1IC6A

Structure of a serine protease proteinase k from tritirachium album limber at 0.98 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a serine protease proteinase K from Tritirachium album limber at 0.98 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEINASE K
total genus 87
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ic6A00
1TECE 3CO0S 4LVNA 3D9QX 3LXUX 2HD4A 5B1EA 2X8JB 3TECE 2WUVA 3LPDA 1IC6A 1SPBS 4KB5A 2WWTA 3BX1A 4KPGA 2Z2XA 4NMXB 3SICE 1SBTA 1WSDA 1SUBA 3OSZA 2G4VA 1TM7E 1C3LA 2IXTA 4OV6B 1SIBE 4H6VA 4CG0A 4HVLA 1GTL1 4C3VA 5JXGA 1SH7A 1AQNA 1KE2A 1SBHA 2W2NA 1P7WA 4J94A 1DUIA 2W2OA 1AH2A 4I0WB 1AV7A 3UNXA 1YU6A 3EE6A 1R0RE 3HJRA 1TO2E 2B6NA 5ARBA 2SNIE 1BFUA 1SCJA 1ST3A 4BWGA 3TI9A 3GT4A 4B5LA 1UBNA 1GTJ1 1T1GA 1HT3A 5B1DA 1SN7A 1S01A 3AJ9A 3I34X 3VV2A 1SCNE 2Z57A 5AMXA 4HX2A 3Q5GA 4ZARA 1BH6A 1XF1A 2PWBA 2XTJA 3ZXXA 2V8BA 1CSEE 4CFZA 2PKCA 1GT91 2DP4E 1SCBA 1R6VA 1WMFA 3QFHA 1V6CA 1KDVA 1Y3DE 3WHIA 1BE8A 3DW3X 1Y33E 3AJ8A 4FONA 1TM5E 1TM3E 4WOCA 5FAXA 3I2YX 3SQOA 4M1ZA 1WMEA 1SIOA 1T1EA 1SUDA 1YJBA 1V5IA 1GA4A 1GCIA 1Y34E 3DE1X 1SBNE 2PMWB 3BGOS 3Q40A 2Z2YA 4MZDA 2XRMA 2ID8A 3DVSX 1C9JA 2E1PA 3DE6X 3AFGA 3GT3A 5ARCA 1JEAA 3WIUA 5K7SA 5AVJA 1KDZA 4LVOA 1Q5PA 2IY9A 3D43A 5CW1A 1GA6A 1PFGA 4WOBA 3VYVA 2SICE 3BPSA 1SUAA 5JXJA 1DBIA 1KE1A 4Z2AA 1ZVJA 1GNVA 1WMDA 1SBIA 1GNSA 1ST2A 3F7OA 3QMPA 4NE9A 1Y4DE 2PRKA 1TMGE 1GA1A 5I9SA 2ID4A 1NDQA 1TM1E 1SCDA 1T1IA 1SVNA 2PWAA 3DE0X 3DE3X 3LPAA 3L1KA 2SBTA 2Z30A 4RYDA 1MEEA 1SELA 1P7VA 4OMCA 1KDYA 3DVQX 1AK9A 1BJRE 5SICE 4AKSA 4ZOQI 1PTKA 1S02A 2Z56A 2ZRQA 3DE7X 3PTLA 1TM4E 1BE6A 2W2MA 2WV7A 3A3PA 3DW1X 3GCXA 3LPCA 5FFNA 2DUJA 3EDYA 4KG7A 2PYZA 1SUEA 4YN3A 1BFKA 2HPZA 3H42B 1LW6E 2ST1A 1A2QA 1S2NA 1PJ8A 1Y48E 4DWWA 1OYVA 2TECE 3QTLA 4K8RB 3VTAA 4DJ5X 2DQKA 1SUPA 1SIUA 3DVRX 1IAVA 3F7MA 1CNMA 1YJAA 4GI3A 4H6WA 1SBCA 2W2PA 4DZTA 2QTWB 1Y3FE 3T41A 3ZXYA 2ZWPA 1OYOA 5FBZA 4AKTA 1WVMA 2WUWE 3A3OA 5AQEA 1ZVKA 3WQBA 3WIVA 1SCAA 3I37X 3PRKE 1THMA 5JXIA 1Y1KE 2ZWOA 3VSBA 5JMOA 3DWEX 2P4EA 4NE7A 1R64A 1YJCA 5ARDA 1GTG1 1C9MA 1EGQA 1Y3BE 3I30X 1TO1E 3DYBA 3VHQA 3DE4X 1OT5A 1Y3CE 3DDZX 2Z2ZA 4OMDA 1MPTA 3A3NA 1AU9A 1SUCA 3DE2X 3TI7A 2Z58A 4CFYA 3DE5X 5JXHA 1PEKE 1Y9ZA 3GCWA 5AVKA 3CNQS 1P8JA 3P5BA 4JP8A 3EIFA 2X8JA 1NLUA 3VV3A 1AF4A 1EA7A 2GKOA 1C9NA 1VSBA 1Y4AE 3F49S 2SECE 2W2QA 1TK2A 4C3UA 1AVTA 4H6XA 2PQ2A 1NDUA
chains in the Genus database with same CATH superfamily
4D7AA 5HX7A 3AO0B 2DUUA 1N92A 2X8JB 1L5GB 3PA6A 2B7BA 1SPBS 3RYHB 2FHSA 3CCCA 4UKDA 1I4TD 3UMVA 4B6JA 4UDOA 4BVFA 2Q4RA 3ZDQA 1RM3A 3E1SA 4IXDA 3VAZA 1KRWA 4RLQA 1YQ9A 1E2QA 1XZIA 2P9QA 2VHEA 3DYVA 2YJGA 3QJGA 1JPJA 4EJSB 1EK6A 4YUYA 1CUUA 4RTNA 3BXGA 1JIXA 1IHUA 3R8XA 3SVLA 1X1CA 2XXJA 1DP4A 1CC1S 4Q3KA 1R0SA 2A78A 4RK6A 5AJWA 2CMGA 2RGEA 5BRNA 1UBNA 2PG3A 5JO0A 4ZAGA 3NG1A 2AVNA 4EI9A 4HLQB 3SSMA 3ND7A 3N28A 4DV4B 4DT1A 3ECCA 3E9ZA 1KZ9A 4BMOB 2XZDA 4BAUA 3ZXSA 3ACCA 3KD2A 4OHCA 1IUPA 2DR2A 1G7SA 3EIWA 4QXAA 2IYXA 1JRLA 3LT4A 2QTMA 4GU5A 4PZZA 3ZW7A 5KOHA 1VI2A 1I2ZA 2WAAA 3CA8A 6ADHA 5G0UA 1XNQB 2F00A 2V6GA 4MR7B 2EXXA 2OCYC 3MTGA 3HV0A 4R05A 3C3EA 4X45A 4ZQCB 3N2IA 3THYA 4DRXB 1V11A 1XVLA 5HJEA 3LDFA 4ZP1A 2ID8A 2VSOA 4IWNA 3COJA 4CMIA 1PT5A 3FI9A 2PDAA 3IJ5A 1JEAA 5H8WA 3BA6A 3FHJA 2Y0PA 2PU7A 3ORQA 3AXTA 4PZEA 3D81A 2Q6TA 2CZQA 4C2BA 3J81k 4ESEA 2ZWAA 4RLHA 2QTCA 4QARA 5AD1A 1FRFS 4MMXB 1DG1G 4F91B 4PR0A 3OZEA 2UZ4A 2B8TA 3PQCA 1YSCA 4MICA 1KQFA 1IY8A 2VAXA 4PZAA 4DR6B 4QWMA 3RWBA 3BE5A 3MT0A 1VKJA 4ND3A 1OLSA 1ZZEA 3USCS 4V2IA 1TT5B 3SY8A 5JWHA 1X42A 4OKSA 2OD2A 1IEQA 1TU3A 3LCRA 5K01A 1JR3D 1XTKA 4BFUA 1G5FA 5FUVA 3HKCB 3N0VA 3BIOA 4LZLA 4PZ9A 1P4SA 1VIDA 1W94A 1QQ7A 4X6XA 4NQZA 2DVMA 3WV5A 2DQKA 4ICIA 4RHYA 4C01A 1JDBC 4DJJA 10MHA 4K6CA 3HV2A 3AKDA 2VIIA 3RAGA 1BN6A 4N8DA 4NC9A 2MTBA 3GUVA 2IHJA 1STOA 1KK2A 1ZXXA 2QRJA 1WOYA 3AJDA 4KLCA 2NVUA 2Y1EA 4HDKB 1E5QA 1M1NB 5B7QA 3WQSB 1DC7A 1SU6A 5AVRA 2KI5A 1IB0A 2QIOA 4UJ3A 2FN4A 3PYXA 4ZDWA 4DMUB 1MRSA 5DHRA 3PC3A 1JEQA 3K15A 1FSFA 1HYQA 2GN9A 2QIPA 3DDZX 2GLUA 3FM9A 3GN1A 4M0PA 4B3XA 4YUAA 5CB6A 3AU9A 3LKVA 5EXEA 1W35A 4DDWA 1CUWA 3AUXA 4P7JA 2FQYA 2YN2A 4FBMA 3U7JA 1C9NA 4GKKB 2GPYA 4NEHB 1SHZA 4QU9A 1GAWA 4IGIA 3LF2A 4DNQA 4ZVNA 2BTQB 2WFZA 4J0KA 1OYWA 1SXJC 3LP6A 3WZMA 3UG7A 1AHHA 3BFKA 4HNHA 1VM6A 4K9KA 4P34A 3ZVLA 5JPCA 1DGQA 2KQUA 3VU9A 4D0NA 2FSVC 3RVPA 1ENOA 4TMFA 5L3ZA 1ZEJA 1GGVA 1G2IA 1U65A 2H5EA 5EZ5A 4CG0A 5KTOA 16PKA 2AN4A 3FKJA 1RPZA 2JBHA 3EBPA 2XZOA 1XJCA 5KVAA 1GVHA 4RHFA 3V4VB 1P3DA 1ECJA 3PTAA 2HB6A 4US0R 1SCUB 3EVDA 2YHIB 3TZ6A 3E22A 2Y2VA 3K2QA 2XB6A 1T1JA 4JIMA 1OLUB 3UOAB 1A8HA 2DJIA 4L0CA 4PO3X 3GD7A 2Y99A 3IRVA 1L0BA 2EGHA 3KQVA 4QTTB 5F21A 1ABEA 5FWDA 3UN1A 3PX7A 2MJLA 3HGQA 2QTHA 1IBSA 4X60A 2XUKA 2J0UA 3OO1A 4KAJA 4PLGA 5FNVA 3VR5A 4CKXA 4R2LA 4HXFB 2BZ1A 2XMZA 1WHTB 2JFPA 1ZL0A 3EZGA 2FPIB 3KXIA 4JI1B 4I7EA 1ULHA 2VJMB 2YQZA 4ZJUA 2GYYA 3QQPA 1YRAA 3VR4D 3STVA 1PZXA 4MCAA 3EJWA 3HTXA 4GMDA 4DHWA 4BEWA 