3AFMA

Crystal structure of aldose reductase a1-r responsible for alginate metabolism
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase
publication title Molecular identification of unsaturated uronate reductase prerequisite for alginate metabolism in Sphingomonas sp. A1
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Oxidoreductase
total genus 97
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.1.1.126: 2-dehydro-3-deoxy-D-gluconate 6-dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3afmA00
5AXCA 4D79A 3AU8A 3PGXA 2JFHA 2I3GA 3W1VA 5COQA 4RDHA 1VLLA 4CM4A 4I5DA 3WFIA 3HN2A 3L4BC 4O5OA 3DBHA 2WD7B 3W6ZA 4OXKA 5IZCA 3F4BA 5TX7A 4AJIA 4IQ8A 3I9NA 5IN4A 1AHIA 2CMDA 2Y1GA 5DCWA 1BW9A 1MLDA 2HK7A 2HLPA 3PQFA 1GL3A 2GN8A 4J4BA 4YJGB 9LDTA 3H7AA 4CR7A 2EW2A 3MCVA 3N7UA 1U2DA 1D1SA 3QQPA 4MVJM 4JIGA 1LDEA 1TB4A 2G1UA 1FDUA 3CINA 1I33A 2WD8A 3OMLA 4I8XA 5EIOA 4ZU3A 3AUAA 3RBVA 3PYXA 2FP4A 4JJIA 1UJMA 4FR5A 1WW8A 5TT0A 1P31A 4OKNA 3UCXA 3SX2A 1IE3A 4GLOA 2CF6A 1HKUA 4LRTB 1BMDA 4WNIA 1IPFA 4BIIA 4E5PA 4ALLA 2QIOA 1CQJA 5B4TA 3MJ4A 4BHTA 3EY4A 3GVXA 3NEPX 1I3LA 4JJGA 4YRDA 1ZEJA 4PCVA 2BF7A 4ITUA 4W7IA 1YWGO 4EJMA 2YUTA 2YDYA 2WTBA 2BD0A 1SB8A 4MOWA 3DC2A 3GFBA 5IDQA 1S7CA 1BHSA 4RQTA 4ZHSA 2WJPA 4MVJP 4NBUA 4A10A 4L0QA 3C24A 5TSDA 3S55A 4R51A 4YYZA 5KKAA 3HUDA 2FN7A 3O8QB 3DL2A 4TRJA 1DHTA 5CG1A 2VUSA 2I65A 3DO5A 1KBZA 1D4FA 1P44A 3DWFA 2Q99A 1ID1A 3G17A 3W4IA 1Q7CA 1QV6A 4UUPA 4D42A 3N74A 4JLWA 1R12A 4CLHA 3GR6A 3ZWCA 1E7YA 1PGOA 1ZZEA 2B5WA 1PSDA 2GF2A 3I3OA 4OSOA 2Q4EA 3GN1A 4J7XA 1Q1NA 1ZXBA 5LDGA 2O4CA 3DHNA 4BNUA 1JWAB 1IZ0A 3DDNA 1U3UA 1ZK2A 1NPTO 4Y6RA 3ZWXA 1A27A 4FFRA 4CUZA 5L4SA 2Y0EA 1N1EA 4B7XA 4U5QA 3MTGA 4EYEA 3VPHA 3OJEA 4E13A 2BHLA 3ZWNA 3G1UA 4XQ9A 5EINA 5IAAA 1QYDA 4J90A 1PIWA 5FEUA 1LUAA 2Y1OA 5HTOA 4OH1A 1MFPA 5U4QA 2GZ1A 2ZTUA 3LT1A 4G5HA 1UXGA 1E6UA 1K3TA 1E3WA 4FC7A 3FBTA 4XA8A 4II2A 3PWKA 3OSUA 4NDNE 1AHHA 3JQAB 1Q0QA 3AU9A 1SCUA 5ER9A 4MP3A 5JC1A 1NR7A 4GLLA 3VKUA 1YH3A 3LC1O 1R4MA 1O94A 1P1HA 4W9NC 3R0IA 2BGKA 3DHEA 1LU9A 4ND5A 1MFZA 2AQKA 1A4IA 5GMOA 4RVGA 2C07A 4HNHA 1Q0LA 1JLLA 4B3JA 4PGFA 4R41A 4GKVA 4JBHA 1YBVA 4ONEA 1EBUA 1PGJA 3DOCA 5TJ9A 4BV8A 3D7LA 3BTUA 2OZPA 1DOHA 4ZJUA 3JQBC 1E3IA 4WK6A 4EJ0A 4OYRA 4Q3CA 1ZXLA 1U1IA 5L3ZA 5U9CA 4MVJH 1Z45A 2NM0A 2DBZA 1E1LA 1DIAA 3SLGA 4AJLA 1T2EA 1XU9A 1LLCA 3JQ8B 3K9QO 3QJ5A 2P91A 2J5RA 1PJQA 2EKPA 2DBQA 3I4CA 4HUJA 1B15A 4HFRA 2OHXA 2DKNA 4CMIB 4OOFA 5I9NA 1ZFNA 1YONA 2DT5A 4FOOA 2O3UA 1EE2A 2VYVA 4IZHA 1VRWA 4E32A 3DQPA 1MUUA 2OP1A 1UR5A 2B37A 2J5QA 4NG5A 2H5LA 1KC1A 5COAA 3QWBA 5THKA 3PEFA 4YR9A 2XXBA 2ZYDA 3OP4A 1WAMA 4XGIA 2QW8A 4ZVVA 2O23A 1X13A 2YQ5A 1CRWG 1U4OA 3DAGA 4BNTA 3BIOA 3DBLA 1NPDA 1AUPA 4HXYA 4CM5A 4Y9DA 3UICA 1HYEA 5C7IO 5I7FA 4CMHA 3CZRA 5ITVA 3BA1A 2EERA 3QHAA 1QLJA 2GO1A 3GEGA 2QYTA 3WB9A 3U4IA 4JN6B 3ICCA 2VOEA 1RM5A 1F12A 2X23A 4DRYA 2GNAA 4NJOA 2G0TA 1N7HA 2DUWA 2VRCD 4NFYA 4DLBA 1EEHA 2FR0A 5A3VA 3M1LA 1KEPA 1ZSNA 3GHYA 4S1VA 4XYMA 1DFGA 1AXEA 1XIVA 4QFCA 3IP1A 4R54A 3SVTA 1H9BA 2YV2A 4BKUA 1XYGA 2CF5A 3QSGA 3E82A 1HDRA 4EZBA 2E37A 3GF4A 4B8WA 2RCYA 4BO0A 1ONOA 3TZHA 1P77A 1F14A 3QE3A 2OL4A 1EVZA 4FJ2A 2Q3EA 5CPBA 4NU5A 1PS8A 2CD9A 4IIVA 5T5QA 3ST7A 4YAEA 2VT2A 1PR3A 1HETA 4BO8A 1R0SA 1XGKA 3DBLB 1C14A 3FWNA 1PJ3A 1RM0A 1NAIA 1X0VA 1U3TA 1HYGA 2UAGA 2Y05A 1ULUA 3ASUA 4YQYA 5ENVA 2WYVA 3BHMA 4EUFA 5IG2A 1O0SA 5KVVA 4YAGA 2I67A 4RZIA 1WDKA 3BAZA 5DOVA 3CZMA 3WBBA 1FMCA 3WGGA 4CMEC 4XX0A 3GG2A 2BGMA 1R66A 3UFXA 3RFTA 1ZW1A 3DEYX 2BGLA 5HBRA 1N8KA 5TJHA 1JVBA 5HM8A 4JP2A 1YBMA 1Q2XA 3FNHA 4CV2A 2VT3A 3PQEA 4BGVA 1DLIA 4RJTA 3RROA 2I9PA 2EHDA 5I9MA 3VTFA 2JFFA 4YEDA 3S2EA 3JSAA 4BKQA 4E30A 1PZGA 3K6JA 4IDEA 3OHSX 4FJ0A 3QVXA 1ZNQO 4LMPA 1XKQA 3W4JA 1B14A 4JK3A 2BKAA 2EP5A 4RF3A 3RUFA 1NX6A 4I9UA 4NBRA 3EAGA 1FDWA 3GHHA 3UXYA 1E77A 3WSWA 1S6YA 2GERA 3WJ7A 3DB2A 4CMBA 2G17A 4NHEA 5G0VA 3OA2A 2RBEA 3QVTA 4WLVA 3RJ9A 2IEDA 3SLKA 1F0YA 3ZV5A 1VJTA 3ZCXA 1QYXA 2FZEA 4MPDA 3RKUA 4IS3A 3QV1A 1E1NA 1UDBA 2BRUA 2O3SA 3PPIA 4XJSA 5DCYA 1ZK3A 4E21A 5JXWA 2VTDA 3BMOB 4FPXA 3U4CA 4O59O 1SPXA 3JQEA 1H93A 3KBOA 4FFMA 5T57A 1YO6A 2A94A 2AG8A 4PVCA 5DF1A 2Q4BA 3NJ8A 1JKIA 1O89A 3U4HA 5JBIA 1YBAA 4WCFB 1R4NA 1VJ1A 2JHFA 1EFLA 2DFVA 4IZIA 4CV0A 5CEEA 3IAHA 3WNQA 2E4AA 2GCGA 3KHUA 4PLYA 3WMWA 4W6ZA 4PG4A 4M1QA 5CG2A 1HE2A 4II3A 1QP8A 1ISIA 4M86A 3ROPA 3FN4A 1DC5A 1ZK4A 4OM8A 2F00A 3VDRA 1GYQA 1TI7A 2VTEA 2DQ4A 4WLFA 2AHRA 1A9YA 1ZKMA 3GOHA 3OICA 5DZSA 3NGLA 4BNZA 4JBIA 4M87A 4PVDA 5BNFA 3ZGYA 1UP6A 3CXRA 3GZ4A 5KJ1A 3EVNA 1DIGA 3C1OA 3QWHA 3TFQA 5COBA 4NPCA 4RPJA 1E6WA 3D5TA 2BLLA 3B1FA 4J49A 2B5VA 2VUTA 3KYCB 2NACA 3U5TA 2OORA 1GPDG 2OUIA 3GVHA 4BNIA 4TROA 5EESA 1GU7A 3NYWA 2Y68A 2FPIA 3DMTA 1HE3A 2JD0A 3WLFA 1UXJA 2VNAA 1Q7BA 2DTDA 1BDMA 8LDHA 2AE1A 1QKIA 1LX6A 1IZ9A 1W8DA 1ZCJA 4XKJA 4PLGA 1I32A 1LDNA 5K0ZA 5CAEA 4D3SA 3QW2A 1H5QA 4NJMA 4IJUA 1Z7EA 3O26A 4CMCA 3PK0A 5L7TA 1GQ2A 3TOZA 3BMNA 3L77A 1H6AA 1LJ8A 4UEJA 4A2CA 1CQIA 2CVQA 5KOIA 