1IC6A

Structure of a serine protease proteinase k from tritirachium album limber at 0.98 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a serine protease proteinase K from Tritirachium album limber at 0.98 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEINASE K
total genus 87
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ic6A00
3VV3A 1SUEA 1BFKA 1ST2A 4B5LA 1ST3A 3DE3X 4JP8A 4CG0A 1SIOA 3I37X 2ZRQA 5JMOA 4H6WA 1AV7A 4OMDA 2WUVA 2Z57A 3AJ8A 3LPDA 3OSZA 1SBNE 1MEEA 1AU9A 2ID4A 4KPGA 3QMPA 4C3UA 2W2MA 2PRKA 4HVLA 3PTLA 3DYBA 1NDUA 1SUAA 4NE9A 1JEAA 1UBNA 4Z2AA 1OT5A 3LXUX 1BFUA 2Z2ZA 1PFGA 3H42B 1AH2A 3I2YX 1SCJA 1TK2A 5AVJA 4I0WB 3LPCA 1A2QA 2X8JA 1YJBA 2XTJA 1VSBA 1Q5PA 1C9JA 1SBTA 1P7WA 1ZVJA 4HX2A 1P7VA 1AK9A 2WUWE 3CO0S 2IXTA 4KG7A 4MZDA 5FFNA 1S2NA 4NE7A 3DVSX 3DW1X 4AKTA 1SVNA 1GTJ1 4OV6B 3A3NA 1T1EA 2P4EA 1TM3E 3BPSA 4KB5A 2W2NA 1SUDA 1TMGE 1GTG1 2W2OA 3BGOS 3DVQX 3AJ9A 1YU6A 1TM7E 3SQOA 1GNVA 1TM1E 3A3PA 5JXGA 1SCBA 3Q5GA 5JXJA 5JXHA 1KDZA 1SCNE 3EE6A 2G4VA 4H6VA 1ZVKA 3SICE 3LPAA 3DE6X 3VV2A 2DQKA 5FAXA 2XRMA 1T1IA 1KE1A 3ZXYA 5B1DA 4AKSA 4K8RB 5I9SA 4LVNA 2V8BA 5AMXA 4J94A 2Z56A 1EA7A 1GNSA 4YN3A 3VYVA 1AF4A 1PTKA 1GA6A 1OYVA 1SCDA 1SPBS 3D9QX 3GT3A 1SN7A 5AVKA 2PWBA 3DE5X 1KE2A 4DZTA 3QTLA 1R64A 1HT3A 1R0RE 1Y3FE 1CSEE 2SNIE 3DVRX 3PRKE 3QFHA 3DE2X 4FONA 4M1ZA 4DJ5X 1TO2E 3DDZX 1Y3BE 2ZWOA 1SBHA 1BE8A 2ST1A 3Q40A 1TM4E 1V5IA 1S01A 1XF1A 2HD4A 1YJAA 2Z30A 3GCXA 2HPZA 2SECE 5ARCA 1PJ8A 2PKCA 1Y34E 2PMWB 4NMXB 2ZWPA 1MPTA 1PEKE 3VTAA 1GTL1 3DE1X 2IY9A 3WIVA 1SUCA 5B1EA 1R6VA 3T41A 5K7SA 2Z2YA 4C3VA 3DE7X 2ID8A 4WOBA 4H6XA 1C3LA 3ZXXA 1DUIA 1NLUA 3GT4A 1BE6A 3WHIA 1Y3DE 3TI7A 4ZARA 5FBZA 1CNMA 5AQEA 4ZOQI 3VHQA 1KDYA 1SUBA 1DBIA 2Z58A 3F7MA 1GCIA 4GI3A 1Y4AE 3VSBA 1GA4A 1Y4DE 3AFGA 3WIUA 4OMCA 1LW6E 2PYZA 4BWGA 1WMFA 1SBCA 1Y33E 1Y9ZA 1TECE 2QTWB 5ARBA 5JXIA 1WSDA 3BX1A 1Y3CE 3DE4X 3F7OA 1SCAA 1WMEA 1KDVA 1AVTA 3WQBA 3EIFA 1AQNA 4CFYA 1IC6A 3A3OA 1WVMA 1WMDA 1Y48E 1SBIA 2DUJA 2WV7A 2DP4E 2PQ2A 2W2QA 1IAVA 2Z2XA 3DE0X 3I30X 4DWWA 3P5BA 1OYOA 3DW3X 1S02A 3EDYA 3L1KA 5SICE 3F49S 3I34X 1T1GA 2B6NA 3GCWA 1SIUA 3HJRA 5ARDA 3TECE 1C9MA 1SIBE 1SUPA 2GKOA 2PWAA 2SICE 2W2PA 4WOCA 1BJRE 4CFZA 1SH7A 1BH6A 1GA1A 1YJCA 2E1PA 3TI9A 1SELA 1Y1KE 2WWTA 4LVOA 1C9NA 3D43A 1GT91 1NDQA 1P8JA 1V6CA 3CNQS 4RYDA 5CW1A 1EGQA 1TM5E 1THMA 2X8JB 2SBTA 1TO1E 2TECE 3UNXA 3DWEX
chains in the Genus database with same CATH superfamily
4O4LB 4D5GA 3Q7QA 3ZV4A 2OORC 1ZOLA 3WJ1A 4EG8A 1Q0SA 4WZAE 1P9NA 5H16A 4JYAB 3GZTB 1DRVA 3N2ZB 5JD5A 1L9KA 1W9MA 4KWEA 5L6MB 4CQJA 3Q88A 5I9BA 5TT0A 2DBYA 4OJNA 4R1SA 4YJDA 3MTJA 2JANA 1M83A 1QQ5A 1QKIA 1O87A 1RFLA 2CFTA 4YDQA 1E18A 4ACAA 4TVKA 3L8FA 3K2BA 2XMZA 1U1IA 2RAVA 3ZY6A 4DE5A 1O08A 1ZH0A 3RF7A 4C07A 4C0LA 1CF2O 2IQIA 2WUWE 4DLRA 3MZ0A 1I24A 1PDOA 1QGUB 3JARB 3SFZA 4ZTZB 1K2VN 1IY2A 4J1NA 3CVOA 3DOJA 5D51S 3ETCA 4B44A 3K73O 2O8DA 4KDFA 1P6UA 2OQIA 2QMYA 2Q3JA 3A6JA 3AFOA 3D54D 3RUDA 4MLZA 2GO1A 3CWQA 1U65A 4O29A 3GQBA 1OAOA 2BONA 3QELA 3WMWA 4DCNA 3BAFA 4FB4A 5AM4A 2IPAB 2I22A 3PKZA 3RFXA 4BVJA 1C7QA 3CSUA 4LNUB 4MGZR 3T5GA 4RV4A 3DVAA 2I7VA 1XWFA 5LU9A 5JTUA 1W87A 2J3QA 3KETA 4RAQA 4MQBA 1U8YA 5A4MS 4IDOA 3EIOA 1J49A 2IYTA 4HDSA 1I5RA 3G7UA 4NYMR 3NGMA 5C8XA 3OLWA 1YA8A 5E95A 1WZIA 4K28A 1IHOA 2PV7A 2EJCA 2R8XA 3LDFA 1E66A 4GOND 1Y6RA 2PKQP 3OX1A 3SPXA 1N2HA 1QH1B 4RMNA 4BC0A 1ISPA 1XB2A 3RVOA 4B75A 2WB2A 1NJ2A 3TGWA 4ZZ0A 3I52A 2D2IA 5FBRB 2I4NA 3IE1A 2G28A 1PNQA 1KIAA 4CMAA 4DJEC 4ZHQB 3M1YA 2H9IA 3BXXA 4N3CA 3UN1A 1T6XA 4LYAA 1ODIA 2C00A 3CF2A 3HS3A 2VPQA 4GI3A 4EHFA 3JYLA 1Y98A 3TKYA 2R7MA 4F46A 1LW6E 3TZQA 4CCSA 4ENSA 2BEWB 2VEDA 4LZPA 1PQYA 4HH0A 4R1OA 3IS3A 3T94A 2ODNA 2EL7A 2JFPA 1EDDA 2OFFA 2Z5GA 2CMDA 3KVRA 3K0SA 1E2GA 3RVJA 3KPUA 2DTEA 5AW2A 4A23A 3DE0X 5LQAA 4HDNA 4KKVA 4Z7NB 2P41A 4MRSA 4PFQA 2IEZA 5FL3A 3W2EA 4BUJA 2BFBB 2MSWA 4DBVO 4L75A 3BJMA 4W8HA 5JCZA 2OCXA 2QN7A 4JGGA 4GXQA 2B37A 2C58A 4CFZA 1USKA 3PA6A 4NK4A 4LZLA 3PF8A 5AI6A 5L6LB 1Y1KE 3GDHA 2GA9A 2G25A 4EG4A 4HN4B 1RRKA 4TV8B 4WKOA 4OFXA 3DFZA 3W3ZB 2DKOA 2HOQA 2VSOA 2FJ0A 2FUNB 3ENWA 3Q6NA 4MUYA 4YQEA 2HSJA 4R0NA 1CZRA 5IAGA 3TQQA 5CDGA 4F04A 4JP8A 2J0SA 4IMJB 3BRQA 4R5HA 3T5DA 4MAMA 4G37A 2PSFA 1X7HA 4IZHA 3H1AA 1OBVA 4YGYA 1RAHA 4MGKR 3E70C 3IQXA 4DRYA 3TVDA 2OV4A 1E8MA 4OGKA 2AOUB 3HXKA 4NXNB 1VP3A 3P2JA 1F2VA 4GP7A 1KEEA 3VVMA 4HEA6 2QAGB 2JJ2D 2M2IA 4TS9A 3ZIAA 1EUCB 2Z95A 2WWHA 1IXKA 4D6YA 2ZRNA 5EA2A 4RKFA 2F55A 2O1XA 3ZHCA 2PMCA 2J7PA 4ZZIA 1DWPA 4IFEA 1H0SA 4JYZA 2Q4OA 3SU8A 1Q0LA 3KXKA 2E0IA 1D6MA 3C7CB 4REOA 1AKNA 4S3MA 1H5NA 4HAWA 4B2YA 1J9EA 1D2EA 1QH8B 1SB9A 3SBEA 2XT9A 4AJHA 1E3IA 3EA0A 1CD5A 2C88A 2JFXA 3C4JA 4QZVA 3TOXA 1YO6A 1M2GA 2AVNA 3L4BA 1EPUA 4B09A 1G7TA 4CL8A 3AHHA 1UDAA 3SVZA 2IHBA 1AXEA 1UPFA 2WMDA 1EHIA 2FLWA 3HVUA 3EWSA 3BC1A 2H2HA 1EXVA 4ZYWA 3IQHX 2G63A 4RZ3A 1QGOA 3W6PA 1YNSA 4K5QA 4D0RA 4E5SA 2WSLA 1P62B 3T9DA 2EFEB 3HBLA 4CM4A 4YRGA 4H27A 2H1LA 4OGLA 3E3OA 3FSJX 3TQTA 