3AFMA

Crystal structure of aldose reductase a1-r responsible for alginate metabolism
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase
publication title Molecular identification of unsaturated uronate reductase prerequisite for alginate metabolism in Sphingomonas sp. A1
pubmed doi rcsb
source organism Sphingomonas sp.
total genus 97
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.1.1.126: 2-dehydro-3-deoxy-D-gluconate 6-dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3afmA00
4GI2A 5BSGA 3H2ZA 1CEQA 4NI5A 4AJKA 4LSMA 4EEXA 3RC9A 3GG2A 1JQBA 3WX0A 3G49A 3K2BA 2X22A 4OH1A 4HXYA 2VZ8A 2FOIA 4HNGA 4B7XA 4NU5A 5EN4A 1IHXA 4DC1A 3IOYA 2O7SA 4Q3AA 1U2GA 2DT5A 3G0OA 3RD5A 4R68A 3ZW8A 1PS8A 5CFZA 3MZ0A 1I5RA 3D5QA 2X5KO 1UZMA 1VC2A 2Y1FA 1NQOA 4ITUA 2GDZA 3KO8A 4Z9YA 4ZD6A 3SVTA 1TI7A 1PJ3A 4GX2A 5DOVA 3B20A 4I5EA 4BB5A 5G4LA 4YJDA 3KTDA 4BGEA 3DBHA 3OSUA 4DMLA 5A5EA 1BMDA 1GYPA 2QYSA 3UKOA 5JCJD 2WYVA 1Z73A 4MVJI 3FR7A 3VH1A 5ILOA 2G1UA 3DTYA 5L3ZA 1Q0HA 4CLDA 4W7HA 3ZWBA 1E3LA 5DN9A 2VTEA 4UUNA 2J8ZA 3AY7A 1MXHA 3VVCA 5ITWA 4GGOA 5LCXA 4URFA 4ZRNA 3BXXA 3EYWA 3KYBA 3AOEC 4PRKA 1EK5A 3G1UA 1EDOA 4J1NA 3AFMA 4IZHA 3TRIA 1RM5A 5F1KA 4ZQHA 4RL6A 1PJLA 4IUYA 3ZDFA 4DIFA 4Q3BA 5A9TA 3GH3A 1P1RA 3FR8A 1PX0A 1TXGA 3BHJA 1WZEA 2X9NA 3RUCA 4AJPA 7MDHA 1EBFA 1NQ5A 1U28A 3RWBA 4LMPA 1QG6A 2YZ7A 1ULUA 2NVBA 1ZK1A 1ZH8A 2Y67A 3C8MA 1LDEA 3I1JA 1P44A 1EFLA 1XU9A 3GVXA 4OXYA 1TT5A 3NEPX 3H3FA 2NTNA 4XYMA 1NFFA 2A94A 4BNUA 3KV3O 4JROA 4DGSA 4FOSA 3AU9A 1VKNA 3FRJA 5F5NA 1DLJA 4YRAA 5IZCC 2BD0A 5IN5A 1FDSA 3NV9A 4RDHA 1ENYA 4HKTA 3RFTA 1XEAA 1PWXA 3TL3A 4BMSA 5IN4A 4BO3A 2BGLA 3WGIA 1LLQA 4CLHA 1SB9A 5F3RA 2JAHA 3RC2A 1PZHA 4OHUA 1GPJA 4ZQFA 2NVWA 3OECA 3HSKA 4Z9FA 5A02A 1GU7A 1SO8A 4CUKA 1T4DA 1YE3A 5C7OO 3EHEA 3LLVA 3MWDB 3UOGA 8ADHA 1ULSA 2Q3EA 2VYVA 4DVJA 1H6BA 3QSGA 3NX4A 3OETA 3WTCA 2DTEA 2Y1DA 2Z95A 3WGQA 2IRWA 3VZRA 4CV0A 1UJMA 3AOEA 1E1MA 2Q4EA 4TVBA 3ZU4A 1O6ZA 1R37A 2NV6A 3NGXA 1N7GA 4J4BA 1EZ4A 1NNUA 1PS0A 5A3VA 3ROMA 4LMRA 3ASVA 2ZTUA 1IY8A 2C5EA 1I3KA 3HHPA 2WWRA 4LVUA 3JCZA 3PVZA 3CZRA 4X54A 5FI5A 4AJLA 1DRVA 4HY3A 3UH1A 1HDXA 2Y0CA 3I52A 3PWZA 5CDTA 2HUNA 2FSSA 1Q7GA 4A10A 5I8ZA 1YGYA 4FGWA 3LU1A 3K30A 4DMMA 1IPEA 5ES3A 1ZK2A 5A9RA 1FK8A 2Q1WA 2OHXA 3AI2A 5ER6A 1DB3A 4A5OA 4B3JA 4NNJA 3EVNA 3HB4X 3D3WB 3Q11A 1K0UA 4NQZA 4RORA 3E6AA 3K6JA 2PA3A 2WDZA 3GUYA 1NWCA 3WIEA 4GVXA 1JWBB 1XLTA 3R3SA 1DO8A 5IXYA 4YB8A 4J16A 1YBAA 3BMCA 5A05A 2XOXA 5L4SA 4JJGA 3WICA 4B8WA 5J23A 2NVUA 2DUUA 3BTUA 2O4UX 4E2WA 3OP4A 1RM0A 1NHWA 4Y8VA 1PZGA 4MVJD 4YEDA 1A5ZA 3KYDB 4XQ9A 3DZJA 1SAYA 3GQVA 4NMHA 4EDFA 3NJ8A 3OICA 3NGLA 4KQXA 5B1YA 3VKUA 3PIIA 1LSSA 1P1JA 3PGXA 1QXSA 4B3HA 3BHIA 3RUFA 4OM8A 3NDJA 2GF2A 1VI2A 4CM3A 1YOVB 4CM9D 2A92A 5KIAA 1O89A 5A3JA 3DL2A 1R4NA 1PQWA 1U2DA 1WVGA 2UYYA 3AUAA 3ITDA 2BFPA 4M1QA 3H7AA 4W6ZA 4R1UA 3RBVA 3SJ7A 1KIFA 3QA9A 4TSKA 5JDCA 5JPIA 3C1OA 4BNHA 1HSZA 4FCCA 4WECA 1ISIA 4DREA 1PU2A 2CVQA 3U0BA 4BL5A 3R3JA 1R12A 2CUKA 3QWHA 2OORA 3ZV4A 3HNPA 4GKVA 5IAAA 1U7HA 3UW3A 4TKLA 2O7QA 3QWAA 4WEOA 4D3FA 1VL8A 2NM0A 4Y6PA 2RCYA 1JLLA 5DP1A 4HBGA 2EEZA 4EGFA 4GBJA 3F1LA 4QT0A 3HFSA 2RH4A 3K31A 5G0VA 3ICPA 3H9UA 2BMAA 3DOCA 4E12A 2PZLA 1PL6A 3OH8A 4HV4A 4UVIA 3HDQA 4FC6A 1C1DA 2PV7A 2E37A 4J4HA 3OJ0A 3QQPA 4OO3A 3W6UA 3WYEA 4WLUA 5HWSA 5A9SA 2WD8A 1S6YA 2IE0A 2B36A 2JKVA 4Y6SA 1AHHA 2Y68A 3F4LA 3GEMA 2ZB7A 3GN2A 4NBUA 3WGTA 1B0AA 1LNQA 4Q3EA 2I76A 2PWZA 5KTKA 4TROA 4XDZA 4YAGA 1Z82A 3O8QB 2OMEA 3DAGA 4XR4A 1GV0A 2F00A 2HLPA 3ROKA 1Q0LA 3VKVA 2Q45A 4AJ1A 1V6AA 5HS6A 2R00A 4L9RA 3H2SA 1X13A 2I3AA 3FI9A 3DBVO 1YWGO 4I9UA 1K2WA 2Q50A 3U4IA 1E7QA 4JBGA 1DHTA 1E3WB 5AXAA 1N7HA 3BTOA 4TRJA 1FDVA 1ZXLA 5ICSA 1TA4A 1DOHA 5DOZA 5EERA 4W9NC 4ROSA 4D42A 3FWZA 4HP8A 1HZZA 3PHLA 1HSOA 4CR6A 1SMKA 2GZ3A 5HM8A 4ZQBA 1YL6A 1KEWA 4G65A 3JQAD 1P0FA 1GUZA 4N5MA 2VWGA 2X7HA 3VZSA 1AXGA 1C0PA 3Q9NA 1H5QA 4FOOA 4BKUA 1HDOA 1GZ6A 3F46A 4WLFA 1NWHA 4ZQEA 3W4IA 4CLRB 3OJEA 1LJ8A 3D4OA 1N8KA 5MDHA 3DZBA 3I9NA 2HMUA 3W8FA 2X0JA 5L40A 4F6CA 2Q99A 5G0WA 4B8ZA 3BTSA 4XYEA 1Q1NA 4KUHA 4BKQA 3STHA 3QW2A 3U3XA 1I32A 3V2HA 1I10A 1QLJA 4KP7A 4QUKA 2J6IA 4FR5A 4PLGA 1LUAA 4PLHA 1AUPA 2J5KA 3OQ6A 3JQ8A 3JYQA 1PL7A 3FF4A 3GN1A 2YV2A 5KVQA 3WJAA 4AJOA 3HE3A 2AEFA 2B37A 5T64A 4YR9A 5L51A 4OOEA 4L4SA 1ZMOA 5CDUA 2CVOA 3JQ9C 5F5LA 1ZEMA 1I2ZA 4L74A 1JW9B 1P0CA 3UHAA 3ZWCA 1LI4A 4J43A 4NU6A 2X6TA 1ZSNA 3F47A 3TFOA 3DBLB 1GZ3A 2C7GA 2EW8A 3X2EA 1U7TA 1ARZA 4R3WA 1ADCA 4FJ1A 1MV8A 4PG7A 2HMVA 5TIIA 1Y8RB 1YKFA 5BNTA 1ISFA 4W9NA 4GQAA 2JCYA 1KERA 3I9JA 2BFMA 1EDZA 2C2XA 4FDAA 5T5QA 1M6HA 4E4YA 5I8WA 2CSUA 1BW9A 1B14A 1DIHA 1HLDA 4MP6A 3GGGA 4S3MA 4YJHA 2NADA 4GMFA 2GN4A 3UICA 4YWJA 3WIDA 2YV3A 2JHFA 5KJEA 3P7MA 5AXBA 4BO2A 2IEBA 2D5AA 2YJZA 4HX5A 3E5MA 3CXRA 2D5CA 1JAXA 1KC3A 1GYRA 3EVTA 3QLJA 2SCUA 4PG6A 1DC6A 2QRKA 5ENDA 3ZNQA 3AUUA 2YQ4A 3R1IA 1XCBA 4DRYA 3F6YA 4UEOA 2GERA 2PR2A 4XB1A 1WDMA 3P2YA 4L75A 4RVDA 4ZN6A 5CDSA 1A27A 1P45A 4HWKA 1IE3A 1GL3A 