3AFMA

Crystal structure of aldose reductase a1-r responsible for alginate metabolism
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase
publication title Molecular identification of unsaturated uronate reductase prerequisite for alginate metabolism in Sphingomonas sp. A1
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Oxidoreductase
total genus 97
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.1.1.126: 2-dehydro-3-deoxy-D-gluconate 6-dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3afmA00
4LVCA 3WLEA 2UVDA 1UJMA 3NEPX 4CPDA 9LDTA 4AG3A 4R68A 3RUHA 1T1RA 4GKBA 4WLNA 5GZ6A 3NJ4A 4ZVVA 3D5QA 2IODA 4I9HA 4R41A 5G0UA 3DBHB 5DP2A 2V65A 3I9JA 4MIEA 3K6JA 2EF1A 4Q39A 1HYHA 1ISMA 4BNFA 4IMPA 2Z1NA 1BXGA 3GLQA 4RLSA 1KC3A 3WWYA 4YJGB 1HSOA 1DAPA 1QKIA 4J4HA 5GMOA 4KTTE 2DM6A 3DBVO 1IHYA 1UP4A 3EY4A 1HXHA 4BL5A 4BNYA 1EFKA 1IULA 2WTBA 2D2IA 4NZ9A 4DGSA 1GUZA 1MFZA 1ORRA 4TSKA 4X54A 1PJ2A 4Y67A 5LDGA 2YHIB 1R4MB 4R5MA 4Y6SA 3GVHA 3I9MA 3WNQA 1ISFA 2P5UA 3FNGA 3E6AA 2Y1GA 1M2WA 1TT7A 4PG5A 4RPJA 5KVQA 4QXMA 4YAJA 1Y8QB 1SZJG 5CEEA 5G4KA 4JROA 4BGVA 2DC1A 1Q2XA 5B37A 5DCYA 3JQDA 3ZHBA 5DDIP 4DA9A 3LC2O 1U5CA 5JE8A 3G3EA 3DFUA 5LC1A 1E3IA 3UXYA 1KERA 2A92A 3GN2A 4FIZA 3LT0A 4FB5A 4YJFB 3LLSA 2EJWA 2DVMA 3DOCA 3CXRA 1A4UA 1M75A 3E5RA 4PG6A 2CZCA 4R51A 2YJZA 3OICA 1PWZA 4LW8A 5C3MA 3ON5A 1B3RA 4RVDA 4FJ1A 5DCWA 3EZLA 4OXYA 1DPGA 3FRJA 4WEOA 3ZWBA 4E3ZA 1I10A 3H65A 3X2FA 4Y98A 5I9MA 3RUIA 2GO1A 3IL2A 5CG2A 2O2SA 1ZMTA 1I33A 3KSZO 1A7KA 1LSUA 3S2IA 2QG4A 4I9UA 4Q3AA 4U7WA 3GRPA 2Y66A 3E8XA 1D7OA 1C0KA 4D3SA 3D1LA 1HE3A 4C4OA 3QWBA 3WFJA 4EUFA 3KYCA 2TMDA 4IGEA 3TOXA 1UP7A 2BHLA 3QA9A 4GGOA 3GHHA 1DB3A 3L4BA 3RCBA 1PGOA 3RSHA 4XQGA 2O7QA 1VRWA 5BT9A 1WLYA 2Q1SA 2WEKA 5EPOA 5TRTA 2HRZA 5KKCA 3WYEA 3CSDA 4ROSA 4BO5A 5AXDA 1GD1O 2OMEA 3L07A 4L75A 4IBOA 5EQFA 1E6EA 4CLRA 1JAXA 4DC0A 2BI8A 4K6FA 3TZ6A 2ZB8A 5B4VA 1MGOA 5A4DA 1IY8A 1J6UA 2ZTLA 2HAEA 4CM5A 1DIRA 4TRNA 5IDYA 1NBOA 3NRCA 4OOEA 3JQAB 1K6XA 4FSHA 3MJTA 2O3SA 4Y6PA 1Z75A 3HDQA 1L7DA 3BHMA 4B79A 2X7HA 3CUKA 1GYRA 4II3A 5A5EA 2JFGA 1U2DA 2NWQA 1WP4A 2ZB4A 1DEHA 3FF4A 3LT2A 4J7CA 2WD7B 1XU7A 1JKIA 3G17A 1YQGA 1JWAB 1V0JA 4N7RA 2GN8A 1O0SA 1BW9B 1RYDA 1U5AA 2X9GA 2NVWA 2A35A 1JU9A 3CINA 4GMGA 3C7DB 5JSFA 4RVHA 3AI1A 1NVTA 2D0IA 2D5AA 3DQPA 3E03A 3DBLA 5JO0A 1H6BA 4JP3A 2YFQA 2Y93A 3C1AA 2D59A 2Y05A 1PSDA 4IXTA 2W4QA 4BNIA 4CLHA 1U2GA 1H5QA 3E9QA 4BKQA 2UUPA 4NFSA 4RQTA 1Y1PA 4XRGA 5HM8A 4JBIA 4UEJA 2C07A 3TWOA 2AE2A 3HADA 3ZU4A 5HWSA 3LT4A 1BXZA 3WGGA 4E2WA 2ZYAA 1GUYA 4J4TA 4LCJA 3EHEA 4HV4A 3W8FA 1ZBQA 3SLKA 1EK5A 4BNXA 3QVWA 2QZ9A 1R37A 3BHJA 4E2XA 1FDVA 2PLAA 2QZZA 4PLHA 4E5KA 3HHPA 5JCJD 1W73A 3ZWOA 1IPFA 3WJ7A 1JKFA 5THKA 1X7HA 1JLLA 2G5CA 8LDHA 2Y0DA 2CDAA 2OBNA 3GMDA 4BGEA 1CRWG 3O8QA 1BDMA 1VJ0A 5IN4A 2HJSA 5COAA 3H5NA 5KCZA 2O48X 3ITDA 3ZU2A 4EEZA 3TF5A 2P5YA 3I4FA 5JY1A 2JCYA 2Q49A 1CJCA 4A26A 1ZEMA 1XR3A 4IDAA 1BSVA 1V35A 1YQXA 4BNZA 1E1LA 5L4SA 1PGJA 3WBBA 3TDKA 3SLGA 3RI3A 2HCTA 1O95A 3V1UA 5DT9A 3DZFA 1EZ4A 4XX0A 2D1YA 3GMSA 2BFPA 3GNQA 3GEDA 4G65A 1F8GA 4DMMA 1YL7A 1Z74A 1KEPA 3KUXA 2GZ1A 4XDYA 4LVUA 4KWHA 1UZMA 2I67A 2NVBA 1UAGA 3W6UA 2E37A 3NT5A 3M2TA 3QWHA 4AJ4A 2Q46A 3MTJA 3ST7A 4NU5A 3UN1A 3NGLA 2NUAA 4XA8A 1ZSYA 1V3TA 2BLLA 2D5CA 1PS9A 3WTBA 4CV2A 4NQZA 4BV9A 3JD2A 5FYDA 2PKQP 1IYZA 1E7MA 1G6KA 4MP8A 1IHXA 4Q3CA 4L4XA 3FNEA 3P7MA 1YL5A 1C1DA 4NR0A 4BS9A 3U09A 1M6HA 2GYYA 4MP6A 4Z9FA 3KBOA 4BKRA 1NYTA 3DR3A 2AG5A 3UCFA 4IMRA 4EJ0A 3PHHA 1MC5A 5JW6A 1NPDA 2Z5LA 1RM0A 1PQPA 3RAJA 5JS6A 2FZWA 1YL6A 1B0AA 4PLCA 5F5NA 4CQMB 4JJFA 3KLMX 4DIBA 3OA2A 2VHXA 3IS3A 4UUMA 3GZ4A 1A4IA 4B4OA 3I9NA 4R9RA 1LRKA 2NTNA 3Q11A 1XQ6A 2NU7A 3OECA 3RC2A 1B8VA 4CM4A 2G76A 4ND4A 3L6EA 2J3IA 4MVJD 1GV1A 4G81A 4MVJA 4B8WA 3WIDA 2RH4A 2NLOA 4WE3A 1V9LA 4PN3A 4BQPA 2EWMA 2YUTA 1HKUA 1CYDA 1B3BA 4I5DA 1GL3A 1PGPA 3G1TA 2IYPA 1L7EA 2FPPA 1N8KA 5BNTA 1K89A 4J9VA 1QP8A 3PJGA 3JD1A 5L9AA 4WKGA 1ZK4A 3WTCA 5F3RA 4WLVA 5K6AA 1X14A 2VNAA 5JFOA 4YJHB 3D0OA 3K96A 2VRCA 3OJEA 4OXKA 1EEHA 3DZKA 3CTMA 1LRJA 3PJEA 4M87A 4RGBA 4D3DA 2FSVA 3KB6A 1HSZA 3HNPA 3DWFA 4KUHA 3ANNA 1KETA 3V1TC 2LDXA 4JN6B 3ZWNA 2OGUA 2VT3A 2C7VA 3JD3A 1XCBA 3NX4A 2A9FA 2PK3A 1HF3A 5L4NA 4PLFA 1GZ6A 5JMPA 3TSCA 1ZK2A 1UXHA 2XXBA 3QIVA 3WB9A 2E4AA 2EKQA 1DIBA 3OMLA 4YT5A 4E5MA 1SPXA 3GDOA 3RWBA 3ZNOA 4YBZA 4GX2A 1PWXA 3BTVA 2X0RA 3VPXA 3WQRA 1T25A 1I5RA 4RJTA 1PTJA 1SOVA 2AXQA 1ZK0A 3GVIA 3H7AA 4NFHA 4MVJF 3DL2A 2WWRA 2NU6A 3AI2A 1F14A 4XJTA 1JVSA 5IAAA 3FNHA 4GMFA 3WGTA 4AJNA 2B69A 2EV9A 5FF9A 4WCFB 3NTRA 4OAQA 5KJ1A 4KQXA 4YEDA 3D4NA 3U4DA 2O4UX 3GOHA 3HDHA 2ZYDA 1EUZA 4J6FA 3JQBA 1SEPA 3BMNA 4BKOA 2V6MA 2NTVA 6ADHA 1S7CA 3E1KA 1HYGA 1M6WA 4XR9A 1HE4A 3E18A 1FDSA 4HFMA 1EVIA 3M1LA 3LK7A 4WUVA 4MOWA 3TNLA 4OYRA 3JQGA 4J0FA 2QIOA 1WDMA 1XYGA 4CM1A 2B83A 5JMWA 3SC4A 3FCOA 3IKTA 1O8CA 2VOEA 3DHNA 3IJRA 4BIIA 5G0WA 2NQ8A 2RHCA 4BO3A 3DZJA 4KWIA 4BNWA 3GFBA 4PG7A 3V1YA 5JC8A 4J1QA 4U8GA 4KP7A 4ZQFA 3RFVA 1X7DA 4FFPA 2VT2A 