5FI1B

Crystal structure of the p-rex1 dh/ph tandem in complex with cdc42
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
b'FMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3.
pubmed doi rcsb
total genus 53
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fi1B00
3A1WA 3R8CA 3RSOA 3CH4B 1A7JA 3CRMA 4QXAA 4RY2A 5CK4A 2F3RA 2IYWA 1U81A 1U0HC 3MMPA 4V0NA 3OE7D 1BIFA 2F43A 4LJ8A 4AG5A 2FPMA 1LW7A 2WKQA 5C4GB 1G3QA 1ZVQA 2FFAA 4S2EA 1BH2A 3KKOA 3I32A 1R2QA 3LWNA 3NH9A 1E2GA 4FMDB 1OH7A 5EXSA 4G0NA 4MDEA 3QBVA 1NF3A 3LBIA 3A1VA 2DPXA 821PA 2XSZD 3CX7A 1U9IA 4KYIB 1N6LA 5AUNB 4WXRA 1KK3A 4A2WA 3GEIA 4C3ZA 4ASUA 4DCNA 3RNLA 1JAIA 2NO0A 1E1RA 4KVAA 5JECA 4Z1MA 3BOSA 1UFQA 3OIUA 3VU9B 1JR3D 3ADDA 3ASYA 1AGRA 1Q1EA 2IYTA 1GKUB 2CLSA 1TX4B 2CJWA 4Q9IA 3NKVA 4B6EA 1G9XA 2AXPA 1IN7A 3IBGA 4BZPA 4OJQA 1G5TA 4X8MA 2PEZA 3CNLA 5D3QA 1C1YA 3AF4A 1SXJE 2IL1A 3GFPA 1I4DD 2FSGA 5SZJA 3D7MA 1CS4C 3FGNA 5EZ5A 3U3RA 4U02A 1FUKA 4Q4AA 2CNWD 4PR0A 1N6RA 3KQHA 1E9BA 1LVGA 4M1TA 3LX5A 3KJIA 1UBCA 3PFIA 3FVQA 1VYUA 3WMFA 2ZRPA 3VAAA 1XD8A 2AKAB 2BBWA 4FW9A 5AUOB 1KTVA 2QT0A 1E99A 2GILA 3WNDA 4IVRA 1OH6A 1XJ0A 1COWA 1T8TA 3GLFA 1CJKC 1R0XA 3WXMA 2QORA 2WKRA 1E1RD 1UKEA 1QVAA 3HJNA 3E70C 5B2ZA 4PAOA 2GETA 2KWIA 2ZJ8A 4MH0R 4V02A 5LB2A 3WBKA 1GL7A 3AH8A 2HEIA 3B2EA 5DI9A 5TV2A 4PZYA 1Q3TA 1U0LA 2JCSA 2QAGC 1S4QA 4JZKA 5FOSA 2GXSA 2ODWA 3KB2A 2ZI5A 3AUYA 1VCMA 2O0JA 4PZLA 1VG8A 4MRVA 4TZ0A 1KI7A 5CJ2A 1ETUA 1JJ7A 2CLDX 2G3YA 1G291 1K5DA 2BIFA 2XZPA 3AF3A 3AKEA 3AVQA 3Q85A 2FFHA 3L0OA 4JS0A 3FHCB 4ASUD 4CRWB 5J4LA 3GLHB 1DTSA 3PR1A 5IRCD 2WAYA 2C99A 4WZBE 1DG3A 3RRYA 3SJZA 3W5IA 2ATVA 4DDWA 4P31A 4JMPA 2R9VA 2V1UA 2JEOA 3KKQA 4YONB 4YXWA 2ZRMA 3H4MA 2GF0A 1IHUA 2IXFA 1AKEA 4HAWA 4LYHA 5CIQA 5F2EA 2CHGA 2QMUA 2QROA 4HB0A 3RS5A 3T5DA 1AS0A 1DELA 2ZI4A 2FGJA 4CDGA 1XCMA 3FOZA 2AN9A 2E1RA 2IYQA 4ZI3A 4G1UC 3TQFA 1OW3B 1W46A 1YZKA 2JJ2A 2KJQA 4F92B 1IXSB 1CTQA 1E4VA 2KBFA 1YQTA 2IHBA 3FMFA 4S35A 4DSUA 3PUXA 2AK3A 4QRHA 4DLWA 1W48A 2J5XA 2XJ9A 4FXPA 4XVQA 1N5KA 2BV3A 2J45A 1S0UA 5EQTA 1NVUQ 5HR5A 1R7RA 2J7PD 1E9SA 5KPDA 1P9WA 3UWKA 3VKHA 4JVNA 1T3LA 3T35A 4ZDIA 5FPHA 4OI1A 2ZI9A 1LY1A 5K8TA 3TAHA 4H1UA 4NYMR 1P73A 1KZ7B 4C7OA 3JZMA 2ZVPX 3UKDA 2WKPA 2HUPA 2ZRNA 1EXMA 2JDIA 3T1QA 4MYUA 2LCFA 1L4UA 1F60A 3BFKA 3K9GA 2CVHA 2ZQ5A 2G0TA 1OH5A 3DPUA 3SYLA 4PX9A 3CPHA 1JR3E 4NP6A 1II8A 4OQFA 4CGZA 1W0JD 3B9QA 1P75A 4TYWA 1VTKA 3PEUA 1EK0A 1OIVA 2WWGA 4M21A 3I1FA 1IN8A 5H70A 2H17A 1JAHA 1DG1G 5DI3B 2BWJA 3QKRB 5FL3A 1KO5A 2GBLA 1T9HA 4NCKA 2PJRA 1SXJC 3LW7A 1BMFD 1W4AA 3TE6A 3QXXA 4R9UC 3U3MA 2YV5A 2WMNB 3ETLA 5KSYA 1Z0JA 1XEXB 3I61A 4PHFA 2OBNA 3QKUA 1E9EA 1OYWA 1TQ6A 1NL3A 3DEFA 4U00A 1R8SA 4EPRA 4C4PA 1Q57A 4JLMA 4B3CA 1G64A 3LO5A 4BFUA 3ADBA 1HQCA 1OLOA 1KI4A 2D62A 1E2NA 4V0ME 4DCVA 4BRUA 4B44A 4XWKA 5EP4A 3CF6R 3SZRA 4B2PA 1W0KD 4D6PA 2V6JA 1XPUA 3ZQ6A 1GZSA 3ZVRA 5FOTA 1ZM2A 1QHHA 1M7GA 1G3RA 2RGEA 3EZ7A 2F1HA 4A4DA 1PVOA 3RRZA 4M1WA 3ZVMA 2NMVA 3GJ3A 4W5HA 3SS8A 1ZP6A 3AF0A 2YVUA 1N0VC 2GCPA 3EA5A 3LQRA 5F3WB 2IS4A 2GHIA 4OL0A 3ND9A 4Q1DA 4DLVA 2GDJA 1JPJA 2QAGA 4HB4A 1ZW6A 1E0JA 4JLVA 1OHHD 1FOEB 3U3KA 4Z51A 2G1KA 4PAQA 3LVQE 4FD2A 1G4UR 4FCWA 3T61A 5DO9A 4AYWA 1OIXA 1G21E 2JJ8A 4ARZA 1NJFA 3VX3A 3MJHA 3MSXA 1KO8A 3LD9A 3AGQA 5EZ6B 4BASA 3WRXC 1ODFA 3EC2A 4F4CA 3EZ2A 1VPLA 4UXIA 5FOWA 2ZRJA 1W0KA 1G8HA 2OLJA 3CF2A 3T34A 2H1LA 5HTKA 3ZIAD 1HQYE 4RVCA 3UATA 1WCV1 3U6KA 3PUZA 2WJJA 4P0TA 4YMWA 4LYJA 2OO7A 2GESA 1WP9A 1A2BA 2WPDA 1SKYE 4C0HA 2V9PA 4RSGA 1KI9A 1YVDA 3MWKA 2N46A 4ESVA 2H16A 1D9ZA 3RHFA 4DLYA 1ANKA 3BWDD 1P72A 2FZLA 4LYFA 3ZGXA 3KDSE 1BMFA 1SULA 2J87A 3L0PA 4F7WA 1E2FA 1WRBA 1XMVA 4DLZA 3B1YA 5FR1A 2RGNC 1WBDA 4D25A 2CJWB 3NHAA 5A4JA 1U99A 2QTHA 2PMDA 5EE9A 4Z54A 3LFUA 3TR5A 2OCAA 1DO0A 2V4ZA 5JRZA 4MGZR 3CKLA 4TLAA 4B47A 2JIZD 2OT3B 4HDOB 4NCNA 1OJLA 3WP1B 3LQQA 1E9RA 4PC2A 1P60A 1SKYB 5DHFA 3EPHA 1KK2A 2ZE8A 3GJ0A 2NPFA 1L2TA 2ZI6A 4MA4A 4CEHA 4FCVA 1U8AA 1JEEA 3OEEA 2O5VA 2FNAA 4HEJA 3OF5A 4BEJA 2Z4SA 3A6PC 1C4OA 3K0CC 4B6FA 2GCOA 2O0HA 4TZ6A 2QENA 2VL7A 3BAFA 3RAPR 2EFCB 3EIHA 1OKKA 2Z5FA 1VKJA 4KFRA 4PQRA 4QHSA 2L0XA 2MMGA 5FBLB 3TRFA 3WP0A 4ACAA 1KK1A 3OESA 4QM6A 1E9FA 1Z6XA 3OAAD 2GZHA 5C4MA 4P32A 5GJBA 3RANA 4PHTA 1XBTA 4LHXA 5ANRB 5A0FA 1AA9A 4PTLA 1XP8A 4QGGA 5EP2A 3PEWA 2ZU0C 1NY5A 1TU4A 1PUJA 4OKSA 1G5RA 2JATA 3PUWA 4NPHA 4AWXA 3ZS8A 1CEEA 1RZ3A 1D2MA 5TXGA 4XSHA 2RGCA 3K0AB 2GAOA 4FMBB 2IHYA 1UDWA 5KNCA 4BLTA 3GPLA 1GITA 1Y3AA 2AXNA 4NYIQ 4QG7A 4YDHB 2GNOA 4TMXA 1NG1A 5JRJA 2Q6TA 1YZQA 2ZRBA 1II9A 4ZKEA 1QVRA 2GCOB 2YOFA 3SE0A 4B3DA 5J4KA 1NNEA 3I3SR 4MGIR 5C18A 3CNOA 3VNVA 5KDLA 2ZRHA 2FH5B 3DO6A 4X8HA 1L4YA 2X8AA 3P26A 1X3SA 1EX7A 1KJZA 1QHHB 1QF9A 1X86B 3LRPA 1N6PA 2EFEB 1NSFA 4LJ9A 2BCGY 4KBGA 4EJSB 3LAWA 2UKDA 3MD0A 2OFWA 4JLDA 1XEFA 1NMZA 2REXB 3A4NA 4JT2A 4Y0VA 1W5SA 2P65A 2DWPA 3TR0A 4ILEA 5SZIA 5JMTA 2NO9A 2X1VA 2FEMA 2QSYA 1QG2A 1QHGA 4LJ7A 4RZ2A 4KHZA 3VHLB 3GLIB 2OESA 1OYYA 4M1YA 4I1VA 