2D59A 3JQ7B 8LDHA 4CMAA 3SLGA 2PK3A 4CUZA 5L53A 4FGSA 5JC8A 4NJMA 4FFRA 4CMIB 1WPQA 3JD4A 3GZNB 4D44A 4I08A 1YOVA 1V0JA 3A4VA 3KRTA 4DA9A 3EC7A 4HFRA 4YAIA 4HFJA 3KVOA 4P4LA 1ZK4A 3LF1A 3ZU2A 4RPKA 3SLKA 3GPDG 5BNFA 3GUCA 4XQEA 4MVJG 4XB2A 4HFNA 4WCFC 1F14A 4ALNA 1I30A 1MFZA 4XZ3A 5KVVA 3MJVA 4MVJP 3FBGA 1IYZA 3OMLA 2OBNA 4LW8A 5FI3A 4RCVA 3U62A 5C7IO 3JYPA 3TFQA 4CM5A 3KETA 1NASA 1D4FA 3WOHA 4XGNA 1UH5A 3PJFA 4YQZA 1YVEI 4YCAA 4KTTE 3RKRA 4RZHA 2GD1O 1DAPA 1O8CA 2UVDA 4UREA 4K28A 3BYZA 5C7LO 4OSOA 1U9JA 4O63O 4IQGA 1ONNA 5JO0A 1C1XA 1ML3A 1PL8A 5K0ZA 1YS4A 4Q3NA 4F3YA 5JMWA 2WSBA 4YAJA 1NXQA 1O5IA 1Y8QA 5BSFA 4IJVA 2UAGA 2BELA 3JQBC 3ZN2A 5JYEA 1PJBA 3TPCA 4BO8A 4U6QA 4XGIA 4D7AA 4Q9NA 4TRRA 3M1AA 1PS9A 3BIOA 2QX7A 4M49A 3QE3A 2B4RO 3FSRA 1W73A 4UUPA 2GPTA 4QSMA 3S55A 3UCXA 3V8BA 3VPXA 2E6UX 2ZTLA 2AE1A 4OL9A 3OQBA 4IDDA 3JSAA 1D1TA 2CD9A 2Z1NA 4KDEA 5DBFA 2ZYDA 2GZ2A 1SPXA 3F4BA 1HE4A 3FTNA 4IJWA 5JS6A 3LF2A 1SOWA 4J1QA 2O2SA 5HA5A 4H3VA 2DUWA 3WGOA 1B7GO 4XYLA 1IUKA 3S8MA 3V2GA 3EMKA 5H81A 3Q3CA 2EP5A 1MP0A 1QYVA 1LDGA 3SX2A 1H9AA 1N9GB 3FN4A 3UVEA 4RF4A 3ZWYA 3JQFC 2VCYA 4I5DA 1C0KA 1JWAB 2NSDA 2NQTA 3DBRA 4AJ4A 1E7RA 3M6IA 3E8XA 4CMCA 1M76A 4RVFA 1YB1A 5A04A 1QLHA 4LISA 3TNLA 2I9PA 5A1TA 3LDHA 3ADOA 3WJ7A 2HMTA 1WWKA 4LK3A 1GV1A 4PVDA 3ROQA 1CETA 4PLCA 1EVYA 2AA3A 4BKRA 4XJSA 4NHEA 3GHYA 3PWSA 3W4KA 4IGFA 3JD1A 3MWEB 5C3MA 4TZKA 3WBFA 4Z6KA 2E48A 2VN8A 4BKPA 1E7SA 4JQCA 1P74A 3I9LA 4CLOA 2PKQP 2QIOA 5K6AA 4BNTA 1D1SA 4M54A 5DBGA 3C85A 4JXKA 3S2GA 1NX6A 2F1KA 4P22A 2OUIA 2EGHA 2O3UA 3DMTA 2X58A 3WFIA 1MA0A 4NZ9A 1SEVA 1SZJG 1B16A 1TT7A 4MVJM 2PTGA 2DKNA 3C3XA 5G4KB 3K92A 1XWFA 3F3SA 4GL4A 4M87A 2WD7B 1Q0QA 4NBWA 3WYBA 1ZJYA 2B69A 4WCDA 2E49A 2HK9A 1ZJZA 1IL0A 4E33A 2ZJ1A 1JTVA 4RPJA 1GADO 5CEFA 2PH3A 3JYNA 2JD1A 2PLAA 1ORRA 2Y99A 2OBYA 5U1PA 4OYRA 1YB5A 3BMNB 3QWIA 3INTA 4JK3A 1B3RA 1JAYA 4P8RA 3FBTA 3KSZO 7ADHA 3WQRA 5KJ6A 3PHGA 4GVLA 1TLTA 4XYGA 4E30A 4CLEA 4FSHA 3TN7A 3BZUA 3WLEA 4A27A 4ZVVA 1WXDA 2AQKA 3AK4A 4WNIA 2PNFA 3PJGA 1BDMA 2VWPA 3L07A 1SOVA 3PIDA 3Q9UA 1VJTA 1DFHA 1KEPA 1T26A 2NTJA 2XXJA 5TC4A 3K8ZA 3PP8A 2JD2A 1EE9A 1ZSVA 1W8DA 2O3JA 2B5VA 2PZKA 5ER9A 2Q2QA 4ND4A 3C1AA 4YQYA 2ZKLA 1P1KA 1EQ2A 4OJNA 2FZEA 1U4SA 3D5TA 4CV3A 2GRAA 4J9UE 4Z0TA 3BMQB 2D4AA 4TZTA 3FNGA 2CZCA 4DIOA 1R16A 2TMGA 2CMDA 2UDPA 3ULKA 5IDWA 4UAGA 4XR9A 4YDRA 1E3IA 4IDAA 2P5UA 4I5FA 4U8GA 3NUGA 1PGJA 1LBEA 4QEDA 1T2FA 4KQWA 4LRSB 4MDHA 5LDGA 2VQ3A 1HE3A 2UUPA 3ZHBA 4WOKA 2FHSA 4BIIA 1ZW1A 4CQLA 1UXGA 4XWYA 3VDRA 3AUTA 4DIBA 4BNKA 1PQUA 4GGPA 2ZB8A 3KEQA 1V35A 3HUDA 5GY7A 3W1VA 3E9MA 4YVFA 4ALLA 4CM8B 3BMOB 4LRTB 2P91A 3PHHA 1YL5A 3AU8A 3KB6A 2X0NA 2NU6A 3D64A 3RVDA 4BNWA 5JFOA 2FPPA 1MFPA 4OXKA 1U8FO 3LT2A 4IBOA 4J3FA 5F1PA 2HSDA 3GNSA 3WLFA 5BSEA 3F1KA 5EJ2A 2DBVO 3WGYA 3GDFA 2XAAA 1H9BA 1Y5MA 1UDCA 3P19A 3HADA 3I23A 3HJAA 2DM6A 1RWBA 1QORA 3L9WA 1JA9A 1LLUA 2FZWA 1E5QA 9LDBA 3ABIA 3KM0A 3M2PA 3WMWA 2C07A 2NWQA 1XQ6A 3GNTA 5U9CA 3GDOA 4MJLA 1NR7A 4YT2A 1W0CA 3LC1O 3ZGYA 1UZNA 2EKPA 4PVCA 3TZKA 4UVEA 3M2TA 3VAZA 2DU8A 4A03A 4RDIA 3GZ4A 1OZAA 1CERA 3CMMA 2Y1CA 1IPFA 2V65A 4OXNA 4DBZA 5JAZA 3HB5X 4KTVE 2W2KB 4BO9A 1V9LA 1YB4A 3L4SO 3UXYA 4BNLA 4ZGWA 4NFHA 1FMCA 3H4VA 4XRRA 5DNAA 5F21A 4XJTA 1PJ4A 3OF2A 2Y0EA 4PLTA 4K1LA 5LDHA 2VYND 1T25A 3FNFA 3F5QA 1UXJA 5EMHA 5AXDA 2EWMA 2G0TA 1HDZA 2Q1UA 4RV9A 3ONDA 5TJHA 2B5WA 1XIVA 2P9CA 3NDRA 1R66A 2QQ5A 2I3GA 2VUSA 1CJCA 3GPIA 4ONEA 1OBFO 2P4HX 4CMGA 3OJFA 2DTDA 2V6MA 4CMJA 4BO5A 5HS4A 4UUOA 1T24A 3GAFA 4CL3A 2VRBA 4BKOA 3O4RA 3C1TA 2H5LA 4M8SA 3JQGA 2YHIA 3WBBA 1V3VA 4U0KA 1CDOA 1KS9A 4PLVA 1HKUA 3C7CB 6LDHA 1ENOA 2HJRA 2RH8A 3V1YA 5KJ1A 2D2IA 2QHXA 4MP8A 1PQPA 2DQ4A 2FR0A 1YBVA 3OEYA 1M67A 5JDCC 1XA0A 4WNCA 1O9BA 3MJTA 3GK3A 3H5RA 1D7OA 3D7LA 1YJ8A 1ADGA 2X0IA 2Y1GA 3H9EO 4JJIA 4EYEA 5TGDA 3JQAA 1IZ9A 4WPGA 1M66A 4BNYA 4EUHA 4YT8A 1DSSG 3H9JA 2QG4A 3RIHA 2ZCVA 5CPBA 3NT5A 3IKTA 1KBZA 1R0SA 4R1TA 1PJTA 4XDYA 1LQUA 1HXHA 1RYDA 2NUAA 4G5HA 1DDOA 4J7CA 4MPDA 4XGKA 4B4OA 1FJHA 2IODA 4IDBA 1P3DA 3H5AA 1QR6A 2X23A 4CQMA 4EITA 4QXMA 2JAPA 3WB9A 1DIBA 3TZQA 3EW7A 3MTJA 3T7CA 4M89A 2EKQA 5THKA 2EP7A 3RUHA 4XIJA 1Q7BA 2DBQA 4WJZA 4I9HA 4G2NA 5JSFA 4KDFA 1ISGA 5FEUA 1LSOA 4EBFA 4PGFA 2OZPA 4FS3A 2P9GA 2PD4A 1ISMA 1PR3A 5FFFA 1GUYA 4CM4B 1UDBA 4K6FA 4RGBA 2EERA 1JVSA 4J1SA 2R00C 3GRKA 2X5JO 3ZNPA 5B4VA 6ADHA 4UEKA 2CF6A 1X0VA 4L73A 5DBIA 3CSDA 3D3EA 4K9DA 3LC7O 1HTBA 2C59A 4D3DA 2GYYA 1BXGB 1PIWA 4AJ2A 4DUPA 3GAZA 5IXSA 3OM9A 3AM5A 3QP9A 1K89A 1JN0A 1R15A 2EGGA 3QVTA 1Y9AA 4IJUA 3SC4A 2GR9A 1RM3A 3PQFA 4MINA 1PZEA 3CZMA 4KUGA 1IZ0A 4WLNA 1I01A 2WMDA 3DAPA 1WDKA 5C5IA 1U3UA 3LC2O 1NTOA 3AUSA 1OOEA 3AY3A 3GVCA 2BF7A 2XXBA 1NQAO 3ZH2A 3RBZA 3SJUA 4E5MA 3IP1A 4IGEA 1OMOA 3L6EA 4DPLA 4P4NA 3RSHA 2DBZA 4L8VA 4E32A 3CTMA 3PYMA 3U5TA 4IDCA 1VPDA 2HMSA 1VM6A 2VHZA 4YJFB 4MO2A 2Y05A 4NBVA 2GCGA 1DC4A 4NDNE 3RJ5A 3INGA 3GEGA 3OA0A 5HRUA 4YT5A 1QKIA 2VTDA 3MOIA 5L95A 4A0SA 1LDBA 2YUTA 3DONA 1JKIA 1MC5A 4OMUA 1SEPA 3PK0A 