5FI1B

Crystal structure of the p-rex1 dh/ph tandem in complex with cdc42
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
FMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
total genus 53
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fi1B00
3GJ7A 1G3IA 1UFQA 4ZI2A 3TUZC 2JLZA 1RIFA 2H18A 3A4LA 1G3MA 2FPMA 2QMEA 2ZYTX 1EFCA 1FMLA 2ERYA 1VECA 3ZIAD 1Q3HA 1G3QA 2PMKA 2WKPA 2ZRFA 4OHYA 4Q7LA 2HF8A 3QXHA 3KFVA 2EFCB 1ZYUA 2W2TA 2QAJA 4F91B 4ITRC 3SU8A 4QBGB 1H8EA 3BOSA 1U0JA 4BEBA 3VU9A 2KB0A 2JASA 4OQFA 4BLOA 2IHYA 4QJ4A 3ETLA 1XF9A 3F5FA 1CU1A 1GKUB 2IK8A 5FBVB 4WOPA 1OXTA 3LVRE 6Q21A 3GJ8A 3NG1A 3PEUA 3LBIA 4WXPA 4AURA 3IPYA 1ZBDA 1YR6A 5FUVA 4CT5A 4JVSB 3ZVLA 1ZUIA 1UDXA 2W58A 1XWIA 3KDSE 4DDVA 1P61B 2R6GA 2GCOB 2J5XA 1TF7A 3QBVA 4PAMA 3U3MA 2HV8A 2A5GA 2OCBA 2WJYA 4OI2A 3U7EB 4BE7B 5IHPA 1TPZA 2WIBA 2V1UA 4DRZA 2V9PA 3REGA 1N6PA 1L7VC 1P9NA 1TQ6A 1YR7A 2ZITA 3QF7A 1Z0KA 4HLCA 1NLFA 4D4LA 2VLIA 4Z1MD 3L0OA 1XTJA 2QPOA 1VCOA 2ONKA 3AEZA 2IYYA 2IS2A 2Z6VA 1JPJA 2ZROA 4FWIB 4M9SA 4JLMA 4NE2A 4R2HA 5CM9C 2XZPA 4JVLA 3Q5DA 1RRFA 2OLKA 2YINC 1W44A 1ZM2A 1BH2A 4KSBA 4ZIRA 3PEWA 2JJ2A 1O3YA 3FKSD 3KJHA 2P6NA 1DVRA 1XCMA 3EWSA 3TH5A 1FUKA 4P3YA 5DN6D 1P72A 3ZVMA 5EP1A 1R6BX 4C30A 4M1KA 1W47A 4IVQA 4TL7A 3FGNA 1PUIA 1HQCA 4G3XA 1JI0A 4AWXA 2ZAMA 1A5TA 4XOIA 1I4LD 1TQ4A 3I5XA 1Q12A 2FNAA 2H1LA 2BMDA 4A0GA 3GQBA 5J4YA 4EJSB 1JR3A 3BFKA 1Q44A 4PAQA 5J4LA 1ZD9A 3AUYA 2YC4C 4A6XA 3CRRA 1G64A 1T9HA 3GFOA 4U5XA 4XJXA 5EXPA 4Q9IA 3EIHA 5K8TA 3M0EA 1XXHA 2KE5A 2F55A 3CF0A 1V5WA 2ODBA 4HATA 4MDFA 1KO5A 1HH4A 3AVQA 3LXXA 4F93B 1BYIA 4LDJA 5DHFA 2QQ0A 1S1MA 1P2UA 2D7DA 3R7WA 1Z5ZA 2RGBA 3ICQB 4EAQA 1F2TB 5EP4A 5JI3E 1EWRA 1Z6AA 1ZM7A 3PUZA 3RSOA 4UNNA 4OHWA 1AGRA 4M1WA 1ETUA 4FMDF 2XAUA 2ZETA 3FPAA 2P67A 3WY9A 5L8VA 2JLSA 2ZR0A 3NH9A 2J7PA 4QGAA 1NSFA 4D0GA 2Q9AA 2G0NA 5G41A 4QKQA 4TQAA 5E7JA 2ZEJA 3P27A 1E3MA 5FPTA 3BBPA 1GKYA 4MGZR 3TQFA 1E2EA 4CEHA 1KI3A 2ZRGA 5KOYA 1NN3A 1SXJD 1RJ9B 2VA8A 4QHTA 1AZTA 3UMFA 1E69A 4DLZA 4ZDIA 2GVZC 5KDLA 2F6RA 2WAYA 3THWB 1KSGA 3CR8A 3QPUA 4TSFD 3UK6A 3P32A 5ELXA 3L0IB 2ZREA 1HURA 1Z0FA 3ZH9B 1TU3A 1S1CA 1OIVA 2AD1A 2GJAA 2NTYC 4A8JC 4DBLC 4D2IA 3PITA 1N6NA 3ASZA 5UKDA 2R6CA 3Q8XB 3SYKA 1L4YA 2KBFA 2DPXA 1DAIA 2CK3D 1X3SA 3RNLA 1XTQA 3CIOA 1WRBA 3QIAA 2FF7A 3RDPA 4J0QA 2FDCA 1J8MF 1US8A 5TXGA 5FPHA 2Z4RA 2ZM5A 3DL0A 4RFSA 1K8RA 3PJRA 4TQUS 2XJ4A 3NWJA 2QI9C 2A5YB 3KZ1E 5BN3A 1MT0A 2DR3A 3NHAA 1KSHA 