4D26A 3QUSA 1IN6A 2MSDB 1D5CA 1Z28A 2A5GA 3ZJYA 3QXHA 1A2KC 2FPLA 3AVYA 5JWHA 1L8QA 2LWIA 1XJQA 4DXAA 3R7WB 2ZIAA 3ZVNA 2FSHA 4M1MA 5UKDA 5L3QA 3A1UA 3KZ1E 3LDAA 4B2IA 5EE0A 1X8JA 3SU8A 2GWHA 3RYTC 1SQ5A 4W5JA 2V3CC 3QVVA 1TF5A 2FWRA 1MO6A 1VIYA 1DBSA 3A4MA 1PJRA 3IQXA 3QOFA 3HR8A 4R2HA 4DB4A 3QENA 4Z8XA 1G16A 4IRUB 1MABA 2BBOA 4M2LA 4CVNA 2V54A 1JALA 3VHXA 2WJVA 5LPNA 1OT3A 3QG5A 1JI0A 1KO1A 4XSGA 2ERXA 4R7ZA 4LV5B 2UZIR 3NBZC 1G19A 4PAMA 2YC4C 1KI6B 3R7WA 1NN0A 2VQSA 4A0RA 4A15A 1QHNA 2WJYA 5F98A 1YR8A 4Q18A 2WM9B 4GRAA 4WZAE 3RS2A 1RVDA 4GBMA 2Q3MA 1M8PA 1LNZA 1Z8FA 1XFAA 1RYFA 4HI0E 3ONWA 4MRSA 1NN5A 4CT5A 1S96A 1VG9B 1BS1A 3BH0A 2V8OA 2ZRLA 3I8XA 1E94E 4EUNA 2IWRA 1KNXA 3AP2A 3ZD6A 4CEIA 3B7GA 2VLIA 4EPTA 2O8BB 2VP9A 2GEUA 2D06A 4DUGA 1FZQA 4ZIRB 1SVIA 4P4SB 4LOAA 4LYAA 1E9DA 3TVTA 2HCBA 3QXCA 5H68A 1DAFA 1GNQA 4KODA 3UG7A 3VKGA 3PUYA 1JR3A 2K5UA 5KO2A 1XTQA 2XNDD 2A2ZA 2A5YB 2AD5A 2F1IA 3TH5A 1IBRA 3IDQA 4KLZA 5J4VA 5DYGA 1RKBA 3DHWC 1AK2A 4URVR 4FMDF 4U5XA 3F8TA 4DSTA 4G01B 4KCGA 2PT7A 3SJBA 5JZVA 1JBKA 2XOKD 1E2EA 1LS1A 2FX3A 2NO7A 2RMKA 3U7FB 2IWHA 4OI0A 4G3XA 1XDBA 2WWHA 2IUTA 4ERNA 1X1RA 4LY6A 4BFTA 1D2NA 1M7HA 4HLCA 4AYXA 5G3ZA 2DHRA 4XVRA 4RD2A 1G41A 3LNCA 2P5TB 3V4RA 1YRAA 2JLUA 3I72A 4A8JB 1HURA 1N5LA 1E2KA 4LBVA 3T5GA 3U60B 1PLLA 2BOVA 4IOJA 2VP5A 2W2VA 2OHFA 3BH6A 2H57A 5J5CA 4M1KA 2I4IA 4MRRA 1DEKA 5AJWA 4JYCA 3TNFA 3ZDQA 4DSOA 5JBQA 2A5DA 4JLBA 3CRVA 1DAMA 5EUMA 1SHKA 3NC0C 1ZJ6A 4IHQA 4LBYA 1W36C 3W6PA 1OF1A 1H65A 5FTMA 3GLFB 4JYBA 1GNPA 2QBYA 4LGMA 2ZPTX 4NKRA 5CM9C 1KZGB 2X77A 1AZSC 3GJ5A 4ACBA 2VTKA 3E2IA 4Q03A 3RRNA 5CB8A 1KSHA 4HB2A 5DHAA 5FPTA 1F6BA 5GADl 4BZXA 1RRPA 2NO6A 2ZYWX 2R2AA 4WZ6A 2C9YA 4URZR 4A8JA 4MYTA 4YQFA 2AK2A 2WOJA 4IDHA 2CLCX 1IY1A 1GP2A 4UNPA 2ZSDA 3K70B 4MGKR 4XVUA 1IXRC 4URXR 6Q21A 4NCIA 3VQTA 3RC8A 5A5GA 1FQKA 3NDBB 3CIOA 3H0KA 1G3UA 3U4QA 2R6CA 1ESNA 2W00A 2J1LA 3BGWA 2VO1A 1HY3A 4Q21A 4Q9LA 4YMTA 1W47A 1ZBDA 3MG9A 3THXA 3GQBA 3CW2A 2VF7A 2H92A 2XEXA 1CIPA 1V43A 1Z0DA 2D7DA 3RABA 4JLAA 4QNRA 3J81k 2W58A 1IQPA 4NHOA 1VCNA 4JKYA 4KSBA 1RJ9B 4JSYA 2VP0A 1AQYA 1MO5A 2H5EA 3I73A 3KKPA 4A1FA 4L15A 4CZ2A 2ZTSA 2G6BA 2QM8A 2VP2A 4IXNA 1W36B 4LX0A 5HE9A 1KHTA 4UJ5A 3ZZTA 1I2DA 3NDPA 3LXRA 4YMUA 3PV0A 4IOLA 1Z6GA 4EFNA 4LC0A 2BMFA 3QEJA 3PXGA 1JQLB 3TK1A 5HZHA 4C2UA 3H1TA 4BFWA 1Q1QA 2QRNA 3IQWA 1PLKA 4X8OA 1XXHA 1MO4A 3EWAA 5DN6A 4RFSB 4BLSA 1IN4A 1KMHA 4RD4A 3R8FA 2QMEA 4QJ5A 1FX0A 3DOEA 1SVOA 5CDFE 3KUDA 5CDFA 5BQ5A 4FMCF 1ZM3A 2EWVA 5CLLA 3SI7A 3KXLA 3UMSA 3FWYA 4PSAA 3TMKA 3MUFA 4BPBA 3EZ9A 4Q48A 1RYHA 3U3OA 5FPSA 4BGDA 2J0VA 1QHIA 4D81A 4BE7B 2IYSA 2KBEA 3LW8A 1ZNXA 5FBQB 1PV4A 5F9HA 3AVWA 4EJSC 3BERA 3U3JA 1N6OA 1ZD9A 1XZQA 4F38A 1CULC 1U0JA 3K09A 4NBSA 4L9WA 2G0NA 1JQJC 2DWOA 2WTUA 4NYMQ 5E3HA 5FR2A 3CRW1 3THWA 5J47A 1KGDA 3LBNA 2D4HA 1KMHB 1QBKC 1T6NA 1IJEA 4TL7A 4R71A 2VIIA 3H86A 4EPWA 1TMKA 4PPGA 2OXRA 3EASA 4FWIB 4O25A 4KFUA 1FNNA 2IYZA 3TUJC 3ADKA 4BFXA 3TJZA 2WWFA 3DM5A 5LDDC 1SVKA 2IF2A 1LF0A 2ZVQX 3EAQA 5H1YA 1GRNA 1E0SA 4D4LA 4RD0A 2PBRA 3GEEA 5KHOC 1OXUA 2IEZA 4DB2A 2GJ9A 1AS2A 3K0AA 1GIAA 5CK5A 1LB1B 1IONA 1OIWA 2CDNA 2RB4A 3AQ4A 3ZYCA 2G83A 1T3SA 1FMLA 4W7SA 2C95A 1HTWA 2EVWX 3THWB 3ZVLA 1G7TA 3IO3A 1R0YA 4FN5A 4HUQA 4XWAA 2YZ2A 3QKRA 3Q72A 2RGDA 1G8PA 2OM2A 4M1OA 2J0UB 1IN5A 3CR7A 1DAKA 1Z06A 1SVWA 2BKUA 2IYXA 3NIBA 1T0HB 5AJZA 5GJVC 2JLWA 5HCNA 1OE0A 1PZNA 5EE1A 1T3HA 3VR5A 2YNMA 2DYKA 3WYFA 4GSYA 4OK6A 4POAA 2HV8A 1ZIPA 3SN6A 1NBMA 4Y0AA 4GP6A 4B3FX 4YMVA 3IHWA 4OQMA 1ZNZA 5BN3A 4EQ6A 1BO6A 5AK0A 1ZC3A 2A7QA 3A1SA 1XJCA 1KJYA 1NN1A 1GKIA 2QP3A 4HLUA 3B6EA 3GLIA 4AKIA 4PQFA 4V03A 1Z07A 4DLUA 4E22A 2ZI3A 4KSCA 1R10A 2W2TA 4TYYA 2VBCA 2VHQA 3KKNA 1Z0FA 4PFSA 5IK2D 4HAVA 2OAQ1 2RAPA 1ZUHA 1YRBA 4GNKA 1W2HA 1LS6A 1CKEA 3FHOA 4WA7A 3DMDA 3W6OA 5L3QB 1FTNA 1P9RA 1Q3HA 3DM9B 2EFGA 1GRQA 5CLQA 2ZXUA 2WOOA 3IILA 4UNNA 1XF9A 5G41A 5IHPA 1E0KA 2ZS9A 3ASZA 4XD7D 2NIPA 4Q7LA 2GJSA 4JSTA 4LHVA 3EPKA 1VECA 1XMJA 3HDTA 2ZM5A 5DNYB 3OHMA 5EJEA 4Z1MD 4WVFA 1F5NA 4UQOA 1IXZA 3EIQA 2GJAA 3K70D 4WBSA 1YKSA 2AFHE 3SQWA 1G7RA 3ZH9B 2RGNA 2W6IA 4IOKA 1KO7A 3IIKA 4RZUA 2IYVA 1NMYA 2GK6A 5CYOA 1NG9A 3NEJA 4E07A 4RCYA 5KDOA 3DZDA 2B8WA 2XB4A 2OCPA 4MRNA 3LA6A 1FP6A 2PZFA 4KXFB 3VTKA 3CZPA 4DUGD 2ZYUX 4WOPA 1P2SA 1Z2AA 1CR2A 5IF9A 5JWOA 4LHWA 1L7VC 1X1SA 4HAYA 3V4FA 1ZUNB 3L0IB 1DADA 2GBLC 1M1YE 4N3NA 2WICA 1Q1ZA 4OHWA 4B43A 3A37A 2REOA 2XNDA 4L8GA 1I4TD 5JHGB 1CBUA 3WNBA 1QHSA 5L8VA 1G1MA 2CL7X 3K0CA 4KITB 3LX8A 4MKHA 3FMIA 5BXQC 2ODEA 4OHVA 1E1QA 1GFIA 1U98A 5B57C 4A36A 3AKCA 1Z6YA 3QEOA 3JVUA 4JL6A 2MMCA 4TL8A 4DEXA 2QU8A 2CCKA 2CVFA 4OQNA 2P5SA 4Q1CA 4PO1A 1TEVA 1JEDA 3BJIC 4JLPA 4XTRA 3ZZ0A 3KQLA 1Z83A 2C96A 4B32A 4D0NA 5KSZA 3QXJA 3EWSA 1Z3IX 3H84A 3L8ZA 2MSEB 5HKKA 3VR6A 3CZQA 1OKKD 3SDZA 5JI3E 4M9SA 3QJYA 3A1TA 4Q7MB 1XTIA 1HA3A 4EIWA 2VYFA 4RZXA 5GJWC 3EARA 3Q5DA 2QTVB 4OQLA 1ZINA 1GOTA 2GXAA 1RPZA 4CYMA 3BORA 1UKYA 3C14C 1XCPA 2JLVA 2O52A 5JS7A 4DKXA 1Z22A 