5BT9A 3UVEA 1M6HA 1Y81A 3JQ9C 4HV4A 5L53A 4PLFA 1KVSA 3K96A 4BGIA 5ES3A 3HE3A 4NBWA 3T4XA 3AUUA 4Z9FA 1U5AA 4Z0PA 2JCVA 4YJFA 3JQFC 1YQGA 4W99A 4NK4A 1MV8A 2EP7A 4LSWA 5JFOA 1V3UA 1FDVA 2LDBA 3LSYA 1VL0A 4FQ8A 4AJ4A 2EGHA 1ENZA 3D3WA 1YE3A 2GR9A 3AI3A 4XEHA 4ESOA 5IZ4A 3AY3A 2JD1A 4DGSA 1UZNA 1PL7A 3T7CA 2FWMX 2O7SA 4AJKA 3AI1A 4UEOA 3I83A 4W9NA 2NTJA 1W0CA 2YFHA 1V35A 3CEAA 3S1LA 1C0IA 1U9JA 4R5MA 1U8XX 2VRCA 5IDWA 1RWBA 4MVJI 1O9BA 4CMKA 3D4NA 1WDMA 3ETDA 1B3BA 4DBVO 4XRRA 4FFOA 4BNHA 3F9IA 3CPSA 1HE4A 5JAZA 2B0JA 2E6UX 3JQAD 4UUNA 1ZSVA 5A9TA 4DIBA 4OL9A 1GV0A 3QP9A 3WX0A 5DT9A 4ZQBA 3PHLA 4J9VA 4Q39A 2J3HA 4MJLA 1SZJG 3E1KA 5CPFA 5G0WA 1YVEI 1L7EA 2GYYA 1SEVA 4Z9XA 5FF9A 5I8WA 4Q3EA 2EW8A 1LEHA 1P45A 1PS0A 2OO5A 4D45A 3E9QA 4J1QA 1RKXA 2NWQA 4WOJA 4ZD6A 5KVCA 3K2BA 3OJLA 1ZK1A 2AG5A 5JS6A 7ADHA 2XPCA 1Y8QB 1HLPA 1FF9A 4DREA 2ZK7A 8ADHA 2VQ3A 4A73A 3TQHA 3D64A 5T6BA 1E3SA 4EGFA 1WMBA 1DXYA 1YQXA 3RFVA 5A9RA 2Q49A 1YB1A 4CM1A 3H6KA 3AFNA 4DQVA 1T25A 4G65A 2IXAA 3CKYA 4LMRA 4AFNA 1E3LA 3E6AA 1YJ8A 3WGHA 1QMGA 4RPHA 2B83A 3UAGA 1QLHA 1YOVB 4DYVA 5G0TA 5BSGA 3FF4A 3ZV4A 4PG7A 2DLDA 4K9DA 3RC9A 5AOVA 4J3FA 2HMUA 3TL3A 3DZBA 3H9GA 4NBVA 4CR8A 4UUOA 5LDHA 4ALMA 1SNYA 1DDOA 4YWJA 4J4TA 4WJZA 1C1XA 1GR0A 3HDHA 2B4RO 1X7HA 4DBZA 4MINA 1MA0A 4RZHA 3GAZA 4IIUA 5ENDA 2V6MA 3VH4A 5JAMA 2NSDA 3WWZA 1HLDA 1CWUA 1AGNA 1DFHA 2ZTVA 1EUZA 1W73A 4KWHA 5BSEA 3FSRA 3B20A 5C37A 1KY4A 3ROQA 3RUEA 3ZWAA 4KZPA 3A06A 5CHEA 1VSVA 1B3RA 3O38A 3FCOA 2ZTMA 4KUEA 1M66A 4E4YA 4W4TA 3IL2A 4UVDA 4CLRA 3BHIA 4WOKA 4CM7A 2UVDA 4YJHA 2ZB4A 2X86A 1UAYA 1P3DA 3WYBA 4I5EA 1RYDA 5F5NA 3IJPA 1O95A 1T4DA 4M55A 1PX0A 5KVQA 5TNXA 2HMSA 4OKIA 3JD4A 5I7SA 2JFGA 4BS9A 1VE9A 2W98A 2PGLA 5F5LA 4DIFA 3VVCA 4YDRA 5EERA 2HMTA 4JJFA 3GZNB 3H5RA 1QYCA 1Y5MA 2QQ5A 2WD7A 3FD8A 4A03A 3WGZA 1E0DA 4NNJA 1YGYA 5EQFA 1O6ZA 3MEQA 1C1XB 1X14A 3H4VA 3G49A 2I76A 1T1RA 4YAJA 3GDGA 1P1JA 3P2OA 1B26A 5HA5A 4PLWA 1LC3A 1X7DA 3AWDA 4OHUA 1BG6A 4TRRA 4WEOA 2HUNA 3ZWVA 4O63O 4XYGA 5G0SA 3ZWBA 3IMFA 3DBRB 5DBGA 2ZB7A 2GUGA 1VL6A 3TWOA 5JNLA 1DSSG 3CMMA 2VZ9A 3F47A 3ZZNA 3GLQA 5DNAA 3RQSA 5DDIP 4CM3A 1E1MA 2BH9A 3ON5A 3PWSA 2XAAA 3RUCA 3EW7A 5A02A 1XEAA 3GEMA 1PGQA 2FOIA 2GZ3A 2YJZA 3HFGA 4ZRMA 3ZU4A 5A1TA 3ZWMA 4JQCA 3V2GA 4KTTE 4D41A 3UF0A 3D0OA 4CLDA 2PV7A 2J3IA 4R68A 2C82A 1BSVA 1C0KA 3KYDA 5TRTA 1N2SA 1F8FA 1TT5B 4J4HA 1LXCA 2J5KA 1V3TA 3DHYA 3WS7A 3B1KA 1J49A 2UDPA 1QSGA 5JSFA 1U28A 4R9SA 5JDCA 1ZK0A 1ISJA 3I9KA 1FJHA 1DIHA 1VPDA 3M2PA 3O8QA 4HFNA 5GZ1A 1GUFA 4CQMB 3E8XA 5JYEA 4MIYA 7MDHA 4DC1A 2HJRA 3EYWA 1BGVA 2CZCA 2A35A 4HFJA 2FPPA 4IJVA 5JCJD 3ANNA 5HRUA 3E5MA 2DBVO 3HDYA 3RUDA 1OFGA 3FRJA 1WLYA 3AM5A 2QZZA 3EVTA 5IDYA 1I01A 4A0SA 4NU6A 3VVBA 2PZJA 4PFJA 2Q50A 5A3JA 4FJ1A 1PWZA 2ZYAA 3D4PA 3GK3A 4JBGA 5L95A 4E3ZA 1ENPA 1UXIA 3HFSA 2Q46A 3IIEA 4EITA 1MGOA 1AE1A 3R3SA 4I08A 5BNIA 2HKIA 3AFMA 3GPDG 1V6AA 2RAFA 3H5AA 3ZWYA 1DEHA 1NVGA 1CERA 1H9AA 3GGGA 3UCFA 3ZI0A 4YACA 1EQUA 1T26A 1HL3A 3KYDB 4CMJA 2VRBA 3JQAA 2OOSA 4GVLA 2IEBA 3DZKA 3UKOA 4E6PA 4EW6A 1SOVA 3E18A 2V6BA 1WZEA 4AJNA 5EL0A 3E5RA 1UH5A 1GTMA 2Q1SA 3U49A 3RBZA 4FGSA 5C3MA 2EJVA 1EBFA 5HS6A 3OH8A 3UH1A 4JXKA 3PHIA 4BO2A 3ZNOA 1EUDA 3ITDA 2X9VA 3V1YA 3TN7A 3U3XA 4N18A 3IQDB 1LSSA 4AJPA 2O3RA 3R3JA 4A26A 4BNNA 2PKRA 2ZKLA 3Q6IA 2IDZA 1I3NA 3TDKA 5A5FA 1MXHA 4J9UE 1KYQA 1QRRA 1H2BA 1HSOA 3EGOA 5FWNA 1I2BA 1K6JA 4CV3A 1A9ZA 2H9IA 3KEOA 1A7KA 1V8BA 1Y7TA 3BXXA 2QX7A 2C5AA 4RDIA 4Z3DA 6LDHA 3ZN2A 4B4UA 3ROMA 4U0JA 4CLXA 2VUUA 2V65A 2POQX 2WMDA 3JQ8A 2P5UA 1I2ZA 3JYPA 4K28A 4QX6A 2WE7A 5IFLA 2X0JA 2GLXA 5ER6A 4GX2A 5K6AA 2HAEA 2J8ZA 4L8VA 2ZCVA 4B4VA 3IC5A 4PRKA 4CMIA 5JDIC 1H6BA 1U7TA 2X4GA 1I3KA 1PJBA 1A4UA 1BXKA 1UXKA 1LLQA 2PTGA 5LC1A 2O3QA 3WWYA 3BMCB 1JA9A 4WLEA 4DQXA 3BYZA 1XA0A 2IZ1A 3L6EA 4LN1A 4XYBA 1C3VA 1GUZA 4TVOA 4KQWA 1AN9A 2UUOA 3D3EA 1X15A 1VKOA 2YFQA 4R1SA 4PIVA 4YRBA 2B35A 1JWBB 1KC3A 1CDOA 4XR4A 1X1TA 4MVJG 4CMGA 1Y8RB 1DJNA 3GMDA 1C0LA 4L75A 3PIDA 3O4RA 2BI7A 2AMFA 3SJ7A 1EE9A 2OFPA 4MO2A 1WNTA 3VH1A 3H9JA 1H94A 1NYTA 4MVJE 1E7WA 3VOSA 4YQZA 3WGYA 2WSBA 3ITKA 1NQAO 3AOEC 1O8CA 3COSA 1HXHA 4DIOA 1HDYA 3HB5X 3IDSA 3JD2A 2NVWA 4RVHA 1SC6A 3P5SA 4MKXA 1JKJA 3KYBA 2C5EA 1GQQA 3CE6A 4Z0HO 1PZFA 4R1TA 2GRAA 2RH8A 3QLJA 4BNXA 4Y98A 5KCZA 2Q45A 4ALNA 1R0KA 2AEJA 3VTZA 3QIVA 4FS3A 2NQTA 4KOAA 5JLAA 5TQVA 5JAQA 2C20A 3G79A 3EZYA 3WGQA 4FN4A 1ZSYA 2AEMA 4E2ZA 4Y8VA 1GEEA 2VWQA 1VSUA 1LRKA 4B7CA 2TMGA 1E3EA 2CSUA 1I3MA 3BMQB 1C0PA 3I9MA 3ZWWA 1MG0A 3JD0A 3RU9A 1OMOA 2P9CA 4KP7A 1IOLA 4H15A 1HE5A 2QRJA 1Z82A 2W2LD 4N5NA 1K5HA 1K2WA 1R0LA 4IBOA 3WOHA 4RQUA 3OECA 2DVMA 3L0DA 4BKPA 2JAPA 4CMAA 2D4AA 2JD2A 5L7YA 4LCJA 2DBRA 3PFWO 5CDGA 3ADPA 1P1RA 3Q0EA 3G1TA 2CY0A 3MZ0A 4GX1A 5JE8A 4R9RA 2ILTA 4E2YA 2EKLA 3TJRA 1KERA 2HU2A 4R01A 2EV9A 2NVBA 3WTCA 4DMMA 4FFLA 1WPQA 1KIFA 1YL6A 4YB8A 3RU7A 2CDAA 2R00C 4AVYA 5GY7A 3RWBA 1KVUA 4YPOA 2YDXA 1Y9EA 3LC2O 2VHVA 3EMKA 4FFPA 5J23A 5A04A 1LBEA 1LC0A 3PYLA 4S3MA 3HJAA 4E2WA 1JN0A 1KVQA 1XLTA 