3AFMA

Crystal structure of aldose reductase a1-r responsible for alginate metabolism
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular identification of unsaturated uronate reductase prerequisite for alginate metabolism in Sphingomonas sp. A1
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase
total genus 97
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.1.1.126: 2-dehydro-3-deoxy-D-gluconate 6-dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3afmA00
1MX3A 4BNZA 1R4NB 1E3JA 5G0TA 1YDWA 1T2CA 1AHIA 2HJRA 3PHJA 2Q1TA 1ADCA 2PKQP 5GZ6A 4KQXA 5CFZA 4Z0HO 4B7XA 2DAPA 1E3EA 5A3JA 5ENVA 2C2XA 4BKRA 3E9NA 3FPCA 4YJHA 3VH4A 4CM6A 1T2FA 3H4VA 1F8FA 4Q3AA 5COBA 3CPSA 3DQPA 2NVWA 4CM5A 2PFGA 4DTIA 3OM9A 4A27A 1TB4A 4IM7A 4J4HA 1QYDA 4BNJA 4OM8A 2E4AA 4IZIA 5THQA 4IS2A 3LZ6A 1KEUA 4PLYA 3OIDA 3SXPA 3X2EA 5LDHA 3ZV4A 2JKVA 4FGSA 2WD7A 3EMKA 2X7HA 5H82A 1E3WA 3DR3A 1QYCA 4CODB 2HQ1A 2GO1A 2C82A 3ZWBA 4G81A 2OUIA 2Q1WA 3F1LA 1HZJA 1YONA 3LC2O 3TFQA 2P2SA 4FFOA 2BFAA 4IJUA 4Q3DA 4DYVA 1E7WA 1B14A 1VLLA 3F3SA 3JQBA 5HA5A 2X5JO 4YAJA 3ROMA 3KYDB 1DHRA 2GLXA 1IPEA 4MPDA 4YQZA 4AG3A 1TI7A 3DC2A 3KOUA 4NG5A 4IUYA 3R0IA 4AL4A 5AVOA 3EK2A 3K30A 1BMDA 4IQ0A 4HXYA 3CH6A 2H1SA 3OJFA 3RUDA 4J7UA 1UAYA 1TA4A 2E49A 1Q2XA 4P4NA 3RJ9A 3E8XA 1KVTA 3VTFA 4GKBA 2C7GA 1EQUA 5IXYA 3I6IA 3WDSA 3VH2A 2EERA 2R00A 4ALJA 3W1VA 4R01A 4BGUA 3LT2A 4Q9NA 4DIBA 1P44A 1Y9EA 3BXXA 3DDNA 3ZU2A 5A04A 3FN4A 4Z3DA 1J5PA 1DC3A 1I3NA 3ITDA 1Z74A 4BMSA 1P77A 1Y5MA 3WGHA 4J43A 3DHNA 1X0XA 3Q6IA 4I9HA 5G2OA 2RBEA 4EZBA 4HY3A 4OAQA 1R15A 2IEBA 3GK3A 3P7MA 2W90A 5DF1A 4JJIA 1MUUA 3C7DB 4P22A 4DQUA 4E21A 1K89A 1DC6A 5A03A 2IYPA 3C7CB 4YJFA 2H5LA 4YB8A 4CMJA 3E03A 3VH1A 4YJGB 1S7CA 3B1FA 3WB9A 2HK9A 1A7KA 4PFJA 7ADHA 4IDDA 2VOJA 5B4VA 4XZ3A 2C59A 3GT0A 5EN4A 3PYLA 5ER9A 1QYWA 1HKUA 2GN8A 4R1TA 1LRKA 1ZK4A 2P5YA 2GRAA 3FTNA 4ZRMA 2WD8A 1Q0QA 4YT4A 5CDSA 4J1QA 1UXGA 3H3JA 3H65A 1HRDA 4CMIA 4FIZA 3E6AA 2I65A 4CM9D 2VNSA 4CLHA 4P4LA 4CQMD 1UP4A 2AMFA 3GH3A 4CMEA 4CV0A 3A4VA 4AJPA 2EXXA 2ZTVA 3AY3A 1UR5A 4IJVA 4FJ1A 4ZQGA 4R3NA 3ZHXA 1C1XA 4I5FA 1DFHA 1GQYA 1MG0A 1VJTA 1I2ZA 5DCWA 1R37A 3ENNA 4WOKA 2O50A 3DL2A 5TJ9A 3RKRA 3MTGA 4UVGA 5CEEA 2OO5A 2DTDA 1WZIA 3JYQA 2F1KA 1UXIA 3U4HA 1ZW1A 5F1KA 1YB4A 3PZRA 4ZU3A 1AE1A 1E6UA 3OHSX 4YJGA 4XRGA 1LSOA 1F06A 5J23A 1ISJA 1E1LA 2VTEA 4XB2A 2Z5LA 1O0SA 2AG8A 3WGIA 2YUTA 4HADA 4WASA 3NEPX 5AXDA 3ZHBA 1PQPA 4QEDA 4BKQA 1ARZA 2EW8A 1XQ6A 1FF9A 4MVJH 2UV8A 4CMIB 4IXWA 3ETDA 4MJLA 2FP4A 3PQEA 1RPNA 1Z73A 1XLTA 3B6ZA 2Y1OA 5L40A 1HF3A 3F9IA 4CQLA 3HDYA 4NU6A 4A2CA 3OEWA 1ZK3A 3JD0A 3PPIA 4E2XA 5DOVA 4B7UA 1HEUA 2GPTA 4XIYA 1UP7A 3NAQA 5G0UA 4RF5A 5JNLA 4EEXA 4WE3A 3D4PA 4DMMA 1PL6A 3I9LA 4GX2A 4WCFA 2Y05A 2HLPA 2Y0EA 4CPDA 1R4NA 3BA1A 3I4FA 4PLTA 2GN9A 3EGOA 4ZQEA 3DZIA 1O9BA 3FPLA 3F4LA 3WQSB 1EDZA 2NU6A 4FFNA 4IZHA 4R4JA 1IHXA 4INAA 1CYDA 1EUDA 1E5LA 3EDMA 1ZKMA 4XCVA 2O3TA 4NQZA 4AFNA 4PG8A 4LMRA 1GV0A 2Z1MA 3DOCA 5JSFA 1EK5A 5JXWA 1HDCA 2V6GA 3PVZA 2V6FA 3OQ6A 1ADBA 1M6HA 3VPFA 4PLFA 1E7MA 3KBOA 3D64A 3QVTA 3UF0A 4DLAA 3GGPA 3IDSA 2FSVA 5TNXA 1DLIA 1B8VA 2D8AA 3PHLA 1N2SA 4RCVA 5JYEA 5L7WA 3KZVA 1YQGA 3TOZA 4A73A 3ZU5A 2DPGA 2NV6A 3ZW8A 1YS4A 1X14A 1HDZA 4BGEA 1QG6A 3DBLA 3JQBC 5DP2A 2VQ3A 2OL4A 1VKNA 1YB1A 2O4UX 4U7WA 3KYDA 3Q0EA 3IAHA 5DN9A 3MOIA 1YL5A 3G3EA 1I32A 5JW6A 1LJ8A 3C1OA 3LC7O 4W6ZA 5I9MA 3DBHB 5C7IO 2W2KA 4CMGA 1CEQA 3RC7A 3FD8A 1KY4A 4ALLA 1PGPA 2GZ3A 1JLLA 3O4RA 3RBXA 5H83A 1C3VA 3S2EA 1BG6A 4E32A 5B1YA 2CFCA 1GDHA 4E2WA 4LCJA 3H9EO 1ML3A 2GN4A 1O5IA 2O48X 3UOGA 2C29D 2ZCVA 3CE6A 3CEAA 1IPFA 2IYOA 5F3RA 4EITA 4HKTA 1PJBA 1GPDG 4HFMA 1NVMB 2PKQO 4UVHA 4ROSA 5KJCA 3JD1A 3HWRA 2O3QA 1XIVA 2O23A 3WJAA 2AA3A 2D0IA 4B7CA 4RPGA 1VRWA 3QRWA 3GG9A 4Q3CA 1KIFA 4XQGA 5EL0A 5A9RA 1GADO 2JHGA 1NM5A 4RDHA 4DRYA 1ID1A 5JC1A 4WJZA 4PG7A 5A5FA 1PS8A 1H6CA 4IQGA 3L9WA 4A5OA 2O7SA 4FS3A 1YDEA 5B4TA 2J8ZA 4RQUA 4XGNA 3OJEA 4DGSA 4NBWA 1U8FO 5FI5A 3IMFA 1R4MA 1PJLA 1N1EA 1NBOA 4XYBA 2AEJA 3QW2A 5CG1A 3IKTA 4IDEA 2XOXA 2YY7A 3GAFA 3GAZA 3U4IA 3KVOA 3BMOA 5JDIA 5LDGA 3RBVA 1LLQA 3TQHA 4MP3A 1V6AA 4YEDA 1U2GA 3BTSA 1T2AA 1PJQA 5TGDA 1OI7A 1V3TA 3L6OO 2QZ9A 5IN4A 2D4AA 1X1TA 5FI3A 5T5QA 5EJ2A 1NFFA 2VYVA 1WVGA 2VHZA 3K31A 1J4AA 4FQ8A 1ZZEA 1YOVB 1FDWA 5EIOA 2PA3A 3AK4A 3GG2A 4IGFA 3QVSA 3K92A 4GVXA 4DYDA 1C0LA 2PZMA 3CSDA 2A9FA 3SLGA 1DIBA 3WQRA 4FR5A 5F5LA 3BMQA 2OP1A 2DTEA 3I9NA 5JYDA 5L9AA 2VUTA 1NWHA 1TVEA 4J90A 3RJ5A 4CLXA 1LRJA 3P19A 3PRJA 4G2NA 3L07A 1YRLA 4XQCA 4ESOA 4WLUA 2C07A 5T8KC 3U9LA 5G0VA 3WMXA 3QY9A 3DZKA 1EQ2A 2CD9A 4YWJA 5B37A 2E6UX 3OA0A 5IN5A 3TFOA 5G4KA 1ISMA 1D4FA 5U9CA 3C7AA 3BMOB 4W9NA 2AQKA 1MP0A 3AY6A 1GUZA 3PFFA 3LT1A 3GMSA 1H93A 1HT0A 1SOVA 4O1MA 4L76A 1B3RA 5KVSA 4NZ9A 3COSA 4D45A 2PNFA 4J1SA 3K2BA 4PGFA 3H9GA 1JAYA 1Y1PA 3RVDA 4F46A 2D59A 4Y98A 1P1HA 4RVFA 1LU9A 2R2GA 3JTMA 1Y6JA 3AOEC 1PJ4A 3QLJA 4WCFB 4XX0A 1R0LA 3RUHA 3BMCA 4IMPA 4GLLA 4E5YA 1F12A 3GDOA 3SX2A 4JIGA 1E5QA 1XQ1A 3NDJA 4NI5A 4QT0A 