3M4YA 3VR1A 5G40A 4LBZA 1VHLA 3AF1A 3RS3A 2B6HA 4DSNA 3F5FA 3D31A 4CEJA 1R5NA 3OIWA 1N0UA 4DEYA 4F93B 2ZRCA 2FJUA 1UBGA 3UMFA 3ZD7A 3MWYW 2PZGA 2IYYA 1SKQA 3X1DA 1N6NA 2Q3HA 4C0LA 5K8UA 2WSSD 2F55A 2O8CA 1CR0A 4YDSA 1GAJA 1KIMA 4Q4AB 1P2UA 2NZ8A 4KV9A 2F9LA 3NHBA 4RD6A 2CE2X 3OIYA 2ORVA 3VR3A 3PEVA 3GLFE 5D3MA 2CMKA 1DVRA 3UXMA 4B35A 4HZUA 1PLJA 5KNDA 1QG4A 5BYKA 4PANA 1FP7A 1WMSA 2NPIA 3B1ZA 2QP9X 2V1XA 2OSBA 2B21A 3R20A 2QEQA 4Q00A 4AD8A 4BFZA 5HPYB 3L43A 1MV5A 3ICQB 3SBEA 3CM0A 1YE8A 4EPVA 5JWRA 2QNRA 2JASA 1LV7A 4LUCA 2ZJ5A 3BFXA 4NDZA 3AV0B 4BLPA 5FUXA 4O0MA 4LHZA 4TYNA 3KQNA 4N0EA 1HYQA 3RWMB 1DAIA 4LPKA 1MABB 2ZSAA 1VYVA 1JJVA 2PCJA 5JEEA 1I2MA 3K0EA 2QN6A 2QPAA 2XITA 2ZJAA 2HYIC 3OZXA 1E2MA 5D3MB 4B76A 1E2PA 4Q1EA 3CO5A 5BW8A 2C77A 4IFBA 4DWJA 1II0A 4PHHA 1GILA 2XGJA 2AX4A 4QBIA 2QRZA 3LLUA 5FOXA 5TMPA 2I1QA 3OIVA 721PA 1LFDB 2JGNA 3GEHA 1TUIA 1LTQA 3REGA 1TAGA 2ZUCA 5JLJA 2QMOA 1FX0B 2A3RA 1E9CA 4DBLC 1E98A 4JL8A 2JLRA 4JBXA 2CE7A 5JCPA 1WBBA 2REBA 2BM0A 3KX2A 4A2PA 4E5UA 1HH4A 1ZAKA 3BE4A 2OXCA 4JLOA 2CEAA 3OEHD 3RS4A 1H8HA 2QE7D 1UEJA 1G8YA 2JAQA 2VHTA 2J7PA 4B3XA 1KY2A 2RKOA 5P21A 4CF7A 1J70A 1GSIA 2ZYTX 3D6TB 2IT1A 3MWJA 521PA 2Z0MA 4K8OA 3CLVA 3NVAA 4JBYA 3T12A 1E2LA 1T0JB 1EFUA 4YMSA 4PC1A 3R9XA 2BHRA 3QF4B 2XZOA 4DZZA 2QPTA 3M1IA 4GPTA 2ZRDA 2FPKA 1A1VA 3CUEF 1TL7C 2YWHA 3DZ8A 4A9AA 3GD7A 3HP1A 3P20A 2F3TA 4LJAA 5AUPB 2XXAB 1F2TB 2G88A 2VHCA 4BFYA 4ZCMA 1CRPA 5JI2E 1AKYA 4ZCIA 1FPMA 3AVPA 4QKQA 4TSFA 2CHQA 3LY5A 4ZI2A 4IVQA 1X8KA 4LC1A 5BN4A 1CU1A 1WA5A 1E32A 1DAEA 4TQAA 5FPYA 5FI1B 2GJKA 2WWXA 2Q3FA 4KFTA 3Q5EA 1S3SA 1IOZA 1KSJA 1YR7A 2AR7A 2IC5A 3GLHA 2RGAA 4WAUA 2IA5A 2R6FA 4BLRA 3ZS9A 2R8RA 3I92A 3EIEA 2JDID 1FNMA 2WPDD 2Q9CA 4HAUA 4LSGA 3QF7A 4YC7A 2JJ1D 3JZAA 2Q0HA 3Q8XB 4XOIA 2KE5A 1GDDA 2ORIA 1X8LA 3MAAC 4I1SA 3JVVA 2J0SA 5FBWB 3T1OA 4TL6A 3UWOA 1HEIA 2DFNA 4DVGA 1D9XA 2J3EA 3L0SA 4J0QA 5IK2A 2VH5R 1F2TA 4KVGA 1BKDR 1KSGA 4A0HA 4US0R 1AM4D 1ZRHA 1E2IA 4AYTA 4OHYA 1W7AA 1XZPA 1VDZA 4Q1FA 4B74A 3P32A 2WHXA 4TLBA 4II7A 3QPUA 1OFUX 621PA 2CL6X 4HLUC 1TNDA 1EFTA 1E96A 1N6KA 1KI2A 2TMKA 3KB1A 4BRWA 4HAXA 3GP8A 2YKGA 3TKLA 1RFLA 4JVLA 4BFVA 1XCGB 4O3MA 4PC3A 5AUQA 3PIRA 3CH5A 1DPFA 2QBYB 2IEYA 2FSFA 3FDIA 4OHZA 4URUR 2DFLA 1J8YF 1MOZA 2BJVA 3KKMA 4Q7KA 2EYUA 4TT3D 3U7EB 3GLGB 4QM7A 2C03A 2ZJZA 1M6NA 4GFDA 2RHMA 4Z8YA 3O8RA 4FMCB 3UG6A 2N1BA 4LHYA 1ZUIA 3QKSA 2A9KA 5TY0A 2HF9A 2AHOA 3CPJB 3IEVA 4XH9B 2FA9A 2G1JA 3FKQA 1E4YA 3QPWA 5DI3A 2R6DA 4K46A 2ORWA 3W3ZB 4XWOA 4G5OA 4TYQA 3OFNA 4AKGA 5FFMA 5LD2B 4NCJA 2R6AA 1YZUA 3O8DA 2W83A 2IUUA 5GJCA 4HDQB 4ZO4A 2OFXA 1JECA 1K8RA 1R5OA 2AKYA 5G3YA 2FG5A 3PENA 3B78A 2X19A 1W5TA 4JL5A 2BDTA 4RD3A 3KXIA 2VHUA 2B92A 3R9IA 4LWZA 5E95A 2ZJ2A 3O47A 1CJUC 2OUKA 3GLGE 4WXPA 3BRWD 4HLDA 2C9OA 1RE0A 4LJ4A 5L3SA 2ZE7A 2GZAA 2FE4A 4XIGS 3VR2A 3IUYA 4LJYA 3SYKA 3F0TA 3WY9A 3U44B 4L4UA 5E7IA 5HZKA 3W5JA 1NRJB 4A0GA 4KAXA 3DL0A 3KJEA 5CB6A 1GVNB 4MKIA 3U2QA 3K09C 2ZJYA 3SJCA 2HCJB 4N0DA 1VCIA 4C0BA 1AZTA 2B8TA 1HV8A 4ZDKA 3FYHA 1YZTA 1E2HA 4IEIA 1D8TA 1P9NA 1GL6A 2YOGA 2O8FA 1AIPA 1ZM9A 4ABYA 2BJWA 2G77B 4G5QA 4JT4A 2BEJA 2EYQA 5SZKB 5AJVB 5E7MA 4N1AA 1OXTA 2OV2A 3ICEA 1R0WA 3OEED 2QQ0A 2CXXA 1E79D 1G8FA 4TLEA 1SVMA 3ND8A 1P2TA 3TLXA 2W6JD 2UVQA 2WWIA 4LV6A 4NYIR 3RS0A 4E03A 3I5XA 1UBEA 1VG0B 4B48A 2PH1A 2RGBA 3NEYA 2R44A 3WMEA 4IJMA 4D4JA 5GVRA 2EFDB 2DBYA 3W90A 2OEPA 2ZUDA 1VYTA 1NP6A 4OQXA 2IYUA 2WZQA 1EFRD 1F3OA 2EFHB 3WYAA 2ZSFA 5E7JA 5KYKA 4Q02A 2VF8A 4C9BA 2JLXA 1U8ZA 3V9PA 1H8HD 1TUEA 5J40A 4CIDA 1CLUA 1S1CA 1KDOA 1W4RA 5ELXA 4LZZA 4B3BA 4QNMA 1NLFA 2HXYA 4DCTA 2PLRA 4URWR 1Z0AA 1US8A 2HXSA 1ESMA 5B64A 3B82A 4HUTA 2I1VB 2KI5A 1MRNA 2WIBA 1NLYA 4AURA 3CX8A 1SXJD 1A5TA 1U90A 2P6UA 1J90A 2XAUA 4OHXA 5EUQB 1AN0A 3HYTA 4US1R 4HZUB 4DCSA 2NG1A 5CYPA 4LV8B 2OBLA 2XTMA 5FL7D 3LV8A 3H2YA 1DAHA 1T4GA 4A6XA 2B7CA 3KTAA 5KSOA 4L5BA 3HPRA 2QGNA 5AJXA 2IK8A 2GEDA 2ZR0A 2IF0A 4H9GA 5JSZB 1CRQA 4DT1A 3I8SA 4TWZA 1HE1C 3N5CA 3QKSB 4TMKA 2ZU6A 1P4SA 4OBEA 1TPZA 4TYPA 4D0LB 2ONKA 3EX7C 4MUBA 2XTZA 4QJ3A 2PMKA 3MLEA 1NBMD 3NXSA 4HUQB 1X6VA 1T5IA 4ZDWA 3AVVA 3CWZA 1G3MA 2GXQA 2IW3A 4UNRA 1IY0A 1G6HA 1QRAA 4Q5IA 4V0KA 2OILA 2J7KA 1CJMA 1T8UA 5LB4A 1FFHA 3K0FB 4F91B 3QXSA 3GMTA 1JPNA 2YWFA 4QBGB 2GTPA 4LJ5A 2P0EA 3G5UA 5JFGA 4CT4B 1AQUA 1NVXQ 3CONA 4I81A 4V0OA 1JNYA 4DC9A 3BD9A 2A5FA 4DT1B 3U5ZB 1TQ2A 1Z0IA 1P2VA 2WBLC 2ZREA 4HSEA 4QGFA 3O8CA 2AL7A 1CR4A 1XTJA 3DMNA 2XJ4A 4NMMA 3X1YA 4M4SA 3BK7A 3BXZA 3BB1A 2WSSA 3U4QB 4B71A 4C2TA 4XJXA 4O2LA 3F3YA 3AF2A 1BOFA 1YHNA 1EWRA 4TMZA 4P4TA 2BVNA 2VSXA 3CBQA 5C2JB 4U7DA 3AP3A 4NYJQ 4DLTA 4KBFA 2JLZA 5JJKA 1TQ4A 1XMIA 3SFZA 1W36D 4FIDA 2ECKA 1W4BA 4Q66C 4YLGA 1P7CA 4G5SA 3HU3A 1Q12A 1MR3F 4Q01A 2QUZA 3RVBA 4B3GA 1U2RA 2OCYC 4BLQA 3AVTA 3KXKA 5J4HA 4UXJA 2NOAA 2VSOA 1TF7A 5DE3A 3IO5A 4PPQA 1N25A 2ZS8A 5KSPA 1EESA 1UADA 2BCJQ 3TGPA 4Q4JB 1ZYUA 1DOAA 1RRCA 3QF4A 5CIWA 3M0EA 3K0SA 1T91A 1OFIA 2WJGA 3K9NA 1XMSA 3TUIC 3C15C 1NVWQ 3KFXA 