3OJFA 4BOYA 5KVSA 1D1TA 3GVPA 4XR9A 1NHWA 4B4OA 2EG9A 4KUGA 4WECA 1EDZA 3F5SA 2PFGA 1UAGA 3RCBA 3ZW8A 1B7GO 1HDCA 3K73O 2CNBA 4CM8B 3SEFA 5FFFA 5JCJA 1PEDA 2UV8A 3GDFA 1OC2A 3QY9A 1NVMB 1PGNA 4GH5A 3U4DA 1V3VA 4CR6A 4QT0A 1QXSA 1VC2A 5JYDA 1NQOA 1N1GA 4PZCA 3ZU3A 2E48A 4FD3A 1U3VA 2PLAA 3V8BA 1P74A 1T1SA 4XB2A 3IKTA 1NR1A 1W6UA 2D5CA 3MWEB 4E31A 4K6FA 1N9GB 1E92A 5L40A 2NQ8A 4DPLA 3LQFA 3BMOA 4IUYA 4E5YA 3EHEA 3M2TA 4IDBA 4O0LA 1PTJA 5GZ3A 1YDEA 3BTOA 3NGXA 2WYUA 4DPKA 4PG5A 1ARZA 2IZ0A 5JMPA 1GPJA 3PI7A 3TOXA 1NFRA 4YCAA 4MP6A 1G6KA 1TLTA 2HK9A 4WCFA 3TZQA 1OC4A 1RM4A 3IUPA 4FFNA 2P5YA 3O9ZA 3VH3A 2NU9A 2YY7A 3F1LA 3AUTA 4XJTA 3F4LA 5TS3A 2IYOA 1JAXA 2RIRA 1DB3A 4K26A 4TWRA 1IUKA 4OIMA 2VZ8A 3NDJA 2YHIB 1SAYA 1W4ZA 2FSSA 5H82A 4XIJA 1NFQA 1ULSA 1ZMTA 1PQWA 2AEFA 2PGDA 3N58A 2BFMA 3DOOA 5T8KC 4KWIA 4GGOA 1CJCA 4PLCA 4L4XA 1NHGA 4L4SA 4WE3A 3VPXA 3WTBA 1D3AA 2CVOA 3A28A 3KYCA 6ADHA 4YT5A 4YAIA 4AJOA 4P4NA 4TKMA 4Z3KA 1LDBA 3L4BA 4BNFA 1TXGA 1KOLA 1JU9A 4AICA 1Z73A 4BO5A 3PQDA 4L73A 4XQCA 4BO9A 5JY6A 5ITWA 3FBGA 2B4TO 3H2SA 4PRLA 3S8MA 4RPGA 3SBOA 4UVHA 2VZ0A 3PHGA 3LDHA 4XQEA 2QG4A 1ENOA 3DAPA 4OAQA 4QO7A 3Q3CA 3DZGA 4Z0TA 2P4QA 5IZCC 2X7HA 3LZ6A 4BO4A 1DBVO 3PZRA 4PLTA 3LF1A 1YDWA 3ZHXA 1RM3A 4MVJD 3M1AA 3NTOA 2B69A 1HT0A 3GH3A 3HN7A 3GY0A 1Y5RA 4TZKA 2X1HA 2O2SA 2Y1CA 5MGBA 3QRWA 4C7JA 5A4DA 4CLOB 1YJQA 1K6IA 3GQVA 4CQMD 1KY5A 2ZATA 1KS9A 3GMSA 4LRSB 4ND2A 2QHXA 2NU6A 3INRA 3AJRA 3RKRA 4WLNA 1GYRA 4YT2A 3V2HA 5I9LA 1T24A 4LSMA 1IPEA 4ND3A 2J6IA 4RVDA 4MIEA 2D59A 5AXDA 1HRDA 1I2CA 3RBXA 2A9FA 3KSUA 2O48X 3MJTA 4EUEA 4E5KA 3HB4X 2DUUA 2QYSA 2XOXA 3RI3A 2PD6A 4AJJA 1FXSA 1UP7A 1Y6JA 4DXHA 5KJFA 3WGTA 4CUJA 2QRLA 5G4LA 5B12A 4D0SA 4UVEA 4FIZA 3OIDA 2R6JA 1NWCA 1E7RA 3MJVA 1XQ6A 4XB1A 4Y67A 3T7EA 1PU2A 3WICA 4EDFA 2GN4A 3U9LA 4JROA 3RAJA 4WLOA 3GT0A 4C7KA 1GFSA 4TRNA 2OGUA 2UUPA 4BGEA 5BQFA 3S2GA 1C1DB 3W4KA 4E5NA 1Z7BA 2HQ1A 3DFZA 3E48A 4EUHA 2W2LA 1UUFA 4YBZA 1N5DA 3NT5A 4BMVA 4RF5A 4IXWA 3R6DA 4WNCA 1Y8QA 5DBIA 1DO8A 4U0KA 4IJWA 3DXFA 4YT4A 3FPCA 4UVIA 1J4AA 1YXMA 1GCUA 2W8ZA 3Q1LA 5F3RA 5IXYA 1ZO8A 4HBGA 2NV6A 1K6XA 3HHPA 2Q2VA 4IDFA 4ZQEA 1LLUA 1ZJZA 3V1TC 2FY8A 3I9JA 1EK6A 4NMHA 1BRMA 1Q0HA 1E7SA 1NPYA 5ILGA 3P2YA 4XRGA 5L51A 2JCXA 4NFSA 2ZQZA 1UDAA 3F5QA 1JW9B 4E5MA 3MWDB 3FPLA 1OZAA 3JQCA 4J2HA 2HK8A 3FI9A 4XYEA 3SJUA 4O6VA 3AW9A 3NKLA 1QV7A 4BO7A 1I36A 4BUCA 4EI2A 3OQ6A 3ZW9A 1G0OA 5H81A 1ADBA 4TRMA 3RVDA 2Y1EA 3D5QA 4OQZA 1BWSA 4QO8A 3CTMA 1NFFA 5EN4A 1YOVA 3JQBA 3D4OA 3ZHYA 4LGVA 2Y93A 5KIAA 1HSZA 3ZHBA 3LT4A 3KSZO 1R15A 1QYVA 2PNFA 4UREA 2Y67A 1LQUA 3FR7A 4NI5A 4DPMA 2Z95A 3WQRA 4CUKA 1B0AA 1BXGB 4BNYA 3PYMA 1PL8A 1D7OA 4FB5A 4P38A 1CF2O 3GDOA 4GL4A 1LNQA 4H16A 1F8GA 1VL8A 1LSUA 2Q1TA 3Q2IA 5TF4A 1ADFA 2ZCUA 1M76A 4F6LA 3I5MA 5G4KA 1ZBQA 4L76A 4BNMA 3WFJA 3CH6A 3GFGA 1VI2A 1LQTA 4J0FA 1E3JA 4BO1A 4K1LA 4YXFA 3WQSB 4NQZA 3WQQA 4TMFA 2IODA 1GZ4A 4HWKA 4D0RA 3B70A 3VKVA 4LVUA 3STHA 4INAA 2AQHA 4GWKA 4M54A 3OQ1A 1WWKA 3KV3O 3ABIA 2XXJA 2JAHA 2IRWA 1G0NA 2C7VA 5C7LO 3C8MA 4BV9A 1T2FA 4IY1A 3WDSA 4B3HA 1JDJA 4IXTA 3SXPA 2CFCA 5F1KA 1SEPA 1TEHA 3GZNA 5EPOA 4XQGA 1VJ0A 4N5MA 2O50A 2Q1WA 1Z75A 2DM6A 1AXGA 3ZU5A 3GN2A 3L9WA 5A9SB 2ZYGA 3L07A 3LK7A 4F46A 3U62A 5A05A 1GUYA 4HADA 1HF3A 5F1OA 1DRUA 1D8AA 3EC7A 1KEWA 3G0OA 3K5PA 3QVWA 3DONA 3LT2A 4PG8A 2JJYA 5G4KB 3PFFA 3GNSA 1Z6ZA 3DBRA 2WEKA 1ONPA 5IDXA 1KVRA 3BTSA 3PHJA 2VHYA 2AXQA 3PTZA 4IINA 2VWPA 1I8TA 4R4JA 1YRLA 4GX5A 2QRKA 4XGNA 1PL6A 1YS4A 5AYVA 2VYND 3HADA 4U6QA 3FNFA 1SBYA 1KETA 1I0ZA 2DTEA 3I6QA 4WUVA 5GZ6A 3JCZA 5LCXA 4BGUA 5L45A 1UP4A 3WLEA 4CLEA 4GWGA 2Y99A 3GUYA 4XCVA 2ZTLA 2I5PO 1GY8A 5JO9A 1KEVA 2V6FA 2J3KA 4AL4A 2EKQA 4P22A 2DC1A 1HZZA 1TT5A 1U5CA 5KJ6A 4NR0A 1M67A 4YA6A 4YT8A 2O2YA 1PJ2A 1OI7A 5I8ZA 1PJLA 2NUAA 4W82A 1R37A 3ETGA 2X5OA 1CYDA 5MDHA 2NADA 1GEGA 1U4SA 1ZMOA 1NBOA 4CQMA 5K9ZA 2VHXA 4XGKA 1X7GA 4CMEA 3IUSA 2X8LA 1DLJA 3FR8A 4PLHA 4QEDA 3PJFA 4BNLA 4I9HA 3QWAA 2PGJA 4RORA 1PQUA 2O7QA 4DUPA 2IXBA 4C4OA 1ISMA 3DR3A 2W2KB 3NDIA 1XU7A 4OXYA 1EFKA 2GPTA 1U8FO 4Q3DA 4QSMA 3LC7O 4ZGWA 3HDQA 3H9QA 5IJZA 3EDMA 1ZIDA 5G2OA 2C54A 3RIHA 3X2FA 4I1IA 4MP8A 1M6WA 3AM3A 4UVGA 2AW5A 1EVIA 2O3TA 2OBYA 1P1IA 4OGWA 1TT7A 1U3WA 1HTBA 1MXFA 3JYQA 2HJSA 1HWYA 1P33A 4LCEA 4LVCA 5JY1A 3L6DA 2UYYA 5IXSA 4N7RA 5FI3A 4Y6PA 1WMAA 2X9GA 3VZPA 4HNGA 3TNLA 2HMVA 4RLHA 1WZIA 2A4KA 2ZB8A 5BR7A 3GVIA 5C7OO 1MC5A 1LDYA 1MB4A 4R1UA 1LTHR 2X0IA 3OJ0A 5L9AA 1XELA 3JYNA 5JPIA 3U0BA 4UAGA 1B8PA 1LA2A 2CDBA 1GV1A 2FZWA 3MTJA 3UW3A 4RPLA 2NU7A 1X1EA 2BFPA 4CQLB 3ZHZA 2CDCA 4BKOA 5DP1A 2NLOA 3GG9A 3GA0A 4IDCA 4RF2A 4Z9YA 3ZWOA 3H3FA 2Z5LA 4BVAA 1PZEA 3NTQA 2E49A 4MKZA 4FDAA 2PKQO 4B79A 2EWMA 4HFMA 3PRJA 2RHRA 4DC0A 3NAQA 1H0KA 2FR8A 1UZMA 2YV3A 3K31A 3OIFA 3O03A 3ORFA 2DPGA 2HMWA 2B4QA 4ID9A 3RUHA 2VWHA 1HDGO 3JYLA 4ALJA 2DTXA 1GYPA 3VDQA 2H1SA 1MC4A 1DC3A 3ONFA 1XG5A 4IMPA 5EJ2A 4FOSA 4ILKA 1IYZA 1SOWA 2Q2WA 2FRDA 2J3JA 3BMCA 3VPGA 3JQ7A 4PLPA 1DPGA 3NTRA 2V7PA 2SCUA 2H6EA 4CM4B 2GZ2A 4B7UA 