1R4MB 2NLOA 4HFMA 2PGDA 4RF5A 2Y0DA 1BVRA 4YBZA 1P77A 4XIYA 2NU9A 3SBOA 1A71A 1UZLA 2EIHA 1ADFA 4L76A 4ZA2A 4J49A 3H9QA 3DOJA 5G0SA 4CV2A 2EKLA 5L7WA 2VHVA 3DB2A 1GQYA 1T1SA 4YJGB 2NTVA 1WNTA 3TSCA 3MJEA 3K5PA 3CIFA 2GN9A 4MKRA 3VTZA 1MX3A 2VOEA 1KYQA 4INAA 1YO6A 4RVHA 3KYCB 3H5NA 2C54A 2BI7A 1HDYA 3NAQA 3EZYA 1GCOA 2WE8A 1H93A 1R6DA 1YXMA 3JD2A 3HDYA 4BO1A 4GX5A 1YDWA 4Y67A 2HK8A 2NNLD 1PGNA 1P1FA 4J2HA 1ZFNA 4BVAA 4WUVA 3OIFA 5AYVA 3ZWXA 3UN1A 4UULA 1HZJA 3KSDO 3PLNA 1A7AA 3QVXA 1B26A 5CPFA 2V6FA 3IIEA 4YPOA 1U8XX 3RFVA 4I1IA 3RUIA 1KC1A 3C24A 3ON5A 1X7HA 2O48X 3E5RA 3HDJA 4J4TA 4AICA 4WCFB 3K2EA 4DWVA 1UP4A 4J91A 3PQDA 3QRWA 1A7KA 2AG5A 3JQEA 1I2CA 3AFNA 1Y81A 3QY9A 1KVUA 3CEAA 1VL0A 5DULA 1U3VA 1QRRA 3WMXA 4DLLA 2PFGA 4E31A 3VH2A 2OP0A 1LU9A 3ZNOA 1B8VA 4PG8A 3IDSA 1U3TA 1TB4A 4AFNA 5H83A 1Y1PA 4WOJA 5L9AA 2VT2A 2O50A 2UUOA 1K5HA 4R01A 4EUFA 5L4LA 1LDNA 1Z74A 3MJCA 2I67A 4JP2A 4KUEA 5KNLA 4JCOA 1G0NA 1NPTO 3I3OA 5JY1A 1JKJA 1YQGA 1GDHA 3BHMA 3ASUA 2DPGA 3ZWVA 1EVJA 2ET6A 3MJ4A 3H3JA 3RFXA 2IZZA 1AHIA 1N1EA 3W8EA 4IS2A 4B79A 1H2HA 1XELA 3G3EA 4AJJA 3JD0A 3S1LA 4CV1A 5CDYA 1AN9A 3W4JA 5JYDA 1SNYA 3AI1A 2YDXA 3D0OA 1IOLA 3I83A 4FD3A 4EUEA 1NR1A 3D3WA 1K6JA 4MKZA 5BT9A 2ZIZA 3ZU5A 3DEYX 4LSWA 3ZWWA 3PRJA 2Q2WA 5G0UA 1NBOA 4XRGA 1DIAA 3B70A 4IXWA 3Q6IA 1XGKA 3AY6A 1A72A 1E6WA 1Z75A 2ZYAA 1WLYA 2W2LD 1I2BA 4U0JA 4OAQA 5LC1A 4Z0HO 1VJ1A 4E5PA 2P5YA 4MIEA 2J3JA 1L1FA 1ZK0A 2PGLA 1P33A 3D4NA 3MCVA 3QVWA 3PI7A 5KJCA 3GHHA 4QX6A 3KYDA 4E3ZA 1DFIA 1U5CA 3G17A 3WQSB 4RVSA 2D8AA 3DO5A 5COBA 3RU9A 5IDXA 3VH3A 2VHXA 1LSJA 2R2GA 3HQ4O 3OQ1A 3PGJA 1PGPA 3GVIA 3VC7A 4CM7A 4ND3A 3GRPA 4XQCA 5I7SA 3JQDA 5BR7A 1E3EA 1B8PA 1DBVO 1ENPA 5TT0A 2AW5A 4GAEA 3WSVA 4BO7A 3L77A 1P1IA 3RUDA 2EHDA 4GWKA 5KKAA 4NR0A 4FFNA 1P31A 3UGKA 1R0LA 3TZ6A 3H6KA 2GLXA 4GX1A 4TMFA 1E3JA 1UR5A 2FSVA 2C82A 4CR8A 2V6BA 4D3SA 4TWRA 4E21A 4KZPA 4R51A 1PWZA 5DP2A 2B35A 1LDMA 3GC6A 5CP8A 4CODB 3EUWA 5JC1A 1ZNQO 1ONOA 5IG2A 1DFGA 2AEJA 5JE8A 1IHYA 4CL8A 2NQ8A 4PG4A 2HCTA 2AG8A 1UP7A 1T2CA 2JL1A 1E7WA 5G0TA 1NAIA 1I3MA 3NT4A 3GMDA 3PZRA 3T4EA 1E5LA 1QYWA 1HE5A 3PXXA 2DBRA 3PJDA 1PJQA 4QO7A 1J6UA 3PHJA 4DLBA 3IKVA 3T4XA 4JJFA 3RUEA 2O23A 3MOGA 4JLWA 3U4DA 2C5AA 4G81A 2GN6A 4MP3A 2GUGA 2GASA 4GX0A 2VRCD 4IDFA 3UAGA 2X1HA 4CM6A 2H63A 5BQFA 2HK7A 3VZQA 4E5KA 2B4TO 3O8QA 2VZ0A 3B1FA 1TEHA 4JGBA 2NU8A 2O4CA 1EQUA 1CYDA 5T6BA 1T2EA 2D0IA 5K6AC 5EINA 1H0KA 1WMAA 2O3QA 2VHWA 2W98A 1DRWA 4FPXA 3RROA 4GSKA 4E5YA 1A9YA 1NVGA 2OGUA 2X5OA 3DZKA 1E3WA 2X8LA 5T57A 4CMEA 3A28A 1ZZEA 2OFPA 3DMTC 2Q1SA 3JQ6A 3UFXA 2ILTA 2BFAA 3SEFA 2LDXA 2W8ZA 4DXHA 5I9LA 4IY1A 5DZSA 2HO5A 3NRCA 2PKQO 3B6ZA 1EUCA 5JCJA 2BI8A 2ZB4A 1TT5B 5JW6A 2PZMA 4BNIA 1ZXBA 2GSDA 2G82A 3L9XA 3DZHA 3CUKA 3WYCA 3GG9A 2J3KA 4Y98A 4CUJA 2HDHA 4LCJA 1LC0A 1R0KA 3QHAA 1LQTA 2AQIA 4R16A 2I6TA 3GF4A 3TJRA 1HYEA 5KVCA 1CRWG 1S7CA 4CLRA 3COSA 1EE2A 3L6DA 5AQ1A 1I24A 1CQJA 4RO0A 2DFDA 3H9GA 4N5NA 1G0OA 1SB8A 1EVIA 1N2SA 4MIYA 3RC1A 1YJQA 3QV1A 5IF3A 4ILKA 5JDIA 3ETEA 3QVOA 4ESOA 4ZHSA 5GZ6A 3ZHYA 2QYTA 2VHYA 1EFKA 1XDWA 5BNIA 3N7UA 1ZUD1 2CDAA 3E18A 4CPDA 1X15A 2J3HA 4IM7A 4ZJUA 4J7UA 4R54A 1T2AA 2Y66A 3ZWOA 4A73A 2HRZA 1WW8A 1CF2O 1LTHR 4D46A 4A26A 1Z7EA 4J7XA 4NBRA 3FTPA 4R1SA 1W4ZA 1Z7BA 4XA8A 1ZVMA 4AVYA 5KOIA 3DR3A 1XSEA 3P2OA 4M55A 2OO5A 1D3AA 4AL4A 3DBLA 3SC6A 1BSVA 1XU7A 5DT9A 2BGKA 1ZBQA 2Q4BA 3IUSA 3PHIA 4M86A 3ZHXA 3AM3A 4S1VA 2JFHA 4NH4A 2QW8A 3T7EA 1OAAA 3JYLA 4IINA 3F5SA 1Y8RA 4DBVO 2E4AA 3DDNA 3EDMA 2WYWA 2RAFA 2PY6A 3HFGA 4B7CA 4IDGA 1I3LA 3ANLA 4XD2A 4BMNA 4UVHA 3GT0A 2FN7A 2VNSA 3CE6A 4R41A 3GGPA 1GFSA 4OQZA 1P9LA 3BMCB 2VUTA 4PLYA 4CJXA 2O3SA 2A35A 3LZ6A 2NVUB 1V8BA 2JFGA 3C7DB 4QQRA 3RAJA 3ORFA 1OI7A 3QVSA 4D0RA 4Z3KA 3A14A 2YV1A 1KOLA 3V1TC 5JAIA 5L45A 1LX6A 1AE1A 2IEDA 2RHCA 3IL2A 1X14A 3VVBA 4I5GA 1HYHA 4Q3CA 3U4CA 3Q2IA 4GLLA 3BAZA 1BG6A 4CLXA 3IAHA 3I9MA 4E13A 4IIUA 4AJIA 1UDAA 4N7RA 4YACA 4NFYA 3VDQA 3EK2A 5CDGA 1BTOA 2CY0A 3NTQA 1R4NB 5A9SB 1WDLA 1OFGA 3JQ7A 2EW2A 2B83A 5T67A 4BOYA 1GQ2A 2PKRA 3VPSA 3CINA 1DIRA 4CMIA 3WGGA 1WAMA 1UXHA 3GZNA 4RQTA 5TS3A 1QSGA 1PEDA 3RCBA 4YA6A 5HTOA 4IQ0A 3PFWO 1C0LA 2I66A 2I65A 4KMSA 4AJHA 4EJ0A 2JFFA 4KWIA 1GQQA 2RBEA 2OP1A 2OXIA 4E5NA 1VLLA 4DYVA 3E1KA 3F9IA 4MVJA 3GR6A 2P68A 2J3IA 1HETA 1HWYA 2J5QA 2Z5LA 2HAEA 5THQA 4A2CA 2AQHA 4L4XA 3PTZA 2IXAA 2QZZA 3D4PA 1C1DB 4BO0A 2XPCA 3MEQA 4RF3A 2G17A 3ICCA 3AM4A 1UUFA 1LRLA 1XHLA 4FFPA 1XG5A 2WE7A 5CEJA 4CM9A 1Y5RA 2FPIA 3KSUA 4RLSA 3I9OA 4UVGA 1LC3A 3OBBA 4O1MA 1QV7A 1SBYA 4E2YA 1P1HA 4JNKA 4WEQA 4Z0PA 3E03A 3W6ZA 2IZ0A 3LT4A 4K6CA 1WP4A 4O0LA 2ZATA 3UCFA 2YW9A 4B4WA 2A9FA 3S2FA 3RASA 2PGJA 2DLDA 2X9VA 1PGOA 2Y93A 4L0QA 1VJ0A 4Y6RA 3BA1A 5K9ZA 3WSWA 1QYDA 2NACA 5TQVA 4BGIA 4UVDA 5I9MA 3ZHZA 3PLRA 1RM4A 2VUUA 3RQSA 1GEEA 5L7TA 2CDCA 5TRTA 1LRKA 4Z3DA 4RPHA 3FPCA 3OFSA 1E1NA 3JYOA 4GPD1 3RBXA 4OKIA 2FR1A 2E82A 4PZEA 1ISJA 4R5MA 3N74A 4FFLA 3PDJA 1N1GA 3EZLA 1LLDA 3O38A 1CQIA 1E0DA 1MC4A 1NVTA 3E9NA 3IJPA 1GEGA 4FB5A 3DHEA 3E82A 