3V4RA 1VHTA 2QA5A 3DMNA 2CK3A 5JCZA 3WP1B 3T5DA 2ZUDA 3KKMA 1RC8A 2IS6A 1GL7A 1JXOA 1MH1A 4ZV4A 5DH9A 4O3MA 4JT4A 2C8VA 3BGWA 4MA4A 3NXSA 1XD8A 1T5LA 3FFBA 4Q21A 2XB2A 2JJ1D 1GNQA 2A7QA 4OQMA 4URYR 3S1AB 4M8NE 4GPTA 3EA0A 1CBUA 2QM7A 3T1VA 2F43A 4I1OA 4K46A 2PZFA 1Q22A 3I62A 2GZHA 2GJ8A 1CF4A 2GF0A 3LV8A 3PCRB 1JR3E 4P4UA 4AI6A 5LBIA 1U2RA 1FTNA 2ZI9A 1CRPA 1T3SA 2AFIE 5JI2E 2BV3A 3F8TA 1XU4A 3CNNA 3M6AA 4KCGA 4EQ6B 1E2PA 2CEAA 4L8GA 1E79A 3BB3A 3T34A 2CCGA 3SJZA 1VG8A 2GHIA 3MWLA 2OCAA 5SZKB 1IN4A 2CNWD 1A2KC 1KO8A 1NIPA 1P2SA 3CWQA 5M04A 1A1VA 3FTQA 4DEXA 2BMJA 4TYYA 1OT3A 3B7GA 2VP2A 4RKEA 3UATA 2OAQ1 3NC0C 2NMVA 2NQ2C 221PA 1CTQA 4KU4A 1SGWA 1X8KA 1G8YA 2IYUA 1KDRA 1NLYA 4RD1A 4Q4HA 2G1KA 1FMJA 1T6NA 2QQEA 4NYIR 4NP6A 1FP6A 1PLJA 2ZJBA 1HQYE 4QBHA 2QMUA 4F38A 4NZYA 4B34A 4GBMA 4DLYA 3H1TA 1G17A 4FW9A 3BS4A 2CVFA 2W00A 4DCSA 2ZSEA 1Q21A 1NVXQ 4KXFB 2FEOA 3EW9A 1PVOA 1NP6A 4A8JB 1C4OA 1P2VA 2CBZA 1ZM9A 2BWJA 1RVDA 1KI2A 5EQTA 2AWOA 1UKVY 4YXWD 1P60A 1ZNXA 4RKFA 2ZI7A 1MABA 4P31A 1M6NA 2OSBA 1GDDA 4Q4LA 4NPHA 4A8JA 3AVVA 1YHNA 5CM8B 5JFGA 1U81A 3VX3A 4ZDJA 3GFTA 4PC6A 3A1TA 4GFDA 1S9DA 1RKBA 2GK6A 1P2TA 1G7SA 3AB3A 1W48A 2O52A 2WWXA 4ACBA 1DG1G 2ZS8A 5DIFA 1W36D 1CR1A 1UF9A 2FPLA 2N46A 2ZS9A 4E07A 4KYUA 2ZPTX 1G9XA 1TUEA 3A4NA 4HAZA 2WIAA 4BQSA 4HAVA 2A5FA 3SR0A 4HI0E 5CIQA 4XTRA 5AUQA 4B3CA 5K8LA 4URXR 2XX3A 4L9WA 4HZIA 2JLQA 2ODNA 4DCVA 4WVFA 4PXAA 3T1TA 4UXHA 1NBMD 1IN7A 2JDID 2QP3A 3TAHA 1GFIA 4QC2A 3RSLA 2ZVQX 4Y0AA 2XZOA 5ANRB 4JMPA 3KXLA 2GF9A 4IDOA 1DAGA 5JWHA 3LW8A 1CEEA 1S3SA 5FOWA 3QVVA 2CDNA 2REBA 3W3AA 1RRGA 3MCAA 3CRVA 3H4MA 2IC5A 1GAJA 1VG9B 2JLVA 4DSUA 1E0KA 3X2SA 1OH5A 4LBZA 3TKLA 2JLXA 3EX7C 4BLSA 5JRZA 3NC1C 4YMUA 2HLDA 2IF2A 4MUAA 4HLDA 1EK0A 3AKCA 1G8FA 3CKLA 4CRWB 4FCTA 2R6AA 2J9RA 1KJZA 1QF9A 2FSFA 2WJHA 3HU3A 3KKOA 4KBGA 5TVKA 1NG9A 2MSCB 1IJFA 2ZAOA 4Q01A 2MMGA 2YWGA 1S3GA 4U7DA 4HAUA 4JLNA 1SVLA 4I4LA 2JCSA 2AD5A 1VCMA 3QPVA 1NN5A 1II0A 3W8NA 1G18A 2EFEB 5FFMA 4NH0A 4AKIA 4LJ5A 2BOVA 3WMGA 2PX3A 4B74A 4DJTA 1OPXA 3KQUA 1MO4A 2FFAA 2VPPA 2YOFA 3C5HA 3TJZA 2VRWA 5HZKA 1N3BA 1KI9A 2PL3A 3MJRA 4QFMA 2XSZD 4TMTA 3ZJYA 3C4JA 1OXUA 1WDTA 4XIGS 2DFKB 4HDQB 1WA5A 2A5JA 3WBJA 4D4JA 1W4CA 2GZDA 1R7RA 3LLMA 4URWR 3AVOA 4L9SA 2QRNA 3QF4A 3PXGA 4D81A 4WZ6A 4P4SA 1LF5A 1GNRA 1OE0A 2OBMA 3U3RA 3I72A 5KSOA 3FVQA 5FR1A 2ZJ2A 3C5CA 5JECA 3PG5A 1G8HA 3IKJA 1E2QA 1FOEB 1LS1A 1GL9B 2FG5A 3PUWA 2FA9A 4LJ7A 3B1WA 2AL7A 5EXSA 