2PH5A 4IM7A 1E7QA 3DBHB 3EZLA 4E2XA 5CEFA 5ICMA 4HKTA 3DMTC 3G3EA 4DQUA 3C1AA 2BI8A 3OIGA 4AJ2A 1DRVA 1IB6A 2GGSA 3NT2A 1Y8RA 5BNTA 2YHUA 1N7GA 3GGPA 4LISA 2NTNA 1BW9B 2IZZA 3E03A 3FNEA 3KOUA 4NH4A 2JL1A 3PHHA 2ZJ0A 4WGGA 1ONNA 3ANMA 2HRBA 3CIFA 5F21A 3VHRA 4YTEA 3DTYA 1FDTA 1WDLA 5KNLA 3JQ9A 1LI4A 4WCDA 5KJCA 1WXDA 3OQBA 4GBJA 5F1PA 4BNGA 1LSOA 1BVUA 1RPNA 1GZ3A 3LLVA 4P4GA 1YB4A 1E5QA 1E5LA 1WP4A 4EEZA 4D44A 3F3SA 2DPHA 1BTOA 1TA4A 2HO5A 3I52A 3JQFA 2X0NA 3GNTA 3TRIA 4HP8A 3WBFA 3WIDA 2F1KA 1G1AA 2NNLD 2GN9A 2YQ4A 4WPGA 1HDZA 2FSVA 5JW6A 3TL2A 3OA0A 1X0XA 4TQGA 5JO0A 3GPIA 3K8ZA 4NFHA 4URFA 3PP8A 3ROKA 1U2GA 3JQ7B 5A5EA 3U09A 4I5FA 1K0UA 3OEYA 1P1KA 3EUWA 1NASA 3JD1A 3KUXA 3BMQA 3BTVA 5KWEA 3OEWA 1T2CA 3PDJA 2PD3A 3QWIA 2C2XA 3A1NA 3W8EA 4E0BA 3ADOA 1F17A 3F6YA 4UULA 1Y9AA 2WE8A 4BMNA 3IJRA 1DJQA 5IN5A 1RYEA 4UEKA 3V5NA 4YAKA 4DMLA 1I5RA 2CVZA 5CDUA 1VM6A 4E12A 2EIHA 4HX5A 4JGBA 4KDEA 1OBFO 4QUKA 4RO0A 5A06A 3LF2A 4FCCA 3H65A 4DVJA 4GGPA 3MJEA 2VYNA 3RC2A 3TF5A 4R16A 3PJEA 5BSFA 4KUHA 4J7CA 2C29D 4OXNA 3ULKA 3K30A 3LT0A 3LYLA 4IDGA 3KEQA 4BNJA 5JC8A 3W8DA 1EUCA 3ZWPA 5TLSA 2ET6A 5BSHA 1ADCA 1DFIA 3C7DB 4DTIA 4EEXA 3E9NA 4LK3A 2VNSA 4PLVA 1E3WB 4CM6A 1A5ZA 5TGDA 4XIYA 4RV9A 2NTVA 3L4SO 3GGOA 4P4LA 3AUSA 4EJ6A 2W4QA 1OAAA 2RHCA 2VN8A 1GCOA 1R4MB 1YL5A 4TKLA 3DBVO 4CM8A 4ZQHA 2EJWA 4U7WA 4QTZA 1B8VA 1JKFA 1NM5A 1GQYA 4YVFA 5DN9A 2OP0A 4J6FA 1QR6A 4IMRA 3M6IA 1DAPA 4UUMA 1LDGA 1ISHA 2D5AA 1MG5A 3W8FA 4FC6A 4RPKA 1N9GA 3AY6A 1PS9A 1GAEO 4IGFA 2EGGA 4KDFA 5AVOA 3C85A 1BXZA 3OJOA 4NZ9A 1U7HA 1SO8A 2YW9A 1NP3A 3P19A 2D8AA 2X0RA 2D1YA 2P4HX 2Y0DA 3HWRA 4D7AA 2DFDA 3FWZA 4Q3AA 3OF2A 3ZNPA 5CP8A 2BELA 2C2YA 4A27A 5THQA 3GRKA 3A9WA 2I3AA 2D3TA 4WEQA 3ZH2A 4U8GA 5AXAA 2YZ7A 1NXQA 3D1LA 4CODB 3RD5A 1B8UA 3WXBA 3IOYA 2YV1A 3PXXA 3C7CB 4OQYA 1IHYA 1EZ4A 1CIVA 3MJSA 4CM9D 5C5IA 2YHIA 3WIEA 4PN3A 3KXDA 2XF8A 1BDBA 3UOGA 2G76A 1K89A 3OM9A 4ZRNA 2PH3A 4GAEA 4R69A 3CUKA 3B6ZA 4MVJF 1PJSA 2PK3A 3CMCO 1ORRA 1JTVA 1HZJA 4ALKA 3HDJA 4DYDA 4OO3A 2GDZA 2VHWA 4BMSA 4DL9A 1V0JA 2PD4A 3PLNA 3IP3A 4FW8A 1V9LA 3QA9A 3ZNNA 4OMUA 4AJ1A 2Z1NA 1PZHA 4D3DA 4N54A 2X58A 3ZDFA 5TIIA 1EVYA 3SC6A 3GUCA 1H2HA 1JAYA 4GX0A 5JCXA 3KETA 1JQBA 3JYOA 5JMWA 4H3VA 4OOEA 4LW8A 3PIIA 2OBNA 5KKCA 2EXXA 3DTTA 4XDZA 3UGKA 4D3FA 3DZFA 2P2SA 3K92A 1UXHA 1N92A 1H6CA 5HS4A 1H6DA 1HDXA 1M75A 2RH4A 3KO8A 4NK5A 2I66A 1ADGA 4L9RA 3S2FA 3NV9A 5ICSA 2WDZA 4CLOA 3DZHA 4L4RA 4CJXA 4XYLA 2P68A 4GSLA 4CL3A 3V1UA 3W6UA 3PWZA 2FPGA 4D46A 3T4EA 4CV1A 1T4BA 3LU1A 3VZQA 3AOGA 4ZQFA 2Y1FA 4Q3NA 4XZ3A 3VZRA 5FYDA 2HDHA 4QXMA 2FR1A 2Q2QA 4R1NA 3WSVA 5CEJA 1DC6A 3KZVA 1XQ1A 2BMAA 3VZSA 4TSKA 4DA9A 2FHSA 4A5OA 5KTKA 3NRCA 1T2AA 5L4LA 5CDSA 4RGBA 4YJDA 1LRLA 2VHZA 3DOJA 2R2GA 4M49A 1HYHA 3V2UA 5L7WA 1FDSA 3JD3A 2W90A 3PGJA 3ASVA 5ADHA 1P0FA 3GNQA 4K6CA 4RVFA 5L4NA 3I23A 3NDRA 2VCYA 5JDCC 3RASA 3TPCA 2FMUA 2I6TA 2DAPA 3KTDA 4I9NA 4J16A 4E33A 4R5HA 4FSHA 3QVSA 1HEUA 3H5NA 3ONDA 4KMSA 4F45A 3LLSA 1IULA 2A92A 2O3JA 1B2LA 3R1IA 1A71A 5H83A 3ZV3A 3NJ4A 1J0XO 2CUKA 4IGEA 4BKRA 1NWHA 1QORA 1EQ2A 4OJNA 4FGWA 4PZDA 3C1TA 5I7VA 4TVBA 1E6EA 4PZEA 1UZLA 3OFSA 4XWYA 3FHLA 3EK2A 5B37A 1C1DA 1O5IA 1E1KA 2HCTA 3WG9A 5FI5A 4PLZA 3ANLA 2NU8A 4GSKA 5TT1A 2AQ8A 3INTA 4GI2A 3PLRA 3SC4A 2G82A 4ZQGA 2C7GA 2PA3A 1EK5A 4M89A 3MOIA 1A72A 3MJCA 2WM3A 3H9UA 1MP0A 4M8SA 4GKBA 2X9NA 1P9LA 1GD1O 1M2WA 1GDHA 2AQIA 1JVSA 2Y66A 4QFDA 2PR2A 1WVGA 5EMHA 3VPSA 2HRZA 4W7HA 1XHLA 2I99A 3AM4A 4J2OA 3QWFA 2X5KO 2C59A 3E9MA 3L6OO 3KLPX 4J91A 4ALIA 1IY8A 1DAOA 3CSDA 3ETEA 4GQAA 3DZJA 2H63A 4QECA 4J0EA 3TZ6A 4G81A 5I7EA 3B1JA 2DU8A 4MKRA 1R4NB 2X6TA 3ICPA 4RLSA 4AJEA 3RUAA 5CFZA 5B1YA 4GPD1 5AXBA 2VWGA 3H2ZA 1P0CA 4XDYA 2PY6A 5JAIA 1YKFA 2HSDA 5B4VA 1BXGA 1P1FA 4Q9NA 3RC1A 1ML3A 3INGA 4WKGA 4N5LA 1UDCA 1F06A 4IDDA 3I1JA 4TZTA 3K2EA 5CDYA 3UCEA 3BZUA 4DLLA 3I9OA 5JDIA 3HSKA 3F46A 1I30A 5A03A 1L7DA 1ISFA 2TMDA 2E82A 5DOZA 2BFAA 4RVSA 1VKNA 2GASA 4R3WA 4B8ZA 1IHXA 4BO3A 5K6AC 3DZIA 3FNGA 5TC4A 3WJAA 2AA3A 3I4FA 1YQDA 3TSCA 4JX8A 2YYYA 2OXIA 4CL8A 2P9GA 2JKVA 2LDXA 2PZLA 4H7PA 5B4UA 3Q2KA 3JQDA 5DP2A 3ENNA 1NQ5A 3S2IA 3BHJA 1RJWA 1NVTA 1I10A 5AQ1A 4ROSA 2AE2A 3HZZA 2EF1A 3PJGA 2G5CA 1NAHA 3AOEA 1Y1PA 3KSDO 2GN6A 4NJMB 2PWZA 1DC4A 2X22A 4B4WA 2IE0A 4BL5A 4BNVA 2WWRA 3JQGA 1YL7A 1KEUA 2BFOA 1CEQA 4CM9A 3BMNB 4JCOA 5A9SA 2QZ9A 2VOJA 1SB9A 4J7UA 4NBTA 2PZMA 1DIRA 1GZ6A 1Q7GA 1ENYA 1FK8A 2Y1DA 3ENKA 2D0IA 3F1KA 3H9EO 3WYCA 3Q9UA 4EBFA 1NQTA 3VPFA 4DWVA 4YJFB 3WYEA 4AJHA 1J5PA 4NIMA 3KM0A 4ND1A 3C7AA 2WYWA 3VAZA 4J1NA 3D3WB 2ZQYA 3UUWA 4IQGA 3Q9NA 3A14A 1R16A 4AG3A 2NVUA 5CDTA 1IL0A 3GVCA 4JP3A 1ISGA 1QG6A 4A7PA 1DHRA 4BQRA 4Z6KA 3ZU2A 1B16A 1YB5A 3DMYA 3KVOA 1L1FA 4D43A 3AK4A 4J1SA 3JQGB 3HG7A 1TVEA 4RVUA 3DFUA 4ZA2A 3ONEA 3TFOA 1DIBA 1PJTA 4WASA 3RUIA 3ZV6A 2R00A 2JCYA 3OBBA 4IQ0A 2O4UX 3C3XA 3I6IA 2X5JO 3JV7A 2ZIZA 1BVRA 1EVJA 3NT4A 4MDHA 4XD2A 1GADO 3GRPA 2GSDA 3JTMA 4BO6A 4RF4A 2W2KA 1E7MA 2C0CA 1T2DA 3TZCA 3GEDA 1J6UA 4J43A 4IDAA 3IS3A 4GVXA 1QYWA 