3LC7O 1E1MA 1SO8A 3GK3A 3JCZA 4D0RA 1Q0HA 1J5PA 3AUTA 3KEQA 1RKXA 4TROA 3H6KA 1G0OA 4W82A 4Q3EA 3F6YA 3JTMA 5JDCC 3OQBA 4CV0A 1MXHA 3LVFO 1DIHA 4O63O 2ET6A 2JHGA 2ZQZA 3ABIA 1VL0A 1RYEA 4RVFA 4N54A 4PLTA 4PZDA 2GERA 3UCEA 1NR7A 1YE3A 1PJCA 4PVCA 1HZZA 5JAQA 2LDBA 1GAEO 5T8KA 2VTEA 4NBVA 3V8BA 1Y5RA 5HS4A 3I1JA 3S8MA 4NPCA 1MG5A 3U62A 2AA3A 2FR1A 5EMHA 1CWUA 3E82A 1I2CA 3AOEC 4TRJA 1PJLA 5DBIA 4UVIA 1H6DA 2Y1EA 1ADBA 3A1NA 1MG0A 1N7HA 4Q9NA 1QORA 5BSGA 4PFJA 5L45A 4PZCA 3Q2IA 3BMOA 2ZKLA 1PIWA 4FD3A 1LI4A 3AU8A 3ZHYA 3H8VA 3PQFA 2OOSA 1LDBA 3I9LA 4KZPA 2RBEA 2X6TA 2CUKA 4BUCA 3JQ8A 3P5SA 5A05A 3I5MA 4QFDA 4ALKA 5A9SA 5KIAA 4XZ3A 4BMNA 3I23A 2BGLA 1ADFA 4OM8A 1ADGA 1N5DA 2PZJA 4ID9A 3CZMA 4FBGA 1PS8A 1IOLA 4CLOB 2W2KA 4CQLB 4Y9DA 1LNQA 1NR1A 3N74A 1HDRA 2PZKA 4GSKA 1BMDA 4L76A 3OSUA 4N5MA 4E4YA 1D8AA 1YDEA 3GDGA 1GQYA 2PZMA 3IQDB 1LJ8A 1UAYA 3GT0A 3QHAA 2FR8A 4UAGA 5DBFA 3KRTA 1BRMA 5BQFA 3UHAA 4AJ1A 4R5HA 3ICPA 4M55A 2O3TA 2V7PA 4BO6A 4N5NA 3DMYA 4HY3A 2P9EA 2BGKA 4WJZA 2ZB7A 3DB2A 1BG6A 2VNSA 5BSFA 3UGKA 3RFXA 3B6ZA 3QV1A 4EYEA 4YT4A 1YBMA 5JCXA 3EGOA 4CMGA 2VRBA 4L74A 5CEFA 1P77A 1NQ5A 4MKZA 2Z1MA 2DKNA 1YDWA 4LRTB 5TGDA 3FHLA 1K3TA 2DBQA 2AEFA 1KS9A 1E7RA 4UULA 4R4JA 3NAQA 4CM9A 1C0PA 1F17A 4EGFA 3DOOA 4EDFA 4FQ8A 5T67A 4B3JA 1MFPA 4INAA 3Q1LA 2B36A 3EUWA 1LDGA 1U8XX 4AJLA 1SBYA 1DJNA 2I6TA 2DFVA 3TZHA 4G5HA 3GGGA 2V6GA 5JBIA 3UVEA 5H81A 2J3JA 4IXWA 5CP8A 1NAHA 1YOVB 1NX6A 4IDFA 3QVXA 5CPFA 3W6ZA 4KTVE 1ENPA 3IAHA 2F00A 3IDSA 1OC2A 1YB5A 5DZSA 1ULSA 1S6YA 5EJ2A 5F1KA 3R3JA 4HX5A 4EBFA 1JKJA 4BO9A 3DOJA 4JGBA 1ULUA 4DQUA 2IXAA 3MJCA 1B26A 4LGVA 4CR6A 3H3JA 3OEYA 3L4BC 3AUSA 3AFMA 1EFLA 3DAFA 3VHRA 1A71A 1XLTA 4NBTA 4J0EA 4ZGWA 1Y6JA 2HK9A 2ZIZA 3GG9A 3IIEA 4A7PA 5JY6A 1J49A 2JCVA 1EQ2A 3WGHA 3KYDA 1UXJA 3BYZA 1Z7BA 4IQGA 4YXFA 3FN4A 3BMQA 2JHFA 2ZJ0A 1YBVA 5BNFA 3C7CB 3W4JA 4MP3A 2OP1A 2O3QA 4IDCA 2Q1TA 4PLVA 4TRRA 5CDUA 3LQFA 4BGUA 1PJTA 5CDSA 1H2BA 5JAZA 2CDCA 2HRBA 3I9KA 4B3IA 4YB8A 5TT0A 3ZWPA 4QUKA 3RC1A 2HMSA 3S2EA 3DFZA 1VM6A 4QO7A 4WNIA 1E3WA 5IXSA 2Y67A 1YJQA 1ZCJA 1Q7BA 4UEOA 3IP3A 1MC4A 3KTDA 1I36A 3HB5X 1P0FA 3JQ6A 1AE1A 4DPKA 2PD4A 3L9WA 4GBJA 5F1PA 1ZKMA 2YZ7A 4NJOA 4NJMB 3ETEA 2TMGA 2OP0A 3C3XA 1C1XA 2C59A 1ENOA 4JP2A 4OJNA 3AOGA 2WYVA 4DL9A 5IDXA 4J1SA 5DF1A 4RPGA 4RPKA 4CMAA 4MVJE 1B2LA 4KMSA 2IZZA 2CDBA 1DLJA 1NXQA 2FHSA 1VSUA 5ICSA 2DQ4A 2E6UX 2HJRA 2Y1CA 4GVLA 3KEOA 3TL3A 5T64A 4YAGA 4YT8A 4GLOA 3NYWA 4O1MA 2J8ZA 5G4KB 4MPDA 3KO8A 1NVMB 4W9NA 2X23A 3U4CA 2BFAA 1E5LA 2GN9A 2VWPA 5C7LO 4ZN6A 4TQGA 1ZJYA 1P1HA 3DHYA 4ND5A 4W4TA 2CSUA 4D3FA 1PJ3A 4AFNA 2VZ8A 3VC7A 4YRDA 1E6UA 3IMFA 3PVZA 4NH4A 1CEQA 3AUUA 1FDTA 3B1FA 5I9LA 2BKAA 2PV7A 4LSWA 4D43A 4FW8A 3UFXA 1PJQA 2R00A 4ALIA 4IDEA 4BNVA 2X58A 1MUUA 1BVUA 1E6WA 1T2AA 4AJIA 3BAZA 1BVRA 3GA0A 4FDAA 3RJ5A 3QRWA 3ROKA 2GPTA 3UAGA 4BMVA 1EVJA 1HETA 1PL7A 2FR0A 1E7YA 4NK5A 5BR7A 2J5QA 4UVGA 1LBEA 3PDUA 2X0JA 1BGVA 1HZJA 4AVYA 5DNAA 4FFOA 3DBHA 3FBGA 3QSGA 4GLLA 3RUDA 3TFOA 3KYCB 3JYPA 4IJUA 3R3SA 3PIIA 4Z3DA 1QG6A 2NTJA 3GPIA 2UAGA 3VH2A 3VTZA 1BTOA 4D0SA 3WYBA 4GL4A 3P19A 5GZ3A 4YJGA 4W7HA 3RD5A 1P31A 2NADA 1K0UA 4XQ9A 1T4BA 2J5RA 2NU8A 4F46A 3DZIA 2GR9A 4IM7A 3A4VA 3KVOA 3VPSA 2EG9A 1HDGO 2VCYA 1AN9A 4ZRMA 2PGJA 3RC9A 3WJAA 4CLRB 2W2LA 3WG9A 2EJVA 3P2OA 3C7AA 4DREA 5IZ4A 2R6JA 3QQPA 3WMWA 3A06A 4Z3KA 1ZO8A 2YHIA 1R4MA 4J4BA 3BXXA 1SC6A 4XGIA 4F45A 1U3TA 1Y8QA 2WDZA 4GAEA 4HFNA 3FWZA 2OUIA 5BSHA 1GEEA 2EHDA 1UXKA 3AY7A 4ESOA 3G0OA 4F3YA 1LLDA 4DLLA 1WZIA 3GF4A 3DO5A 3AY3A 4WCDA 5JAMA 4PLWA 4J7XA 4P4NA 5AXAA 3TZCA 2DFDA 4DQVA 3WLFA 2AQ8A 5JYDA 5L4LA 2EW2A 1T1SA 4OKNA 3GNTA 5FI3A 3ZHXA 4BV8A 1WXDA 3INGA 4GI2A 3PJDA 1ZK1A 4H7PA 2AEMA 3HN7A 5TSDA 4D41A 5FWNA 3SBOA 3ZU5A 1YQDA 1NPYA 3V5NA 3DBLB 5KKAA 4BO4A 1SB9A 3O26A 3U5TA 3ASVA 5ITWA 3OJOA 1OI7A 2BH9A 1UDCA 3CEAA 4GWKA 3OQ1A 4QEDA 1R12A 3FTNA 5L95A 4RVGA 3DXFA 3TN7A 2DT5A 4CMIA 4NBRA 1A5ZA 2YDXA 1NWCA 3ZH2A 1ZH8A 1BWSA 5AYVA 3HQ4O 3CKYA 2HMUA 4J1NA 1FDUA 1OMOA 1BDBA 4A03A 1K6IA 3OQ6A 1QSGA 4WLEA 1ZNQO 5KNLA 4J7UA 4ZA2A 3WWZA 3LU1A 5C7OO 4XYMA 3ONEA 3GH3A 3UH1A 3WFIA 1ZXLA 3HFGA 2JD2A 4OMUA 3DBRB 5K6AC 4OO3A 5BNIA 2QW8A 2ILTA 4YAKA 3K73O 3PLNA 4ZRNA 1QR6A 1I2ZA 2RCYA 3WX0A 3NTQA 5THQA 1CETA 2C5AA 4UVEA 2C0CA 3QWFA 4FGSA 2ZK7A 1U8FO 3JQAA 4XCVA 1H0KA 1U7HA 2OHXA 2D4AA 5DN9A 2DLDA 4LN1A 4IDDA 3PHIA 3F1KA 4P4GA 2CVQA 3OETA 3HE3A 1UXIA 2DPGA 3JD4A 2QRJA 3RUCA 1B8UA 3F4LA 4TKMA 3WNVA 4BNMA 3KXDA 3U4IA 4YDRA 1UZNA 3C1OA 1R0LA 3ADPA 3JQFA 2WD7A 2XF8A 1RM5A 4HFRA 1P74A 3W1VA 4GKVA 5F21A 1DRVA 1Z7EA 3PEFA 3EC7A 4ILKA 2OO5A 1KVTA 3F4BA 3BZUA 3PI7A 1BW9A 4KOAA 4OL9A 5KVVA 4J9UE 2AQKA 1HDCA 4FGWA 3RUAA 3T4XA 5TNXA 3VH3A 2VUSA 4BO2A 3UCXA 5L51A 3H2ZA 1KY4A 1WDKA 4GX1A 3FNFA 4IDBA 2NU9A 3NKLA 4I5GA 2C2YA 3PP8A 1KIFA 1E1NA 1E7WA 4XGKA 4BNJA 3JQBC 4RLHA 1YXMA 4IQ0A 3JQ7A 4ZQEA 1E7SA 3D64A 4NG5A 4CM7A 5AQ1A 4BO7A 4RORA 3AWDA 4RCVA 2BFMA 1XDWA 4HNHA 1K6JA 4P38A 1HDYA 2GF2A 4EZBA 4J16A 1WDLA 3NT4A 4R1TA 3PPIA 5CEJA 1XHLA 1M76A 2ZTMA 