1HE1C 3AM1A 4QRHA 2OT3B 4I81A 4BFWA 3U5ZB 3E70C 2YHSA 1TADA 4B6FA 1OJLA 4GMXA 4LV8B 2GEVA 3FKQA 3K0AA 4BLTA 1FZQA 4DLVA 1U98A 2GXQA 5LPNA 1YU9A 2EVWX 4G5RA 4EFLA 3AQ4A 2YNMA 5F9FA 2HJGA 2C2HA 3LBHA 4L4UA 3WNBA 3D3QA 1K6MA 4K81B 3IILA 4LHVA 2PEYA 3AVYA 2ZU6A 1GL6A 2IX3A 4DZZA 1NMYA 2QL6A 3U7HB 4HEJA 5CK5A 4A82A 4DLTA 2ZSDA 1QBKC 4JLOA 4Q1EA 4RZ2A 1E4VA 1IONA 4MGYR 2RMKA 4EPRA 2HF9A 5F2EA 2P6UA 5L3RA 2IYZA 1FL9A 3TQCA 1SKYB 2W6JD 2PT5A 5EXTA 2J59A 1KI6B 2RGEA 1W2GA 1FX0A 5A4JA 3SHWA 2ZQ5A 1VYTA 3VHXA 2IYTA 3K70C 5LDDC 1MO5A 3LH5A 4EPYA 3AF2A 1OFTA 3TUJC 5TMPA 4MKGA 2O5VA 1Q1EA 2AKAB 2R9VA 4PPFA 5TDHA 1Z0AA 4B3FX 1MO3A 3ZLJA 2VEDA 2QROA 4KAXA 2GBLA 2PH1A 4JKIA 4Q02A 1COWD 5BWMA 4NU0A 4BZXA 1E32A 2FJUA 4I1UA 2O8CA 4LC0A 4B3XA 1E2GA 1KO4A 1UKYA 1AA9A 3R7WB 3LLUA 4EIWA 3I73A 2QPAA 2LKCA 2Q3HA 4MYUA 2JAQA 2Q9BA 3MRSA 5SZJA 2IYRA 2VIIA 4TMVA 2QMHA 5DN6A 4HSEA 2G77B 1ZC4A 4R9UC 3SOPA 1OW3B 1W49A 2GRJA 1H8HD 2ZE7A 3SEAA 2XXAB 4LJ6A 3FWYA 4PC7A 5FUYA 4LWZA 4D25A 2O8BA 4GMDA 4LUCA 4OQXA 3WHLA 3WHKA 3VU9B 4C0BA 1F6BA 3B9PA 5DHAA 1W0JD 2C9CA 4L16A 4C3ZA 3JVUA 2ZI4A 3SN6A 2GKSA 1QHIA 5LB2A 3TR0A 3ZQ6A 1FP7A 4Q1BA 4D4MA 2BM1A 2F1HA 1GSIA 4O2LA 1H65A 1ZU4A 4O2RA 1XRJA 2OO7A 1YE8A 1XEWX 2ZU0C 1J7KA 1SHKA 2GTPA 1AQYA 3TGPA 1Z29A 4IJMA 3LVQE 1QHXA 2BM0A 5DI3B 1Z07A 5IRCD 4JYBA 2Q9CA 5BYKA 2QP4A 2GBLC 2ZI5A 5L3QA 2OBLA 2OXRA 4QBFA 3EAQA 2EFGA 5KSZA 4FCVA 3AKDA 2GXUA 4NCHA 1XX6A 3LY5A 5GJVC 1YZUA 1UAAA 4A0FA 3NBZC 2BBOA 3SC3A 4C0HA 3HP1A 5FOVA 1S4QA 2P3SA 3BB1A 3B1ZA 2CMKA 4M9ZA 5C46F 1XMIA 4HAWA 4ON9A 1Z08A 3GP8A 4NCNA 1Z22A 1I4DD 2OE2A 4RZXA 4OI4A 1B0UA 3B1XA 3M1IA 4RFVA 3SYLA 1R8SA 5JJLA 2I1QA 1OXXK 4NHOA 4MYTA 2ZRLA 2MSDB 3OHMA 4LJ8A 1PUJA 1W4AA 5JWRA 1KOFA 3K70B 3AP3A 3GFPA 1F2UB 2ZYUX 4LI0A 2ORVA 2EFDB 2H17A 3TK1A 4B32A 4B43A 4ARZA 4PHHA 2ZYWX 2YJTD 3LBNA 1U0LA 3SFVA 2VP0A 1JJVA 4PHGA 4EPWA 3IPXA 1PLKA 4OKSA 3RC3A 3FHOA 3V9PA 1N6HA 1F2UA 3QKSB 4RD3A 1W4RA 3EZ7A 1GVNB 3A8TA 4BLQA 1AJEA 1NVVR 4C0QC 3NBXX 1Q1BA 4ZDKA 1OHHA 3T61A 3IIKA 1NKTA 5BW8A 3TW4A 2F3TA 2XNSA 2GA8A 2SHKA 2FSHA 3X1ZA 1S0UA 1XPOA 3OIWA 5JEDA 2JJ2D 2VTKA 3KJEA 4UNQA 5DE3A 3WNCA 4Q7JB 1Z28A 3SZRA 1SXJA 1XEXA 1Z2AA 2FX3A 2AWNA 3QKTA 1D9ZA 5BXQC 4XWOA 3PVSA 2DWPA 2ZUCA 1LV7A 1D2EA 2PJZA 3R20A 2VO1A 2P5SA 2ZS7A 1F2TA 1P6XA 3WXMA 4EDHA 4Q1DA 2CLSA 4B35A 1XZPA 4DUGD 1PZNA 5IDVA 1CR0A 2YYZA 1KMHB 2C78A 4DDTA 2GJKA 2OFWA 1DADA 4ZCIA 2GK7A 3VR3A 3X1DA 1CR4A 3BWDD 5AJYA 4IOJA 4MITA 4C0JA 