3IDQA 3TSWA 1SO8A 4HPWA 3V8PA 3S3TA 3PJRA 4BNDA 2YY5A 1SKQA 1D2GA 2HB6A 2A3RA 1KY2A 2CNDA 4ACBA 3RWOA 3LCRA 1WRBA 3EUFA 2H4FA 1I7NA 3JALB 3A1FA 4KSBA 4QDJA 1JR6A 3ZXIA 3PIIA 4IFIA 5EQFA 2BAGA 3MUFA 1Y1TA 2BMVA 2GETA 5DOVA 3GHHA 1AO0A 3A4LA 3BFKA 4XOUA 2PPLA 1LPPA 4NE2A 4PINA 2GBGA 3RARA 2W42A 3DBLA 4ZYYA 5EXDA 1E2QA 5L4LA 1HWYA 3AVOA 3QUBA 4M49A 4WXRA 1NVUQ 1BVUA 1NX6A 1VBMA 3UHPA 2ZBDA 5DI3B 2H57A 4I7EA 4B9EA 3K9FC 3IE2A 5A2QA 1JRLA 1Z7BA 2OG2A 3BYZA 4ND8B 4OMCA 4ZV9A 2VATA 2ZS9A 1NW5A 2GFQA 1E1CA 2H4XA 3MINA 1SKYB 3STYA 1UBKS 3D7LA 1RKBA 2RHHA 4JLUA 3REOA 3I42A 1B0AA 1T8TA 3GJ4A 1VL5A 1CUJA 4OCZA 4HCJA 5DKFA 2XYGA 4G6ZA 4N4AA 5EQDA 3UAGA 5IT4A 5IYZB 4EW2A 3ZWMA 5LB2A 2JCXA 3M2TA 1KFEB 4LFBB 1CDZA 1SIUA 3NTRA 1G42A 2F43B 2NUAA 3UF0A 3X2FA 5M29A 2WWWA 2VF5X 2FFRA 3KSZO 3HBAA 3GHYA 1V96A 2PBFA 1IUOA 4P0PB 4UJ5A 1T1RA 2X86A 2A86A 4B83A 5AKYA 2J85A 3DC2A 5TQ2A 5HKKD 3HL4A 5KVQA 5IK2D 4PQYA 3ZW8A 2NQ8A 3CKMA 4IVPA 2RC6A 4Y1RA 2C4UA 1PZNA 1YQGA 3UNXA 3NGLA 4JXJA 3RTBA 2PZGA 3QG1A 1U5BA 4FI3F 2VSXA 4HC4A 4O4IA 1H6BA 2VSFA 4UZEA 3HFGA 2ZJZA 3AJ8A 1ZOPA 4J1TC 4M9UA 5CDYA 1XZ8A 4BKPA 2HWWA 1JEOA 2JIOA 5B6PA 1HXHA 3S5JA 3V7YA 2WT9A 3QWBA 2FMFA 4NE9A 1AGYA 3ONWA 3RRFA 4AROA 4BNJA 5JYEA 4LGCA 1ZESA 1RQXA 3LQRA 4UE3S 3IDAA 1ZM4A 1N2JA 3WDMA 2FWIA 4CMBA 3AB3A 1C4XA 2AYZA 2F90A 5CT8A 1O4WA 3Q7IA 4HFJA 5TXGA 3W06A 3I12A 4D57A 5H9VA 1U28C 5JPDA 5MGBA 4XGIA 2Q7DA 1IN7A 3AW8A 5KNDA 5LP1A 3EMKA 2EKLA 2QI9C 2OXRA 2J5XA 4BVHA 3PXAA 5JJCA 2J0EA 3N6RA 3B6ZA 4D3ZA 5FHQA 5BSHA 1PLLA 1QIIA 1OUMA 5JS6A 1ZH8A 4O1IA 4FW8A 4M1YA 1KZYC 2WU3A 4H7EA 4TL8A 3UFBA 4OP3A 4IRUB 1WUKS 4IHAA 4TWAA 4BY9E 1IJKA 1GZHB 3HGMA 1TQ8A 2P9QA 4UTPA 1RYNA 4YN3A 4DPKA 3NFRA 4QNNA 1YB4A 3NFYA 5K8UA 2KB0A 3CN7A 4WOKA 3R7FA 3WYDA 4ALIA 3HL0A 1ZGCA 4FZRA 3A2MA 4RKQA 3L6CA 3MWLA 4CT4B 4MAAA 2PMEA 2QRMA 1VE7A 4CKCA 2P6MA 4N76A 4G09A 2VJNA 4N7MA 2PUFA 3ZZTA 1VIYA 3MCWA 1HE1C 2Q9UA 1J22A 3RADC 1LI7A 2PSDA 4BYMA 1PK9A 1UZLA 3EVGA 2YMLA 1FEZA 1HF3A 4B6RA 5KTMA 1VHWA 2B20A 2C42A 4L4XA 4IRXA 4QT4A 5FA5A 4IOLA 4AK9A 4EHNA 4EO4A 2HU5A 1GRVA 3NCHA 3U5ZB 3TL3A 1QHHB 3GYGA 4KEAA 3JQ9C 4RHXA 2NZJA 2IZOA 1Z4NA 3IFSA 1DLJA 1UMDB 5JWHA 5REQB 2C9CA 1ZEJA 2I4TA 2V7XA 4WZBE 5G0VA 3DLPX 5JAQA 1S8FA 1UKVY 1C7ZA 1BGVA 5CNJA 1NW4A 2EC5A 2RGCA 1E3JA 1GZ4A 2VF4X 3MAJA 4IH4A 3NEYA 4P35A 1YR3A 3AV3A 3L6RA 4QOHA 4LZJA 2X8LA 2C5HA 2GM4A 5E6SB 1ORRA 3VVLA 4CTKA 1QH0A 4I4TF 1M2NA 2D62A 1OFIA 1U3CA 1YL5A 2LNDA 2PIDA 4WK6A 1DJPA 4YRLA 5TE9A 1RXUA 1ZUWA 2AL7A 3EDYA 3RU7A 1V5GA 3ROXA 1I4LD 1Y8QB 2FQXA 2BBWA 4WA7A 1NC3A 3LGXA 4N9WA 7AT1A 1XGKA 3EAQA 5F64A 1I4WA 3NIDB 4C4AA 4MV6A 5KTTA 5L3VA 1J0XO 1NDQA 3HB5X 1UPBA 5CGQB 3V4VB 3RW9A 1PT5A 2OILA 5TIIA 4QHTA 2HU2A 2NUPA 1PGOA 1VOTA 2QRVA 2GAAA 3H9QA 1WCV1 5BXYA 4K0RA 3SQXA 3K31A 4GLOA 4N6GA 1R0LA 2D2FA 2WPNA 3VISA 5IJ9A 5F1PA 4BFLA 4Q4JA 1JSCA 4EAQA 4JYCA 1BKDR 3UYKA 2WLSA 4ZVPA 4QSMA 2OP0A 4BTVA 3NONA 3TR5A 4C03A 1NP7A 2PQ6A 3HCEA 1KEPA 1CS0A 3C1AA 4K05A 2MU1A 4TYMA 2Y9PB 5J4LA 4DM7A 4DDWA 4WAUA 3KVVA 1WB5A 5HDBB 2Y77A 1U7UA 1XYYA 1NV8A 3UGQA 2PUAA 1YJBA 4IHJA 1ULAA 1G4UR 2Z5FA 4O0LA 2JI9A 3AM1A 3G8BA 3C45A 4G0ZA 1FDOA 1DBQA 4MI6A 3OZ7A 3BCUA 1KNXA 3AILA 4H1UA 5EZYB 1SVNA 4OV6B 3A7DA 3HU2A 1N32B 2VJKA 3UAZA 1QG4A 1QHSA 3BB1A 4LXXA 4DC0A 4OHVA 1QZXA 3F6PA 3FYDA 4PAMA 2YY7A 1AG9A 3AL3A 3UJNA 3AY6A 4BL5A 4EABA 3EC1A 1W4RA 1T26A 5JI2E 2WRZA 1E1DA 3FMOB 3F5MA 5HQJA 3LCMA 3EEBA 3D6AA 1IL0A 4O1MA 1R0KA 3E84A 1SN7A 5FUBA 1MQSA 3HZHA 3IMCA 3OIUA 2WR8A 3L5OA 4JMLA 5K8LA 3R0JA 3U7QA 4J16C 4ZMRA 3PTAA 3K70C 2YJTD 2BZ1A 1BE8A 4AXBA 4RWEA 1LC0A 1NNLA 3BDIA 3NEPX 3D7RA 4ZQFA 5KC9A 4US0R 3CKYA 1VCOA 1JQBA 3WGKA 1Q3HA 3HNPA 4OXYA 4FFOA 5CP8A 1MAUA 3I5YA 1GZ6A 3EXG2 3AVWA 2O3SA 5ECYA 3M33A 1SQ0A 3ZZ0A 1GAQA 2C2MA 2R0QC 4A4DA 3I9KA 1W48A 1DQRA 2Q1UA 3WZMA 2Q99A 1ONBA 5TS2A 1QE0A 3G59A 3O47A 1TMYA 1VMKA 2QW1A 3ZQKA 2EX1A 2AI3A 2RH5A 4D3FA 4XLLA 2DGDA 3H2YA 1ZA1A 1T2NA 2ISSD 4OAPA 4UPVA 2X0RA 5A3SA 3VHQA 4Z9BA 1T2EA 3FUVA 3A14A 2CLSA 3EDCA 4WKCA 4K88A 5IK2A 1MBZA 1HYEA 2CK3A 1QUFA 1SOUA 4NATA 5GTDA 1G41A 1QQ6A 3LRTA 4I1IA 4QWMA 2G6TA 2YJGA 1BHJA 3H2HA 3KEOA 2QGZA 3NM6B 2ACVA 3NNNA 1OB2A 1RJ9B 3GLVA 1RQ7A 3WS7A 3U7IA 4D8YA 3LHIA 3AKZA 1XTUA 1L3CA 3W4KA 5HP4A 2ZR9A 2WLTA 4MEBA 3O26A 2YHAA 3SFVA 1RI5A 5G4KB 1BRTA 1DKUA 1OAOC 3DJFA 3GJXC 4I4LA 4JN6B 4XFDA 2NAFA 5FBLB 2WFLA 5IZCA 1M0SA 2SICE 3HDJA 5C8YF 1ZITA 2DAPA 1QBGA 3EMBA 2VUHB 3NTXA 3AR6A 4OQYA 2WNHA 4B82A 1VSVA 1EDOA 4M0UA 1GNLA 2VT6A 5DT9A 5FL7A 5CVTA 3WLJA 3TNDA 3DO8A 4UE2A 3SR0A 4AULA 4E6PA 3EPLA 2NP6A 3A37A 4DDHA 4YP0A 2Z83A 4HSGA 4G0QA 2XUGA 2INGX 2AX3A 4EPWA 1WY5A 1HL7A 3PUYA 1BHQ1 1NBWB 2V7VA 3I37X 3OIFA 4UPDA 4WNIA 3W2HA 1CEYA 2VJDA 2ZRAA 3OPYA 4M9XA 5DGCA 5JE8A 1W7AA 2W6MA 3NC0C 1N8SA 1A71A 1YIOA 2B5WA 1I2BA 4JI2B 2FPWA 4I1SA 2IWRA 1QG0A 3CRNA 1IDOA 2HYDA 1YL6A 5DW3A 3RV3A 1A9YA 4MWTA 5AI8A 1QC5B 2DLCX 4YCLA 2GEDA 3GAAA 4I5IA 4MLPA 5GONB 4PC2A 4GL4A 1E9EA 3LIIA 4O02B 3U48A 3GA7A 4IWNA 3HY4A 4GHWA 1ONOA 4U6SA 