2PY6A 4RF4A 2VHVA 1IL0A 2FRDA 5A9RA 2G1UA 2VWGA 2WSBA 4PVDA 1ZXBA 4BB6A 3EAGA 2YV2A 4P4LA 1MLDA 1F8FA 3CPSA 3QP9A 3PYLA 1FK8A 4D45A 1VE9A 2H1SA 1HE2A 2QX7A 4WOJA 5COQA 2EP5A 2HK7A 3ADOA 2HMTA 1OZAA 4CM3A 1XG5A 5TF4A 1ID1A 4DBVO 1WVGA 1XWFA 1ISGA 1KEVA 5BSEA 3F46A 3VH4A 3FD8A 3FSRA 5EESA 4IPTA 4PLZA 1GCOA 3HG7A 1U4SA 3MJVA 4JNKA 1FJHA 2Y1OA 2UUOA 1EBFA 3CMMA 4NK4A 4RF2A 3BHIA 1ENYA 4HFJA 5G0SA 4FJ0A 1NQTA 2NM0A 3INRA 5KVSA 2C20A 1UUFA 1NFQA 3ZWCA 1VSVA 1M66A 4NHEA 2BFOA 4E5NA 2FMUA 2WD8A 4GPD1 3DAPA 3GPDG 4MVJH 4XYBA 2ZJ1A 3H9UA 3K5PA 4ND1A 3DAGA 5T8KC 2PH5A 3Q9UA 1TI7A 4PLGA 1U3VA 1ZVMA 4E0BA 2PFGA 3RKUA 3AY6A 1DC6A 4QO8A 4GVXA 5FFFA 4PGFA 4TKLA 1ENZA 2YYYA 4R1UA 2JCXA 3RU9A 4GSLA 1XEAA 2A4KA 1TB4A 1R4NB 1YO6A 4ALMA 1M67A 4LMRA 4DTIA 1R0SA 1B14A 1QRRA 4UREA 3OH8A 2PKQO 1O9BA 2XAAA 4CMBA 3LYLA 4E5YA 5L7YA 5KJCA 1MV8A 2DAPA 2Q1UA 4OOFA 2VRCD 4QT0A 3RROA 3NTOA 3A14A 2IRWA 1TT5A 1DIGA 5JO9A 2GASA 2PZLA 1DHRA 4CQMD 4CQMA 4A73A 2I3GA 2QRKA 4I1IA 1T2CA 1N2SA 2DUWA 2QYSA 2WYWA 1RWBA 1V6AA 4JBHA 2V6FA 2GN4A 4TZKA 5EQDA 1LC3A 1ZJZA 5A1TA 4IJWA 3U0BA 1R6DA 4PCVA 3FTPA 2JFHA 3BMNB 1DRUA 3PFFA 4AJOA 5HRUA 3D4OA 1H94A 4HBGA 2P68A 3G49A 6LDHA 3T7EA 3JYQA 1AXEA 3UOGA 5KJFA 4OXNA 4YCAA 2IDZA 2W8ZA 3KHUA 4R69A 4NMHA 1KOLA 5TLSA 4KUGA 1B15A 5A04A 4LRSB 1NWHA 2J3HA 4HUJA 4R01A 4BNNA 3KZVA 2GSDA 4MVJP 1HEUA 4K26A 3MJ4A 4YJHA 1ISJA 2EKLA 3E5MA 4GGPA 2HQ1A 4WLFA 2XXJA 4G2NA 3VH1A 2ZCVA 2O7SA 2QQ5A 3EZYA 5HBRA 5U4QA 1MX3A 3AI3A 1N9GB 4DMLA 5JNLA 4E12A 3PQDA 1D1TA 4WGGA 1QYXA 5C37A 2I66A 3H2SA 4MO2A 2P4HX 1W8DA 1HDZA 1N92A 2GRAA 3MOIA 5TS3A 4FC7A 4IDGA 3WXBA 4ALNA 5IZCA 3ZV4A 1PJSA 3LDHA 1Q0LA 2AQIA 3AK4A 4NI5A 3VPGA 1C3VA 4YVFA 4YQZA 3VTFA 1PQUA 3OM9A 2NNLD 1E3LA 3GGPA 4IS3A 1QYCA 4FFRA 4HKTA 4ZU3A 3K2BA 1VLLA 2GGSA 2PH3A 3PDJA 3WGYA 2GCGA 5G2OA 2Y0EA 1X13A 1P1RA 2WE7A 3S1LA 3FPCA 1X1EA 5ICMA 3C8MA 3NUGA 4PLPA 4W7IA 1CQJA 1XA0A 4BGIA 2RH8A 1GYPA 3E48A 1P9LA 2EERA 1QYVA 1PGNA 3B1JA 5JYEA 3D4PA 3IUPA 1YJ8A 3ONFA 3HDYA 3HN2A 4JJGA 1LEHA 1P45A 1U3WA 1Y8RB 4MVJM 4WCFA 3ZNNA 5AXCA 3WQQA 2V6BA 1YVEI 1NM5A 4EJMA 3EMKA 1PZGA 3HUDA 2NSDA 4M86A 4EEXA 4OHUA 4IJKA 5JXWA 4R1SA 3LSYA 2P91A 3A9WA 1AHHA 3I4CA 1YS4A 5TX7A 1NPTO 3PXXA 2P9CA 2BF7A 5ENDA 3JQ8B 4B7XA 1O89A 2J3KA 4FFMA 3GGOA 3I6QA 3B1KA 5A9SB 4OKIA 1KVSA 4AJEA 2Q4BA 1C14A 2EKPA 1VI2A 4IY1A 3L6DA 1SMKA 3TRIA 1ZMOA 4BQRA 1DO8A 1U1IA 1YKFA 1LUAA 4XR4A 1WNTA 4E2YA 1IZ9A 1LTHR 2O23A 1J0XO 3MWDB 2H9IA 1HLDA 2CMDA 4EUHA 2DBRA 3CIFA 3EVNA 1T4DA 1SOWA 5IZCC 1LDNA 4DC1A 3AW9A 3BMCB 2JJYA 4Z0HO 4N5LA 3RFTA 1A27A 4IQ8A 5TC4A 5IXYA 1TLTA 3UF0A 3KYBA 3GUYA 1EDZA 4YQYA 5MDHA 1E3SA 3QWIA 3RU7A 3OEWA 4L9RA 3VZPA 1DBVO 4CUKA 4R1NA 1Z45A 2PGDA 3H5AA 5J23A 4J90A 2Z95A 2NVUA 1DC4A 3ZI0A 3GUCA 3ZZNA 5HS6A 5H82A 1KBZA 1WAMA 3D3WB 1GFSA 4W9NC 4RF5A 3RJ9A 5KTKA 5C7IO 4CV1A 4EUEA 3RUEA 4UVDA 1L1FA 1CQIA 3NDRA 2X86A 3H9QA 1NFFA 2B37A 4KQWA 5I7VA 3PHLA 1ZW1A 3QVSA 2RAFA 1E92A 3OIFA 4M54A 3O9ZA 2HK8A 2G17A 2R00C 4ZQHA 3WYCA 4GX5A 5U9CA 4CMKA 1F06A 1PQWA 4IINA 5KWEA 5A5FA 3H9JA 4YA6A 4BKUA 4BNUA 1E1KA 3FR7A 4I08A 3EK2A 4CM9D 3NJ8A 4CLEA 2DU8A 5HTOA 2CF6A 2CNBA 2JD1A 4XB1A 2PTGA 2Q2QA 3U9LA 3LF2A 5DCUA 2PA3A 3WSWA 4CL3A 2H5LA 1QLHA 3DTTA 4CLOA 2X1HA 1WPQA 3WBFA 3EYWA 4CM8A 1LDYA 4J43A 3GG2A 2POQX 4WK6A 4RV9A 3VVBA 4YT2A 1LC0A 2O3JA 1GQ2A 2XOXA 1RM4A 2CF5A 3ETDA 5JDIA 3IC5A 2DBZA 4YACA 3FWNA 2G0TA 1OAAA 2VYVD 2VYVA 1B8PA 1DFHA 3PFWO 4II2A 5T57A 4WASA 7MDHA 1QXSA 1D4FA 3ORFA 3FI9A 2CY0A 5IG2A 1HTBA 3PJFA 1NHWA 2GUGA 4HADA 4IZHA 3F47A 1PS0A 1C0IA 3AM4A 2W90A 3UICA 1PZHA 3RKRA 5EL0A 3WICA 1PX0A 3WSVA 1GZ4A 1R15A 4DPMA 3DDNA 5CDYA 2NQTA 3Q2KA 5LCXA 4DRYA 4D46A 4UUOA 4FCCA 3DTYA 1EBUA 3ANMA 2FP4A 2Y99A 2VQ3A 2BD0A 5DOZA 2Y1FA 5I9NA 1P3DA 4XWYA 3BIOA 3AUAA 4TZTA 1DFGA 2EP7A 2B5WA 3H5RA 3D3EA 2I3AA 3K8ZA 4MIOA 1LDMA 3GZNA 4JIGA 2A94A 3QLJA 2JAPA 3QW2A 4NU6A 1WMAA 3RUFA 4MKRA 3VZSA 4CR8A 3S2GA 5ENVA 4RPHA 4XQCA 2Y0CA 3VVCA 4DYDA 1IE3A 5A03A 3W4IA 5A9TA 2CVZA 3ZCXA 1E0DA 1BXGB 4CMCA 4OGWA 4UUNA 2FPIA 4LSMA 4ONEA 3V2UA 1A72A 4NNJA 4PG4A 1BHSA 2YQ5A 2X0IA 1I01A 4BB5A 1GYQA 2B4TO 4FFLA 2BI7A 4YWJA 2PD6A 1ADCA 1EVZA 3CMCO 3W8EA 5CFZA 3ZV6A 2JD0A 2DBVO 3Q9NA 4ITUA 4RZHA 4Z0TA 3N58A 3HZZA 4R54A 2X5KO 3DC2A 3QWAA 5FI5A 1Z73A 1JDJA 1JQBA 3D7LA 3GEGA 4BNTA 3HB4X 4ZHSA 1MB4A 1ZZEA 4LK3A 4WNCA 4B4UA 4E33A 4IS2A 4C7KA 4CM6A 4AL4A 1JW9B 1P1KA 1DHTA 1PR3A 1TXGA 4IIUA 1U3UA 2VWHA 3UUWA 3VKVA 1EK6A 4RF3A 1EQUA 1WWKA 4R3WA 4UUPA 1DJQA 4HXYA 4YPOA 1LSJA 4OSOA 3AFNA 5IJZA 3PTZA 1LQTA 3JQFC 4QECA 4IJVA 1GDHA 1H9BA 1QMGA 4YJDA 4TVBA 1MXFA 3F5QA 1OBFO 3JQ9A 5TJ9A 5TT1A 1XSEA 3I6IA 3CH6A 4YAEA 1DDOA 2EEZA 2EGGA 4O59O 3SJUA 3MWEB 4XIJA 3VKUA 4NJMA 4AJKA 4L8VA 4JLWA 1HYEA 2ZB3A 1G1AA 2EGHA 1HDOA 2GZ2A 5ILGA 1LSSA 1O5IA 2O2YA 2FY8A 1R0KA 4B3HA 4BO0A 4BO1A 1ZEJA 3KM0A 1X0XA 2YDYA 4HP8A 2VTDA 4U0KA 4WECA 3OF2A 3TZKA 3H3FA 3GVCA 4I5FA 4B7CA 5IDQA 3ZWVA 4E5PA 2YW9A 3F9IA 5G0VA 4E13A 4XB2A 3VZQA 1KYQA 2OXIA 2B35A 2HMVA 2E48A 5I8ZA 5I7EA 3AJRA 1F12A 4CLXA 4Z9YA 1PGQA 3LLVA 