4RKEA 2A78A 2JJ1A 3P4YA 2PLFA 3U7GA 2EU8A 1N5IA 1BYIA 2AWOA 4LBWA 4QFMA 2VP6A 2AWNA 1KJWA 1SVSA 4I4LA 1FL9A 1HUQA 3EA0A 4JLJA 3RS7A 2WJIA 2V55B 4B75A 4F4JA 4JIMA 1AGPA 1GG2A 2BC9A 1OXXK 2ZR9A 4JBWA 2VEDA 2QTFA 2EQBA 3HR7A 4TLDA 2ZRFA 1Y63A 1DARA 2VSFA 4IEEA 2VPPA 4PSKA 4QC2A 1E6CA 4FI3C 4PO8A 2ZAOA 1KAGA 3IEUA 1S8FA 1EG7A 3PUVA 4EPYA 1Z6TA 2ZR7A 3VX4A 1E9AA 1VHTA 2NGRA 2XZLA 3FE2A 1Z2CA 2HF8A 2HYDA 3FFAA 3NH6A 2FSIA 3WYGA 1U94A 1CR1A 5H8WA 4IDOA 5L3SB 4TTRA 3Q3JB 1Z5ZA 1EFRA 4PPNA 4TTQA 3SNHA 4A0FA 4XD7A 1XTRA 3EC1A 4B2LA 1HE8B 1E2QA 3BC1A 2VA8A 1M74A 2Z83A 1A4RA 5AJYA 4AK9A 1E79A 1ZMXA 1A82A 2RGXA 2C5LA 1OB2A 3BS4A 2BMJA 4OYHA 2W6JA 3IIMA 3LXXA 1J8MF 2H7VA 4AC9A 2J0UA 4XTCS 4EFMA 2QL6A 4PPFA 4TMTA 3WBJA 1W4CA 2GEVA 1OV4A 1U9IC 4NONA 1CJVC 4R98A 1G20E 1W1WA 1D6JA 1QHYA 2FFQA 3FKSA 1YJ5A 1NN3A 1QHXA 3Q7PA 3WHKA 1OFHA 1RJ9A 3MWLA 2N42A 3AB3A 5K8IA 5KDDA 2F6RA 1UDXA 2GCNA 4YXWD 1EGAA 1W2GA 4TQ9A 5AR1A 1M2OB 3T06B 2P6RA 5HCIA 4EPXA 1TADA 2GK7A 3B1XA 3X1XA 1Q20A 2ZROA 3BIFA 2DR3A 1NMXA 3AUXA 1GL9B 5TARA 1VIAA 2IBMA 1TQDA 3AGPA 3GFOA 1AJEA 1DAGA 4AIIA 4W9MC 4DRZA 1G17A 3A58B 1WF3A 1YU9A 1EFHA 2NQ2C 4JJZA 2OBMA 1WE2A 2QQEA 3KTAB 2NZJA 1GNRA 4FWTA 1R4AA 2QG6A 3ZLJA 1ZC4A 4V0LA 4ESHA 2FZ4A 4OK5A 3K9LA 1UM8A 2IXEA 2C2HA 3HWSA 2HT6A 5EXXA 2C78A 4ON9A 3NWJA 5EP1A 3RC3A 1ZIOA 4JLNA 1WXQA 4V0MA 5FOUA 5FTJA 3T15A 1US8B 1KK0A 1IM2A 3KUCA 2ONJA 3IKJA 4L9SA 1KI6A 4ITRC 1J7KA 3X1WA 4D2IA 5BN5A 1KMQA 1NJGA 1N6HA 2GA8A 3K0FA 4NCHA 4Q4LA 3DKVA 3VKWA 1ZU5A 3RLFA 5FH9A 3KFVA 4C0AC 2ERYA 3IHLA 4LDJA 3KQKA 4GT1A 4TT3A 3WRYC 4AG6A 4ZDJA 3AVXA 4C0KA 3U7HB 1ZNYA 5JHHB 4CEJB 1XD2A 1ELOA 3B85A 2YYZA 3ADCA 3EW9A 3I4LA 4GMXA 4ZIRA 2E9SA 4PC7A 3QSYA 2HDNB 2WWWA 1GUAA 1ZNWA 3RDPA 2FMXA 4G5RA 3L82B 2IX3A 1KY3A 3D3QA 5DN6D 2F9MA 4O2RA 1NLZA 3FPAA 1O3YA 4M53A 3W8RA 3BFVA 3DDCA 5HKKD 1RRFA 2ZETA 4KYUA 1I4LD 1YZLA 2HLDD 5FUYA 4MKGA 1SHZA 2WAXA 3CR8A 4DDUA 4Q19A 1OH8A 3C8UA 1P5ZB 3M6AA 4UJ3A 3VMFA 4D80A 4DHEA 4C0SA 1BYUA 3CB4A 1E0AA 1H8ED 2QT1A 1DO2A 1QDEA 2ZSBA 3TUZC 5DGXA 4C0QC 5TVKA 4RKFA 2YWEA 1FQJA 3VNUA 1C9KA 1UJ2A 5DIFA 4Q9JA 3QG1A 1JB1A 2ZUBA 3SBDA 2VP4A 3W34A 2IYRA 5JJIA 4M1SA 3REFA 2OG2A 4KU4A 1ONBA 1XD9A 4MYHA 4TLCA 3G82C 4Q7JB 3NTUA 1Z29A 3B13B 3GJ6A 2WV9A 3VU9A 4DLXA 3KL4A 1NIJA 3TSWA 2GXUA 3SHWA 1S1MA 3GCGA 2XNSA 5FBRB 2SHKA 4A6PA 1F48A 4TQUS 3HYRA 1N5JA 5BYJA 1OB5A 2W6ID 1SVLA 2ZITA 1Z63A 2F7SA 2W0MA 3C4JA 1KDTA 1G8GA 2F43B 2PX3A 1OPXA 2W2XA 4US2R 3CRQA 3TAUA 1Z0KA 5DSZA 2FN4A 1XB2A 3C41J 4EDHA 5HE8A 4JJKA 2FDCA 4M9ZA 3THYB 3CWQA 2ANCA 2V7QA 3I5YA 1G7CA 4PSVA 5KOYA 3OE7A 4RJLA 2PL3A 3GJ4A 4Q47A 3EPJA 1OXVA 3PG5A 2RCNA 3PQCA 3GJXC 2JA1A 3WMGA 3UMRA 3FFBA 2O8CB 5G53C 1YZGA 3QY0A 3WHLA 2CK3A 4G5GA 4D4MA 5L3VA 3NBFA 2P3SA 1G3IA 2ODNA 1CXZA 2Y8EA 2C98A 2ZAMA 3IGFA 2HJVA 4LJ6A 1UAAA 2IXGA 4AKHA 3VFDA 5LD2C 5FBVB 5EP3A 2C8VA 4EJSA 3E1SA 3GLGA 3C5HA 1LF5A 4PC6A 3MJRA 5TB5A 3S1AB 3QKTA 1S9DA 3AKDA 1CF4A 4DLRA 2F1RA 2FEOA 2ZRKA 3UPUA 4NTZA 4QGAA 2X2FA 3ECCA 4M8NE 3P1JA 3QE0A 4TL9A 1VMAA 2QI9C 3Q9LA 1E69A 2Z6VA 2A5JA 1YZNA 2J41A 2JIZA 3TW4A 2IYLD 3C5CA 2IS1A 3ZZUA 4GOJA 5KNBA 4GZMA 1VCOA 4NE2A 3OFND 4A2QA 1G4AE 2D2FA 4IVPA 5FOVA 3UIEA 4BUJA 2QSZA 4LK2A 1Q22A 1Z08A 2ZJOA 4MITA 2PJZA 3DKPA 3MFYA 1R5BA 3GLIE 4Q4JA 1MRSA 1PUIA 3SQXA 1J99A 1NVVQ 1P6XA 4DLSA 3U61B 2DCUA 4PXAA 2G9NA 2WMOB 2Q9AA 2OAP1 1RC8A 3CNNA 2ZANA 1SXJB 2DB3A 5F9FA 3W6NA 4A92A 2FF7A 1EFCA 1YR6A 4QHYA 4I1OA 3SEAA 4D0GA 4RD1A 1ZD1A 2JLQA 1KNQA 4RZ3A 4GDFA 3C7KA 2QP4A 5FI0B 4NL4H 3EXAA 4OJKA 3SOPA 1TTTA 3TW8B 1KO4A 4LCBA 3QIAA 4NU0A 5FTLA 5KTYA 3TIFA 5C46F 2J46A 1E2JA 3L8YA 4MDFA 1ZCBA 2PX0A 5FPKA 3K70C 5FUVA 1EWQA 2KB0A 1KYIA 1Z47A 1IAQA 3E5HA 4PQYA 1KI3A 4WIAA 3B8HA 1UPTA 3T1VA 1FUUA 3BH7A 3TQCA 3ZIAA 2YJTD 4HYYA 3I62A 1NBME 1WB9A 4C7OB 4JVSB 1MO3A 1FMJA 2XX3A 5JSZA 2AFIE 5SZHB 2WJHA 2FV8A 1T5LA 3X2SA 4HLQB 4FCTA 1KKLA 4IOMA 2ASEA 1XEWX 1TEXA 2GKSA 3CRRA 1GKYA 4GOKA 1NI3A 3CX6A 3OAAA 4ZCLA 1KI8A 1XWIA 2YHSA 3P27A 1KDPA 1UF9A 4M9QA 1V5WA 2J9RA 3AM1A 4URYR 3FKSD 5EE3A 2V6IA 2ANBA 2YOHA 4L16A 2RHDA 4WW0A 5DYIA 1UKVY 2H8KA 4P3YA 1HT2E 2BMDA 5JCZA 1NVVR 2PCLA 2Q9BA 2DFKB 2QM7A 4GP7A 5J4YA 2BM1A 3SFVA 2DFTA 4AKEA 1AS3A 1JXOA 2W0SA 5L3RA 1DE0A 5CITA 4HZIA 4CEHB 4Q1AA 4TSFD 1R0ZA 1E1QD 2CHVA 4MUAA 1ZM7A 3RWOA 3RRMA 1O87A 2FOLA 4IKEA 1II8B 3BB4A 4OI2A 3PJRA 2I3BA 1GM5A 2DY1A 2Z43A 4IDNA 3V00A 4TMVA 4A82A 5E4FA 2NTYC 1N3BA 1E3MA 4MGYR 3A8TA 4DIDA 1F2UB 5FTKA 5JEDA 2BMEA 1DS6A 3DVLA 4BWYA 3A36A 2EW1A 2GVZC 4RFSA 1P62B 2KSQA 3TSZA 4BLOA 1S3GA 4KO8A 3MGCA 4Q1BA 3HPQA 3OEHA 4H1VA 1NIPA 1MT0A 5FTNA 2WIAA 3AP1A 3N2EA 2GZDA 4GL2A 4QL3A 1CP2A 4DDTA 2O8EB 4HB3A 3U6BA 4DCUA 4IDPA 4MRPA 4BZQA 4ARZB 3KQUA 2CBZA 2GJ8A 3GJ8A 3PVSA 5KU1A 2P2LA 4OI4A 4PO9A 4Q9KA 2FGKA 2IS2A 4NYJR 3B5JA 2QE7A 5JS8A 3B1WA 1XRJA 4BEBA 4DIEA 1F2UA 1KI1A 2AD1A 1N6IA 1XXHE 2QA5A 3QBTA 4Q9HA 3TSOA 3PEYA 3TVDA 1OXSC 3MRSA 2HLDA 2ZYVX 1GTVA 3UANA 2ZRGA 5B58C 5K8LA 5DH9A 2QAJA 2GF9A 1M34E 3GLHE 1ZCAA 2YWGA 3SJAA 4X8LA 3G0HA 