1I0ZA 4CMBA 2ZYGA 9LDTA 1DC3A 2O2YA 4BNFA 1JDJA 3PJEA 1SC6A 3ITKA 3VPHA 3WGZA 2PZJA 4BQRA 1K6IA 3DZFA 3ROPA 3TDKA 3FCOA 3ZWPA 1N9GA 4PLPA 2Q1TA 3ZW9A 5DCYA 2RIRA 1JKFA 5JAQA 3WNVA 1HRDA 2DFVA 4J2OA 5COAA 2BLLA 1B2LA 3JQ8B 4FN4A 4AG3A 4TKMA 3GVPA 5EIOA 5C37A 4E2ZA 2DC1A 2YDYA 2X86A 3ONFA 5B4UA 1E1KA 1KVRA 1F06A 1GY8A 4IXTA 4OSPA 2J5RA 2ZQZA 1I33A 5JLAA 4DQVA 2WM3A 2OL4A 2VZ9A 1ZSYA 1HDCA 1ZO8A 2C0CA 4F45A 1BDBA 5FWNA 3VH4A 4KOAA 3A06A 1XR3A 4OIMA 3PDUA 5CEEA 2Y1OA 1I3NA 2W90A 4II2A 3ZV6A 4JN6B 2IXBA 4RPGA 2CNBA 3DMYA 1YQXA 1YBMA 5EQFA 3PYXA 5GZ3A 3AWDA 4HUJA 4JIGA 5B37A 1EMDA 4R3NA 3H65A 3DOOA 3CH6A 4RLHA 5JXWA 3AJRA 5A06A 3I4FA 2GZ1A 1NFRA 4MKXA 4JP3A 4YRDA 4NK5A 3FNEA 3LQFA 4I9NA 1BW9B 5EESA 4PLFA 1K6XA 4CM1A 4AJEA 1QP8A 1MGOA 4YJHB 5G4KA 1ZCJA 4N5LA 5KKCA 4XCVA 2WD7A 4W4TA 2B0JA 2WEKA 2X0RA 4J6FA 3S2EA 3PEFA 3IMFA 5TNXA 3TQHA 2CF5A 3U4HA 3WXBA 4BNMA 4ALJA 3O03A 3HZZA 4FJ0A 5IZCA 2JJYA 3R0IA 5AXCA 1YL7A 3KUXA 1BXKA 4ND1A 4RF2A 4QFCA 1YDEA 4GMGA 1PSDA 3BMNA 4D43A 5ADHA 2EV9A 2O3RA 2PD6A 1UXIA 5L4NA 2GN8A 3PZBA 2AEMA 2VWQA 2VNAA 5B4TA 4BHTA 3LLSA 4EEZA 3CMCO 2WYUA 4DC0A 1NM5A 4OGWA 3V1UA 1KY4A 5AOVA 2UV8A 3RI3A 3GY0A 3W8DA 3ZV5A 4XX0A 1YRLA 1DLIA 2H1SA 3X2FA 1EUZA 3VTFA 4BMVA 4MVJE 4D41A 1BGVA 2R6JA 3AI3A 2C20A 4AJNA 4RJTA 4ID9A 2DPHA 4NJMB 1ZEJA 3FWNA 2YY7A 4ZQGA 2GNAA 1O95A 1X0XA 2HJSA 2CFCA 4NBTA 3I9KA 5JBIA 1O0SA 1MXFA 2ZTVA 3IQDB 3HDHA 3IP3A 2BGMA 2NU7A 4WASA 3BMQA 1LSUA 4MIOA 3EY4A 2ZB3A 2C7VA 4H16A 1F17A 3ENKA 1NYTA 3GOHA 1FXSA 4D0SA 4NFSA 5JAMA 3L0DA 4ALIA 4O6VA 2Q2VA 4QTZA 2W2LA 4ND2A 5TX7A 4XQGA 3S2IA 4BV9A 5A03A 4OKNA 2CDBA 5IDYA 1VRWA 5TF4A 1PJ2A 3HG7A 4IMPA 4DLAA 1RKXA 4MVJF 1LA2A 4PLWA 1DAOA 1GR0A 1HF3A 5L7YA 3LVFO 2W4QA 1EUDA 2IYPA 1ISHA 3KLPX 1DEHA 3Q2KA 1ZK3A 3ZCXA 1HL3A 3I6QA 2BRUA 4CM8A 3BMOA 3Q0EA 4YYZA 3LT1A 2EXXA 1KVTA 1GZ4A 3GMSA 3NJ4A 2FR8A 1T4BA 3KZVA 3I4CA 4R69A 1A4IA 3LK7A 1C1XB 4R1NA 3VHRA 4C7KA 5U4QA 3K73O 1OC2A 2D1YA 4WE3A 3C7AA 3TZHA 3DFZA 3IC5A 3QIVA 1ENZA 3RJ9A 1VSUA 1Y8QB 2FMUA 4B7UA 3WDSA 1HE2A 5ICMA 2Z1MA 5H82A 3A9WA 3JD3A 4DQUA 4C4OA 5I7VA 2HMWA 1X7GA 5IDQA 1HDRA 2Y1EA 1L7DA 3OJOA 4WLVA 1H6AA 4GKBA 1J4AA 1PJSA 3N58A 4B3IA 4GSLA 1J5PA 2VYVD 1E77A 1I8TA 3DAFA 4XKJA 4EJ6A 2BH9A 2V7PA 4WKGA 3PQEA 4BNJA 5MGBA 2VWHA 1EEHA 1Q2XA 3GGOA 3PFFA 3DXFA 1HYGA 2W2KA 1H2BA 4EJMA 1U4OA 4OQYA 4BUCA 3ETGA 2YFQA 2BFOA 2G5CA 1MLDA 5JO9A 3QJ5A 4C7JA 4EZBA 1Z45A 1Y7TA 1KVQA 2I99A 2FWMX 4FIZA 3V2UA 3M1LA 1F12A 1GD1O 2AQ8A 3GFBA 1RYEA 5CAEA 1DPGA 5ENVA 4YRBA 4PLZA 1UAGA 5FYDA 2IYOA 1NPDA 3DHNA 5EPOA 2X9GA 5CHEA 4BNNA 4BV8A 2VRCA 3ETDA 1AXEA 4GH5A 1BHSA 4F6LA 3U49A 1JU9A 1HDGO 1RJWA 2FY8A 1E6EA 3Q1LA 1NQTA 3DBRB 1ZMTA 1H6CA 3WG9A 4DYDA 1NAHA 4IPTA 2I5PO 3B1KA 5IJZA 3GDGA 4CQMD 4W99A 2GGSA 4J90A 3GVHA 3OIGA 4F46A 4CR7A 4FFOA 4JX8A 2O3TA 2AMFA 1NPYA 1YQDA 3JTMA 4ZICA 1FDUA 4Q39A 4J0EA 3OHSX 1NFQA 3EAGA 4PN3A 2BHLA 2HKIA 4N54A 2WJPA 3UF0A 1BXZA 5KCZA 5JMPA 1E6UA 1BWSA 3ZWNA 3MJSA 2DTXA 4A7PA 3FD8A 4Q3DA 1QV6A 3P5SA 4ND5A 4QFDA 1U3WA 3I5MA 1Y6JA 3DC2A 4IDEA 1HEUA 4K26A 1N5DA 4IS3A 1M6WA 4R5HA 1BRMA 4UEJA 2YFHA 4CLOB 3ONEA 4JBHA 5DCUA 4ALKA 1O94A 4IZIA 4PIVA 4CMHA 1A4UA 2AXQA 1ZIDA 3DZGA 3O26A 1M2WA 3A1NA 3PWKA 4WK6A 4PRLA 4PZDA 3CPSA 4D45A 3WR5A 3JQCA 4ZRMA 1M75A 5CG1A 4DQXA 5I7EA 2RHRA 2TMDA 4MOWA 2BKAA 1AGNA 1KETA 1KY5A 3RU7A 4BGVA 4CMKA 3KLMX 1ADBA 1GAEO 4RPLA 1F0YA 3WQQA 1PZFA 4GWGA 4L4RA 4DL9A 1DHRA 4NPCA 2AE2A 4XYBA 1DIGA 1PJCA 5ITVA 5I7FA 1E7YA 4UUMA 3L4BC 1N92A 3TZCA 5DF1A 4FC7A 1CWUA 2C29D 2IZ1A 4WLOA 5GMOA 4BNXA 4CM4A 4W7IA 5GZ1A 3V5NA 1X1TA 1GUFA 1JVBA 1ONPA 4BQPA 2ZK7A 3ST7A 4LCEA 4KWHA 1XKQA 1F8GA 2FP4A 2G76A 4W82A 4BNGA 1W6UA 4EI2A 1BXGA 1LLCA 2D3TA 4CMEC 1G6KA 2X4GA 5F1OA 1PGQA 1BVUA 3RC7A 3UCEA 5EL0A 5KVSA 4WLEA 3O9ZA 4YT4A 4GLOA 2V6GA 4J1TA 1GYQA 4PZCA 3JQ9A 1MG0A 4BB6A 4H15A 3WWZA 1Y9EA 5IFLA 3B1JA 4ALMA 5AVOA 5TT1A 1L7EA 4DPMA 4NG5A 4TVOA 4FBGA 3VPGA 1QYXA 4HADA 4E2XA 1H6DA 4IQ8A 2PH5A 1NHGA 4E6PA 4DPKA 1T2DA 1VSVA 3G79A 2DVMA 5B12A 3H8VA 4B4VA 1UP6A 1EVZA 4JBIA 4PG5A 4U6SA 1H94A 1NP3A 4P38A 4YAKA 1HT0A 3DBHB 3ZU3A 1X7DA 4CQLB 5JDIC 4LGVA 4OOFA 4YJFA 4IIVA 2YHUA 2FPGA 3KXDA 2OOSA 4TRNA 2P9EA 1Q7CA 2EF1A 3LYLA 4FFMA 3NTRA 4RVGA 3R6DA 3WS7A 1ID1A 4BO4A 3DZIA 4TRMA 4R9SA 3FPLA 4N18A 5T8KC 4ZU3A 4BS9A 3QWBA 2P2SA 3HWRA 3L4BA 3ANMA 5TLSA 1R4MA 3MTGA 3INRA 2ZJ0A 4EW6A 3HN2A 1J49A 1MB4A 1MUUA 1YONA 2DAPA 3D1LA 3JV7A 2Q49A 1J0XO 3KOUA 3QWFA 3VZPA 1XQ1A 4IMRA 3ZWAA 1K3TA 1FF9A 1CIVA 4YXFA 4YJGA 3K9QO 5BSHA 4RQUA 4HNHA 3TF5A 4DTIA 4YTEA 3VOSA 3AOGA 4WGGA 1GCUA 1HLPA 4FJ2A 4H7PA 3WTBA 2HU2A 3NT2A 4PCVA 5IZ4A 1DJQA 3AW9A 3KYCA 4NIMA 3RUAA 3ZZNA 3K96A 3E48A 3CKYA 1LXCA 4RVUA 1KVSA 3WNQA 1U5AA 5TJ9A 5CG2A 5G2OA 2JCXA 1LEHA 3ZV3A 2VOJA 4LN1A 3NDIA 1B8UA 3ENNA 4QECA 4MVJH 1T1RA 1GTMA 1B3BA 2XF8A 2JCVA 1FDTA 3G1TA 3PYLA 4YAEA 4BNZA 3PPIA 2ZCUA 2AHRA 1QMGA 1WZIA 4R9RA 3I6IA 3OIDA 4NK4A 3IJRA 4E0BA 1E1LA 5DCWA 3VPFA 3RKUA 3ANNA 1E3SA 5EQDA 1EK6A 1V3UA 1ZKMA 2C2YA 4WCFA 1XYGA 2POQX 3KEOA 4R4JA 2EJWA 2YYYA 3IUPA 