3MWGA 1NLZA 4A6XA 1ICEA 3HQ4O 5CIWA 4KEAA 1IH8A 1XRLA 1NY6A 1RYHA 4V0KA 3TJZA 1KJZA 1BRTA 1T24A 3M6WA 2ZU6A 1HYBA 2HSWA 1LWOA 5K7SA 1CUVA 1JNYA 4YAJA 3HYRA 3DKVA 4PZYA 4E0BA 3OETA 3WO1A 4IDOA 1JQDA 3IA2A 1JZQA 4NE9A 5JSYA 3OC6A 1NF3A 2C2BA 1VJ0A 3BAZA 4TTAA 2RSLA 5I7EA 2A9QA 3VNQA 4NU8X 3C7CB 1R5OA 3IPRA 1FFEA 2QZ9A 4E1BA 1U2DC 4JN6B 4QOJA 1D4FA 3TUIC 2AFIA 4UMEA 4XM2A 4ENQA 5C34B 3E8XA 2G63A 1KXZA 2BP7B 2DE0X 2H92A 1ACMA 4RKYA 3ELUA 3LOUA 2O1SA 4RGYA 1G5QA 2Z1MA 3CMMA 2ORIA 3CB2A 3HR8A 1H3NA 2IP1A 3SR0A 4EI2A 5BT8A 1YQEA 1NRIA 2C57A 3WSTA 2QAJA 4L9RA 1M34B 3NHPA 1U8YA 4EJSA 1PJ8A 3STYA 3L92A 4X66B 4XVHA 3MJTA 5FULA 4CIWA 2P9JA 4MZXA 4OOFA 4LOKA 4LV6A 1XJ0A 1NIJA 3QPAA 4RJIA 1Q17A 2FPGA 1HURA 1USIA 1T9BA 1TLFA 3T3NA 2OOSA 5TX7A 3N2NA 4C0QC 5BW8A 5KTMA 3T8YA 2QN7A 1R4AA 1NVDA 4QYTA 4PG8A 1TZJA 1QRAA 1KGSA 1NW4A 4G5QA 2ZDGA 2ZRNA 3T52A 4I9FA 5AI9A 1WW2A 2AXPA 2IUTA 3C8DA 1ATZA 1E2NA 1L8AA 3E3OA 4MGIR 1QC5A 1JIQA 2O1EA 2BP7A 2V7TA 1TVCA 3FAKA 3O75A 1Z2DA 3DEAA 5KYUA 1IJBA 2OXCA 2XR1A 4E2FA 4MO2A 3HFJA 3K0FA 1OC4A 1Q7EA 4W9MC 1ZJYA 1NTOA 1Z73A 1FDIA 4HAYA 4P82A 1M3SA 2IODA 2FE4A 1DOHA 4IJQA 4ZT3A 2FSGA 5KYVA 3DFZA 4X85A 4DADA 1KP9A 2MDTA 3GJYA 2HD4A 2Y6VA 5HDBB 1C4OA 2GUWA 1O97D 1PZNA 1RKXA 4QJ4A 1BOOA 4R9RA 3CRQA 1EUDA 5G3ZA 3S28A 1VCIA 1BS9A 5CVTA 4OUDB 4YQYA 2V7EA 3ND9A 2VNIA 2ZBDA 3D7LA 3F8SA 3HUUA 1I2CA 4PCAA 5KOIA 4LRXA 1QWSA 5DISB 4MHSA 4JCCA 4PZCA 4RZIA 5KYXA 2GHTA 4B5LA 4YCCA 4O8ZA 2M6LA 3P27A 5EC8A 3OBBA 4FYYA 3GZTB 4QZVA 5L51A 1E4OA 1GZ4A 1NMEA 4TVOA 1N5KA 2QJOA 3VV2A 1II8A 4UPDA 1U99A 2YRFA 4G1FA 4MGYR 4D4KA 5HQJA 4DLPA 2PGNA 2RKOA 2RFLA 1Z6QA 3AVOA 3QYAA 1WO8A 2Y9PB 3AUYA 4N41A 3CWCA 4YRPA 1GYRA 1Z5WA 1J5EB 4MIYA 3HYSA 2VCEA 3PXCX 1CCWA 1OZ0A 1ZDMA 3NV7A 1Q0LA 3GGGA 1BE8A 1RBZA 4GG1A 5G53C 4ADSG 1MC8A 4EM6A 2XXAB 3UXYA 3E70C 3R74A 2ZXUA 2J5XA 3MOIA 2YNMD 4MULA 4CL3A 2B36A 3DT6A 4HGZA 1RJGA 4S1PA 1FYDA 5CDTA 2MINA 4JC4A 2ZPUA 4ZD6A 1VPEA 3DMPA 3SHVA 3M5DA 3U7RA 1JAYA 1LK7A 2AFHB 4FYIA 3V8VA 1IM8A 5BWNA 1JB1A 3KSZO 5HVNA 2GTHA 1SBIA 4Q4DA 3RO7A 1MAVA 3Q88A 4BQSA 1SVLA 3ZV5A 4BWVA 4UHKA 4ZI7B 3H5LA 4HQOA 1WP4A 2GFHA 1AIPA 2WFMA 5I3CA 3O90A 2XUJA 4LX8A 1F7UA 4Q9DA 4XIYA 2DSNA 2C4TA 5B58C 1E2UA 2ZBEA 1XZ8A 3AINA 2EL7A 2X3YA 4O59O 4NDNE 4YMHA 1JJIA 1LJLA 1L5SA 2HDWA 2QK4A 5TMDA 1NVVQ 3GCXA 3LPCA 3R24A 4U7HA 3TNJA 1QZ3A 1U1IA 2NXEA 4HV4A 3DKKA 4BMDA 3ZK7A 1QSGA 4K9OA 2J3DA 4JR2A 4L4SA 1TMOA 4UAJA 3ZHBA 1V9SA 1VJ5A 1VA4A 5CLGA 3OOEA 3KBOA 3KR9A 5DTJA 2XEXA 3WLQA 2GSDA 3HVIA 4L4ZA 4CFSA 5L4LA 4X62B 3IT1A 1BDHA 1FMFA 4K46A 3U4AA 3HJUA 1UMKA 1XB2A 3LY7A 4H7IA 2GHRA 3FUVA 1XMPA 4OHMA 1OYYA 1BGVA 2HU5A 2OHGA 3L6UA 3UB2A 3WQRA 1VG8A 3L6OO 5JXIA 1L7NA 2BZGA 2R6CA 4BKUA 5K3OA 4R7TA 3UYLA 1ARZA 3ZE7A 3IDOA 1ZINA 5HRCA 3EFHA 4LHVA 1D9XA 4PCVA 4EYGA 1U0JA 1RWBA 1C9MA 1WULS 2CGEA 3UC9A 5ALWA 1J2RA 5C4IA 3SMVA 1LZKA 4AJEA 4EPXA 5EJ2A 1FSGA 1HDRA 1DKLA 1CUAA 3GDHA 3W7BA 5KJFA 1OAAA 4NBSA 4TTTS 4IMRA 5IEBA 1OY1A 3NWOA 1W96A 3NBYC 3TQCA 1VC2A 3O4GA 4B3GA 2EP7A 3NC1C 2GKOA 2VJMA 1JLRA 1HDZA 4D45A 4EG1A 5IBPA 1E9EA 4UDNA 3VGJA 5K2OA 1AQLA 3DMRA 2Q2OA 1IM2A 1FMJA 4IOKA 1TC2A 2H2GA 3AU8A 1UUFA 3NHYA 2J3KA 2C83A 2NW6A 2OFOA 2YV3A 4CMHA 4R71A 3TCKA 5C51B 2GXSA 2WU8A 2PX3A 3HKBA 5DDIP 3ROQA 1KYTA 5BRJA 4BE7B 2NU7A 2FUCA 3HGMA 4BV8A 4I1SA 3DOEA 2ALJA 1TKBA 3PHJA 3KVNA 3RRZA 2ZSHA 4MI6A 3FETA 5LNK6 3QELA 4R7ZA 2ICAA 1B76A 2ZIUB 3PUHA 3K1ZA 1Y9DA 4QEZA 5M3BA 2P8SA 3C7TA 5A06A 2GXAA 1GGHA 2ZAYA 4L5AA 5BMVB 3RFVA 1V1RB 4PCLA 3KQMA 2I7VA 1AN9A 1DPGA 1AT1A 1YIAA 3KB8A 3JWJA 1PRYA 2BDEA 4MVJD 2UYGA 3B2QA 4YT2A 3R0XA 1KU6A 3CMCO 3H1GA 4N8SA 4F6RB 4KQ6A 4H0CA 5CH8A 4RD6A 2B8EA 2HO5A 3MBOA 2PJRA 2IPXA 4KNYA 1FDRA 4JLAA 1XPUA 2X86A 2JAOA 3EUFA 3QWHA 2FLVA 1PG5A 3CR8A 1KNXA 1JKJB 2D8AA 1A1SA 4PSCA 3TOZA 3UZUA 3DLAA 1CB7A 3MJSA 4PBTA 4A2QA 1GYPA 1V6AA 4U8HA 4ZOAA 1XTTA 3L18A 3IJEB 3O5AA 3A9RA 2ZG6A 4ND8B 4DPKA 3UJ8A 1CJTC 3VU1A 4MEBA 3BORA 1Z0SA 4PR3A 2W6PA 4M1MA 5FTJA 2WJHA 4US1R 1YQTA 4EUKA 4JP5A 4TKMA 3TR5A 2GO7A 4Y2SA 3W2TA 3I05A 1M8FA 1OWMA 3QW4B 4H2DA 3TDMA 3U48A 2DTDA 4TWZA 3OMLA 3PQ2A 2CN1A 4KRFA 3UJ6A 3H9QA 2PUWA 3DM5A 5K3FB 3M8KA 3DE0X 3B5IA 3OKAA 3TLJA 4W99A 1HBJA 1BJRE 2XMQA 3WGGA 1JIUA 5LMUB 1DVRA 1SO8A 2DY1A 3K8ZA 5CNKA 4BBAA 4AMBA 2DLCX 5DBHX 1R8YA 5AVZA 5FI1B 1Z7EA 1C9YA 1JHXA 1OLSB 1YBAA 2WHPB 4U9UA 2W58A 4G81A 2GZ1A 3U81A 3BIJA 3OTQA 3LC7O 2QR2A 1Y48E 3IVCA 1LLQA 3L41A 4WERA 1E7MA 3DM9B 1QFJA 2YINC 1G9SA 3ZW9A 4XI9A 1F4VA 4EHDA 2QUKA 5FBZA 1ZRMA 1RC8A 3ET4A 1WHSA 4G25A 4BBPA 1L5VA 4UULA 3FRJA 2IIVA 3PEEA 3EHEA 1RPJA 2OZPA 1CVLA 2ZT8A 3LBHA 3UHOA 1NMZA 2KX7A 1G8SA 3N05A 2W2TA 1Y8QB 2XT9A 1YR3A 3H6GA 4Z7OB 3RABA 5HS6A 2ZW9A 3NYQA 3RFXA 4DRXA 2JAHA 2VZLA 1L7OA 4M4SA 2HJRA 3AFHA 3LP8A 2Q0QA 3TLGB 1VBNA 5EHQA 3I5MA 3THWA 2FP4A 2WB4A 2ZS9A 3SIWA 5EESA 4FB4A 1UBOS 1KJJA 3NEYA 4TM7A 1EQAA 1Q7TA 5K8VA 4LSGA 5TMEA 4V39A 5FOWA 3TQSA 3UWOA 5JDIA 2OPHA 2V96A 3GLHE 3W5IA 5BV2P 3R1IA 2ONCA 4DAEA 2FSFA 5E6UA 4HWSA 1BH2A 1N1GA 2PIDA 4GRDA 