3BBPA 3GFTA 1KSFX 4DJTA 4LRWA 2BBTA 4LPSA 3AEZA 2WVJA 3QNUA 5IDVA 2QMHA 5DLQC 2FU5C 2LKCA 421PA 1OHHA 1JR6A 4FINA 4DDVA 2R6GA 3AKYA 1KOFA 3IBYA 2HJGA 4QOSA 2ZEJA 8OHMA 1FTSA 1N0WA 4P4SA 1G7SA 2VRWA 1P3JA 4UXHA 4B73A 4I1UA 2JJ2D 3C16C 3D8BA 3AVOA 1K6MA 3NBYC 2IUSA 5KPJA 1E2DA 2E87A 5KUTA 2JLYA 2XOKA 1ZM4A 1XPRA 3WNCA 2V7QD 1CJTC 4PHGA 4B33A 4F4IA 1XXHB 3ZQJA 2ZI7A 4EFLA 3THOA 1D2EA 2Q21A 1S9HA 1W49A 2EWWA 4P33A 1XPOA 2O8FB 2BEKA 4KJZA 3CF0A 1VG1A 2CCJA 1XTSA 2CCGA 2H18A 1RW4A 3EZ6A 3R9WA 4AY2A 3TBKA 4CW7A 4QJ4A 5EXPA 4UKDA 3RSLA 4PZZA 4EAQA 1NKSA 2R62A 5DISB 1GWNA 1Q0UA 4Q4HB 3QI2A 1TF2A 1M7BA 3T1TA 4ZV4A 4IW3B 4M22A 1XEWY 4GMDA 3B9PA 5B30A 221PA 2XSZA 3DOFA 2O8DB 4M9XA 4NZYA 1RIFA 3SR0A 3N70A 4UNSA 1OSNA 1HT1E 3FMOB 4TTPA 1UBFA 3LVRE 1XX6A 3NBXX 2D3WA 1N2CE 2BBSA 1Q44A 3K9HA 3K8YA 2QY9A 1NSTA 2WWYA 2PEYA 2GRJA 4KLNA 4D4KA 2LKDA 2P6NA 1XTKA 1H8EA 3CPEA 1OFTA 2J59A 3Q7QA 3GJ7A 4MKFA 4BQSA 1W0JA 2P67A 3EZFA 3L2OB 4RCZA 3A4LA 4B34A 1J2JA 4Q4HA 4ZPXA 4UNQA 3K1JA 1UKZA 2XXAA 2PZEA 3SYNA 4CEIB 1WQ1R 5LBIA 2R65A 3S1AA 1R6BX 5EE5B 3THYA 4GOXA 4W5WA 2O8DA 4TMWA 1G5PA 2OFOA 2ZS7A 4KFSA 3LLMA 2QPOA 2YINC 2ZE5A 3KJGA 4JKIA 4C30A 2A30A 2GAAA 2OE2A 2Z4RA 121PA 4MYCA 2YC2C 2CNWA 2B7BA 3QQ5A 5CM8B 1WDTA 1YR9A 2C9CA 5GVSA 4I99A 3QPVA 3FHTA 4C0JA 4OK3A 3THXB 1KKMA 4HAZA 3FB4A 1QZXA 1K5GA 1MH1A 2QGZA 4TN1A 5EXTA 3O8BA 3P4XA 2RH5A 3KJHA 1ZD8A 2NO1A 2O0KA 3IPXA 4RFVA 3NG1A 1B23P 4IDQA 3BB3A 5FL7A 2XB2A 3W9YA 1W44A 3VR4A 2OLKA 4EQ6B 2X2EA 1GRRA 4IFEA 2VHJA 4HATA 1SXJA 5FUWA 3EPLA 3U44A 2C04A 4IXMA 4BECA 2RGGA 4QGHA 4JLKA 1TU3A 2J0QA 4HDCA 3IIJA 2QZ4A 1NY6A 4GI7A 4NH0A 4QBFA 3SHFA 3X1ZA 1FW6A 4JVMA 3PITA 4LI0A 2UZ3A 3B60A 1U8YA 2OCBA 2WSMA 3HU2A 2PT5A 2ZE6A 1Q21A 3PCRB 1G6OA 1XEXA 1IY2A 2D2EA 1KAOA 2XTNA 5BWMA 2ZRAA 3B1VA 2QAGB 3LH5A 4KI0A 5CJPA 3W8NA 5TDHA 2MSCB 3IPYA 1Q1BA 4D82A 1XNJA 4AI6A 5C1BA 4R2IA 1XD2B 3LBHA 3FMPB 5JJLA 5AWFC 3QVUA 1Z6AA 1UEIA 2BKEA 4M0LA 1R8QA 3N2IA 1B0UA 1S2MA 2D74A 3AVUA 2FFBA 3W3AA 1COWD 2ATXA 2HT1A 3EG5A 2IS6A 2JLSA 4QHTA 4A8JC 3FTQA 1IJFA 1ZU4A 4MQBA 2DWQA 4GZLA 2F1JA 4E09A 4EKDA 1KDRA 2CL0X 1MKYA 3MCAA 2ODBA 3SC3A 1G18A 2ZJBA 4BFSA 4ZKDA 1RRGA 5M04A 3K53A 4P4UA 2O8EA 2D7CA 2OZEA 1EX6A 1XU4A 2O8BA 5IT5A 1NKTA 1SZPA 1P61B 1JXMA 3HU1A 4QBHA 2ZRIA 3NC1C 2GVDC 2ZSEA 4K81B 3UK6A 2CK3D 1SGWA
chains in the Genus database with same CATH superfamily
3A1WA 5FT9A 2JGRA 3FAKA 3QVMA 1UBNA 5JY1A 1K0FA 3B5IA 4HXYA 4Z0PA 5CFZA 3QVGB 1SVNA 3PGXA 3X44A 2IUEA 2XT6A 3GG2A 3MMPA 1PR2A 1U2SA 4BB6A 1M1YB 2UYYA 5B58T 3G8BA 2RHOA 3QEMB 4L07A 1TC1A 4OSEA 4J6FA 1NBEA 2BGMA 2C4TA 2YJGA 1LW7A 4JWKA 5ESDA 4AWAA 1ZVQA 4EYEA 1NW7A 1BH2A 4KEAA 4S2EA 1SCNE 4O4JF 4BKUA 3OCCA 3GLQA 4G0NA 1SC1A 3UJ3X 3L49A 4U7JA 5B3KA 4JEMA 4KKVA 6ABPA 2RBKA 5BV8A 1ND6A 3A1VA 2WG0A 3QFFA 4XASA 3HCDA 3VI4B 4OOFA 2IDKA 4UNIA 1NI5A 1OAAA 4GZ3A 3RUCA 4WXRA 5B6IA 1KK3A 1N2XA 2D5AA 3NP7A 1ISGA 1RCFA 3STVA 4EITA 4W6QA 5KIAA 2FQ1A 1T0PA 1FLDA 1JAIA 1YE5A 2W8BA 1BMQA 2XQIA 3GWZA 3N07A 4I08A 4N18A 4Z1MA 1ZMBA 3GRKA 2JVIA 1JR3D 2W6PA 1N2BA 1THGA 2WU1A 2XKAA 3OIUA 4QFBA 2ZYGA 5ADVA 1KAMA 5DULA 1WMBA 5FRDA 1AGRA 1Q1EA 1GKUB 2CLSA 5LLSA 2P4SA 2CJWA 4QIHA 2CNOA 2PKEA 1V5FA 2Y0EA 4E5SA 5HHTA 3IBGA 7MHTA 3MJEA 4H7DA 1W9HA 1YK1A 4GSLA 5K0LA 2WIDA 4X8MA 5TMDA 1WIWA 5J59A 3JWGA 3BCUA 4QWMA 3CNLA 3EXIA 3PNLA 4GLLA 2V6MA 1C1YA 4K7JA 1YOVB 1ZDMA 2JFFA 3A6ZA 2O14A 5BT9A 3U3DA 1I4DD 2Z9DA 4MW4A 3RUEA 3ZE9A 2E37A 4HNQA 5C7IO 3D7MA 2JFUA 4RENA 4IV0A 4I4IA 1VPWA 4PIVA 4U02A 4NMLA 4NOJA 4R3WA 2JEZA 3MOGA 1SC4A 4HQ0A 1N6RA 5C5DA 4M3NA 1B6GA 3H11B 4P58A 5IBRA 3CVWA 4M7OA 5FORA 3N8KA 4KOAA 4TTIA 2H1HA 1DCFA 1HC7A 4UBNA 3ANNA 3K8ZA 4MAMA 1LTHR 4M83A 5AI6A 5A0TA 1VYUA 2CF6A 2Q4EA 3IA7A 2EFJA 2PSEA 3GGGA 2IU4A 2ZRPA 3PKJA 2BBWA 2AKAB 3VVCA 5AUOB 2DZDA 4O3FA 5LNK1 3LPMA 3V8NA 3AMVA 2GILA 3T4EA 3TRKA 4ZP1A 4UE3S 1ZR4A 5HTOA 3KAQA 2W6ZA 5K0CA 1UBSB 3O7WA 5K99A 1F9EA 2CUNA 2DULA 2WKRA 4RCVA 4DLPA 2OAEA 1QVAA 3C48A 3E70C 3DOJA 1Y33E 3CPSA 3GAAA 2ZJ8A 1RVV1 3NXKA 3OZIA 3PXDA 4ZO7A 1NDQA 1APBA 1HLGA 2HMWA 3I09A 4R0NA 2HEIA 5TV2A 2DUNA 1TTQB 1I6MA 1S4QA 2AN3A 3PC6A 3VPSA 3J7AC 3KB2A 1GNTA 2ZI5A 1U7HA 1VCMA 3N2ZB 4J07A 1QIKA 4TZ0A 3OE4A 5IN5A 1JJ7A 2CLDX 4IO0A 5JUWA 1UK8A 5ED4A 2BIFA 2E4ZA 2XZPA 1PT7A 2G9ZA 4PM4A 3AVQA 3Q85A 4MVYA 2FFJA 2FFHA 3L0OA 1V3TA 5F1YA 5CLJA 5BUQA 5J4LA 3GLHB 3O8NA 1LQTA 2ATEA 1UBKS 1J2YA 1UP7A 2VYQA 3G2MA 4DDWA 1NA5A 2RH4A 2YS7A 2O23A 4P31A 3ZTYA 2J9YB 1ZH2A 4Y18A 3HM2A 4YEDA 4C21A 1Q0HA 1TM3E 3KKQA 2Z5GA 3Q1LA 4G1MB 2IXFA 3RC2A 3DB2A 1AKEA 2B37A 4LYHA 5CIQA 5KVQA 1A1SA 1GA6A 4ZVPA 3IV9A 1AS0A 3VR4D 2X6RA 2ZI4A 3DAOA 1P1JA 3FOZA 2AN9A 1ESEA 5AVYA 5I9IA 3TQFA 4OB8A 1OW3B 1SOUA 1DHRA 2I4NA 3AOEC 4WKPA 2JJ2A 1E4VA 2KBFA 2Q6VA 2YZGA 2F1KA 2IHBA 4S35A 3UK0A 4DLWA 2AK3A 1M1XB 3DKKA 4EZBA 2DE0X 1KL7A 2WP0A 5EMHA 5TQ0A 4BMCA 1T36A 4MRMA 2VSQA 3LGXA 3B1JA 4QYIB 1S0UA 3IAAA 2P4HX 4BEWA 4URHA 1B43A 1M67A 2LCQA 4B9EA 1USUA 1LPSA 1V1RA 1NVTA 4HFJA 1E9SA 3CLUC 5DLPA 3WKBA 