2W2LD 3E9MA 1LX6A 3UW3A 5AVOA 4AJHA 1R16A 5DOVA 3DMTA 4JXKA 3OP4A 5ES3A 3RBVA 1YWGO 4MIYA 5TIIA 1LLQA 2QRLA 4CMEA 2YFHA 1DAOA 5COBA 3SX2A 3RASA 2UV8A 1QYDA 3WR5A 2VOJA 2D8AA 1DC3A 1A7AA 3PWKA 2D3TA 4K1LA 4XYGA 4QTZA 4MVJI 3JQEA 1XKQA 5MGBA 1DLIA 4J2HA 5EIOA 2Q4EA 1Q0QA 2DTEA 2HUNA 2YY7A 3PZRA 4YJFA 1YONA 5A3VA 3ICCA 5EN4A 2ZYGA 3N7UA 5A06A 3PRJA 3Q3CA 3IKVA 1U28A 2VWQA 3I9OA 2P2SA 3C85A 4CMIB 4L4RA 4NDNE 3B70A 4Z9XA 1SCUA 3SEFA 1NAIA 1ZFNA 2VZ9A 2UYYA 3G1UA 4DIOA 4ZJUA 3OHSX 1VPDA 2AHRA 1CERA 3DEYX 3VDQA 2WYUA 5ER6A 1UR5A 3ZHZA 3I83A 5JC1A 3NV9A 1O94A 1T2EA 3HJAA 2PGLA 3IP1A 4JK3A 4WOKA 4XRRA 2X5OA 2OL4A 8ADHA 2J5KA 1NASA 2IEBA 4GQAA 2WJPA 3Q0EA 5I7SA 2FOIA 4DIFA 1DSSG 4E21A 1QYWA 4DVJA 4M89A 3PHGA 3ZWXA 4EITA 3AM5A 5FEUA 4Z6KA 2CVOA 3ANLA 1Y81A 4MDHA 3BA1A 4RDHA 3GC6A 1PL6A 1VKNA 4Y6RA 2ZQYA 1IZ0A 3GAZA 3PQEA 1LSOA 1VL6A 1GZ3A 2I9PA 3OA0A 2EXXA 2O3RA 1OFGA 1D1SA 1VKOA 2EIHA 1NHGA 2VZ0A 1FF9A 4ND3A 1XQ1A 4TVOA 1H93A 2IYOA 3WDSA 2HLPA 1P1IA 3ZV5A 3RC7A 3JQAD 4D79A 1GPJA 4O5OA 4GWGA 1W0CA 3QVTA 1BXKA 3U49A 3O8QB 4BOYA 1HT0A 5F1OA 2BELA 2G82A 3KSUA 3TJRA 3RBZA 2PR2A 4U5QA 3EVTA 1I30A 4R3NA 1GR0A 1UH5A 1I3MA 2VHZA 3KETA 3NDIA 2AW5A 2JL1A 3WGOA 3OJFA 1HRDA 3ULKA 3JQ7B 3T7CA 3A28A 3H9EO 3KSDO 4K9DA 3P2YA 1ONOA 1GTMA 2J6IA 3OBBA 4N18A 5DBGA 5TQVA 4WLOA 5IN5A 2I99A 3PZBA 5JPIA 3GQVA 1JTVA 3TOZA 5ADHA 3GVXA 4DBZA 5AXBA 2Y1DA 5IFLA 5L40A 4NFYA 1HWYA 1YB4A 4AJ2A 3DBRA 3JYNA 4GX0A 5DULA 3ZW9A 1W4ZA 3H9GA 1P1JA 4PIVA 4J1TA 4QSMA 5JCJA 5H83A 1PR9A 4FN4A 2X4GA 1ONPA 2GN6A 3UKOA 1XU9A 1E7QA 3M1AA 4Z0PA 4FR5A 4B4WA 1FDWA 3ZWWA 4D7AA 1YH3A 2Y68A 1PU2A 4A27A 2HU2A 3NT2A 1NQOA 3IJPA 4XKJA 3ROQA 1F0YA 1HL3A 2B5VA 1C1DB 1I2BA 5U1PA 3K92A 4AJJA 4WPGA 4TWRA 2O3UA 4CLDA 4BNHA 1Y9EA 4HWKA 2AG8A 1KEWA 1N1EA 2C2XA 3BTOA 3PWZA 4A2CA 4S1VA 1LLUA 5DP1A 9LDBA 1U9JA 1ONNA 3PYMA 5B4TA 3GHYA 4OSPA 3EDMA 4I8XA 4S3MA 4BO8A 1GADO 4NBUA 5TJHA 5B4UA 4XJSA 3IUSA 5K0ZA 4CM4B 2NACA 4XYLA 4H16A 4XQEA 3L0DA 5I7FA 1W6UA 2ZCUA 4O6VA 4TRMA 4L4SA 4B8ZA 1KVUA 3RBXA 1ZIDA 3WGIA 4WCFC 1I8TA 4E30A 1VJ1A 4OQYA 1V8BA 4D44A 1HE5A 2BGMA 3HFSA 1PJ4A 5L7WA 1D3AA 1JA9A 4E2ZA 3TL2A 4AJPA 4UVHA 3R0IA 1HLPA 1U7TA 1QV6A 4ALJA 1NFRA 3L4SO 2AE1A 4XYEA 1X15A 5KJEA 1AUPA 4JBGA 3K31A 3VAZA 4RDIA 4DQXA 5IF3A 1X1TA 5ITVA 1EVYA 3RQSA 3PWSA 1DFIA 4BKPA 4JQCA 4KUEA 3S55A 4QQRA 1C0LA 1TT5B 1EE2A 4RVSA 4BMSA 4IGFA 1GCUA 2EW8A 3MEQA 2QYTA 2JAHA 3GEMA 5GY7A 3H4VA 1ZSNA 2PWZA 4Q3DA 4K6CA 4BNKA 4ZICA 4CUZA 3OFSA 4FFNA 4ND2A 4PZEA 1I3LA 3ROMA 3K30A 3NGXA 2B0JA 5G0TA 3KOUA 1ISHA 1FXSA 4E32A 2H63A 3TPCA 1N7GA 4FS3A 1LQUA 3L9XA 4DWVA 1PJBA 2VUUA 7ADHA 2YHUA 1EUDA 2AQHA 2C5EA 3PGJA 4WLUA 5KOIA 3HDJA 4NBWA 3WQSB 5C5IA 5IDWA 2IEDA 4RQUA 4YRBA 2AEJA 3AM3A 3W4KA 5A3JA 1ML3A 1JAYA 1CIVA 1UXGA 3TQHA 3VDRA 1ARZA 3KV3O 1H6AA 1H6CA 3EW7A 4P8RA 3MOGA 2E82A 2CD9A 5T5QA 1JVBA 3GFGA 3F1LA 4YAIA 1HDXA 5KJ6A 4P22A 1Y7TA 4U6SA 4DYVA 1E3JA 1MP0A 1EDOA 3ZWAA 2Q3EA 3OIDA 5CAEA 2OZPA 3QE3A 3S2FA 1R4NA 3ENNA 4MKXA 3JQGB 3B20A 3GRKA 5GZ1A 4KDFA 1DOHA 3U3XA 4A5OA 4CMHA 4PRKA 1PL8A 3C24A 2PNFA 2XPCA 3HWRA 4B7UA 5G4LA 3ONDA 2YQ4A 5A02A 1J4AA 1KVQA 1KVRA 5LDHA 3TZQA 1UDBA 4EW6A 3ZN2A 1KC1A 2IZ1A 1JN0A 2SCUA 1DC5A 4ZQBA 2WE8A 3SXPA 3QJ5A 3L77A 3WGZA 1AGNA 3CZRA 2FSSA 3JSAA 2HO5A 2UDPA 3PIDA 1T2FA 1B16A 3ENKA 3DZHA 3FBTA 2ZTVA 3I52A 3L6OO 2B4QA 3F3SA 5CHEA 2P9GA 1IPEA 1T24A 5EERA 1ZK3A 2WM3A 2IZ0A 4PRLA 2VUTA 1DIAA 3K2EA 3K9QO 2H6EA 2CFCA 5JDIC 2FWMX 3SVTA 4JX8A 4FJ2A 4RVUA 3M2PA 2C29D 1GU7A 4RZIA 3JQCA 3G79A 4RPLA 1YB1A 3ASUA 1Q7GA 2NV6A 2PKRA 2Q2VA 4OIMA 2BMAA 2I65A 1RM3A 4LCEA 5CPBA 4ZD6A 2OFPA 3JD0A 3R6DA 3MJSA 1A9YA 1NP3A 1P1FA 2O4CA 2X22A 2B4RO 1E3EA 5JAIA 1LRLA 3OJLA 4RL6A 2OBYA 3GY0A 1Q7CA 2Q45A 1N9GA 3SC6A 2Q1WA 3QY9A 1GPDG 4K28A 2HDHA 3ZWYA 1LA2A 4J49A 5CDGA 1I32A 3KLPX 4B4VA 2WMDA 3BMOB 4XGNA 4CMJA 4XDZA 4DXHA 2R2GA 3WMXA 2AMFA 5T6BA 3DHEA 3HSKA 2RHRA 1I24A 4W6ZA 5CDTA 1I3KA 2C54A 4MJLA 1VL8A 4R9SA 2JFFA 4FPXA 1ZSVA 5AOVA 1EUCA 3GVPA 3E9NA 3X2EA 1E5QA 1B7GO 1T2DA 3FPLA 5F5LA 4BHTA 5ER9A 2W2KB 1SEVA 4GH5A 3V2GA 2PD3A 3ZV3A 4RO0A 2X8LA 2IE0A 1K2WA 4F6LA 1KEUA 2NVUB 4URFA 4J2OA 1VC2A 3WOHA 1GUFA 3ZU3A 3COSA 1E77A 4H15A 4DLAA 3WGQA 2E49A 5HA5A 1NQAO 1Y8RA 3D5TA 4R16A 1TVEA 3JYLA 3GDFA 1N1GA 2X9NA 4PLYA 3O4RA 4DLBA 4D42A 4Q3NA 2JKVA 3NDJA 3ZGYA 2GZ3A 3W8DA 4YTEA 5B12A 1CF2O 2FN7A 2HKIA 2O50A 4LISA 2F1KA 3ZNPA 3ZWMA 2C82A 3SJ7A 3CE6A 4AICA 3ZNQA 2DTXA 3BTSA 5KVCA 4TMFA 5JLAA 1YBAA 1I0ZA 1JWBB 3VPHA 4J3FA 1XELA 1GY8A 3IOYA 3JYOA 4E31A 3PGXA 1A9ZA 1XGKA 1V3UA 3ITKA 2VHYA 4ZQGA 3VOSA 2HMWA 3QVOA 1H2HA 1QV7A 3ETGA 4QFCA 4CL8A 1U4OA 3FR8A 1TEHA 1SB8A 2GNAA 3I3OA 3LC1O 4CM8B 4Q3BA 3LZ6A 2YV1A 4U0JA 4DPLA 4M8SA 2VYND 3GAFA 4BNGA 3JQ9C 2VYNA 1LU9A 4MINA 3TFQA 1FMCA 3DZBA 4FOSA 3STHA 1P33A 5EINA 2HSDA 3T4EA 1Y5MA 3MCVA 3AU9A 1WW8A 3BMCA 4LMPA 4XD2A 2VHWA 5B1YA 4YRAA 1EE9A 3GN1A 4FC6A 4CR7A 4IUYA 3VZRA 4I9NA 3OJ0A 4Y8VA 4CV3A 4A0SA 1QLJA 4O0LA 1MA0A 1K5HA 1Q1NA 4CQLA 4CJXA 1T26A 4BNLA 2BRUA 3VPFA 1DRWA 1WMBA 1Y9AA 2W98A 4EJ6A 4IIVA 3MZ0A 