2OFXA 4DDWA 5H68A 2XXAA 3RRMA 5BN5A 3CW2A 4XVQA 3P4YA 3B78A 4D80A 3DZ8A 4MRRA 5FPKA 5IT5A 2N42A 4II7A 1G8PA 3K9GA 1F3OA 1K5DA 3LXRA 1YR9A 1R0WA 1QDEA 1E2KA 3H86A 2R8RA 4DLXA 4Q00A 4B73A 3P4XA 1JQJC 1ELOA 2BJVA 1DAHA 2FE4A 3HYRA 3A1VA 3GEEA 4IDNA 2ATVA 2CHVA 2CHQA 4M21A 4RD4A 1N5JA 3L8YA 3FMPB 3MG9A 3QKRA 3WYFA 4C0SA 1IN5A 4HLQB 4A6PA 4IOKA 4B6EA 1F48A 5FI1B 3O8BA 1WE2A 1WCV1 2BMFA 4BGDA 4ILEA 3KX2A 5BYJA 3IHWA 4WIAA 2Z4SA 1N6KA 4WZBE 2EYUA 4JT2A 2DWQA 1XJCA 3ND9A 2WMNB 3CPHA 1G5PA 2J41A 3Q9LA 2ZSFA 1AK2A 1RYFA 2QM8A 4NBSA 2OM2A 4NONA 4ABYA 4KODA 3K9LA 2JLUA 3TSWA 2QRZA 421PA 4HB4A 2XTNA 2V6JA 4HLUC 1AM4D 3KB1A 2FFQA 1D2MA 3UPUA 4TTPA 1P5ZB 1UEIA 1E6CA 3F3YA 4D0LB 4G1UC 1DAEA 1XEWY 1T8TA 1S8FA 4LV6A 1SHZA 3PUXA 3EIQA 5AR1A 4R71A 1Z63A 1N5KA 2RGAA 1UBGA 1E9BA 2WM9B 2ZI3A 3BC1A 3I5YA 3THYB 3SJAA 1G291 2J0UB 3T12A 4CW7A 3IBGA 4MRSA 3TSZA 2ZR9A 1Z6TA 3Q3JB 4HB0A 4JYCA 3NIBA 2W2VA 4N3NA 2OXCA 4M4SA 4ACAA 5JEEA 3RS4A 1TU4A 1ZVQA 3QKUA 2GXSA 4N0EA 3SS8A 3ZZUA 3RHFA 1SXJC 3QNUA 3IHLA 3DO6A 2DHRA 3QOFA 4IRUB 1GM5A 3VR1A 4QHSA 4FD2A 5LD2B 2J0UA 1NN1A 1XB2A 1MRNA 3FHCB 1SULA 4NYMR 2A3RA 2XOKA 3NDPA 2G6BA 1TX4B 4WXRA 1TMKA 3AH8A 1YKSA 2IWRA 3BH7A 1GRRA 2ZRMA 3WMFA 4DSOA 1Q0UA 4ZCMA 3DOFA 3GLFB 2A9KA 4DLRA 5HCIA 1QHHA 1Z8FA 2PT7A 4ESVA 2QTFA 3I92A 3K70D 2Q3MA 2HT1A 4V0MA 2W83A 2ERXA 4XSGA 2CJWA 3L0SA 2QENA 1GRNA 2QAGC 3DM9B 3PUVA 5KSPA 3RWMB 2HXSA 1NLZA 3SHFA 3NVAA 3IIMA 3QI2A 3RRYA 3WP0A 3K09A 2IYSA 1QHSA 2QSZA 3DZDA 2O0HA 2VHUA 1C1YA 1CRQA 1VPLA 2ZRPA 2BEKA 3FB4A 5KPJA 4Z1MA 1Q57A 4PHTA 5AWFC 4JSYA 1NJFA 2Q3FA 1JR6A 1Q20A 5J4VA 1P4SA 1E9EA 3W90A 1AS2A 2C9YA 2ZRJA 2ZE5A 1KDOA 3FOZA 4C2TA 4PQFA 1VHLA 1E1QD 1HUQA 1Z83A 2I1VB 4BLPA 1ZC3A 1NBMA 2LKDA 2JDIA 4IDPA 2YOHA 1X6VA 1DAKA 2QU8A 3A1SA 2GJSA 4B3GA 1FTSA 3I4LA 4QGGA 2NO9A 1NI3A 3NDBB 3CZQA 1XTIA 3AV0B 3KTAA 4LOAA 1OLOA 1TNDA 1W5TA 4F4JA 2VHJA 4NDZA 3VKWA 4D82A 1D9XA 3RS7A 3QXSA 4ZDWA 3W34A 5E7IA 3RRZA 2D2EA 4A4DA 5BN4A 4FWTA 3E2IA 4A36A 2QGZA 2HXYA 4LSGA 4YMSA 4UJ5A 1MO6A 3BD9A 4AKHA 1BOFA 3QEJA 2NPIA 1GKIA 2BKEA 1SVIA 1ZIOA 2DY1A 1JR3D 1VCNA 4DSNA 1VDZA 3BRWD 2HLDD 3HU1A 5CLLA 2GILA 1Z06A 2JLRA 2RGGA 2RHDA 3NHBA 4PFSA 3RS2A 4Q4AB 3GLIA 1EESA 1YZNA 2VF7A 2ZRAA 1E0JA 4X8OA 4CEHB 2W6IA 1RFLA 2P6RA 1DG3A 4M1TA 4HAYA 5CIWA 5DISB 4TZ0A 2KSQA 2QEQA 1NY5A 5FL3A 3AVWA 4QM7A 1Z6GA 4CF7A 4CYMA 2NZJA 2IXFA 4C0LA 3BORA 1E2IA 4IEIA 3CF2A 4UJ3A 1ZD8A 3CZPA 4GOXA 1U8YA 4W5JA 4M0LA 1DARA 4B47A 4LYHA 2ZRIA 