA 2GHRA 2A9QA 2NAFA 3TCXB 4HN4B 1TK2A 5JS6A 1A4UA 1N25A 2J3IA 2ZJ6A 1YD7A 4BNNA 4F6CA 3JD4A 3EGWA 4PZEA 1SCUB 2A30A 5AW4A 2LPMA 3CUKA 4HDKA 4Y1RA 3SYNA 4CTMA 3USZA 3EUAA 1XA3A 4HLNA 4QUAA 1Z13A 2G72A 3JQ9A 4Y0AA 1EUZA 4ASUA 5HBGA 4LJ9A 4DV2B 3LVQE 1XRPA 2DCUA 2Y68A 1BZYA 2PZLA 3ZCPA 1K3FA 1U9ZA 3BFJA 4DQDA 5B3LA 4BX3A 6ABPA 4CF4A 4XOUA 1KFBB 1T2NA 2CL0X 1J39A 1QJCA 3NRBA 2OVBA 4L0MA 3FYSA 2QT0A 3RREA 1T9AA 2XDQB 3HSYA 4KRXA 5DZSA 4B3BA 2IK8A 2GD2A 3B48A 3QX8A 4NV1A 4LE2A 4IHQA 4WADA 3O5AA 4MRPA 1XRLA 3FIUA 5WRFA 3P9ZA 3TK1A 1AMUA 4NI5A 4F3NA 2VF7A 3NM6B 3UM9A 3K0AA 2GTHA 4I1OA 1CIJA 1XMPA 3GMTA 1ANKA 2JZNA 2JATA 1TAUA 5G40A 1XRSB 4OP1A 1UQUA 1JDPA 5KUTA 1VI6A 4EG0A 2NMVA 1HG1A 1H05A 1WMBA 1NF3A 2B4YA 5K3FA 3RROA 5DIZA 1S89A 3RBZA 5EP1A 3DQQA 3IMKA 2FPOA 2VSOA 1D03A 1RCTE 4KBFA 4I0WB 4Q7LA 2OBBA 1YRAA 4WOCA 3FMFA 2CLHB 1R0CA 4CKXA 3DE6X 1QWOA 2BZSA 3F5MA 3N86A 4W9NA 2YBEA 4C0SA 3DLBA 4UAGA 4A2PA 5CEFA 4ARIA 1N33B 1MQSA 2Q07A 2BPOA 3EAFA 4OHPA 1AMNA 1HDCA 2B6HA 5HF5A 1KJWA 1EJ2A 4Q3BA 1CY7A 3UGKA 1JIKA 4DCPA 4OGFA 1TQ2A 1JI3A 3HBMA 4OG2A 3BMQB 2II6A 1J21A 4LCBA 3G2NA 4EPYA 3GJ3A 2CDRA 2CNNA 2VDLB 1U04A 2ZGVA 3K9BA 4QXQA 5BOSA 1ZP6A 1V6AA 3GNTA 4OMDA 5IT9A 2JJ2D 3D81A 1GNSA 1P9WA 4HB3A 4RMHA 1XHEA 2J5XA 2HO5A 3BWEA 4PLWA 5EE3A 4U7JA 3T1VA 2MCFA 2ZJAA 2BEJA 3U44A 1CZRA 1GKLA 2IYTA 5HFJA 2IIVA 4GWGA 3O8QA 5JWRA 4GC9A 3SZLA 2PUJA 5C7IO 4PHGA 1V8OA 3V33A 1I6KA 2W2NA 3SHQA 4D0RA 1W48A 2XKKA 4D26A 1JR3A 4CF7A 3TX2A 4EABA 2REOA 5HIKA 1L1QA 3IAM1 3Q8MA 4I4IA 5JFGA 4G84A 5C81A 5K4HA 4P84A 1SUEA 2IEYA 3GJZA 2WABA 1NJ1A 3OOYA 4KO3S 4US0R 5BT8A 2CXHA 2Z6UA 4GYYA 1JU9A 2Q3FA 4AG3A 3NZEA 5J5VA 4S2UA 4ND1A 4EL0A 1P2UA 5HM6A 1F3OA 3KWFA 2B94A 8OHMA 1AG9A 1RVV1 1BCRA 2GVNA 1JU3A 1B8UA 3EIOA 4K88A 4RV9A 3ER9A 3HADA 3STVA 4EJSC 2Y1DA 1OZAA 3KIPA 3LLSA 5FEMA 2VDVE 2VP9A 4IHKA 3LOQA 4C0XA 3LCCA 1NASA 4NS4A 1KMQA 1ZX1A 3LPNA 1P0MA 2CXNA 2GX6A 1I3MA 4OBWA 1F06A 2I6UA 2PL1A 1AKYA 2Q3BA 4PYMA 4WLEA 5JPIA 5HJEA 2P4UA 3M1LA 4P9NA 3UA3A 4Z7JA 1SUPA 2NZ8A 2Q41A 1Q0HA 4FDTA 1ORHA 4KDRA 2X5XA 1PW7A 3HKEA 2FPXA 4LGVA 1M67A 3HKEB 1VGVA 1PNVA 1V8PA 3N9IA 2IYRA 1YMVA 3I5AA 5J2UB 4RD3A 4EARA 4ZDKA 2BP7B 2QNBA 3P9XA 4XIJA 5AJWA 1YV9A 4C0JA 5CXQA 4ZCIA 1VPDA 3JQAA 1PWHA 4HTAA 4Q00A 3ZU4A 4GFDA 2Y4NA 3HVJA 3NU1A 2D59A 3X0DA 1U7PA 3EUFA 5DHSA 5K3AA 4B35A 3WL7A 4W9NC 1UMDA 2ZW9A 1HE4A 4MHTA 1UADA 4MQFB 5GONA 4X93A 5DTQA 4Q6BA 3CCCA 3GZJA 1ZK3A 1M6HA 1T25A 2D1YA 2DFDA 3RJTA 2REXB 1KK0A 2JFPA 2ZDQA 1CLUA 4IH1A 2W83A 3VDMA 4WASA 3LY5A 2QJFA 1Q19A 1OX6A 3K8YA 3KT0A 3MTQA 4M1SA 3UJPA 2AEJA 2RGUA 4FT2A 5I7FA 1NQTA 1PR2A 2R7MA 2UVPA 3OEHD 4RQBA 1Z26A 2Q2QA 1YASA 1M8FA 2Q1UA 4MRRA 1Y9JA 4XD2A 4B7ZA 4WD3A 4O02B 5EFZA 1PNQA 1WB4A 1X7XA 3D6UA 3WB2A 3MRVA 2ODNA 5AW9A 3K2BA 1DG9A 3VR4H 4P81A 5AOAA 1MJNA 1M6NA 4HLDA 5DNEA 4DRYA 2WDPA 2DWUA 2A94A 2R6R1 2VA9A 5AVUA 2F8TA 3I2JA 3KPVA 1EZ4A 1JU4A 1S8NA 4HNQA 4D8YA 1RKQA 4R3NA 3TZEA 2VK1A 1NVVR 3L0CA 1E0SA 1WNFA 2MWMA 2BE7A 1QH1B 5H5JA 1NF8A 4UHFA 3NO4A 3WK6A 2DHQA 1W4AA 2AFHE 3HVIA 3OF5A 3KZOA 4TRNA 1L4FA 5JQGB 3CZ4A 1B76A 5KVAA 2JGJA 4FXOA 4MUFA 1HLFA 2GD1O 1IHYA 3WIUA 1NC1A 1CR4A 1NNLA 2YUTA 3ELUA 3ND7A 4FHFA 4LYJA 1JQBA 3LFTA 1FTQA 3ED1A 4DV4B 3ZQUA 1TYBE 4Z7QB 3UHOA 3EVDA 2I1VB 5EJFA 3H9JA 3OCWA 3RSOA 1I1QB 3PYMA 3KQUA 3L4SO 3AUJB 3HCWA 2DRIA 4JT8A 1WXXA 4WZAA 1R3DA 4WZAB 4HEQA 