1BKYA 5EUMA 5KYUB 2H1RA 4LF8B 1SQFA 3N7AA 4IIJB 4U2DA 4ZI7A 5GZ3A 1ODKA 1KEPA 2AQHA 2HNKA 2PQ0A 2HX1A 3DV9A 3WB1A 3PRJA 4WN9A 2D3WA 3NUQA 4HR7A 1B14A 4DMGA 1N7IA 1XRNA 4G4SP 3KQHA 1E2JA 3O2JA 1J33A 2A9FA 3FYCA 4YAEA 4N7MA 4Z4CA 4R31A 3DLHA 3N8DA 1P45A 1P33A 4UTRA 3TZLA 5HUHA 4J2HA 2QKYA 3GAMA 2VTEA 3NM6B 1PX2A 4QULA 2A1UB 1LKZA 1GPNA 2CNWD 4PICA 4BVAA 1JALA 2H1SA 2FPPB 4F2WA 3HCFA 3W1EA 1OXBB 5EZSA 2CZCA 4TSKA 1RPNA 1J00A 2FE1A 3OIUA 1YUBA 2AKAB 4MV8A 2C9ZA 1IIRA 5I7VA 1FRNA 4BNNA 5CDFA 2CL0X 2EIXA 1PFVA 3JU3A 4MUMA 4FN5A 5H3CA 3LT2A 5CGZA 1K86A 1Q7GA 2WWGA 3I4FA 2H5IA 2B61A 2HIHA 4MS4B 4M46A 4PLFA 2ADOA 1E1KA 1S5PA 3UMYA 2NU9B 4E4YA 4F9TA 1TA0A 1II8B 3BGOS 1K92A 1NOKA 2ZUSA 3ELYA 2RHWA 3IPLA 4NMLA 4CF3A 4YRNA 2HLPA 4R1PA 2XMBA 1PLLA 5B5SA 1F8FA 1U1CA 1VPDA 1IHOA 2DT8A 2EV9A 3SSNA 4M1OA 3IOMA 5CW1A 4C20A 3TLBA 4DHEA 3RYFB 7REQB 5AVWA 3ZBUA 2XVZA 4G0WA 3U3JA 4BZQA 4ALNA 3L9XA 2KMLA 3OZSA 1U0OC 3V4OA 4A03A 3QX8A 2PV7A 2RCYA 3L6EA 1XCJA 3Q3CA 4G8JA 4XGKA 1JEOA 1U7UA 4OXRA 2Z6AA 4FEAA 1NOIA 1ZNQO 4KI0A 4FNOA 3ZHXA 2B9VA 1U81A 3D7SA 3NTOA 3JTEA 3ZWKA 1NONA 1FFGA 3TR6A 3TR0A 2UU9B 1P2GA 2P62A 5P21A 3EC2A 3FYTA 1J8DA 3H5TA 3JQAB 3NRCA 4EW3A 3GEEA 1OBHA 3ZIAA 3FJYA 1GR0A 4OL0A 1CHNA 4TQGA 5AP9A 2PCLA 1PW7A 1Q19A 2JKZA 3PGJA 1W4CA 4DBLC 5K0CA 1I3LA 3SBOA 2ON6A 3E05A 5LLDA 4U2FA 2LCQA 3V8RA 3T0IA 2VWPA 2Z0MA 2ATXA 4HZGA 2NVBA 5H0IA 1DQPA 1ZPDA 3A1WA 4FDVA 4G4IA 1XZQA 4IIEA 4BEJA 2NZ2A 4C0JA 1UPUA 1HYGA 3WIVA 3AUAA 1THMA 1EZ1A 2V7UA 3FROA 3KZVA 2BMAA 1DFIA 1DBQA 4Q1DA 3K6RA 3B20A 5M34A 3INRA 1K7EB 1ISJA 2Y1OA 3I73A 1E1RA 5EMJA 2QT0A 1WKVA 4DNPA 5FPYA 5JJKA 3O21A 4D9MA 4LF4B 2YH2A 1I4LD 3TH5A 1BVHA 2DHQA 3AGPA 3JZFA 3PGKA 1HE8B 1Y37A 1VSBA 2WTNA 4LDAA 5CFZA 3BFVA 2JBWA 3R7WB 1PS8A 1GLGA 2P0EA 3NAGA 1IMJA 3PUWA 3AUJB 3HRIA 1U2GC 2FB9A 3I1JA 2C1EA 5K0EA 2D59A 1JW9B 4AFNA 4B76A 3DC7A 3FUWA 4D43A 2HU7A 1IHDA 1H1TA 5FBQB 3TQHA 1BHQ1 3G13A 4NONA 1NXPA 2R6GA 1XP8A 2GJSA 3AB7A 4RL4A 5EPOA 1XP5A 2LP4Y 3INYA 5KNBD 2ZRJA 2G1PA 2OO7A 3ETDA 4GXTA 2I1WA 3SS9X 1SZDA 1KP3A 3RC7A 1KOJA 2FUG6 3HBAA 4IOLA 3MHTA 4S3MA 1V4BA 2JGEA 1RI2A 4UBLA 5AHOA 3DFKA 2PKQP 2P2CA 4WFIA 5ADUS 3E3MA 1DZIA 1HT3A 2PWZA 4O2AA 3T3HA 4HRXA 1CQIA 2F3TA 4KPUA 4UCXA 4WKNA 4TXJA 2BBTA 4OSOA 1AOXA 2XDWA 3WK6A 1ULTA 3MPUA 3QFCA 4OHZA 4B4OA 3B9BA 1S8FA 1X86B 1YRYE 1CQXA 2VL7A 2OKCA 1C1HA 1XZLA 1YVUA 1F2TB 2RH9B 4M9RA 1PR4A 5DV9A 4B33A 5IFKA 2QVXX 1FS6A 3F96A 3WGUA 1DV2A 1IZ8A 4GNRA 3SQOA 5L9AA 3SMQA 4EITA 5CIQA 1EVIA 1M8KA 3QNWA 4WDQA 4XYMA 5E1MA 3S68A 5KWIA 3PJRA 4KBYA 2FPRA 2XUOA 3INTA 2JJ8A 2Q99A 1XD8A 3T9AA 5FPHA 2IZ6A 1P6XA 2SCUB 2B4TO 3E22B 4K28A 4L75A 4O63O 4PSVA 4B8ZA 1OH8A 1YS9A 2A59A 4G0UA 3TRFA 1VB5A 3C16C 4Y0NA 1GNVA 3IBGA 4DLZA 3AUFA 5CG1A 4YRQA 3V1KA 3AVXA 4NYIQ 4C0BA 3CN7A 1G20E 2XOXA 3HB5X 4EB6B 1OLUA 4JOQA 2UUAB 621PA 3W2HA 3C48A 4ZVLA 5IJWA 3Q41A 3ZDFA 4DLNA 4HT3B 4RDXA 1LBTA 2VRWA 3BRWA 3HCDA 1M8GA 1Z8HA 3UWPA 2WM9B 2VQSA 4DREA 2PUFA 4RPKA 3CG4A 1FUEA 1DAOA 2QHXA 1WXWA 1JF8A 3R7NA 3IIJA 4WGFA 4JELA 2ZAGA 3REFA 4G63A 3KPVA 4N3GA 4BC1A 1DARA 1SXQA 4IILA 1QX4A 3KV1A 5GIPE 1KS2A 3BSWA 4S24A 3LYLA 1LLCA 5ALJA 1H2XA 3A0RB 2HFKA 3URKA 3CISA 1LJUA 1YAJA 1II0A 4MKHA 4DUYB 3NTLA 4R9VA 4AWBA 4GBMA 3T5MA 2J4CA 2C4VA 3OQNA 2PKEA 4I3FA 5CM9C 3HKEB 2MSCB 3E1KA 5KJ6A 1L4FA 1IE3A 2V4UA 3IO3A 1J22A 1WZNA 1X92A 3PX2A 4RV9A 4ME6A 1F0YA 4PG6A 4MV3A 4GWLA 3DV0B 1FB5A 5I4IA 2AN5A 4IUYA 3SVTA 1Z7GA 4P7GA 4FYWA 3NNNA 1V8DA 3VHQA 5JH7B 5DM70 4HDNB 3AF6A 4JBHA 2H65A 2ZT7A 3F1KA 3LS2A 3O2QB 4RL6A 4XJVA 3ESAA 2XZPA 3U44A 1ZOSA 1SGWA 2O1WA 2IYFA 3ZGXA 3L6CA 4AIIA 2QNBA 2J5QA 2C2HA 3F6CA 1ZA1A 4ZEMA 2PK3A 1A9PA 3HHPA 5H70A 3ZD9A 4ISBA 1B26A 1MH9A 1LPMA 2XMDA 3S2GA 5CJ2A 5IKEA 1G42A 3IB6A 5KVQA 3RRJA 5JDCA 3W8EA 4TMZA 4OHBA 3A7EA 1PLKA 1WZEA 4IIXA 5HUQA 4Z4EA 1W2WB 2GCGA 1TT5A 4BV2A 3DP7A 1KAMA 4DQ0A 1RYBA 2C5GA 2FY8A 3SZRA 1H85A 4D9BA 3Q6IA 3QI7A 3SXPA 3INGA 5IP5A 4MWTA 5HOEA 4EMBA 1K8QA 1Q0HA 1OLXA 3ZHTA 3RU3A 3WLFA 4B3RB 4OXQA 2Q9BA 5ES3A 3NEAA 4G07A 1J70A 2D4HA 4ZRDA 1QZTA 2C96A 4GE3A 1HFWA 3S8YA 3SHOA 4DWOA 2PM8A 2NX2A 4KQ1A 2XKJE 3FR7A 1J1ZA 2HQ1A 3P1JA 1SCBA 2FAXA 5T3YA 1O54A 1Y3DE 3Q7SA 5IVIA 3WLTA 1YFJA 4MW9A 4YV7A 4TS9A 3ZV6A 1OBCA 2I7TA 2NXJA 3IUPA 3LX5A 4FXPA 4JEMA 5CYOA 4WOCA 4CEJA 1DI0A 4J9VA 4M99A 3REQB 1LBSA 2TRSB 4FFRA 1AJEA 3JSXA 1D6JA 4CQLB 1PV2A 4J1SA 5BUQA 4OOEA 4WZAA 4G26A 2JEZA 4JX9A 4QOSA 4ZHQF 4OLJA 1TF2A 2FOXA 3FPHA 4V0QA 4Y2RA 3G0OA 4U6NA 3ZWNA 3OFJA 3R3VA 2W90A 4C0KA 1P1RA 1WZUA 4E6PA 3CJRA 4DUPA 3FHCB 1R0KA 4CI9A 5EZYB 2WR8A 3EDQA 1IWPB 3KQLA 3IHLA 3L8CA 4PNPA 5MN5A 4PC6A 3FUTA 2W42A 1JBQA 1RMQA 2H00A 3KR1A 4XGRA 3MLBA 3B1JA 4RESA 4BNTA 5FWYA 5TB5A 3UAXA 4L8YA 4OATA 5C81A 3K70C 1D6SA 1HPLA 4NEGA 3M5CA 4PTZA 2B69A 1ZM7A 2AFIE 2VPIA 2JCGA 3GRVA 1IWOA 1KMHB 1KQNA 4CF7A 1C81A 5TQ2B 3CZQA 2NP6A 4S12A 3UPTA 4RTKA 5IDVA 3CE9A 3ZLJA 2WSIA 4MTLA 5K0ZA 4CUKA 1MA0A 2ZPAA 4WASA 4K9RA 4YXWA 1JECA 1GTZA 2XXAA 2NZJA 5HMMA 3ILSA 1GYQA 4ZVPA 3IE1A 3K0KA 5AHXA 4ZAWA 