3KQOA 2KE5A 4BN4A 1XQXA 1Y8AA 2Q3EA 1AM4D 2WHRA 2Y4OA 4PHHA 4KX5A 1Z37A 1YULA 3A4IA 3DOIA 4YPFA 3GLFE 2WWXA 3FGOA 2VQFB 3K9QO 3CJTA 3ULKA 2JG3A 4X90A 5A9SB 2EKBA 1U98A 1U0LA 2O1EA 1FDRA 9GPBA 3LO8A 2HNKA 4HDRA 4P32A 4HGNA 3TBHA 1X1EA 2X8WA 3FF1A 3FM9A 3EHDA 2ZXEA 3ELWA 4J7CA 1VMIA 4KX3A 3U61B 1UMBA 1W36D 1CRPA 1ZIYA 2A9JA 3A06A 4UUAA 2C7PA 1Z7EA 2GSDA 1E9SA 3TLYA 4PLVA 2K87A 2PGDA 4ZDKA 4B74A 3RANA 1I3NA 1SBHA 3G82C 2H2AA 4B3SB 4GXTA 4HT3B 5MN5A 4FQ8A 1KWKA 1RP1A 2Q5QA 2PCJA 2PLNA 2BI4A 1GUDA 1KPIA 2XVXA 3B9RA 2VCYA 4OF4A 5EJ4A 2IDJA 1PJ8A 2XF8A 1JS1X 3KO8A 3SBOA 1IJFA 3QXCA 1E3DA 4MW5A 3T54A 4ZCSA 4AJLA 4DGQA 4LKOA 13PKA 4OXIA 3GN1A 3C1UA 5B64A 1GGNA 3LLCA 4IR7A 4JLVA 1E59A 3SJZA 2W8BB 5KOJB 2BJWA 2VQ3A 3WHIA 3CW9A 4YQZA 2CEAA 4G3XA 1FLVA 4NS1A 2XIJA 2DOKA 5F9MA 3WKCA 3WYFA 2QNBA 5JJ5A 3D5QA 1FQWA 2QMUA 4YDRA 4LE2A 2DPHA 3C48A 4ERXA 2WYOA 3C3BA 4RA6A 4LFCB 4PFKA 3TEFA 5KYYB 2WYVA 2XIQA 2I80A 3CINA 5HEKA 3WRVA 3D3QA 1OWMA 1JKJB 5HCNA 4D0GA 1WHSB 3RS5A 2D4HA 3M7IA 3ZG6A 1MHTA 1P0MA 2X7HA 3A9WA 1LK7A 3H5OA 3FTPA 4DIKA 7MHTA 1NT4A 2I9KA 1KK2A 1VKRA 1NV9A 4KC0A 3R23A 4GKAA 3GT7A 4L6AA 4L9RA 3H8VA 2UZ4A 5EWLB 2B92A 1UQUA 1YE3A 4NPAA 3ESAA 4GLLA 2X8AA 1U0HC 3DT6A 3EZLA 2BM9A 5JZVA 3HBMA 4CT5A 1K6JA 4EFNA 3IBYA 2XCLA 1QIFA 3K7EA 1SELA 1ZINA 3U13A 3V4SA 3S27A 5LYJA 3NBAA 1Z7YA 3FROA 5DOZA 5IASA 1OFUA 3HB7A 4MVJE 1QG6A 2NO5A 1AKEA 4JITA 5TMDA 3SYMA 1TI7A 1OIXA 2WVAA 4Q1EA 2BEVA 1FP7A 2WFAA 4U5XA 4UMEA 1SKUA 3ZW7A 2ORED 5G40A 4CVNA 3U09A 3Q8XB 4CKWA 2BZGA 4DQVA 1YFLA 3CH4B 2Y1GA 3D8SA 4J16A 3VOBA 3VBEA 1CYEA 2DZDA 3O4JA 5K9ZA 1E4OA 2F1RA 2PH5A 3CRZA 3GRFA 3BF7A 3HKEB 4OEHA 2J45A 2ZP1A 3D1VA 3QUTA 1DC6A 4LBZA 3BMCB 3OOWA 1RAAA 2Y1XA 1COZA 1MX1A 2HRRA 4KYUA 5G2OA 3CNEA 1AS2A 1MXFA 1I6KA 4OP2A 4NENB 2QTGA 3CZAA 1ZQ9A 3IPLA 3OJCA 4O2RA 4X7PA 4Q3LA 3JWEA 1WZ2A 4J0FA 1U0NA 2MYTA 4E5VA 2PGAA 4NC9A 2OLJA 3WHKA 3QKUA 5BV0A 2BM1A 5JNTA 3ZDBA 1EAMA 2I1LA 1GKUB 1JZQA 3AV0B 4JJGA 3R0ZA 1N7IA 1X70A 3O8DA 3Q8WA 4PYKA 4FVTA 3ABRB 3O93A 5G53C 1JNYA 4XWOA 4BPBA 5CIWA 3HWSA 2C61A 3ZTTA 4L0MA 2GI4A 5DPMA 4DUYB 1SBZA 3W7BA 2YWHA 2J8ZA 2GVZC 3ITNA 3JQRA 4IL5A 3UKOA 4MKXA 2DB3A 4EK9A 4J94A 4QPNA 1EA7A 2EWMA 2WW8A 3S81A 2I3DA 2EJWA 4OKNA 2HLDD 3EVNA 5CB4F 1W76A 4J43A 2P40A 5IC6A 3W5VA 4MB0A 5B57C 5JI3E 2R6AA 4D8VA 6REQA 4EG5A 2H1WA 1FFEA 2C98A 2G8NA 1T9KA 4PVCA 4WGFA 2WD7A 2Q4EA 1CQIA 3ZI7A 2PQMA 5AYVA 2ZQZA 2G9VA 4UULA 3F90A 2QZ4A 3RYIA 3DFFA 1ZJZA 2A6PA 3SZ3A 3FNRA 1IN4A 1G1AA 3PGJA 4B7UA 5ERXA 3E22B 1XD2B 3LK7A 2R7KA 2QY9A 1GZ3A 1RBMA 2YASA 3CZMA 3MMPA 3NIFB 3KT6A 2JLSA 4UNRA 4LYYA 2FVXA 3COPA 3D6TB 3DHYA 4H7KA 2VP0A 4RGVA 2CFCA 5EP2A 3R9KA 1BXGA 1MW8X 4D4HA 3O3OB 1YS2X 4AU1A 2O0LA 5AK0A 3DHWC 2CCKA 1HYQA 3L92A 3UUFA 4LJ7A 4QBHA 1D04A 2PPVA 4HNGA 2E4UA 3K5HA 3U26A 2D8AA 5C35A 4LFAB 4C7KA 4PY2A 2CDBA 4XVQA 4NOKA 1AGXA 1OMOA 3DPIA 3H5VA 1AQUA 4DV4B 3O4VA 2WWFA 4RVSA 4TVOA 5K4HA 5AVSA 4F4IA 4LHVA 1GPWB 1Q19A 1TGYA 2FDRA 3DEAA 1SNYA 5DYGA 5C3UA 2GN9A 3EW9A 3P9PA 4M8NE 4XIYA 3X1JA 2DWOA 2WUDA 2ZE7A 5CM9C 4YROA 2V96A 3CLKA 1SH7A 1NLMA 1PS0A 4JEIA 4QOSA 1Z4LA 1J0DA 1XTPA 2FFBA 5DHRA 1K8XB 4BE4A 1C9NA 1UH5A 3CG0A 3PDUA 2IZ7A 4Q6WA 3DSRA 3N8HA 1Z4IA 4AJNA 1GTSA 3C3XA 3EGXA 1CCWA 1OTYA 1GYRA 2IXGA 3GOQA 3KJQA 1U1EA 2VN8A 4H7JA 5DCLA 4QU0A 5ALUA 2PM8A 3ZVMA 1ZJWA 1EX9A 4MJXA 1X9HA 4GX2A 1L7QA 4L0QA 3D4LA 3DV9A 4IM7A 9MHTA 4GD3Q 5H0IA 2ZW9A 3MJFA 1R88A 4Z54A 5A3VA 1MO2A 1ZJ4A 2X0IA 2GNOA 4J0IA 3OFND 4LJ6A 4PRZA 3A9SA 4UU0A 2HI0A 4DA7A 5DMXA 4RJJA 1Z0IA 3I2HA 4C6RA 3E9DA 3UJ6A 3EC7A 3PRJA 1P17A 1ZM7A 4AP9A 5DO9A 1MC8A 1GZUA 2PGOA 3CRMA 4GBGA 4LYDA 1H2EA 1JW9B 3UXHA 2BTQA 3PPYA 4WCFC 3EIQA 4R2XA 1KQ3A 1SVWA 3B3QA 3FVQA 2YDXA 3U3ZA 4D25A 5B30A 5HDQA 4IDAA 2QRUA 2AN1A 1EK2A 1GTG1 1FP4B 3ND5A 2G9QA 1HZZA 1RLIA 1LLQA 2HFKA 3KDAA 4LISA 3ST7A 1IY1A 2F64A 1OX4A 3GEPA 3W8FA 5BWMA 2VHTA 3QIAA 5DULA 2M1XA 2W00A 1M54A 4E3ZA 2CNWA 3QKRB 4OATA 1R15A 3W9SA 2J09A 5IVKA 2C5SA 4PYRA 4QQKA 1YSCA 4UHEA 5JJBA 4KUGA 1RHMA 3IP6A 4MRMA 3EZ6A 4FGLA 3GAFA 3U9SA 2DEUA 2J9RA 2EW2A 3WFIA 1CVIA 1H65A 2ZBPA 4JVNA 2G09A 4D6PA 3CUTA 2G0AA 1VRWA 1YIAA 2FFAA 5K3EA 1HT3A 4LMAA 5DYNA 4GMXA 1Z4JA 4ID9A 1Y3HA 4KHZA 4R54A 5LM3A 2AFHA 121PA 3U6KA 3B82A 1FVOA 3IO5A 3I6YA 2VWHA 3G8DA 1R5OA 3DUWA 2ZG6A 4IDPA 4RPIA 1KGDA 3C4VA 1JPJA 4FB5A 1WD5A 3NNSA 5LZ8A 4JY7A 3FHJA 2D1SA 3QGMA 1C8BA 3B6IA 2BBOA 2IEDA 5EINA 4D7AA 3TAXA 2JH9A 2AZMA 1Y9JA 4NDAA 3IBSA 1BVRA 4F6CA 2X5XA 5TPWA 3RUFA 1VKJA 4X91A 5A4FS 5IKPA 2EZ9A 1UXGA 5KQMA 1WL8A 5CVCA 2BGNA 1I0LA 1D6SA 1YRBA 4L51A 3RR2A 4AG3A 1QO7A 5G3ZA 4OB8A 2X2PA 1Z6PA 1F5NA 5B12A 1V8PA 3FPGA 3H9UA 1T5DX 4JQCA 1PEAA 1AKMA 1OVMA 2QTRA 2CNNA 3DZJA 2Q1TA 2GD6A 5AK4A 5I9LA 1AVTA 1IUNA 1LBQA 2VF2A 4K9SA 4YAJA 4KDRA 5CVVA 3DMRA 4BMPB 5CBPB 1JJBA 4XZ3A 5C1BA 4RDIA 3BBLA 4PYLA 4R98A 2EV9A 1DFHA 3PL1A 4NPHA 4AN4A 4BX9A 4EGAA 2D7DA 2YBDA 2ZR8A 1RMYA 2GM5A 1NW8A 3IPCA 3RAPR 3U3KA 4G0WA 3C8ZA 4RW0A 2VJYA 2PT6A 3PP8A 1P5FA 1GTMA 4YP5A 3T7KA 2CY0A 1O95C 2B0CA 4F60A 4D4LA 