1H2HA 4PRLA 4EKYA 3LQ2A 2BTQA 1RZRD 1NXOA 2C5EA 4NOKA 4YNBA 1R0WA 3GVCA 4GBGA 4QNRA 2FWPA 4WEQA 2WE8A 5CDFE 3CH6A 4Z4IA 3BB3A 1MPXA 3ZQJA 3MXOA 1GLNA 4JV5B 5TQJA 3TQIA 521PA 1HPLA 5T41A 5JQGA 4LF5B 1M0EA 5JS1A 3GXBA 5A2GA 1QFJA 2NXCA 2O2ZA 1DEHA 2G5GX 2QKYA 3BCHA 3V1TC 4E4TA 1POWA 4Q4DA 3RAGA 2ILTA 3QE0A 4XGNA 2FG7C 3C3PA 5JASA 2CUTA 3I1FA 4MYTA 1R15A 4EAAA 3TLGA 4UTRA 5G4KA 4HXFB 4MGIR 5ALTA 2J9RA 2GEBA 2E87A 3VHQA 1MP0A 2PLFA 4MP8A 4B82A 4C5CA 1W0JA 4B2LA 4HX2A 2QORA 4LNUA 4OGLA 1FUYB 4ARBA 2C7BA 5ICMA 4LSZA 2HJHA 3IAXA 4K2HA 3H5AA 3IEKA 4OB7A 3PRKE 1RM0A 5L40A 4PWZA 2GK3A 3D6FA 2FMKA 1PLLA 1G3IA 3L7YA 4OM7A 4OFXA 3K31A 3AEZA 4P58A 3SF8A 1T2DA 4F8YA 3AEUA 1TRHA 3QVGB 1ABBA 3ELBA 2PZBA 4UM9D 5K0FA 2LNDA 1HO3A 2Z8YM 3O91A 4DL9A 3CEJA 4LWZA 3BG5A 5CLIA 3UXHA 3GFBA 4KITB 1W1UA 3U7EB 5JH7F 4AKIA 4YASA 2Q3JA 1OXTA 2X8JB 4PRKA 3K70C 1S3SA 4HUJA 1ZR2A 1JILA 1KH3A 3THXB 3OZAA 2AW5A 3ML1A 2CLOB 3TIGA 3CVJA 3CJRA 4JC0A 3F8WA 4JJ8A 3M70A 4FDUA 4RPCA 3D7NA 1JDBC 6Q21A 3H13A 1WHTA 2AN9A 1NY5A 2HQSA 4MVJP 2BUBA 1V25A 4LY9A 4V02A 4X1KA 5BQOA 4JWTA 3RVMA 1YFLA 2JFVA 2QB5A 3FWKA 1I14A 1NJ8A 1D07A 1G59A 3BJZA 4CHTA 2CDCA 2PA0A 2YC2C 4AMZA 1ECFA 3DBVO 3TRKA 3IVAA 3ICVA 3K30A 1I9GA 1K2VN 1DFGA 1V96A 3FLAA 4UU7A 4OCZA 3ND8A 5FBHA 1BVHA 3GRYA 2C88A 1AK1A 1WDWB 3HM2A 4P22A 4QBIA 1V5WA 1Z0DA 1B3RA 3F5QA 3T7IA 4A1FA 6REQA 3A1CA 1PL8A 4HAWA 2EFHB 1MO4A 2PX4A 1GADO 3MOGA 2WHPA 2YFQA 2P6RA 2BGLA 1CZKA 2EF0A 1PKXA 3EOAI 1QG0A 3E22B 3ECSA 1R8SA 3GT4A 1OBHA 3NPMA 4RANA 3HXPA 4UUAA 4Y3UA 4BCCA 1EYZA 5IBRA 1C8LA 4XEUA 1KMCA 2O52A 4PCAA 3K0CA 2WUFA 4FIZA 5HK8A 5BNIA 2CNBA 1C0EA 1DPFA 3W5IA 1QANA 4O2AB 2IUSA 4DEXA 4M0CA 4IL5A 1DJQA 2H1IA 5SY4A 4MTCA 4POOA 3YASA 1TKAA 3OESA 1JN0A 1PGQA 2J45A 1PFGA 2WMYA 3EVBA 2A9KA 3JQRA 4DABA 1YCHA 3V8EA 1MAUA 5IU6A 4WI1A 1MFZA 5FO0A 2XXJA 3GJQA 1Q77A 5J5AA 4KRYA 3SHFA 4IQ4A 5H16A 3U80A 3J81k 1OYVA 4TYWA 8ATCA 1U9JA 3L43A 3W8RA 3EIWA 4MGZR 3AV0B 2LDXA 3O8NA 3GK3A 3LHKA 3K9QO 1O94A 3RS5A 3JYOA 4YCMA 1MV8A 4DNPA 1JSLA 4Z86A 2WW8A 1IZ9A 4ZI7A 1WKCA 3NTVA 1KRXA 4IDGA 4NV3A 4IIYA 2HCTA 4P7KA 1FS6A 4Y0VA 2I80A 1EFTA 1BVYF 2GHQA 4HHEA 4QHSA 4Y98A 3T4EA 4EEXA 5T7BA 2AX4A 1U3GA 1E32A 3PEUA 3E5NA 2H2GA 4AT1A 2BR5A 1KSHA 2DUMA 2VPQA 4XWKA 3J7TA 5AW8A 1TVKB 3GRZA 1VMIA 2XTNA 2OCGA 4KN6A 4YQZA 4EYKA 4WXPA 1J56A 5E2AA 1O89A 3PJRA 4DQ0A 2BH2A 2P77A 4IZ6A 1RNLA 1UJCA 3CXRA 2NGRA 2NQTA 1EE2A 3DAFA 3PFCA 2GZHA 4AMVA 1UKYA 1XMJA 5CPBA 3B3QA 1CJUC 4QPNA 5ENZA 2J08A 4CEHB 4KQXA 5EXPA 3KOWA 5L95A 4CCAA 1ADYA 3KXIA 2UUAB 4DIFA 5K3BA 4CW7A 2Z5LA 4LSWA 2PNFA 1EWVA 2QX8A 1PBTA 3H2ZA 3UH1A 1DL5A 1ZONA 2KPOA 4LAFA 2E49A 1MX5A 2JH9A 3WE7A 5BWNA 3G5UA 2HA0A 2IJGX 3TSWA 3VVCA 4PZAA 3I92A 1A2BA 1EHIA 1G7TA 3HU3A 3R09A 4KXUA 3AJ9A 4R83A 3RANA 2R6CA 4J7AA 4PNEA 1G41A 4D42A 1UODA 5GY7A 2H17A 1O87A 3I4LA 1P4RA 4CV0A 1RRKA 2CKDA 1D2HA 3QVSA 2R7NA 4FYYA 4JUCA 5KTOA 4KAAA 4PPFA 5AICA 4DJ5X 3JZDA 3N6XA 3OWOA 4OJTA 3C3XA 3KUUA 1AV7A 2Q7DA 2OG1A 1RZRA 4H60A 3QVXA 4IICA 1DWOA 2R25B 4F5YA 4MIOA 4NF2A 1B2RA 2JBAB 1ZLXA 3ZIUA 3UV3A 2FN9A 3HFRA 3RTDA 4BHTA 5FPPA 4W6ZA 1YJBA 1WMDA 5I6DA 3BCRA 4D4IA 3H3JA 1CIVA 4WA7A 1ZQ9A 1E92A 4IGIA 3PUKA 3V55A 5MHTA 1M9NA 1DIRA 1II0A 1THTA 4XUGB 3WXBA 3R7WA 3GV0A 4XGRA 2EKQA 1XB2A 1U5BA 3T3IA 4BFCA 1EDEA 4L5YA 2IYUA 4RZ2A 1NW3A 1V11A 5FL7A 4FMBB 4G97A 1TC1A 1UPXA 2X0KA 1QNLA 4QJ3A 