3W4KA 4CM9A 1C1DA 1H6DA 3D0OA 3H5NA 2J5RA 1U28A 2V6BA 3FR8A 3L77A 1ZCJA 3AUTA 5IDWA 4RO0A 3H7AA 4CQLB 2BFPA 3KEQA 1U3VA 3K8ZA 4J91A 3UFXA 1V3UA 4HP8A 1LQTA 2X4GA 4PCVA 1Z45A 3E18A 3W8FA 5ES3A 5JY6A 2PLAA 3T4XA 4BIIA 1LDMA 4FOOA 5F21A 3PQDA 1FXSA 3KLPX 1FDSA 1HE4A 2DT5A 2YV3A 2R00C 1T25A 1RM3A 5IJZA 4EYEA 1H9BA 2GR9A 5DT9A 2X1HA 4N5LA 3GEGA 1KERA 2AW5A 3DAPA 1GYRA 3ZWPA 4JJGA 3U49A 2CSUA 3HFSA 4DL9A 3TL2A 1HDRA 2J5QA 4LRSB 3TWOA 3H2ZA 1JW9B 3ZWAA 4YAIA 3BMCB 2HK8A 4HX5A 3RUCA 1KC1A 4CM4B 3GC6A 2EG9A 3D3WB 2D2IA 3VVBA 1PEDA 3LQFA 4JXKA 1ZSNA 3FRJA 5CP8A 1E6EA 2ZJ1A 3HHPA 1VE9A 2X0JA 2QX7A 5AXBA 4R9SA 4FD3A 4XQ9A 1Z82A 3DWFA 4LVUA 3S55A 2I5PO 1P45A 1HYHA 3ZHYA 4BO4A 1ENZA 2I67A 3G49A 1LSSA 4BUCA 3GVCA 3KV3O 1FDTA 1MC4A 1I33A 4EW6A 4QTZA 2PKRA 3V5NA 4EDFA 1NQ5A 4CR7A 4PIVA 4PG5A 3ZWMA 5GZ1A 4CR6A 1VL6A 3I52A 3WIEA 4PG6A 3ASUA 1O95A 4OXYA 1XCBA 1B8PA 1X7DA 3ZNNA 2QRLA 4OMUA 2V6MA 3K5PA 3H9QA 3ADOA 4GPD1 5CDGA 1H9AA 4XJTA 3S8MA 5I7SA 4RVDA 4ZD6A 2DTXA 4YAKA 4Y9DA 2WYWA 3I3OA 4U8GA 1ZEJA 4Z9FA 3R6DA 4IIVA 4YAGA 2FSSA 4M1QA 3V1YA 2FOIA 3GUYA 3AWDA 1WNTA 1ZEMA 2HRZA 3V2UA 3GHHA 4CMHA 2X58A 2GUGA 1LTHR 2R6JA 3NDIA 2PK3A 4FBGA 2DUUA 1NVGA 2BH9A 1KY5A 5K0ZA 3FBTA 3NT2A 4OSOA 2I66A 1YGYA 4D3DA 2NU8A 2CZCA 3L4SO 1YWGO 1N9GA 3P5SA 1MLDA 3W4JA 2JD2A 3WQQA 4Z9XA 4BO9A 3PEFA 5TLSA 4NIMA 1LEHA 1DSSG 4CMAA 1R4MB 2IODA 4I1IA 4W99A 3SVTA 3AM4A 2YHUA 1AXEA 4TMFA 4FSHA 1DOHA 3A06A 3DAGA 5HTOA 2VOEA 3D4OA 4E12A 1T24A 2G17A 1DJNA 1DIHA 1EVIA 1B2LA 2QYSA 4IPTA 3VDRA 4PLGA 1NQTA 3QWHA 2NVBA 2OXIA 5G4LA 5BR7A 3LC1O 2D5CA 3V1TC 3LT4A 2F00A 1A4UA 2BI8A 3VKUA 3UCXA 1EBUA 3K73O 1DAOA 3DMTA 4P4GA 2RHRA 1T2DA 3HDQA 4OOFA 5G4KB 5JDCC 2VYND 4UREA 3S2FA 1I10A 4B4OA 1TEHA 3D7LA 3FCOA 3VAZA 1I3MA 3HN7A 1ZXBA 4WLFA 4U5QA 1Z6ZA 5JE8A 4E2YA 1I2CA 4PLHA 1ZMTA 3QIVA 4OJNA 4MVJF 4Z0TA 1C0PA 4IBOA 3ZU3A 2NUAA 4BKOA 1FMCA 2NADA 3IIEA 2JJYA 1UP6A 2PZKA 3NJ8A 3PHGA 2DQ4A 3QWIA 1M6WA 2Y0DA 1EUCA 3CINA 1KVSA 2I3GA 3NV9A 2GD1O 3UHAA 4NU5A 3OQ1A 1IY8A 1OOEA 2OBYA 2EHDA 2FR0A 4DLLA 2BGLA 1ZXLA 4A0SA 3WNQA 5L95A 1DRWA 3I6QA 3UICA 3ZWCA 1WDLA 2G82A 3MWEB 2IDZA 1GQQA 2W98A 3BHJA 3WNVA 4KWHA 4WK6A 3RROA 1Y8RB 1E3LA 1RWBA 1BXKA 1UUFA 4LSWA 1NR1A 4JQCA 1NX6A 1GZ3A 3JQDA 4N5MA 4PVCA 1GU7A 2YQ4A 5IZCC 4GWKA 4ALMA 4GX5A 4E6PA 3I1JA 3ZWOA 3ORFA 3DOOA 1PGOA 3DEYX 2VWQA 1LC0A 1K5HA 3CKYA 2X0NA 1LXCA 3BAZA 3JQFC 1XR3A 3WOHA 3BIOA 3E5RA 4CMEC 3I9OA 3LVFO 4UUPA 1TXGA 3MTJA 4R51A 1C1DB 3CZRA 1UJMA 2WEKA 2CNBA 3RI3A 1U3TA 1T1RA 5TX7A 3JQAD 1L1FA 3WYCA 4XEHA 4R68A 1EBFA 1YO6A 3U4DA 5TF4A 3G1UA 4KOAA 3MJEA 2PD4A 4YT5A 3JQAA 1KS9A 5H81A 2ZQYA 3ZNQA 1RYEA 5T6BA 3A1NA 3KO8A 5JAMA 4S3MA 4NMHA 3RC2A 1FDVA 5IG2A 2E37A 4EGFA 2Z95A 2UYYA 1UXJA 1GEEA 3WGYA 1Y8RA 3OBBA 1EK6A 1OBFO 1JN0A 4K1LA 6LDHA 4FFRA 2ZTLA 3NTOA 5COQA 1QRRA 1MFZA 4BL5A 3OETA 1ZK0A 4IGEA 4GQAA 4WNCA 5KJ1A 3OJLA 1GUYA 4YJFB 2DVMA 3PXXA 1JKJA 1SO8A 4G65A 3WFIA 3PWSA 5L51A 4CM8A 3BZUA 3O26A 3D1LA 4WCFC 4RF4A 5L4SA 5A4DA 4CM4A 1K3TA 4MIOA 1BXGA 3MJVA 1PZFA 2ZTMA 1Z7EA 1L7DA 4OGWA 3VZQA 4GSLA 2E48A 5JPIA 4PG4A 4ALKA 3WBFA 3AI2A 4XB1A 4D46A 1NXQA 3FI9A 3T7CA 2J6IA 4OH1A 1H94A 3U4CA 4EEZA 3NGLA 4FFMA 3RCBA 1HXHA 2JFFA 5AYVA 1GYPA 3RD5A 4FCCA 4IDAA 1JVSA 5CG2A 1LI4A 1U3UA 3GZNB 4DQVA 3QQPA 4FC6A 4HWKA 1U7HA 2XXBA 4E3ZA 3O9ZA 1BXZA 2YJZA 3Q2IA 1YOVA 3OMLA 2CF5A 3ZU4A 2OORA 3NT4A 4OOEA 2Y1DA 5CEFA 4NBRA 2EKQA 4QSMA 4AJEA 3C24A 4MOWA 2O3UA 3OA2A 2PTGA 4GL4A 4J9UE 1U5CA 3FNHA 1LDYA 3ANLA 1ZJYA 5TQVA 2Y1CA 1V35A 2I9PA 2BELA 3EZLA 3INTA 4A10A 4JP2A 1DHTA 2BFMA 3RUIA 5B12A 3EAGA 3M1LA 3EHEA 2POQX 1A9YA 3R3SA 2X9GA 2YDYA 4YAEA 1M76A 1N9GB 3ONFA 3K2EA 3JD3A 1ZO8A 4JROA 4XDYA 2EW2A 2AE1A 3ASVA 3ANNA 2HAEA 4RVHA 1JVBA 2PZLA 2TMGA 1Q7BA 4UAGA 4J0FA 4RPHA 1GCOA 5F1OA 4XR9A 2BRUA 3V2HA 5FWNA 4FPXA 4ZQHA 4OQYA 4WPGA 1ULSA 1P1KA 3DMYA 3IS3A 1MB4A 5DBGA 4BO6A 4OXKA 5AOVA 4Q3NA 3PIIA 3Q3CA 4E13A 2EWMA 4LSMA 5KVVA 3TPCA 3JQGA 4F6CA 1XYGA 4LMPA 3DZBA 4ZGWA 5CEJA 4L74A 3TZHA 1U9JA 1BSVA 1XU9A 1LUAA 3QVWA 4IDCA 3ZNOA 5F5NA 4CLEA 8LDHA 3TZ6A 2HU2A 1P3DA 1Y9AA 3PLNA 4EUEA 2PD6A 2W4QA 4EBFA 2HMWA 5JCJA 3DBVO 5U4QA 1LDGA 4D3FA 2VT2A 5HS4A 4QFCA 1QXSA 1Q7GA 3GMDA 3H9UA 1WW8A 3PI7A 4BQRA 2WE7A 1H0KA 4D41A 4IDFA 4NK4A 4JX8A 4XA8A 1ONOA 4KP7A 1D8AA 3SC4A 1RM5A 4DUPA 4O5OA 4D44A 4I5DA 3ZV3A 1R0KA 2OBNA 1ZMOA 4CMCA 1U5AA 1YQXA 4YTEA 4UUNA 4BB6A 3LYLA 2WYVA 1G6KA 3HUDA 4DLBA 3ONDA 4NK5A 2P5UA 3KSZO 1DC4A 1GTMA 1PR9A 3OIGA 4O63O 4C7JA 5KVCA 2DU8A 1KEWA 1RJWA 1ADGA 1DIAA 3AFNA 3KRTA 3JQGB 4RVGA 4DPLA 3CXRA 4ND5A 4YVFA 4BKPA 1N92A 3OECA 2NM0A 3RUAA 1PSDA 3IL2A 4QECA 5EQFA 2HMVA 2O3SA 4L0QA 4YPOA 4OL9A 3PYXA 5BNFA 2E82A 4RPJA 4EUFA 3UH1A 2C54A 3OJOA 2EKPA 2Q1UA 1IHYA 3C3XA 2X8LA 5C37A 3S2IA 3C1TA 2YV2A 3QVXA 1I30A 3WX0A 2G76A 3VH3A 2RHCA 2VHXA 1SOWA 2Q1SA 2P9EA 4Z3KA 3VDQA 3PJGA 1RKXA 1BVRA 1VC2A 3G1TA 5HS6A 1ONNA 2B4QA 3LLSA 1X7GA 4YACA 4CLDA 1ULUA 3JYNA 4M89A 4F45A 2VYVD 2YZ7A 4ND3A 3S2GA 2NVUB 1PX0A 3AUAA 3MJ4A 2Y93A 3DBRB 1Q0HA 2EGHA 2D1YA 2JAPA 1HZZA 5A5EA 1YVEI 5GY7A 1ORRA 