1WMBA 1FDWA 1KEUA 3SXPA 1PR9A 3FNHA 1DC5A 3GA0A 3JQGB 2YHIB 4Z9XA 2ZQYA 5T8KA 3UUWA 5JY6A 4BGUA 3U09A 5HBRA 2P4QA 4FQ8A 5A4DA 1DRUA 1I36A 2EJVA 4FW8A 2WTBA 4PFJA 1C0IA 4J9VA 3NTOA 2H6EA 3WWYA 1VKOA 1DXYA 3ZNNA 1D8AA 3NKLA 5A5FA 2VT3A 3WGHA 1C14A 1VL6A 1MG5A 2H9IA 2HRBA 3L6OO 3GNQA 3JQAB 2VYNA 4J0FA 3JQBA 2JD0A 2A4KA 3KBOA 3NYWA 5FF9A 4B4UA 2JHGA 5KJFA 4U5QA 5ILGA 1GPDG 3ZWMA 5KWEA 3E9QA 3TOZA 2ZTMA 4I8XA 5JCXA 2QRJA 3OJLA 3GEDA 3DHYA 4TQGA 3TOXA 3U9LA 4CQMB 4D79A 1UAYA 1X1EA 3KHUA 3TWOA 3ZI0A 2CVZA 2IDZA 1SCUA 5DDIP 1G1AA 4XEHA 4U7WA 2HQ1A 3GFGA 4BO6A 1LDYA 4RZIA 1B15A 2QRLA 4NJOA 5COQA 2QZ9A 1OC4A 3BTVA 1UXKA 1V3TA 3ADPA 1IULA 1NVMB 2FRDA 5JNLA 1IB6A 4Y9DA 3DTTA 3OA2A 5TSDA 1Z6ZA 1EBUA 3TL2A 4II3A 1PTJA 4O5OA 5I9NA 1F8FA 3LSYA 2Q46A 1VE9A 4LVCA 3GLQA 1LRJA 2YQ5A 1E7MA 1A9ZA 3IS3A 4QO8A 3DFUA 1DJNA 2EG9A 4P4GA 2B4QA 1C3VA 1U1IA 4O59O 1QYCA 3DQPA 1KEVA 1RPNA 3FHLA 3JQFA 1E92A 2LDBA 1YH3A 3LT0A 3EGOA 3WFJA 2PD3A 3HN7A 2GO1A 3DWFA 1TVEA 4BNVA 4IJKA 3OEWA
chains in the Genus database with same CATH superfamily
2I2BA 1BC5A 1ESEA 2LV8A 2JANA 2DWOA 3GGJA 4HZIA 3T5DA 1E4EA 3BXZA 4MGEA 2W0SA 1QIGA 4YXWD 4QD3A 3SX0A 3A6ZA 2NUPA 4XWAA 3G49A 2XH8A 1H42A 3SBDA 4MEBA 821PA 1US8A 4C87A 3HGQA 1CT9A 4B7XA 2EW1A 1KO7A 3V00A 5AW9A 3PKIA 3UV6A 3WA7A 1ETUA 1JPJA 4LNAA 1N4AA 3FOFC 1ACLA 1HNXB 4K2AA 1U2RA 4R68A 5REQB 3OEHA 3RS5A 1EFVB 4PO9A 3TYXA 3MZ0A 5LOVF 2BSAA 2O2ZA 2QN8A 3D5QA 4BLVA 4XE5A 2XODA 5MN5A 1KKMA 1RKVA 1RLOA 1KHHA 2VDVE 2JJ2A 2QVXX 3IMKA 2GDZA 1T3LA 1Z7WA 1V5IA 4N9WA 5ALMA 2QTMA 3HZHA 4GX2A 2R7AA 2PLRA 4GPZA 5DOVA 2NP6A 1JYEA 3B20A 1R64A 3L0SA 3MWJA 2XTJA 4JLSA 5FOXA 5ABPA 1EH5A 2J0VA 2RK3A 1HOTA 5HE8A 5FWYA 5G4LA 3F67A 4YJDA 4RIGA 8GPBA 5AJYA 3IT2A 5LP6A 4MEJA 2QBYB 3K32A 3C3BA 2UYOA 1O0BA 2JZOA 1O9HA 3IV7A 4LECA 2ISQA 1WHSA 5DRYA 2OPHA 4JASB 1SXHA 2G1UA 3DTYA 4LQLA 1FDRA 4MR9B 1Q0HA 3E84A 3E7XA 3ZWBA 5DN9A 2O14A 3W3ZB 1DX9A 1ATZA 3IVGA 4UD6A 4OUKX 3SZOA 1RZUA 3KQPA 4B80A 5JUWA 4CEIA 1PV1A 1QO0A 2UXBB 2ZSEA 1EAMA 5DNCA 1XCGB 1W44A 1JAIA 2HRQA 4Y9SA 1QOQB 5DNEA 2VG8A 1G3UA 3BAFA 1L1EA 3FH0A 4OHBA 1P62B 2WJ3A 1EDOA 3AFMA 4LY0A 1T0IA 1T15A 4IZHA 2XEXA 3LP8A 4DIFA 3ZDFA 3D8UA 2F3SA 2HLNA 4DLSA 3QSYA 1E2LA 3GH3A 1J5EB 1B23P 3PX7A 1TXGA 3KPVA 3EWSA 3TLXA 1WZEA 3OT1A 1GFIA 2FFBA 4YC7A 4L4ZA 5K99A 4JA0A 2QN7A 4PAGA 1F20A 3S3TA 1NQ5A 3NOQA 3RWBA 4LMPA 1QG6A 2X76A 1RXWA 2ZRPA 1WCYA 5FOTA 2LXNA 3SE7A 5JAOA 2Y67A 1ZK1A 2XUAA 3C8MA 1LDEA 4B6RA 1EFLA 1XU9A 4XPIA 4IIBA 1CZUA 2AG6A 3NEPX 2DERA 3AL0C 1NFFA 2A94A 1THGA 5K09A 4MB2A 3KV3O 3WRYA 1AQLA 2P9TA 4NV3A 4M6WB 3VC1A 2IUFA 3QVMA 4UKDA 4X6UA 3PUIA 3FRJA 5CMLA 2ZW9A 5TGTA 2XWSA 2A9QA 2IOFA 3HKBA 5D6OA 4HKTA 2C7BA 1OUMA 1IEXA 5IN4A 1KJ9A 4BMSA 1IXKA 5JNVA 2LUOA 2QD4A 3I58A 3VHQA 1E2IA 2P90A 1Z63A 4NPHA 2IYRA 2ZAOA 4UM8B 3IBSA 2HB6A 2R7KA 3ND7A 3RGWS 2MYUA 3SAJA 2BZ0A 2BEUB 1L4KA 3VPBA 4RIEA 3MUNA 5UKDA 2IHNA 2FVXA 1Y42X 2WINI 1V8OA 3PFBA 4RE6A 1J2JA 4GUDA 5C7OO 3ZE7A 1P9NA 1QZZA 1OKKA 3EHEA 4Y1RA 3HXKA 5IHXA 3KJFA 5IHPA 3EUAA 4IQ4A 8ADHA 5GIPE 2F43A 1Y9JA 4JFRA 1AMUA 3KQSA 3OZVA 5DHFA 1C0EA 3TMAA 1TEXA 4UBNA 4OI0A 2RK6A 3WTCA 3FA2A 1UXOA 3CUSA 3CX8A 4NCHA 4PC1A 1IUPA 2P1ZA 3I73A 2E5WA 5YASA 4X8MA 3IHTA 4CV0A 4CIYA 1G2OA 2NT3A 2Q4EA 3DQQA 3MGGA 1VP9A 1O6ZA 1XKTA 4J4BA 4TVBA 2BF4A 1JKJB 1KOJA 1GL7A 1JIKA 1MJGM 1MIOB 3ASVA 2HDOA 1E6CA 2ZTUA 2B34A 4OATA 2AYZA 2G72A 3QNMA 2XUZA 1MX9A 3MTBA 1I3KA 4LVUA 2JI8A 1FVHA 4MQ4A 3CZRA 2MSLA 3ILXA 4HY3A 5DN6D 5I47A 5CDTA 3D59A 2CNLA 3LX6A 4A10A 3T61A 1YGYA 1FNNA 1YUBA 1OBVA 3LU1A 3IP8A 3K30A 2FGKA 4FGWA 1XEWX 3FETA 1ZK2A 5ES3A 1FK8A 1NW3A 2GX6A 2FVYA 3CRVA 3CO0S 5ER6A 4TXLA 5AH0A 1U98A 3HB4X 4B85A 3D3WB 1E69A 4RYDA 3E6AA 4HN9A 4L2IA 2WDZA 4EY5A 1HMYA 1RHUA 1W7AA 5IYZF 3DC7A 2AXPA 3Q7EA 3Q0TA 4GVXA 1QH8B 4KH1A 1JMKC 3I5YA 2GILA 3FPGA 3DLCA 1XWIA 1DINA 3R3SA 4L27A 4HNSA 1VJDA 4AO7A 3OT5A 3OLWA 4J16A 1YZNA 1PD1A 1C3OA 1BXRA 4D8XA 1GCAA 4PAWA 3WICA 4C4TA 5J23A 4IF6A 4ZP1A 1A1VA 1BEZA 1ZJ6A 1ZM4A 3BTUA 3RTCA 2I80A 2P62A 3V4SA 1PO7A 4E2WA 1E5TA 2IT1A 1NHWA 1FMJA 2ECKA 3B3AA 2J7PA 2D62A 2OBLA 3PEUA 1JXMA 3TNDA 2FKNA 1HT3A 4HB0A 3X1ZA 4NMHA 1FYEA 4C89A 3WK5A 2F1RA 1WCV1 1KDPA 2J45A 2RAPA 5B1YA 3OE4A 3PIIA 3VJRA 1KU6A 5EJ9A 4C6SA 3PGXA 1PDVA 1QXSA 3RUFA 3EN0A 1W96A 1UKEA 1F2DA 4LJAA 4NRDA 4CIAA 5KI6A 2XUIA 3OCXA 4CM3A 1YOVB 1FDOA 5IJ9A 5FA6A 4CM9D 1WUTA 5A3JA 1KYWA 1R4NA 1PQWA 1U2DA 2B8TA 4CL0A 1X7XA 2BFPA 2OV8A 2VP6A 1RRPA 4M1QA 5LQCA 5D3ZA 2FSFA 4YCNA 3VSCA 5JPIA 1S8NA 3C1OA 5ALTA 4B75A 2DPMA 1JHOA 2FEWB 1I1OA 1G2PA 1Q92A 1DADA 1HSZA 1U8CB 2CWDA 4IUDS 5DI3B 5IT9A 1VLJA 1CY7A 4MLCA 3R3JA 1FTQA 3QEOA 2DX7A 4HDSA 4U63A 4UM7A 5AJTA 4DDHA 1OI4A 4JHXA 3EGXA 2OORA 3ZV4A 1G8FA 4X5OA 1S3SA 2PXHA 3DOFA 5JEEA 2AOWA 2Y27A 4EHDA 1W36C 2FMTA 3AHIA 5KSYA 3R0VA 1IUNA 2NM0A 4Y6PA 5TEVA 2W2MA 3CNHA 3QKSB 4KZKA 4NDZA 2I4LA 4HBGA 3ITEA 4R2HA 3RYFB 3F1LA 1JALA 5K0BA 1JU4A 3ICPA 4UHCA 3TRFA 1P7ZA 3I1FA 4LXXA 4B3MB 4KGZA 3NBXX 2P3QA 4LG1A 1N36B 3LHFA 1C7FA 2QZ4A 4OFZA 5CITA 3NAZA 3DDSA 5BW6B 