5JSQA 3ONNA 3PQ5A 3PJGA 1H42A 1EINA 4JVNA 1T3LA 2BH9A 2WTAA 4WASA 3T35A 3EZLA 1B0PA 2AG0A 5FPHA 5YASA 4OI1A 5FD8A 4EENA 4C5AA 2WABA 1YC2A 4M38A 1RXUA 2B2NA 1ECBA 3E8XA 4RK1A 4YRCA 5AVOA 3PC7A 2NP6A 2Z8ZA 4X1YA 1KZ7B 2EDAA 3QUAA 3A1DA 3PC2A 1DAPA 3RAGA 1SCKA 1EXMA 4MROA 4OD0A 1NULA 2LCFA 2C54A 4KOEC 1L4UA 1UP6A 3HB9A 5TPZA 4GBGA 1F60A 1C7IA 1JFLA 1CQJA 3BFKA 2WE7A 3K9GA 3N8DA 1A8SA 2YYAA 4RKYA 2G06A 2GHQA 2JPDA 3O1JC 5JO0A 2AOWA 2YYYA 3CPHA 4J0FA 4NP6A 1BJTA 1T0UA 4OQFA 2EKZA 4R7GA 2RBGA 3B9QA 4TYWA 3PEUA 1VJ0A 1QIDA 1KE1A 4CKEB 4G2NA 4M21A 1T1JA 3ZX5A 4CV2A 4JHLA 5TGZA 2BWJA 3PHIA 2VH1A 3IUPA 4WBNB 4PIMA 1L5NA 3O2QB 3RKUA 1AUPA 1XNQB 2X0KA 5HXAA 1SXJC 3GDHA 5DEOA 3KXDA 2P1ZA 4GUAA 4R9UC 3HXMA 2YV5A 2QTLA 3GRAA 3NAGA 3R1IA 3TVYA 4KE6A 4CUJA 5J2UB 1XEXB 2OWEA 2UUCB 1KPIA 4FFBB 3KT0A 4XZ3A 3QKUA 2P91A 3FWHA 3O8OB 2E3JA 2YZ7A 5CT5A 1Q95A 1Y1TA 3DEFA 2DWCA 2HA0A 3S68A 2NXEA 4BNLA 1DQZA 1UWVA 1O9GA 4JLMA 3EXFA 4HY3A 4R9NA 5AVJA 3GZJA 1WM1A 1CB0A 4IHAA 5FKJA 1T0IA 3EVFA 3K71B 4V0ME 4BRUA 2VKQA 4WD3A 1DI0A 4WADA 2Y71A 4HDRA 2DHCA 4X66B 3KSDO 5BNTA 3CVOA 2E1PA 1L4FA 1RRVA 1C3OA 1XVUA 3IAUA 4Y1RB 4CDNA 2BGLA 5JTUA 1M7GA 2GRUA 3EZ7A 2F1HA 4A4DA 5AVZA 3RRZA 2Q9UA 2UV8A 4AIRA 3GJ3A 1VMEA 4PE5B 13PKA 3KELA 3W2FA 2G72A 3FVRA 2VAVA 1ZP6A 3EA5A 3H0EA 2IS4A 4OL0A 2UZ4A 2Q5HA 4IIBA 3Q8WA 4Z86A 4HB4A 4EY5A 1V11B 3DP9A 4JLVA 3U3KA 1U8EA 4I5EA 2G1KA 5ALSA 5HBRA 9ABPA 3LVQE 3V1KA 1G4UR 2LIPA 4G07A 4KMMA 2C7OA 4KHPB 4DMUB 3MMNA 4ARZA 3WFZA 2P1RA 3SYTA 3VX3A 1ODLA 2V03A 5AOCA 5I7OA 1N78A 1NR1A 5EZ6B 2ZUWA 3DVQX 5COQA 5GV7A 4MVXA 4NDAA 5CVCA 1BKSB 1UPCA 5ALDA 1WB5A 5T3YA 1Z4IA 1VPDA 1GO2A 2PNFA 5LU9A 1MVLA 1OLUB 3Q9NA 4ZQCB 1DINA 1TAQA 3CF2A 3L8DA 4INPA 4L5JA 4P8RA 2QQFA 2OPHA 3T34A 7MDHA 5L6MB 1N77A 4Q3OA 2PS0A 3UT5B 1JHPA 3IMEA 2OPBA 2I80A 3STXA 4DQUA 3O4HA 5HIKA 1K8XB 1E60A 2X4LA 3IXLA 4KE7A 4LYJA 5EVJA 2OO7A 4B3SB 1YJBA 2GESA 2VUHB 3R41A 1SKYE 2NUBA 3LP5A 3MTGA 3LCRA 3P0EA 1RU3A 1YIOA 3QU4A 4OJTA 5BRNA 4OLJA 1K2WA 4DV2B 2V9PA 1X14A 1ATZA 4RSGA 1KI9A 4TX1A 2ACVA 1JXAA 5J2TF 4AP6A 2UZ1A 2YV1A 2N46A 3E3AA 3FLBA 4L6CA 1Y7TA 3EULA 1SZCA 2H16A 1J2UA 3MOSA 4CM3A 4Q3EA 1NM5C 3WMRA 1ANKA 1E1DA 1U4NA 2VT2A 2PUVA 1SB8A 2IXTA 3G7NA 5GQSA 5CBKA 10MHA 1FRFS 3UGQA 3TNJA 3KYCA 3L0PA 1E2FA 4DLZA 3B1YA 2Z1MA 1MDBA 1B1CA 1U7ZA 4D25A 2P9GA 2ZK7A 4EG5A 1YB4A 3FLAA 4JB0A 2WM2A 2ONZA 1PS9A 2PMDA 2X7XA 3JARA 3MILA 1ECJA 4K3UA 4RQBA 5EJ6A 3A9UA 3O3MB 4ETMA 1SO8A 1A2QA 2BFPA 1KQPA 2M9MA 3D8UA 4TLAA 3X1MA 4NCNA 5EZQA 3KUKA 1OJLA 3HXKA 4JQZA 3LQQA 2PGJA 5SV2A 1H4VB 3DDNA 1P60A 3MINB 2H0AA 4ZFNA 3EPHA 3ESYA 2ZE8A 3GJ0A 3VSBA 2P3LA 4EG0A 2RIPA 3LQYA 1FDWA 4MA4A 4CEHA 4FCVA 2GN0A 4C4TA 1IY8A 3HVJA 3MJCA 2O5VA 3IIIA 2FNAA 4QDJA 1URPA 2BGIA 2Q41A 1FFXA 4OJMX 4CKYA 3A6PC 3UJAA 3LCMA 1MNAA 1UT5A 3DMGA 4R3NA 4XCXA 2BCEA 3W4IA 1GT6A 1E2UA 2FSPA 2IEGA 2EFCB 3EY9A 4RM2A 1PQPA 2QUIA 3UV3A 3QTLA 2NSDA 2RHJA 1CZLA 1Y9EA 2QY6A 4QHSA 1UR5A 1EGVB 4MKZA 1W52X 3RK1A 3TZHA 1DDGA 3QA9A 1OLXA 3D8TA 4QM6A 1E9FA 1Z6XA 4KVFA 5AK5A 3RYFA 4H35A 2IOQA 5KTKA 5GJBA 1WV0A 3RANA 2C07A 3CWCA 4NEGA 3BA6A 5EXEA 5JZSA 2WKWA 3WE7A 1AA9A 2PLWA 5EP2A 3AT1A 5B1DA 3PEWA 3RNOA 1P0QA 4QSMA 4BZWA 5D85A 1TCUA 2XA9A 3LJKA 3LWBA 3KQSA 3FOCA 5D86A 3ZS8A 5LWHA 5DM70 2IYAA 1ZUWA 5L7WA 5LU8A 3OT1A 1QV7A 3D5QA 4ID3A 2CLLB 3K0AB 3SKYA 2GAOA 4LF7B 3D2LA 4F2WA 4J0IA 3B3QA 5KNCA 3S8EA 1NSYA 3H1AA 3L92A 1UWCA 4P5DA 2P3QA 3ZBPA 4B34A 3KJZA 2Q6TA 3MXOA 2ZRBA 2BHSA 3M6VA 2GCOB 3N8NA 2VNKA 4Q3DA 1GTJ1 2XQFA 1PAUA 3ORFA 4YJHA 4B3DA 4E30A 5CXQA 2IHUA 2WNHA 4BTEA 4I3GA 5KB3A 7ADHA 3MGBA 2NNLD 5KNBH 1L4YA 4BQFA 1MZVA 4KIJA 1EX7A 3TSCA 3DYBA 4B8WA 3KEGA 2IIBA 5EYPB 2NTNA 2EFYA 2DWUA 3T0IA 1E92A 1TTHA 4X94A 4GECA 4BNVA 4ND8A 2WU4A 4A3SA 4F7DA 3CSSA 3ZVKA 4JLDA 1D6MA 5IZCC 5C7YA 2H3HA 4GQBA 5HOEA 2REXB 2B61A 4JT2A 4Y0VA 4ECAA 1W5SA 5BVHB 1XCJA 3KEMA 3Q3VA 1H23A 3PJDA 1JQAA 4LKOA 1W5EA 2NUTB 4N5LA 4WNAB 1QG2A 3GPIA 1MOSA 1QHGA 2Y9PB 3BDVA 4G0OA 3JD4A 3U81A 1Y0BA 1MGOA 5J5VA 2E6KA 3GLIB 1QPZA 2C5FA 1OYYA 4UQPA 5A9SA 1TA0A 3M1YA 1L5OA 1Y1RA 4MLPA 3QV1A 2YIMA 1BWSA 2YV4A 1N92A 1D5CA 3KSAC 4YQEA 4CMBA 1K7EB 3PNVA 2NU6A 1UKCA 5I48A 4J4BA 1XJQA 3BZUA 4TM7A 1XDZA 4F5YA 4OHFA 5U9CA 4KFCA 2ZIZA 4M1MA 2PUEA 4NS1A 2NU8B 3A1UA 3KZ1E 5ERYA 4ZQFA 1DP4A 1X8JA 3D7RA 1SQ5A 1QUEA 3HTXA 4MWOA 3JQGA 4RIEA 5GP1A 2FR1A 2P7IA 3A4MA 1W6RA 1Y5LA 3I9JA 4DB4A 4AUMA 2WHQA 3QENA 1G16A 1J39A 3KPJA 3WB1A 5EJ9A 2H63A 3BTUA 4M2LA 4CVNA 4G0UA 1QZTA 1JALA 2APJA 1UC9A 4F5WA 4MICA 5LPNA 1OT3A 1ORVA 2FN9A 4BMPB 4E7OA 4XSGA 2AOTA 3BSWA 3OSZA 1U1EA 2OXFA 4LV5B 5AHWA 4AY4A 3SPXA 3JRXA 1G19A 4GLJA 1H22A 4PAMA 2CUTA 3TPCA 1KI6B 2QG9A 1WVMA 3R7WA 3TLJA 3U3ZA 4A0RA 2O05A 3O91A 1T5HX 3AOGA 3ZHOA 1MIOB 1P0MA 4DCJA 1B0ZA 5ECWA 4F04A 2O8NA 5KX5F 4O4LB 1XCBA 4Q18A 1J6UA 2WM9B 1GGJA 3L46A 2HPHA 1PZFA 1RVDA 2I2CA 1Y7HA 1P7YA 1RQGA 2IODA 4GM4A 4WXYB 1RZRD 4IYRA 3K5PA 1ZJ4A 5EXDA 4HI0E 4MRSA 2OTCA 1AO3A 1X7HA 1BS1A 4BGIA 2V8OA 1KNXA 3NKFA 1YCGA 3RVLA 1ABEA 3GA0A 3ZXIA 