2GF9A 2R7KA 1XJWA 4QUEA 4KAXA 5EWMA 3IQEA 4GR5A 1FDIA 1GSIA 3SNKA 1AZWA 4Z51A 2RHMA 4K03A 1U4SA 2FG6C 4OJQA 1GGMA 3E8XA 2N0SA 2C5SA 3KPJA 2IH4A 4K81B 1J2RA 3P0RA 3KR0A 3NASA 2GBLA 2B20A 5L4SA 2JAUA 4BTVA 3C4QA 1IN8A 1YL6A 4DPKA 2W6JA 2AOXA 1KVSA 4U00A 3A4VA 4F9GA 2OHIA 1V5GA 5ENVA 1YJQA 3I61A 3ROKA 1A7JA 1L5YA 3KV1A 1E8NA 3ZJ5A 3T9CA 3I9V1 3C6QA 1TTHA 3KE9A 1E3LA 1IWPB 4NBNA 5LMUB 2YBDA 3WLHA 1IIBA 2HHAA 1BWRA 4ZMBA 4N5MA 3EIEA 2I4IA 3NANA 2ZSAA 1OE0A 2NVUA 2W6ZA 2A58A 3LPAA 1U1CA 2QAGA 3TTWA 5ER9A 4AP9A 4RMJA 3C5VA 4C2UA 3WVNA 1VCMA 4N5HX 2A9PA 1G3QA 2WB2A 1RRGA 3OOHA 4QFDA 4Y6SA 1MBZA 2G09A 3JQPA 1RQ7A 1XEXA 3DHNA 1FSZA 1XD2A 1EWQA 3PWKA 4OHVA 3AFGA 4N3CA 1ZS9A 1EGHA 3JRXA 5G1PA 3K96A 2XE6A 3DEZA 4LUCA 4RWZA 1YR1A 1GFWA 3GROA 3KEMA 4ERXA 1SUAA 4E22A 3W79A 1NJ6A 1XTKA 3LQRA 3B60A 4MAFA 5DULA 3NBKA 1A9SA 3LV8A 4OATA 1WABA 4KXLA 2JIZA 1G5RA 2PUAA 1N8SA 1G5HA 2VT3A 3OZGA 4YP7A 3ZDYB 5EHQA 5GM1A 3K7EA 1D0VA 4IDEA 4IQ8A 3UNXA 4GGOA 1NNI1 3GJ4A 1RQ2A 3G02A 1IWOA 4DJAA 4G0OA 1KFEB 1NXSA 2DTDA 3MTDA 5G0WA 2BHTA 3B8HA 4O4JF 5CCDA 2OXEA 2QPAA 2XVAA 4Q6WA 1TQ6A 3FNBA 1IEXA 4EI9A 2CFSA 1OLOA 4N7RA 2AX3A 3JASA 2AOTA 5I01A 5JAPA 4UKDA 2CF5A 5AVSA 2ASVA 3UY4A 5EE0A 2OFPA 1CUUA 3W77A 3PYXA 4Q24A 2TMKA 1Z0KA 2DYKA 4MQ4A 5TS3A 3HCDA 5KYGA 3M83A 4IGEA 1CQIA 3QPAA 1E5XA 1HE8B 1N2CB 5K6AC 4R8MA 3L3BA 1QIFA 5G02A 5BW8A 4GS5A 4MTLA 3VUFA 1EWTA 1G1AA 2ZOSA 5LOVB 2OAQ1 3KL4A 5CT6A 5IJ9B 4C3ZA 3SXPA 2O4UX 2XCOA 2X4DA 3FZNA 1HSZA 1BX0A 2J7KA 4DXAA 3ZQKA 1GAXA 5C4MA 1OZFA 1SHTX 1KZGB 3HKDB 3PR1A 5EKTA 1Z6ZA 3VAYA 4DBVO 3PX7A 3BM5A 4MYUA 5AM2A 2PN1A 4RXUA 2JCYA 2OO5C 4WXMA 2Q0HA 3OCJA 3N8HA 2P6NA 1SBYA 2C9CA 4N7MA 3GT3A 1E3IA 4LDQA 4ASUD 1WHSB 1Z6QA 2W6OA 1EXNA 3L1VA 1P45A 3QYJA 3AEYA 4N0MA 4RFSA 5AK5A 1BWSA 1G9TA 4DSTA 1CCWA 2V6GA 2X2FA 3BJRA 1CY0A 2R6ZA 3BDVA 3KSZO 5FBQB 2DZDA 1TZBA 3WYDA 3EEFA 2QW8A 3N07A 3Q3VA 3O8OB 3COPA 2B30A 1TFRA 3Q8WA 4LF6B 1P19A 2YVLA 3JQ9C 4UATA 5I7RA 3HJFA 3GQBB 2XUFA 5E6RA 1U2RA 3EVZA 1VE6A 1C4KA 4YAGA 1PGNA 4L15A 4LDAA 4FC7A 4RVGA 3M5CA 4TLLB 4NL4H 4NYIQ 5CDHA 2WKPA 4BQQA 5CAEB 3TDKA 1E1LA 2VSYA 1PZEA 4NBSA 4OHKA 3ZHYA 4UU8A 1FUKA 1JH9A 3I39X 2P9JA 3N8KA 2L17A 2XSZD 1E2LA 4EGSA 1JFFB 2JI8A 5TEVA 2Z1MA 2ZSJA 3CZ9A 1MXFA 4L6IA 4Q4LA 5EUCA 3VZSA 3O8QB 1DBPA 1K3UB 1KZ4A 1W5SA 1A96A 2R60A 3NDRA 4XUCA 3C6XA 3LUGA 2FFHA 4GKBA 1OX4B 4JFRA 3M6FA 5LN1A 2ZUFA 4ZU3A 3PZRA 2PX8A 2GJKA 5FO1A 4RY0A 4ESOA 1YJ8A 4J90A 2V7XA 3S3TA 1Q1EA 3PPYA 4MLCA 2OSBA 2Y4OA 1O94C 3FHLA 3ISJA 3V4VB 1H2AS 2YWEA 1L7PA 4HADA 1QVRA 4DLSA 1EBFA 2AT1A 2YFHA 3ITNA 1OZGA 2P35A 3AVWA 4BMZA 1N3IA 4WY8A 4B45A 2DERA 3TTTA 1FQOA 4LOIA 2RGXA 2FYTA 1LDYA 1QC5A 3BX1A 2XE4A 1ITZA 3I62A 3ZLVA 1BA2A 3LVBA 5T64A 1LPAB 3O3MB 2ZS8A 3CF4A 3DUFB 3FMPB 3L6DA 2GPWA 3CEHA 4KYIB 4ALNA 1XFAA 4RTOA 2PEZA 3OHMA 4B3MB 1RPZA 1Z8HA 2RHDA 5EY5B 4FZJA 4ARAA 4JZYA 3R8FA 4JK3A 2OYRA 4B9AA 1OYYA 1ISJA 1E0KA 4J3JA 4TXHA 3AZOA 4QOEA 1LWOA 2FN4A 2Q21A 1W88B 3JQBC 2TMYA 3VKVA 3P4UA 4NPAA 3SHVA 3GUZA 2O6LA 3ELYA 3IDFA 4H3SA 5DNVA 5A3QA 2LW7A 4F4FA 1V1MA 3OJ0A 3RJMA 3S2SA 3C3AA 4LFAB 5LBTA 2H18A 3CLKA 4J9UE 3WB9A 2G9UA 4JQYA 1ZYUA 5JR3A 4JOBA 2VPPA 4K6GA 2FKAA 4MUAA 2B25A 4Z1MD 5B1HA 1FP7A 2GRJA 2OK8A 4HQFA 4IP0A 4MKIA 3ICWA 5KQLA 1R4MA 3QU5A 2A0XA 2H2DA 3FVQA 1JKJB 1FF9A 2B35A 2ZP1A 9GPBA 3P2OA 3MN1A 5YASA 3GWZA 4QGAA 2O1EA 4LV8B 4ZAZA 3QQPA 5LKRA 