4RZIA 4TRRA 5ITWA 1QLHA 3H5RA 3HJAA 3WICA 4U6SA 2I6TA 3GEDA 1ISIA 1EMDA 3QV1A 4OYRA 2BF7A 5IZ4A 1ZNQO 4XQEA 3UW3A 4CM8B 3IOYA 3Q9NA 3FR7A 3M1AA 4MIEA 4C4OA 3ETGA 3NTRA 1ZK2A 2XXJA 3O03A 1PJ2A 4W82A 1Y7TA 3DZHA 4CUJA 2BGMA 4AJ4A 1VJ1A 3JV7A 4AICA 2DBQA 2JAHA 2P4HX 3IC5A 4GX0A 2NQTA 1P9LA 7MDHA 1JQBA 4YRBA 3GNQA 3AU8A 4CV2A 2VHVA 1O8CA 1PGNA 2P9CA 4NDNE 5L3ZA 1AHHA 2JCXA 3L4BC 4FDAA 2ZIZA 5T8KA 4BO7A 5I7VA 1NAIA 2AG5A 4D42A 4NPCA 4ONEA 1A72A 3VZSA 2HMUA 3F1KA 4AJLA 3ZDFA 3Q1LA 4PZEA 3DHEA 4UVIA 3OSUA 2IXBA 3GRPA 4PZCA 1PWZA 4BO3A 3DFZA 4IY1A 1LA2A 3DXFA 3ENKA 4KWIA 2FY8A 3PFWO 4WEQA 2GDZA 2GERA 4KZPA 4WEOA 4M87A 3BTOA 5BSFA 4TROA 2BMAA 2FPPA 2ZYGA 5CDTA 3CMMA 2DBRA 3PTZA 1N7GA 1U2DA 4JNKA 2FN7A 4IIUA 3RWBA 4D79A 3WGTA 1D1SA 2ZKLA 5JMWA 4II2A 3AY7A 4YJDA 1PZHA 1Y5RA 2HJSA 5F1PA 4H15A 2A94A 3GVPA 2P91A 4DVJA 5BSHA 3F5QA 3GFBA 3CMCO 1QV6A 4RQTA 1UAGA 1ZSVA 4MP6A 1E1MA 1BRMA 1Z7BA 4D0SA 2NNLD 4KMSA 5A9SA 3M2TA 2ZB8A 1SZJG 3GOHA 4BNHA 4WLNA 4MVJI 3WS7A 4K9DA 2Q4EA 3GVHA 1PZEA 4YRAA 2GGSA 4ZVVA 2PGDA 2CDAA 3GHYA 1MV8A 1ZUD1 4WLOA 1ONPA 5CDUA 4HFNA 4JBGA 1X13A 4DPMA 3VPGA 2HMSA 1SEPA 2WJPA 3WYEA 1PJ3A 3RC1A 4GLOA 4AJJA 4K28A 2GF2A 4J1NA 5EERA 3RU7A 4CLOA 2B69A 2Q4BA 2Q2WA 3NTQA 1QR6A 1F8GA 4B4UA 1Q7CA 4BNNA 2OOSA 9LDBA 4M55A 1LLCA 3ZV6A 1GAEO 3CUKA 3FNEA 4YYZA 1R12A 1YXMA 3Q2KA 4TRJA 5A1TA 5DDIP 5K6AA 3VOSA 1IB6A 3JQFA 1NPTO 4LK3A 1UZMA 2FWMX 4BNIA 3ZWWA 3PQFA 3QWFA 4YA6A 5EQDA 4CUZA 2Q2VA 4X54A 4DIFA 3MJTA 2C5AA 2C20A 2H6EA 4RZHA 2GZ1A 3SJ7A 2GN6A 1E77A 4J3FA 2QYTA 4Z6KA 1NHGA 3G0OA 1MC5A 2VRCA 4IINA 2OZPA 3DBHA 4P8RA 5B4UA 3NYWA 1ADFA 4RDIA 1I8TA 1OC2A 5ITVA 3DFUA 2FPGA 3DONA 3F4BA 4NJOA 1NAHA 4DQXA 1WWKA 2GZ2A 5COAA 3ZW9A 4GBJA 1WPQA 1P1JA 3ICPA 2WWRA 5IDYA 4RV9A 1DBVO 3E5MA 4MDHA 4QO8A 5I7EA 3F47A 4J2HA 4R3WA 3K6JA 3RFTA 3MEQA 3RUFA 3HSKA 3QP9A 3G17A 2HMTA 2ILTA 2WM3A 4CL8A 4URFA 1NFQA 1E3WB 2HDHA 1SCUA 3UKOA 1ZBQA 1HE5A 4PZDA 5BNTA 1YB5A 3OIFA 5U1PA 5KNLA 4NR0A 5GMOA 3QSGA 1B3BA 4BHTA 3WGQA 4Q3EA 1HE3A 1IOLA 3LT0A 1XWFA 1A5ZA 1I01A 1I5RA 1HYEA 4MVJD 1VSUA 1SEVA 2FPIA 4GI2A 5TT1A 4MVJE 3DTTA 3K9QO 5TJHA 4XYEA 1DO8A 1CQJA 1J6UA 3GGGA 2NVUA 1GFSA 1WDMA 1Y81A 2DM6A 1JAXA 2B5VA 4OO3A 4CM7A 3VPSA 3UAGA 3RC9A 4CR8A 3EY4A 4HBGA 1FK8A 2GYYA 5IDQA 3ZCXA 4R5HA 1C14A 1SAYA 3VPHA 3ZI0A 3T4EA 1HSZA 3GEMA 4H7PA 1IULA 3PDUA 2C2YA 3JCZA 1BDBA 1PJCA 2AE2A 4GWGA 1SPXA 3PHHA 4IDBA 4B4WA 1EZ4A 4DIOA 4MVJP 4Z9YA 3RFVA 1LC3A 2CVQA 2JFGA 4HV4A 1CETA 1JWBB 1N7HA 1JKFA 4L9RA 4HUJA 3NJ4A 2EKLA 4FGWA 1BHSA 3F6YA 1E1NA 3VPXA 1ISFA 4JP3A 1O6ZA 1E3SA 1GD1O 4TKMA 1OC4A 1PQWA 1RM0A 3AUSA 1UXKA 5ILOA 4ZICA 4MKRA 4I9UA 3OICA 4S1VA 4XR4A 3WGZA 1T1SA 4OKIA 4YRDA 3ANMA 1TLTA 4B3HA 3EUWA 2EF1A 3HDHA 3OF2A 1E7SA 1N8KA 1M67A 1X7HA 3V2GA 5KJFA 5MDHA 3VZRA 1BTOA 1NQAO 4DWVA 2IZ0A 5LCXA 1B15A 3AW9A 1GEGA 2X22A 2QHXA 1SB9A 4QX6A 3LSYA 4NBUA 4MVJG 3E9MA 2Y99A 4XYMA 3SJUA 4WUVA 1V0JA 3PLRA 1GZ4A 3WR5A 4E5PA 2D3TA 3M2PA 3MZ0A 4FC7A 3L6EA 5A3VA 5HBRA 2Q49A 4BNWA 3OJ0A 3QWBA 1ISHA 1M75A 5LC1A 1UXHA 1YQDA 1MXFA 3ZHZA 3ONEA 4YR9A 1VSVA 3DAFA 4DREA 1K6IA 4Y67A 1KVUA 3WWZA 4MVJM 4BNXA 1GCUA 1P31A 8ADHA 4D43A 1KETA 3WSWA 2JL1A 3TDKA 3GVXA 4M49A 3LF2A 1NNUA 4RL6A 5G0SA 4LRTB 4R69A 3O38A 1KC3A 4BOYA 1B16A 1MGOA 3QHAA 3G79A 3IP3A 3ADPA 3N7UA 2J3JA 4JJFA 3VZPA 1S6YA 4JGBA 1I36A 2AEFA 5JAIA 4N5NA 3WBBA 5KOIA 5DCYA 2JFHA 3KM0A 4WNIA 3JD4A 2X23A 4II3A 3ZWNA 5KTKA 1Q1NA 2VZ9A 3ABIA 2EEZA 1D3AA 1HL3A 1B7GO 2EV9A 3QJ5A 3EC7A 3JQ6A 4PLZA 1PJTA 5C3MA 1W8DA 2HK7A 3HQ4O 2JCVA 2X9NA 3W8DA 4J2OA 3C1AA 1E92A 3JYPA 3BHMA 4RVUA 3WIDA 3FHLA 1QORA 4WLVA 5ILGA 3RAJA 4BS9A 5IXSA 5L53A 2O4CA 3GPIA 3TL3A 1MA0A 1MG5A 5DCUA 1PQUA 1W6UA 2VRCD 4HFRA 4Q39A 1B26A 3B1JA 3RBZA 3QWAA 1YL7A 2B0JA 1IZ9A 1PZGA 5BQFA 1T4DA 4PLPA 4OHUA 2NWQA 1XG5A 1QMGA 3FSRA 2FZWA 2G0TA 4W9NC 2DFDA 2ZB3A 4UVDA 1VL8A 5KWEA 4E30A 1DLJA 2H63A 1A27A 4JK3A 1NR7A 4UEKA 4CQMA 2VWGA 5KVQA 1DJQA 1H6AA 1DRVA 1HE2A 2VZ8A 5A02A 5HRUA 5JDCA 4JN6B 2O2SA 2FR1A 2YFHA 4YBZA 2DKNA 4BNKA 3AI3A 5I9LA 4IDGA 1QYXA 3H8VA 5CPFA 2VNAA 5HM8A 1NPYA 2RCYA 4TRNA 2ZK7A 3EYWA 4ND1A 3DZGA 4ZQBA 5I8ZA 5JFOA 2A92A 3KYCA 4UUMA 3ZN2A 4GMGA 4ZN6A 2ET6A 4LN1A 4EJ0A 2YHIB 3CZMA 1EUZA 3E1KA 4K6CA 4ZHSA 2I3AA 5IFLA 4TSKA 4FFPA 3ZWXA 1BW9A 3IP1A 1GZ6A 5KJ6A 4MKZA 1SNYA 3DTYA 3SLKA 4AJIA 4YXFA 3FF4A 3CIFA 4UULA 2VTDA 2GSDA 2B4TO 1OFGA 2A4KA 2PZJA 1VJ0A 3LDHA 2OP0A 4KDEA 5EESA 1GQ2A 2Y67A 4BNLA 3R3JA 4LCEA 1SC6A 3WGOA 4I5EA 3NDRA 4L8VA 5KIAA 4BNYA 3JYLA 3HADA 4KQWA 5T67A 3P2OA 4BNMA 1CJCA 3VKVA 2BHLA 2Q3EA 4Y6PA 3UUWA 4J7CA 4PN3A 1PGJA 2VUSA 4FFLA 2QQ5A 3PJFA 2NTNA 4CV1A 2C7VA 1OMOA 3KUXA 2VN8A 1P1IA 3M6IA 4FN4A 4UVEA 1WDKA 3HN2A 4BGVA 2W2LA 5DZSA 1U3WA 5IZCA 4IS3A 3L4BA 4QXMA 2PD3A 3BHIA 3FBGA 3KB6A 2B83A 1KEVA 4WOJA 1W4ZA 1NQOA 3IUSA 3JD2A 1ENYA 2VCYA 3B20A 3OQBA 1DEHA 1M66A 3INGA 5MGBA 3UVEA 4BB5A 2RH4A 4NBVA 1VM6A 3IKVA 1HSOA 5T64A 1D7OA 3ST7A 3BTUA 1XKQA 3E9QA 3L9XA 1XGKA 4O59O 1K2WA 4JBHA 4L75A 5IAAA 1IYZA 3AI1A 5JLAA 1QKIA 4E5NA 3HG7A 3OEYA 3GNSA 4BO1A 3JSAA 1F14A 