2LCFA 4OK6A 1UBFA 2RHMA 1XMJA 1N6RA 3SJBA 4JZKA 4DDUA 3BFVA 3EIEA 2GJ9A 4EFNA 3VNUA 2RGCA 3HR8A 4KITB 4BFUA 2VBCA 1R2QA 4MGIR 5FOTA 4WBSA 1SVSA 1XBTA 3AF4A 2J7PD 1CKEA 3K0EA 2BBSA 3QEOA 3VNVA 2PZEA 4XWKA 4YMVA 4RFSB 3O8RA 1U8AA 2FN4A 2I3BA 2HCJB 5B64A 4QG7A 4DXAA 2ODWA 1E4YA 3DOEA 3FE2A 2NPFA 1S2MA 1J2JA 4A2QA 1NVUQ 2WWYA 1WB9A 2CJWB 4TTRA 1WBDA 5FL7D 3DM5A 1T4GA 1ZCBA 4BFTA 621PA 1EFRA 1A4RA 1GITA 1ZCAA 4G5SA 1R0YA 1KSFX 2V4ZA 3QBTA 821PA 2X2EA 4JLKA 4MKIA 2OCPA 4BWYA 2WMOB 3LQQA 2QT0A 1KDPA 3I8XA 4GZMA 1SVMA 2B7CA 2ZJ8A 1RYHA 2F1JA 1KK3A 2RH5A 5FPSA 1TEVA 3D7MA 5FOXA 3ICEA 4YDHB 5KNBA 3C41J 3E5HA 2XSZA 5G53C 3RANA 3SNHA 4POAA 5P21A 5H70A 4BPBA 5G3YA 2E1RA 4KFSA 4MDEA 4PZYA 3IBYA 3GEHA 3OIVA 2XOKD 2XTZA 3QG1A 1G41A 2CE7A 2B8TA 3CRQA 3ADDA 1KO1A 3ASYA 3OAAA 4UNRA 4LHZA 1K5GA 5J4KA 3W5IA 4UXIA 4DSTA 1PV4A 2XNDD 1ZRHA 3TVTA 3IEVA 2I4IA 5L3QB 2IYQA 5JS7A 2QNRA 4ZKDA 1US8B 4IXNA 4LYJA 1JB1A 3DKPA 3TAUA 2ZYVX 2CL0X 2HEIA 3AVTA 4XTCS 4UNPA 4M9XA 2BBTA 4GSYA 1KY3A 4A0RA 2NG1A 1Z0JA 3KUDA 3T5GA 2ORWA 3CF6R 5DSZA 4V02A 4UXJA 1LW7A 5CDFE 1ZMXA 2WWHA 3NH6A 5L3SB 2DWOA 3CR7A 3PFIA 3PIRA 3PV0A 4FIDA 2Q0HA 4B2LA 2X19A 2J7KA 4EPTA 1IN8A 4WZAE 3VFDA 3P1JA 2ZANA 1VIYA 2JJ8A 3LAWA 1OKKA 3KKQA 4BASA 4URVR 3R8FA 1E79D 1IXSB 2ODEA 3AF1A 2B21A 2ZE6A 4NCKA 3S1AA 4TMZA 5B57C 5DYGA 2GCNA 2R65A 1QZXA 1IJEA 1Z0DA 1XTRA 2GWHA 3NTUA 2V7QA 1T5IA 2J3EA 721PA 3B13B 1XEXB 4PC3A 1XEFA 4TMWA 3AP2A 1IXRC 4RD0A 4US1R 1XMVA 2E9SA 2F9LA 4EQ6A 1E98A 1ZINA 3FDIA 3RVBA 1D8TA 2DFLA 2HCBA 1G21E 2GEDA 2MMCA 2RAPA 1L8QA 2QSYA 4JBWA 4IHQA 2ZE8A 4PC2A 4F4IA 3U7GA 1TTTA 2OESA 1TL7C 4PO9A 5J5CA 1YRAA 2O0JA 3Q7QA 1KDTA 5GJCA 3K1JA 3ZIAA 4A15A 4AYTA 3EZ2A 4O25A 1G7CA 1SVWA 4JL5A 1G4UR 4YC7A 3EZFA 1NSTA 2P0EA 1BIFA 4ZCLA 1G8GA 2WICA 4P4TA 1ZD1A 3B5JA 2VSXA 3BERA 3LRPA 1KGDA 5JHGB 2GCPA 4UKDA 1O87A 3BH0A 4FI3C 2EQBA 1FW6A 2H5EA 3AKEA 1JECA 3JZMA 2JIZD 2F7SA 3ZDQA 4C4PA 2FU5C 1DS6A 3UWKA 4Q1CA 3N70A 1JBKA 1ODFA 2V54A 4LHWA 3SQWA 3B8HA 4BFSA 5JJKA 2QY9A 4QGHA 4Q4HB 2YOGA 4B33A 3HR7A 4A0HA 1GTVA 1LTQA 1SKYE 2REXB 4IDHA 3U44B 4AKEA 1MOZA 3QF4B 3B6EA 4NL4H 3SQXA 4KBFA 1BO6A 2WPDA 1KHTA 3KL4A 1FNNA 2H92A 2FZLA 1W4BA 4FN5A 1GP2A 3HYTA 1XZQA 1H8ED 1GUAA 1IAQA 1KNQA 4LRWA 5JSZA 1G1MA 3R8CA 4JS0A 4LYFA 2B92A 3CH5A 2C96A 3LO5A 1HT2E 1KI7A 3QE0A 4YMWA 4PQYA 4TMKA 4QNRA 1H8HA 4B76A 3TR5A 3ADKA 1MKYA 1T0HB 5L3SA 2C9OA 1AQUA 3Q85A 3MWYW 1HT1E 1NMXA 2ZUBA 1XXHE 1GOTA 4BFYA 3NBFA 3DEFA 3EC2A 4TT3D 5KSYA 