4DR7B 1GQQA 1CS4C 2X3UA 2ZIXB 3NTOA 3QBVA 3C3DA 4B3FX 3QE9Y 1IBSA 3BIWA 3O7WA 3DDUA 3GU3A 1XL1A 1TKAA 3RS3A 4JIMA 2ZVPX 1ZDMA 2ZUVA 3H1FA 3ZS9A 1XNHA 4EB0A 4CF7A 1Z82A 1FZQA 1NN5A 2R6GA 3QVWA 4YY3B 2JI8A 5D1NA 3OSZA 3VOAA 3G9TA 5A9RA 2AF4C 1OR8A 3IYLW 4HDCA 1ZIPA 4HYYA 4NRDA 2VDWB 4MP8A 2PMBA 3SG0A 5E3HA 5AM5A 1EINA 1BU8A 3CIOA 2YN0A 5TS3A 4RK7A 3QVVA 1FE8A 1ZRNA 1R8YA 4TXLA 2QVCA 3UK7A 3K8YA 4LGVA 1Q0PA 2VTVA 4NCXA 4P7FA 4UBMA 3AZPA 4OY3A 2X0EA 3T0FA 2GYWA 4Z3DA 4E51A 5LWHA 2QV7A 1TTPB 4U6NA 1AK9A 3K0BA 5AICA 1C1DA 1IZ8A 1HZJA 1AK1A 3BPSA 3LPMA 4JVMA 1M8PA 1P75A 4YJ3F 3PB3A 1EB8A 1GARA 1PFQA 2FUG1 1OLSA 1TZBA 1B3RA 2VPIA 4LHSA 4NBWA 5KDLA 3RAEC 2VHQA 3EWIA 4XX0B 2VRCD 4F71A 3QPUA 4N40A 2CJYA 2W48A 3GJ5A 3COJA 4MVXA 1TUGA 1JLRA 2H3EA 1CIJA 4HGOA 3WLEA 5F1KA 4B47A 3FGPA 3FUWA 1NJ1A 2HQBA 2B82A 3Q41A 3N2LA 1D5WA 1ZK3A 4BB6A 3PPWA 4DG8A 1RC8A 4IDFA 5IC5A 4K6MA 2X7XA 3IT0A 4TM7A 2AXEA 1NXQA 1YDGA 3RS4A 4FXPA 1ZM3A 4EO7A 2OHJA 2B3TA 1T6YA 1Z2CA 4RD2A 1BHO1 3IAXA 1JNXX 1SHTX 1Y34E 4GOXA 2W90A 3D7NA 3MCUA 4NEGA 1L7MA 2H51A 1G5PA 4N3BA 2PNFA 521PA 1F48A 1XU7A 4BLOA 5GAJA 3HJCA 2QG9A 1ODCA 1ZG3A 2LV8A 3GFOA 4XEUA 3STXA 2Y0EA 3RSQA 4D44A 4PN7A 5A5FA 4YO7A 3O8CA 2WHQA 3H7AA 4UTOA 1GG2A 4R8RA 3PC3A 2OHOA 3KSAC 4RE6A 1JDBB 3S55A 3JYPA 4MYRA 3DR3A 4Y6RA 1R12A 3EW7A 4KO3S 3HABA 2REQB 3I64A 2HWXA 5BN3B 5C8DA 3A1EA 5DBIA 1EUZA 3DUFB 3GC6A 3IXLA 3VH4A 2P5UA 1PR6A 4DAOA 4PZ0A 2PJDA 2Y1OA 1BD3A 2J4CA 1NM5C 1O6BA 2GEUA 3GJRA 4FC6A 2DHQA 3EXFB 1ID8A 1MENA 3OX2A 3G68A 4ASUA 2DUJA 3KCNA 4X1IA 4INOA 2QS9A 1EUYA 2FW7A 4WCFA 1XNQB 4J9VA 2IDMA 1EE1A 1U2ZA 4RQBA 1G8YA 3HJRA 1JB1A 3PXBA 3HGQA 4R2KA 3V4ZA 3JVDA 3ZWOA 2UZ1A 2QRQA 5EPOA 1XPOA 1ZIOA 2AEJA 1PT9A 2YVUA 3EFOA 1YJCA 4YMLA 1H6CA 1U3WA 1H2ZA 2CLHB 5A05A 4TS4A 2ZZMA 3A1DA 1MDFA 3E9RA 4W7HA 1HFKA 1THZA 2OSVA 2SCUB 3SE0A 4DLNA 2OY0A 2QD4A 3H7IA 3JWIA 4FOTA 4NAUA 4QUJA 4ZQEA 1Z25A 4ZVKA 5AW5A 6YASA 2IH2A 5FPHA 4IGAA 2B9EA 3VJRA 4MUBA 1H3FA 1LX7A 1YR9A 3VKHA 3U44A 3AUSA 1HDIA 1D03A 1LDNA 1LPMA 1NPYA 3H75A 4L0DA 5DM2A 3T3PB 2BIFA 3Q1KA 1KGSA 2YXNA 2X6QA 4EKEA 3ZD7A 3DYBA 3DZFA 3PDIA 2JBWA 1ESZA 1D4AA 3CNOA 1Y9AA 4MPRA 5JZBA 1VJ5A 1RZVA 1FXWA 2P11A 5C0OE 1XE3A 4NG4A 1J2YA 2Y6VA 1CVLA 1U1GA 4MYCA 4B4UA 1KP9A 2XT6A 4MW1A 1NVTA 1RTTA 2QIOA 2KBFA 3FPLA 1ESNA 3KL4A 2WVGA 2XQFA 3QVOA 4GGOA 5CVDA 3OT1A 3ZQ6A 2O3UA 2VYFA 3SXUB 2DUUA 5HKAA 4L7VA 5FTLA 4R9SA 2AN9A 2LZ0A 2YJ5A 2X5JO 4RIEA 5BSRA 3F4BA 4XYGA 3INTA 1JKFA 4TMWA 3KQKA 5DNVA 1MVOA 4OHOA 3OX4A 1CF9A 1NVMB 4EF6A 2XRYA 4I66A 1HRKA 2H54A 2PX5A 3AOEC 5JTTA 3GPLA 5FWDA 5I9SA 1QFZA 1MT3A 2C57A 3U7JA 4CU5A 5JMPA 1MZVA 5JS7A 2WWYA 3I5XA 1W0JA 2JLRA 4BQEA 1C1DB 1WPRA 1CE8A 4JD5A 1C30B 3IDFA 1V5EA 3IVCA 3QEBZ 1MAWA 1KYTA 2CJXA 4M0CA 5BNIA 3DDZX 5H1YA 3JPYA 3OZRA 1P4SA 4OAOA 4RJKA 5ITWA 1C1YA 3WGJA 3CVUA 3F6RA 1PTJA 2NO0A 1ULBA 5DBEX 2LPMA 2VPWA 2L17A 3AOEA 1OAAA 1WF3A 2QQ5A 4Z4GA 4EJ6A 3F9CA 2Y1KA 4OJQA 3PEUA 4QICA 3RAGA 4EF4A 2OFWA 4JH0A 1M1ZA 3B2QA 4I6JA 3VKFA 5FR1A 2VDUE 2ZJ8A 3NDIA 3FCOA 3KTDA 4YRMA 2HJHA 3FPCA 4RGBA 5EPUA 1TKRA 3BAZA 2QNRA 3MJSA 2FEMA 1G8JA 2YIMA 3HA7A 3HDTA 3PPIA 4O4LF 4V0KA 4MP3A 3HCCA 3ZDEA 3ICQB 2JBAA 5CXSA 4KNYA 1N7GA 3UKDA 4M21A 2E18A 3STUA 3P2OA 4YRNA 4CDMA 4A7PA 3IVAA 1HX7A 1Y6FA 4DR5B 2QRVB 1R8SA 2AK2A 5E3IA 1MAVA 2VNHA 4IHQA 3ZCTA 1EG7A 2YFQA 2AN3A 2HMUA 3CH6A 2KJQA 3E9NA 3W9BA 1WLYA 3MWDB 4C0BA 1TX4B 2I78A 1HKUA 3KJFA 2BFBA 4K2HA 4TM8A 5EZ6B 2RD2A 2OTCA 2DQYA 5TQ0B 1YBMA 2BEUB 4QARA 1N77A 4BC1A 2HQRA 3SYLA 4XWWA 2XCRB 5JCXA 3OCUA 5EXTA 2PRIA 3UBTA 1WB4A 4FYYA 1JE1A 3GMTA 1XZFA 3LXXA 3NV9A 4XUDA 5UKDA 5I48A 1H42A 3HA5A 4KO2S 4EDHA 3HKDB 1B6GA 4NDNE 1GQRA 1VMEA 3IA2A 4ND3A 1P7YA 4J0CA 4MMXB 2VQEB 3MVEA 2VBIA 1IQRA 5JSKA 2IPNA 3W2IA 1ZMXA 2C94A 3NB0A 1LSJA 2VI5A 3OLVA 4O5OA 3AUAA 4RFVA 4RKRA 4BB5A 4OQQA 4YMGA 2GZDA 3N58A 1ULTA 3SVLA 4BLWA 4YR9A 1QANA 2CVQA 3RRXA 2QAGC 3U19A 1NY6A 2XTZA 3IKLA 4HAZA 1EFVB 2ID4A 4IJVA 4OLHA 2D06A 3TNYA 4ZCIA 5ICGA 4UEKA 4W82A 3VDNB 5G4LA 3JQQA 5DYTA 5KHAA 3L46A 1DG1G 4ZT3A 3NIWA 1P4JA 3H13A 3CX3A 1YZKA 4HB0A 4R2HA 1YACA 4YMIA 4HUTA 3VI4B 2Y27A 1XALA 2ZATA 3JAWA 2R8EA 3C8HA 3LKVA 4D3SA 2WSBA 2PKQO 1T5HX 4QD3A 4V0SA 4X3CA 4B4VA 4RU1A 4W9MC 1C9KA 2H0AA 4FSDA 3S2YA 1GSIA 1ZXLA 4IMRA 3UWSA 2XCSB 3CKLA 3DW1X 4GM4A 2JZCA 2WDPA 2FFJA 3HG7A 1N0VC 1ZD3A 2XMDA 2ZUSA 3DVLA 1B41A 5BV1A 2I03A 3QSGA 1Q83A 1JYFA 3AZOA 1YKGA 3QU2A 3QBJA 1XA0A 1NVXQ 1VI6A 3FETA 3M82A 2XUKA 4LZWA 2DR2A 2QT1A 3E4DA 2XADA 3NP9A 2DLDA 6AT1A 5B58C 2NACA 3RU9A 1BX3A 1GPJA 4PX5A 2G36A 1XLTA 3FCUB 1D9ZA 1QHFA 1N6PA 3H8WA 3IPXA 3JQBC 4I5EA 1MFPA 4EPRA 3CUVA 4X44A 2GDZA 5C7LO 4AXXA 5ELLA 2ISCA 2WJIA 3K0HA 3JU3A 1KQFA 4ARIA 3K9LA 1KYIA 2GD1O 721PA 1NUUA 4LF4B 4OTZA 3DNMA 2JIBA 4FGWA 1BGXT 2WG0A 4LYJA 4JDPA 2I2XB 1XTTA 4JBLA 1IPEA 4NCIA 3L07A 4IIJB 4M1TA 1ACMA 4BWFB 3V8VA 5AI5A 2IT1A 3GRPA 3OEYA 3ZXUB 3FDZB 2YW2A 1G6OA 1YRHA 1E6MA 1P44A 3L01A 4YJ2F 2P6NA 4XVRA 3SFTA 3B12A 2X6TA 2M6KA 2IOQA 2JFFA 4OHYA 1OLOA 4X97A 5KX5A 2RH9B 3GT4A 4BP1A 