2CL0X 2PV7A 3S7TA 2YC4C 2QRPA 1GAQA 5AVTA 2PG3A 4J4HA 2XIJA 1AHNA 1OBOA 4WLUA 2BPOA 2WD8A 3ENZA 4M0MA 5IEBA 2FPRA 3RK0A 1TUEA 3ZTTA 3E3LA 4ZDKA 4H3SA 2CHVA 1QVAA 3K1TA 3PPXA 4Y6SA 2BSQA 2XT9A 2ZB7A 3GN2A 4TQAA 1XZEA 4JB0A 1UZUA 3WGTA 1BH2A 1FMLA 1ST3A 2O8VA 3CJRA 4OFBA 5FD8A 2AG1A 1Y1SA 3AJ8A 4XDZA 3H11A 1IMOA 3KFXA 1KXJA 4N1AA 3DAGA 1CHDA 1SUCA 2FPKA 2HLPA 3I09A 4XR4A 1XF9A 2Q45A 5EKDA 4I2VA 5F33A 8OHMA 5HF8A 3BJZA 1JFVA 2EF0A 3AVQA 1U0LA 5HS6A 3LDGA 4L9RA 3H2SA 3V4VB 5BN3B 4LPSA 4NARA 5D87A 3DDCA 3NC0C 4UE6A 2Q50A 3LOUA 4V0LA 1BQEA 2HREA 5IBCA 2GFIA 1ODTC 5AXAA 3BTOA 1L5MA 2G28A 4OHFA 4QM7A 4YIHA 4ZYUA 2H08A 1DOHA 4EMBA 1M54A 1XMOB 4D42A 3FWZA 4HP8A 1JXQA 1EUCB 3DEJA 3MC1A 1Z2AA 2ZYTX 3Q85A 3AZQA 3C41J 1IAVA 4XJVA 1J2YA 4M1ZA 4ZQBA 1B41A 1KEWA 2Q62A 4IFTA 2E1PA 1A8SA 1P0FA 2IHTA 3JQAD 1PQ4A 2X7HA 3KR2A 1ZUNB 1Y0BA 4BPRA 1UFKA 3WIUA 1T4GA 3F46A 4WLFA 1NWHA 1G42A 1JJ7A 1I0IA 2QM0A 3AR2A 4NULA 1N8KA 5AW4A 2JARA 5L6MB 1XCMA 2ORYA 3I9NA 3W8FA 1U1FA 2HF8A 3EXEA 1JFLA 3BTSA 1VPWA 1OFUA 1Q1NA 1KMCA 1ZWKA 2C9YA 3STHA 2K4MA 1F48A 5B7PA 3NNNA 1H85A 2IBTA 3V2HA 4KP7A 3HCBA 2WHPA 2YTZA 2QM8A 1PNTA 1TFUA 3DUFB 5EJ5A 1NSFA 4PLGA 3FTEA 1T9AA 1LUAA 2AJBA 4PLHA 4Q00A 2J5KA 3JQ8A 1IEWA 3BKWA 3FF4A 4K6GA 4KXLA 4RADA 4RWEA 5KVQA 4YPVA 4DKJA 3HE3A 2PSDA 5T64A 3K6RA 2FN3A 4IJ5A 3LWDA 1ZMOA 3B1ZA 1YAHA 2CVOA 4H2DA 2CXUA 2ZI9A 3TBFA 1CQWA 1SUAA 1ZEMA 3OWHA 4XARA 1P0CA 2JAOA 2CE7A 3C6YA 3KR0A 4NU6A 5T3YA 1QU3A 3OPQA 4G9EA 4IX1A 3F47A 5DLDA 2B8EA 3T41A 4MQEA 5DH9A 5AJUA 4HLNA 3IUEA 3RTEA 3CE9A 3DF7A 4Q7JB 5EHNA 1YNSA 4DDVA 1KMHA 2IOFK 1ADCA 1WLSA 1MV8A 4R1LA 1GLVA 4R9VA 1GA4A 3LA8A 5LLDA 1IRIA 5K01A 3AF3A 4XLLA 1EHYA 2XGMA 4UU8A 2VCEA 1NYQA 5JSZA 2NMVA 1R6UA 1PZNA 1YKFA 4DG5A 1Z3IX 4W8GA 1CR4A 2OYSA 2VA9A 4GQAA 3UJ9A 1RHRA 4EKDA 4HJRA 5BW8A 4EJ2A 3RV3A 2JEZA 3GB9A 1EDZA 3ZLVA 1UK9A 2ABWA 5C3UA 2CBXA 1HE1C 4RKFA 5B2EA 4FDAA 4LRQA 5T5QA 4E4YA 4LQDA 2DPXA 1Q7RA 2VJAA 1DIHA 1HLDA 2BIFA 4S3MA 3LHKA 3C15C 3NH6A 1N3IA 2VTBA 1V7PC 4WKBA 2I7CA 5LBUA 3UICA 1DCMA 3H0EA 5BR8B 4XTRA 4WOPA 5IABA 2Z6AA 3SZMA 2WSIA 3AF1A 3MMNA 5AI9A 3CV3A 4J8PA 1Y3CE 5LZ5A 2R97A 1ZGCA 3CXRA 3N2KA 4OUDB 2BBSA 1KC3A 5FPQA 3QLJA 2GYWA 3FBWA 1NRIA 2SCUA 1KORA 4KWEA 1KO8A 5ENDA 3BCHA 3OTHA 2BGNA 1U90A 3TIFA 3ZNQA 2XBLA 3ZYZA 3S28A 3AUUA 1X80A 3R1IA 4RZSA 1DJOA 1G8KA 1NKVA 2DJ5A 5F76A 1ZQ1A 3TRDA 3WI7A 4JC4A 5JQWA 1Z6PA 1JMYA 2H4WA 3F6YA 4QUJA 5KOJB 1LQ2A 2GERA 4Y2XA 1FFEA 1XA3A 3P2YA 4CKCA 4ZN6A 5CDSA 2VF8A 2XUKA 2RI6A 4OYYA 1P45A 4V1CA 1J0AA 1ZITA 1IE3A 4M2LA 4LFCB 1U11A 4FMCF 4EA6A 2FAXA 4CMAA 2OGWA 4D4GA 1GTVA 3ER6A 4NNOA 3N3BC 3ZE8A 2VHEA 5I7OA 2Q5QA 4O4JA 4OM7A 3JD4A 1QDEA 1H3EA 3GZNB 3GUUA 3PPWA 3QKUA 1YOVA 3ILVA 2Q0SA 4D5GA 3T9DA 3VHXB 4DA9A 3ZQJA 1W2GA 1W1UA 2RKOA 2Y6UA 3EC7A 1T1GA 2JI6A 3KXKA 4HFRA 5KNCD 1ZK4A 3EWAA 3R44A 5GGYA 3OUZA 1NDHA 4RPKA 3WNCA 3WHKA 3SIXA 2HCRA 1AUVA 3LHSA 2VUIB 1EG7A 2PBFA 4BUJA 2HSEA 4OAOA 4XQEA 3HZOA 1KQNA 2Q7XA 1KYXA 3C74A 3IIIA 1P7PA 1XMJA 3GW8A 4WCFC 1F14A 2GK3A 4WESA 4Y2JA 3VMFA 3HCWA 4PPNA 4XZ3A 3OZTA 1Q44A 1QPGA 1QUEA 2X0KA 2ZUSA 3N75A 3PNPA 1ISPA 4OLFA 4R2IA 3DDWA 3NBMA 5ESDA 1NBIA 5DHTA 3CPJB 4QRDA 4Y2PA 1VYUA 3C98A 4LW8A 4MLZA 3W04A 4ACAA 4PX5A 4DA7A 2OQ2A 2R44A 3MS4A 5FBKA 2WDPA 4C03A 1D4FA 1GG5A 4WK0B 1FUIA 1UBTS 5LQUA 5LQRA 1KDOA 1U9ZA 3LLUA 3QX8A 3BT7A 2GK6A 4PIPA 3P2EA 5CHYA 2XX3A 5AQEA 2GVNA 3DW1X 5JXGA 3R9XA 3JATA 3HVJA 1C7IA 2C98A 3LO8A 4FI3F 4RZUA 5KEIA 1XCPA 3LK6A 3AG5A 2B1QA 3PQ5A 3L3BA 3LM8A 4CI0B 3VOBA 4IQGA 1ONNA 1JI3A 2PGNA 3OU6A 4X93A 4Y2HA 4JXJA 1FXWA 3E5NA 4KQJA 5K0ZA 1YS4A 4Q3NA 2PKEA 2CWWA 5JMWA 4JELA 4TL6A 2V9CA 4URUR 2CJWA 2FRXA 1MMFB 1KTIA 5ALVA 5F7XA 4PCLA 5B1SA 3V1NA 3VGPA 2XJ9A 2C57A 4GPBA 5JYEA 4BO8A 1T8WA 1XWWA 2MHCA 1T8RA 2Q6IA 5FBHA 4D7AA 1K5GA 4QA9A 3BIOA 4UW9A 2IEGA 3DV2A 2YH2A 1VI5A 4MS3A 1GT91 3R3VA 4JLUA 2VPIA 4LTMA 3NHBA 4N4AA 4QSMA 4QYIA 1FB5A 4HYQA 4A0FA 4CG3A 4ERNA 1Z6GA 4KR9A 5HIIA 2ZTLA 2AFHE 1KQGA 4TMKA 5LQKA 1TQHA 1YQ9A 2Q0XA 2QVYX 3I6YA 1BCSA 3WK8A 1C7QA 1I1NA 1EFAA 2Z1NA 3L04A 4KDEA 5DBFA 2ZYDA 1ORWA 1IN6A 2GZ2A 2IBMA 3F9CA 4E07A 3FLEA 3KB1A 3HSSA 3RYHB 4C29A 5HIKA 1YZHA 2IYLD 3AKCA 1QHSA 2EYQA 2WP0A 3A1UA 1RI2A 5GAJA 4JVOA 4JLOA 1BE1A 4XM2A 6Q21A 5SZKB 5HA5A 2FETA 1E5DA 4BN5A 4F12A 4FYJA 5BMVB 3R24A 1B7GO 1FQWA 2BFEB 4BVFA 1QONA 3S1SA 3FZNA 4GEGA 4NEGA 4OFWA 3S8MA 2UXCB 3M4NA 4PYOA 3S5UA 3OZXA 1MP0A 3KB8A 4PSDA 4C7MA 2NV2B 1EK0A 2VJDA 1H9AA 3WLIA 1N9GB 2EIXA 3HPQA 4QUHA 3ZWYA 1XRJA 3LL7A 1SD1A 4PCUA 3SYNA 4WBNB 4ZCMA 2WWTA 3BM5A 4NZNA 4RKRA 3RS4A 5KWEA 4A8PA 4HB2A 5HILA 1S9DA 3CF4A 5J5CA 3RU2A 4ER5A 3GAAA 3ABRB 3KKLA 3M6IA 4Y9UA 5ESWA 4CMCA 2G9RA 4RVFA 1YB1A 2IYNA 5JWHA 1PK8A 1QLHA 3NUQA 4LISA 3TNLA 2KWIA 3PQCA 5CFQA 5ALYA 2Q7DA 4OB7A 3IVXA 5M29A 4DEYA 2AF4C 2F6RA 2GDJA 4ZO4A 1KKUA 4R31A 4EELA 3WQBA 3E22B 3PGA1 3CR7A 1F9EA 3BK2A 3B3JA 3B6MA 4PVDA 4TYMA 1CETA 2R0QC 2AA3A 2BN4A 5E9WA 4KRYA 3LUJA 1BROA 3NWEA 3W78A 4UM5A 1T4CB 4YV2A 1C9EA 4JJ7A 5AVSA 2ODPA 3WMEA 3ZIDA 3GHYA 3N70A 1F51E 1VL5A 