3MMZA 3R0JA 5JSUA 3PR2B 3HA5A 5JI3E 2BDUA 1KMHB 1AIPA 2WJJA 2KSQA 3RNLA 4UEOA 3PG5A 4ZARA 3I9MA 5EC8A 2EFCB 2VH2A 3TPCA 3DVAB 4D3ZA 2VDNB 4BUZA 4Q3DA 2IA5A 3H97A 4F4HA 5EVJA 3UO8B 1UKVY 1UPBA 1H2YA 3DB1A 3C8HA 1GQRA 4YMHA 4C4OA 1SG9A 1CY2A 2XDAA 4YMGA 2BFAA 2Q6IA 3LKBA 4FE3A 5LQKA 2O8FA 2Y92A 3T8YA 3H6KA 2YVKA 4PONA 1K98A 2EFGA 5A9TA 1C0KA 1DBVO 3KWJA 3OTIA 2NNLD 4YJ2A 3QV1A 1A04A 4KYTA 2QN2A 2NADA 3QIVA 3CCFA 1KOJA 3HB9A 3OQVA 4X8OA 3R44A 3CX7A 2YV1A 1O0SA 4DT1B 2TSYB 3MTIA 1NUPA 4Q3CA 4FWIB 5J58A 2ZTHA 3N05A 1E9SA 2R1TA 4GXNA 4OXIA 4TV9F 4YLGA 4Z8YA 3TD2A 3A1NA 5LDDC 4LDRA 1U1FA 2C1EA 2WM2A 1HLDA 2FWIA 2H4WA 1NUQA 2XY4A 3R0VA 3RVRA 1ISRA 5E9AA 4JBWA 2CSUA 3BK1A 2NZWA 3AZPA 4EY4A 3AKDA 2JCXA 2L2QA 5DISB 4HV4A 1Y1KE 2PT5A 1C9EA 1HNXB 1Z07A 2H9YA 1SHUX 5K3DA 4S1VA 3DG9A 1CR0A 1LVGA 3SF0A 4I1SA 1A8HA 2G83A 3KELA 1Z3CA 1C80A 2QE6A 1WVMA 3TXXA 1IVYA 1IBMB 4PGHA 2VNIA 4HRAA 4NU6A 3MQ4A 1N5RA 3MUOA 5HDBB 4ZVPA 1Z0SA 2HRCA 1EJ6A 1O9HA 2LCIA 3W2TA 2Z4TA 5M7EA 1EGQA 2HCBA 3CX6A 3LAWA 2OKGA 1A71A 3GBSA 5AJYA 2EXXA 2HJ9A 4BUJA 1TT5B 5HQ3B 2GHIA 1M2WA 2C04A 1VB3A 1KDRA 4G8BA 4BX8A 3HVUA 3STHA 3AGPA 4CT0A 4EI8A 5DM70 2WJWA 4F2DA 1YZLA 3DL4A 2BBTA 2ADMA 4M8IA 1I3KA 2PV0A 3R6GA 4D7AA 4DDUA 4H7FA 4WBXC 1RPTA 2C96A 3AV3A 2CL7X 5D1HA 4ZGGA 1JEDA 1F14A 2XBUA 1VLZA 3FOWA 4OSEA 1WXFA 4I4TF 2BCEA 2VP2A 1XD9A 5CTJA 1UJ5A 5EMMA 3T35A 1CE8A 1WD5A 3G0BA 3PFGA 4LQDA 1NW9B 2WFLB 1UDRA 1AVTA 2HMVA 1PE0A 1UBTS 2X1MA 4MCIA 5CUQA 5B57C 1Q2UA 1NW7A 1CEYA 4HVTA 3ZLBA 2EBHX 4FYVA 3A9RA 5IC5A 4QQ8A 1Z6GA 2EZTA 4QDXA 5K8CA 1PJZA 1DAGA 1DQPA 4FR2A 3HLKA 1SK8A 1KY2A 4GUAA 3NCHA 1OWPA 1GPJA 3DZDA 3GN2A 1YE5A 4R7GA 2QD5A 2XDWA 2IT1A 5K01A 1GAEO 3QF7A 4R0NA 2WMOB 4C0HA 4QDUA 2GBFA 2O2EA 1YDHA 3DKRA 4Z4HA 1XMSA 3VO1A 1HDIA 2VXBA 2QD3A 3LT1A 4YQFA 1U0OC 1CJTC 4Q7JB 3E5MA 1YDGA 3Q1KA 4RXTA 1TGYA 1RIIA 2Q2VA 4OX9B 1DEXA 1DQNA 1SHKA 1BQ3A 1W0JD 1V37A 3LX6A 4U0JA 4A92A 1XZIA 5IFLA 5JI2E 1J70A 5BWMA 4DGSA 3E7DA 2FX5A 3HRKA 4ILKA 1Y5IA 3ZV3A 3H83A 3SY8A 5B6PA 1EFCA 5H8WA 1KNXA 2WFZA 2G4CA 4FOTA 5A7GA 3P5BA 4BVEA 1FDTA 4H6XA 2J1LA 2W2TA 1I10A 4A7PA 4WACA 2J5QA 4JL6A 4RQTA 5JUWA 4OL9A 5DH9A 4WQMA 1O6CA 1XZQA 2CLCX 4TTPA 3CB2A 4NYMQ 1SG0A 3KVOA 1NY6A 2JLRA 1NW8A 3QU4A 4GI2A 3ZBUA 4DJDC 5JH7B 3S1SA 3OQHA 4LTMA 2AE2A 5CB4F 2PGDA 3STUA 4ER5A 1YQWA 3FTPA 3TSAA 3FWZA 3W2GA 3G2LA 2CN1A 1TJ5A 2JHFA 1IZYA 2G70A 1CQPA 1S3IA 2G36A 3LBIA 3AP3A 2AC2A 1RTTA 3PWTA 2XPCA 4S05A 2AFIA 3Q7PA 3H6GA 4QAJA 4R69A 2E82A 4ZOEA 3AOGA 3V4OA 3LKVA 1PK8A 3ROZA 4KGVA 4PBSA 3D8BA 2A0UA 2GILA 1GQFA 3GJ5A 3JQFC 3VPAA 4BP1A 2EYUA 4D97A 3MWDA 1ESMA 2NZJA 3QUBA 2BGGA 1XTSA 4GR4A 4RYLA 1UBGA 2I62A 3BFKA 1JHPA 5TQ2B 4F12A 1RVDA 1XT6A 1MUUA 2IE8A 3FDFA 1LS6A 1SD1A 3W6ZA 4MR8B 1P7WA 2FK8A 2H7XA 1PQPA 1UFRA 3PD1A 3FIJA 2RB4A 5FBZA 2QMHA 1DCTA 5HW0A 3W3AH 1WDLA 1F8YA 4LY3A 2WY2D 5JT1A 5KYUA 3QPCA 4PLHA 1YZYA 3R9XB 5TGZA 3GELA 1RKXA 1NJFA 1YVEI 1X74A 2AZTA 4J49A 4G5QA 3FROA 3Q3CA 2PTHA 2Y77A 4DZRA 4H7HA 5KTKA 1XEFA 2TRSB 4PHHA 3FPJA 4BPRA 4ZYZA 1XA0A 3C3BA 5KNBD 4I55A 2GLTA 4L7VA 2HFKA 1M10A 2YIMA 2HTFA 2WTNA 5ALZA 4NYIR 4ETIA 4KAJA 3IEVA 2I4TA 4P4TA 1XLTC 2BFFA 4U1RA 3I30X 1S2MA 1P4JA 5CCXA 4X20A 3ZE8A 4V03A 4X20B 2PXXA 3ZZNA 3HQ4O 3F9CA 2CXSA 4R2MA 1QVAA 1WB6A 1SU8A 2CKMA 3TLMA 4FCTA 3Q6NA 1GITA 4R8SA 3VPGA 1AUVA 1IL0A 3ZYCA 1PR0A 1UMBB 1UDBA 4JLNA 4ZT3A 1Z7BA 