2IYPA 4IS2A 3IKVA 1XSEA 3DAFA 1NNUA 4F6CA 4RCVA 2Z1MA 5HWSA 4F3YA 2ZJ1A 2Y0CA 2ZB3A 4L74A 3UHAA 4P8RA 2NVUB 3RJ5A 5IF3A 4J1TA 3KB6A 4I5GA 1ZVMA 4JNKA 1ZJYA 3PVZA 1PJCA 4ND4A 5ILOA 3VC7A 2GD1O 3H8VA 3FTNA 3ZNQA 4MVJA 3H3JA 4MIOA 4DLAA 4BNKA 4ZN6A 3QVOA 1DRWA 1OOEA 1LDMA 3NX4A 4FBGA 5DCUA 4BB5A 5DBFA 3GAFA 3WMXA 3AI2A 1SMKA 1PGPA 3P7MA 3RC7A 5KJEA 5T67A 1PJ4A 4O1MA 2D2IA 2OMEA 2EEZA 2VYVD 4BB6A 4HY3A 3KLMX 4X54A 1R6DA 3X2EA 3RSHA 1A7AA 1ZEMA 3L9XA 4CQLA 1LSJA 4WLUA 3RFXA 3JQ6A 1XDWA 1XR3A 4YRAA 3LVFO 1XCBA 5DULA 4OSPA 9LDBA 1EDOA 1MX3A 4WCFC 2V6GA 2Q1UA 3NUGA 4RL6A 3HNPA 4IPTA 4YJGA 2JHGA 1PQPA 3GC6A 3I9LA 3Q11A 4Q3BA 3PZBA 3OETA 5T64A 3AY7A 2B36A 3PDUA 3PJDA 4G2NA 2P9EA 4B3IA 4BQPA 3HQ4O 1XWFA 3UN1A 1Z74A 3MOGA 1PR9A 1I24A 4QQRA 1LRJA 4R3NA 5T8KA 4CPDA 4GMGA 3WGOA 3WR5A 4ZICA 4IJKA 4CLRB 3FTPA 3KRTA 4U6SA 1NTOA 4PG6A 1KVTA 1EMDA 4YJHB 3TZKA 3WGIA 1PWXA 3A4VA 1LLDA 5U1PA 2PZKA 1ZH8A 5EQDA 5G0UA 1HDOA 1CETA 4BNWA 4Y6SA 4KQXA 1ZUD1 2PKQP 3VH2A 4KTVE 4GMFA 3WNVA
chains in the Genus database with same CATH superfamily
1N0IA 2J08A 2JIZA 2OB1A 2P4EA 2OA0A 3AU8A 2JBAB 3PGXA 2JFHA 2I3GA 3W1VA 2JZOA 4OFWA 5COQA 4HDKA 2VJOA 5EZYF 3X43A 1VLLA 1JSCA 4EY6A 3QUQA 2O8EA 3H16A 4G5RA 3HN2A 4L28A 4O5OA 1XZKA 2LWIA 3H83A 1Q2UA 3H8SA 4JP5A 4DDUA 4MQ5A 2NZUG 4OFZA 5IZCA 3Q8LA 1Z68A 1EGVB 4Y2TA 4AJIA 1TJ5A 4IQ8A 2CYCA 1GPAA 3JASB 3T3IA 3NVMB 1IEVA 3AKEA 2GRJA 5IN4A 4CKBB 4RH3A 3U13A 2HK7A 1GNTA 2OXCA 5KI6A 2WIJA 3RFUA 2GN8A 5J2TF 4YJGB 1Z0UA 1GL6A 2FMFA 3O2SB 4YECA 1G291 3QU5A 3PNVA 2YQZA 1Z5ZA 1M6VA 2DQKA 2I33A 4FUQA 4HAXA 1RHKA 2EW2A 4GLBA 2HF8A 3TL6A 4JIGA 1TB4A 2G1UA 2HK6A 3ZTYA 4BN4A 1I33A 3JW8A 1NG9A 1TCBA 4MW9A 3ET4A 1T91A 2ZE5A 4C07A 1WNFA 4FR5A 4FD2A 4ZVNA 5GWXA 2M6LA 4AZ3A 1YKGA 2GBLA 2J45A 2ZJ6A 3CRMA 4B2IA 1I6KA 1M8KA 1SXPA 3DLCA 2CF6A 2PSFA 3GUHA 4GLOA 2QYHA 4JMPA 2QAGA 1V8PA 1IN4A 1WCIA 2LRHA 3PNQA 2WBLC 4MRPA 2QIOA 5B4TA 1HE8B 4U7TB 1XTZA 3MJ4A 5GV8A 3EY4A 5IJWA 5JNTA 1R6UA 2VC2B 1E1QD 4YRDA 4AMVA 4M76B 3NHPA 5JHGB 5LXTA 4NU8X 3GEBA 2AJLI 2FQWA 5AK4A 4ITUA 3HKCA 4ZI5A 4FHGA 2O8EB 1X7ZB 2QIPA 2YUTA 3AERB 2F67A 4UARA 3A3KA 1SQ5A 2D2FA 2WTBA 1SB8A 4MOWA 4RGQA 3ESZA 4C9BA 4RULA 4KPYA 2YHSA 4X94A 5TR9A 4CYMA 4N8DA 3MCWA 3VXKA 4LF8B 4R51A 4CRWB 3HUFA 5DMHA 1QC5B 1LPOA 4G23A 4RD0A 2DFPA 3LXXA 3TH5A 1DBRA 2FFQA 1P44A 2Q99A 1IQPA 2X6RA 4V0SA 4LY9A 4UUPA 3P2JA 4D42A 4EF5A 1T9HA 3N74A 4JLWA 5IRCD 3TW8A 1EJ6A 2AFIE 1ZZEA 2ATVA 2OEPA 4LC1A 4IO1A 3NP7A 4OSOA 4B83A 4ENVA 1NVEA 1XZCA 3W1WA 1Q1NA 2D7CA 4YQFA 4Q1AA 1PFVA 3QI7A 3ILHA 1MC1A 4MYUA 4XLLA 1IK4A 5TV2A 1JJ7A 1QHFA 3MBOA 1EKXA 5WRFA 2GBCA 5BN3A 4QT4A 3G2LA 4V3BA 3LY5A 2B0CA 4ISBA 1CR4A 2Y0EA 2G4VA 1C7IA 1LBSA 2AMJA 2BPOA 4JJ8A 1B6TA 2BHLA 3I2JA 3ZWNA 5LYJB 2CXXA 4ZJPA 1R4AA 2PANA 4WFKA 1SK9A 2Z58A 4IGKA 1EAYA 1WEHA 3PFGA 5KDDA 5U4QA 5C3UA 1JHOA 2GZ1A 3L8DA 4HUQB 4ENPA 2QLTA 1SOUA 1E3WA 2GZSA 2ZBRA 1VBNA 1JT2A 1EFDN 1QO0A 2WOJA 3FBTA 4II2A 3JY6A 2QRGA 3WRXA 4EFNA 3OSUA 4JR0A 5M7EA 3JQAB 1LTKA 1Q0QA 1NXSA 3AU9A 3DKIA 3LQ1A 1HORA 1E5DA 3DQZA 1SCBA 5AM2A 1I2AA 2IZ7A 5LA6A 4PPFA 4PFSA 3BD7A 1L5HB 3DFKA 3HACA 1S3IA 5DHUA 1GA1A 1G19A 3EJ6A 1O94A 4W9NC 3UV7A 4AUEA 3R0IA 3HO6A 4G4SP 3GEEA 1JV2B 3I9V6 2B7CA 1O08A 5IAGA 2E4XA 4EENA 4OJYA 5FH9A 5MFPA 1J1UA 1XLUA 2CMGA 1ZLYA 1YR3A 2F8LA 2LIPA 4LX8A 4ND5A 5GMOA 4QXAA 4RVGA 4TUYA 1MIHA 2MIIA 3MCTA 1BD3A 2C31A 4B3JA 3EEOA 1ULAA 4R41A 1MD9A 4JBHA 3V55A 1ACLA 1BS2A 4ONEA 3GRVA 3DOCA 5TJ9A 5IBRA 3VVMA 4BNDA 5JYCA 1RWNA 2HR1A 1G8MA 1RE1A 1DAEA 2O6HA 5BN3B 1J0BA 3AJ9A 2PWBA 2C8JA 4BLRA 1DOHA 5IP5A 3JQBC 1H4QA 1UMCA 4K86A 3SHFA 3NHSA 1KR2A 4Q3CA 4ZT6A 4EJ0A 3BFKA 3PPYA 5CX1A 1U1IA 4RL4A 4TX1A 3VTAA 3EUFA 1JLKA 2XUKA 4RSHA 1EM8B 2D1QA 2GDJA 1TC2A 2VA8A 3T3OA 3V4LA 4WBNB 1V5GA 4BP9A 1R8YA 2HA2A 2J5RA 4YRQA 3RIYA 3OE7A 4EJSB 4UTVA 3AIMA 4HUJA 4EB6A 2RJOA 3S70A 2DKNA 3W9BA 2R1VB 4MYTA 5LA6B 4UBLA 2CHEA 4TLAA 3ZDCA 1YONA 221PA 1SZPA 4Q7MB 4FOOA 4JJKA 5IUNC 3T52A 1EE2A 1AN0A 1W0KA 2VYVA 1VRWA 1X9HA 1ISSA 2ZIEA 1XZMA 2OP1A 5DEIA 1F20A 3F71A 1XN4A 1ZUWA 4KQ9A 1NXOA 4Q9HA 4YDHB 1G2OA 2B37A 4KO4S 3HY4A 2H5LA 2QYOA 2ZT5A 3NBAA 3R8CA 3HCOA 4YR9A 2ZYDA 4UQLA 1ZQ1A 1LK7A 1XTTA 2Q2OA 3GJ5A 3MTDA 4NARA 4H4DA 4RYDA 2XD9A 3IEKA 3RV3A 3KJZA 3P27A 2O23A 2QX9A 1OU4A 3SYLA 1U4OA 3IP5A 3E81A 4KNVA 1SU8A 3BIOA 3DBLA 2I3ZA 3JS5A 3NLLA 4LOJA 4R0VA 3SQDA 5JALA 3HXKA 1HNWB 1VPVA 2QSYA 5I7FA 2B2XA 2BZGA 3G5TA 4D8UA 4CMHA 1CDDA 2CUZA 2P65A 5CX1B 3RF6A 1CD5A 1UT5A 3ACBA 3QHAA 3GEGA 3T9FA 3G7NA 4AS2A 1QH0A 5JWRA 1OTYA 2G70A 2YY5A 3DXZA 3OCVA 3JAKB 4H0FA 3ICCA 1RD4A 1RPJA 1QPBA 1RM5A 3AHGA 2VS1A 4EK9A 1ADYA 1II8B 1Y7IA 3R5JA 4LJAA 1H65A 2GCNA 4KPUA 1KEKA 2BDUA 3AHDA 4HGQA 4JLNA 4MW0A 4GLFA 2VRCD 5ALZA 5I7AA 2KSQA 4MR8A 3VR2D 2GXQA 1MQSA 4EB6B 4Z7JA 3M1LA 2IH2A 3QX8A 3P9YA 1AQIA 2EZ9A 2XDYA 3C4QA 1U0LA 2CCJA 4M4SA 4OPMA 1GZ5A 1WOMA 2NZXA 3TGLA 1V39A 3RRZA 1N2HA 2YV2A 3WI7A 3EODA 4BKUA 4DDWA 3T9EA 1WXGA 4YLYA 1NVVQ 5JNVA 9GPBA 3E82A 1YC5A 3K6KA 2HBRA 2FMHA 2VFAA 4EZBA 4JJEA 1XRLA 1IIBA 4B8WA 4DV5B 