4BMZA 1NMYA 1NN3A 2Q3HA 3B3FA 4GPIB 3QEMA 3RRYA 5B36A 2FPMA 3V6MA 3W5AA 1OXTA 3LXRA 2XWBF 1B6SA 4G01B 9LDBA 1A96A 3K4PA 3UUWA 1PSDA 4M6WA 3PNVA 2DT5A 2DPXA 3AJDA 3C3KA 3M9XA 5MF6A 5BUCA 3OF3A 3RC8A 1RMTA 4YRAA 5KDOA 1V2HE 1DRUA 1ZC4A 2AV6A 2IOFA 1DE0A 3FYUB 3NRBA 3R3SA 5C1IA 4DRXA 5AW6A 3U4QB 1PG0A 2DPLA 1CF4A 2QZZA 1QE3A 1EJ6A 1CULC 1G21E 3BIFA 4HZUA 2B78A 4TN1A 5CMLA 4YV0A 3N74A 3MBKA 2RMKA 1F5SA 4TKLA 3ZJYA 2AIRA 2B0JA 2PGNA 2ZJBA 4OYYA 4PYMA 3TZ6A 3H2BA 4CN9A 3E3MA 3IIEA 3U4HA 1XVLA 3Q7EA 2CXXA 4U3JA 1V8BA 1CUUA 3RVLA 3G2QA 4ZMSA 3OEEA 3GA5A 1N0HA 2Z8ZA 4K6FA 5F35A 5J4KA 3GRKA 4RV9A 1T0BA 4DYDA 5ALNA 1Z47A 2OQ2A 4WLFA 1U7TA 2FB9A 1XQ1A 1A9PA 1WS6A 2FW1A 2IEIA 5AJXA 3UGKA 4HQ6A 1JDTA 3AC0A 2LD4A 4AY4A 3M2PA 2IU4A 2BTOA 1DCKA 3G8CA 4RLSA 3CX4A 4ID3A 4OKSA 1NI4A 3BICA 5E9AA 3AONB 4D8XA 2FSFA 2VTEA 1KPHA 3HVRA 3FFBA 2VSNA 2OC4A 3G0GA 2C1ZA 2MSEB 5I8WA 3MRTA 5CPBA 2IA5A 1V3UA 1XYVA 5EKXA 3GRCA 5IX8A 2QUJA 1U3GA 3E6AA 4OK5A 1G5RA 3HTXA 3ORYA 4JKYA 5CB4B 1JKIA 4EYSA 3TDKA 2A9PA 4U5QA 1NT2A 3B7PA 3JALA 3RYIB 5MHTA 3KE8A 3WGNA 4ZREA 5JY1A 4Q05A 3NBQA 5AJYA 5J1TB 2RHTA 2X8JA 5H7XA 4JROA 2ZCJA 3K70D 2PSEA 4D9NA 1K8QA 1JR3E 1G5FA 4U0JA 4E22A 1R0SA 2QL9A 4DKXA 1Q17A 1V9SA 4B3GA 3D2BA 2Q5JA 2UVDA 1Z3IX 4YASA 4XUEA 2HHCA 4B71A 1U7WA 2OBFA 4PBSA 5IHXA 2D1FA 2OCDA 3FE2A 1YC5A 2JEYA 2XZLA 5JXJA 2JFQA 1UK9A 4HRVA 1IWBB 4AY5A 3CYFA 2W2XA 2WM9B 4PAOA 4TRNA 4CIAA 1V1MA 1Z45A 3TG8A 2GK3A 1PD1A 5ALOA 3Q3HA 3ZEAA 1VA4A 2RBGA 1AKYA 1LRJA 3G49A 4JV5B 3NHWA 4A8JC 1C8VB 3TK1A 1Z7WA 1WXHA 1ML4A 1OWLA 1V45E 2GD2A 2VHXA 3AR2A 1DIGA 3JQAD 1BMQA 3LRPA 3ND9A 1OD6A 3ES9A 3AF2A 4ND7A 3RLIA 2HHHB 1PW5A 3SHWA 4EDFA 1JG7A 4RVDA 3FDIA 4N48A 3NATA 2TMGA 4BAZA 1KTVA 5L3SB 2IHTA 1X7GA 3MT7A 2EJVA 3BL5A 4XXHA 3IOBA 5F78A 3TG2A 2IHNA 5LKAA 1TAHA 1J56A 3ZY5A 2FCAA 4A0HA 3QUCA 4DIMA 4TZ0A 1F0KA 3LUFA 1QVWA 2NW6A 2Z9CA 2ATXA 2CFRA 5KTNA 3ZVRA 1PGPA 3AVVA 1JILA 3AUTA 3R7AA 4DCPA 1Z74A 4ATNA 4B3JA 2ZZKA 4KPUA 3HVJA 1SHLA 2VZ0A 4I9GA 4ZDJA 5L8VA 3WI7A 5FBZA 3UMFA 4Q1BA 4OI0A 3SAJA 2Q46A 2GJ9A 1U8AA 3PGVA 4Z4CA 4LYHA 4Y2PA 4JA2A 5IWAB 3BE8A 1SCKA 4IIJA 1VLLA 1U0FA 4GC5A 1JJIA 4OLFA 5IJZA 4C5AA 3PR2B 1URPA 3SM9A 2APJA 3EGWA 3JRNA 1N5IA 4BNZA 1HFWA 1MB9A 3NT4A 2BCJQ 4YR7A 4YMTA 1JSZA 4TWIA 1OF1A 2BM0A 3ORQA 5IDQA 2JFVA 2Q2WA 2R4TA 1HE5A 1T9BA 3SICE 4R9NA 1M1UA 3LNTA 3TD6A 5BNZA 3VPAA 4GBMA 4C7OB 2F9LA 1DWQA 4A0FA 1OAKA 4NFYA 5FBKA 3BWEA 5T3YA 1G60A 2HA6A 4ZGWA 1T2UA 5JADA 1Y5NA 3L1UA 3EZGA 2IIQA 3OIYA 3WFJA 2GN8A 4MV1A 5JV5A 1B23P 2G82A 3H97A 3K1YA 2V3VA 2IZZA 3QBTA 4ZDWA 2IU3A 2HIMA 4QGSA 6ABPA 2BUCA 5EUBA 4LV5B 3CNQS 3QX3A 2BEWA 3D7KA 3VXKA 1U4NA 3KELA 4J0KA 1GUBA 3H8SA 4L2IB 3PFCA 2P5YA 5DTIA 3NBFA 4EI7A 2ZBEA 1TIBA 3MT0A 3PDCA 4ALMA 3PGLA 2W8BA 4MUIA 5KOJA 4PSVA 1I2CA 4QYSA 4QLBA 4ZODA 4LYGA 6GPBA 2FUG6 1MQ8B 1TVKA 4QO8A 1BCRA 2B5VA 1HLDA 2HXSA 3OJOA 2OXIA 3OMLA 1KH2A 1VMAA 3T35A 1R9GA 3DOCA 3REGA 4CKEA 4E0BA 4E3WA 4NCAA 1CVRA 1PUXA 2NU8B 2Y71A 1RJEA 1B73A 4DCJA 4ENTA 2Q0HA 1EHCA 1B42A 3TEMA 4DXAA 1XRSB 5DM4A 1QTRA 1GGEA 1W6UA 2WMYA 3Q3EA 5J4HA 1YIDA 4HXYA 3KQLA 1LD3A 2VYQA 1O03A 2ZT8A 1D1PA 5L7YA 3I5AA 3W90A 1GCGA 4HKTA 4Y7CA 3WRYA 2YQ4A 4URVR 4BGDA 4U39A 4Y2UA 3RIYA 4MV3A 3JQGB 3WL6A 3IKTA 2YZNA 4OHZA 2N0SA 1P19A 1W36C 2QXTA 3IE0A 1ZICA 2FZGA 4ZQIA 2JASA 2C9YA 1A9XB 2CV0A 1P9OA 3D1JA 3KKNA 1E2LA 1JLHA 4MWSA 2ZREA 1E1YA 2BEUA 2Q6LA 3OJFA 4CLXA 3LE8A 1PFUA 1MRSA 2G1KA 1DTWB 4RAOA 3G0BA 1PL7A 5FL7D 3GLHA 4OUDB 2GZAA 2WZBA 1IOVA 1KZGB 2G5TA 3H9GA 1R6UA 1GSOA 1VSQA 3H2GA 3AUFA 2GERA 4GUAA 3U9TA 3NDJA 5H4GA 3KJNA 4KYTA 1DOHA 4XB1A 3HWRA 4RMHA 5GONA 1TTHA 4LUCA 5BUSA 3TQRA 1ZD1A 1GDHA 1W4AA 2QI9F 3M89A 3Q11A 4R3WA 1T5LA 2QAGA 1GQOA 3OLCX 4MR8A 1N6NA 1ZGBA 3GELA 4LAFA 1MPTA 5ADHA 5IS2A 4Q3CA 3SQLA 5HR5A 4I5FA 1MN6A 2CVPA 4RTOA 3BXGA 3TIFA 4ENUA 2XYQA 1H3EA 4UM7A 5K3BA 2J9FA 2QSJA 4ZIRB 2VQSA 4EFDA 1XXHE 4X0EA 2RGGA 4CGZA 2W22A 2ZI4A 1ISHA 4N39A 2VRBA 1H8EA 3D2CA 3IP7A 1P5HA 1FX0B 4KPYA 1I3KA 4J03A 4HTFB 4Q3OA 1W75A 2GN6A 2GHQA 5I47A 5H3LA 2OOKA 3RHFA 4CF5A 4LBVA 4ZYXA 1KI9A 5I4KA 3RSZA 1QFJA 2H92A 2L0XA 3ROMA 4GNRA 2QRHA 2IHVA 3CUYA 3LC0A 3D59A 4ZP1A 5KTSA 2CV1A 1QFSA 2RGEA 4HDNB 5FRDA 1QAMA 1KXZA 2F3UA 3N8GA 4DS3A 1U5AA 2GO7A 1S5PA 5AOAA 1WCYA 5D6OA 3S28A 3TSYA 3IP3A 3VHLB 3ET5A 1ZSVA 5I7WA 4RTSA 2VHJA 5HYVA 2AG5A 2OWDA 5CFZA 1E1NA 3HYSA 4FEGA 4M1MA 5E6SA 5LFAA 2J0UA 4URUR 4N8SA 3B1XA 3EJWA 1PYGA 3KRTA 4OHWA 1ORHA 4C29A 1MB0A 1J2TA 2X9QA 5BY2A 5IDXA 5FP0A 3INRA 3UXEA 2H1RA 5A3RA 4RWZA 3LQ1A 1N1MA 1N2GA 4DY4A 3D3WA 1BMFD 1K66A 1FJHA 2F3SA 4WY8A 1ZH6A 3ICVA 3EGEA 3PUWA 1L5KA 3VNAA 1C0KA 1GGKA 3OE1A 4BP9A 5KYWB 4GFDA 3OETA 3GLGB 5JS1A 3SJ7A 3B9PA 2P6PA 3VM6A 3MGBA 4DWJA 1JI3A 4E31A 1BCRB 1AGRA 3BB4A 3WL5A 5FPTA 4Q01A 4D81A 3D8NA 4CW7A 5LCXA 4Z2YA 3SF8B 2DQ4A 1HV8A 4ZT5A 1NQVA 4X66B 4BMOB 3DPUA 1DXOA 1F14A 1XOIA 4RD4A 2XWQA 5BSGA 2IV3A 3UANA 2WICA 2X19A 2YV3A 3B38A 4RD1A 3U4DA 2J3DA 1YQDA 4V38A 4IXTA 3LWBA 2BELA 1VJTA 4BQFA 1NMXA 3GPCA 1XVTA 1O97D 3GV0A 4FE3A 