4BVGA 1NBHA 3GNLA 2XDYA 3BCUA 3MBOA 1R6TA 1YOBA 4PR0A 4PO1A 4RAOA 5DX0A 3R3HA 4FBLA 3G2OA 4JIMA 4EJ0A 4JKIA 2BIFA 4KE7A 4OUKX 1ZGBA 2V0CA 2HLNA 2VHJA 3ONWA 2JFQA 4KI7A 1H2FA 2UVQA 4FDVA 2QQEA 3LQKA 2CSXA 1OF1A 2J6CA 4KQCA 4JXJA 2BFMA 2IY9A 4PLZA 1KY4A 5DGIA 2PL3A 3ZU2A 2C1ZA 1JHAA 3ICEA 2O7QA 4MKFA 3CURA 3VSAA 1DRWA 2O8NA 2HQRA 2M6KA 4XVCA 3IO5A 4BZZA 2ICAA 5UKDA 4L6AA 1QFXA 1N3YA 1Z3IX 3RVLA 3GGCA 4NX2A 3CW2A 4Q1DA 4ZKDA 4BVBA 2NSYA 3A05A 4E31A 1UC9A 4O33A 4V1CI 4N03A 4KREA 2ZANA 1G2IA 5G2OA 4EB8A 4KQIA 2OK7A 2WJHA 3GN1A 4TS4A 3ZXIA 4GVLA 3EGOA 2W6MA 4YXWA 4L4XA 1H9CA 2W6PA 2GZ3A 1U5CA 2QUIA 1J1IA 3CHYA 3PLNA 2J5KA 4HLUC 4LPKA 4NMLA 3RHZA 4B4KA 5KYXA 5HGJA 3SQWA 4WNAA 5C1IA 5E6UA 2CL5A 3R20A 3AVTA 3AU8A 1SIUA 3NT2A 1DXOA 1K06A 1S01A 2PZMA 4AO8A 1K92A 4PYKA 2QW1A 3B13B 2CK3A 3IFSA 4HFJA 3KKNA 2QY9A 5ARCA 4J3NA 3RBXA 4DLNA 4ZEVA 5JNSA 3L7DA 5CYGA 3NUQA 3COWA 4PEVA 4JP5A 1JJIA 4BAZA 4P3KA 4XLLA 4CMEA 1NUHA 1Z6PA 3ONNA 3WWYA 4BEVA 3GUUA 3CVYA 4HYTA 4RPKA 5F51A 5G4KB 3QJYA 4TPKA 2ET6A 1AQ6A 1VLMA 3GFFA 2R6DA 3KPYA 4B6FA 3A4MA 7AT1A 4YJFA 4UMVA 4CQNA 3SN6A 1T0JB 5TR9A 5EHNA 2V58A 4H4CA 1X2BA 3WDKA 2ZU0C 1F1BA 1P2TA 2Y1OA 1RACA 1RC1A 1RE1A 5ALJA 2I3BA 3WZMA 4B6QA 1S0UA 2NTEA 4GX0A 3FNQA 4EJSA 1XNHA 3HJBA 5AJTA 4B33A 5KWEA 5B2FA 3I5XA 1HLGA 3AP2A 1L4EA 1RPAA 3UHAA 1KI4A 2C9BA 5CVUA 4Z49A 3PUWA 3F4LA 1BC5A 4IUCS 5CK4A 1NPYA 2HA2A 4D9IA 1MMFB 4NFYA 5FIUA 1YS9A 3JVDA 2XXAA 4FKBA 4DCVA 4ZFNA 1AZLA 4HH0A 4MRMA 3L7BA 1CNMA 3UTCA 4CFSA 4CKBB 4R9NA 5HVNA 3LIIA 4ZODA 2BCGY 2IYEA 2XWQA 1E94E 4BQIA 1U65A 3VU1A 1I9CA 1M6VA 2IVFA 4FFLA 1ESZA 2CDAA 3L7LA 1FRZA 1QRUA 4UFOA 3TOVA 2BMFA 2NXEA 3DOEA 3OIGA 4YJFB 3ISVA 1XZDA 4UCQA 3TKLA 4M46A 1JLMA 1YJXA 4OJMX 1I6MA 1TTQB 1E9FA 3VR1A 3FX2A 3SC6A 2V6MA 5I7HA 1GPWB 4V1CB 2C03A 2F9MA 2RI6A 2YOFA 4PNZA 1YOVA 3ZE6A 1KRWA 1ZXXA 1C30B 3A2NA 1AT1A 1E7QA 1L3CA 1R0RE 2WAMA 3AIKA 4FINA 4ZCPA 4D41A 1LEHA 1NVMB 2QSZA 3KZNA 3PCXA 5AW1A 4RTJA 4UTPA 1PL0A 3MGBA 3PGA1 4PAMA 1P0QA 1D4ZA 1EK5A 4TN1A 4BMPB 4B32A 4JCOA 1IAQA 2I7CA 5K6TA 2F67A 4LRSB 1MG0A 3GG9A 2FZGA 5JVDF 3C1OA 1DQYA 1SKAA 3DOCA 4H7IA 3KYCA 5H9VA 2YZ2A 4G5RA 3AC0A 3JQDA 3FF4A 3GEIA 3Q98A 3K0BA 2HGSA 2PKWA 3Q88A 4YMWA 4QM6A 1DRVA 4G3XA 4NDAA 2WTEA 4O4LF 1JHXA 1HZJA 2E9SA 4MMZB 5KDLA 3GFPA 4FEGA 1O95A 5EE5B 4D57A 5IEBA 4E03A 1YRBA 2P4QA 2HI0A 1EVLA 4ZQEA 3VNQA 1B41A 5NLLA 1DG1G 1QOPB 5HG0A 4O2LA 2I2FA 1A4XA 5EPOA 3SLGA 3WMXA 2QM7A 4V2UA 5LU8A 2E6KA 1P7YA 3DMRA 2IEBA 4FFSA 4YI5A 3PGLA 1YBFA 5FRDA 1Z38A 1FB5A 3O03A 5DCLA 3FYUB 5CDUA 3QY0A 2ONCA 1C1XA 2XVXA 2Y6VA 5FXMA 1GQYA 2GYWA 3QBJA 2RAPA 3LUAA 4ENUA 3GUVA 2OZLB 4BNJA 3QXXA 4LZLA 4YPOA 1EESA 2EVWX 4MYCA 3ZLJA 3L4BA 1YDWA 4TV8B 4S1PA 2RGDA 5ITVA 1DTSA 1FRQA 1YA4A 1EBBA 2V7GA 2HYDA 1DU4A 3AR4A 2ZRLA 4HN2A 4O4IF 5EINA 5BVGB 1P31A 1GR1A 2QLNA 4DLZA 1OXSC 2Q5OA 1CUCA 1RHRA 4RKRA 3GAMA 4CR6A 4A8HA 4KU4A 3A6DA 2OCXA 3UATA 1E6EA 2AWNA 3CO5A 4IX9A 3IQIX 4P86A 1QU2A 1O5IA 3C1AA 2FSIA 1FZQA 4R40A 2I2WA 5GQSA 1ZN9A 1X80B 3OIYA 4WFQA 3HY3A 2D2IA 4UNSA 1N2SA 3GJ6A 2NV0A 1VPLA 3CCBA 2VK8A 1IQ0A 3MWLA 4PX2A 5JH7A 3DFZA 2QXYA 1OU4A 3H3FA 3TKYA 4CTOA 3CWZA 3N0VA 3ZDBA 1Z4QA 3B6IA 5EQFA 2W2QA 2HBZA 3UHFA 3PQCA 4HUQA 4LXTA 3ZQ4A 4Z4CA 1MH9A 3D54D 3GEMA 3I2HA 4DJJA 2D1QA 1SXJB 2XI4A 4I8XA 2RONA 2C2GA 2HY7A 4NYMR 4B34A 4EFKA 1H9AA 1ZXLA 1NYTA 3MCWA 3R7WB 4DMKA 4MQ5A 3S27A 1Q11A 