4XYLA 2ZB7A 1FDUA 4U6QA 3AJRA 5FEUA 3EVNA 5FYDA 1NPDA 4TVBA 3FWNA 4XWYA 4ZA2A 1HTBA 3SBOA 4BO5A 1KVRA 3QE3A 2JCYA 2V7PA 4MINA 1OZAA 4E5MA 1LSUA 1H2HA 3MJSA 4GGPA 1JA9A 4RGBA 5JCXA 2YDXA 1JU9A 4YJHB 1GYQA 3DO5A 3WGGA 4H16A 3RIHA 1YE3A 2DBVO 5A05A 1MXHA 5CPBA 5TIIA 1G0NA 2NLOA 3PGJA 2QZZA 1N1GA 2FMUA 4ZRNA 1DPGA 4WKGA 4BNFA 1QYVA 4BV9A 2AHRA 3VTZA 4EUHA 3D3WA 4HFJA 1QSGA 4Y6RA 4EJMA 5KKCA 3HFGA 4XIJA 3NKLA 1EFLA 4YT8A 1CERA 5CHEA 2VRBA 2PV7A 2XPCA 5JO0A 2Y68A 4E33A 4CMBA 2DPHA 1WXDA 3BYZA 1CQIA 3PK0A 5JO9A 1UDCA 3ROQA 1DAPA 1AN9A 4XGKA 1A7AA 2CUKA 3SC6A 4A03A 1C0KA 1O94A 2B36A 3JQ7B 4AVYA 3VHRA 5JC8A 2UDPA 3GZ4A 3U62A 4XGIA 2Y1GA 2UAGA 2FR8A 1LNQA 1LQUA 1PU2A 4CMKA 4PLWA 1VPDA 4B8ZA 2W2LD 5DBFA 2UUPA 2C5EA 5I8WA 2WTBA 4MIYA 3QVOA 4Y8VA 2CVOA 4M8SA 3GUCA 4N54A 1T2EA 1C0IA 1E7QA 4TZTA 4E5KA 1SB8A 2OHXA 4IJKA 5IDXA 1HWYA 4ND4A 1NASA 4NH4A 2NQ8A 2DUWA 3GGOA 1I2BA 2HCTA 3WXBA 3W8EA 3HNPA 3PJEA 1EE9A 4B3IA 4CLRA 1JTVA 2BFOA 4J0EA 1CWUA 2LDBA 4L4XA 1YH3A 3NUGA 3U3XA 4B3JA 3TOXA 3TJRA 5A9TA 2O7QA 5JMPA 3TZQA 3IUPA 1XA0A 2EIHA 3D5TA 1H2BA 1ZK1A 4XRRA 2X6TA 3OFSA 4YT2A 2JHFA 2CY0A 5ADHA 4KDFA 2VHWA 4BNVA 2ZB4A 3ON5A 5TRTA 4DMLA 3RASA 2ZYDA 4DC0A 4CJXA 2QW8A 3P2YA 5JS6A 1H5QA 3LU1A 3WSVA 4YQYA 5BNIA 1TT5B 2RIRA 3JQEA 3WTBA 1WMBA 4B4VA 1GV1A 3TZKA 1JDJA 2PH5A 5L7YA 3GN1A 2EJVA 1IUKA 2B37A 1W0CA 2IE0A 3A28A 1X1EA 2W8ZA 5TS3A 3SEFA 4K26A 4QO7A 4J49A 2H9IA 3N58A 1E7RA 1EDOA 3ROPA 5EMHA 4YCAA 3FWZA 4BMNA 2YW9A 4LISA 3D5QA 1XDWA 1PL7A 5DP1A 5DULA 4DPKA 3WLEA 1HDYA 3NT5A 1PS0A 2DC1A 4KTTE 1E7YA 4RPKA 3AFMA 1HLPA 4I08A 2AQ8A 3AOEA 1PS9A 2HUNA 4A7PA 1KEPA 2NACA 2PY6A 3INRA 5L45A 1KBZA 2VWPA 3LLVA 2ZCUA 4ID9A 4RJTA 3KYCB 2O2YA 4U0JA 1NVTA 1CIVA 3GFGA 4IXTA 1HLDA 2YHIA 4XDZA 4RPLA 1F17A 3Q11A 4AJ1A 2X5KO 1WAMA 2BD0A 3I5MA 4NFYA 3VVCA 4PLVA 4RLHA 4OIMA 3UGKA 4BNTA 1A4IA 1P1RA 5I7FA 2SCUA 4ITUA 4AJKA 5L4NA 4TRMA 4OXNA 3R1IA 2OGUA 5ER6A 4GKVA 4J16A 5TSDA 3C85A 1YJQA 3MWDB 4DC1A 4E2ZA 2CMDA 4Y6SA 4R1UA 3GN2A 4HNGA 1X0VA 2B5WA 4WECA 4ZJUA 2P4QA 3GQVA 3U09A 1DRUA 1ZIDA 4XJSA 1ZFNA 4J4TA 2VT3A 3PWZA 1VKOA 3AOGA 2IEDA 2YQ5A 3PGXA 3E82A 1HDOA 3H5AA 4KTVE 3RQSA 2PWZA 1EEHA 4TQGA 3BMQB 2XAAA 4W7IA 4GAEA 4BNUA 4QUKA 1EE2A 4TWRA 3D3EA 2Q46A 3LK7A 1BGVA 5JDIC 1VI2A 3ZV5A 3I9MA 6ADHA 5C7OO 1EVJA 4ILKA 3KYBA 3KETA 3IJPA 4GH5A 1GY8A 4M54A 1P0CA 9LDTA 2CDBA 1J0XO 1OAAA 4BO2A 3ZGYA 1AXGA 3AU9A 4DBZA 4DXHA 3PJDA 3EZYA 4C7KA 1KOLA 4E4YA 1R16A 5JAZA 2YV1A 1AGNA 1AUPA 2X86A 1BDMA 2HSDA 4HNHA 4E31A 1K6XA 3I23A 5AXCA 3TNLA 1FJHA 4BNGA 2GASA 1HYGA 3DBLB 1XELA 4DA9A 1PTJA 1U4SA 4I5GA 1Q0LA 4ZQFA 2G1UA 5I9NA 4NJMB 2WMDA 1LX6A 3A14A 4BO8A 3ETEA 2P9GA 1O89A 4RF2A 1R6DA 2W2KB 1I3KA 3AM5A 1KYQA 4EI2A 5AQ1A 4N7RA 1BVUA 5JY1A 4RF3A 3MJCA 1CDOA 5IF3A 1I3LA 4GGOA 4XYGA 4AJHA 1JWAB 3S1LA 3ZZNA 2ZTUA 4AJ2A 4OSPA 2WYUA 1U4OA 3RSHA 2IZ1A 3GZNA 3ZWVA 4CLRB 3BTVA 4D0RA 2EJWA 2PGJA 3H6KA 4NFSA 4BV8A 5TT0A 2JD1A 2IZZA 1ENOA 2AEMA 1GUFA 3K96A 2WE8A 4L4RA 1I0ZA 1QLJA 2X0RA 1PR3A 1LRLA 4EJ6A 1HDXA 2YYYA 1QP8A 4XD2A 1E0DA 1YJ8A 4Z0PA 3DZJA 4BMVA 4MO2A 4GMFA 5DBIA 3BMNA 4D3SA 2AXQA 2J5KA 1PGQA 1V8BA 1WP4A 2FZEA 3FNFA 4RVSA 3N74A 3GVIA 1GR0A 5THKA 1LDBA 4CV3A 3HB5X 2FRDA 2ZJ0A 4ALIA 2YFQA 5JBIA 3GDFA 4W4TA 1UH5A 3H9JA 1A9ZA 3KTDA 4BVAA 2WSBA 4OQZA 1VL0A 3KLMX 4F6LA 1YBAA 3HZZA 3WG9A 1SMKA 5CDYA 1DXYA 1NHWA 1T26A 2OMEA 1G0OA 4P38A 1WZEA 2VZ0A 2X0IA 3TN7A 1A71A 4D7AA 1V9LA 3GA0A 1RYDA 3GR6A 4FJ0A 5K6AC 2PGLA 1TT7A 2DFVA 1HETA 4DBVO 2G5CA 3IJRA 1EVZA 5T57A 2RH8A 4LW8A 1JKIA 2PH3A 3Q9UA 1P74A 4RORA 2NTJA 4UUOA 1TT5A 3I4CA 3GDGA 1F0YA 4BGIA 4LGVA 3KEOA 1HDGO 4ND2A 3WMWA 2Q45A 3WJ7A 2EGGA 1J49A 3WFJA 4AJNA 4WLEA 4IQ8A 4PLCA 1LDNA 4NFHA 3UCEA 5KKAA 3BMNB 1P33A 1XSEA 2O3RA 1CF2O 2B4RO 4TKLA 3U5TA 1DFIA 4R41A 1UDBA 5C7LO 3JQ9C 2HRBA 4GX1A 5JCJD 1QV7A 4QQRA 4OKNA 3H2SA 2HKIA 3RFXA 1RM4A 4CLOB 5CAEA 1UZLA 1X15A 4W7HA 1W73A 1XEAA 4IMRA 3WTCA 5GZ3A 4G5HA 2C0CA 4CM3A 4R1NA 1IL0A 2ZQZA 4FB5A 4TZKA 3FTPA 1DDOA 4MP8A 2V65A 2XF8A 3GPDG 3LF1A 5DNAA 4B8WA 3WYBA 3PP8A 4J1TA 3NRCA 1DFGA 1E1KA 5KJEA 1H6BA 5BT9A 4BKUA 4PRLA 1U1IA 3UN1A 2O3JA 4A26A 5K9ZA 2D5AA 3JYOA 4ALNA 3ROKA 4R9RA 4JBIA 3RKUA 2ZATA 3PHIA 4AJOA 1YKFA 2P68A 4I8XA 4YDRA 4U0KA 2Y66A 3L0DA 4RLSA 4Q3BA 2J3HA 1ZH8A 2WD7B 1B8UA 3JQCA 5TC4A 3AM3A 4WGGA 4L73A 3TF5A 4B79A 2BKAA 1SBYA 3AUUA 3W4IA 5HWSA 1U8XX 1Y8QB 5EPOA 4PVDA 2I76A 1MFPA 3E48A 2VUUA 3I9JA 3T7EA 1DIGA 4WCDA 3WWYA 2EP7A 3O8QA 2Q99A 3KSDO 4CUKA 4R16A 4K6FA 2FHSA 2Y1EA 5BSGA 3ULKA 3B1KA 1UZNA 2ZYAA 4R1SA 2CVZA 1PIWA 2A35A 3JQ7A 2Q50A 1DIRA 3RUEA 2AQHA 1WLYA 3U0BA 4GSKA 3C8MA 4QFDA 2I99A 3PZBA 4NNJA 3DBRA 4L4SA 3IQDB 3GY0A 3DB2A 5FF9A 4UEOA 1NTOA 3V8BA 4E0BA 3GRKA 4TVOA 1NYTA 3V1UA 4KUEA 1M2WA 1PJSA 2OFPA 2NTVA 3DHYA 5L4LA 4O6VA 1NFRA 2VYNA 2BI7A 3MCVA 5A06A 3HB4X 1NP3A 3NX4A 4J4BA 3OP4A 1U7TA 5ENDA 1PWXA 1L7EA 4PRKA 5FFFA 5BSEA 1ISGA 1LLDA 1LSJA 2AQIA 2Y1FA 3EVTA 1E6WA 3KSUA 4NJMA 4R5MA 1LDEA 3UXYA 1ZSYA 3JQ9A 2TMDA 4CQMB 2QIOA 3B70A 4KUHA 1XU7A 2UUOA 2Q2QA 1GL3A 4FJ2A 3VC7A 1Y8QA 3W6ZA 1N5DA 