4H3KB 1SKBA 2Z1DA 3QQ5A 1HDEA 4JKOA 4V0NA 5FLKA 1QAOA 3LA6A 1IZ0A 3H16A 4LDJA 5IW8A 3W5JA 5KNBD 4JWTA 2VTBB 4JKIA 4XIJA 3C5EA 3UTCA 1OGIA 4PRKA 4QX6A 3TW8A 5FQOA 4DVJA 2P2SA 1IK4A 3ZDDA 1T5OA 4GL2A 2O8DB 4FGZA 3ZWWA 2B36A 2B4AA 3M83A 2FEWB 2YX1A 3N87A 1CQJB 3LC1O 5F2KA 5IXJA 1DC3A 1LTHR 4C4SA 4B7ZA 2Z4SA 4PCUA 4DRZA 3ABIA 5I5EA 1RW4A 1JJAA 2B21A 2L18A 2YDYA 3RS2A 1IN5A 2A8YA 4UNPA 1Y3BE 4P34A 1CG6A 4HNAA 4X20A 5BYBA 2C77A 3IEKA 4QOJA 3J7TA 1XNGA 2GPNA 4H0FA 1C9YA 3L93A 1RAFA 1L5WA 3ESBA 3B9QA 3RYCB 2CUNA 1X8XA 2MSCB 3I5MA 2UZ3A 4GQAA 1S2LA 3OZEA 4ANFA 4XM2A 2J3HA 1NWHA 1ONSA 4ZEOA 4NL4H 2PH3A 5D3MA 5H59A 1K6XA 1NLUA 4AUEA 3H18A 3ANXA 3BQNB 1QX3A 1MPXA 4ZAVA 1UJ2A 4MR8B 5BRNA 1G6Q1 4ARVA 3R6WA 1T6ZA 2VTKA 1L7OA 3GBSA 3W5UA 2ZR0A 3WYCA 3BTOA 4URHA 1QAQA 3ILYA 4F4DA 3JQ8B 1G3RA 1J7KA 1ENPA 2GAOA 2A92A 3SDSA 4F5DA 1BGWA 4I50A 4COKA 1EFKA 2RGBA 3ELDA 3IAHA 1U3VA 1KRWA 1P2FA 1UQRA 2BMJA 2OQRA 3HB4X 1Y3CE 3LT5A 4CIBA 1SVUA 2F8MA 4I5GA 5HOEA 1ICEA 3CB2A 4QRIA 1ADFA 1VYUA 1YHNA 2G88A 3KKZA 4FYMA 3G9XA 4M9RA 4Y8VA 3X1YA 1U8UA 3PWTA 3ZHXA 4EB8A 1DAKA 2VP6A 5AW7A 2HQSA 4IKOA 4R7GA 1G3IA 5IAJA 3INNA 4ND5A 4YLYA 1D07A 3VR4D 1L5ZA 4CG3A 1RIIA 3NM5A 4EY6A 5HMMA 1FXSA 1W4ZA 1OLSB 2EKPA 3E5RA 5ED4A 1RXWA 3FTNA 5AJZA 1KJWA 3K53A 4XSGA 1HDYA 1T5IA 4Y0AA 4NBVA 4YRTA 2XBUA 3LWDA 3LVFO 4ZVRA 4KXFB 5HOQA 1M1XB 2DFLA 2PKYX 3VPDA 2GZMA 1XDSA 1CRLA 1JLLA 1U8FO 2Q8PA 4LQDA 4Z4IA 1T36A 3AEKA 3HDHA 4UU1A 2QLNA 1VG0B 1INLA 2XYRA 3S99A 2CUZA 5BR8B 4EHLA 1UZAA 4IO0A 4NFSA 1N6RA 4QJIA 3KX2A 4EHJA 5G3YA 3FWHA 1OT5A 4IG9A 4XSVA 4DEXA 1QLHA 4EX6A 2CZGA 1MVNA 4MUFA 3LQ4A 3H4MA 3MTAA 1TK2A 1TYEB 1UJ4A 1YRLA 4GGPA 4OQMA 1O94A 3ADCA 2QM7A 2Q2VA 1GDDA 1Y1QA 2R87A 1QR2A 2R1VA 1KVUA 4JJ6A 5GOZA 4DC1A 1J0AA 2DKFA 1DRKA 1XTIA 1SCIA 2QSUA 3MB5A 5AXCA 1ILWA 1GTVA 4RESA 4NBLA 2VQ6A 1FSFA 4N0DA 4UHKA 1LZLA 1UDWA 3DVQX 4CKYA 5BV8A 3DHEA 5K8CA 3QFCA 2JLWA 1E2EA 1F0NA 3EH2A 4R0VA 3Q8KA 4MUHA 1TM1E 5GJBA 4NH4A 4ZOEA 4JI3B 3AT1A 5TGDA 1A4IA 1KK3A 4F4FA 2JFHA 4A03A 3FHOA 3KV1A 1KHTA 2B1QA 5CXQA 1TUIA 3IELA 2WAOA 2GTHA 4BVKA 3SKXA 3UQYS 2OBXA 1Q57A 3HUUA 1L6RA 2HCBA 2XMCA 4CLOB 3Q12A 1LQTA 4TKVA 4MGEA 5EE9A 3SC4A 1NW7A 2XTAA 3G88A 4PVDA 4S2EA 1WU7A 2ADFA 5J2UB 3JV7A 1VZ2A 5IAOA 3BN3A 1O6ZA 5JVDA 3EPPA 4OB7A 5JG7A 1CNFA 3BWYA 4LSGA 1X7DA 2NXJA 1QLJA 4N1AA 4PANA 4F3CA 3UPUA 4B4WA 3TQOA 4PN3A 4KE8A 5AKIA 5FOUA 5GIOE 1YZYA 4RTPA 2BR5A 1WTCA 4QYIA 1KFKB 1RHQA 3MYYA 4G9BA 3JASA 5BQFA 5JQWA 1OKKA 3EZ9A 1LPNA 2J32A 3I0NA 1EQUA 4KN5A 1NM5A 1KWGA 1F2TA 2XXJA 3EH1A 2QLBA 4BN5A 3V7NA 4ENVA 3FDZA 3RVBA 4A9AA 3ID6C 5G0TA 4EHDA 2XB6A 5I7EA 1M2OB 4B6JA 4M83A 3ICPA 3ZBTA 3OIDA 1AS3A 1U3DA 5KEIA 1WSWA 4RZ2A 1ZVMA 2VPZA 4LMBA 4HZIA 2BGWA 4UCXA 1I10A 4UHBA 1ZRMA 4CCWA 1JFRA 2ZROA 4C08A 1ZISA 3CUEF 2IHJA 1KH3A 2WF7A 5WRFA 4MKZA 3VPCA 2ZBGA 3HLTA 5AP9A 3WGOA 4KVZA 3T3MB 2HTFA 4J49A 4K6GA 2E5LB 3LW7A 1Q12A 2WP8J 2ZVQX 3DXFA 3FAZA 4EY5A 3LUCA 4LS3A 1I94B 1LS6A 2VRWA 1UOOA 3SXPA 2WIBA 4HX9A 1GRQA 3JSXA 4WZBA 5LA6F 5LQRA 2JFYA 3HBNA 1G20B 2ZE6A 5BPFA 3MJHA 5E6UA 2FP4B 1O89A 3QE4A 4IX1A 4M86A 4E2XA 2NMVA 3O4HA 1S8AA 1DAOA 4FJ2A 2EWWA 2QR3A 3PYMA 2RI1A 5D3KA 1TCCA 3GLGE 3L0SA 3MJCA 2G77B 4FFDA 2Z2JA 5I3CA 1WF6A 1AZSC 1T3GA 5NLLA 1K9SA 1L8LA 1YHZA 1L8QA 1DI0A 2H4JA 2OEPA 3R1IA 3M6WA 3NIBA 3DZGA 1QV6A 3BA1A 4CM1A 5I51A 3CNNA 3BT7A 1SMKA 2W2MA 3QPCA 4MPDA 1H0HA 4HEA1 4IHKA 4ZOCA 4EG3A 1N92A 1YK1A 4ALJA 4PTLA 2NXCA 3R41A 3HRIA 3DMNA 1X7XA 4XFKA 5LUBA 3SZUA 5KYUA 4Z49A 1SK8A 2GHTA 5I7RA 4LY3A 2VDPB 5SZJA 4PWZA 1ZVJA 2PMDA 5TF4A 2FPOA 3H2KA 3KE9A 5F2OA 1UPUA 3UMMA 3ENNA 1YUNA 3VR0A 4BRSA 1GTJ1 4C06A 5AI9A 4WJLA 2ZOSA 1YBFA 2JAPA 2WAMA 1UXJA 4R1PA 4JSRA 4O2AA 1KMIY 1EJBA 1RXVA 1B8NA 1BEUB 3ANMA 3FLEA 3PQ8A 3VR6H 3AEUB 3I05A 3E7FA 1Z63A 3NZEA 1IY8A 1OKKD 3WWOA 1GU1A 4CV1A 3SYTA 5TPZA 4XGQA 2P9FA 1G8GA 1CUBA 3K3PA 4FR2A 1VSUA 2I99A 4AKSA 4CM8B 1TU4A 3BTVA 4G36A 4ER5A 5AVXA 3C1OA 4BO0A 1SPBS 1D0IA 3IR6A 4BV8A 2IZ5A 2X8BA 3DDHA 4Q19A 2FSIA 2Y3IA 1DIOB 4QT0A 4ZVUA 5GY7A 4B48A 3FRHA 1L5YA 3JQ8A 4FOLA 5IDVA 3IEXA 3RH0A 2C7QA 5IKXA 2ZB2A 3T6KA 2ST1A 3GLKA 3I6BA 3WZ2A 1IM5A 2PLWA 3BEOA 4BCBA 4JI4B 2HUNA 2GBCA 1JAHA 1UFVA 2I66A 3DAGA 1BXZA 2GXUA 4MUEA 4IGEA 4PAGA 2JCBA 3UJ7A 3GJZA 3RTGA 3D2AA 4E11A 1SEVA 4CQMD 1L1FA 2DLNA 2H00A 3OTHA 2YICA 1JI0A 4QPZA 3WIVA 4Y2TA 2I7XA 3QX7A 4PO3X 4B85A 3OD5A 1I4DD 3FHLA 3U7GA 3UBMA 3ESCA 3S6JA 3T9FA 3ZCUA 3RYCA 3GEGA 3MW8A 1J23A 2Z3WA 2E6KA 3AF5A 1Z0DA 3JWPA 3PITA 4AWAA 1R18A 4UKDA 2IQ5A 2FHPA 1PQUA 4I4TB 4ROSA 4WLVA 1RWQA 5CH8A 2A0XA 2EJTA 3KU4A 3QLVC 5LYJF 4KOAA 3SLKA 3GPDG 3F7MA 4S1PA 3S8MA 3UT5B 4A26A 2P0YA 2BFOA 3PC8C 4GT1A 4HI0E 1YTLA 1WXWA 3CBQA 5DHSA 5DYYA 3NDPA 5IEJA 2NZ8A 4FEEA 1O5IA 1NVVQ 4KH0A 4UDOA 4AJ1A 3T7EA 5IXSA 4B80A 1RQLA 5AHXA 1D3AA 2O8CB 2HJSA 2OGUA 3IH5A 4U7GA 3AF6A 1VG1A 1H0KA 2AFRA 3FYCA 3QF4B 3QLVA 3VZBA 3RG8A 1NQTA 1JYSA 4EQZA 4MR9A 2VWGA 3C14C 4BB0A 1CQXA 1NUQA 1FDSA 3PHJA 4MLDA 4OJKA 3TQSA 2GGSA 2XHEA 3OZUA 2L69A 1C5KA 2Z98A 4Q3AA 3VDMA 1DIAA 