3ABQB 3WTCA 2TSYB 2FEWB 4EX7A 3H6KA 1GV1A 1R6DA 2PSSA 1AZWA 5COAA 4IHQA 3ZJUA 4WECA 1ORIA 2FSSA 2GF0A 4IH4A 5B4TA 2NIPA 1Z6XA 3W2GA 5C2JB 4D9FA 3UFXA 3I45A 3GZJA 2GZSA 3AM3A 5IKMA 2X76A 3HBLA 1FLVA 3EXEA 3KVOA 3OLCX 2J4DA 2P75A 2GBPA 5FLKA 3A31A 4QTZA 3N58A 4MV1A 3FGZA 1OFGA 2OBXA 1NA5A 2W4QA 2SECE 2ZLBA 3NTRA 1DIOB 4JEUA 2OXIA 3VMMA 4BLQA 4OHUA 1VPWA 4DQKA 9GPBA 4MDFA 3H0KA 4AXBA 3IIMA 2NMVA 4B4VA 1O58A 2Z6VA 1VFPA 5CVEA 4O0LA 1PP4A 1XQWA 1U3VA 2MSNA 4Q7KA 5KTNA 2HMYB 1AD2A 8ABPA 3UJHA 3PDIB 3KYBA 1WF6A 4YRKA 3AY6A 2BL4A 1O03A 3HN7A 1LI7A 3BMOA 3W5CA 4EHKA 2FVYA 2H4WA 3SQMA 5UKDA 2VTBB 1TRHA 1FP4A 3MJFA 2FV8A 4FFSA 1V39A 2WJZB 1AS2A 4RM2A 2MR5A 2EDAA 3QHQA 4NV0A 4AY4A 3GFOA 1SURA 3LK6A 2GEBA 3O8NA 3IMEA 5AKXA 3F71A 2B4YA 5BQFA 2DULA 5HKAA 1FLAA 1IL0A 1KYZA 3P9IA 1Y6FA 1R2QA 1MC4A 3GA7A 1AHPA 2X4DA 1M1ZA 4D4GA 2PGAA 1J1IA 4RSRA 2B2NA 4EO4A 5CURA 4AMZA 4K88A 2WTUA 4J7AA 3RSLA 4WN3A 3TW4A 5K0SA 1HF3A 4QDOA 4D8UA 2Z2JA 4NDZA 2VDQB 3AJAA 1AUPA 1EAMA 4JHLA 4P32A 4X63A 2BRUA 2IEDA 1ZQ9A 3L7MA 3NKVA 5HF9A 3U60B 3WI7A 3UMRA 3L0SA 4N18A 5C8DA 4F84A 2O8EB 1KZGB 1FYVA 3IHTA 3ZG6A 4N1AA 4IH9A 2ZITA 1RXCA 3AC0A 1R9GA 3PF9A 2I87A 3ZLVA 3FTPA 4RA6B 1HQCA 3VTZA 1GCOA 5GWXA 2XCRB 1JA0A 4HX9A 4OJTA 3NJ4A 2BPOA 3ZCVA 3PD0A 2J87A 3EVFA 3UMJA 2CDBA 5CBPB 1KEKA 4FMBB 3PUKA 1DQSA 3TTSA 3ETJA 2ZSIA 3CUUA 2K87A 3W6OA 3GQBB 1N3IA 1KF0A 2EYQA 3H1TA 2I2BA 4FGWA 5A04A 3ZU6A 3ISVA 2Q3EA 2FR0A 4MV4A 2DBVO 4DEVA 3AVVA 3K0HA 4R1SA 4UNPA 1B23P 3MJEA 3HM9A 4JBGA 3CIFA 2QGZA 3GC6A 4G5OA 3U4GA 3MWLA 1K6IA 4U4AA 4JKOA 1QAMA 2F8LA 2HRZA 4TT8A 3I9V6 4FIZA 2DUWA 2PKXA 3QP9A 1GQYA 1TDJA 5D5PA 5A3JA 1RZRA 1YNSA 1TZKA 3KBBA 1N33B 2C42A 2NSJA 3OESA 5ENZA 1VFNA 4K9MA 5F1PA 1JQBA 1OFTA 3S40A 5DTIA 1FU8A 1K8YB 5LB4A 2P27A 5IBRA 5JBIA 1DCFA 4BLTA 4P98A 3A1UA 3DWEX 4A23A 4AG5A 5A3QA 4JJEA 1Y3BE 4TKVA 4N5MA 2JGNA 2UZAA 3I53A 4PLWA 4AO7A 4D8VA 5KYTA 3D1LA 1FL9A 1K89A 4W7SA 5CW2A 4BNJA 2BELA 2FPUA 4ZVMA 4S0XA 5AXDA 3OCZA 1QC5B 1ZY2A 2HA7A 1AKEA 3KU4A 4RKRA 5HJ2A 2BFCA 2JH9A 2AQIA 3F46A 4XEHA 2CDNA 2FKNA 5AKJA 4Q9LA 3TTVA 2VOJA 4HC4A 4YJ3B 1VKZA 4DR5B 4ZDKA 4RTQA 2HW8A 1PE0A 3ZJTA 2FUG1 1E3LA 2WQ7A 3UV3A 1N57A 3K8YA 4PPFA 2C99A 1GFIA 2ZUCA 4IO0A 5B3JA 4ESHA 9LDBA 1YVPA 2BDUA 2DX7A 5ALQA 2OYCA 2EHDA 2A0UA 1ZR4A 1OH5A 4IJKA 1P2TA 2YMLA 3JV7A 4E2WA 3DHEA 1F6DA 1RQLA 3ORRA 5D5HA 4OGLA 2H31A 4JI5B 4XWKA 1S4MA 4BLPA 3SC2A 5HWSA 1XJWA 2HWXA 1IBRA 4EAQA 1U7DA 3E23A 3G9QA 3FNBA 2X3UA 1DC4A 3ZVRA 3GFSA 5EUBA 3TLMA 1PR1A 1R4MB 3SC6A 1ISGA 2JJ1A 2XSZD 3G0BA 3ZZTA 3ADCA 4FWTA 1YASA 4RE5A 4WHMA 4A8JB 1CRLA 5JY6A 1EUYA 4MROA 1BH6A 4GQBA 2GAFA 5FLEX 3KJGA 3GVCA 5TVGA 4NY1A 3DZFA 2ZIXA 4EL0A 3PITA 5JJBA 5ADHA 1P7YA 3HVJA 3M6IA 4YRSA 1WSBA 2WTBA 4GOMD 1GU7A 3W2IA 1RRGA 1F0KA 2GR9A 1VLLA 2VAMA 2QXYA 1ZGZA 1QHYA 3BM5A 2P1ZA 2VJLA 5DHUA 4B3IA 3EC1A 3KCNA 2EU8A 4TUYB 3O92A 5IULC 5ITSA 1MQAA 2QMOA 1ILEA 2XIJA 5E1DA 2P7IA 3BWMA 2MU1A 1D8AA 2J0VA 3IIEA 4FT2A 4LXHA 4NOKA 5E7JA 3RTBA 4EF4A 3B53X 2PPLA 4BATA 2IFTA 5JS8A 3NASA 1NV8A 4BNIA 3H8SA 1N8KA 4AP5A 4DOMA 4J75A 4QOGA 1DE0A 2VF4X 3AIMA 4OIMA 1J8YF 1M33A 4N5LA 2WE7A 4QQ8A 3VDQA 3I6ZA 1MAWA 2GN6A 3K0BA 4IJ5A 3T99A 4BMZA 4J1NA 1HDYA 1TQHA 1V2GA 4H7EA 4TTVA 4HF7A 3TD2A 2Y67A 2YYYA 5H9VA 3AEUA 3HB1A 4RLSA 1P7CA 2EQAA 1A2OA 1TPYA 3B48A 1KZYC 4FP9A 1NN5A 2GZDA 4MUBA 4ZU6X 4RC9A 4KOEC 3H4MA 2VRNA 4AJNA 2R44A 4IFBA 1Y3IA 1ML3A 1U1DA 3HUEA 2WABA 3DULA 4JI6B 2ZCVA 2AB0A 3Q7EA 1ZFNA 1DBSA 1HL3A 3CW2A 3JQ6A 1FX0B 1XLWA 4J6FA 4L7QA 4QGHA 3K5HA 1SBCA 3LBIA 4YRFA 3NHJA 4ZJYA 2D1QA 2F48A 3A1CA 3X2SA 2OCAA 2W7TA 5TLSA 5H68A 5TEVA 5LL6P 4W8GA 4E5PA 4DKXA 2WSYB 2AKEA 1GUDA 3T5BA 3I6MA 2GTPA 3A4MA 2IZ5A 3CX8A 4KX5A 4D4IA 5A5GA 3O8QB 4JUFA 2YJ4A 4MP3A 5FT9A 2MYUA 3AHGA 2BR4A 4M9ZA 3U3ZA 4AY2A 3ASVA 2VP9A 4YCNA 3A3NA 5JC1A 4ITVA 1RSZA 1P6QA 4Q82A 3M1AA 2YDXA 1M6VA 4I99A 4C0WA 3S70A 4K87A 1KKLA 2ZULA 2ZYWX 3T1OA 1ZOPA 4YNBA 2EYUA 2P68A 4CIVA 3OQ6A 1MA3A 3Q9LA 3WLOA 1DAPA 2WMOB 3HR4A 3MSXA 5B1EA 3EGDB 2RG7A 3NM5A 1IJEA 1DRJA 1V47A 4INZA 2DG2A 2FZCA 5A7HA 5EIWA 2VZEA 3R9KA 2A7QA 3NDRA 4EB6A 2AI3A 2C4HA 3KVRA 4UE3S 4ZMRA 2CK3A 3S0JA 4MVJP 2GASA 3FKSD 1DXHA 3PBKA 3DVAA 4PX9A 4N54A 5IHPA 4P7FA 1MVLA 1FFAA 4D42A 2J6HA 3VH3A 4EUNA 1QFZA 4MYTA 1C80A 3KHTA 2NVWA 3ILYA 3KRTA 1E1CA 4IQFA 5GJVC 1NBHA 2YZMA 4A8TA 3L49A 4DDUA 4G67A 3BWYA 1ULUA 3MGBA 3JD2A 1XZNA 1V0JA 4M6WB 1VLQA 4QLAA 5KOJA 3WYFA 3BUSA 5I7WA 1R0XA 1Z74A 5REQB 4IV0A 4DQXA 2DLNA 2ZVQX 5ADVA 4WQMA 2FN9A 2X40A 2EJVA 2H54A 4ZO7A 4BN0A 2OK8A 1VRCA 3ZHQA 1T1EA 1T9AA 3DE1X 3NONA 2IBSA 4KVZA 3UYKA 1NMQA 3KEFA 2AZDA 5DI9A 3RVBA 4YRAA 4ZHQA 1IG3A 1KAGA 1K08A 3YASA 4N3BA 2XNJA 1VZ2A 3TXYA 4J7UA 3QWBA 2C7RA 2JGRA 3AERB 3OM1A 4XR4A 4PGFA 3HMKA 5DTQA 4ZOBA 3PQ6A 2LXNA 4V02A 1P74A 1IVYA 1UOOA 4NENB 1I4EB 1DDIA 1MD9A 3QVGB 3R0JA 4JU9A 2FSUA 2E49A 1TVKB 3VVLA 3HKDA 3HKEA 2FZGA 1M76A 4KPFC 4RTSA 1Z39A 2WLSA 2YYAA 3IAS6 2I62A 4BQNA 4RKFA 4EPTA 5BWBA 2HJ9A 1G3MA 1REQA 2XB4A 4FFVA 1UDCA 4N0QA 4TLEA 5KUTA 3CVJA 2YJZA 3G7NA 5CFNA 