1DXYA 1NVGA 3OIGA 2X9VA 1OOEA 2P4QA 2ZATA 3D3WA 3GNSA 3WIEA 1X0VA 5I8WA 4WEQA 4A10A 5L3ZA 3PYXA 1LDEA 4IZIA 4HNGA 3KYDB 3M6IA 4I5EA 2X5JO 3BMQB 4NIMA 2Q50A 3PHJA 3U4HA 4FOOA 3DMTC 4QX6A 4PG8A 3LT1A 4CMEC 2YV3A 2GD1O 1SNYA 2RIRA 1LLCA 4OH1A 3JV7A 3GR6A 3MJEA 1NNUA 2DPHA 3O38A 4OQZA 2IXBA 3GZNB 1VJTA 4JCOA 3MTGA 3DZGA 4F6CA 3R1IA 4E6PA 1AXGA 1PEDA 1Z6ZA 3ZW8A 2VN8A 1AHIA 1RPNA 1YGYA 4DUPA 3C1TA 4XIYA 2C7GA 3Q6IA 1G0NA 1CDOA 1GEGA 1E3WB 1PZEA 2I76A 4L0QA 4W99A 1P0CA 5L7TA 2QHXA 2GLXA 1GV0A 1TA4A 4M1QA 1SAYA 2FPGA 1UDAA 3INTA 4BVAA 1I3NA 4JJIA 1YRLA 3V2HA 1YOVA 2Q2WA 1EMDA 3O03A 4YYZA 5ILOA 5JDCA 1H9AA 2Q99A 4ALLA 1C1XB 1OC4A 1UP6A 4CUJA 4YR9A 1V3VA 4U6QA 1RJWA 4KDEA 4UEKA 3F5SA 1ZUD1 1XIVA 4XEHA 2FZEA 3LF1A 5L53A 2GDZA 1X7GA 5CG1A 1PZFA 1KY5A 2X0NA 2DTDA 2OORA 1IUKA 1IB6A 4C7JA 3BTUA 1LXCA 4H3VA 3WS7A 2I5PO 1O6ZA 2DUUA 3RIHA 4MVJG 1R66A 3ZDFA 4L73A 1GQQA 3RVDA 3AOEA 1WZEA 3DONA 2ZTUA 1ISIA 4EI2A 4M49A 4CODB 1UZLA 1NTOA 1P44A 4J91A 1Z82A 5K9ZA 3PK0A 3PLRA 3ROPA
chains in the Genus database with same CATH superfamily
1C30A 1FNBA 2ZYSA 3TTSA 3ZGOA 1BS2A 5CCEA 1UJMA 2E55A 3CR8A 2XUAA 1RHUA 1GDDA 2GX6A 1XAIA 4HX2A 3QKRA 1SCIA 4QXRA 3WRYA 1GFWA 4EHAA 4I3HA 4AG3A 2C2GA 1DDGA 3NJ4A 2MWMA 1J7JA 1N2JA 2RBKA 3W0LB 1N5LA 1YQ9A 3IT2A 3B1YA 4BZQA 1ML4A 2ODQA 3CRRA 1PFVA 3IAAA 3P26A 3LHKA 5AD1A 1UKCA 3I9JA 1M1YE 3QNWA 2EF1A 3G5AA 3IQEA 5CA0B 5JNVA 4X1YA 1NVXQ 3BGWA 2OYSA 4OHWA 4YXWD 4LJ4A 1FUYB 3LD9A 2QGZA 4IJ5A 4LYEA 4BNFA 5HJEA 2Z1NA 5HF8A 5KEIA 3D4BA 2DQSA 4M9XA 4GKKB 5KYYA 2XDAA 4QHSA 5AP9A 2VF8A 1N2EA 2YX1A 5LQCA 2FPSA 4DQ0A 4FZVA 4X20B 1IHYA 3T95A 4I4TF 3BM5A 5CCXA 3FSJX 3FJOA 2ONKA 4G5QA 2AX4A 5EMMA 2OECA 4F4DA 3IERA 1EFPA 1SUPA 2XKBA 4BNYA 1U80A 3O90A 1E5DA 1XZFA 3CNQS 5FOSA 2WTBA 2D2IA 2RC6A 4NZ9A 2HQOA 3M4YA 4FU0A 1GUZA 3FGZA 1JEOA 1ZGGA 1E4EB 5IBCA 4BMPB 3KAPA 1M6NA 2FSGA 3GT4A 1HA3A 4DJDC 1R4MB 3GVHA 1J8FA 3FVWA 3HDGA 3PC6A 1RMYA 3T9CA 3WNQA 5HKKD 3TD6A 2IXTA 2OV3A 1TT7A 2F1JA 3HH8A 5KVQA 3ZCRA 5HKKA 1I6LA 4QXMA 4PXYA 4MUHA 1T8TA 2P9TA 2VRNA 1YCDA 4LZJA 5G4KA 3S28A 2X9QA 1RI5A 1NULA 2QLMA 3D3JA 3L7LA 4B7ZA 3ZHBA 3JQDA 1O9HA 5CH8A 3LC2O 1OBCA 3F5DA 5DTEA 2BSAA 5FULA 1NMEA 5JE8A 1Z39A 5P21A 4AUEA 1FFAA 1T13A 2Z83A 3U44B 1YR8A 2W22A 3DOHA 1PR6A 4U6NA 4AYTA 3UIEA 2J0UA 3DOCA 3ACCA 4JL5A 4V3BA 4X93A 4EG1A 4F46A 2XDQB 1NW5A 2HBZA 4UAJA 4OBBA 4R51A 3IHKA 4FBLA 3SJBA 1PWZA 3VUFA 4LW8A 1EKXA 4X1IB 4O0MA 4B5LA 5HKLA 1SCUB 3P2MA 3TQOA 5E8JA 3TLMA 5LP6A 1V8OA 5DCWA 1LWOA 1YR3A 1M6VA 1SG0A 1SKYB 1GUAA 2PBLA 3FRJA 1MNAA 3MERA 2IGBA 3ZWBA 4E3ZA 3X2FA 1XUOA 2GLUA 3QG1A 4CQJA 4F85A 3IL2A 5CG2A 1ZPDA 1VFPA 1I33A 1FXWA 3DPUA 3KSZO 4KXQA 1SVNA 1MDBA 3AVYA 2NAPA 5K0FA 2XUGA 1LJUA 3E9ZA 1Q16A 3D1LA 2JATA 3HU2A 3K9BA 4R2IA 5FNVF 4C4OA 3QWBA 4EUFA 2BTOA 2JJMA 2PUHA 2TMDA 4IAOA 2XTJA 2Z56A 4RHUA 1JHQA 4GGOA 4YRGA 3U37A 3KYIB 2HSWA 3TRJA 4ZCMA 1TMOA 2DFPA 1NSFA 2O7QA 1VRWA 5F35A 5A6SA 1JWLA 4P0QB 1CUSA 1UJBA 3L01A 2P75A 2ZUWA 1HMPA 1PYOA 4TT8A 2QVLA 4L5CA 2QU8A 5AXDA 3REGA 1X7WB 2P1RA 3L07A 4X64B 2BKVA 2HF7A 1ATZA 4LOIA 1NOJA 2BI8A 1CRZA 2IQIA 4IV8A 4DTCA 1I7NA 1EXDA 4LZOA 2UYGA 3TZ6A 4K6HA 2QL7A 4NS1A 5A4DA 5EWLA 5KVAA 4DLVA 1J6UA 5IF9A 1HR0B 3O8RA 2YVUA 3QEKA 2GILA 1DIRA 1VKHA 3MFYA 1Q21A 4MHOA 1WXHA 3VC1A 3NRCA 1P8AA 3LC0A 4ZYXA 1K6XA 3KZMA 1FEZA 3U7GA 3A05A 4L0MA 2IP4A 1J70A 3CO5A 3FDZB 3QX3A 4Y6PA 1Z75A 3AL2A 1AURA 2QY9A 4LRUA 4DQKA 1D6JA 1E9DA 1LVUA 1NU8A 2C99A 3CUKA 2OWEA 4C4SA 1DUSA 1U2DA 5FBHA 1U2EA 1DEHA 3LT2A 4J7CA 2Z0MA 3AEZA 4PYMA 2DHDA 2AKYA 4P4SB 2XQIA 2A86A 4CGZA 4RDXA 2CL7X 1IHUA 1V0JA 4N7RA 4R0NA 4RANA 1YU6A 5KYKA 1O0SA 4GS5A 1BW9B 4P3NA 1IN4A 1XALA 2X9GA 2NVWA 2W6OA 3OTQA 1BOFA 4RIHA 3H2JA 3OE7D 4HRXA 2V3VA 3A9CA 1KAMA 3CINA 2O7VA 3EF3A 1JYEA 1ND6A 5AIBA 2AFIA 2BJHA 1QHFA 2ZT6A 1BWPA 3EGVA 5H9VA 2D0IA 5JCZA 3DQPA 2AIRA 2BE7A 4IGIA 3DBLA 2BGUA 1H6BA 2GPNA 5YASA 4BFYA 2JH9A 3A1EA 3PC8A 3N3BC 2PT5A 3GJQA 2B1RA 2YWDA 1R0CA 1XX6A 1PSDA 2D59A 2Q5EA 3HL4A 5DGIA 4ZXFA 1J9ZA 1U2GA 3A6DA 3E9QA 3RAGA 5KNDH 1QCCA 1ACMA 1QC5A 2UUPA 2P1ZA 1C1HA 2XCOA 4IV0A 2Z3WA 2H9AA 4ATNA 3WADA 3UV7A 2AE2A 3HADA 1AGRA 3ZJTA 3ACBA 1BXZA 2A3NA 2WU1A 3E27A 3EN0A 4LS3A 1DAHA 2PR7A 3NWOA 3EGWA 3F6CA 3KD3A 4LCJA 5GJVC 5HIKA 4BCBA 5KQMA 2AUTA 2LCQA 3G13A 3QVLA 2FB9A 3FW1A 1Y82A 1XPRA 5F76A 3AXTA 4BNXA 3S5JA 1RJ9A 4KLAA 3KJHA 2M6SA 3DLIA 4BVKA 4AKSA 4F11A 3PX2A 3PNPA 3FOBA 1DDIA 1U0FA 4ZAZA 4R2MA 4A8TA 3BWVA 3MA0A 3PUKA 4TT3A 3HU1A 1JKFA 2I1WA 1JLLA 1XL1A 4AF6A 2P7HA 2ZRGA 4B4DA 3FAKA 1NNEA 3UA3A 3D7NA 2OBNA 3GMDA 3HCPA 4JKYA 4OJQA 2M6KA 4RTJA 3ODPA 1OFUX 4O2RA 5IN4A 1LBTA 5LPNA 2XB9A 3DL4A 4L3VA 3D59A 4J3NA 2Q62A 5KCZA 3ITDA 3GLGE 4FOLA 3O1HB 3VKFA 2P5YA 1ITZA 2JCYA 3CV3A 4A26A 3FZEA 1BSVA 4L9AA 5D87A 3P45A 1E1LA 3MRXA 1PGJA 3WBBA 3TDKA 3KNZA 3SLGA 4PYNA 2WTEA 3C3BA 1JFVA 3VV3A 4YJ3B 5SY4A 1NZDA 1Q7EA 4QFMA 4C3ZA 4H31A 3QLVC 5E6UA 2XV1A 2RAUA 2BFPA 1JDSA 3GEDA 4G65A 6ABPA 3AR4A 1F8GA 1JLRA 2C42A 2ZRQA 4I55A 4QRHA 2GZ1A 4XDYA 1MX1A 1L5HB 4G23A 1PLLA 3GLKA 5AVZA 4EGAA 3OZSA 