3ZH2A 3TZCA 5C5IA 1V3VA 1ZVMA 2NU9A 1B0AA 4R54A 2IXAA 3D4NA 3O8QB 3DOJA 1YL6A 2CDCA 3ZWYA 3ITKA 1T4BA 2PR2A 3HDJA 3FNGA 1P1FA 1XHLA 3H3FA 1LLUA 3TSCA 2CF6A 1G1AA 4CM1A 1C1XB 1IE3A 2DBZA 1DB3A 3GNTA 2HO5A 3DMTC 2J3KA 2LDXA 2NU7A 4JCOA 1I24A 3GF4A 2VWHA 3X2FA 3GLQA 2Y0CA 1WMAA 4XKJA 5L7TA 3ICCA 1BW9B 3JQ8B 4O0LA 5DOZA 3TRIA 4JLWA 3W6UA 4BQPA 3JQAB 3MOGA 4BO0A 1BXGB 3OH8A 4F3YA 2JD0A 1DC5A 3DZFA 2GNAA 1NWCA 2B35A 3I83A 4N18A 1P0FA 3PIDA 2RAFA 4NBTA 3STHA 2DLDA 4M86A 1Z75A 5G0WA 1EVYA 1ZJZA 3PDJA 4J6FA 5A9SB 4KUGA 5JAQA 2QRJA 2WDZA 1YBMA 5KCZA 3EW7A 2QRKA 4IJWA 2BGKA 1YBVA 1UDAA 2EP5A 3UCFA 3PYMA 3RU9A 3QA9A 2J3IA 3WLFA 1KVQA 4MVJA 3CTMA 1ENPA 1R0SA 2X5OA 4NHEA 4J9VA 1LBEA 1K6JA 1GPJA 4MKXA 3HE3A 4UEJA 3KXDA 2Z1NA 3KHUA 4CL3A 1PL8A 3PWKA 1K0UA 1CRWG 3JQ8A 3NGXA 5ICMA 1E3IA 2QG4A 2UVDA 4H3VA 1R66A 2GCGA 4I9NA 4J7XA 3F46A 5ICSA 2BLLA 3L6DA 2NSDA 3ZNPA 1D1TA 4GVLA 2IRWA 1EFKA 2VHYA 4LVCA 5EINA 3F5SA 4FOSA 1BWSA 2X9VA 3I9KA 5AXAA 3A9WA 4FW8A 1IZ0A
chains in the Genus database with same CATH superfamily
4BNZA 4HTFB 3A1CA 4LOLA 1T2CA 1AHIA 3OZ7A 4X62B 3RTBA 4JOBA 3OKAA 3L8EA 1JBQA 5GZ6A 1ISPA 3F5DA 5TQJA 2FZGA 3RQIA 5CFZA 1T5SA 4B7XA 1TQ8A 2DAPA 1L7AA 4R7ZA 1ULHA 2H1IA 2RAVA 4MLZA 4YJHA 3VH4A 3F3KA 3UOAB 3AH8A 4D3YA 1NGSA 1I4TD 4Q3AA 2GKGA 5COBA 3IAS6 3DQPA 2NVWA 4ZCMA 1PR4A 4KSYA 4DTIA 1DELA 3OM9A 1Z4QA 3KXLA 2AF4C 1AKTA 5LUAA 4QJIA 4U7JA 3R3HA 1TUEA 4J4HA 1QYDA 3QXSA 4KIJA 4OGGA 3ZE1B 4IZIA 5B3LA 4CKEB 1V2HE 1W9MA 3UJCA 4M83A 1NJFA 2IKSA 2H3HA 4L7VA 1UKVY 4LYJA 2XDQA 3W5DA 1KMHB 2CXTA 1V5IA 2WD7A 5LP6F 3D4BA 1J9GA 3PDCA 1GPBA 2WZDA 4U02A 4OV6B 1AC5A 5HF6A 3K9BA 3OCWA 5LOVF 1MOZA 2HREA 2P2SA 1XVIA 2X1VA 1PZNA 3D54D 1XD8A 3H2BA 4Q3DA 2DBYA 3CUVA 4FYHA 2QLTA 4K6KA 5DSXA 3TTYA 4AUNA 1N5IA 4ER0A 1JIXA 3JQBA 4HEA6 1OGYA 1MQ8B 5AM0A 1FSZA 2QWXA 3QYFA 4IJMA 3KYDB 4MPDA 5I45A 5IF9A 1TI7A 3GO4A 4V02A 3HO1A 3KOUA 2LPMA 1QB7A 4JI1B 3NU1A 5KWSA 3QOXA 4NC9A 2AOUA 5AVOA 4HNTA 1JP7A 5KSPA 2BHNA 3FWYA 2XA1A 4JYCA 4FHCA 3LLMA 3CH6A 3K7EA 2DFLA 2AFHE 3AO0B 1L4BA 4F9FA 4P4NA 1LBHA 3MUFA 4M1OA 4COKA 1TD1A 1A9QA 1C3JA 2C7GA 2OLEA 1HDIA 2H17A 1SBNE 4M1KA 3SDBA 2R00A 5JZOA 4ZK2A 3GLHE 1SELA 2HSGA 4FBLA 1RCFA 2R5NA 3M4YA 4RMJA 1I2DA 3DLAA 3OZBA 4NCKA 4Z3DA 3PA8A 2QDKA 2AW3A 2HCJB 1M1YE 2VPXA 5DJ5A 1CUAA 4ZAWA 2FX3A 2Z6UA 1CVIA 2GEJA 4IG9A 3WGHA 2F6RA 3DHNA 3DOFA 1WZ2A 2V03A 3AKCA 4LS3A 1NZJA 4NH0A 2IEBA 1RKUA 3KIPA 4FE4A 4RAOA 4X1OA 3PSAA 4DLNA 1A9RA 1MUUA 1S3SA 4QODA 4BP9A 1E58A 3BCUA 3I92A 2E21A 1RXSA 2IYRA 3UAYA 1TQ4A 2R8YA 3UYKA 4F9TA 4PN7A 3SGLA 1Q0TA 3U81A 4OLBA 2IYPA 2Q5HA 4GNKA 1IZZA 2GB4A 2VNIA 4IWXA 3SNKA 3OFND 4KYVA 4CTOA 3STXA 1ODCA 1GKIA 5EYPA 2GJ4A 1YVRA 3B1FA 3E5HA 4RTNA 1SCBA 2DERA 2YCLA 4S1TA 1PG2A 1FSGA 4EOGA 5AM3A 3MBIA 4CWAA 3GT0A 3IOEA 3PYLA 5ER9A 1QYWA 4AUMA 2GN8A 2A7XA 2CXRA 4NZNA 4XWTA 4MQUA 1LRKA 1ZK4A 2Q3LA 2P5YA 8MHTA 3LLUA 2GRAA 2Y6UA 3EIWA 4LGYA 3PGA1 3IKLA 1Z36A 1R88A 1X42A 1LPPA 3QYJA 3H65A 3TYXA 2BONA 2EL7A 4MJ3A 4CM9D 1DAIA 3ENVA 3HU1A 4ZP1A 4DNXA 3R5HA 4CQMD 4W9MC 2IW1A 1CIPA 3TRHA 4YRSA 3BORA 1PYOA 5F5XA 4CMEA 4D81A 1R9GA 1FQJA 2A30A 3B7WA 4JSTA 3CGGA 4AJPA 2I54A 4LY6A 1XZLA 2AEEA 1UR5A 1JSCA 2FSIA 3AY3A 3GRYA 4ZQGA 1Y7PA 2C4WA 2GAFA 2PUDA 1C1XA 5DCWA 1V9CA 1MG0A 1VJTA 1TJ5A 3ER6A 2WM2A 3CWCA 1E2BA 5F23A 3RKRA 4G89A 4L4UA 4AYXA 2QNBA 3P2EA 4U2BA 4JI3B 5CEEA 2OO5A 4EYGA 4C20A 3GPLA 4BJ1A 2O19A 1M72A 4XGRA 4JP8A 2QTCA 4R83A 1GPMA 1ZW1A 2PZFA 2UXCB 3L84A 5ICEA 1GJRA 4C08A 1QG4A 5LMCA 1P2TA 3AHJA 4YJGA 4XRGA 2DWOA 3LE8A 4ZMSA 1F06A 5KNBA 1ISJA 3WWPA 1RR6A 2Y71A 4NZMA 4BLUA 2C5GA 2Z5LA 3KVRA 4MWDA 3TX6A 2VAXA 1ZVKA 2YRWA 4IXNA 1O0SA 1IUNA 2AG8A 2EZ4A 3DTVB 4LQLA 3KQQA 2J6HA 4D8TA 4FGJA 4CEHA 1RQ7A 4ZVMA 4D8VA 5LJLA 4OXQA 3TINA 2GPNA 3H16A 3WLJA 1E9DA 4Y0NA 4JS0A 3F3YA 3KT8A 4BCBA 2Z4RA 3AF1A 4YIHA 4KE9A 2W6ID 4IJQA 2JZNA 3TTVA 3LYAA 3UHJA 4CMIB 2WSSA 2FP4A 5K0CA 1CEXA 1MB3A 5E2IA 3CUSA 1XYYA 4FGKA 4GZ6A 1OAOC 3RRXA 4IH9A 2QX9A 2Y1OA 4YPVA 2HWWA 4DXAA 4JLMA 2X4LA 5L40A 4ERNA 1W7AA 2WC1A 3V00A 3PTAA 2VIIA 3TIVA 3WRXA 1Z5GA 1ZK3A 4TV9A 5E7MA 4MGHA 1XJWA 3ZKAA 4N3AA 5DOVA 5FBHA 2G88A 4L3VA 5CFNA 2DETA 2C7RA 1YI0A 5FL3A 3K8YA 1QGAA 4AKTA 1WJGA 1NATA 2HD4A 2I4TA 2HIMA 4GX2A 5BN5B 2HLPA 3WGLA 1A2OA 1R4NA 3H8WA 3ZEAA 2CNNA 2ZJAA 3FJYA 1GLVA 5K0EA 3F4LA 2RGXA 1Z06A 1Z0DA 1HNNA 5AI8A 2NU6A 4FFNA 2A33A 5IH3A 4MW4A 4IZHA 2QSYA 4INAA 4LGCA 2ZWOA 5NLLA 3UUGA 5C1OA 2OHVA 5KC9A 3QSYA 5EZ5A 4MIKA 4M36A 4DJEC 1ZKMA 4BQOA 4NQZA 5HUQA 1KK2A 1GV0A 3AVPA 3CF4A 1EK5A 1A97A 2HA0A 2V6GA 4ZI7F 3HYRA 3ZD6A 4JXXA 2H7YA 1P5JA 2JH8A 3PVZA 5AW3A 3FOFC 2IH2A 3IMEA 2WRZA 1NXXA 3I9FA 4ZZIA 2P6UA 1MZPA 1ULZA 2ATIA 2H2HA 3GGPA 4IDPA 2FSVA 5TNXA 1DLIA 3L18A 4D3XA 2X1LA 5F33A 5BV7A 2TRSB 5FBVB 4K1XA 2HDOA 1ACMA 1UBUS 3AUFA 1U2GC 1QHXA 3NNDA 4ZVSA 1NVXQ 1YQQA 2H1HA 3MUEA 5JYEA 3KZVA 3S27A 1K8ZB 1YQGA 2IV7A 3AF5A 1VYTA 5HZHA 3LPLA 3LUPA 4H3KB 1F2TA 5FAXA 1KSGA 4IQ4A 4D4LA 1TW3A 3EDOA 2NV6A 2ID9A 3FROA 1GT6A 4BGEA 3RIYA 1BMQA 1QG6A 1RZUA 5JQGB 4IDQA 2MSKA 1AQLA 