4Z4QA 4KC0A 4BIMA 4IG9A 1OZHA 1DRKA 2JFZA 1I3KA 3GNSA 4IVPA 1O97C 1YA8A 2W6JA 3A32A 1Z68A 3GBPA 4BTVA 4FNGA 3MQFA 2VAWA 3UJBA 4PS0A 3PFGA 2PXXA 4XZ3A 1I30A 5JYCA 5T67A 4BX8A 1KKUA 1M0EA 4AKTA 2QAGA 2VEOA 2WWIA 3LC0A 4QL3A 4WLEA 1FP1D 1YL7A 4Q4HA 1PJ3A 4PGAA 5ALZA 5KNCH 1Z4JA 4FGSA 2VBIA 4FFWA 2XYVA 2C8JA 4F3CA 3EZYA 2IUSA 3K31A 3RWOA 1RFGE 1CP3A 3KPJA 1PWEA 1E2PA 1N36B 2F8SA 4UNQA 3ECSA 1OT5A 5KCZA 5EHZA 1ECGA 4XD7A 1MLDA 1YRWA 4ZVKA 3Q3GE 4F06A 2I6GA 4BNKA 4NFLA 4CETA 3A25A 1LF0A 1P8JA 3CKMA 4N7JA 1RAGA 5KTKA 4EA8A 5JDCC 3C6QA 4O4JA 3U16A 1AS3A 2GD2A 1JDPA 1UBEA 1B41A 4FFMA 3P9KA 5CDSA 5I6DA 1S2DA 1A9XB 1DAIA 1ODSA 2FP4B 3MUNA 3B13B 2D8MA 4B47A 5GP1A 1YZVA 2QRVB 3D3JA 3UJ9A 5LOVA 2FWMX 4B40A 2PUVA 4QGBA 4RPHA 4B3JA 1Q14A 3DT9A 2G88A 3OJ0A 4UU0A 4FYJA 5EYPA 4DMCA 2JGJA 2I5PO 3AFNA 4KO4S 3WLMA 2XCLA 5KTRA 2N3ZA 1A77A 1KE2A 4AURA 3K6SA 4V38A 4XX0B 5BPHA 4N3NA 4YDSA 1Z4OA 4YP5A 3GAZA 1KYWA 3PNLA 4CMCA 2IYZA 4O2AB 1VECA 1V37A 4DLUA 1Q1GA 3L8ZA 2Z2IA 3N0RA 3TXAA 4ED9A 5GTDA 4HVAA 2BYTA 3BHJA 4H35A 5AI5A 3DFIA 4YV2A 5IDQA 4KIFA 3JR3A 2VDKB 4RF3A 4B79A 2FPKA 3HVKA 4X3OA 4N0MA 1GUZA 1YR7A 4BNWA 4NMWA 1Y8RB 5DVZA 4YLGA 1Q1NA 2OAEA 1F4LA 2EZ9A 4O0MA 3EJ6A 4QG7A 1VL8A 5JNRA 4O6VA 4GZ6A 3C45A 4LI3X 4YCBA 2Y2UA 4O4HB 1KPGA 3L8GA 1AHIA 1OTHA 3OU7A 1XAJA 4YAOA 1V9CA 3TKAA 1UT8A 2XJ9A 2YW2A 3TZHA 2HA5A 2AN9A 3OTWA 2WSSD 2GB4A 5KSZA 2PGIA 3CRNA 3VX4A 1FYFA 3C98A 2ZYHA 1PZFA 1I6MA 1YDHA 2OVBA 4MUFA 4QQNA 3L0PA 2QTVA 4Y2QA 2QL7A 5DHPA 4RSHA 1UOPA 4H4EA 3DXFA 5FB3A 1JQ3A 4EJSC 1BXZA 4NFHA 4EHIA 2GZAA 2V97A 3G1WA 1UJ2A 2MT9A 4ZALA 5EJ8A 4B09A 1QGOA 2G6TA 3EPRA 1ZNYA 2BFBB 4C4AA 1Q0PA 2FFJA 5LWQA 1VOTA 3P96A 5J1SB 5LXTA 5KREA 3NATA 2GGSA 3U3KA 1JFFA 1GR1A 2YWJA 1VMAA 2CJWA 5AOCA 4UM7A 3V5NA 2ZYUX 2FCRA 5I51A 3A3PA 4O2AF 2D1SA 2D7CA 3OQIA 2ZXEA 4X8HA 5E9AA 5A2GA 1ETHA 3PJGA 3HA3A 2CUZA 2COEA 2XGGA 3ROZA 4B9AA 1IMOA 4HGPA 3U37A 1U1FA 2OWEA 5I9BA 2HEGA 1A0OA 3I6YA 3OTHA 4LOIA 1RCUA 5K03A 3KQSA 1YI1A 4NVRA 1F20A 3KKNA 3AQIA 4OFBA 1P9RA 1U0NA 1XTJA 3F7MA 3FZGA 5D2CA 3U40A 1O6BA 2HH9A 3QEOA 2B7LA 4ID9A 1EIZA 1U0EA 1P0MA 4LI0A 4QWWA 3A05A 3UUFA 4ZRMA 2Q6VA 1V96A 3UKOA 4RABA 3KQUA 1K9SA 4MLCA 2Q5HA 2P6RA 3ZGYA 1LQUA 4TVBA 5ICMA 1MOSA 3DMDA 4U0JA 3F98A 4IDCA 1X7XA 2E3JA 5DEOA 3K30A 3VO1A 5DBFA 2Z2ZA 4PLPA 1N0WA 1QZZA 2V7BA 3OOJA 3F4LA 4HXYA 5CCDA 2YV2A 4P2BA 3VC1A 5KQGA 4BVLA 1R0CA 5FUQA 3CVYA 2E5WA 4L28A 1X3LA 2RJNA 1EP2B 2ZANA 4M6WA 5EZ6B 1JL3A 4WGGA 1KI1A 3TBFA 4P3XA 1A9YA 1N2EA 2R00C 1Z0DA 3C2QA 4KLAA 3BQMB 4LDNA 3PI7A 3V2HA 5D86A 1A82A 3BTOA 1Z36A 2HM7A 2E37A 2W6MA 2ZAOA 4NX2A 1H3EA 3VKUA 2FPPA 2B8NA 1H42A 4RIGA 4RGQA 1X7XB 5AKYA 5JYDA 2NUTA 1DJNA 2E7ZA 2VUTA 3M4JA 5JO9A 2BF7A 1X1SA 2J0EA 3F4BA 5KYYB 1RJ9A 5I45A 1EFRA 1S8NA 1VJDA 2CL7X 4BCBA 4I1UA 1KKMA 1ULBA 2IU6A 1Q84A 4F4CA 2K2QB 2A0FA 1TJPB 1I1QB 2QM0A 4GPZA 1PHPA 1RI4A 3QW2A 5ECDA 5A9SA 4BMXA 3LH5A 4B5KA 1BD4A 1A4IA 3KJXA 3KSDO 3RADC 1U0SY 1COWD 2E9SA 4OHYA 1WCIB 3H5IA 4LTMA 4WXRA 5EG5A 3ZLTA 3GFTA 1R4MA 2W48A 1A9OA 1Z82A 1UWLA 1YIOA 1JHQA 1KR5A 2R62A 4RFSB 3QVLA 4ZQBA 4RIIA 1OFIA 1U2GA 4Z51A 3LBFA 3DNPA 3OJXA 3N2GB 2G9VA 4JUCA 3WYEA 5KHLB 2O8CA 3O7WA 1E2GA 1XCMA 2OORA 4GC9A 2BFBA 1C7JA 2XD9A 4HDRA 4C78A 1LBIA 3WG9A 1HFKA 5BUCA 3H9EO 4COOA 5BWLA 5LSAA 3KPYA 2ZK7A 1GL3A 3P4YA 3CVVA 4XIIA 3ZZ0A 1DBIA 1P2FA 2OAGA 4DCNA 2B94A 3FCCA 1SVOA 1BA3A 1K3UB 1RLIA 5F9MA 1SU8A 4B7ZA 2NU7B 4GP7A 4Q66C 1UJNA 2ZBGA 4HDSB 2CLEB 3TG8A 4ND4A 1KVUA 1G2OA 1K9VF 5KHOC 3JRNA 3DVQX 5CFOA 2VQ3A 1D4AA 3F5SA 4FSDA 4Y6PA 2KM1A 5EIBD 3ZI7A 4ZGBA 5A3RA 4QQKA 8ATCA 1GPWB 2LBPA 4MCHA 4GLBA 1BWRA 1LH0A 3GRPA 4CKCA 1TYAE 3CEJA 3PRHA 3QVWA 4LJAA 2RC6A 4QRIA 2G9NA 3RUIA 3SYRA 4ANFA 4E1VA 2OMKA 3OCXA 3C5CA 4UOEA 2Q5IA 4RK4A 4BIIA 1CNMA 2Q9CA 1YJAA 1ZRHA 2BFFB 3J7TA 4O1IA 2QU7A 4HTAA 4TKUB 2ETVA 2ZM5A 1EHCA 3CLRD 2XUIA 3D8RA 2BJWA 4EB0A 4JVMA 1SXJD 2QRMA 4JEHA 2B1RA 1R64A 1RHQA 4R8LA 4JQCA 5EINA 1RADA 1PGJA 3M5PA 4OMUA 1EK0A 2WV9A 2FEPA 5G1PA 1XQ1A 3KTDA 5LU9A 4JYBA 1CVRA 2B1JA 2CLDX 3U3OA 4DIEA 5KNDD 1RJDA 2KS6A 5JH7A 4BO2A 3K32A 3VZBA 3QKUA 1XRJA 4L2IA 3U49A 1BROA 2W2QA 2VHTA 3N1UA 2H1VA 3KPWA 3TMAA 2Q2QA 2W2VA 4MX8A 1ATIA 4JUBA 3O26A 3WAGA 2DQ4A 3CF4G 5DNVA 1IN7A 2I78A 2OZLB 2XHZA 3E7FA 3M6XA 3MOSA 4PGGA 4C5CA 2ETXA 1IZZA 2HV9A 2BMEA 3PDHA 1TF7A 4XB6B 5AK0A 4BYGA 4CN8A 1GFWA 3FYUB 4M9CA 5GQSA 3EYAA 2OCXA 3GFQA 4DJAA 3OEHA 3W3ZB 4JX8A 1M74A 3WGMA 4RTLA 4M76B 4X93A 3PVZA 5CDGA 3VR2A 3ZTTA 1U7PA 2B6NA 3ZDAA 2QTVB 2FK7A 4HHEA 3Q5DA 1GU1A 2H2HA 4NZZA 3L0ZA 1UINA 2C3UA 1DSSG 2OQ2A 3K9NA 2WHEA 5LBUA 3ANLA 4PWZA 1T36B 5AM5A 2GI4A 1E0JA 2GWHA 2VK4A 4MVYA 4FKMA 2PZ8A 1JMYA 5IS2A 1Y80A 1QV9A 3PP8A 4NXMB 4QYSA 2J67A 2PQMA 1ADJA 1HE1C 3AJ8A 1BWQA 3OURA 3BE8A 4HSGA 4IDNA 3NKLA 3SLGA 4DANA 5LQCA 2W8BB 1LVUA 4YFVA 2FQWA 3AM4A 2CHEA 4R68A 2JIDA 3UO8B 2M6KA 4LZJA 2WD8A 5A6SA 1QH8B 2PWPA 4ZAYA 4YECA 1V5EA 4QTXA 2QAIA 4ZODA 2E87A 1Y8RA 2I4RA 4MUHA 1AQ6A 3OJFA 4L85A 1VE1A 8AT1A 4JJIA 1SIWA 4II3A 5FBHA 3LHSA 3TF5A 4NARA 4NQRA 1N2GA 