4Z7OB 4ZRDA 1OI4A 4Z8XA 3AY3A 1OMOA 3OX1A 4ED9A 4MV7A 3C7CB 1KQOA 1H3NA 2LP4Y 2QPTA 4QPZA 1X7DA 4GX2A 4WKGA 5KNCA 5EEGA 3HXMA 3GMSA 3WMEA 2YWHA 3GRUA 3SS8A 4BBAA 3IDAA 1BKSB 3OAAA 1Q57A 2DE0X 1AQUA 1PT8A 1OSNA 4GEKA 1IXSB 3WAJA 1OC4A 3IEMA 3ZDDA 2C4VA 3A9WA 5E9JA 5ADVA 4KV7A 1F2DA 1B14A 2OFFA 2NU9A 4AQDA 1BHJA 1YDMA 3AEKB 2M6RA 2XVZA 4R9RA 3OY2A 1OU0A 3DVRX 4M99A 4AY2A 3ZHVA 1T8YA 4BGEA 3IKLA 4Y1EA 4YRFA 3C3MA 1EXDA 2UKDA 5KX5F 4ZRMA 2QJOA 3TZKA 3L49A 4XWYA 1CF9A 1BE8A 1IWBB 3OFKA 4NHOA 5I4KA 5LQAA 5JXWA 3AM1A 4ZOBA 5JEEA 1M34E 4WA8A 3B1XA 4IXMA 2HEIA 2G5TA 1G3MA 2R2AA 3GIWA 3H2YA 3BS4A 3LKZA 3LC7O 4HDMB 3WRVA 3WZLA 4E3ZA 3ZG6A 4H77A 1T9BA 4EF4A 3LK7A 4FKZA 5LMNB 1XQ9A 3DYBA 5EGSA 3KKLA 1RCFA 2PX2A 2A7QA 2HV8A 1VYTA 4LC0A 5HKOA 5JAZA 2F64A 3PF9A 2F3QA 2KW5A 2OGZA 3H5TA 4JSTA 4MV0A 1ZMOA 1IXKA 4H3VA 4P83A 5FTMA 3T61A 4GGPA 1TLTA 1E2MA 2JRLA 2EW2A 4MZDA 4XJVA 3SEZA 3UF0A 2R2GA 4NP6A 4GRAA 2HKIA 1SCBA 1UZLA 5KPDA 2VSNA 1S4MA 1P7PA 1XEAA 1UXGA 3S2EA 4A6EA 3U26A 3IPLA 1BMDA 5JAIA 3AJAA 1IPFA 4RCZA 2XT0A 2XCTB 2W7TA 4ZVOA 3MJCA 1TMYA 2OXFA 3MUNA 1KI8A 1RWQA 2B1QA 1SD5A 2ZYUX 3NX4A 5T3YA 5HKKA 1BKDR 1CUJA 3E9ZA 4U9IS 1Y4DE 2QIPA 3LL7A 3X2FA 4DAEA 2PUEA 4MVJI 4L5IA 4IIJF 4R1QA 4X44A 4N65A 2JGFA 1NQUA 1DAPA 3ABZA 5CVTA 2VCEA 4F60A 1IHPA 4W1RA 4CPDA 4LVUA 3IMGA 4R2KA 3QHQA 1CF4A 1KTIA 1TK9A 2ZSKA 3VJRA 5E7QA 5TPZA 5TT0A 2HWKA 3QPVA 1W6RA 4Q4JB 1VKZA 4Z9BA 3PTLA 2DT5A 3O1IC 4RY9A 7MDHA 4R2IA 1PK9A 3AR9A 1TA4A 2GZRA 3C15C 3H5NA 3BWYA 2XDQA 3O21A 4HDOB 3UFBA 3WLQA 4AMYA 4QM7A 3JD0A 3WL4A 4H7DA 4X1IB 4OFWA 2H00A 3L6UA 3Q2IA 3PSAA 3I2YX 3NOVA 1W5BA 1Q0TA 4C30A 2H0RA 1JAXA 3WJ1A 3PNKA 2L42A 2ZIFA 5G3YA 3L8ZA 4C4ZA 2B2CA 2F1RA 4DSUA 3D1JA 4S0ZA 2WSBA 2X15A 4CV3A 1I13A 2I3GA 3PDIB 5HOQA 1Z0FA 3ABOB 3KQWA 2QP3A 4ARCA 1Y8AA 2C5HA 5F2EA 5BQPA 4KIJA 5B4TA 2PBLA 3FSGA 3KQVA 4TKVB 3OMXA 4D6XA 2IBTA 1CY4A 3DOHA 4KO8A 5LZ8A 1G4AE 1RRCA 1QVVA 4KLCA 1GU7A 2H1HA 3P9RA 1G0OA 4N01A 2WIAA 3FAKA 1CPYA 2DWCA 3BGDA 3BXFA 3OZ7A 3RG2A 1XELA 3W5CA 4UHBA 4N3AA 1BOFA 2XGOA 1QDUA 3GP3A 4HZUA 4PZDA 4ZVVA 4H08A 5KNBA 4DR7B 3RAEC 2HYIC 4JQOA 5F76A 3RSFA 1CQWA 1W0KA 2EP5A 2ZYDA 1FRVA 2ZE6A 3EVNA 3CH7A 4WUTA 3U9SA 2O3UA 5LXTA 3EPJA 3L40A 4X84A 4EMUA 3D43A 3RRZA 4CG0A 3O9VA 1OAOC 1NRXA 3NMUF 1W87A 1R8QA 4M3NA 1IOVA 2ZUUA 1P3JA 1J23A 1FU7A 3L05A 3Q0TA 4IDAA 5C35A 3IRUA 2BELA 4HH4A 3QV2A 4UUOA 1PWZA 2QZZA 2QU8A 5D5HA 2XUOA 5IMBA 5KYYA 3HB0A 4HXYA 1X7WB 3WGKA 4UEKA 2WIKA 4TWZA 1NI3A 9LDTA 5LDHA 1UBUS 2BZ0A 4XWGA 4RQUA 5D00A 2HQ1A 2WJGA 4U2BA 4CEHA 3QG5A 1RYHA 3M6UA 3WQRA 4BN5A 3KXKA 2P5YA 1Q12A 3JRWA 3HV0A 4FU0A 4HN9A 1Q15A 3KJGA 3OT4A 1ZIXA 2A84A 3ICPA 4A03A 2QI9C 1PJ8A 5EHIA 1CS0A 2H52A 4FN4A 3V1YA 5CBPB 4X45A 1FNDA 5LQCA 3GDHA 1EFRD 1U11A 1HNZB 3TR0A 1QP7A 1ZNXA 5F9FA 1UF9A 4BRWA 2X4LA 4MV6A 3LFHA 3R3ZA 4BB9A 2CLLB 4LXHA 3BFVA 4OQZA 1PQWA 4KK4A 2WDZA 2XWPA 3HA3A 1TYDE 4FC6A 1E1MA 3ORQA 4G56A 5KBYA 1AJEA 2GEKA 3CRNA 2IY7A 2H16A 2WK1A 2W6CX 4LG1A 4ROTA 5G0SA 2FPPB 1E69A 3L41A 4ZI5A 1PVDA 2H29A 1NQAO 4V0KA 4KZKA 4LHVA 5E4TA 2X0FA 1FFHA 3QIAA 1JLLA 4Q16A 3PBKA 5FTWA 1QP0A 2W6IA 4IDQA 3Q8XB 1DC7A 4JGGA 3B51X 3KXPA 4QRIA 5DGXA 3RU3A 4D8TA 1JZSA 1CY1A 2G1JA 1JMKC 1K0UA 3V7YA 2DHCA 1VFPA 4PXAA 4ZZ3A 4BGVA 2BRUC 3ICCA 5KVCA 2JRCA 2JFBA 3L7OA 2RGCA 4INZA 4ND8B 4EUEA 4ZYTA 4X8LA 2GM3A 5K0LA 3KVVA 3LT0A 2F3UA 1OKKD 1Z5NA 4JEIA 