3IIKA 4HGNA 3SF8A 1CT9A 3PQ2A 2CMHA 3MCTA 1OSNA 2OGSA 1GPWB 1ZM9A 2COUA 3FNQA 3H9CA 3K3PA 4V1CA 3SJBA 5JQWA 3P9QA 3DBHB 4XPIB 3BHNA 2FEAA 4UAJA 2ADOA 1Q15A 2R3SA 2W2KA 1EVQA 3IALA 4ALLA 3TNDA 2CYBA 2YWDA 2BOVA 3ZLTA 1JLLA 1L7MA 2XRMA 1UQTA 1KQNA 2WVAA 1WV0A 4E32A 3MM4A 5K6TA 1R5NA 2FWJA 1GCGA 4S1PA 2CFCA 1Q7EA 2V7WA 3GLTA 4E2WA 2QX6A 1ZL0A 1ZU5A 2GWHA 2YOGA 4M9QA 4BZQA 1CUIA 5B36A 5DB4A 3UV3A 4FE3A 1MD9A 1WEHA 2C29D 2ZCVA 3CEAA 3UOGA 4XIGS 1IPFA 4R2JA 4B9EA 4CW7A 3HXOA 4BVBA 2DG2A 2QL9A 5KHOC 2H06A 1WETA 2HSJA 2JLQA 4EITA 1FRNA 4HKTA 4DZRA 4UKDA 5LQJA 1JLSA 4IL5A 2PKQO 3OQMA 3GJ8A 1EP3B 3HNOA 2IUFA 1E9CA 1F6WA 1IHDA 2RGCA 4BXOA 4IIDA 4KGVA 3WJAA 2REQA 1XZ8A 1U1GA 4EVQA 3GP5A 3U7JA 1CY7A 2QZJA 3GG9A 1K08A 1KIFA 2FPGB 3HMKA 4L27A 5EL0A 3DXYA 3WZ2A 4DRYA 5BWOA 3U56A 1ID1A 1PDVA 3R23A 1PNRA 2G09A 2O2GA 3FUTA 3MQ2A 1V16A 3BWVA 1V9SA 4CEIB 1JLMA 2J8ZA 3K32A 4NAVA 2RGGA 3I2FA 2CHUA 2N9UA 3OJEA 4LY9A 3TAXA 3V4ZA 4BX9A 1H0RA 2XW6A 3AYXB 3MYYA 4DGSA 4LXTA 4DEVA 4P0PB 4NHOA 3UJ9A 1R4MA 1N1EA 1NBOA 2QL5A 3NBYC 3NUQA 3P0HA 4R9VA 1DKNA 3G7NA 3EGEA 3TUZC 1RYHA 1KDTA 1Y4ZA 3JXEA 4IDEA 5ECWA 4DCVA 5CG1A 2XOXA 1H8HD 2YY7A 3O4JA 1RYZA 3K0AB 1QX4A 1S8OA 2IOQA 4DT1B 2YN4A 3KVOA 2FA9A 1MORA 3BMOA 4LVOA 4LZPA 2G9VA 1CV2A 3VR6H 3TQHA 1NLZA 3ZCVA 1D2MA 3VR2A 1GZHB 4FDLA 1V6AA 4LV5B 4YEDA 1N5KA 2LKDA 4MS3A 4L02A 1OI7A 3AJ9A 5DWQA 1P5ZB 3L6OO 1OFUA 4C14A 3MWFA 5IN4A 2X19A 5CHYA 4D9EA 1NFFA 2VYVA 3PRYA 5EMJA 2ZJ6A 3OLVA 4JUIA 1W6RA 3FPJA 4U2DA 2H48A 4D96A 3ABOB 4BJ5A 1PR0A 1HYQA 2PA3A 2XYRA 4OKSA 1IVNA 4MUKA 3HUTA 1G5IA 1M74A 3QVSA 3K92A 4FNGA 1I1NA 4IXDA 4QU8A 1C0LA 1S2MA 1TAQA 3TQFA 3WQRA 4AMZA 5CFLA 4FR5A 4I6GA 2PX0A 3T5CA 5B30A 2XE6A 1EFUA 4KLRA 1ACLA 2NUTB 4Q1FA 1CCWA 1TVEA 2JAOA 3QVMA 1GUDA 4JR0A 3SCZA 4ZOBA 1Q95A 3ROGA 3CVYA 3LUFA 1YQUA 4HDAA 2FW7A 4OJKA 3VAYA 3P19A 1E9SA 3L07A 1W4RA 4ESOA 4P35A 4WLUA 3TSAA 2XRFA 1MJ5A 1BXRA 5B37A 3O75A 1QRAA 2CD9A 1ZUHA 3OA0A 1IXYA 2FMHA 3TFOA 3KZXA 1M2NA 1D4FA 1XMIA 1DP4A 2FFBA 2ZPUA 2ZSFA 3LHDA 4I8IA 1JWLA 2QPAA 2AQKA 4Y1GA 2P2ZA 3AY6A 2OFWA 3NHJA 4AMUA 4WXEA 3GT4A 2IT1A 4B3MB 3DZDA 4K05A 1XVVA 3VFDA 3WXMA 1VHWA 2QM3A 4R2XA 1Z7YA 2PNFA 3DT9A 2O8FB 4PEVA 1T0HB 3G2LA 3OD1A 4ZVRA 4DA8A 1Y1PA 1Y4AE 2DF8A 3N0XA 4EHHA 1YZYA 5HK9A 1E64A 2PMFA 3DDZX 2WA2A 3FKSD 3RTGA 4HN2A 3ICVA 1DEKA 4IXMA 1G38A 3E22A 2D00A 4DDWA 4FWBA 5F73A 4AYWA 5DBHX 1E2PA 7REQB 1SXHA 4WFQA 4WCFB 2X9LA 1PD0A 1T3SA 1E0KA 1R0LA 3G7SA 3IXQA 4D9CA 3FLEA 1M2GA 1WSDA 1DV2A 5C34B 1F12A 1QGZA 5LZ7A 4E5YA 4YDQA 2O5EA 4JIGA 3OKCA 1WSBA 3NDJA 3OCCA 3I58A 3EXFA 2QAGC 2JF0A 1FNSA 1P17A 2J5RA 4IHJB 3SEAA 1LVGA 1O97D 1QC5A 4EHKA 3TNYA 1SD1A 4E70A 1G5FA 3AUTA 3BRQA 5D00A 1ZU4A 3THWA 1XRPA 4LY3A 4LOIA 1V3UA 2J30A 3I12A 4MICA 3I01A 4JVOA 2JK0A 3HDVA 3PHCA 4PCVA 5BQOA 4F8JA 2GILA 2FWRA 1JSZA 2G1KA 2PLAA 2F1RA 1E2FA 4LRUA 3ZCSA 3KXKA 1LDMA 4BIIA 1XTJA 3AHFA 1PFGA 3PQDA 6ABPA 1Q74A 4BZZA 4JT2A 2R60A 3OO0A 5CVEA 3VR3D 2DT5A 2OPHA 1JHUA 2R00C 4IZOA 3C43A 4GEGA 4BU0A 1KQ3A 3SDSA 1Z16A 1H9BA 4FYMA 4V0MA 1BD4A 4U1RA 5ICFA 4OHWA 1F6BA 2ICAA 1QFYA 1JFTA 5DT9A 4L9WA 4OVKA 3RWOA 1VSQA 4GL2A 4UM5A 3GEGA 2VPYA 3U7IA 3ZWPA 3Q7TA 1SUCA 3T54A 2ZU6A 2CSUA 2QU7A 3C5EA 4HQLA 3TL2A 4BVHA 2VYFA 5K03A 1JW9B 4XUDA 3RJMA 3BMCB 2MSEB 3PB3A 3V9PA 2A9VA 4RGYA 4E11A 1AQJA 4CKXA 3GC6A 5IMBA 2A6PA 2D2IA 4KXMA 3OZFA 2FZVA 1QHHA 1VG8A 2H16A 3LQFA 5KYGA 2E2WA 2IELA 4L5AA 1Y6GA 1WM1A 1KWGA 3QKUA 4A8HA 5LMZA 3FOBA 3UMSA 5H3CA 3IO5A 1Z82A 3OLCX 3ZE7A 3GGDA 4LVUA 3U13A 2ATXA 1P45A 3Q40A 4BO4A 3V3KA 3M33A 1OR8A 1O57A 3LCJA 1XZPA 3ZGNA 1LSSA 4BUCA 1E60A 4RY2A 1M1NA 4XSVA 3LY8A 1WO8A 2PAAA 1RYFA 4BQQA 1NVFA 4O2BB 3C6ZA 4EW6A 4JQZA 5EEGA 4Q4HB 1HQKA 4WH0A 4TKVB 1Z47A 1BDJA 2IYAA 1N33B 5DEOA 1J8QA 5DXJA 5GZ1A 1TIBA 3R3YA 3EUEA 4X63A 5EC8A 1G8SA 1K6EA 3DL7A 4EYSA 3S81A 4WT7A 1KYWA 1E8NA 3D4IA 2FW1A 3T3MB 4CKWB 4OXYA 3DPIA 1XCBA 5IP5A 1YQWA 2QAGB 3SEZA 4Z8XA 1IY0A 3CW9A 3GJ6A 1KDPA 5CDGA 5FQOA 4H4CA 1BE6A 3PGVA 4ZQCB 4BJ3A 5I7SA 1G5QA 4ZD6A 5FAKA 1GA4A 1W59A 2WYWA 1VIVA 3R0VA 3KJHA 2A7QA 3BRWA 3IQFA 4NTZA 4PX3A 1J22A 4POOA 3R6DA 4IIVA 2FDXA 4UPEA 2FKNA 1N3BA 1Q1BA 3L6UA 2FSSA 2HC9A 2I2FA 4QDUA 2A0FA 2VBCA 3A9UA 4MWCA 5JVDA 4OP1A 4AO7A 2OCAA 4QHYA 2WU1A 3IP8A 4IHJF 3AWDA 3K9HA 2BGUA 4BE9A 4WTOA 1XN1A 4RJIA 3WYAA 2WWHA 4F9EA 5KO2A 1NLYA 3GUHA 4HVTA 3EFEA 1XNJA 4BY9E 3NDIA 2PK3A 3DT8A 3MS2A 1OY1A 4KQGA 4B6FA 3JALA 3LPMA 1FP7A 1ZD3A 2BH9A 2HI0A 3BB1A 3KX2A 2JIZD 1I4EB 5DN6D 5K0ZA 3KKOA 4I9FA 3HCRA 1E4OA 3NT2A 4OSOA 4R7GA 1YGYA 3A1SA 3PEUA 4HO1X 2NU8A 4MQEA 4AD8A 4DLVA 1XFDA 1R6BX 1XZQA 1DBSA 1EEXB 3WQQA 5K0TA 4BFVA 2Q8QA 4M37A 2PRYA 4BO9A 4DLRA 3FHTA 2PH7A 2XD4A 2IS2A 1LEHA 3U60B 3I30X 4CMAA 1QQBA 1R4MB 2V7EA 3BL6A 4B8YA 4XD7A 3AM4A 3SVTA 1J33A 3R7SA 4TMFA 2JG3A 5M04A 2WSIA 4LE0A 3UMRA 3UBTA 4PIPA 1JA0A 1DOHA 4FSHA 4DR2B 4PTLA 3AL0C 4RD4A 3ND9A 3DAGA 3IIJA 4Y2TA 5BWNA 3T3OA 4A8JA 3PUIA 3D4OA 3KTAA 4KO2S 1BYUA 1T24A 2QPOA 3FZEA 1ZUWA 3FB4A 1A96A 2QYSA 5AMXA 3T4PA 3LZCA 4PLGA 2A1TS 4HYEA 1EM6A 2SBTA 3AFGA 2XNCA 