4Q21A 5ALMA 2O8DB 2HDHA 2CXOA 1Q77A 1SG0A 3AERA 3JASB 4AF7A 4RAOA 2X2FA 4XLLA 3S8EA 1JU4A 1LPOA 3P8ZA 1ZM3A 2VA9A 4LRWA 4RZHA 1UP7A 2FPWA 3RUCA 2ZUEA 3GMSA 2DRIA 3JYHA 1KRHA 1OHHA 2OBNA 2YJ6A 4M37A 4OBWA 4OMCA 5AKKA 4GR9A 1XXHA 2IUYA 4Q0MA 4Q1VA 4CNBA 3NRBA 2NZ8A 4DMHA 3SIXA 4CTMA 2A1IA 1TVMA 1FFCA 1RYEA 5DHFA 2R7NA 1M1YE 1WR8A 1YDWA 2C0CA 2NT4A 4C43A 4YX9A 3TIVA 1B4DA 1VHQA 4HN4B 3AIIA 2QZSA 4P31A 3PNYA 4LRTB 1RCTE 4C1BA 2FZKA 3C7DB 4JKIA 2Z6QA 4DJFC 2BCJQ 3K6KA 1IZYA 4XTRA 5EE5B 3DV2A 1G8FA 3M6VA 2HJHA 3CO5A 4OSPA 5AICA 3OQHA 3ON5A 1USVA 3A9WA 4RMHA 4IMJB 3SJZA 1OYOA 1FSZA 2CJWB 3W9YA 3IQZA 1J4AA 1SWWA 1XD2A 2P6UA 2VK1A 3KG2A 4P4SA 4FJ0A 1TAHA 2LNDA 1PEAA 4Q4LA 5CFMA 1L8OA 2QQFA 1VDZA 3PUIA 4CQMB 5ALYA 2YCLA 3R9XA 2ODNA 4JLJA 3B6KA 5FLYA 2PA3A 3K2IA 3MC1A 4M98A 5G1OA 4DE5A 5HZGA 4LECA 1IY9A 2WG0A 2F9FA 3RK4A 1BDIA 4EDHA 1DDGA 3KOOA 3KLOA 1NVEA 1O96A 4XJTA 5BV8A 1AE1A 4CFYA 2J8ZA 1IY2A 3NWEA 1V45E 1SB8A 1N77A 3VSDA 3EZNA 1UKVY 3NCTA 4M8SA 5LU8A 1FQWA 4GF5A 3DZJA 1H0RA 3WNCA 1QHIA 1X0VA 3L77A 4IIJA 1E77A 2R4QA 3L7AA 3ILXA 4M89A 2DF8A 2L69A 2UAGA 2WAXA 2QTFA 1SC3A 3PUVA 4KH0A 5I9MA 4QRHA 3V3KA 4DPMA 4H15A 4LJ4A 3OZXA 1E99A 1DO0A 1XD2B 4NH4A 1KWKA 2C7PA 2R2GA 4F56A 1XTRA 5B6JA 1WE2A 2J3JA 3FMFA 4YUZA 3PXDA 3MYRA 2Q3CA 4CLOA 1XG5A 3WIBA 4Z86A 1EHYA 3EW9A 2ZRBA 1VPLA 4E07A 4XQ9A 4E2YA 2JEYA 4KR7A 4L73A 2HIAA 3KX2A 3U5ZB 2HC9A 1MG0A 1U9CA 2A9RA 3H8WA 3QE0A 1NW5A 4NIMA 4B32A 4EATA 2Q28A 1M1YB 1HZJA 4KWTA 4OAQA 3G6KA 4TTJA 1Q15A 1ORRA 5JCXA 4HX2A 5BSKA 1MJFA 3DDNA 4PM4A 2CCKA 2XEDA 4M1EA 3IKVA 4ND7A 5HRAA 1QO0D 1EDDA 4FJ2A 4C88A 1XVVA 5EGNA 1WZ2A 2AEJA 1WAMA 3RJMA 1Y9AA 4Y18A 2WNHA 2W00A 5B1SA 4CG1A 5ILOA 2Y0BA 4BL5A 4RJLA 5B58T 1DCTA 1QRSA 4N49A 1CJKC 2OHJA 5J4VA 3HN2A 4OM7A 3M4NA 1CU1A 3QLVA 4H1UA 4PVCA 4B3TB 4WTOA 1PSZA 2EP5A 2ODQA 4C7OB 3LGSA 3M4XA 4J4HA 4QAJA 4D99A 3UV6A 3PXBA 2XAAA 3DBVO 1L4YA 4UBIA 2AEEA 1L1QA 2HY7A 1UZAA 2Q3HA 4UQPA 2RBGA 3CH7A 1DC6A 1N6OA 1YT5A 2BFAA 3HC7A 3LTEA 4O1MA 4R01A 4D1YA 4O1HA 4QNRA 2WKQA 2QTNA 1FU7A 3OOWA 5EHGA 4FLEA 5MN4A 4MI9A 2CYCA 4AKSA 4HS9A 3LUBA 3TZQA 2I9PA 2IY7A 1AK2A 2RK6A 3CY6A 2ZYIA 3OX4A 2BGGA 1RWOA 2O3SA 3PHHA 1IPHA 4HEA6 3IQGX 3V9PA 1CXZA 4PWYA 3DQPA 2R8XA 2O2GA 3CZ4A 2JB9A 4TQUS 4GMHA 5BUSA 4HK4A 3OIYA 3AXSA 3P5SA 4IGAA 4N7BA 1H0HA 2Q3DA 3ZWCA 5JNVA 2F4NA 3I8XA 5JISA 6ABPA 3OZRA 2IP4A 4MUKA 1R8SA 3NC4A 3LLUA 5EOVA 3FYUA 3QFFA 4XWOA 3DOOA 2QLNA 3RBXA 1FDVA 1EFAA 2FWAA 3P9QA 2Q1YA 1IUOA 2NUAA 3N39C 5CXUA 3FWYA 4GD3Q 1TVKA 3O4IA 1I33A 4ZRNA 1ZVVA 1TADA 1UCFA 3MBIA 1EM8B 3B8EA 4PG4A 1NC3A 3DBHB 3VZRA 4QGSA 1OH6A 4FE3A 3WFZA 2GLTA 5K4HA 3HFRA 3GDWA 3K7EA 1YB5A 2QLJA 2VDMB 4Y7CA 1DEHA 2L2QA 1A4XA 1W30A 3GYGA 4BKQA 4F21A 3G2NA 4MQBA 5AW6A 4G1VA 4OLFA 5I9IA 3HKBB 3TOSA 5C1PA 4B4DA 3V32A 3GOHA 3QKIA 3X1WA 1NAHA 5L3QA 5LNK1 2JFGA 3RC8A 2ERCA 4BFXA 1QFYA 2FPIA 2JGDB 3GELA 4ARBA 2FZLA 4M7RA 3BREA 3LQRA 3W79A 4HYEA 3QYFA 3E7XA 1AV7A 1DO8A 4I5EA 3I92A 1DDOA 3HJRA 3JTMA 3KEQA 1LQ2A 1N2CE 2QQ0A 1Z63A 4UNIA 1QM5A 1NBMA 2E55A 3KFLA 3N7UA 4TXMA 3PWTA 3LOPA 5B1DA 1L7VC 1AQJA 1JWLA 3V2IA 1XAGA 1RW4A 3ZWQA 1ZK3A 1JXQA 2H6EA 2ZSFA 4Z0TA 3EX7C 4WNCA 4DBZA 3HY6A 2C4NA 2JATA 3VOSA 1JFSA 3RTGA 1T4CB 3A9CA 2PS1A 3K4HA 4XVRA 4BMPB 4ECAA 4ZEVA 6NULA 1T6BY 3U80A 1EX9A 1U7HA 2M9MA 4FJ1A 2POQX 3D8UA 1F2DA 4IH1A 1VJCA 3ZCXA 1LNSA 9ATCA 4RTJA 3TZEA 4BNZA 2P0YA 3PVCA 3QKRB 3PL1A 1EB9A 2CBZA 4I5FA 4YAGA 1MZPA 1IZ9A 1YBVA 3F6SA 3GLIA 4FFLA 2FFAA 1G5PA 1GQRA 1VLVA 1DXQA 2B35A 3P71T 3N2GA 3WNZA 1KH2A 1CRQA 2RH8A 3ET5A 4A1OA 1TYEB 3OC0A 4V0OA 1NF2A 3SXJA 3KL2A 4WA8A 5A4IS 3WL3A 1RPAA 1Y7LA 3LC1O 4BO4A 4XE5A 3JRWA 1S0UA 1PDOA 3TLEA 2NO9A 3KQQA 1S2LA 3D7NA 2WM3A 3R7WA 1ZHOA 2D1RA 4L5CA 4GOLD 3GHYA 4NICA 1U2EA 2J6BA 2LR0A 5CITA 2QN9A 5ALSA 1YB4A 4CZ2A 2ZSEA 4B46A 4DG8A 3U9SA 5KYNA 1E1MA 1NJ8A 3DVLA 2XCIA 2ZRQA 5JS6A 4XPIA 2VWGA 2O0MA 2XDAA 2C9MA 4MQMA 4QU8A 5CGQB 5TMPA 1X9GA 2AOUB 4YMUA 4N3AA 4ZAVA 3TE6A 4RD3A 1NN3A 3HWX1 1NG1A 4FPXA 2WU0A 4HGRA 4HPJB 3IULA 4KWEA 4Y1GA 4Z9BA 3Q3EA 5ER6A 5TDHA 3E84A 4WADA 1QGUB 5BYKA 1VCOA 2W2PA 1CW2B 4TLLB 4DC0A 3VVCA 4QECA 1J7KA 2JBAB 1TQDA 2IV7A 1J0AA 3CWZA 1PGNA 2GLXA 2R97A 4AMYA 2BFDB 4TXNA 1FP4B 1ULAA 2FXVA 4ZWNA 3NTXA 4W5RA 4ZVRA 1DRWA 2QTTA 3GGDA 4IM7A 4NCIA 4D6XA 4YC7A 4ZTUB 2Z3VA 4NG4A 5BQPA 3FOBA 5A1JA 1SAYA 2PSEA 4X1YA 1ZVMA 2V6IA 3KCQA 5AJZA 4RS4A 1RYNA 2VZ0A 4BVKA 1Q44A 3DZGA 4FHFA 1OA0A 2HRRA 3PNKA 1A5AB 3BRWD 2OYRA 4GXRA 2I33A 1L4BA 3RIXA 4H7DA 1YMQA 1W2GA 2B9EA 4OQDA 1RTTA 3ASZA 2YXNA 5DXAA 1SXJA 2IZOA 3VOTA 2CD7A 5DULA 5GV7A 4KE8A 2FF5A 1KA9H 4YXFA 4MKGA 1UAYA 5ENDA 3IO5A 2ZRIA 1A2KC 3LD9A 2LIPA 3L7BA 1XDWA 4I50B 4GSKA 4AN1A 3NWBA 1FNCA 2Q4TA 4FSHA 1TEXA 2ZIXB 4NFYA 1ODFA 3N74A 4ZZIA 2V3WA 3NAZA 2PGJA 3DC2A 4DIOA 2JLWA 1SMKA 3O1HB 2WD7B 3RIMA 3OPXA 1SKQA 1OUMA 3CZ5A 3CUTA 3IR5A 3PICA 4D3DA 1TA9A 4Y9DA 3NDBB 3ESYA 4MRSA 4RVUA 3KZOA 3V4SA 3RGGA 2EJUA 3G2LA 1QG4A 3GROA 4Q9JA 4F60A 4BE9A 1NVUQ 1ZN8A 2YWEA 1ZICA 3PKJA 4HDMB 4JGIA 4CRWB 1JQJC 3KQNA 1G9XA 4NDAA 