5KPJA 5CA1A 4YDSA 5EHXA 1ONOA 2G83A 1P77A 1F14A 2QRVB 4XUEA 5EMJA 2GPSA 2WKSA 4FJ2A 8MHTA 1VMKA 3NBMA 4NU5A 2CD9A 4B6GA 5JXJA 2Q3JA 2WD9A 2XY4A 1T1GA 4G0ZA 3COZA 3EVEA 5C4MA 1PR3A 3VSDA 1HETA 4BO8A 1R0SA 1XGKA 3DBLB 4HEHA 4XWWA 1EX7A 2QJWA 1GNSA 1NAIA 3CIOA 4HGNA 2FE4A 4XWAA 4BECA 3PC3A 1P2DA 1V4BA 5KWVA 1GFWA 4QNNA 2UAGA 5KZMB 4PC2A 1UKZA 2W9XA 5EJ8A 1NYRA 4GEKA 1KOGA 5ENVA 3KVNA 3SQNA 3BHMA 3D59A 5ED4A 3N3AC 2V5VA 2NOAA 3LLCA 2FUNB 4C6RA 1R3UA 3B13B 3LFHA 4KVGA 5CVJA 4BCBA 2CBXA 3Q6MA 2QDKA 4RZIA 5F9MA 4YAGA 1TIKA 4RHCA 1MKYA 4YN3A 1QG0A 3QGMA 5DOVA 4BZPA 3NOQA 3CZMA 4UNIA 3GD5A 3SQWA 2A33A 1FX0B 1X8KA 4B17A 4B35A 4G97A 2HREA 1D2EA 2BGMA 5B58C 2J09A 3UFXA 3AR3A 1RWXA 1UDRA 3IP9A 2VH2A 2HFKA 2ETVA 1JXMA 1MGPA 3VOBA 5TJHA 4DSZA 1RI1A 1OIXA 4DJAA 3V80A 3FPFA 1YBMA 3TXYA 4J3NA 4D25A 4GF5A 4UD6A 3RROA 5KYGA 3ZQ6A 2I9PA 2EHDA 2JI9A 4PX9A 2J3LA 1AHNA 5I9MA 5AIBA 4ZPJA 2AW3A 5LNK1 4QBGB 3S2EA 2PYZA 3ZD6A 4RETA 1PZGA 4IDEA 1EU1A 3BE4A 4FJ0A 4D99A 1RLJA 1ZNQO 4LMPA 1V2GA 2Y92A 2Z57A 1B14A 5FOVA 4JK3A 5LFAA 4OLHA 1K88A 4XQ0A 4NBRA 2HJ9A 1SQSA 1E77A 2ERXA 1S6YA 3QOXA 2GOYA 3KAKA 1A4XA 4DR6B 3A1DA 3GFVA 3L7DA 4CMBA 3G9ZA 3HRHA 4L8GA 2BZ0A 2EOAA 5JSYA 1JALA 4NHEA 2A1UA 3AP3A 2XUIA 2RBEA 3QVTA 3ZV5A 3H2JA 1J0CA 1D0SA 1F0YA 3HS3A 4FLFA 4B6SA 3Q7RA 1BA2A 1E4VA 1P2VA 4MPDA 4PYOA 3CURA 5E7MA 1ZNZA 3N86A 1HFJA 1TJ4A 3NOXA 4HN4B 3R7WB 4N0EA 4DNFA 2BRUA 4XJSA 5JXWA 3PPIA 2WU1A 3AXTA 2I7VA 2W6QA 3NORA 2HTFA 3AIOA 3VR3D 3FYUA 3VJRA 1K27A 2OV8A 3AW8A 4O59O 1SPXA 3JQEA 2BMVA 4FFMA 5EPUA 4OJMX 3D4BA 2J4DA 4ZMBA 2A94A 2AG8A 5DF1A 3GP3A 2Q4BA 3NJ8A 3KG2A 4WCFB 3GP8A 2ESRA 1EFLA 3OAAD 3N8HA 4U9HS 3FHOA 3IAHA 1XXLA 3P9PA 3WNQA 1G9XA 2E4AA 2EFCB 2VHQA 3O90A 4MPTA 3MYYA 4CT4B 4C6SA 2W6NA 3FPGA 4P83A 3PUZA 1AQUA 3ZWDA 1QP8A 3PXAA 1ISPA 1GPMA 4H7HA 4HCJA 1I4EB 1PK7A 2W2QA 4G24A 4OM8A 1KPHA 1JP7A 4B6JA 1LNZA 2ZUBA 2HBQA 3HLYA 2HSWA 1YZFA 3WLIA 4KIUA 3BQNB 3U1TA 4H1WA 1KO5A 1WMDA 3DDWA 3IUJA 3RYHB 3NGLA 3MCZA 1UOEA 1EGMB 4BNZA 1XAHA 2FFAA 1PFUA 4G01B 4BZQA 2FR8C 2YCBA 5BNFA 3CXRA 3ZGYA 1XXHE 3WSTA 2W6PA 5CCDA 3N2GA 2RG1A 1XVAA 4O4IA 3KT6A 1UBCA 4A9AA 2ZUWA 3VKHA 1SU7A 2ORVA 1B6RA 3FMIA 1Z0FA 4OU5A 2Z2IA 3U5TA 3IXMA 4LG1A 1OSNA 2HO4A 3BH0A 2ZJYA 1NN0A 1HT1E 3WDMA 4ES6A 4B3MB 2XQIA 2ZPTX 3IODA 4LHYA 4TROA 2ONCA 2ZUUA 5EESA 1AMOA 2Y68A 4GE0A 3G2QA 3WLFA 1OLOA 4IJMA 1Q7BA 2OOKA 2PX8A 1BDMA 1VFPA 3R3XA 2CXQA 1LX6A 2ZSEA 1W8DA 2CB9A 1IH8A 2L69A 5EE9A 3L7IA 3TJZA 3VHXA 3QPDA 5T4FA 5AM3A 2JRLA 4I2VA 4E2FA 1DUVG 1I32A 4OSEA 1NMZA 4GPAA 3KTAA 4E5SA 5CAEA 5EJ6A 1QP4A 2Q21A 3AV3A 3CF4G 4M37A 5DXFA 5JD5A 1IN8A 4MYCA 1NF2A 5LUBA 3FROA 2X9QA 3VAAA 1MRNA 3CLTD 3IP7A 3P2EA 1XRQA 1YQ9A 4BEJA 3CY6A 4CMCA 2P41A 3BMNA 1IXYA 4DVGA 2X3UA 1H6AA 4FN5A 1LJ8A 2C61A 3QVLA 4GKAA 3L02A 3F90A 5B2FA 1CQIA 2CVQA 1VGRA 4FWIB 4HV4A 4NZPA 4PLFA 3BH6A 4EYSA 3HJBA 3ASYA 1DAMA 2GILA 4KDRA 4BGIA 4KH1A 3ANSA 2KPOA 2XQGA 3BQ9A 1EFCA 4IOLA 2O2GA 3E3NA 4AUNA 1FW6A 1V95A 4BX0A 1FTNA 1U5AA 3E58A 2OHVA 3SDZA 2JCVA 3W2TA 5C7YA 2O8BB 2YJNA 1NRJB 4NK4A 2EP7A 5JFOA 1B6GA 1KPGA 16PKA 2YNMC 5C8DA 4QGBA 5EIFA 2XJ4A 2EGHA 3QKRB 4FQ7A 1ENZA 3WKAA 3TB4A 5ERXA 1UWLA 1OH8A 1MO2A 2CHQA 2IF0A 1EXNA 1OJ7A 2B8TA 2JD1A 4WH0A 3TX6A 3ZDYB 4EPRA 4TVSA 1T2UA 3R4CA 3T7CA 4EYQA 5CGZA 5EVJA 1QDEA 1KTIA 4AECA 3NH6A 1H2XA 5B2ZA 1OAKA 1U8YA 1W0CA 5JJ5A 5TS2A 2BSAA 3HI4A 3S1LA 1THMA 4HAUA 1I5EA 3ZCPA 4R5MA 4CKEA 3DE2X 3MRXA 2HJWA 5IDWA 1RWBA 3SYTA 3CT4A 4BKMA 4OG2A 2DETA 1UOPA 4G0MA 3D6VA 3SOZA 5K0SA 3GT7A 2MHCA 2IIPA 1VCOA 4ZAWA 4PYRA 1E8MA 4BNHA 3F9IA 3CPSA 5KTSA 2B0JA 2XQVA 2R4TA 4XLZA 5EZSA 3JQAD 4UUNA 3Q0TA 4BVLA 2ZIFA 1P0QA 4OL9A 1IZYA 3N8IA 3KQOA 4H7DA 5DT9A 5JBNA 3GXBA 5A0FA 1AUQA 1Y7PA 2E89A 3PHLA 4J9VA 3SNKA 2J3HA 4QOEA 3UXHA 1SZJG 3MQ4A 4AKSA 4KU4A 1F60A 3HL0A 4YV1A 3NDBB 2JB9A 2GYYA 3ZKWB 4C2AA 1SEVA 3STTA 5I8WA 3WOVA 4Q3EA 1LEHA 1PS0A 2OO5A 5K0GA 1IAQA 5H1YA 2EFHB 5JZ9A 1KZGB 3CONA 3OJLA 4HDRA 1KI8A 4AM8A 4HX9A 5FHQA 1UBUS 4LF7B 2XPCA 4NICA 5EUQB 4WL0A 5FBVB 5JNWA 1BHQ1 1PSWA 5KMGA 2ZK7A 8ADHA 2GPBA 2JGFA 4OGFA 4RA6A 4RGYA 4FE3A 4NCJA 5DFAA 4KFSA 4UU8A 3U56A 3MSCA 5HKBA 4U8HA 1YQXA 3CLHA 3SKYA 1S1MA 2PO5A 3JZDA 4NV0A 4DSTA 4YCNA 2BEUA 2PN1A 4RENA 1E62A 1VMAA 2OWDA 3AFNA 4L27A 5D01A 4DQVA 2B4YA 3BE6A 3K0EA 4KIJA 2COKA 1L5QA 4LMRA 4AFNA 1E3LA 2Q6KA 3E6AA 4R2LA 2R7AA 2VDNB 5FL7D 3OZIA 1QZXA 3WGHA 2Q6LA 3QFFA 1JHUA 5EP2A 1NM5C 5JWHA 2G1AA 4RPHA 1M2OB 2B83A 4C7OA 5JV5A 1O4WA 3Q7QA 2V3CC 4Q15A 4OHZA 2O1SA 4I1SA 2J9GA 3BN3A 1CB7A 1VE3A 1YOVB 4K9NA 5EXSA 2OSBA 3CVYA 3G0DA 4LWOA 2QKYA 5AK3A 2V5AA 4JGIA 3RC9A 2TECE 4FU0A 4NBVA 4UUOA 4B2YA 1I4LD 1SNYA 4RHUA 1DDOA 1SK8A 3DD5A 4YWJA 4I4TA 4J4TA 3SX4A 1C1XA 2C94A 1EWQA 4KI0A 1EJBA 4NYMR 1MA0A 5ENDA 4IIUA 5F33A 1IHOA 2OXFA 2W11A 2ZE8A 4JBXA 3RRFA 1HLDA 5JZVA 1EUZA 3NIBA 5FEMA 2WG1A 3E22A 1LK5A 1WCYA 2DOKA 3HYSA 3F0TA 5JCZA 2FWAA 3EW9A 3KQWA 2PZAA 5AW9A 1L5GB 3B2QA 1CEXA 4FBMA 4KZPA 3EVAA 4RS4A 4TYMA 3ZWAA 5AW3A 3U44A 1VSVA 2QGZA 4Z2YA 4LHVA 2QUBA 3FCOA 2ZTMA 4ENRA 4XWTA 1CZKA 1M7BA 