1W6RA 1YB7A 2HZBA 3EVAA 4OGFA 1I1OA 1OC4A 3DL2A 3R3JA 7ABPA 1UDBA 2F48A 4O2AB 4OG2A 5CXXA 3P9QA 5LA6A 1H1TA 3OCZA 3EY4A 1GCOA 4G8BA 2GBFA 4RXMA 2NZUG 3GJTA 1AS0A 1IMJA 3H3JA 2CLLB 3ICOA 3USCS 3W79A 4EUNA 5IABA 1BX1A 3I9V6 3TLGA 6PFKA 2OHIA 2OO7A 5JXWA 1I0IA 4TS3A 4FHEA 2BF7A 1JFFB 2PU5A 3C87A 1X86B 5IUJC 3HFRA 2AW5A 2ZSHA 1KYZA 3BMCA 3TNLA 2AKEA 1QIMA 3C7DB 4JT4A 4C2AA 2BFMA 5KYWA 7GPBA 2PUHA 1HLGA 3RYFB 1JBEA 2BHTA 4EJSB 1KIMA 4FFVA 5DK6A 1QHEA 1TVKB 5BWLA 1PU2A 3HM9A 3D2LA 2C20A 5H02A 3K8ZA 4UNNA 1OXKB 3WX0A 3CZ4A 2V6FA 3H2ZA 5C7YA 4NZMA 4YJ3B 2XOKD 2Y6UA 1HDRA 1RJGA 2ZANA 3LNCA 3PHCA 5JT1A 5DTEA 4UBLA 5EFZA 4M8IA 3PGXA 4ZI7A 1OBOA 2WHEA 3HPQA 4FFMA 3B2NA 4DGSA 2NVOA 3LY8A 3ER6A 2A4MA 1MW9X 2QJWA 2W2OA 3OKPA 3IAEA 3P9RA 3GFQA 1KPGA 4Q66C 4TL9A 4YAEA 5BOSB 3VKWA 3CH7A 3RUHA 1MO3A 1EE2A 4IH9A 3V5NA 2AC7A 4MR9B 4AI6A 1U2RA 4X7RA 3R5JA 3T52A 3CX6A 3TEJA 5JPIA 1HUQA 1UL1X 2XB4A 1EVIA 1JUDA 2BDEA 3HJNA 4B17A 5EHXA 4HS9A 3EULA 1LSOA 5JROA 2BP7A 1VGQA 3CXUA 2GT1A 2Z6VA 4C4XA 1RJWA 4GKKB 3KVNA 3LV8A 2JZNA 5BMVB 5KSZA 2QPLA 5C46F 3LA8A 4BZQA 3EOAI 4XQCA 4KR9A 1YKFA 5IANA 4LW8A 1R0ZA 1O6GA 2HV9A 3CW8X 2C95A 2J3IA 2VXCA 3AUJB 1QPBA 1UWCA 2HNAA 1KEZA 3N8KA 3QMVA 4LYFA 1MX5A 3BH6A 4NMXB 4RTRA 5FWXB 1Z56C 1PZMA 4PLTA 3ZY2A 1THTA 1X7YA 5GGXA 3PYXA 2WZDA 2ZB7A 1NVWQ 1WZCA 1ZXXA 2QYOA 3R5XA 4L95C 3FHCB 2ZU0C 4NZNA 4PGFA 4W5JA 4XASA 4LE1A 3ETDA 1KO1A 1MGOA 3I4LA 3DCYA 3K4QA 2ZUFA 4R4JA 2EU8A 3NBZC 3VZCA 3AEZA 3LUAA 4LC9A 4Q9AA 1YXMA 5ILQA 3K6RA 2IPLA 2MR6A 4KMRA 5IRCD 3K0EA 2G06A 2CEKA 2JAUA 3JZIA 2VJCA 3CH5A 5F12A 1ZAYA 4XAQA 5EJ8A 4HWTA 2EZUA 1HNWB 4H1TA 3HDVA 1GOTA 1YGPA 2Y0DA 3C6BA 2QD2A 1HOTA 3V3TA 4R1QA 2XUPA 4IJWA 4RD6A 3WOVA 2CSXA 5DX0A 3ZYCA 1AQNA 5D1HA 4MVJG 1AY0A 4J9UE 1M75A 1SUIA 2PQ2A 4YIHA 3N2KA 1UM9B 2UDPA 1WXEA 3BH0A 4MCHA 4BX2A 4KQJA 1GPLA 1R50A 1SCUA 3PBKA 4GPAA 4MKHA 4RS3A 2FOXA 1SZJG 5FPQA 3WKEA 5AHRA 1T8RA 1Y37A 4MQFB 5EXPA 2O8FA 5LXTF 4JK3A 2D00A 3OT1B 2WF5A 1NZFA 3HWWA 3OU6A 4DMGA 1N57A 2CLMB 3UFXB 2O5RA 4YGXB 4C05A 3D6VA 3ACDA 2QENA 2FN7A 4E21A 1Z68A 1I3LA 5ITSA 4NTZA 5A4DA 2DBZA 5KYUB 3DA8A 3CR8A 1NYQA 4CG0A 1I9GA 1ST3A 4PBRA 5GV7A 2P3LA 1MOSA 2HCJB 1Z18A 1LBTA 2AQ8A 2XCOA 3CCCA 4TMVA 4C7XA 3THXB 3ROEA 2D1TA 3SS7X 3ESDA 4FNMA 4NZOA 1EU1A 1GP2A 1S8NA 1SUAA 4M0KA 2WFZA 2ZSJA 1B16A 5BRJA 2XGMA 4ZU1X 1JWBB 2GCNA 4FYPA 4TMXA 2RK3A 2I2FA 4C0XA 4QGAA 1Z8FA 1XZIA 3I9NA 4G26A 2O8NA 3SJAA 4EZEA 2JLXA 2OM6A 4WBNB 2QUKA 1ZJ5A 2WOOA 3QVXA 3DF9A 3F4LA 5E6UB 4WX2B 2P65A 1V3VA 3PEWA 2ISQA 4D8UA 1ZUNB 2ZEJA 4TXHA 4WUVA 1YTUA 2G9UA 3OJEA 1P0CA 4FHZA 4QG7A 2W6QA 3MCTA 4WESA 1T91A 4PE5B 4QA9A 3UAXA 5DVZA 5EE1A 1FJXA 5TY0A 1ZGAA 1Q74A 5IVIA 1LPSA 2FR8C 1L5FA 2BC9A 2WJVA 4FGUA 4K3VA 1E92A 3WBFA 5A6VA 5AW1A 2GXAA 3W77A 1N4AA 3OQIB 2BGGA 3R5SA 3SQNA 3QW4B 4ZALA 1F0PA 3ROZA 4B6FA 2Q3LA 4ZANA 3OY7A 1MO5A 1E4EB 2LE0A 5BN3A 1LNZA 1SQ5A 4L85A 1P3JA 1KJZA 4PLHA 4Z4HA 4YRDA 4GUDA 3QNMA 1XEWY 1TC2A 2CCGA 5CD9A 5E38A 1H2BA 5CD1A 4AD8A 1EEXB 4CL3A 2W2LA 2I87A 1TXGA 2FEKA 3C15C 3KZNA 4F4UA 2ETVA 1NNSA 1TYZA 3ETHA 3KYDA 4IYRA 5BO5A 2ZYTX 3MA0A 3ETGA 2P1DA 4RS4A 4EY7A 4I4NA 3VDRA 2P2GA 1NURA 3WDSA 1F4VA 4AY3A 4TKZA 4A5SA 1L4KA 3WKDA 1I7LA 4S2UA 1KP3A 2PUJA 4P9NA 3WO0A 2JS7A 5J2UA 4WLUA 1DFIA 2Z58A 1XC7A 3GG2A 4JCOA 3LQFA 5K3CA 4F6RA 4HQRA 2RIRA 4Q21A 3VSBA 5FXMA 4KDEA 4R1TA 4U2EA 1FU7A 1T8UA 5BW5A 2OUKA 1S3IA 4MRNA 3V2GA 4KLRA 4A16A 3UWMA 2V7BA 3KCQA 4RE5A 1US8A 2JW5A 1E99A 2OT3B 2WSMA 4WSOA 1FFWA 2BGUA 1E63A 4DNOA 2ORYA 2Y1FA 3N2NA 4GAEA 1Z6GA 1Y7PA 3ON5A 2WUGA 3H1GA 4LXGA 3EOBI 4OK6A 3K71B 5IF9A 4LJKA 4WESB 3WKAA 2AE2A 2UUPA 3CZRA 5IN4A 3A9VA 3CLTC 2ZT6A 1HG1A 4RK5A 4BVEA 1GA1A 3N28A 2IF2A 4LY6A 4PTZA 2PUDA 1OH7A 2PDAA 1T43A 4JU9A 2AN4A 4QDTA 5FNVB 1RP7A 1N5MA 3ND6A 4RQTA 1DXYA 3N0RA 1IEVA 3VJKA 1JG3A 4UAUA 2B98A 5SZIA 4G4IA 2CNLA 2X8JB 1TO1E 2VK2A 1U8EA 1XLTC 4K9LA 1PZEA 2Y1EA 2PRYA 2GLTA 2HA0A 3PJDA 2JFGA 3IHKA 3GFBA 4Y2HA 2VPXA 4J07A 4YK7A 3TX6A 1OWPA 2B7CA 2MINA 4B81A 1MJ5A 5K3OA 2TS1A 1P7ZA 1WDKA 2YWRA 3EC2A 4JXZA 1OX6A 3FSGA 1EX6A 1XU9A 4HWOA 1ZHHA 4PONA 3T7RA 2JGKA 2CL7X 5ELXA 1RXEA 3MCVA 4C0QC 3AF4A 5EJIA 2V6GA 1E77A 2IYRA 1W5SA 4J6EA 4XUCA 3KB6A 4EW3A 2W6CX 3GLGA 1MDBA 4LF8B 2ZVDA 4HLDA 1NI4B 4F5WA 3DTTA 3HCDA 3ZCSA 3V1YA 5KPDA 3UOAB 2AFIB 1DP4A 1NQWA 1T0UA 1BU5A 2DX7A 2W5UA 1KXJA 1TNDA 2GD0A 2V9PA 4QDXA 4V24A 3R7NA 3ME5A 2D0PB 3HJFA 2GXSA 5C5IA 2A1UB 4PEVA 3IHLA 1PG5A 4TLLB 1L8AA 1YQUA 3N5CA 2XWJI 2NAPA 4DY6A 1XFAA 5G41A 5COAA 2RGDA 1Z5GA 2NOAA 3HCAA 3OTWA 2R7LA 2JIRA 1QS0A 2QE6A 3U56A 1K5GA 2D5AA 4KAFA 1M1NB 2W2TA 3LTEA 4HAUA 4MUKA 3WLAA 5KO2A 1N8KA 1PQWA 2JJ1D 5DHUA 1KI8A 5J5CA 2H08A 1TQ2A 4F11A 2IW1A 2QU8A 5KINB 3DPSA 3MUEA 3PVSA 1JZSA 1M7HA 3F6EX 3UWDA 4BFXA 1QP4A 4E5YA 1SZCA 2AUTA 2P4UA 4BYGA 1D5CA 3EXEA 3IR7A 1GRCA 2XW6A 2OV6A 3I4FA 4PV7A 1KHHA 5EYPB 3CLSC 2A9OA 3GLHE 2GASA 3JQCA 4XYMA 4LJ9A 4BJ3A 4EG1A 5JNWA 1QNFA 1QRSA 3P94A 3NXSA 4JFAA 4Q48A 3V97A 2YNMC 4J1TA 1B14A 5KX5B 3AZQA 2V45A 2YXPX 1E6WA 2QJOA 3QK7A 2AD5A 1P0QA 