4J0CA 4TWIA 3ZGNA 2AMFA 3TW8B 2YWFA 4PYNA 5AT1A 1HT0A 2WSMA 5BV7A 5IZ4A 2W83A 1C7QA 3BRSA 1EKXA 1WNFA 1ZCAA 1EMDA 2VJBA 2PS3A 4BO9A 3JQFC 2Q8QA 3BD7A 1PNTA 3R7FA 1D7AA 5KYKA 1L4EA 3OPMA 5CVVA 3K0CC 3WRYC 5LMNB 2YHAA 3LDAA 4X90A 2Y71A 3L4BC 3UPUA 2YUIA 1GVNB 1SC1A 1G41A 1HFJA 1JEYB 2X6QA 3CONA 2XBMA 5FFFA 5HFAA 2QL6A 1SB9A 1I8TA 3MMPA 3O83A 1EDZA 1OREA 3C1TA 3LM8A 1XCOA 2DWQA 4WOPA 1PHRA 5TNXA 1T2NA 5JD6A 4MW1A 1SUAA 3H1AA 3W7AA 5I7FA 4HDMA 1BD3A 1CV2A 1N9ZA 2JJYA 1NV9A 3CLUD 1S3GA 1Y6JA 2H2AA 4TLBA 5G40A 1QCYA 4IICA 4F5DA 1UXJA 1TZMA 4OXKA 4UHDA 5JUWA 3MNFA 2VF2A 4BCCA 4F2DA 1U5BB 5AVQA 5JR3A 2B1GA 3TB6A 5DIFA 2XYQA 3OZBA 5DFAA 4U5XA 3AKYA 1UADA 1YI0A 1X9IA 4HYTA 3UMSA 1KMIY 3T0GA 1RWWA 4O4LB 3ZWBA 3PVSA 5TQ0B 1NHGA 1UIMA 2JHCA 5AVYA 1SBZA 3BICA 3DOCA 3KHKA 4IGEA 2Z8XA 2C2KA 5IAKA 5JMPA 1KZ7B 1UMDA 3C3AA 3ORYA 2HK8A 2M98A 2C92A 2N9UA 3KTFA 4INJA 1LW6E 4MWDA 2WJAA 3SPXA 4AROA 4F4FA 4U3JA 4WJLA 3DEJA 5A0TA 2GPWA 2A8YA 5CHEA 3I39X 1H6CA 1X1BA 1PR3A 4IS3A 5IWAB 4X1YB 1GNRA 2VHVA 5IK2A 1M2FA 2DHRA 2ZTMA 4DSTA 4JU8A 3I5UA 1YDEA 2QVCA 1F1BA 3TLZA 2PX0A 3FZNA 2JLQA 3AUTA 3EBLA 4HAWA 2J46A 4J43A 2VDOB 3LHKA 4O2RA 3WYNA 3ICWA 2UVPB 1QK5A 1U5BA 2OD7A 4B4WA 4W63A 3WLRA 2DOKA 1E5TA 2CDCA 3F6RA 1TGVA 2AQ8A 4GYKA 2CFRA 4HO1X 4M36A 1WBDA 4YB8A 3HR7A 1LDEA 5JAUA 3MLAA 4C29A 1Q2UA 4TN5A 3FWHA 2GVZC 4QFCA 3IGFA 2YZKA 4KN8A 4QU0A 5TEWA 4DIBA 1PS9A 2VHCA 3GJQA 4WXPA 4NU5A 5AIBA 3B9RA 3DJFA 4HNSA 1GAXA 5J4KA 2WIDA 3F49S 3A37A 5CVJA 2QV0A 2GHIA 2ORYA 4URHA 2CLKB 5CEFA 4MWCA 1CUFA 3C15C 3HABA 2EATA 1RE0A 4R9UC 3ANXA 3DXZA 2EF1A 3GLUA 2AEFA 3EPKA 1V7PC 1UOQA 1X19A 3Q9SA 5CX1B 5EIAA 1WMSA 4LV5B 4P83A 3T1HB 3IE0A 4OJKA 1OH7A 1M0TA 2IF0A 5CBKA 3IELA 2E4XA 3CR7A 2I3AA 3IIKA 4XYLA 1TXGA 3CXUA 8GPBA 4KR3A 1HNXB 3RR2A 2Y92A 1I32A 3BKXA 4YMTA 3WLJA 3IODA 2O05A 1FFYA 3NBZC 1JYSA 1PUXA 1L5RA 1E7YA 4HZIA 5ED0A 1WCWA 1X14A 1BNCA 1H1LB 4LHWA 1GEEA 3QVGA 4XKJA 1AN0A 2R6ZA 1OVGA 4J0EA 3LQ1A 4L2IB 4BLRA 4UM9B 1GSIA 1EE9A 4G36A 5JS1A 4RUKA 2ZATA 3EDOA 5SY4A 4HJXA 1GLVA 1IQ0A 2JIZA 2YV1A 3QWAA 3RKRA 1JHRA 1X6VA 3FYSA 4DW8A 4EVRA 4RM3A 1V5IA 1LI4A 1C1YA 2BC9A 1TTPB 2PMWB 2P9BA 3DDHA 3NX4A 1M66A 2QUZA 2LIVA 4AJJA 4L6AA 5IUJC 4WKGA 3WIUA 1X7WA 4GBED 3C6ZA 3I9V1 1ECFA 1NN0A 4JR1A 1EVQA 2AF3C 3FDZB 4XCQA 1IHPA 3TLXA 5KNCD 3LWZA 3B3GA 3IA7A 3AJEA 5LZ8A 1I01A 3EIUA 3SEQA 4DYDA 5GGXA 3STTA 3L4BA 4KW7A 2D5IA 4YLEA 4YRLA 1DCMA 2JGDA 4YR9A 2NADA 3N7TA 4MUGA 1C5KA 4HEA1 3GPDG 5AMXA 2QENA 4ZGWA 2YQ4A 1KQOA 2DZDA 5EI5A 1BVUA 1MX5A 2GPJA 3LGAA 1LDMA 3ZE2B 5CP8A 2F9LA 2Q1TA 4LYJA 2JLUA 5T7BA 1VPTA 3RVQA 5KS2A 1ZIOA 4MUYA 5HPYB 3D6MA 1BEEA 4EGCB 4QDUA 5AVSA 5HE9A 3BXXA 1M2VA 3LFUA 3CN9A 1BW9A 3H97A 1K5PA 4QEDA 3VO2A 5JD5A 4WDRA 1J23A 1YS2X 2QMQA 3HN6A 1GG2A 3SYLA 2OOKA 1EWKA 1QORA 1Z5ZA 5F33A 2A3NA 1GQSA 2OCDA 1ORVA 1XQYA 2CB0A 3F3MA 2GA9A 2XUDA 1XKLA 3D4PA 2R60A 1UFOA 5G4KB 3UHAA 1NAIA 1KRXA 2IOYA 5K3SA 3RBVA 1C8KA 5FF9A 1OIVA 1SQGA 5DZSA 5KKAA 1QYVA 2ZRPA 3L01A 4ZYYA 1H5NA 2I6SA 2ZB3A 3FPFA 1IATA 2I4IA 3IESA 4IMPA 2WQZA 4MCJA 5DYGA 2WU4A 3PK0A 4LVCA 5FBRB 2W2KA 4CMGA 3CHYA 5LKRA 1ESNA 3V7NA 1R0ZA 3VXKA 4BFCA 2ENWA 1E32A 3P0JA 4MARA 4PRZA 2QMYA 1F06A 3B36A 3WBKA 1I7LA 2G5GX 4AECA 4BFYA 2Q1WA 1YH3A 3HU1A 4NAUA 4W4TA 3WNDA 1SUCA 4I9UA 2NU8B 3ABOB 3T0FA 4IXWA 2CE2X 4KSCA 1YOVA 3LECA 3ML1A 1G20B 1F38A 3A3YA 3HJAA 4FHEA 1U98A 5JI2E 1SHUX 3C8HA 1A97A 1QDEA 4RWZA 4C4PA 3BT7A 4ZOLF 3UJPA 1WUTA 2PTGA 2VHUA 1A8SA 1BMFD 5TS3A 4NV3A 1M72A 2X0FA 4OUKX 3E9CA 4KB5A 1A9SA 5ALRA 5JPIA 1YL6A 1SU7A 2DBZA 2OR3A 2XWSA 3PFBA 3ST7A 4EPYA 3A6KA 3KP1A 2AD5A 3QVSA 3ZDRA 2HL6A 2Q21A 1SUWA 4TM8A 2C9YA 3OCWA 3D5TA 4RS3A 1I0IA 1XVUA 2ZGVA 1C14A 1V6SA 1K7FB 4I4TB 3CZRA 3Q12A 1FC0A 5JCPA 3R9XB 3EIXA 3VNUA 3UA4A 1W36B 3M6FA 5GVSA 2I29A 1RRPA 3CS3A 3QYPA 1NX9A 2OC9A 3FG9A 1MB9A 2ZIVB 3SZUA 5B2EA 5IANA 1FXSA 2UZIR 1KZ6A 2WA2A 3D0RA 4GE0A 2CV2A 3MPOA 3NP9A 5CAEB 5C8ZA 3GA5A 4EO9A 3W5AA 4YRGA 3OI7A 4CUJA 2QN1A 1YVDA 4Q02A 3WAJA 3R5XA 5C35A 4AM8A 4RW0A 2WKPA 2A35A 1PZHA 1TRKA 1CY1A 3LVFO 4PXAA 1ACLA 4BAGA 2R8YA 1OKKA 2BBSA 4Y9RA 5J1TB 3U7HB 4IHKA 1TM5E 2V7QD 2XXBA 3BA1A 1U6KA 3CLUC 1N0IA 2I03A 1Z6TA 1JIVA 4AYTA 5L6LB 2PAAA 3RBAA 1E6KA 3I9JA 3BFXA 1MB3A 3ZX5A 2GVDC 1H5QA 2Q3FA 3A0UA 3OQPA 4BZZA 4OUDA 1KIMA 4F86A 3O74A 5IZCC 3H86A 2HI0A 2ROQA 3O9ZA 5TJ9A 3UW1A 1MAAA 4N6NA 1XEWX 5AI0A 1ZR2A 2Q0XA 1K8RA 4HNVA 4TMKA 3A4YA 2B8JA 1RVV1 2VT3A 5KI6A 1S89A 1BE1A 1TMGE 3OM0A 4R1TA 2JI8A 4WA7A 4ABYA 5T3UA 2X1MA 4J0FA 4JMPA 4LX0A 5H3HA 4AYXA 4E21A 1JMVA 4JLOA 3WWZA 2WYUA 1VSVA 3KE8A 5TIIA 1TMKA 2F43B 1D5CA 2BUAA 1XTBA 2GK4A 1NW8A 2ZIEA 4IG4A 4JJZA 4KXFB 2LDXA 3D1JA 5A4MS 1QAOA 3IILA 1BEZA 2P6OA 4UUMA 4OHOA 2B30A 4AYWA 4JB3A 4IDAA 5F5LA 2PJZA 3KSAC 4OQNA 3D2CA 2HPZA 4DLKA 5BNZA 1PK8A 3HPQA 4MDHA 2OL4A 2BE9A 4F2HA 4LJ9A 3FPLA 1X1TA 3LKDA 3N0TA 2P8JA 2XWJI 1GG5A 2NYVA 2RGUA 2NPOA 1P9WA 2GKSA 3D2LA 1FNDA 2P30A 3Q7PA 5G0VA 5IG2A 3ENVA 3FF1A 3RS7A 1GRVA 1U0RA 2Z2KA 3FF4A 1NW3A 3NBMA 4TYPA 5IMBA 1E3JA 1T91A 4XX1A 5EHXA 5IM5A 