2CZQA 5AJUA 2EVWX 4UVDA 2PCJA 5HIAA 3E61A 2UVDA 1XZPA 2H57A 2W00A 3PEUA 4EI9A 1ZVVA 2Z5VA 4IR7A 1UAYA 2HXGA 1UANA 5ALDA 2E5WA 3M6AA 4LWQA 3GLIB 4I5EA 4JI3B 4G5XA 3TNDA 1OFTA 1O95A 2B2NA 1T4DA 3K1AB 4RIHA 1QHEA 3VR0A 1WMEA 3GWGA 3NIWA 4TMTA 3VYVA 4C7OB 5K1ZA 4LC0A 5DMXA 2RJ3A 2ONYA 2WHQA 2B8EA 3H1EA 3W9UA 4BS9A 5IH3A 1FW8A 5DNDA 5I7HA 2DH6A 2XTNA 3UUFA 4C4XA 2TMYA 5EERA 3UB3A 5CFMA 3H97A 2RGNC 4NCAA 5G1PA 5M29A 5EWJB 1Y5MA 2XWQA 5BNZA 1JQKA 1EXDA 3DEKA 2ON6A 2XRFA 2ZRQA 1YC2A 2HDNB 2MU1A 4A03A 1FSGA 1MMFB 1YGYA 4TSFA 3Q2OA 5AVJA 1C1XB 3EIQA 3GJ3A 3CEMA 3QLVA 1FP4B 3OKFA 4OCZA 4LGMA 3ZE6A 1C5KA 1DUSA 3CX7A 1NC1A 4QBKA 1QRTA 4N6GA 1B26A 1XA4A 3IAAA 1LJLA 4RKQA 5EKSA 3TIVA 1LC3A 3O4JA 1X7DA 2KB0A 2GLTA 4YP9A 2CL6X 2ZI3A 3RE1A 3TBKA 3QMWA 2HUNA 3LPLA 5IU6A 5IF9A 3U44B 4O63O 2B8JA 4QDTA 1QF6A 4E03A 3IMFA 5JNLA 2LCIA 1XMVA 2QTTA 5IUKC 1FJXA 1T6BY 1WXQA 1T8PA 3CMMA 3PDIA 5JFGA 3IQGX 3ZZNA 4W5QA 3DZDA 4FWBA 4MWTA 4D9GA 1V48A 3M49A 5DDIP 4CF6A 4EMSA 3CLRC 2AF3C 4GZMA 5KC9A 4AN1A 3ON5A 4YP7A 5D51S 5A02A 1CVIA 2V7QD 4FNAA 2A0FA 4MH0R 3EASA 3ZU4A 2BGJA 5IPFA 3ZWMA 3EZGA 3IVRA 4XUGB 3AVWA 2WY2D 2NV0A 4D41A 4D4HA 1SBHA 1FFCA 2IOHA 2M6RA 4QQKA 2W70A 3VFDA 4EHFA 5LP6A 4C6TB 3ZDBA 3AC0A 4HLDA 3BG5A 3E7FA 3TGWA 1ORDA 1UFQA 3LXUX 1Y9JA 1ZCAA 2N3ZA 3GT3A 2OCXA 4F5EA 3SHQA 4P2BA 2Z4RA 1QIIA 3WRYC 1LXCA 3WS7A 1C4KA 1Z6XA 2BR3A 2Q2NA 4MV5A 3D7NA 3M3PA 3S29A 1QSGA 4FDUA 3EOZA 3B89A 1A8SA 1NF3A 2VNHA 2Z83A 4W8GA 2XIQA 4CU5A 1ISJA 1Q17A 1FJHA 3EQ8A 3FSGD 3OE5A 4HFNA 1J22A 4JODA 1GUFA 4MWGA 4Q9IA 4CQMB 4FSXA 4MIYA 4DC1A 2QE6A 3TTXA 2HJRA 2ZIAA 1O87A 4WV3A 2A5LA 2FU5C 3AESA 3HY6A 1T0HB 3EEBA 2ZDQA 4IJVA 2JNWA 2HV8A 4ZKEA 1RMQA 1E2HA 3RUDA 3BRWD 3FRJA 2F3UA 3S28A 4I6JA 2QZZA 5KOHB 5IJ9B 1E79D 2WWVD 1W36D 1IJFA 1CYEA 5KDLA 3RNLA 3UUEA 1JDBB 4PFJA 3VO1A 5A3JA 5FWXB 1F0PA 5FLXA 1NN5A 1JQAA 1WG8A 3GK3A 4JBGA 1X2BA 1UXIA 1G20B 4ZIRA 4F91B 3IIEA 4EITA 1MGOA 2YV5A 4Q37A 1AE1A 2WM2A 3RC3A 5INTA 1K7XB 1ZCFA 2Q5OA 2RAFA 3IAXA 5ED0A 1NVGA 1CERA 2IQ5A 3GGGA 3CLUD 3ZGZA 1FLAA 1SCDA 1W85B 3C4JA 3QFTA 5HMMA 3LAWA 3ZI0A 3BF7A 4CMJA 1HL3A 2Q3HA 3FCAA 1G4HA 5FUQA 1OPRA 1XTPA 2NPIA 4DA6A 3TEJA 3W79A 3FJOA 4N39A 3FIUA 1SUDA 3DFFA 2XMRA 3DE3X 4ZPXA 1GU0A 3MRTA 2V6BA 2OENG 2G8NA 1X86B 1J8YF 2RI0A 2IOFA 1L4BA 1J2UA 4AXXA 3H1PA 2G5PA 2RAVA 4LV8B 3U49A 2C3UA 2WSIA 4LBWA 2JI4A 3WL3A 1EBFA 3B6IA 3PF8A 3OH8A 4UM9D 3WNZA 3ZJ4A 2FQ1A 3PHIA 2P9HA 5DYIA 1WMSA 2FGJA 2DR0A 4JQSA 4AY5A 4IQ4A 2PM8A 2R8XA 3U3XA 3B12A 4AY6A 3EC2A 4AJPA 4DLSA 2O3RA 2Z0MA 1TQ2A 2IYYA 3BUSA 1QS0B 4PEVA 4ZALA 1CTQA 1L2TA 1TKBA 1MXHA 3L0CA 3EZXA 3WLJA 5AHXA 4KMOA 3G2KA 5JQGA 1U9IA 1VP9A 3DP7A 1YV9A 4ZIRB 1CULC 4P7GA 4DDVA 3VNQA 4TN5A 1N6PA 4WZAE 2FE1A 6LDHA 3ZN2A 5HFAA 2IL1A 2BP7A 4B4UA 1TW3A 2F90A 3DEZA 2C2GA 3CA8A 4YQEA 4CLXA 5FUMA 2ATIA 1QFJA 4PXAA 3D6JA 3OEHD 1YZHA 4S1WA 1QCYA 2L82A 4DG9A 5IFLA 2TRSB 3EUAA 3EXHC 2VXOA 1Z18A 2K2WA 4ICIA 4NEGA 5ETJA 5K6AA 4HEA1 4NOMA 1JHXA 1PD0A 3IC5A 3NWOA 1T9BA 1U7TA 3U16A 2GBGA 4FYYA 1A4UA 2BY4A 4ND8B 1LLQA 2OLKA 4LE1A 4DXDA 5DB4A 3CWZA 1NI4A 2WICA 1JA9A 1QIHA 2HRQA 4UQOA 4DQXA 4QGSA 1XA0A 4JA2A 4ZYZA 1GSAA 1P9NA 2A0YA 2J3EA 1KDYA 3FOWA 3QKTA 5BUZA 4YWHA 3D3EA 2YFQA 5CM2Z 3PXUA 3L5KA 3AKZA 2JJQA 5KQRA 1TM4E 4KLNA 2ZWPA 1CDOA 5FORA 1X1TA 4LQCA 4O2AB 2H48A 3W5UA 1Y8RB 1Y3AA 2M9MA 2F43A 4ML3A 2AMFA 1EE9A 2ZRJA 1WNTA 4BFUA 3VH1A 4LFAB 4EFLA 3H9JA 5KSWB 1H94A 3KDSE 4XWOA 1NYTA 2SNIE 3FFTA 3A1UA 1E7WA 3VOSA 3WGYA 2GAAA 4PPYA 2PMKA 5IEJA 1S9HA 1O5TA 3M4ZA 2ZYIA 3L1HA 4A8JC 1I7NA 3T15A 3FNRA 4REMA 2CLDX 4DIOA 1HDYA 3NNDA 3TOVA 3JD2A 1ODKA 4FHEA 2EJCA 1UBKS 3RHSA 3DTNA 2ZG6A 4MKXA 2R8PA 4BP3A 4GLJA 1JKJA 2YW2A 3CE6A 1GQQA 3KYBA 4Z0HO 5CBPB 3A4LA 5BV0A 4LS3A 3QLJA 5E4JA 1KEZA 4OATA 2HSJA 2W48A 1R0KA 2V03A 2GI4A 4FR0A 2Y6UA 4DUYB 1Z4QA 3VTZA 4DT1B 4FS3A 4PZ9A 2XHZA 2QN7A 3K0KA 5TQVA 3F7MA 5JAQA 2QD5A 4HDNB 2JFNA 2C20A 4HVLA 5AOCA 1VI5A 3IV6A 1ZSYA 2AEMA 3DMPA 1PDOA 4GIBA 3CQ9A 5EGSA 3VJKA 2VWQA 2COUA 1LRKA 2QW0X 3FCYA 4TM8A 4EHDA 4DR5B 3G89A 1XAGA 1C0PA 3CNBA 3JD0A 3RU9A 1M8GA 2IP4A 2P9CA 2E55A 3P9ZA 3H5VA 1A88A 3ZX4A 3ZHUA 3GCXA 4ZC8A 3KJEA 4N5NA 1HFWA 1K5HA 3LKBA 1N6KA 3KQYA 1WX1A 1R0ZA 3G2NA 1M2FA 4FGZA 4L50A 4RQUA 4X1KB 5LBTA 3SQOA 2WDPA 2RK3A 5HW0A 4CMAA 3BXGA 3KKLA 1X1RA 1LBHA 3ADPA 4YV7A 1I4WA 1YFLA 3U7RA 3IDOA 4AG6A 4E2YA 3HSSA 1KERA 1HQYE 3ED1A 4R01A 3BDIA 4BMDA 3KDAA 3TNFA 5C5EA 1IUNA 3EPRA 4FFLA 1M34B 4ZI7A 2BH2A 4LBVA 4AVYA 4I5IA 3RWBA 1A9QA 1PAUA 1UJ5A 2BV3A 2YZNA 2C4KA 3B6EA 3BRSA 3F96A 4R8RA 3TR5A 3UJ3X 1KK3A 3TBHA 4ERNA 2AN1A 5JSUA 4NBLA 5IYZB 4PGHA 4DC9A 4QAJA 1QU3A 4QATA 2HEIA 2XDWA 1UOQA 4MLCA 3A2MA 5J23A 4H6WA 2VKQA 2WJGA 4KX3A 4L4ZA 5E9QA 4KFTA 5A04A 1PV1A 1RCTE 4S3MA 3BHNA 3F9CA 2PG3A 2ZIXB 3LY9A 3GVPA 1J21A 3RSCA 2VF4X 2J7PA 3OP1A 4AT1A 1ODCA 1CPYA 2JATA 4ZI2A 2WSSD 5YASA 1UBRS 1JB9A 2OG1A 4U00A 1T5LA 3RCBA 2J9YB 3ZW8A 4D3YA 3K73O 2CNBA 5FI1B 5AHOA 4DRXA 4ZDJA 2XMCA 1Z36A 1FS6A 1DELA 3CVOA 3HU5A 4CM8B 1C9NA 2PRYA 5JSKA 1PEDA 2ODBA 3GDFA 1OC2A 1SZCA 2IU4A 3L3BA 