4J2HA 3IUJA 1JAYA 3F7TA 4QUGA 4NBNA 4EMUA 2WIJA 2JAQA 5AUPB 1QB8A 1TMKA 3MS7A 2V7QD 2JCGA 1A9ZA 4Q4LA 1UBLS 1WNTA 4DFDA 2Z5VA 1Z5PA 2R96A 2QN1A 3AIOA 2B2CA 3R4CA 1TADA 3GDWA 4H3HB 1FDTA 4HPXB 4ML3A 4OJMX 1OIVA 1RWNA 3NOQA 1RC0A 2ZWMA 2YNMA 5EKUA 4EAAA 3COSA 2OHFA 1ZVQA 3T5BA 2A9RA 4F2GA 5BMVA 1CTQA 3TF5A 2AH5A 3T9BA 1SBYA 2JBHA 2IYOA 3RU2A 2FU5C 4J90A 2B8WA 1VJRA 2Z2IA 3DE4X 2Z4RA 1JVSA 1JHYA 3RSLA 5COQA 4RVFA 4MRMB 1QCZA 2HCRA 1L5QA 1F9AA 3GLHB 1CERA 4NH0A 3G85A 4OUDA 4UUQA 5AVWA 2ZUBA 2AXQA 3OEWA 5LXTA 4PU0A 1XEAA 1XWWA 2QQFA 4DG5A 4C0HA 1NUHA 3C3AA 1KFBB 3KHKA 1GL7A 2NUBA 3IAFA 1DAMA 3PRYA 5HE9A 1YR2A 2R1TB 5AVVA 1CUZA 4U2FA 1NU6A 2G1UA 3KWFA 1KBOA 1ZN2A 2ZETA 4ETNA 3OCCA 1MO4A 3GGCA 3HA2A 2VR1A 1SY7A 4J91A 3LQKA 5ENVA 1LH0A 1Z16A 3EGCA 2FY8A 3QP9A 1IWPB 1SVIA 1W46A 2VS1A 1J2RA 1WXIA 3QOWA 4KU4A 2Y1DA 5AKHA 3DXXA 3EVZA 4MI9A 4Q7JB 2A78A 4RMJA 1EDEA 3IUPA 1N0UA 4WN9A 3LBIA 4E2WA 4DCOA 4O1HA 4XDYA 1EFRA 4MW0A 3ZH2A 3O3CA 4R1MA 3W8NA 5KMGB 4RLHA 4IIJF 1S2OA 3DEIA 1HDZA 1JLSA 4IIXA 2HGSA 3GEEA 5EMKA 2QAJA 2IHUA 4CM3A 2V6IA 4DWVA 1LJUA 4O33A 1JJ7A 1LBEA 1ZO8A 2C9BA 3L6DA 4BMNA 3W2TA 1YDFA 3N0XA 2YWDA 3QYAA 3BDVA 3HKDA 3NHRA 1MV8A 1DMSA 1KA9H 1MNQA 3DAOA 5FO1A 1AKWA 1PQ4A 3SNKA 2Y66A 1H22A 3GUHA 1XR3A 4NFHA 1FPMA 2KQUA 3N8NA 4DR3B 4FEAA 2AOXA 1YUMA 2BGTA 4EJFA 4AS1A 1RI2A 1FYEA 4FYJA 3QLTA 1DBVO 5L40A 3N53A 4G4GA 4GP6A 1FDVA 1OBCA 1QZZA 4TV9F 3BL8A 3VV2A 1C2TA 2O1WA 1DADA 3P20A 1B1AA 1LK5A 5BVGB 2HXGA 3BZBA 4RA9B 1W44A 3EBLA 4KODA 4L4SA 3RKRA 3FOZA 1Q21A 4BKMA 5F1OA 1U0RA 2WJPA 3RNLA 4OVKA 1KORA 2FW6A 3VU1A 4HQFA 2EERA 1KJNA 1LWNA 1PT6A 5J2UF 1IZ7A 5EUMA 3FPJA 3L6BA 4MIOA 5EOVA 2PFSA 4BVAA 4QFBA 3AR7A 3I2FA 2ZVJA 2Z8YA 1H9AA 3PEFA 1Y42X 4NJOA 2HHLA 4FT2A 3UV7A 2Z1NA 4XE5A 5BSVA 4OQFA 2O9JA 4FS3A 3AUKA 1O9GA 3GIWA 4JHXA 3ZNPA 4BGVA 1F0YA 1ULSA 1M5TA 4Q9DA 2JLQA 2FKAA 2VDJA 2EP7A 4QU5A 4RO0A 5EZ5A 4XSHA 5YASA 3M5CA 3EXHA 1G16A 1NBMD 2ACWA 1MQAA 4EKDA 4GYWA 1FNNA 1NJ5A 3GBVA 4ZD6A 3LT4A 1BOOA 1NPDA 1RWPA 1VL8A 2Q28A 4M0FA 1YR6A 4PIMA 4BNDB 4F4JA 2I4RA 3INGA 1GM5A 4GW3A 2JGEA 3O2QB 1M5UA 4NJMA 4RDHA 2C82A 3MUNA 1C9DB 2W6JD 4J3JA 5I8PA 2X9NA 1DTWA 4JELA 4OA5A 4EHHA 2XB9A 3Q5EA 2J4DA 3EXHC 1QDUA 4P93A 1YZFA 1ML3A 2QN2A 2LWIA 1UXOA 3PCTA 4OJYA 4CV2A 3EG9A 1USVA 1QHIA 3R0QA 4JC8A 4TWZA 1OIWA 2XAUA 2JGLA 2QA5A 4TTTS 4GOKA 4QTYA 4BUCA 1A0OA 3E9ZA 4R1UA 1DEXA 3HLKA 3E03A 3OM8A 2VQDA 1EXNA 1G55A 1YDWA 3QRWA 4MQEA 3M1AA 3KEMA 2GBPA 1H1LB 4MPTA 2UVPA 2FZ5A 4DREA 3LHKA 4TT3D 5BT9A 1IBCA 1SBQA 4QUIA 2A0YA 1TA4A 5FIUA 3HK2A 4RXTA 5CW1A 4H9GA 3X0DA 4KVGA 2GJ8A 5EEGA 3TN7A 2G71A 2PJUA 4RZXA 5ILGA 3GGSA 3HKEA 1JPNA 2X3FA 4JODA 1VDZA 3VNQA 2CFIA 5L4SA 2ZM6B 3QE0A 2RB4A 4F06A 3C41J 4LXYA 3R76A 1A9OA 4CL2A 5LOVB 3K0CA 4WH0A 2NO7A 5DM60 5M04A 1UXKA 1KYYA 2H6EA 3MRSA 4MDHA 3WQHA 2JKVA 1CFZA 2MSDB 3PNKA 1QYIA 4Z3OA 1U8TA 3IUSA 4G4JA 5FTWA 4EG7A 4I0WB 1VZ3A 1QYWA 1FFAA 2A88A 1D2CA 3ZDZB 1H8ED 2YS7A 4FOPA 3ITDA 4LDRA 4F9GA 4RM3A 4D9MA 1PJRA 3F9IA 1F8UA 4NJEB 2PGIA 4LQCA 3EEFA 2HDOA 3FY4A 1GZDA 1TW2A 2CKMA 3CWZA 4F6LA 3FOWA 2B1GA 5LQSA 1EX1A 1ZBDA 3H5TA 1B6RA 5DBGA 2FPXA 5AJVB 4DB4A 1RLUA 5DN6A 1R7RA 3KYCA 4KIJA 5JD6A 1PN3A 5FTNA 1PFKA 4U2KA 4P53A 5AVZA 4XARA 3IA7A 2L82A 4XRRA 3IQGX 5G4KA 2AQHA 4QULA 2FSHA 1C0LA 4QVKA 5AW8A 5C9ZA 3ELYA 3FMIA 1KAGA 4WDRA 1I3CA 1U9CA 2JFUA 3KC2A 5A4KA 2OCAA 1B0ZA 1FOEB 1PSWA 1WHSA 2ZIWB 3A2NA 3DUFA 3IUEA 1QJCA 1EI9A 3ADBA 5FEMA 3VSAA 4HRXA 4QGGA 3NVKI 2IOHA 4BTEA 4YCJA 3T3DA 1M2OA 1UBJS 3QHPA 2R6ZA 4DLPA 1EWKA 3ZQ4A 4BDTA 4ALLA 3KR0A 1JT2A 2R7NA 4LJLA 4OBXA 5HKBA 1JTVA 1EZZA 2H1IA 3GRVA 1C7EA 5BVHB 4IDNA 1OH6A 2ZPUA 2NNWB 2O8EB 4DUGD 5DM0A 2GXQA 2SKCA 1YHYA 1T4CB 4X1KB 2CD9A 2YR0A 3E1SA 1VCHA 3GVPA 1NW3A 3G2OA 2Z9DA 2VPPA 2PXAA 2CXSA 2PYDA 3CF4G 4KRYA 2OZKA 3D3JA 4UVHA 1I2AA 2H8KA 1JBQA 4Y6PA 2QT0A 5HF5A 3EEOA 1QTQA 2PLFA 3DZIA 1TUEA 1P81A 4Q4AB 2ZUTA 4B32A 4Z1OA 1TJ4A 5T5QA 3PKJA 1QDEA 2A5DA 3Q9SA 3DLHA 1CKEA 2OO5A 2VUSA 2ZS7A 3AU9A 3F46A 1VIVA 3G17A 1YKSA 1NBHA 2B6NA 1XZGA 2BD0A 3H84A 3HEMA 3MC1A 3JW8A 4BMXA 3L8EA 4IUBS 3TS1A 4WOPA 1YMUA 3FKSD 3U4MA 1XLWA 3H2SA 2QVLA 3MUOA 3UJAA 1J8VA 1RZ3A 2A57A 4AQ7A 4UMFA 3GJ8A 3PF9A 3R7SA 1BEZA 4KXWA 4KP7A 3TD9A 3MS4A 4UMVA 2FQWA 5JAZA 4LVUA 1XQ9A 3B52X 3ZR4B 5BWOA 3HUEA 2K6GA 2ZWPA 4YJFA 5BURA 1Z0KA 3CU5A 4IUYA 4WXHA 2CBXA 3WWEA 4H4CA 2GH1A 3T4PA 3VU0A 3AVUA 1Y8RA 1IUKA 4FFSA 5B3JA 2J5QA 1KZ7B 3CF4A 3W8RA 3FLAA 4QO7A 5K0JA 3ZDCA 3HSSA 5CU7A 4ZCLA 2Q21A 3A1VA 2HA4A 1DUVG 3FNBA 5LZ5A 3R3UA 4P80A 4U02A 1J21A 1WX1A 1C41A 3QHAA 4DA9A 5HIIA 3ZU6A 4Z2AA 1Z4QA 1KJ9A 3DOUA 5LSAA 3N2GA 1KP2A 1MRNA 2FSVC 2RHGB 1JKXA 3WLRA 4GMGA 2UZAA 5E0KB 1O94D 1T0HB 2AJBA 3GUUA 4QELA 2WF6A 1SBTA 2AJLI 3B1ZA 1E60A 4O4LA 3NR2A 1Q2XA 1KR2A 4YONB 5FFNA 4BLRA 2ZRJA 1TVEA 4AKTA 4FZVA 1RLTA 3IJ5A 1QRTA 5LP6B 5EP4A 2W2NA 5ILOA 1JLMA 3JAKB 1IUPA 4JI1B 5TX7A 3PEVA 2BSAA 1PGJA 1SWWA 2F4NA 4P4SB 5ALWA 2JK1A 5JXHA 4ZU6X 1TPYA 3GX1A 4BBPA 1Z0UA 3E23A 2PCLA 3ADKA 1KTIA 3BFVA 7REQB 1O57A 4P4SA 2BHLA 2Q7XA