1S6YA 3DOFA 1G5HA 3BXEA 3RG2A 2OUIA 3QOXA 3W77A 2PZEA 5ALVA 3R09A 1I2BA 3QY9A 3FE2A 4C0SA 5BR1A 1BIFA 2GK6A 1EFVA 2H18A 3CT6A 3ILHA 3WBJA 4C7KA 5LIPA 3WYCA 3O6VA 3MJCA 1T2AA 3NT5A 2JG3A 1JFVA 3KQWA 3QV1A 1X87A 3FVWA 4O8CA 1PCXA 4XYBA 1OU4A 2E89A 3OZVA 4JOCA 4AMUA 5CFLA 4FLMA 2ONKA 5TPWB 2PT5A 3LZCA 3VKGA 4W9NA 4CMAA 1TO6A 2VNHA 1SD2A 3I64A 1B3BA 4UU8A 4J7CA 4DM7A 5JOQA 2IYLD 1FJXA 2F2TA 3OUZA 4BLOA 5TS2A 4YMSA 1IAQA 2J5RA 3OZFA 4JXJA 4L1KA 3VZQA 3VDXA 1HLPA 5CNIA 1BXGB 1EINA 3B7PA 3GBVA 4JFAA 4KE7A 4TTPA 3RRMA 3PEUA 5KX5A 2C97A 4O3MA 3PHCA 1WKBA 1M1YA 1BS1A 1G4HA 2ZUBA 2JS7A 3EVBA 4PLZA 2O3UA 1NR1A 3MUOA 3NI2A 4A82A 2OGSA 4BP3A 4CF4A 1XA4A 3OQ1A 2FDCA 3GARA 2Q0SA 4O2LA 1WHTA 3ZQJA 2WF6A 3OLWA 4BMCA 2ACVA 3CLTD 2DETA 3OT1A 4J9UE 4BLUA 3MUEA 1W5EA 3FPEA 4OVKA 3V1TC 3H18A 3QVJA 3PZRA 1QRDA 2BGMA 3HJGA 4HLUC 2W43A 1EGVB 1YCFA 1Z6ZA 3EVAA 4OQYA 2P77A 1NC1A 1DXYA 2AQKA 4YGXB 3EZFA 1RM4A 3EXHC 4QDTA 1U3WA 5L3SB 3H13A 5FHRA 4O5AA 1W85B 2QXTA 4NPAA 1B8PA 1UK9A 3G85A 2V5VA 2XRMA 1SD1A 4N6GA 1MBZA 2NOAA 4CQJA 3AYZB 1W9HA 4IJ6A 1EFLA 4B7AA 2AI1A 4JLUA 2W8ZA 4A2CA 3UFBA 5DYIA 1AO0A 1R50A 3BPSA 4IGKA 4WLNA 4F6CA 2OT3B 3EOBI 2F3PA 1YDMA 4PX2A 3SNKA 1EQUA 4I1RA 5HFNA 1N9KA 3BWEA 3CLSD 4MVJI 5CIYA 3PXAA 4BXOA 2DPGA 1U28A 3RK0A 2YFKA 3MWKA 1K1EA 2ZJ4A 1J42A 4FDUA 3ZQ6A 1WW3A 2YX1A 2ZKLA 3K05A 1RYZA 4UHJA 1FOEB 2VSFA 2ZJOA 4XLTA 3PXGA 3KS9A 2NTVA 3OY7A 5HQ3B 4YRZA 3RS4A 3VISA 1JKJA 2WV7A 1E98A 3QBJA 3B38A 2R8ZA 3M9LA 1YK0A 2HA4A 2ZREA 4PO1A 4XQCA 3HL0A 1E7WA 1R0LA 2MR6A 5DYTA 4E7OA 1JDZA 4EA9A 4DWWA 1E3QA 3PDJA 1G8HA 5CT8A 1ZESA 2JAWA 1N5RA 4RZXA 1QHNA 3LY5A 2Z9CA 1N7HA 2IVZA 1J0EA 2HR1A 1QU2A 2OUKA 1GHTA 4MMYB 4WK6A 4B3SB 1NSYA 2F1IA 4NBKA 2XGMA 2FH5B 4OJMX 1K6JA 1MJ5A 1YS6A 4M53A 3VO9A 1SXJB 2LRHA 4CM8B 4XSGA 5JHHB 1LSSA 1QE3A 3B6ZA 1DJQA 2NUTB 4PHCA 3KTAA 5DX1A 5JG7A 4PX3A 3L43A 1QHSA 1RQNA 2VH5R 4BRUA 1V25A 3K5PA 2FJ0A 3KUCA 3MGCA 4G1UC 1ZSVA 4NNOA 3UCFA 1IVSA 1JQAA 2CLMB 2OWDA 4RHCA 5BR4A 1CRPA 3U6BA 4JP8A 3SLRA 4QNNA 3TEFA 5AJTA 2ZSDA 4L3OA 2G1AA 1TK2A 2JA1A 2RGDA 1ZD1A 1QMPA 5KYWA 3WJ1A 1RNLA 3TE7A 1JLHA 1F5NA 1DLIA 4F38A 1CIPA 5FR2A 2O4UX 2X77A 2HBZA 2WKWA 1V95A 4INOA 2BFEB 1H05A 4UM8B 3WLAA 3AVYA 5CLIA 4R1MA 1TUBA 1FF9A 1N0VC 1MB2A 3M89A 3OHMA 5H3LA 4CGYA 2QVLA 3PWZA 2REXB 2Q1SA 3JPWA 4LYGA 4TMXA 4LXIA 1VSQA 1G18A 3PWKA 4WAUA 3W90A 1G8AA 1HDCA 1SVUA 2BEKA 3EDMA 3WA7A 1XNRB 3K94A 1HTBA 3U9LA 5B57C 4UDXX 5THXA 2EZUA 3H75A 5D7NA 5EPEA 3FMOB 5CA0B 4TMVA 3BWCA 3WDSA 5KPJA 2CT8A 5K0NA 1EDOA 1IZ0A 2YBEA 5EFZA 2J59A 2A5LA 1PR5A 4EG8A 4MIKA 3SD7A 4L9WA 3AI7A 3STHA 3WK4A 2B5OA 2BKAA 2BMVA 2ZJ8A 3FMGA 3ITNA 3KEGA 5B6PA 5JARA 4LTNA 3AVTA 3W05A 1CJMA 2IHBA 4H9GA 5LFAA 1WCV1 4OA5A 1CD5A 1SA0B 5E3HA 2EIHA 1ONNA 2H4FA 2KBFA 3JY6A 4O3FA 5EQJB 5BSFA 1CRZA 4HOYA 3JS5A 2ZBQA 1CR6A 2XKAA 2VXBA 4M1ZA 4QDKA 5BT9A 2PT6A 5A5DA 5F4BA 4CIDA 3JQ8A 4Z8XA 2IZZA 3L07A 5IPFA 2QG4A 1KEZA 4J29A 3HB7A 2QX7A 4ZEWA 1ZJJA 2FX2A 2WWFA 4EHBA 2JHPA 3PXUA 2H17A 5BR7A 2R1VA 3TLYA 4X8OA 4C7MA 5LZ7A 1B8VA 3UMBA 1QWOA 2GPNA 2OD9A 2OXEA 1LDGA 2FWJA 1F2UB 2I6XA 2VI5A 1I3CA 2I6TA 2WMYA 3CF0A 3RUPA 2BFCB 1FZQA 2CBXA 1YQUA 2ODAA 3SZOA 1U5AA 3H0EA 2J08A 3GR6A 2HLHA 4MS3A 4AJKA 5HJ5A 2QSYA 1XXHE 1EK1A 4YJ2B 3MMSA 4XSHA 4NJMA 2JL1A 3T3EA 3Q9UA 4H3VA 3GUHA 2JCXA 2LKCA 4Q7MB 1JDJA 1KFJB 2BBOA 1V71A 1SUEA 4N40A 1XOIA 2D2EA 1TCCA 5DK4A 1PL8A 1FYEA 3TM4A 2VHJA 3OH8A 1G7CA 4XARA 2H0QA 2FVXA 4V3BA 4XM0A 3RREA 4MYUA 1OYVA 1FTSA 1G8PA 3BWBA 2WYIA 1MRZA 3JQBC 4P0PB 3UHFA 3LA6A 1W76A 5JLAA 1JVNA 4J2OA 1U8FO 4OQLA 5JTUA 5DO9A 4Y1RB 1KC1A 3JQ7A 2GEUA 5KSWB 4GP6A 1Z08A 4HAUA 1UBLS 2O7QA 1N5JA 4YY3B 1PVOA 4CLEA 4JT4A 5E4YA 4WT7A 1JHDA 4B31A 1E9FA 1CFZA 4DMLA 1IBLB 1HQKA 3EN0A 3S81A 1QQ6A 2EW2A 4OMDA 3TNYA 3NTUA 4F4JA 2D0IA 2X13A 4M1TA 3BBLA 2HBQA 4WNIA 2BE7A 4RGVA 4ZKDA 3KZ1E 3IUJA 1VIYA 3CB4A 3SHQA 1ODIA 2JGMA 2PD6A 3D54D 4X44A 4C4RA 4E14A 5A62A 1Y6RA 2QN3A 3DSRA 3SCZA 4CKWB 2GA8A 3P45A 4DIFA 2VSYA 2QRPA 3X3HA 1NVMB 1XC7A 5E2IA 3T5GA 5F1YA 4A91A 1X80B 3R5JA 5KTYA 4ZO6A 3D6NB 4ZTBA 4BNDA 4MR8A 3IR6A 4URVR 5DCWA 4HQ0A 2PUCA 3T9FA 4OXNA 4I1VA 3P2OA 1W0JA 3GLVA 3V4LA 3NHKA 3QVTA 4EY6A 4ZO8A 3FOEC 1VCNA 4F71A 4TZ0A 3BYZA 2H1CA 5EE3A 3ZTWA 2DUMA 4JJAA 2A92A 4KUEA 4EG6A 5KTSA 2R3SA 4GH5A 1KYYA 3AHJA 4Z9FA 5IAEA 2C78A 3WKEA 4BQPA 4BXOB 4RF5A 2PRSA 2WTAA 5AJVB 3PNOA 1LLDA 2AT1A 1W4AA 2W93A 4TWRA 5JVDA 3SM9A 2ZJAA 5JATA 4KYUA 4JFRA 2AFRA 2WRZA 4DCGA 2IH2A 4Y1EA 1GITA 4KWCA 3EXHB 1FRVA 1YFZA 3HYLA 1TOAA 2VLIA 4DXHA 1F7VA 3TRDA 1KY3A 1J8VA 1E6LA 1Z5NA 4L57A 2AH5A 5FYDA 1DOAA 4RIHA 3TGLA 3GRAA 2ZE6A 2QM8A 3HXTA 5D3MA 4JAVC 4JYMA 1E0DA 1SJ9A 4S0ZA 2BTEA 5DGXA 1HXHA 4Z0PA 3OE5A 2J3QA 3FOFC 3RD5A 4PW0A 1RZVA 2QGNA 5L7TA 3JVVA 1V9LA 4PHGA 1KJ8A 1T5SA 2VKTA 1J56A 2CVQA 1NXXA 3FCOA 4NHEA 3LZ6A 2JCSA 3WYAA 1SWVA 5BOSB 5EQDA 1Q7RA 1CE8B 2NO5A 2M2IA 1I9GA 1J07A 2NO6A 4ZOLA 2V74B 1RLTA 4YT5A 4ZPXA 4D9HA 2CW5A 2I3DA 1UH5A 3CF6R 3ROXA 1EESA 1RRVA 2R751 3FWKA 2SBTA 4QHSA 2XB8A 4X3PA 2ZJ2A 2GN4A 4JI4B 4MWEA