3PWSA 4AF6A 2V7EA 2ZJ4A 2EFDB 2GJ4A 4QJIA 2PNJA 3MWEB 3L0BA 5C3MA 1U2GC 1J20A 1GQOA 1UPXA 4Z6KA 3QUBA 1XDDA 2E48A 2VN8A 4YASA 4AK9A 4BKPA 4JQCA 1P74A 5LQAA 1WABA 3AUYA 5AK6A 3F71A 2CK3D 2QL7A 3HJHA 3C85A 5L3SB 1JBQA 1EFRA 1Q11A 4TXHA 3KQKA 2OK8A 2OUIA 5C81A 3QI2A 1B0PA 2Z3VA 4UNQA 4JI7B 2X58A 4UCWA 5FTJA 1XJQA 4F7DA 4NZ9A 4OP3A 1SZJG 1CZNA 1EESA 5DGIA 1C9JA 2C84A 5H3CA 1DBPA 5ICGA 3QKWA 3K92A 2FSPA 3ISVA 1Q0QA 2BR4A 3OZDA 1XX6A 4WCDA 3OTWA 1H3NA 1RHJA 5SICE 2GD6A 1U8YA 1MNQA 1M1NA 1SKUA 2YJ3A 4QG7A 4D0NA 4E33A 1A2OA 4DJEC 1GADO 5CEFA 2PH3A 2FCAA 4EI9A 1XEXA 3JYNA 2Y1WA 5A4AA 1MH9A 1YSCA 1JSCA 1YB5A 3G8DA 4IV5A 4EG7A 3YASA 5KTRA 3HEBA 3IEUA 2AC2A 1TLLA 4S1OA 1V7CA 4KXVA 5ALJA 3PGMA 1ZGHA 4GMXA 3KSZO 3SS8A 3ZKAA 5C8DA 4WZAE 2D74A 2GA9A 5FUQA 1LI7A 1W8IA 4OKSA 1H4SA 4FSHA 3BZUA 3EHDA 1Y1TA 5IT0A 1W5FA 1Z15A 2LCFA 3L8HA 4JYPA 4LZOA 1KEEA 5ADWA 2BM9A 3L07A 3Q9UA 1SOVA 2CLHB 4BVHA 2XT0A 3PL5A 4REQB 2NTJA 5FA8A 1L4GA 5TC4A 3TLEA 3K8ZA 4BB9A 3AIIA 4EF5A 1Q21A 2QV0A 1CR0A 2ES4A 4P4TA 1NY5A 5ER9A 5J4LA 2QAJA 5DBEX 1PV2A 4AP5A 5DFAA 1JDVA 3RVKA 5KNBA 2I2FA 2EQ5A 2EQBA 3M9XA 4DV6B 2VS1A 3A3PA 4CV3A 2NU7B 2V6JA 4NTZA 3BMQB 3QPBA 4JJ4A 3FYDA 4DIOA 5JPCA 4O4JF 5B3JC 1UQUA 1EXDA 2CMDA 1DDGA 1QNFA 1G7RA 3NW9A 2OTCA 2O8DB 4YRGA 4UAGA 2I22A 1E32A 3VVLA 4DLPA 1VGQA 2ZREA 1ANKA 4I5FA 2GO7A 1QMPA 4KV9A 1OHHD 1E0AA 3FWYA 4KN9S 4LRSB 1QAQA 5J5AA 3GLKA 1RQGA 4JLPA 2F8SA 1HE3A 3ZHBA 4WOKA 3EZNA 5I48A 1Q3HA 2FHSA 2Y92A 1OXBB 1WSWA 5AW3A 1JLSA 1GKKA 3BXHA 1UXGA 1ECLA 2PGAA 2PFSA 4LGCA 1P6QA 3GFVA 4CKWB 4DIBA 1I1QB 5ARDA 4DZRA 3AB7A 5GY7A 4BEBA 2FA9A 5KOYA 3W06A 2CHGA 3T06B 4CM8B 4QYXA 1QZTA 3BMOB 2YQZA 4QDTA 1AKNA 3TQTA 5TPZD 5FDFA 2X0NA 3CNBA 3D64A 4P2GA 4Q9AA 1W2HA 2FPPA 1MFPA 3QPWA 5BSRA 3ZV7A 3DA8A 3QE4A 1UBOS 5H3LA 5KHOC 1U8FO 1ZGZA 5F1PA 1MC8A 3WLFA 5BSEA 3QA3E 4TSFA 1G16A 2OEPA 3NIGB 3IVRA 1E2QA 2DEUA 1Z88A 4LFAB 3N2GB 3HVHA 1B43A 3ID6C 2O2DA 1Y5MA 4PN7A 3CY6A 3HADA 4NF2A 4HDRA 3ZI7A 4HUTA 4DNPA 4Q1DA 2ZRQA 2DM6A 5EG5A 1QORA 3CU5A 1FXWF 1RAGA 3EEYA 3TQSA 1LLUA 4FOPA 2O59A 4LAFA 1TM4E 2X13A 3EQ7A 1CKEA 2XUGA 2RHDA 1XQ6A 3F73A 2HM7A 2VXCA 4LNHA 3RV4A 3PXAA 2GLUA 3GDOA 4MJLA 1II0A 3I42A 2WT9A 3ASYA 3WK7A 1SXJD 3HH8A 3ZGYA 2D1SA 1QGYA 2CHUA 3DD1A 1T9GS 2RJ3A 3IR7A 4G4SO 3M4JA 3M2TA 3VAZA 1VXRA 4RDIA 4EJSA 2QN1A 1MDBA 1OZAA 5A62A 2DGDA 2V65A 5TS2A 1YR2A 3G5UA 2NZ8A 2J6CA 3NUZA 3HB5X 3IQGX 4D4JA 5KSZA 4V24A 4TYNA 5JD3A 3ZY3A 4DG8A 3IQFA 3L4SO 4Z51A 1SQ5A 2BJWA 2E1RA 4NFHA 2QY6A 3M89A 1HX7A 3NQ41 4OL0A 4XRRA 4UD2A 4TV9F 5DNAA 3WMGA 1R10A 4G07A 2EFEB 4H27A 2C2KA 2AH5A 1OXVA 4RGQA 5GONB 3ZD9A 2O5CA 2XZTA 4K1LA 4PLTA 1V1RB 1VDMA 2VYND 2XUFA 3DE1X 1TPZA 2C2WA 1FYVA 1NU6A 1UXJA 1ZD4A 2FW0A 3F5QA 4KMOA 4QIHA 1HDZA 3ML1A 1C9NA 5DIZA 3ONDA 2IU0A 2C2GA 4BEVA 4BAGA 5PNTA 5K5EA 2XT6A 2Y0PA 4K8RB 2UYQA 4QU5A 4ZT7A 1XQXA 4Q1BA 1I5EA 4UQLA 2WIKA 1W47A 3NDRA 1R66A 1CJCA 1GNPA 2VUSA 1YGPA 1OBFO 3DB1A 4M0DA 4F2WA 4KQ2A 2V6MA 3B12A 1L4MA 3RWMB 3ZPXA 3ZHQA 5KX5A 4FEYA 2AFHB 2ZUBA 4CL3A 2X19A 3GNLA 1E79D 3VZBA 2VRBA 1XZDA 3O4RA 4DM4A 1SQ0A 2H5LA 3ADCA 1EWQA 3P9KA 2AR7A 4ZDJA 1P39A 3CUVA 1KAHA 1RQXA 3DMNA 3OJWA 2HEIA 1V3VA 4QBKA 1CDOA 5EWLB 1TO6A 4BBJA 1WRBA 4PLVA 3QNUA 5B6IA 1N32B 1QJCA 3ZQKA 5MFZA 1ENOA 3MLAA 4NE7A 1XYYA 2OECA 3V1YA 4IIJA 2QTCA 4I9GA 2W0MA 2A7XA 1KWKA 1M67A 2XTNA 3GQBA 1RYYA 3EA5A 3MJTA 2RCNA 3H5RA 3QUTA 1K86A 1JFTA 1YJ8A 1F0KA 1ADGA 2EBWA 2ONYA 2X0IA 2E4YA 2HLDD 2JCGA 2Y1GA 1AK1A 1Z39A 2HTEA 5TQ2A 4BEJA 5TGDA 2H0QA 4EYEA 5TPWB 4JEUA 3I92A 1QIKA 5IM5A 1TVCA 1MW9X 4QDOA 5D3MA 5TDHA 5CB4B 1M66A 1CJVC 3RIHA 1XRPA 2QG4A 1QQAA 4DM3A 4DE5A 4R2JA 3AX6A 2QJOA 2QRMA 1KBZA 3RFCA 5FTLA 5I8PA 2NUAA 1WDTA 3QXCA 3OWOA 4D96A 1JHZA 1XALA 3WGMA 1ZHOA 1AB5A 1K7SN 1SUPA 3MN1A 4B9AA 1M6YA 2IODA 2SKDA 2NT4A 4IDBA 1E89A 3H5AA 5FV4A 2GBFA 3JZMA 3SFTA 3SXUA 2X14A 4D1YA 1F6BA 4V03A 1CY1A 5EWMB 1HR0B 2K5UA 3D6HA 1DIBA 3ACBA 4Q7EA 1LK7A 3FHCB 3MM4A 2WWFA 2XB4A 1H2ZA 1NLMA 2R2AA 5HG0A 1UMBB 2EKQA 2IW1A 2I0FA 1KI6B 3E0QA 1AQIA 3B82A 3BL8A 5KAPA 1ZLYA 5DSTA 3G0BA 4JXXA 4WJZA 3L40A 5EZ6B 3DLHA 4DB2A 3D31A 1X8XA 3JU3A 4PRYA 4XSGA 4C04A 4F5EA 4KVFA 4NABA 4ZI5A 2PD4A 2CXQA 4F4FA 1A9XB 1UBNA 1WULS 1PR3A 3D7RA 3GMIA 4B0PA 5LKRA 3LLMA 1R5NA 1KFEB 3ZGVA 1UPUA 3DDUA 5FI0B 1A2BA 1UEIA 1Y6RA 4FW9A 4RSMA 2A84A 2JGMA 2PUFA 3ZNPA 2OVFA 4FZ5A 6ADHA 4UEKA 4EHJA 1NRWA 2CF6A 2FP4B 2ATIA 4L73A 4MYCA 1QQ6A 2BCEA 2RHMA 3LC7O 3ZWQA 3DXZA 1G63A 1DXHA 3PVSA 2B3DA 1NBAA 2HZBA 2JRCA 2VDLB 3C4VA 4QARA 5E1OA 3RDPA 4DUPA 3SP1A 2YZGA 2W7TA 5AVVA 5IXSA 4Z4GA 2CZGA 1G55A 3C5EA 5LA6B 4B71A 4Q34A 4EY6A 2EGGA 1DMSA 3QVTA 2I55A 4BMPB 4C0LA 1N7IA 2J1LA 3IE1A 4JBNA 5C8YA 5E6SA 5P21A 3BILA 4F1JA 2IIBA 2NUTB 3DD5A 2DSNA 4KRGA 2EQAA 4Y0VA 3DLBA 1S9HA 1P29A 4KUGA 2JAWA 1IZ0A 2ZJFA 3PPYA 1AF4A 1OT5A 2BM1A 3PTLA 4Y2RA 3S70A 2G1PA 3W7AA 1G5RA 1EP2B 2OCAA 3AUJB 4QDUA 5C5IA 3LC2O 2GN2A 3OX4A 3AUSA 2VHJA 3AY3A 3GVCA 4G0OA 4PPFA 4JLAA 3K8OE 1QVZA 2XXBA 1NQAO 1SIOA 4OB8A 4TMXA 1AZTA 2YIMA 3IP1A 4PZ0A 3BFVA 4CKEA 4YBRA 1LF5A 4EMUA 