3SZRA 1J39A 1AMOA 2WAYA 2VS1A 2IDKA 4EF6A 4PS1A 1FLNA 1ZSYA 3CG4A 4ZP1A 1RQRA 1ODCA 2VLBA 3COPA 3PICA 5M3BA 4DNXA 1KNXA 3JD2A 2AOVA 5IJ0A 3O8OA 2PKQP 1MEEA 3KQHA 4C2BA 4EKDA 4HDCA 5D51S 4BECA 2G9RA 1IHXA 3NATA 4JC4A 4LC1A 1U7XA 1VGVA 3FNEA 5IK2D 5IK2A 2ZSKA 4TTPA 2P9FA 5F7ZA 3OTOB 2PKXA 1Z34A 2Z6VA 4MRRA 1M6HA 2BEUB 3BWXA 4YDSA 2PSJA 4Z9FA 5BW4A 3R3XA 1F2VA 4KG7A 4UD6A 4DLSA 4EJ0A 2AJLI 3HTXA 3PEYA 3MTAA 4S1OA 1V71A 2Z5LA 5IH3A 1PQPA 3RAJA 3A6FA 2FZWA 2PPLA 3O8DA 5CIWA 4A92A 1DEKA 2PA0A 5F5NA 4I36A 5T3YA 4JJFA 4DIBA 2ZR8A 4V02A 3WYDA 1NXXA 1R4AA 3CNEA 3IS3A 4L8WB 3GZ4A 4L5BA 1A4IA 3KQYA 3MINB 4IKPA 4UUMA 3OQMA 2RC5A 4XDHA 3I9NA 4R9RA 2O2EA 1LRKA 1G8PA 2PH1A 1RXCA 1JMKC 3OECA 3TW0A 1GKKA 3L6EA 4UDXX 4V03A 1F2TA 2X3YA 3ENZA 4IFIA 3Q7EA 1FTNA 5KWSA 4TKZA 3E2IA 1V9LA 5FNVA 1XD8A 1HE1C 3LTEA 3WOVA 4IOKA 3I8SA 1RPTA 1YRAA 2EHJA 5K4GA 6REQA 3EDQA 1CYDA 5EP3A 5KCMA 5KQRA 1JEQB 1XZGA 3ZY6A 1GL3A 3EZXA 2ODNA 3CN9A 4GKJB 1RRKA 4JGIA 2H18A 5JAUA 2XD4A 2FPPA 3OIVA 2ZR7A 3I04M 4C88A 1QP8A 3PJGA 2Y8EA 1U0TA 4QXPA 1J97A 4LRXA 1QF9A 3JD1A 4EHDA 2GBLC 1PDOA 3UK6A 4FDMA 4JYMA 1OLUB 3OM0A 5F3RA 2HRRA 4ZQCB 3ZX5A 4AU1A 2VNAA 2X76A 3N0WA 3ANSA 3DTVD 3DTVA 2RAVA 3K96A 5TE9A 3OJEA 2OXFA 2Z6QA 4J29A 1TZKA 5KU7A 4RSGA 3FZYA 1EEHA 2JFYA 2EFDB 1UJ5A 2EGUA 1UK6A 1Y33E 4WDRA 2KBFA 1FDIA 3B3JA 1RKBA 3EPRA 1HSZA 2OV4A 4D9NA 4HDMB 4UMFA 4W1QA 3SQNA 2ZOSA 3QPVA 4KUHA 1GVHA 3F3YA 1UQRA 3ZWNA 2REQA 5LBUA 3SYTA 1NKSA 2VT3A 3HHEA 4F60A 2R96A 2C7VA 2F3SA 3NX4A 4FB4A 1E4VA 5BVHB 2WVJA 3DWIA 3K32A 4L3OA 1Y6FA 4NVRA 4PLFA 2IYLD 3TSCA 3OZFA 1D4OA 3CLSC 3HL0A 3B2QA 4U2DA 4BBZA 2QNRA 3QIVA 5AJXA 4EHLA 3U5ZB 3A4TA 3OMLA 2P41A 1SPXA 2MOKA 5DO9A 1ZN9A 2CL5A 1RQ2A 3EAFA 1WBDA 3BTVA 3VPXA 2JJ1A 4MI6A 2PQ2A 4CIAA 2RGRA 3GVIA 1SUEA 1MVOA 1UBGA 3LBIA 2DH5A 4NFHA 1NW3A 5U4XA 4AS1A 3DL2A 5BV8A 1JFFB 3EARA 5FTJA 3EDOA 1JVSA 4OQPA 2VDLB 1AKRA 3K1ZA 4AJNA 1YUMA 3H1AA 3ONNA 3SSAA 1H0SA 1ZHOA 1KAGA 3D4NA 2O4UX 3PXGA 1Z5UA 4U7TB 2V98A 3WB1A 2VAWA 2XVZA 4BKOA 4RD3A 5KTRA 2OB2A 1QQAA 1IPHA 1PJRA 2FPWA 2GKGA 1HYGA 2R84A 3HMKA 3L7OA 3E18A 4XR9A 3BF7A 1EVIA 4DKJA 2R11A 4BP8A 5T4EA 2INGX 5B7QA 1CY8A 2QAGB 3QH4A 1F60A 4WUVA 5LSAA 2VPQA 4EJSC 3TNLA 1QO0D 5AW8A 3GJ8A 2G9UA 3HKBA 4BKMA 1WKVA 5I45A 2ZT5A 3D8UA 3AB8A 5BN3B 3OHMA 4B80A 4CM1A 3DZ8A 2YY6A 5ISMA 3FCOA 1K63A 3K9WA 3NYIA 4QLAA 3IKTA 1O8CA 2VOEA 3WGNA 5KKNB 2C5HA 1EXWA 2NQ8A 3MG9A 3H13A 3LW7A 5I7UA 3AGPA 2QU7A 3FX2A 4M1SA 3GZTB 3GFBA 1SOUA 3V1YA 5IT4A 2JFVA 3WZ2A 4U8GA 4ZQFA 5K03A 4WERA 1X7DA 5AVSA 3ZZMA 4JEUA 4MW9A 5A5DA 2Y6UA 3RYCB 4PAQA 2O2IA 3MRSA 1JZTA 3AL0C 1HORA 1E1MA 3AB7A 3LC7O 2E85A 3FYCA 3H6GA 1BDHA 3MPUA 4D0RA 1I7LA 1KR2A 3QKWA 4XWKA 3DMPA 1N2CA 1X92A 4RE6A 3TSWA 1H0HA 1U8ZA 2GJ9A 3MBKA 1QZZA 3S99A 4BBPA 5MHTA 2V7QA 2PL9A 2YYZA 1JV2B 3P4XA 2Y2VA 3OPQA 5TQ0B 3SIXA 4AY3A 2EX4A 5HJ7A 2AYYA 4CV0A 4QUBA 2J6HA 3GGSA 1A9QA 2JHGA 4H59A 1JIXA 1RYEA 2FFRA 2A7XA 1Q0PA 5C31A 1TCUA 3UCEA 2NOAA 2OCDA 2Q9UA 4DV6B 1NR7A 1RTKA 1ETHA 1YE3A 2VPPA 5JAQA 1GFZA 2LDBA 2VP4A 2NZYA 5T8KA 2VTEA 3WRWA 3LDUA 3TQTA 2ZS7A 2O0KA 1AKVA 1NQWA 1R0BA 2O5VA 3G8DA 4ON9A 5J4VA 3EBOA 3GGDA 2BV3A 3DVAA 4US2R 5AO9A 4AF7A 2QMHA 3PNBA 1XDDA 5IT5A 4AKHA 4MAFA 5EMHA 4PYJA 1U6JA 2HJGA 2VTBA 2R8OA 3E82A 4HH3C 1EHCA 1WXWA 4P3OA 2BE9A 2G8NA 4PBTA 1ADBA 1E2JA 1UM9B 4RSRA 4D8YA 3KKNA 4Z4EA 4HEA1 3A1NA 2I54A 3HJUA 3LDAA 3RABA 4YCCA 1CPYA 1GG9A 4PFJA 2CB9A 3BVPA 3MPOA 3EEYA 4XVCA 1HFJA 4PZCA 1SR8A 1QUEA 1LI4A 4EGSA 4FTWA 3PQFA 1NU6A 2OD7A 4LC0A 2RBEA 3OZGA 3UJAA 1JHDA 4ALKA 1RYNA 4IWNA 4OK6A 1LKZA 2D2XA 2P1DA 5EE9A 4OM8A 3PNLA 2EDCA 1ADGA 3VKHA 2PZJA 3QNMA 4P4UA 1ORTA 1Q84A 4FBGA 1LLFA 4HMQA 2L17A 1TQ2A 3TRDA 2C4NA 4IIJA 4CCAA 3PD0A 4GDMA 2R5WA 3IA7A 1ODTC 1ZC3A 4PAMA 3FOEC 4R1OA 1NR1A 4GSKA 3VHXB 3IIKA 4YMWA 3M0EA 4RHYA 4OFZA 1K7EB 4YCDA 3T1TA 1DWOA 1J33A 1LJ8A 2VBCA 3QHAA 4A5SA 2G7MC 1OTYA 2YXEA 3ISTA 4OMCA 4MEJA 1E1QA 1T9BA 2VDWB 1Z7GA 2XYPA 4QXQA 3W9UA 4AJ1A 4LFCB 2B20A 3ZTYA 2F55A 2FEXA 3A6HA 5CX4A 4KPFC 4M7PA 3RAPR 4RPIA 2XVAA 4AKTA 4BO6A 2V7PA 1U63A 2P9EA 2BGKA 4KMOA 5B6IA 5BWBA 2J4CA 4DEYA 1BG6A 2PZEA 2VNSA 4EJSB 5EKTA 4EUKA 5BSFA 2NSHA 3RFXA 4Q3AA 3VR4A 1FJGB 1WW2A 1CYEA 1G2QA 1SM4A 5KU1A 1NVVR 3NBKA 5DM1A 1IVNA 1SUAA 1MJFA 4EJ2A 3VX4A 1FX0A 3I8XA 2KHZA 2MYPA 5CEFA 1ZCAA 4K0RA 4Y1RA 4IGKA 3TAHA 1H22A 1T9HA 2Z1MA 2ZUVA 2QV7A 2DXIA 1VI6A 1TAHA 3LUHA 4TTTS 3FHLA 1K3TA 1EWQA 1KS9A 1U9YA 4U9IS 4KSYA 4UULA 4X7BA 4R4JA 3IE2A 3NAQA 4PQFA 3TLJA 3DOOA 4OLHA 3HKDA 3O6VA 2O59A 1SQ6A 5ALKA 3Q1LA 4ND7A 3VSDA 5HR5A 5C32A 3EUWA 5JSZB 1X9HA 4CDNA 1SC3A 2X0FA 5CLFA 1Z8FA 2VJBA 3B8HA 4C4RA 4KH1A 4XQ0A 4IXWA 5IUJC 1NAHA 2E2WA 3ZI7A 1SWVA 2W11A 4WL0A 3GA7A 3MGKA 5BYBA 2CDNA 3T7RA 1BEZA 4IDFA 1B2RA 3RSSA 1SY7A 2N46A 3GBVA 2HCJB 5CPFA 2JAXA 3W6ZA 1ENPA 1TM4E 3IAHA 4MUYA 4JBNA 5C8ZA 5KHAA 3KWMA 3ZHVA 1S6YA 3VO9A 1VPWA 2YNMA 1NVDA 3R3JA 3Q5GA 1JKJA 4XARA 5HKAA 1ZL2A 4Y9RA 2BWJA 2FX3A 4LGMA 4P84A 4DQUA 3TECE 1YF3A 2AJTA 2RG1A 4N41A 2FPIB 2O1EA 3HCRA 3H3JA 3L4BC 2JHCA 4JI1B 1BE1A 3ZKWA 1MU0A 