3F3KA 1BMQA 1DKUA 3D0OA 2W58A 1X38A 2G3YA 2ZKIA 3DT8A 3LYLA 5LZ9A 1XRNA 1N5JA 1QONA 4BLUA 2O50A 4DVJA 2UZ0A 4YV1A 1I1OA 3LLUA 3H5IA 1NTOA 1QFZA 2YMQA 3HCAA 3RU2A 2RK4A 5JO9A 5DOVA 4DADA 1L5VA 1SKYB 1R9JA 3OM9A 3Q15C 4JHLA 4QAQA 4JI6B 4EHNA 2ZRCA 3THSA 4QYIA 4OGWA 3OQNA 1YS6A 2OM2A 1XOIA 2B36A 3EGXB 1I2CA 1ZIYA 4MARA 1IEVA 2EJUA 3H5WA 1GA1A 4ZZ2A 4JUDX 3AETB 3NRJA 2H1SA 4M6WB 4XFKA 3K6RA 3KCNA 5K99A 3BHIA 3KQYA 4OP3A 1EFVA 3FFXA 3H2SA 1KE1A 4EY7A 1KKLA 3M6LA 1IE3A 4YUWA 5BV7A 1U9CA 2NUBA 4EX7A 3GGSA 4YREA 3UBTA 3A28A 3ZTYA 5A0TA 3FR8A 4F84A 1V16B 4BX0A 3VO2A 4YJKA 4B6RA 1RJ9B 4TX1A 1A4IA 3IR5A 1XZNA 2B4TO 4ZAYA 3A58B 2IHYA 1AU9A 5K3FB 4ZIRB 2P11A 5I7WA 2B2XA 4ZYUA 4XVRA 3HSKA 4PZYA 3GL9A 2ZUEA 4Q0MA 2GJ8A 1QTRA 3DXFA 3ODPA 4ZZ1A 2FLVA 4ERNA 1UPAA 4HYYA 3AI2A 2ONKA 2Q5LA 4QATA 4REMA 1YHZA 3EBPA 4RV4A 5TDHA 1ZGAA 3BZWA 2ZAYA 1NI4A 2ZI3A 3NB0A 3T3MB 4EUNA 2D5AA 4AJ9A 1GZSA 1TTTA 3R7DA 1OLXA 3T5GA 1GZUA 5AESA 1SMKA 3MTEA 5A5GA 4I5GA 3FA2A 2O57A 5KU1A 2ZREA 3O94A 3LUHA 1TJYA 1HKHA 1EX7A 1W19A 2XHEA 2IL1A 4I46A 4KIUA 4L8WB 5AQEA 5J40A 4C78A 4JGBA 2CMHA 3HCCA 3A4LA 3GDOA 3VR6A 2JI4A 2YXLA 3MWYW 3OICA 1VE3A 4DUGD 3M9LA 3TXYA 1ZWKA 2CHGA 1GNLA 4OI4A 5AMXA 1UBMS 2JCBA 2QZPA 4HGOA 2D5IA 2XIJA 2C3PA 1H1LB 1SOAA 2Y1GA 5H68A 2XMRA 4URWR 5FFNA 3AR2A 1LC0A 1ETUA 2QXTA 2WTXA 4X91A 5F3RA 1FXWA 1IB6A 3IB6A 4ZVUA 4TM8A 5G41A 2PIDA 1C1HA 2FP3A 3LFUA 3PHIA 3AYZB 2HIAA 3V9PA 2RH9B 1AS3A 1YUBA 5JMOA 2LIVA 4WKBA 1LK0A 2C97A 2VRCD 4BLWA 3PUJA 1HL3A 3GRAA 1D4AA 1L4KA 2C2KA 3PLRA 1VQ1A 1RFLA 3IJEB 2GCOB 2ZIXA 1JDJA 2OHOA 4G37A 1HDOA 4PR3A 2XEDA 3N2KA 2V55B 2G07A 4IDBA 4EFLA 3ZWNA 2ECOA 4ALMA 4XX0B 1E2GA 1E66A 2FW9A 3UW1A 3TNJA 1FXSA 2FF7A 5JMTA 3RS8A 3TJRA 5DDIP 5IJ9A 5LJLA 2JJ8A 4B79A 3B9PA 2YKGA 3MUFA 3HH8A 3NP7A 3PQ2A 3Q9SA 3UWMA 1PEKE 4UUBA 3T4XA 3TW0A 1JG3A 3O7MA 3WTCA 2Q8QA 4JVSB 2JASA 2DX7A 1QZUA 1DOHA 3KUDA 1ZZGA 2PWYA 3THOA 3ZTWA 2UZ1A 3E2IA 3G5MA 4UHKA 1UIMA 4HX5A 3R9WA 3C8MA 1KI6B 4KFSA 1KWGA 4MITA 4TMZA 4D99A 2JFYA 1HE3A 4R54A 5L3RA 4TWJA 3SICE 4GRDA 2H1OA 1EU1A 2BISA 3H86A 4AMBA 4UXHA 2QJTA 5AIAA 4Z5XA 3COSA 2YJ5A 2BTOA 1LK5A 1TEVA 4GX5A 3KZCA 4JLBA 1NHWA 1XZHA 2EG9A 2V7QD 4JEHA 4L5BA 4MR7A 1KSGA 1L5ZA 4HG2A 2H0AA 4IRMA 2UZIR 5C8YA 1KNQA 1YZQA 2KI5A 1FFCA 2VR1A 4LXYA 2DUUA 3QPUA 4R16A 2GD0A 3BD8A 4RH3A 1TA0A 3D6JA 2GFQA 4WZBA 3N7TA 1FDSA 1V3UA 5EQTA 1O4WA 2H5LA 5CA0A 5F3WB 2I91A 1GIAA 1H65A 3OPYI 1KIAA 5F9MA 4LDNA 4FHZA 1U0BB 4AZWA 2HLHA 3N2KB 1ZL2A 4CR8A 1JG6A 5IYZB 1D7OA 1LDGA 2I7XA 1LPSA 5CW2A 1V7PC 2VDWB 2GDZA 1RXUA 4HMQA 4XIIA 3G8YA 2CD9A 2Q1XA 2XKJE 3V9AA 4A73A 1T1GA 1IHUA 3NWEA 2ZJ0A 1STOA 4L8FA 4GPTA 2Y1KA 3ULKA 3CZRA 4L74A 3SJUA 3HCEA 2WEKA 4JT2A 2IS2A 4UBKA 2RGEA 2DR3A 3JQBA 5DJ5A 4RTNA 3QA3E 2C7VA 2V45A 4WKCA 1XG5A 4G6ZA 1T2AA 1DBIA 1A9RA 3JSAA 3QJGA 2I03A 3FTCA 4RABA 4IJVA 2P2SA 3ETEA 4DT1A 4YJ2F 2Q5CA 1KO1A 2C4UA 2C3YA 5D3QA 3S2UA 1CZOA 4DXDA 3VZRA 5AKYA 4ENPA 5DTRA 1CWUA 1AK2A 3ACBA 3DJFA 3AR6A 3QF4A 2IV7A 4EGFA 4EJ2A 2ZUSA 3O8DA 4U2CA 4B09A 3T06B 4CMGA 1NG9A 1VIAA 1O97D 2HF8A 2AFIB 2EF1A 4Y6GB 4E33A 1S9DA 4N48A 3ROMA 5C31A 4CF5A 5D1NA 1W75A 3Q9UA 1HQCA 4JI2B 3B6ZA 4CQJA 5A9RA 2AMVA 1LLQA 4PCUA 4IS2A 2NSHA 2ZQZA 4PG4A 4YRCA 1VL0A 4LQLA 2J3MA 3VPSA 1Z25A 2ATXA 2DBRA 4JLOA 4KWCA 1T2FA 2IWRA 5F9HA 2MR6A 4DBLC 1VLJA 3LWNA 3PR3A 4KJZA 5JAQA 4ZWNA 4B47A 1E4OA 4I1PA 4ZV9A 4V2IA 