5BR7A 3LC1O 4WVLA 4REQA 2GPYA 2QJFA 2BI8A 1L5LA 3UNXA 4AU1A 4UE3S 1EBUA 4TV9B 3DMTA 3A9VA 3AXTA 1ZLXA 1IQPA 1L9KA 5G4KB 4UREA 2VJOA 4QOJA 3WLLA 1Q11A 3NBMA 3O0TA 5AI4A 4B4OA 3VVLA 1RTKA 4ZVNA 4W1RA 3EFHA 2CWWA 4RL4A 4Y2UA 2FUCA 1P2FA 3HN7A 1TRKA 4R6XA 4WLFA 4HG2A 1Z6ZA 4ARUA 3JW8A 4PLHA 3D8RA 1ZMTA 4HGOA 4IJ5A 1PSWA 3E35A 4LAFA 4AY6A 1HMPA 4R0MA 1C0PA 1PT5A 3QOWA 4C76A 3ZU3A 4BKOA 2GH1A 1GTVA 2BKXA 2JJYA 4JJ8A 4ZT3A 1UP6A 1XKTA 2A78A 2FVXA 1QZZA 1T3HA 3NJ8A 1QK5A 2OPBA 3QWIA 5IBRA 4BYGA 1L4EA 1M6WA 1UMDA 2Y0DA 821PA 3CS3A 1T9DA 2D62A 3IIMA 4HRAA 3OQ1A 4IEIA 3C6YA 1P61B 2IDMA 3VDMA 4J0CA 3A1WA 5GJWC 1ZXLA 2F9MA 3CF0A 3HKDA 5BORA 3OBIA 3L3BA 1SHLA 3RRNA 1KZ9A 4ZANA 2ZT8A 5L95A 3JY6A 1DRWA 1UBMS 3B13B 3ZWCA 1XHFA 4DV1B 1FFBA 4KWHA 5CDFA 2VUIB 3QU9A 4Q3LA 4RESA 4WK6A 3RROA 3K9NA 4K6OA 3HZOA 5A71A 4IGKA 3VYVA 1WR8A 1GZ3A 3X1JA 1F2TB 1TLFA 4C78A 2XCOA 2ZBEA 4PY2A 4UUAA 5EHGA 5C1DA 1VYVA 5E7QA 5KYUA 4MZDA 1UCFA 4NX2A 1NVVQ 5IZCC 2ZPTX 4GWKA 2VF7A 2GN2A 4JVSB 2IWHA 3VNAA 3ZWOA 4Z4GA 3DOOA 4DF3A 3DEYX 1PV1A 1LC0A 5GJVC 2BSAA 4V03A 1U5BB 3E5RA 1T35A 2FVYA 2W58A 1CR0A 3LECA 4KVFA 2HHAA 5A6SA 2E5FA 5I4IA 1FNCA 3LVFO 4PHHA 2PUGA 1RLJA 3NFRA 5FO1A 3GAMA 1M1ZA 1TXGA 5HR5A 1IJFA 3LNCA 2ZBUA 3M6UA 3FSJX 1U3TA 3W34A 3BQ9A 3HHEA 2QGNA 3CZQA 1BYIA 1OYVA 2QL7A 1OJ7A 4XEHA 1NYRA 3BKWA 3U4DA 2IS6A 4O4JB 4DR4B 3WA6A 4LBYA 3FPAA 1RVV1 3FWHA 2BFBB 1CHNA 1E2HA 2QLNA 3AB7A 1K97A 3P9YA 4KOAA 2M6SA 4R2LA 3JQAA 1QVZA 4JH0A 4QXRA 3S44A 3MXOA 3SXUA 4RTLA 1D6JA 4DANA 1U02A 3L7OA 1UPFA 3NKVA 4NMHA 1YVUA 4JKYA 1FDVA 2AFIA 2E37A 2ZKIA 3PNKA 5E4FA 3QUQA 4MMXB 3T7IA 3WGYA 3P9XA 1VCNA 3AFHA 1UDXA 3E0XA 1OBFO 1ZGBA 1PR5A 4O4LA 3RYIA 1JN0A 1TJPB 3SZ3A 2FZ5A 3O92A 1II8B 4DJAA 3H1GA 3UXEA 4JI0B 1QRRA 1XFAA 3HZRA 4BL5A 1UDRA 1PFWA 2C9ZA 3OJLA 2DVMA 2GZDA 2G9NA 1SO8A 4G65A 5H68A 2WT4A 1ZI9A 3DFKA 1VMAA 3ICEA 4RAQA 1HFKA 1QHNA 1ODJA 1UBFA 5LPNA 3IKJA 1TW2A 1XMSA 1P4HA 3F7MA 1CF9A 1TAUA 3B53X 1W0KD 5L4SA 2CL5A 1JZTA 3KFVA 4JOCA 4M53A 3DNMA 4OXIA 3QM1A 2WU8A 4EYOA 2ZTMA 4ETNA 3GD7A 1E2LA 1DXHA 3OC0A 4YRZA 1P7ZA 4F4IA 1HFWA 3WBFA 1Z0FA 4XB1A 3OKFA 4D46A 2WIJA 1MOPA 2BGNA 3F71A 1JIKA 3U44A 4W8GA 4G0OA 3EH2A 3NGLA 4B83A 1NXPA 4LDZA 1O95C 1R50A 3UB4A 5KYTA 3LX5A 1GYPA 1Z5OA 3RD5A 4G67A 2ZGVA 3IA7A 5SY6A 1JVSA 5KPDA 3GZNB 1V96A 3PUXA 4O4HF 1TCBA 1XCPA 4FC6A 1QPZA 1Z39A 3KT3A 2P6RA 2XXAA 4OLAA 4Q4JB 3ZUGA 1BXZA 2VK1A 4ZQIA 3AESA 4MDEA 5CVDA 2O0KA 2CF5A 1PK8A 1NRXA 1YVDA 2ZE8A 4IKOA 2OORA 3RIMA 5CEFA 4GOOD 5ARBA 4EPRA 4AJEA 1W35A 2HBYA 2O3UA 2WWXA 1NSYA 3FGNA 1TRHA 1XZBA 3KE8A 3OA2A 1H0SA 3HLYA 3PIRA 4JL8A 1U5CA 3ANLA 2WV7A 3GWGA 1N57A 4BFSA 3LY5A 2WHPB 3MMSA 5C4MA 2NUTA 2PKEA 1QQAA 1GNQA 2OV3A 4LWOA 2POQX 1A9YA 2MTBA 5DYWA 3U4MA 1T9GS 3OIYA 1C8VB 4GXTA 2HADA 4QU9A 5TMBA 3SIXA 3MT8A 3V4LA 3VAAA 5AUPB 2BUBA 2X8AA 4TSRA 5DMXA 5HKKD 1NKSA 1YZKA 4XDYA 4P1ZA 3ASVA 1FX0A 5K99A 1JVBA 4UAGA 2BJHA 4J0FA 1C4XA 2G40A 2ERYA 5BQ5A 3TIXB 4ICIA 1J24A 1GU0A 1XC7A 4LJLA 3I53A 2EHJA 3VX3A 1NC1A 1JLKA 5B7NA 1FZQA 1J8FA 5B6IA 5FWNA 3MWJA 2EIXA 3E9EA 4AECA 5HIKA 3WKBA 3DMYA 3NIGB 4RCZA 1EP9A 2ECQA 3BXEA 3FZNA 5J9FA 3TW6A 2J32A 3ZZUA 2L69A 1Z8NA 1LS1A 4LSMA 5KVVA 5IX8A 2NYVA 4FFBB 4EL0A 1UEJA 2ZIXB 2AVDA 2QYOA 1BFKA 3CHYA 3DG9A 4LMPA 1NNEA 2Z83A 5K0BA 4QUEA 1A77A 1V5WA 2Q8PA 3IR7A 1V1RA 4D4MA 5BPHA 4RPIA 4L74A 3CGWA 5KREA 3GJTA 4RYLA 2YMQA 2O6LA 3KEMA 3EJWA 1GM5A 4LCBA 4L72A 1RMTA 3QVWA 4IDCA 3KZMA 4CLEA 1Y4DE 3KOOA 4A8JB 2A84A 4EF4A 3FLBA 4EBFA 2HMWA 1ANKA 1RPAA 1YS1X 3OT1A 3IAS1 2R6AA 5IKOA 3E3LA 1DUVG 3D43A 5U4QA 4ZYTA 3NORA 5DHQA 2VT2A 9GPBA 3SC2A 2WKRA 3DMGA 2HLNA 4FFVA 4IAOA 3OE1A 2DHDA 1WW8A 3IBSA 1PNQA 3O84A 2CZQA 2WVJA 3IPLA 3KWMA 3PI7A 4Y6OA 4C03A 3BIFA 3ONNA 1ZD4A 2VCHA 4XA8A 1ONOA 1ICIA 4MUYA 1CQPA 4CKZA 5IRCD 2VEDA 2BFWA 4I5DA 4Y2SA 5E7JA 1YQXA 4RXMA 4EMSA 1AGXA 3EOZA 1G6KA 2NXNA 4DLBA 2WIKA 4LF7B 2C3OA 3KDAA 3WDLA 1LPAB 3N7AA 4EPXA 721PA 4EM6A 3KSZO 3ANYB 5I3CA 4XVRA 5LZ2A 2P3SA 3OIGA 1BJTA 4FKZA 5DHPA 5LKRA 2XV1A 4IH1A 4JI5B 2QVXX 1W8IA 1KK0A 3LDGA 3N0TA 1Z8DA 4D9MA 1E8MA 3CXRA 4ND5A 4YVFA 1VJDA 5E1MA 4MQBA 4R98A 1I3OA 3FFBA 3JPYA 3FCAA 3OECA 1SFRA 5G1OA 1SKBA 3RGGA 4GRAA 2E55A 4BAZA 5K05A 2MHCA 1NN5A 1CNEA 4YPOA 5JNVA 4I36A 1XF9A 3QKRA 4XXHA 2GLTA 1JYFA 2W7TA 2E82A 3G2KA 4PNHA 4EUFA 1KI7A 3F67A 3SZMA 1FLVA 3OJOA 1HY3A 1IHYA 2PYDA 2Z2KA 3WKCA 1OGJA 1ZGGA 2C96A 2YV2A 3FJ1A 3LBIA 1I30A 3KQKA 2PVPA 3DKRA 4UNIA 1L7PA 4QOGA 4Q4AA 3VH3A 2RHCA 2ANBA 1OE0A 1Z7GA 1IB0A 1I94B 4WBXC 3DF7A 4HXGA 4Z3KA 3J81k 3PJGA 2QQGA 2V8BA 3GLVA 1PUJA 5LOVA 1VC2A 2UVPA 4OUKX 1HEYA 5TQ0A 2OB1A 3R3ZA 1N2GA 3C3JA 3RYHB 3L7JA 1NBMA 3MVEA 5HFJA 1ULUA 3JYNA 1J9EA 4M89A 3FDZA 3BB4A 1SQFA 5AHWA 1AOXA 4N8DA 4AMYA 1US8B 2H11A 2OWDA 3LSTA 3OCVA 3IT0A 4XW2A 2ODBA 4MEJA 2OC9A 2NUBA 1DJPA 2JAPA 2HJVA 2BFEA 2PGNA 2H0AA 3B5EA 4N82A 4EY6A 1B00A 2WQ6A 1QIIA 3LHIA 1ORRA 3I09A 3KZKA 2CLSA 4U6SA 1ZHOA 1GNTA 1USGA 1ISIA 1EMDA 3FETA 1LPMA 1ZI8A 2X76A 4MCJA 4X45A 4XQEA 1UJ2A 2ZYTX 4LOJA 5CCBA 9MHTA 1J8YF 6AT1A 3ZYZA 5D3MA 2ZG6A 