2GEUA 4DUGA 2FUG1 4JFAA 4ZIRB 4FZ3A 2ATIA 3FTEA 1R8JA 4MV3A 3WNZA 2A9JA 3D54D 1FDOA 4GWLA 3TVTA 1QP0A 3ZDCA 1DAFA 4COOA 1GNQA 4KODA 5IS2A 3PF9A 3PUYA 4QATA 3AEKA 1XTQA 5KVSA 1LDBA 2AD5A 1IH8A 1XU7A 2F1IA 2C3PA 2XYRA 3IDQA 3KHUA 3DHWC 3KVRA 8GPBA 3GDWA 3AIMA 4ND4A 2HUNA 3F8TA 1TYDE 4G01B 3SJBA 5KSWB 3ENQA 4O2AA 4C2BA 4OYRA 2XOKD 1J0EA 1LS1A 3NEPX 5A4FS 4EY4A 1REQB 1XDBA 2WDZA 2WWHA 2PS3A 4ZPJA 1M7HA 3AC0A 1AHIA 3WKEA 2YVLA 3F96A 2CDRA 5EJ5A 1RBYA 4IINA 1VPEA 1P7VA 4XVRA 5FYDA 4AZWA 3DJFA 1KGSA 1XZJA 3DFUA 2YRFA 4RD2A 4YJGA 1JLLB 1GTG1 3EMBA 4DTCA 3V4RA 1QGDA 3FTFA 3I72A 1UMBA 5T8KA 3K1AA 4IOJA 1JZSA 2W2VA 3BH6A 1NC3A 2R2GA 1LPBB 4WACA 4D9HA 2HX1A 1U4SA 4YMGA 5JV5A 2JG3A 3TNFA 1BROA 3BMQB 3JATA 4JLBA 4M87A 3VYVA 2WUFA 3PWSA 1HPLA 2BR4A 2W2MA 3A14A 4FR2A 2ZULA 4QTUB 3EJ6A 1YS6A 4ARVA 1HMYA 4XWWA 5IDYA 4QO8A 5ALFA 2VN8A 3D2BA 3DOHA 4JYBA 2ZIFA 1X7YA 1M2EA 3TZLA 2ECPA 4RULA 4ND2A 2VQFB 3GJ5A 2XZDA 1AZSC 3NYIA 3RRXA 4ACBA 5JD4A 2VTKA 4HX5A 3E2IA 4DA0A 3IVCA 1BU8A 1QTIA 4HB2A 5GADl 3FI0A 1OI4A 5ITZB 2GHTA 3RSQA 4B7AA 3JWEA 5K45A 2CNKA 3S81A 1NUAA 3JYQA 4FYKA 2ZSDA 3D6MA 2OL4A 2PR2A 1P1BA 4R1MA 1QPGA 2EIHA 4NAUA 1FQKA 1C0PA 2AJBA 2Z3ZA 2FWJA 1PR1A 1OLXB 3UJNA 1B14A 2QL5A 3BGWA 2CDAA 1QU3A 1TO2E 1W47A 1ZBDA 4OQ4A 2QJWA 1WPXA 1JWAB 3E27A 2EGUA 2XEXA 4JDUA 1QZZA 1Z0DA 4MV4A 1GFZA 2ZWAA 9LDTA 4JLAA 5BN5B 3RB8A 4ZEMA 2I4OA 3ETHA 1U2GC 2VG8A 2W58A 4LFBB 3SM9A 2F90A 2HIAA 3AF6A 1IQPA 1FNSA 4R8VA 3SJ7A 4NHOA 3ZV7A 4LRXA 4JKYA 5E6SA 5JAUA 3M83A 2P9EA 2BPOA 1SIOA 3TINA 4E2ZA 4J90A 3MQ4A 1P9OA 1QSGA 3KV3O 4A1FA 3I73A 5FV4A 4L15A 1IHOA 5BMOA 2EG9A 1ACMA 2IDMA 3ZXYA 4BMVA 4URFA 4EGQA 2YL2A 1OZHA 3RFXA 4GBJA 4YMUA 3JAMA 1Z6GA 3PNKA 2HU7A 1SPBS 4LC0A 3QEJA 3PXGA 3TK1A 4AP5A 5HZHA 4UBIA 1Q1QA 3GPBA 2ZT7A 4YRSA 3FNBA 4RTQA 1A71A 1MO4A 1Y6FA 1NBWB 4Z2YA 4NBVA 3O83A 3HC7A 2C7BA 4CL8A 1IN4A 4HYEA 4MI1A 4RD4A 3LIPA 4DMHA 5REQA 2HIMA 1CWUA 1GN8A 1PIWA 1Z39A 2FMHA 3MGAA 1VJDA 3UA4A 1SVOA 4CL0A 5CDFE 4UPDA 4ZQBA 4ER0A 3WWCA 4I5DA 1ZM3A 3UHFA 2B6NA 2HK9A 2VJQA 2PX4A 4WVLA 3UMSA 1D4ZA 2GAIA 5AKYA 2B3DA 4HWSA 4BNGA 5L9AA 1OZAA 4O4HB 4YK7A 4BPBA 2CXHA 1ZUNA 1OBOA 2R4TA 1RYHA 4Q48A 5FPSA 3VJRA 4JYPA 1SMKA 3S1LA 2CZQA 1TK9A 2P4UA 2IYSA 2KBEA 1G2PA 4EG7A 3BN3A 2GN6A 5C4IA 1V6SA 4YJFB 5G0WA 5LFAA 2IKQA 2OHVA 4CLRA 4DIBA 2ZPUA 1FMTA 2ECQA 1Z7YA 2I87A 3ACCA 5LDHA 4WK4B 3QNWA 2DWOA 4M0FA 4NYMQ 3K7EA 1VL6A 3D8NA 5E3JA 3THWA 1EEHA 1X7XA 2PYZA 1MC5A 1V1RB 5TVGA 2FZWA 4YRAA 4RVFA 5AW7A 2FMKA 4LF5B 1KMHB 3LM8A 1IJEA 3ZV4A 2VIIA 3FGOA 5JU6A 1JVBA 1TMKA 1W4ZA 1YRLA 2OXRA 4UMFA 1Y34E 1YU6A 2X9LA 1KH3A 4R1TA 1M8FA 4ZAFA 3K94A 4O25A 2XCOA 1XE3A 3TUJC 1R9GA 2HTEA 3M5WA 1Y3BE 1SVKA 2XMCA 2ZVQX 5H1YA 2NU7B 3TI9A 4BKQA 4RD0A 3C4QA 1CDDA 4I66A 2XUPA 3MLBA 2IEZA 1ARZA 4L5AA 1AS2A 1UK9A 1YNSA 1GIAA 1PEDA 4KBYA 4BVHA 1K8ZB 3NHYA 2OHXA 3G0BA 1EIZA 1QYXA 2JKVA 1PHPA 2OO5A 2RB4A 2FQQA 2WC1A 3P0IA 1T3SA 1FMLA 4W7SA 3RUDA 1UODA 2PIDA 1NXTA 1KDYA 4BOYA 5EJ4A 4EY7A 1I7QB 3DBRA 2OA0A 1DCKA 5BQPA 1EFLA 4MINA 2XUQA 2W4IA 2VOJA 4GR4A 5BR7A 2Q5EA 4NMXB 4FYYA 3N6VA 2D1YA 1IQ0A 1DC5A 4CV0A 5I6DA 1RC0A 4FYIA 1L7MA 3NIBA 3TIVA 4F2PA 4MW6A 1GD1O 1OE0A 5DXAA 1T3HA 1NAIA 4O4HF 3M9XA 3RAFC 5BWLA 3WYFA 2DTEA 4OK6A 5THQA 4IUDS 3L7IA 4IBOA 5I7VA 2DLNA 4ZXPA 2PM8A 2IEAA 2VNAA 5AW0A 3HJTA 1HLDA 1BTOA 4OQMA 1DEAA 1ZNZA 1BO6A 2A7QA 2UXDB 2P2YA 2YTZA 5HKOA 2I2WA 3S8YA 3K31A 4IS3A 2QP3A 4WN9B 5IAAA 1FDVA 1T4BA 4V03A 3KZNA 1Z07A 3GUUA 4C6SA 2NUAA 1RCUA 7REQB 1PKXA 2RJ3A 3AR5A 3VSEA 5HCUA 1YO6A 2FPUA 3MW8A 4C05A 1R10A 2HMUA 5AVUA 3GAMA 3KKNA 5IK2D 2JIDA 2OAQ1 1HLFA 1M6HA 3LUFA 3NGLA 4JAVC 4LJSA 1LS6A 4IDDA 5IJ9A 2EXXA 1YRYE 3FCOA 4WA7A 5KYGA 1DJOA 1KFCB 3DM9B 3S2EA 3Q0TA 1A8QA 5TF0A 4X00A 4RTMA 1P0FA 3RT9A 4HT3B 2AOXA 1E0KA 2NIPA 4NOLA 4HPJB 2Y4OA 4PONA 1OBVA 3LWZA 3VOAA 3WYCA 4WE3A 5EINA 1DAOA 4ZHQB 3ESRA 1F8GA 3MSCA 2A6PA 3CE6A 4WVFA 5KAPA 1UBHS 3G1TA 1RM4A 4XUGB 4UQOA 4Y0NA 4DQLA 4EYKA 4OX9B 1IXZA 4CM4B 1YFKA 5EIFA 3UXEA 3VYTB 2F48A 3AEQA 1WDKA 2GJAA 1Z2EA 2V3VA 2AF3C 4PYQA 3DHNA 4X7PA 3SQWA 3AR9A 2OGWA 2W6IA 3EFEA 3HP7A 4Y2VA 3IIKA 2IYVA 2XE8A 3CN9A 4HBGA 4Y6QA 1CVLA 1WCIB 2GR9A 1TKBA 4PYOA 1E4OA 5G4KA 3WLJA 3KPWA 3LPCA 1C8LA 3NOQA 5WRFA 1ZHOA 1J2TA 3UK7A 5GGYA 3AUTA 4YUWA 1B73A 1BQ3A 4IIJF 4YAEA 3VTKA 3AUAA 1P2SA 5JWOA 1K3UB 3SGLA 2Z30A 3TLZA 4HAYA 3FUVA 4J29A 4RORA 1ZUNB 3V4FA 5C8XA 4PS0A 1Q0PA 5MN4A 4N3NA 1M2OA 1VHDA 2VK4A 3CN7A 2FPXA 4L8GA 3VPHA 1Z25A 5JHGB 3HYNA 2OGZA 1CBUA 3KSRA 2CDBA 1PQWA 5T7BA 3KETA 1PZEA 3W5UA 1XV5A 4GYWA 3VZCA 1KU6A 2RHCA 1QZUA 3GLSA 4MKHA 3IPLA 1QOZA 4LMRA 4OB7A 1L7QA 3GCDA 1SZJG 2AQKA 3EXG1 3JALA 1R00A 1M2WA 1U98A 5B57C 4JVOA 2W2LD 3OTOB 4JBIA 1N4AA 4ABTA 1JA1A 3LX6A 4L4ZA 4XYGA 3HBLA 3RWBA 2GYVA 3KFLA 3WGLA 4QEDA 4MYDA 5IFKA 2QU8A 1VLZA 4IICA 4JODA 1AQ6A 1TKAA 1WDLA 4DV3B 1X9GA 4GYYA 4C0WA 5LNK6 5C7OO 5I4BA 2QTTA 5GPBA 4Q1CA 3HRIA 4LNUB 1UDBA 4XWTA 3JRWA 3KKLA 1QFZA 4X62B 3AU8A 2JL1A 3LFHA 4RABA 3H84A 4MMYB 5IAKA 4WOCA 4ZXFA 5HKKA 3O9VA 2D5LA 2TECE 1WXHA 