1ZNWA 3MWJA 1KZGB 2AK3A 2QG6A 4RSGA 4MH0R 4NYJR 2EFHB 1JQLB 2F3RA 2FZ4A 3BH6A 2F9MA 2PCJA 5CJPA 1S96A 5SZHB 3TVDA 5G3ZA 3ZD7A 3J81k 1NVVQ 2OAP1 4XD7A 3B82A 3EZ6A 4TYPA 3WMEA 1SQ5A 4GP7A 2WVJA 1W2HA 3PR1A 4B71A 4PR0A 5A0FA 2A5DA 4UQOA 4V03A 5AJZA 1W7AA 4JBXA 1L4UA 1WP9A 5JRJA 2R2AA 2WOOA 5FBWB 1Z2CA 3O8DA 1U0HC 4K8OA 3L0PA 4Q9KA 3NBYC 4US0R 2AK2A 2VQSA 3KKNA 4QM6A 3THXB 3ZVRA 1J8YF 2GDJA 1YZKA 4KFTA 4TLBA 4R2IA 1ZNYA 4OHZA 4NYIQ 1F60A 2CL6X 3IGFA 3P26A 2BMEA 5GJBA 1CS4C 1E1RA 4Q1AA 1FQJA 4Q19A 3HDTA 3IIJA 4HB3A 1UEJA 4G5GA 2Z0MA 3JZAA 3UG7A 4TL9A 4KLZA 4E5UA 3QUSA 1JNYA 1FUUA 3HWSA 2O8EA 5EE9A 2FSIA 1QHGA 4DWJA 2XGJA 1E9FA 3RS0A 4DT1A 1YVDA 4TN1A 1D2NA 1P73A 1OB5A 4HUQA 4LZZA 2NGRA 3AKYA 3T1OA 2IUUA 1GIAA 4ESHA 1GWNA 2Q6TA 1EG7A 2FFHA 2O8BB 2OFOA 1KJYA 4NYJQ 2NO6A 4NCIA 5EXXA 1KO7A 4TWZA 1KY2A 3WRYC 2VL7A 4PTLA 1Z6YA 2O8DB 2WJJA 4RCZA 2GNOA 2V8OA 4A92A 1BYUA 3EPLA 1XP8A 1VG1A 4BEJA 4CVNA 1Z6XA 3EC1A 4JLPA 1JEEA 3W8RA 5GJWC 4OBEA 3HPRA 4B2IA 2NIPA 3B2EA 4LJYA 3MUFA 4AG6A 4AD8A 2E87A 5B2ZA 2AXNA 5CITA 2VP6A 1CJUC 3U7FB 1HY3A 3VR5A 1E0SA 1E2NA 1GZSA 2BKUA 4JSTA 4Q4JB 4YLGA 2AX4A 1UBCA 4PPNA 4M22A 2XNDA 4JIMA 2CVHA 5DLQC 4ZO4A 3RRNA 4IFBA 3CUEF 5J4HA 3D8BA 1OFUX 1EFTA 2AHOA 2WJIA 5EE5B 1W36C 1EFUA 3MWKA 3NEJA 3NKVA 1AS0A 4MYCA 4LPSA 2D4HA 1CXZA 3PQCA 2OILA 3HU2A 2C95A 3D31A 3KJGA 3MGCA 1G7TA 4ASUD 1E9SA 2DYKA 5E95A 3ECCA 1UM8A 5TB5A 4C0AC 1XCGB 4MKFA 3QENA 3AGPA 2QN6A 2UZ3A 3CONA 1T0JB 4DLSA 2QE7D 4XVRA 2ZRKA 3BXZA 3SBEA 1KK1A 2W6JA 3TW8B 4KHZA 2B7BA 1M1YE 3B60A 1XNJA 1E2HA 4ASUA 1U9IC 2WKRA 1XD9A 1W46A 1G5TA 2YZ2A 2RB4A 4TYQA 4RD6A 1VYVA 2QTHA 4PC1A 1GNPA 5B30A 3K0AB 4TLEA 4NTZA 2A30A 1C9KA 3ZGXA 5EZ6B 1IY0A 2CLCX 3GD7A 4X8LA 8OHMA 3K9HA 3REFA 1ESMA 4Z51A 2UVQA 3AVUA 4ZI3A 4Z8YA 3THYA 3MAAC 4QHYA 1NMZA 2CL7X 4MQBA 1E0AA 4LBVA 1OB2A 4S35A 1DAFA 1KTVA 1MRSA 5IF9A 1EWQA 4C7OB 1KI6A 4JKYA 2C77A 3ZYCA 1G19A 3K53A 3THWA 1NKSA 4Q1FA 2BVNA 3VTKA 2HYIC 1SVKA 4MRVA 3AF3A 3SJCA 2R62A 4BRWA 2XITA 1T8UA 3QJYA 4M2LA 1IOZA 3UMRA 2ZRCA 3FMOB 4DC9A 1G6OA 5H8WA 5B58C 4EPVA 1WMSA 3I1FA 2ZJZA 1RJ9A 1Y3AA 1R10A 1KJWA 2XZLA 1OXVA 2W2XA 2IS4A 4KV9A 2FV8A 4P32A 4NKRA 2YKGA 4JLAA 2BCGY 1R0XA 2IUSA 4HUQB 1E2LA 3ADCA 1U9IA 3GLHB 4AYXA 2W6ID 4JVNA 4DEYA 3WBKA 5HR5A 1PLLA 2K5UA 2F1IA 5DI9A 2VHTA 5DYIA 2OHFA 2IYWA 2VHCA 1IY2A 1UKEA 5C18A 2JLYA 1N6LA 1VIAA 2WPDD 4RD2A 1W0KA 1N25A 1YZLA 4PHFA 1YZTA 1RRCA 3OF5A 5AJVB 1JEDA 3VAAA 1CIPA 4IVPA 4Q7KA 2H57A 3GLHA 4KJZA 