3DAFA 2QRVB 1K7YA 3I2HA 4C03A 4P93A 5EUBA 1B6SA 1MJNA 3DG9A 1Y6JA 4OQ4A 1GG2A 4D80A 3DT8A 3M34A 2I2WA 2X15A 1S2IA 3S81A 3IIEA 4PRZA 1EQ2A 2X7JA 3A32A 3HCEA 3WGHA 4DV3B 4HAOA 4WSOA 2JHFA 2GTIA 2B4AA 2DQZA 3USZA 4B3FX 4DCCA 2ZJ0A 4L02A 3IDQA 5CJJA 5BNFA 3C7CB 3H5LA 6PFKA 1UXOA 4JT9A 4LOKA 2OP1A 3MWGA 5DX0A 5JPCA 4HLUC 5C3UA 1WSDA 4HDOB 5DHTA 3CVXA 1AKYA 3STTA 3K0AA 2ZWAA 3E7FA 1XMIA 1PJTA 1H2BA 4Y0AA 1MR3F 2CDCA 2LIPA 1HX7A 3KUCA 1USIA 1D6SA 4RA9A 3H2GA 1C9KA 3F3MA 4QUKA 1NBAA 2PSDA 4CFSA 5D6NA 4HWTA 1N36B 4LZWA 4PGGA 4R1MA 1DQNA 1JSXA 4KPYA 1JIIA 1NRIA 4M76B 2BF4A 1Q12A 2B99A 4QE3A 1OIXA 2WM2A 3FF1A 4O1HA 4G4SP 3OY7A 2F3RA 4RADA 5IXSA 3H2HA 3U3OA 1XROA 4UEOA 4EYSA 4IJ6A 2ZTHA 1EE1A 4PINA 3D4LA 5K3CA 1I36A 2JI8A 5AW7A 1CUXA 3JQ6A 3ZGVA 1AE1A 3KQNA 2GM4A 4Q1VA 1UOEA 2Z1DA 3VUEA 1P2FA 2IOFK 3L9WA 4GBJA 1T9ZA 1DMSA 5CFMA 2R66A 2XMCA 3IEMA 2HBRA 3GFTA 3L1JA 4NJMB 4OI2A 5K8VA 1GAWA 2TMGA 2OP0A 4QASA 3WLKX 4FT4A 1KJJA 2C59A 1DWPA 4JP2A 4X45A 3RIEA 3VDXA 1P2UA 3GJXC 3L1HA 1GPYA 4H1HA 1B2LA 5KOJB 2UYQA 5CK5A 1NMXA 2OCAA 3C6ZA 3FPSA 5TF0A 2Y71A 5ALNA 1MB9A 2FRXA 2HJRA 2Y1CA 1V16A 5ICSA 3KEOA 3AJ9A 3OIUA 1ORDA 1NF9A 2BMJA 2J8ZA 4O1MA 4PU0A 4YRQA 1Y1SA 3MCZA 2NTEA 3EMVA 1JALA 5ESWA 5F1YA 1EIZA 3Q98A 2GKOA 1NVMB 3KO8A 1EJ2A 4RFVA 5ELMA 1I13A 2I6XA 2BFAA 4HRYA 1E5LA 3N5KA 4I4IA 1H2WA 3P9IA 3X1YA 4B3DA 3OPYB 1NC3A 4V1CB 3DHYA 4JP5A 2AJDA 2R6AA 2CSUA 3G68A 5BUSA 3NW9A 5DRTA 4GFDA 3SR3A 4JVLA 5G41A 3TSOA 4NH4A 1UL1X 3UFXA 5KS2A 3A6KA 4ZU6X 4CTNA 4IDEA 4XFJA 2NUBA 4LFAB 3C5HA 1OI2A 2OXEA 3BAZA 1BVRA 2EF0A 2Q5FA 4FDAA 3RJ5A 2V8OA 5DHSA 3ROKA 1CZLA 4BMVA 3AHHA 4NCHA 3H8SA 2FWIA 2X19A 5GPBA 2RJNA 3CUUA 1LBEA 1Y3BE 1N0VC 1TCCA 3L92A 4P35A 2ZDQA 4ENWA 1QG0A 1HZJA 1S8OA 2V03A 3ONWA 2HLDD 3QSGA 3FBGA 4HXGA 4MUJA 2HLDA 5BPFA 3PDIB 3SE7A 4ECAA 3THWA 1CC1S 3V4FA 1P8JA 5LQNA 2GZHA 1Q0RA 1S96A 2IF0A 2IH4A 5FFNA 1EJBA 1M9NA 1YHYA 2R4TA 3GPIA 4JT4A 4Q7JB 5LMCA 2NZ2A 1SBQA 4D0SA 4GL4A 4GLFA 5CVUA 4ZV9A 4W7HA 1NBME 1S1MA 2X6QA 1E9SA 4XQ9A 1T4BA 3T54A 1UC4B 3TQSA 3SYKA 3ZY4A 3A4VA 3KVOA 5B64A 2PDAA 4BV2A 1GNTA 2ZSFA 1AN9A 2VQFB 5KNBD 4EL0A 5EJIA 1A77A 1R8QA 3C7AA 4DREA 2R6JA 2HYIC 1W0JA 1ZO8A 3AHCA 1QAOA 2YR0A 4J4BA 3BXXA 4IV5A 3QE0A 1TU3A 5KTPA 3LY9A 1UFKA 5K0EA 4D4MA 2CXUA 5HYVA 5JZBA 5H70A 3LGSA 1PWYE 3MMNA 2I03A 2ERXA 3CEJA 4ND6A 4PAOA 4EA8A 2OUIA 1KK3A 2P30A 1GEEA 2X7XA 1UXKA 3AY7A 5JZVA 3G0OA 1C7ZA 2UZAA 1EAMA 4MUKA 1SA0B 1WZIA 1XMJA 2DQYA 3E7DA 4KKXB 3HJBA 1H4VB 5CX1A 3T1QA 3AY3A 1U1GA 3A4LA 1CY1A 3PGA1 4PLWA 4WCDA 5JAMA 2XLCA 4K2AA 3VGPA 4G85A 5CDFE 1J0BA 3EZFA 1QO9A 4JHXA 4MUIA 4RIIA 5BT8A 2CLCX 3FRHA 3MELA 2UZ1A 3BAFA 3TDMA 4CCSA 4J07A 2PX3A 2M6LA 2NVOA 1FW8A 3VPBA 2EW2A 1T1SA 2EFHB 4P86A 3EX7C 1XZEA 2CXOA 4N39A 4CETA 2XHEA 3PJDA 4C2AA 5K1ZA 5T7BA 1W94A 1KI1A 5TSDA 4Q9JA 5B2EA 3SBOA 5CA0F 3H1GA 1YQDA 3R6TA 3LO8A 3V5NA 1G59A 5FOVA 3IHTA 1TJYA 1BGWA 2PAAA 3DV9A 3C5CA 2CK3A 2RI1A 3ASVA 3BXHA 4Q1FA 1WF3A 5HIJA 3OJOA 5UKDA 4E2ZA 3L7DA 1BVHA 4ARSA 4GWKA 1YR2A 3OQ1A 4L6CA 5LMZA 1K7SN 3OTHA 2H57A 1KMHB 3NVMB 1A9XB 4Q18A 3PDHA 4NBRA 3V8VA 4R7ZA 4D3YA 4TYYA 5I7AA 4IH1A 2H65A 4YR7A 3EXEB 4M0LA 2MYNA 5LDDC 4TGLA 4DARA 2C78A 1XCMA 3C3EA 4NH0A 4RMGA 1EVEA 1AVTA 1U8TA 2AOUA 4UTRA 1WCYA 1Z9BA 5KNLA 1GTSA 4YRFA 4UZSA 1IWPB 4KE8A 1PYGA 1II8B 3ONEA 2NW6A 1T4CB 1ZESA 3GH3A 3UH1A 3HFGA 3MWKA 1TIKA 3PTAA 1TMGE 4OO3A 3JALB 5BNIA 4DIKA 3BGIA 3T4PA 5CNMA 1PAUA 5B55A 5JRZA 4WX2B 4MZDA 1Q77A 1NUHA 4QNNA 2C5AA 3HNOA 5TQ2B 3ZKAA 2WT8A 2LE0A 3QWFA 4E4TA 3PL1A 4FGSA 2ZK7A 4Z4GA 4XLTA 1WPGA 3CB2A 6NULA 2D4AA 1ZW6A 2QV0A 4IDDA 3PHIA 1V1MB 3F1KA 5BV7A 3N8NA 3HE3A 4N4AA 1RWQA 5AKGA 4IVNA 1GTJ1 3JD4A 4FNOA 4HN4B 2QRJA 3NOVA 4JKOA 4RDCA 3RSCA 3RUCA 4EKNB 3KXDA 1ZICA 1UZNA 1VB3A 3C1OA 5LXTA 2WD7A 3DNPA 2HADA 4G8CA 4MWDA 4Z99A 5FUWA 5F21A 4E2FA 3KUKA 2IEYA 3TB4A 4ILKA 2XCQA 5I9TA 2X8BA 5KVVA 3SEZA 5CU7A 3SM9A 1NYLA 1P3JA 4J9UE 3RUAA 4CHTA 4FGWA 4G0XA 4BJ1A 5EXXA 5TNXA 3CQ9A 4HNAA 4MGKR 5AESA 1G7RA 1E2QA 4BO2A 1ZVJA 3VNBA 1U2QA 4RIFA 3H2ZA 4EL5A 1KY4A 1N6KA 5D7NA 3SVLA 1JYSA 4FFSA 4H1UA 2FEAA 5DYIA 4HNQA 4I5GA 5CT5A 5AHOA 1KIFA 1PFYA 4BAGA 1BMFD 1E1NA 1E7WA 4QYXA 3WLJA 4BMYA 4M0CA 1YV9A 2W2NA 3R24A 4GOMD 4RLHA 4XCQA 1EFVB 2VAMA 3JQ7A 5HP4A 3V4ZA 3D64A 4CM7A 3C70A 5BUQA 1GQOA 1HM5A 2D62A 2OR3A 4RORA 3S68A 1O95D 3M89A 3NALA 4FKBA 1KOGA 3AWDA 1KK1A 1GLNA 1I4EB 1XDWA 4KQFA 4BQIA 2FJUA 3BGDA 4NDZA 1WDLA 3FGPA 3CZAA 3BKWA 3NT4A 1DAMA 3PPIA 4BFUA 5BURA 3AHJA 1LPSA 2PAFA 3P0FA 2VHVA 4M9RA 3SMVA 4N3GA 2PSFA 5A9RA 1OKKD 2ARKA 4GOJA 4OHVA 1OKKA 2WSBA 4BB6A 2FUEA 3K1AA 3KQWA 1BE0A 3T9BA 4G5YA 3VNUA 1MLDA 1X9GA 2QUBA 3CPSA 5HSGA 2Q3BA 2ZW9A 4LRYA 1WRBA 2JIZA 4YC7A 4D45A 1V95A 2C92A 5BUZA 1L7QA 4HGOA 4WOJA 4DWJA 2HK7A 4M0KA 5LVAA 1XQVA 3PC7A 1M2EA 3FYSA 1QOQB 1XJ5A 1YZKA 2VRWA 2DMRA 5K3FB 3UG7A 3UMRA 1U7WA 1XWFA 2NU7B 4FX2A 4L85A 5JJ5A 1VSQA 3PB3A 1JJAA 2WI8A 3N2ZB 3FMIA 4PLZA 4GG1A 3N6XA 4IMIB 4UE6A 5FQOA 3SJAA 2VA9A 3HG7A 4JODA 1U4SA 3ADBA 1ZOPA 1EBFA 3CMMA 3LBHA 3NCHA 5B1HA 3LBNA 2ZZMA 5G0SA 2V4UA 