2LVBA 1CQZA 2XTMA 4X71A 4C4OA 1XVAA 4CF7A 1MJNA 3ETGA 3NTRA 4REOA 1A4XA 3ICQB 1PJ2A 1NBEA 3DZHA 1M8GA 3PXCX 3VGJA 4NG4A 2F1OA 1KWKA 1WHTA 2P9QA 4AJ4A 3WK6A 2DBQA 2JAHA 4QBIA 1QFJA 1QO7A 1P9LA 2BGTA 7MDHA 5K4GA 1KK1A 4FWTA 1CJMA 3MCZA 4HLUA 2VHVA 3KAPA 4PBRA 3G5LA 3HCOA 4D0LB 1PGNA 1WUJS 5FUXA 2XCRB 1N2EA 2G1PA 1MO3A 3QY0A 1R1DA 4O4HB 4YJ3B 4JYAB 2ZIZA 2JGDA 4ZREA 2YL2A 5T8KA 1UBCA 2BEWA 1ZZGA 3UPTA 4NCBA 2XCLA 3B85A 3N87A 3HCPA 1QGUA 3JWIA 3VZSA 1JIVA 1XTBA 2HMUA 2V1XA 3QKWA 4MHTA 1LWOA 3HYNA 4G23A 4LBVA 1IBMB 5B1IA 4UVIA 4PZCA 1ZAYA 3W7AA 5JHHB 2RMKA 1G1MA 2Q1YA 10MHA 3ENKA 1JDNA 3EXEB 2FY8A 4KWIA 4MO9A 5ALJA 4LECA 3WVNA 3K0SA 3LFHA 2GDZA 1MABB 1QG0A 2B9VA 3CF4G 2MMCA 3PCTA 1UM9A 1NE2A 3AVQA 3CLHA 4GZ3A 3M3DA 2IX3A 4Z7NB 2P7IA 2FPPA 1QCDA 2ZYGA 4IO1A 3KQMA 4LE1A 4GXQA 4M8IA 3U44B 1LK7A 1Z2CA 2Y1KA 4LYAA 3L05A 5KQPA 4RTPA 1U2DA 4UQOA 3ZDZB 1YSCA 5J47A 5FJIA 2FW8A 3RWBA 4D79A 4Q00A 2ZB2A 5M2QA 1UWKA 5BPFA 2XCUA 3EA0A 5JMWA 1E1RA 3PEVA 4PO9A 5F1PA 2AD5A 1IFXA 2DLNA 2HJSA 3FBWA 1EGAA 4H15A 1EK2A 4PC3A 3O74A 4DVJA 1Z4JA 1PUIA 3F5QA 3GFBA 3A05A 1MHPA 4AMGA 3PG5A 4I4LA 4ZAGA 1ECPA 4RQTA 1UAGA 2J7PD 3V7WA 1D0VA 1YDHA 1E8DA 2XTZA 3TUIC 1NOKA 2WU4A 2NNLD 4F5EA 2JGJA 3LPAA 1N5RA 4MVJI 3WS7A 1RAIA 4E4RA 3QTBA 1VQ1A 4FSDA 1PZEA 2ZZMA 5B2EA 1PK7A 2PGDA 1ZUD1 2VVTA 4B74A 3VPGA 4FCVA 5EWJA 1WCYA 3PGMA 1Z2AA 3UJAA 1PJ3A 4GLOA 1TIPA 1K8YB 4GBED 5EERA 3MCUA 2JBHA 1VL5A 4WADA 1Y34E 3DOEA 2VNHA 3F7TA 4OHVA 4TKUA 1TFUA 4YCLA 1WB6A 1YK1A 2OOSA 9LDBA 1Y8CA 3E3OA 4M55A 1LLCA 3VZCA 2IGTA 2GT1A 1GAEO 3CUKA 3FNEA 1NU6A 1R12A 3C4VA 4B80A 1JSLA 2FFQA 5A1TA 4DV4B 5K09A 4P0QB 4L16A 2HT1A 1IB6A 3JQFA 3T1HB 1ZOOA 5DTJA 1OTYA 3LY9A 1RNLA 1TE2A 2D1QA 2ZI4A 2C5SA 1AKMA 3AUJB 1YQEA 3NRJA 4MGYR 4OQLA 1E77A 5BMOA 2OM6A 3O2NA 3BT7A 4JGIA 4HH0A 3NC1C 1MC5A 2VRCA 1TGYA 2OZPA 4IINA 4YONB 5K20A 4LSZA 3DBHA 1IATA 2B9EA 3EC1A 4MWEA 2C4HA 1YCDA 4DLTA 1N77A 1L5KA 3RARA 3STYA 3GUVA 3OFNA 3TNJA 1QYIA 2A1UB 3LQ1A 4PRZA 2P3QA 5ITVA 1JT2A 1UK9A 2FPGA 2R8OA 3OCYA 4FGLA 3ILVA 2KM1A 3IV9A 1G3UA 2AFVA 4Y2PA 4XDHA 2QNRA 1N2HA 1NAHA 3TKYA 3T3NA 1NIJA 2H4FA 1WPQA 5EKXA 4A23A 1T36B 3QI7A 4DZZA 3IAFA 4G37A 3C45A 1ZGAA 5MN4A 2P1DA 1DBVO 4RV9A 2C9CA 3RFUA 4KXYA 3F47A 3KSRA 4WZ6A 1TJ4A 3HL0A 3S1AA 3PXGA 1P9NA 3SYLA 3VPBA 4BWYA 2P5TB 4XSHA 5KQGA 1YCFA 4HRXA 2ABWA 3L7LA 2P0YA 3ZDEA 2W22A 1SCUA 1DQNA 4D9GA 3NG1A 2DHRA 3IUYA 5ITZA 3UKOA 3TLCA 2XX3A 1WKVA 3LO8A 5BP7A 6Q21A 1W2HA 3OIFA 3QITA 3WLNA 1DGQA 4NR0A 2OV4A 4LWZA 1U7UA 5GMOA 1E1RD 3EEOA 2Z2IA 4Q3EA 2X8JA 1O96A 4LWQA 2H8GA 4DJ5X 1TNDA 2G5GX 2R5WA 4MVJD 3HBFA 2P78A 4RDCA 3RS4A 2Z2XA 2PT6A 4MVJE 2HN9A 3K9QO 5CVUA 3U40A 1Q0ZA 1WB9A 2PZGA 3WK9A 2FN8A 3EISA 1J6UA 1L4MA 2BV3A 1WDMA 1EX6A 2FQ1A 2NVUA 3H2GA 3PF8A 3UXMA 3W5SA 3WRVA 4AIIA 1JAXA 1DI0A 3VPSA 1U0LA 2WJHA 3TX2A 2PSHA 3EY4A 1KY3A 1GP2A 1SUAA 3HPQA 2NZXA 3EC2A 1C14A 2O8CB 3GFOA 1T5DX 2ZUWA 1TKAA 1JJBA 1HSZA 3PPVA 4WY5A 3T4EA 3ZI0A 1ZRSA 5K01A 2PH1A 2R4TA 1U9IC 1BDBA 4TMTA 1PJCA 3RTDA 3BOSA 4GWGA 2P0AA 2QJWA 4CT4B 1QNLA 1SPXA 1SU4A 4IDBA 3DVLA 4B4WA 3L8HA 4P7FA 1KAHA 4PGHA 4DIOA 3MTDA 5K45A 4N3GA 1M34B 4MEBA 1LC3A 3CB4A 1JWBB 1N7HA 4QPPA 1U28C 4HUJA 3LPNA 4LHWA 2DUJA 2EKLA 2BGJA 3I2KA 5CT8A 3CLSD 2VJMA 1NIPA 4M9RA 1CUFA 3H0EA 1AURA 2VP2A 4KREA 1O6ZA 1GFIA 2XYQA 4NENA 1E3SA 1A9XA 2ZBVA 1VRVA 1PQWA 1RM0A 1UXKA 1KZ4A 1ZBDA 2AL7A 4P82A 5TEVA 4ZICA 5L3VA 1KQGA 1RRCA 1D2HA 1NF9A 1NY6A 1VCHA 3ZY2A 1KYZA 4EKNB 1BU8A 3IMCA 1VPWA 1S0UA 2R7NA 1TZBA 3TTWA 5H8WA 1GPAA 3ANMA 3HY3A 2WPDA 2BEJA 3OQJA 5BXQC 1VMEA 1A7JA 2BFDB 5FLYA 1P4GA 1N8KA 1X7HA 4IIGA 5MDHA 2H2DA 3ND6A 3VZRA 1BTOA 3PEYA 2JI4A 4DWVA 3NAMA 1TUIA 1ILEA 4JI7B 4MR8A 2HBRA 2PXHA 1O1YA 2X22A 4EVRA 4WOBA 5HF8A 3R7AA 5TPZA 4DKXA 1GTL1 4BWVA 1P62B 3QFFA 1JALA 1M6VB 1UODA 3RVBA 1MAVA 2VHTA 3WIVA 4WUVA 4L78A 1FBTA 1II0A 5GONB 3AF3A 1P75A 3M2PA 2G0AA 3MZ0A 1XA4A 3L6EA 4G0PA 4M9SA 2BEWB 4JUCA 2Q49A 5TPZD 5AVUA 4BNWA 4J29A 3THWB 4M6WB 2GFIA 1R4ZA 3QWBA 2Q3HA 1YQDA 3DCIA 1VSVA 1VLMA 1N2ZA 2XWJI 4DVGA 3ZE6A 1K6IA 4Y67A 1XEFA 3RF6A 5DIZA 2BM1A 4KQHA 4O08A 2R6HA 1FBNA 1GZDA 3WSWA 1I9GA 2I0FA 4QQ8A 1K0FA 4JKOA 4DUZB 4EENA 2HEIA 3V8QA 1YJXA 2JBAB 1KZ7B 5G0SA 4R69A 1OA0A 3H1AA 1G2OA 2RONA 1VE3A 3O38A 3QVGA 5AKXA 4BOYA 3CA8A 4EO4A 4DRXA 4HL6A 4CHGA 4BNDB 1S6YA 4JGBA 1NQUA 5EPEA 4QUAA 4I81A 3LW8A 2QM8A 4K87A 4KK4A 3S68A 4M1WA 2UZIR 4NFLA 2J0EA 5J5VA 1LK5A 4E08A 2XB4A 3QK7A 4WNIA 3NVDA 3RU2A 4II3A 3THSA 3AC0A 3ZWNA 4MV0A 4QBKA 4TS1A 3TB6A 2F8SA 5GQSA 3HO8A 3CRNA 4YMSA 2IOFA 2EV9A 3VKGA 3N0RA 4M7OA 3LO5A 3I28A 4UNQA 1QHHB 4GFDA 1LBQA 2HK7A 4KCGA 4EPYA 3K05A 3ZJUA 5K0JA 4DYHA 2CK3D 4L22A 3U6BA 2X9NA 3KQNA 3ECSA 5E6SA 4ZALA 1YDFA 3Q0IA 4AXXA 1YR1A 1PFKA 4RVUA 3C4QA 1TVKA 3FHLA 4WLVA 5I4KA 1C9DB 4LXUA 2PPLA 2AOWA 3GPIA 3HSYA 1MA0A 2VP9A 4M76B 1PQUA 1W6UA 3B78A 3I04M 3Q5GA 4KIFA 4O29A 3B1JA 4AP6A 2NZ2A 3EGXB 3U6KA 3QWAA 2B0JA 1Z4PX 1E98A 1T4DA 3O1IC 1TPZA 2ATEA 4QWWA 3IERA 3NHWA 2NWQA 4M9ZA 5CM9C 4B6RA 2V55B 5HCIA 1E1CA 3HCNA 3S40A 2ZUVA 2D5IA 2C98A 2ZB3A </