5TQ2A 2GHTA 1W88A 2ZUWA 2G25A 3EXHB 1JXAA 1NATA 1J07A 1V4VA 5TARA 1SQ6A 1Z35A 2QHXA 3ZDRA 3INTA 4B6EA 1REQA 4MKZA 4RU1A 3P19A 4HQ0A 4GT1A 4B4WA 1QYDA 4YV7A 3PP8A 3I4FA 4B7AA 3GLRA 2W42A 3LXMA 1PJ2A 4AJIA 2NU6A 2DQYA 3BSWA 1ICEA 3QG1A 1JHVA 1NNSA 3EJWA 3ND6A 5COQA 5EP3A 2IYYA 2X40A 4IMJB 5F5NA 5M04A 3CYFA 2EWVA 3QE9Y 2QRHA 3EGCA 4ND8A 1JTFA 1U8XX 3RS3A 3UAGA 1IOWA 1MIOB 2EWWA 3HMKA 1A77A 4KYUA 4LHZA 4WXEA 2JGDB 4ZOLF 4EY5A 4I9GA 3GVIA 2JHPA 4YV2A 2XGMA 3RIYA 2FNAA 3V1KA 2BRUA 1M2JA 4DRZA 4Z3OA 4PZ9A 3C85A 4A5OA 2WT9A 5TT1A 4XUDA 4O4IB 4CV1A 1U8ZA 3ZK9A 4MUEA 4DG9A 4JENA 3ZHQA 4RVSA 2OFWA 2AL7A 2AVNA 3JV7A 3V8MA 4TV8F 1RYNA 5BMOA 3PPXA 2IPNA 2HPHA 4Z53A 2IP1A 4GBJA 3GWGA 1LDEA 1JKFA 1E1RA 2GAAA 1WWKA 4RO0A 4Z7NB 1ZM7A 4LDPA 1H6AA 4RLFA 3UJ7A 1A9QA 1R50A 1RPNA 3MAAC 3ZCQA 2PZJA 5I5EA 4R1LA 5AM3A 1VSQA 4RENA 2UAGA 5C3UA 3TLAA 1U81A 1FYWA 3S2YA 1XTUA 2BGJA 4NJEB 4FWBA 4MHSA 3ZV4A 4QDOA 4W1PA 2R4QA 1NU6A 2HOQA 5REQB 4DCTA 5GIOE 1E1CB 2G9VA 5KDOA 4G0MA 4HTFB 3G5AA 3HRIA 3IP9A 1WMFA 4TUYF 3ED5A 3BUSA 2BHSA 2WU8A 3QFRA 3N3BC 3ZKAA 2WLSA 4WDQA 1Q6YA 5DEOA 5IM5A 3CUYA 4LOHA 1ZAKA 2XNKA 4ZGWA 4BB6A 2GPTA 1KFCB 1G7RA 2V7QA 4Q47A 4CT4B 3W04A 4PBTA 3KRTA 4IH9A 3GFGA 4EYOA 4DV7B 5K6AA 5H3LA 4R7ZA 3RRMA 1W59A 5BNZA 5K0TA 1F4LA 3DEJA 1I4LD 1FRNA 4JS0A 4DIBA 1KIFA 4ARZB 3HL4A 4KH0A 5AVXA 4CODB 4TMFA 4OL0A 1FDUA 1L5SA 2GKSA 4M9SA 3FZGA 2F1JA 4PZCA 3A26A 5FI1B 5GV7A 3ESRA 2CYAA 3W8DA 2ZYSA 2AK2A 5J47A 1MQ9A 4J76A 5T5QA 1WTCA 5IVPA 5DNDA 1YZUA 2VHZA 1CS4C 2ZXFA 3H16A 3MTGA 4HNGA 4WTOA 3ELDA 3HL0A 3RADC 3RSLA 1VLLA 2VJMB 1WKVA 3BIFA 3I8XA 5JLAA 3TZ6A 5K7SA 5CB4A 3VYWA 3O47A 4DLPA 3ZJUA 3R8CA 4KNYA 2OZEA 5DXAA 4MROA 4KSYA 4Q4AB 1KJIA 2AFRA 3HCNA 3IR7A 2G5PA 3NLLA 2XRMA 4MWDA 1F2UA 4ZOLB 1Z47A 2VP6A 3TZHA 4QQKA 4YWHA 5J4KA 2PKRA 1VC2A 4BVHA 4M0EA 5JPCA 2H2WA 3R3YA 1JHMA 4NMWA 4WXYB 4Q3LA 2XTJA 1YMUA 3LWZA 1ZN7A 4PFJA 2AV6A 3IVCA 5B1SA 4BKQA 2VQFB 4HUQB 1XMXA 3OHPA 1A8UA 1CUEA 2VP4A 1MQAA 1Q74A 3S7TA 2RBGA 4ETNA 3ADCA 5H4HA 3RJ5A 2OEPA 4Y9UA 3T12A 4L1KA 5HIMA 2FMFA 2WRZA 1R0LA 3ENNA 4HDCA 3WKCA 2PBZA 1MAVA 2ZBGA 3QVVA 1XHLA 2VDOB 5DHQA 3SMQA 5GJWC 2OCKA 4Y2PA 3EDRA 1V6CA 3BEDA 4P08A 5CFNA 3FRJA 2W71A 5B7GA 2I76A 5JAMA 2OBMA 2XMQA 3GCDA 5KYUB 4INPA 4GVXA 3AB3A 2I6FA 4KBYA 4X71A 4EKNB 4RNDB 2GEUA 2PKQP 3CPSA 4IV8A 1ADCA 1OTXA 4WFJA 4EGQA 3MILA 4GZLA 4AJNA 3AEUB 4RZSA 1DAHA 2HMTA 2PMKA 1PD0A 2YVQA 3KPWA 3V34A 1Y9AA 2ZRBA 3KAPA 3RK4A 1D09A 3OU6A 2UXDB 1NSTA 2I7TA 4IG9A 2F3SA 3WDMA 4MUGA 4ZVSA 4YQYA 3RT7A 3REFA 3K9LA 4ZGBA 1ISIA 4D0SA 3V2GA 3H65A 3P9IA 5FTKA 3M6XA 1GL7A 2OWDA 4CFYA 2AG8A 2I54A 1GTRA 1B0UA 1J5PA 4M87A 5JJKA 3ZR4B 1FOEB 3W6OA 1LU9A 2ZTSA 2HNBA 1JUDA 1V26A 4QHTA 2X1VA 4YJ2B 3WLAA 2XCQA 2X2PA 4G4GA 1L4NA 1NP6A 2JFZA 4AYWA 4DCJA 1S9HA 2W0MA 2ZJ4A 3AFNA 2I2CA 2A67A 2DKOA 5G1NA 1ZSVA 1CR1A 1EX1A 4F21A 2D5BA 5ESWA 5K2OA 4WFIA 1ID8A 2FLKA 1LQTA 2NU7B 1YK1A 4R2XA 4RACA 3MWKA 1KIMA 3BE5A 4G5GA 4JN6B 4R7TA 3NGXA 4ZQIA 4E07A 3AVXA 4BGIA 4P7BA 1HDZA 3CUEF 1KI6A 5AM0A 1Y5MA 1T0UA 1WXDA 1DBRA 5FOTA 2IOHA 4NVRA 3WLSA 4RBNA 4FEEA 3ZE0B 1JEQA 1UC5B 2CF6A 1BFUA 1PD1A 1WM1A 1WVGA 3GVHA 1VKOA 1XZGA 5E6SA 3AUYA 4PN3A 1DI0A 4GUDA 1X7ZB 2JANA 5D51S 1FDOA 1EGAA 5AIBA 5IXYA 3WL8A 4NZPA 1R4NA 1QRTA 1N1GA 4DMGA 2IXTA 2Z4SA 4CDRA 2ZSBA 1Z4PX 2XYVA 4GLJA 1IN1A 4PANA 4CEIB 3CEMA 2POQX 3CUUA 3SYLA 1A95A 2ZTUA 2ZTMA 1VZ3A