2F1RA 2QMOA 5FUXA 1E9AA 1TAGA 5FBRB 2GEUA 3H2YA 3GEIA 3K0SA 2XB4A 4H1UA 4W5WA 5A5GA 1GILA 2ANBA 1P9WA 1VG0B 5IK2D 4V0NA 2Z5FA 3W9YA 1XD2B 3B1VA 2VH5R 1T91A 4Q9JA 4TSFA 2GAAA 3U4QA 3CNLA 5FOSA 3C7KA 2H16A 1UPTA 4E22A 3KB2A 1MV5A 2OCYC 2GETA 2H8KA 2NO0A 3GJ6A 4TL6A 1DO2A 2FWRA 4KFRA 4PSVA 4PSKA 1SXJE 4R98A 4OI1A 5JZVA 1M2OB 1SVOA 1ONBA 2IYXA 2NO7A 1KI1A 5FL7A 2ZRDA 1ZM4A 3KJIA 2YWHA 4I99A 5FOUA 2W0MA 2WTUA 3QXCA 1KMHA 4L5BA 4LV5B 3W6PA 2ZJAA 1N0WA 4TLAA 1DAMA 1XFAA 4L15A 4PPQA 1RPZA 4A1FA 4LJAA 1N2CE 3CLVA 4HZUB 2BJWA 3GPLA 4TYWA 1CJTC 2JIZA 3C16C 1HTWA 3L2OB 1J90A 3B1YA 2REOA 2P2LA 3GJ0A 4LJ4A 5D3QA 5GVSA 3EA5A 4MUBA 3K9NA 1G6HA 1WBBA 1XMSA 1KMQA 2AXPA 3GLHE 4KI0A 4DIDA 1NIJA 2OZEA 3D6TB 1JPNA 1QVAA 3CM0A 4OL0A 4WA7A 3TLXA 5C2JB 1CR2A 1MR3F 2QPTA 4GZLA 4TMXA 4EJSA 1R5OA 4XVUA 2X8AA 2G83A 3BJIC 4M9QA 4Q18A 4AK9A 2WWIA 4RZUA 4CEJA 2O8CB 2FEMA 3UWOA 1U99A 1OF1A 5GADl 5FTKA 2ZRHA 3U60B 3SI7A 4BFVA 2EWVA 4HUTA 3A1UA 3O8CA 1MABB 2PMDA 3Q5EA 2ZIAA 4LCBA 1X1SA 3K0FB 1ESNA 4EUNA 3GLFA 5JCPA 1AKYA 3CH4B 4IKEA 4OI0A 4TTQA 3ZVNA 4Q03A 1G3RA 2TMKA 4DLUA 2O0KA 4MKHA 1CJKC 3FFAA 1N0UA 4PAOA 3OE7A 4Q7MB 2A78A 2BBWA 2ZTSA 1M7HA 3MMPA 4A9AA 2JA1A 3R9IA 1M8PA 1TQ2A 2D06A 3LDAA 5JSZB 3IQXA 2VSFA 4JL8A 2QAGB 1DOAA 5CJ2A 4FCWA 2IYLD 5LB4A 121PA 3OE7D 4EFMA 4AKGA 4GRAA 3TRFA 5DI3A 5EE1A 2IBMA 1XD2A 4DHEA 1U94A 2CLDX 4EJSC 4Q9LA 3EASA 1KKMA 2ZSAA 3B85A 3UG6A 2JLWA 3B9QA 1E94E 1QHNA 2WZQA 3EPKA 1P3JA 5HE9A 1NF3A 3OAAD 4M1SA 1E9RA 2C5LA 5CLQA 1II8B 3QSYA 3W6OA 3RABA 4IW3B 4NCJA 2BCJQ 1ZP6A 4FMDB 3LD9A 5AJXA 4M1MA 5JMTA 2RCNA 3QKSA 3FYHA 3KFXA 4V0OA 3IO5A 3L43A 3C8UA 2OUKA 1X8LA 2ZI6A 4HYYA 1J70A 5KPDA 4KO8A 1AKEA 4HZUA 3CPJB 4OHVA 1E1QA 3SFZA 3MSXA 1SZPA 4TQ9A 4LHXA 2VP4A 4N1AA 4OK5A 1N5IA 3L8ZA 4C2UA 5IK2A 1Q3TA 3T15A 1WQ1R 3TE6A 1LY1A 5E7MA 3BFXA 4OJQA 2QZ4A 4Z54A 1DPFA 3VQTA 4AIIA 4CEJB 3N5CA 1YR8A 4QJ3A 1AS3A 1IHUA 1UBEA 2ZSBA 1RZ3A 1EFHA 4JBYA 5KHOC 4U02A 3U2QA 2F43B 4YMTA 5DO9A 2D3WA 3H84A 4TYNA 3ADBA 1XJ0A 3X1WA 3C14C 3T1QA 1DO0A 2GCOA 3I32A 4B75A 1WXQA 4QXAA 3WYGA 4V0LA 2IW3A 5AK0A 1HE8B 3V4FA 3EG5A 3BB4A 3RAPR 4MGKR 3ZD6A 3PEVA 1UADA 2LWIA 1E99A 1KYIA 1JXMA 1NBME 3GJ5A 5HPYB 1X1RA 5FPYA 4V0ME 3U6BA 5JJIA 1ZM3A 4IFEA 4LX0A 3U3KA 1S9HA 1E2MA 1E9CA 1OKKD 2PLFA 1RW4A 2AKYA 4KVAA 5G40A 1G4AE 3W5JA 1ZJ6A 2XEXA 4XD7D 1YJ5A 3T35A 2IL1A 4MYHA 2C99A 3U61B 1TUIA 4G5QA 4AYWA 5KDOA 3FKSA 4US2R 4MRPA 3VR4A 4M53A 5EJEA 1IQPA 3QQ5A 2FGJA 4PQRA 4I1SA 4D0NA 3A1WA 