2HIMA 2G77B 3KQVA 2NM0A 2BHNA 5KVSA 2XLBA 3N76A 1VYVA 3WZMA 2HR1A 2O8BB 1WY5A 3QYFA 2GK6A 4EEKA 2YZMA 2HPVA 3GXOA 3IAEA 1HUQA 4NHEA 1E9BA 3BF8A 3S8YA 2CMHA 2VVTA 4M0UA 3TINA 4CT4B 4JC5A 4E5NA 4ENSA 4WBNA 1GGKA 2FW8A 3MLBA 1HZZC 4XYBA 4B76A 4C05A 4F6RB 1AHNA 4DLPA 2IF2A 3GUZA 3DAGA 3K5PA 4GPEA 5KBYA 3HM9A 4RKFA 4XE5A 3RK0A 5CTJA 4EW1A 1GFIA 3NAGA 3OX2A 4RFSB 3ZPXA 2PFGA 3FDXA 5DTJA 2BHSA 1J21A 4I99A 4QO8A 1UBLS 5BP7A 3Q7IA 3DOFA 3UB2A 5FFFA 4PGFA 1BA3A 3NMUF 1KFEB 2IK8A 2JCXA 1FFYA 3NHWA 5CCBA 3C3WA 1NOKA 3P2EA 1GLVA 1SVIA 2FCRA 1GPUA 1K8QA 1KK2A 2AI3A 3L0OA 5B53A 2RARA 4R1PA 3DWGA 1EBBA 3AP3A 5CTAA 1LJLA 1R6BX 4DR7B 4KBYA 4OHCA 2HXGA 4ZVLA 4DTIA 1VYUA 4U7GA 2NP7A 3I61A 1QRRA 3GW8A 5AK5A 3MRVA 3R76A 1Y5NA 1DNPA 1O9BA 1T5TA 2XAAA 4MTCA 2FFAA 4Q05A 4U2FA 1NN0A 2DAPA 3JZAA 2Q1UA 4OOFA 5DMHA 3UZUA 3IBTA 5LL6P 1Z6QA 1EA5A 3EXHA 5TPZD 4DG5A 4NEHB 4DE5A 5TPZA 4RGYA 4BXOB 4YN3A 2CHUA 4LSZA 1K27A 3FTEA 1MABA 3AP2A 1DHRA 4FMPA 4A6EA 1M2VA 3X1XA 5H3CA 1ZMXA 4ZJPA 4A73A 4JUAA 3OO0A 1XZAA 4GVPA 3ZV7A 4DCGA 4NICA 1YSCA 2CDRA 2XZPA 2GMWA 3DOIA 1U7PA 3NDPA 3Q9LA 4BVFA 3HYLA 2BP7B 1U8AA 4XOUA 4CEHA 5EQDA 2R87A 4HNRA 3DPIA 1JT9A 3E9EA 4ZCRA 1FRVA 2FR8C 2LGJA 4Q3OA 2VDNB 4PCVA 4Y18A 4BBJA 1SVUA 2R25B 1RQPA 2JFHA 1N9KA 2W2QA 3BMNB 3AR3A 3PFFA 4L07A 3Q5EA 2CLSA 4W8OA 3TQRA 4Y2PA 1JEYA 2VNHA 4P7JA 1RWOA 4YJ3F 3JYQA 4FYMA 4QIHA 5K3DA 2ERYA 1AXEA 4JQYA 1GWNA 5AKJA 4KVFA 5TLSA 3KOMA 4YMTA 5JEEA 3A1DA 1G21B 3T5BA 4DUGD 3N07A 1A5SB 1ORIA 1W52X 4WZBE 2PLFA 5A04A 3ZQJA 4R01A 2AZ4A 2J3HA 4HUJA 4BNNA 1G64A 2ZYRA 1SCKA 4MVJP 2RHOA 1G4UR 2FGJA 1J25A 3L7JA 2X8AA 3QKTA 1TUGA 2GDJA 3T7KA 2ZAGA 1SKQA 2L2QA 3PCXA 4GEGA 4P3PA 4QNMA 4ZGBA 4YHHB 2E4UA 3A9UA 4G2NA 3VH1A 2ZCVA 4ZMSA 3EZYA 1OFTA 2V97A 3TSAA 8MHTA 5ITSA 1OBVA 2WRZA 4DMLA 5JNLA 1UBHS 2Z5VA 2B2CA 1G20A 1ZMRA 1KKLA 2PQ6A 3RG8A 3UC5A 4IG4A 4INOA 4QGFA 3B9BA 4FC7A 3WNBA 3WXBA 2X41A 3LDHA 3AK4A 4NC9A 2OQIA 2W43A 4YVFA 1PQUA 3VU1A 4KO3S 3WK9A 4QGHA 1L8AA 1JQAA 2E18A 1Z0AA 2P77A 3B9PA 4BLOA 3WK5A 3D5EA 4RGVA 1E2MA 2H85A 4RLQA 1GCAA 1VLLA 2GGSA 2IBMA 4JP1A 4N8DA 4TXLA 3PDJA 2RBGA 2GCGA 3LCCA 3IR5A 5G2OA 1V7PC 5CM8B 2NO4A 1ISRA 1P1RA 1N0UA 1Z8DA 2Q9BA 4M9SA 3T35A 3ITNA 1WUKS 4PWZA 3BD6A 4C21A 2YL2A 4W7IA 1IHPA 1XA0A 2YFYA 4M0DA 4DV2B 4MQMA 2RH8A 5L6LB 2H1CA 3E48A 1C3JA 3OZBA 4GPZA 1H2EA 4M8IA 4WN9B 2BFBB 5BWOA 1QYVA 1PGNA 1QX3A 3HJNA 1KH3A 1CLUA 2FZVA 2I1VB 2LP4Y 4JVNA 2VQDA 4R1LA 3ONFA 3HN2A 4WCFA 1P45A 4IWXA 2R8YA 1Y48E 5DYNA 3BBPA 5EIAA 3U6BA 4IVRA 4L15A 5JD4A 4P7GA 4Q9DA 1JDZA 4Y2RA 4AAYA 3D0QA 4TV9A 1PZGA 1WJGA 3WLNA 2R1ZA 4CKYA 4V39A 2EJCA 1G98A 3D8TA 2IZOA 3EDYA 1G9SA 4OU4A 4IJKA 4YRTA 1TTHA 1V37A 3LSYA 3HXKA 4KQ6A 2RI6A 5DLYA 3V1MA 4JZYA 1NPTO 3PXXA 4ZEMA 2WWYA 2F6RA 3RIMA 3CM0A 5LKRA 1E58A 1YGPA 3ICOA 2W2XA 5EZYF 5ENDA 4B7XA 1OGJA 2Z9DA 2C9MA 2A1TR 3CB4A 3GGOA 5CURA 3B8EA 5FB3A 4OKIA 4AJEA 4B32A 5EJEA 2GAOA 1C14A 3EPKA 2FW9A 2P8JA 4UCQA 1DBPA 1SVKA 3U3ZA 4MO9A 1ODSA 4UEQA 1JQEA 2EG5A 4BQRA 1DO8A 5EJ7A 5GINE 1U1IA 2OAQ1 5IBRA 5GGXA 1YKFA 2IZ5A 3LPLA 1KR5A 4KFTA 1NRWA 5I7HA 3EB9A 3BCSA 1ZJJA 4M1ZA 3KVNA 4Z8YA 4X8HA 4CNBA 5CFLA 5JHHB 1SKYE 5B1SA 3U7HB 1LDNA 4BASA 3ELWA 1M2OA 3AW9A 4DR6B 1P91A 1M2FA 4HQ6A 3DKKA 5TC4A 5IXYA 1Y3HA 3ETHA 3T3NA 1YU9A 2BZ0A 2WYOA 5JH7A 5GM2A 1D4AA 1VMEA 1M34A 5TEWA 3HCDA 3GUYA 4PO8A 1EDZA 5AJHA 2CXTA 3V46A 4JXXA 5A05A 1I80A 2KMLA 3OEWA 1RCUA 4K9RA 4L9RA 3VZPA 4CUKA 2BEJA 3DCNA 3DVLA 5M29A 3L8FA 5HFNA 3JWJA 5LKAA 1NLYA 4KFUA 4TLAA 4RVCA 4AURA 3RSFA 2BEWB 1SXIA 5GADl 2AFIE 2OENG 5TR9A 3RK1A 5DNCA 1Z3CA 4EUEA 1RWPA 1CRPA 3KPWA 5HRAA 1P7WA 2HSGA 1CQIA 1D2AA 3NDRA 4HR7A 2ZRHA 2BL4A 1Z2AA 4LBVA 4CL0A 4C07A 1THTA 1RYHA 2ZXEA 1KO8A 1FZTA 5FWYB 1KDRA 1XTRA 4L2IA 5I7VA 3BH6A 5ITZA 1CF9A 2PZ8A 3GLRA 4X6LA 1D03A 2XGSA 2HA0A 2CE2X 2RAFA 3SHTA 2ANCA 4M54A 4Z4QA 2XMZA 1U5BB 1T0IA 4ZQHA 3EIOA 1BWRA 2HN9A 2CLEB 2C5BA 1F06A 5FBLB 2NUTA 1EVKA 1XXHB 3F90A 1GPKA 3S44A 5KWEA 3C3DA 2CEKA 2PZAA 3DNMA 4LHEA 4KR0A 3H9JA 4RZSA 5A5FA 4Z53A 1EVLA 2GEFA 4YA6A 4BKUA 4BNUA 1G16A 1PW7A 2C4MA 3FR7A 1YK0A 3LQQA 4H3KB 4K81B 5K0LA 4JLNA 5HTOA 1LQ2A 4QG7A 4Z4IA 2REXB 1QRSA 4XB1A 3BMXA 3NKVA 2QSYA 3EZ9A 4XI9A 2DPMA 4Q1AA 1GQRA 3E4CA 3TB6A 3VYTB 1TK2A 2ZIGA 4IX9A 1PFUA 2FPGB 5J2TF 4CM8A 5LNK6 3O7MA 1C9EA 4NFLA 1WR8A 3OZTA 2POQX 3JRXA 4LJ9A 2EYUA 1I1NA 1V1RA 5IPFA 2CNNA 4ERNA 1YZFA 3M4NA 3LLUA 2CE7A 1QP0A 4E4RA 2O3JA 1CFZA 5IAJA 4BUZA 2ZSJA 1E2UA 2UXBB 4IIJF 2XOXA 1NXSA 3EEFA 3K5IA 4IF4A 1JBEA 1RM4A 2W6ID 4DIEA 3W5CA 2W6IA 4IVPA 1ZD5A 4YQEA 2JC3A 1WUYA 1A7JA 2FPXA 2JDID 4YACA 2C2WA 5J2UB 4F2PA 2JDIA 3PFWO 2YBDA 4FCTA 1IBLB 3ESZA 5I4CA 2V58A 3ORFA 2YFKA 3EHDA 4MQFA 1ZGAA 4BLQA 1BXRA 1X80A 1EWYA 2NAFA 2ZE5A 2B8JA 3PJFA 4OJKA 4ZOLB 3RTBA 5F23A 1MDFA 1CR4A 2GUGA 4HADA 1E2LA 2BM9A 1ZGBA 1CKEA 3V6MA 5I3ZA 1PS0A 1C0IA 3D1JA 2W90A 3P4YA 4RKEA 1MB2A 1P0IA 2Q0SA 1HLGA 2RK4A 5LZ7A 1VXRA 1H2AS 3DDNA 1CUIA 1QIFA 2P2CA 3EUFA 5LCXA 1XHEA 4MPPA 4FCCA 5LU8A 1JPUA 5EMLA 1Z6AA 3U3MA 2O8FA 1EG7A 4IF6A 1N1MA 2PBRA 2WUVA 2Y1FA 3K7EA 4JENA