2IXAA 1AKQA 4ZCPA 3ANXA 3TR6A 4B6QA 1T15A 3J7TA 5LIRA 4DLAA 1XT6A 5JI3E 2C58A 4YRBA 3PYMA 4Q7MB 1XTIA 2QSJA 4G09A 1GLGA 5T4HA 3DDWA 2A8YA 2GLUA 2IP2A 2VYFA 4DIUA 3A7EA 4EIWA 2PH5A 3CYFA 4CI9A 3F97A 1TGVA 4P2GA 2WD7A 3S28A 3P9CA 5C80A 5I9LA 2EZ4A 2DU8A 2XYVA 3E7PA 1BGVA 2ONCA 3C98A 1GRVA 3DR3A 3KAPA 3W8EA 1RPZA 5TIIA 1UKYA 1XCPA 1ECLA 2CC2A 1FK8A 2W6NA 4YRTA 4F06A 4EMTA 3FR8A 4LBZA 2FW0A 3KEOA 3HUUA 1DU4A 3E48A 4DMCA 1IZYA 2B9EA 4DY4A 4PLZA 1R5NA 2QYHA 2ZRCA 3JAWA 4PNHA 2FPRA 2YN2A 3NT5A 3VSAA 5KZMB 5L51A 2UDPA 3X1DA 2FPSA 1N6NA 2Z4TA 5K8UA 3LCJA 3RR2A 1U0SY 4WK6A 4HQ6A 3S70A 3PA8A 3L5KA 5AI0A 4GE0A 5EIEA 1P2UA 2OQIA 3N0VA 1L5LA 4OKIA 3WNVA 1T43A 4AL4A 2ZTMA 2IU3A 3PHJA 3NHBA 5E1DA 3VR3A 3IUSA 3OIYA 2ORVA 4KQWA 3PEVA 4FSXA 4B3RB 3UXHA 2CMKA 1M2KA 1CLEA 3T9CA 4R41A 2QPLA 1FUIA 3RRJA 1RYEA 1PLJA 2Z2KA 3GEGA 4QXQA 2AFIB 5IAEA 5BYKA 3H5OA 2CV0A 1FP7A 3B1ZA 3FWPA 4IIFA 2H4JA 4HVCA 1NXQA 4TSRA 1IU9A 3ICQB 2QEQA 5HPYB 3L43A 4BN0A 1CX9B 3SBEA 4DIKA 3CM0A 4QREA 5CXSA 2I54A 1YE8A 2NUPB 4Z4HA 4ZEVA 3V4ZA 2QNRA 5HRCA 5JY6A 5L53A 2ZBFA 2JGJA 4GGPA 5AW2A 4BLPA 2MSWA 4ZT4A 4DGSA 4FHFA 1HYQA 1A2OA 3QLEA 4L3OA 1BE8A 2C94A 4DNQA 1CYEA 3IP9A 2AG1A 3AG6A 1UMCB 2PCJA 3QUQA 3C3DA 3TEJA 5JEEA 1FVXA 2YIJA 3LHDA 4AN1A 1GQYA 5K1ZA 3K0EA 1DC4A 2XV1A 2ZJAA 4P4NA 2HYIC 5B2FA 3OZXA 1QH0A 4YGYA 1UKAA 2PU5A 1ENZA 1ONSA 4CTMA 1D8AA 3ZGNA 4B76A 5DNEA 3ON5A 4YDQA 4DWJA 1BDIA 3K2BA 3ZWVA 1NLMA 5HQJA 1QQ6A 5KTRA 3IT0A 1JT9A 3LLUA 3GNQA 5HF9A 5B3AA 5TMPA 3H97A 2WG1A 4FTWA 3REGA 4O63O 5EWMB 4FHCA 1FX0B 2QJRA 4QYTA 4ZYWA 1K9VF 4EJFA 3KR0A 1E98A 3BMNA 2JLRA 5CCEA 1WBBA 3N2NA 3FYSA 3I23A 1VA4A 1FFBA 4I6EA 1N1MA 4QDXA 2WUEA 4LYYA 1NVMB 1OD6A 1YJ8A 5EFOA 4PF1A 2VHTA 1G8YA 2JAQA 4AAYA 2F1OA 3M6UA 2XUKA 4WGFA 1KAEA 4I7EA 4L72A 4TKUB 2IY9A 4CF7A 1J70A 3M82A 3P9KA 4LI3X 4F4FA 4KR2A 1XZKA 4Q05A 521PA 4HEA1 2CYBA 3KE9A 1IZ9A 1IHDA 3L6CA 3T7SA 1E2LA 4YB8A 1DJNA 2V9ZA 2HMSA 1EX1A 3B2QA 4PC1A 5IABA 1YAJA 2KPOA 4YI3A 4NJMA 3UV6A 2XZOA 2AKEA 4AN4A 3FF1A 4TV8B 3M1IA 4MZXA 4NENB 3B7WA 2OO5C 3UGKA 1XWFA 4G41A 4B7UA 1EDEA 1TYCA 2CNDA 4UE6A 3DZ8A 1RI4A 3M9LA 2F3TA 2GARA 3AINA 4LJAA 3EFBA 5HRUA 1F2TB 2VJOA 2JFWA 2X1MA 4BFYA 4ZCMA 1CRPA 3HJHA 1L5WA 3AVPA 2VCEA 4QKQA 1XRRA 1SHTX 2ASVA 2P41A 3H1FA 4BJHB 3FNGA 3OZGA 4DNFA 3BMOA 1WA5A 2I6UA 1DAEA 2RARA 4TQAA 4C0XA 4KFTA 2Q3FA 4V0RA 4ENUA 2EZ8A 1NVBA 4KXYA 5G1NA 5K3AA 1ULUA 3BGDA 3ZCQA 3W5DA 1ULAA 1GR1A 1QBGA 3ZS9A 5KTNA 1I13A 4MO9A 4YYZA 5DYYA 4M37A 2DUJA 4U2KA 4XCQA 3IPRA 1W6UA 2HNKA 2WPDD 4HAUA 3VRHA 1VKOA 3Q8XB 4ONEA 1UCFA 3II6X 4KNWA 3KBBA 4N7JA 3RBAA 5HFNA 1P1FA 2YV2A 3IOMA 5KC8A 3VZDA 4MVJG 3PFWO 3GC6A 2BI4A 4TL6A 5FBWB 3CG4A 3GRRA 1AA6A 2I03A 2YX1A 2VCYA 1D9XA 1XLWA 3ZWWA 3X43A 1M2HA 4PCVA 1RWQA 2OOKA 1SBTA 5CG1A 4BWFB 4A6XA 2F8SA 5JTTA 1WOYA 2QVYX 5BP7A 3Q0EA 4UEJA 5JMPA 4DJFC 3ITNA 2PFKA 3FBTA 1XZPA 2I8AA 4L8FA 3H65A 1C4KA 1HKHA 3KSUA 4K6CA 4B74A 1G8MA 3Q7RA 4YVFA 4J7CA 1CQIB 5AXAA 4AUEA 4BNHA 5TLSA 4ZC8A 3STUA 4HLUC 3WIBA 5AM2A 1X74A 5KQMA 1HDEA 2CXPA 3B3GA 1KI2A 1TZMA 3ORSA 5CR9A 3N6RA 3SF0A 1X7ZA 2X8LA 3DMRA 1WSBA 2PYDA 4DBVO 5KYXA 1RFLA 4JVLA 1DC6A 4XRRA 3MTIA 4BFVA 4DMKA 3TX6A 2MR5A 3GVHA 4LEIA 1KEWA 4BO1A 1T8SA 4AMZA 2BJVA 2EW2A 2ZKIA 3KKMA 4Q7KA 4TT3D 2RKBA 1M6NA 4LRSB 2RHMA 4AJ2A 4BMSA 1RXIA 4Q9AA 2JB9A 5ALOA 3SVTA 1VMKA 4FMCB 4O4JA 2CKMA 3Q15C 4UUAA 3UG6A 2Q5IA 4N6NA 3SSNA 2CKDA 4JP1A 5LP6A 1AKWA 3QKSA 2A0KA 1STOA 4JYAB 5TY0A 3B9BA 2HF9A 2AHOA 3R6LA 3IEVA 4XH9B 3VHQA 4PWZA 1DC8A 3L6BA 4GD3Q 1N7HA 3FKQA 2RHRA 1PJ2A 3OOHA 3HO1A 2PO5A 3A06A 3QPWA 4X95A 3HCPA 3FG9A 4WOBA 1RKXA 5LD2B 3EEQA 1WV1A 3NCHA 2IUUA 3NAZA 3UHPA 1FFAA 4PLYA 4ZO4A 2OFXA 1JECA 3COPA 2FG5A 2XIQA 4UUNA 4UU0A 3N3BC 1RS0A 4JL5A 3WL5A 1RSZA 2BDTA 1L1QA 3ACBA 3D2AA 4JSRA 4K6MA 2VHUA 4C7VA 2HDHA 2H59A 3EDRA 1JEQA 2LD4A 5E95A 4YMLA 4MVWA 4LVCA 3BRWD 4UTNA 1IK4A 2AW5A 4N5NA 3FDXA 1RE0A 3OMLA 4K26A 3W04A 4ENPA 5L3SA 2FE4A 2GB4A 4RPIA 3QU2A 1UL1X 2AOVA 3F0TA 1CV2A 4Z2AA 1QQ5A 1ZD4A 4CU5A 2DQ4A 5B1HA 1NRJB 3FCYA 4XGKA 1MQ9A 1JKXA 3IJRA 4Y1EA 1GU7A 3G0IA 3V5NA 2RHGB 1CR6A 4N12A 4X64B 3WZMA 1EJ2A 2B8TA 1YVPA 4ZDKA 1FMFA 1N2CA 2CVQA 1XA0A 1GL6A 2YOGA 4K1LA 5FEUA 2VRBA 5EJFA 4TV8A 4V2UA 3ZEAA 2C92A 4MPTA 2H7XA 4LDNA 2XMBA 5IM4F 1EKXA 1D2AA 5SZKB 3MS2A 3RBXA 1PVVA 3ICEA 1OXTA 1LVHA 1N3YA 3H04A 1TM1E 4RACA 1ZI6A 3UA3A 1E79D 2IEBA 4TLEA 4ZT2A 2GEBA 1WUTA 1CZHA 1E61A 2VP3A 3AERA 3DLIA 1XC7A 3TLXA 3QQPA 4DR2B 3V8MA 2O2YA 4MVCA 1K6IA 1PNVA 1PR4A 2UVQA 3ONDA 4FU0A 4E03A 1NNLA 4U9UA 1VG0B 3EWNA 5A7HA 2GN4A 3D8HA 3I2GA 4IJMA 3DCNA 3WLTA 1Y3DE 1XKXA 1ZMRA 3VR5D 1C30A 1JG3A 1L6RA 1G60A 1T4DA 3FTDA 4TTJA 3ZZNA 2FN7A 2RC5A 5IG2A 3OCUA 2IYUA 4QUAA 4QT4A 2I4LA 3F2VA 4E5PA 1EFRD 1BEEA 1VI6A 2NYRA 3U4HA 3DTVA 5KOHB 3IKLA 3SSOA 3BEDA 1T1EA 4AFNA 5H3LA 4RMNA 3JXEA 1QTQA 1NONA 3VV2A 1Z16A 4F6RB 1GPAA 3ROXA 5KYKA 4WN3A 4C9BA 3W7VA 1N8SA 1T2DA 2Q4OA 2GPAA 1S1CA 5SYMA 2Q5OA 2W2PA 1ZX1A 4IDFA 3F9IA 4RVUA 4LZZA 1EFAA 3A2NA 3UNXA 3BKXA 1E6KA 4BO8A 5GOTA 1IBSA 3F73A 2I7VA