4MMYB 1K3FA 1QE3A 2EDCA 2HSEA 1NVMB 4PCUA 2QP9X 4G86A 1V3VA 3MFYA 1P7WA 4G1UC 3UAVA 1VC2A 1JZSA 3VMMA 2CL0X 4PZCA 4WESB 2C92A 4UC0A 3VV3A 1SKYB 5B1EA 1P74A 1T1SA 3TYXA 4FYVA 1IM2A 1W6UA 1YUMA 3O9MA 4K6FA 4QOHA 5G1NA 5BMVA 2PUBA 1JFFA 4OQMA 4H60A 4IGIA 4IUYA 3BMOA 1JR3A 3EHEA 1U0HC 1CRPA 5DASA 4E08A 5K2MA 4NVRA 1L5WA 1A9RA 3TIXB 2TYSB 2WYUA 5CT6A 4B6RA 3J81k 2P3OA 1PUIA 1TMOA 3PI7A 5SZIA 1JGTA 4B9AA 4YCAA 3WMRA 5EMLA 2IZ6A 5A1JA 2FSGA 4K3VA 4KSYA 3L4KA 1DCTA 4TL9A 1OC4A 1FXWF 4H1VA 1IU9A 1Y4UA 2P5YA 3O9ZA 2NYVA 2YY7A 3COYA 4FFNA 1L4UA 4YRJA 3UTDA 1MW8X 1NT4A 2GTHA 3JVVA 2GCOA 3BZWA 4PHHA 3E84A 3UYLA 1UL1X 3EY9A 3DA8A 3W5VA 2AD1A 2VQDA 1DVRA 2NX2A 1G3MA 1TUIA 2RIRA 4MLZA 5AKHA 5B3JC 4X24A 3RGWS 4CIAA 5JT1A 4W5OA 2I9KA 2KS6A 2WG2A 1C8VB 4KI7A 1A5BB 4Z7NB 2EDAA 3RGGA 1P7PA 5KTTA 2MINB 4J75A 3O4FA 4C3VA 4FBLA 1ZESA 2WFZA 3GFQA 3NXKA 4K7JA 5LP1A 2BFMA 4YUZA 1Q83A 1VYHA 2QUKA 5E2BA 2NSLA 5EUMA 4P3NA 4PLCA 4BQIA 5DI9A 4WE3A 3VPXA 2UXBB 3M33A 4FFSA 1D3AA 3HN6A 2CVOA 3A28A 4HBZA 3KQUA 1XZGA 6ADHA 1JIIA 1M2NA 4Y2PA 4YAIA 2BUAA 4P4NA 5BQ5A 4Z3KA 2XSZA 2GLUA 3C5WP 3L0YA 1GGHA 5ALNA 1NBAA 3GLTA 1QANA 1KOLA 4WFIA 1GLVA 3O91A 4BNFA 4BO5A 2H1OA 4ER6A 4L73A 4BO9A 5JY6A 1QOZA 1UFVA 3FBGA 1AY0A 1S2GA 1TQ4A 2B4TO 4I1RA 3S8MA 1LI7A 3SBOA 4BWYA 4DNOA 3LDHA 4XQEA 4MUBA 2QG4A 4Z51A 3DAPA 3UWPA 4S1TA 1PI3A 2HSGA 1RQLA 3FKQA 3DZGA 4FGKA 1GQOA 1V16A 2JH3A 3HWX1 2QROA 3O7WA 2P4QA 2FWRA 5T4EA 3ZI4A 4PQGA 4BO4A 2C04A 5I4BA 1GRNA 5ELXA 3P9RA 4E3WA 1Z08A 4GI1A 4MUAA 4OL0A 4Z4GA 5TGTA 2I7TA 5C18A 3LUHA 4I4IA 3UAXA 1ZOLA 2RK6A 2VAMA 4RVOA 3ZHXA 4F71A 5L3SA 3M1AA 4PRYA 3O83A 3GH3A 4HD8A 5HDQA 3X44A 1U9ZA 3CRW1 5DTIA 4AG5A 3RAEC 1RBYA 4L95C 1EUYA 4WXHA 1IFXA 4TZKA 4P34A 3X2SA 2WJWA 1CX9B 1JJAA 1KFCB 3QRWA 3CO0S 4DY6A 4AMZA 2OB2A 1PFKA 1K6IA 1G8PA 4CQMD 3GFOA 2JHCA 1VECA 4LRSB 4AURA 1TEVA 1VHQA 1W44A 2XD4A 4PBSA 1PYOA 2QHXA 1H1LA 1TTPB 1Z6YA 1KJ8A 4LVNA 1B6SA 2OM6A 4Y2HA 1RIIA 4F56A 2PHZA 1U0NA 1UBEA 2LPMA 4DIDA 4CKYA 3L92A 2RAUA 2HM7A 4KRYA 5I9LA 3KAQA 3UPUA 5EUCA 3ND8A 4JT9A 2J6IA 3BA6A 4GZ6A 5L3QB 3PV0A 4RIEA 4JVNA 1ZRHA 2AI2A 1DTSA 3C3EA 5EHZA 1NVWQ 1NU6A 4JEUA 1RI4A 3HB4X 1OZ0A 2DUUA 3SFTA 2IXDA 4D2IA 5EP1A 1L6RA 4DV1B 2GRUA 4AJJA 1YU9A 1VJ5A 2OC9A 5A4KA 2RHMA 1FXSA 3UMFA 4IG9A 1EGQA 2YH2A 3TCXB 2HIGA 1TO2E 1X80B 1PNVA 3AUYA 1WB4A 1P4AA 2VHTA 3EMDA 3GT4A 4N49A 4CUJA 2XX3A 3K16A 5G4LA 3EXIA 5B12A 2YWXA 4D0SA 4UVEA 3E5NA 5CFRA 4GP6A 1W47A 3EPHA 4Y0AA 3C8UA 4RKEA 3H4MA 4HVTA 2JVJA 4Y67A 1K08A 1NXXA 1CUAA 1B43A 3ECCA 1PU2A 4L6CA 1T0JB 4ZQIA 3WICA 3U9LA 5IMSA 1C3JA 1WRBA 4FEEA 4P93A 4C7KA 1ATIA 3DWGA 2PH7A 2UUPA 4OQ4A 2YWBA 3RVQA 3QY0A 3T9BA 4A0GA 4DCPA 5HKKD 3S2GA 3W4KA 1YI0A 3HCNA 4MV4A 1BCRA 2X8WA 1EXMA 3PR2B 4IX1A 2NU8B 4W5NA 3OPYI 5E9JA 2EKDA 2M6KA 2NPOA 1BZYA 1RJDA 4HRYA 4I19A 2Q6OA 3L8EA 4LE0A 3V1KA 4NBSA 3R40A 1UMBB 1FLDA 2ZQ5A 4ZHQB 5LQJA 3DQQA 4DB2A 2CKDA 1Y8QA 2C4VA 3G8AA 1R10A 4HPWA 4U0KA 5FT9A 3DXFA 4YT4A 1ZH4A 1R00A 2QXTA 3B8HA 1QKJA 3CTPA 3FPCA 4M1MA 4BX9A 4EHNA 5DLYA 3SAJA 4DGQA 5IXYA 3VUEA 3BK2A 3HZRA 2Q2VA 1LLUA 3OEED 4PV7A 2J4FA 5T7BA 4TWZA 4LY6A 1BRMA 4MAAA 1Q0HA 3QENA 5JD4A 3ESYA 4KO1S 2F3RA 3T3NA 2JCXA 1HH4A 1FRFS 2I6QA 3EXIB 3F98A 3P20A 4NFSA 2ZQZA 1UDAA 1XDSA 3F5QA 1JFRA 2INGX 4UAJA 3JQCA 3OLWA 4YJ2F 5CH3A 3AW9A 4ZOQI 3UMBA 5AVXA 2HJVA 1U8ZA 4QOGA 5CVVA 4X45A 3OQ6A 4UM8B 3ZW9A 3RVMA 2J9FB 3GX1A 3E05A 1KWKA 3ROXA 3F6CA 1LW6E 4QO8A 1UOOA 1L7XA 1NFFA 3FRHA 4HB0A 1PFGA 1U7ZA 3JQBA 4OXIA 3NO4A 4ZT4A 2BSQA 3PRHA 4KR9A 4DXAA 3M89A 5CURA 4RH1A 4BEVA 4D0LB 4I55A 4NS1A 3W5BA 5BQ3A 4V0OA 1XU4A 4F04A 2VUHB 3DMRA 3A6PC 1QYVA 2Y67A 1LQUA 3MJDA 1JIJA 1AA6A 4PO3X 5T3YA 1P2SA 2ODWA 4LGCA 3UNXA 4YRGA 2VNJA 4CIWA 2EU8A 2GAFA 3LZCA 1QFYA 1QVRA 3R0QA 5GM1A 3L1UA 4L07A 2WAOA 2HCBA 5IVDA 5BW8A 4XPZA 1LNQA 4C03A 1NIPA 2WJ3A 1N8NA 1F8GA 2JDIA 1V5FA 5K8VA 3ZGXA 3EGEA 2QLLA 2ZCUA 4YREA 1JKXA 5LL6P 3FTEA 4B4DA 1E64A 3BFJA 3IHLA 1XCGB 3T1YB 3CE9A 1ZBQA 3DKPA 1F5NA 2IW3A 2AJDA 3Q0IA 4KQ2A 2DKFA 4Y9RA 2XUOA 4H3HB 3O3MB 5BW6B 3GFGA 3IVXA 2FOXA 5FBLB 3WFJA 4S1OA 1CP2A 4AO7A 3E5HA 2DB3A 4P32A 5LOVF 1N3IA 3NUZA 1SVNA 3DAYA 4L5BA 1A77A 4P98A 3WQSB 4ABYA 4NQZA 2AFIA 2IODA 1Z34A 3L5OA 5D6NA 2O8CB 4KVZA 2OMKA 2RSLA 5BSKA 3TG2A 1W59A 1T9GS 2YHAA 4INAA 4ASUD 4M54A 5HJ5A 1BEUB 2XXJA 1P5RA 2IRWA 4BV9A 4FDLA 5KAPA 2OGSA 3O2NA 3VSBA 4Z3OA 4B3HA 3T34A 5ITZA 1T10A 5EJIA 4G26A 4IXTA 3W5JA 4EA6A 1G2PA 1G60A 5F1KA 3SXPA 3O4VA 4KIGA 4BMZA 2F3QA 4WINA 1E1CA 3GZNA 4HEQA 4XVHA 4MULA 4AIRA 1IDOA 3R9IA 4N5MA 1U6JA 1OVMA 4HX2A 5DYGA 1FJ2A 3ONVA 4MHSA 5F1YA 1FJGB 2PJDA 3GRUA 3DOFA 4URHA 5I7UA 2ID7A 2QI9F 3PWTA 4NESA 2WFMA 3L9WA 4U7FA 5A9SB 1JPUA 1YDMA 2HLDA 2ZYGA 3L4EA 4NMWA 3UGQA 3LK7A 3HM9A 4LXHA 4WNAB 2CYBA 3R0ZA 2WWFA 2W71A 4KK4A 4KQKA 1BQ3A 3ZUPA 1X8JA 4LNAA 5FCDA 1MHPA 3MSXA 4P4SA 2QEQA 5AKEA 1AX9A 3KPVA 3HRKA 3LT2A 3ZIDA 4OXQA 1AUOA 1PZNA 3GYGA 1SKBA 3ICVA 2I7DA 5IABA 5L3VA 3FTFA 1BNCA 3STXA 4RSGA 4OJKA 2CDNA 2Z9DA 3BMXA 1MBZA 3GCWA 1OTHA 3BTSA 2Y4OA 4MB2A 2AXQA 4IINA 2QLMA 2BBSA 2Q41A