4P5EA 4E32A 2C4VA 4HGRA 4TS4A 3TD6A 4PAMA 1WO8A 2QROA 5K6TA 2ODQA 3HJUA 4EHIA 4LWQA 1LNZA 2HIHA 4OF4A 4MO2A 3EIUA 2FPGB 2Y05A 3SC2A 2F67A 3VYVA 3VX3A 2D2VA 1DC4A 4NDNE 5ALDA 5ED0A 3RJ5A 3BWCA 1MABB 3INGA 3SJZA 4EPTA 4S1TA 3GEGA 4ZIRA 5HRUA 3AR6A 2PUJA 1I13A 3AHGA 4HEHA 3ICEA 2QTBA 2H9AA 2UZIR 2VTDA 1NT2A 3GZTB 2WG1A 2XMQA 3MOIA 1SKQA 5IJWA 1EBBA 1VHTA 1LDBA 3HVUA 1DC7A 1SRQA 4GZLA 4A0SA 2VNHA 3ZCSA 1NXOA 1BJTA 4OMUA 4BMOB 1Y7IA 1R4MB 1Y63A 3VDMA 3MS7A 3UAVA 3LX8A 1M10A 4HI0E 4JV5B 4YBZA 3EDOA 1JHDA 1U8TA 4QPPA 3LI2A 2P78A 4EHLA 4XIYA 4BXOA 5F52A 4ZA2A 3IQZA 2QAGB 3H9QA 4ND6A 4X7MA 1DTWA 2YYSA 1ZH0A 5G0SA 2ATEA 5IAEA 2ACEA 2HV8A 2XADA 2G77B 5GPBA 1M0EA 1XXLA 2DZDA 2VF5X 4I7EA 3OBIA 3U56A 2ASEA 4QICA 3O95A 3TSCA 3K5PA 2J48A 2V45A 3G2OA 2ZM6B 4MKRA 2PKXA 3VTZA 2VOEA 5HOEA 2G09A 4INAA 4MZXA 2OGSA 3R7BA 4RVHA 4MW0A 5CH8A 4B45A 4RBNA 1UL1X 3EQ9A 4HDAA 4YMHA 4QUAA 4LJLA 1IFXA 3VU8A 3HYLA 4YMWA 3EZYA 5EOVA 4Z49A 4GX5A 1L4EA 1D0VA 3QU7A 4DILA 2P9ZA 1R9MA 2B7LA 1Z0JA 4ZAVA 3TQRA 1QP0A 1V5WA 1FSFA 1TKRA 3IPRA 3OIFA 1LPPA 3ZWXA 3CPEA 1K92A 2Q3CA 3EGWA 1O97C 1A7AA 3KSDO 4FWIB 4IYJA 1B26A 2QE7D 4TT3A 1YZ3A 2RGWA 1Z5GA 1DWQA 2WB2A 3EXFA 3RFVA 1V8ZA 1MORA 3GEEA 2IYAA 3PE4A 3C24A 1X7HA 2KBFA 3VPAA 3TSZA 2ATVA 3PC3A 3DTNA 3E4CA 3I5XA 2ZZMA 3TW4A 1CRQA 3LCRA 3JQEA 1I2CA 2CLSA 2D5LA 1P91A 1OE0A 1SC3A 1Y81A 2ZE8A 4UOQA 4ZVRA 3TLBA 1Y4DE 3CEAA 4RIHA 3TD2A 1E59A 3VR6H 2FCRA 1QRRA 1IEVA 1X1AA 1JG4A 1JB9A 1LX7A 2PT5A 2HWYA 2A7QA 2LVBA 2Z2YA 3A6HA 1FTGA 3AETA 3T7RA 3TEFA 5KX5F 3BD8A 1NVKA 3ICVA 4G5GA 5HGJA 3ZNOA 3DCYA 2FPUA 2B6HA 1B8VA 3LTEA 3TLCA 3H18A 3K5WA 3IDSA 4RHTA 1U3TA 4AFNA 3AQ4A 3USES 4CKYA 1Y1PA 2BTQB 3ZW7A 1J2UA 2A59A 2YKGA 5L9AA 1IQ0A 4M1OA 4EVRA 4TTRA 1BCRB 1A95A 1FBTA 1LDNA 2WJ6A 4Y30A 2J9FB 1CUBA 3MJCA 5FULA 3T5AA 4IIJF 2NXEA 1EFHA 1E60A 3U3OA 5DHRA 4EY8A 1NPTO 2NSLA 5FL7A 7ABPA 3OZSA 4UM9B 1YQGA 2WR8A 4QVKA 3QITA 2ET6A 4BJHB 3V4RA 5CR9A 3VU9B 1EVKA 3H3JA 4GECA 1GU0A 3GGSA 4ODIA 1KFBB 2WJWA 5KYWB 4IIYA 2YWFA 4KPUA 2Z2JA 4UUBA 4AJJA 3EVZA 4B79A 3F0TA 2CHQA 2QD1A 3S1LA 2YRFA 1KY2A 4FLEA 2JBHA 3W4JA 4O02B 1SNYA 1NJFA 2IUUA 2YWBA 2PGOA 1SCUB 1G20E 2FOXA 5DLPA 1P60A 1W5AA 2AD1A 3LD9A 3EQZA 3H1FA 2B61A 3P52A 3ZWWA 1C4OA 2CUNA 4FBMA 5CVUA 3WRXC 4AKSA 4KR3A 2VK2A 3O4GA 2G70A 6CHYA 5KO2A 3KALA 4KPFC 2O5VA 1DIAA 1I7PA 3ZIAD 4EQ6A 2ZJAA 3S6JA 3AY6A 3KT0A 5G41A 4MV4A 4JI2B 2W6ZA 2JFPA 2ZYAA 4FEGA 5K3SA 3ZYCA 5FNVB 2DWQA 1SUIA 2W2LD 4U0JA 4U2EA 4EHKA 5JJCA 2RDMA 5AR1A 1CY0A 1L1FA 4P36A 1ZK0A 5AP9A 1Q19A 3KDSE 3EMBA 5KJCA 1C50A 1WDWB 2LKCA 2HF9A 3GHHA 3AEKA 4V0KA 1RU3A 4QX6A 1KAMA 4WCVA 1RCTE 4B40A 5T4EA 3G17A 5CRIA 4E3ZA 3STXA 2B98A 3BE6A 4ESVA 4TTTS 2O05A 1CNEA 5COBA 1VZ2A 5IJXA 5HZMA 5DTEA 1BHQ1 1TZJA 2P2YA 1VKRA 4EYKA 5KBYA 1TJ5A 1OLSB 3OE7D 2JFOA 4BTEA 3PGJA 1CUHA 1PGPA 3P2JA 2G08A 3L0YA 3R0QA 4ND3A 4X00A 3BORA 2JNWA 3ODGA 4ZTZB 4ARZA 4F5DA 5KWIA 1ZRHA 2PZEA 2D0DA 1VG8A 2FEOA 1IUOA 2OB1A 4NCKA 3WKDA 1ENPA 1U63A 2IF0A 1N6HA 3L77A 4HSEA 2Z58A 4NMWA 4F97A 5C8YF 2QXTA 2TSYB 3LXRA 4F4DA 4LYAA 3I39X 4NR0A 4EO4A 4PINA 4FFNA 5KTYA 1A9SA 4LJ8A 4Z4IA 2J9GA 3TZ6A 3BEDA 4R7ZA 4GX1A 4V0OA 4F92B 3QUAA 3PKZA 4RV4A 1VSQA 3RH0A 4ASUD 2QLMA 1N5RA 4BX9A 4TWRA 4HDNA 4LYHA 4EO7A 2B35A 4XVCA 3QXHA 1J1UA 2BTEA 3EG5A 3ZXXA 1DFGA 4G0PA 4JT4A 2O1EA 3K1AB 2BEVA 4PG4A 3R8CA 5C0OE 1GL9B 1T0PA 1YNOA 1E7WA 1ZISA 3PXGA 5BNWA 4JDPA 3RS0A 2AS0A 2GBLC 3PZRA 3PJDA 1PJQA 3GLFE 1JG3A 2CNDA 4DLBA 3EGVA 1NG9A 2BFDB 2B0CA 3T4XA 1VSTA 4JJFA 4EB6A 2JGDB 3F49S 3MOGA 3M6VA 4MIKA 4JLWA 1E94E 2ZBGA 1E3DA 3OY2A 3R8XA 4G81A 2WF7A 4MP3A 2GUGA 5BVGA 2VDNB 3I45A 5MN6A 2VRCD 5AUPB 5JZBA 4X3CA 3CIOA 1R8XA 4M99A 1NLZA 3Q87B 1CP2A 1UOPA 2B4TO 1BHO1 3LL4A 2IJGX 4TGLA 3VZQA 2FG6C 4M1KA 4BQIA 3B1FA 4JGBA 2O4CA 3TMKA 1T1JA 4MB0A 2CFOA 5TV2A 4B6SA 2AN5A 2ZBFA 4G23A 2WFLB 2ZJ3A 3HCEA 3U4AA 1H0KA 4RHEA 1WMAA 2VHWA 4ND8B 3RAEC 1ZM2A 3HXOA 4X84A 1A9YA 1NURA 2UVPB 2OGUA 2X5OA 3DZKA 2DH5A 5F7JA 1RW4A 3M4YA 2YN4A 3OQIB 1XV5A 3A28A 2OFPA 1NIPA 3DMTC 5EHXA 2AI1A 5KDOA 5LU8A 2Q1SA 3UFXA 1IBRA 4AZ0A 5I9LA 2W8ZA 2P41A 3KR9A 5LQNA 2G0AA 4TSRA 5HMMA 1VZ3A 3AQIA 4MWOA 5AKZA 3NRCA 4B2LA 3B6ZA 1F1BA 5JCJA 4HH4A 4V0ME 5JW6A 2G5PA 1NW4A 3ZOKA 2G82A 2OE2A 3DZHA 4PZPA 2QSZA 2BMWA 3GG9A 1VE7A 3I4LA 3H5LA 3NKFA 4R2KA 5FBQB 3RNLA 1KZGB 3TB6A 3VO9A 4BDSA 4CUJA 1LC0A 2H3EA 2I6GA 4CNQA 2C3MA 5EUQB 3V80A 3GF4A 1WZUA 1XMQB 1N2HA 2WF8A 1JUDA 5KVCA 1Z34A 3HUEA 3TTVA 1EE2A 2CLFB 2QUJA 4GMKA 4H1UA 4QPJC 5HUHA 5D5PA 2Y9MB 5AQ1A 1CQJA 3I04M 4L4UA 2PLWA 2ZB2A 1ONBA 3CLRD 2OQIA 1SB8A 1N2SA 5IF3A 4BV3A 3QV1A 3L7CA 2P79A 1Y7HA 4W1QA 4I6JA 2FMKA 5GJBA 4ESOA 2C8LA 2V1UA 1N6IA 2HXSA 2WJZB 4O2BB 1Y4UA 2DR0A 1CCWA 4NCJA 1JEOA 4YUYA 2WHEA 1FLDA 3HJGA 1XDWA 1N6RA 3CUYA 1V39A 1NUTA 4M1TA 1M5UA 3ZGXA 4CPDA 1W85A 2X3YA 1OWMA 2WPDD 4PRZA 5CM9C 3U48A 4ZJUA 4J7UA 4CDGA 1A82A 3A3OA 3ZWOA 4TLBA 4ARCA 3W34A 1BYUA 1CUEA 1Z7EA 4R1SA 4A26A 3FTPA 5BPFA 3KCNA 1RLIA 2QJRA 2QEQA 5LP1A 3NMUF 2QTZA 4US1R 3F7OA 4AG5A 2AOTB 3U3JA 4DUYB 1EXVA 4M55A 4OJKA 4E1AA 1LK0A