2O8DA 4FINA 3GCGA 2QP9X 3U6KA 5DNYB 4KSCA 4P0TA 1XTSA 1QRAA 2RGDA 1ZIPA 3VMFA 1IY1A 3QPWA 5KYKA 2WSSA 2HT6A 4AY2A 2WBLC 4S2EA 2QAGA 1NVWQ 2CXXA 3QXXA 4JLVA 2J0VA 4IOMA 3AF0A 4P33A 1EX7A 2P65A 1OXSC 1P9RA 2RGNA 5FBLB 3GLFE 1FNMA 4LYAA 1AZSC 1OSNA 2AN9A 4IVRA 1HA3A 2J1LA 1XXHB 4I1VA 3RLFA 1FX0B 5FI0B 2W0SA 4D26A 2FFBA 1ANKA 3FMIA 5EE3A 3KTAB 2YV5A 4G01B 5F98A 3CX7A 3LA6A 3SE0A 4FMBB 1W36B 4AC9A 4URUR 1JJ7A 5CK4A 1IM2A 1M34E 4M1OA 1Q1QA 4PO1A 2KI5A 3TMKA 3DPUA 1ZNZA 2IT1A 4H1VA 1DEKA 5EE0A 4JJZA 1EXMA 2QUZA 2JATA 1QG2A 2OV2A 3BIFA 4BFZA 2P5TB 4Q4AA 3GLIB 1ZW6A 3HPQA 1XPUA 5H1YA 1DE0A 2IS1A 4LBYA 2ASEA 4IXMA 1P75A 3AGQA 1XTKA 3VX4A 5HE8A 4BFXA 3MD0A 3QG5A 4Y0VA 2HUPA 3OIYA 1JAHA 3VHLB 4LPKA 2QBYA 1EX6A 3N2IA 2EU8A 3UANA 2O8FB 5K8UA 4ZPXA 4PPGA 3LWNA 2PX0A 5SZIA 3OEHD 3UKDA 1KZ7B 4QBIA 4BUJA 1YQTA 2VSOA 4CIDA 3WNDA 2J0QA 1VYUA 1Z3IX 3Q72A 4CZ2A 1G3UA 1CULC 1IBRA 3X1XA 3UXMA 3TSOA 3H0KA 3ONWA 5KO2A 4CGZA 2JEOA 2CCKA 2BHRA 1XDBA 1F5NA 2JJ1A 2WKQA 1E1RD 2UZIR 1WF3A 4M1YA 2V7QD 3GLGA 2X1VA 5TV2A 3AVXA 2FMXA 3AVPA 3FHTA 4F4CA 2VHQA 2QTVB 1ZUNB 2ONJA 1LFDB 3BE4A 4Q48A 2J45A 4LJ9A 4C0KA 4CDGA 4A2PA 4DB2A 4DCTA 4OQNA 3PEYA 2RGXA 4HAXA 3CWZA 3K0CC 1QVRA 3NEYA 4R7ZA 3EARA 1VTKA 4QNMA 1VKJA 2KJQA 3DHWC 3M4YA 3OESA 2QORA 2WAXA 3FMFA 1M7GA 3DKVA 4Q5IA 1FPMA 1ZU5A 4GOKA 2UKDA 1R8QA 3A4MA 4HDCA 1YRBA 4XH9B 1YZQA 5JHHB 5BQ5A 4HB2A 3LQRA 3G0HA 1U8ZA 3GMTA 2V3CC 2Y8EA 3AP1A 5JBQA 5K8IA 2IEYA 4LGMA 4YONB 3GLGB 1T3LA 4W5HA 2G3YA 1CLUA 2C98A 3PUYA 2KWIA 1KKLA 3LNCA 4GOJA 1OIXA 2RGNC 1NY6A 2WHXA 3SBDA 2PBRA 1W1WA 1IN6A 3A58B 4TLCA 2R6DA 5HCNA 2XJ9A 1M74A 1G16A 2V6IA 3AUXA 3CX8A 3IDQA 3RS5A 2DBYA 1TQDA 4B2PA 3OIUA 1I4TD 2G88A 4E03A 3KQKA 3C15C 2IEZA 4XSHA 2HYDA 1I2MA 2KBEA 5TARA 3U4QB 2VP9A 1BKDR 2Q21A 3EXAA 4DVGA 3R9WA 3KXKA 5KTYA 1BMFA 2C03A 5CYOA 1RRPA 3CNOA 3KKPA 2PLRA 5KNDA 3EPHA 2WSMA 5DGXA 1LS6A 1CJVC 1VCIA 1W5SA 4LBWA 4QL3A 5FTNA 1M7BA 2OLJA 2IHBA 2IWHA 1P62B 3EZ9A 4GNKA 2BEJA 5D3MA 3E1SA 3F0TA 2AR7A 1R4AA 4QGFA 2WWGA 2QBYB 1D5CA 1UDWA 4ERNA 1E2FA 1N5LA 3A36A 2GAOA 3GJ4A 1OYWA 3PENA 521PA 1AGPA 1SKQA 1COWA 2D62A 2YC2C 1P7CA 3GLGE 2YVUA 4KLNA 3OEED 4H9GA 2J0SA 5J40A 3RYTC 3U3OA 1B23P 2HDNB 2IF0A 3QVUA 4B3DA 3LFUA 4A2WA 5JS8A 4KFUA 3A37A 4PO8A 2X2FA 3W3ZB 2GVDC 4BLRA 5EP3A 3DVLA 3K09C 2V55B 4TL8A 4GT1A 1YZGA 2V1XA 3CO5A 1TEXA 4ZKEA 1OIWA 2ZRNA 1Z0IA 2ORIA 2B8WA 4GI7A 1W0JA 3DMDA 3ND8A 3LW7A 1LVGA 4GL2A 2O8EB 1EGAA 2YWFA 4Q66C 2VP5A 2QE7A 2BIFA 1V43A 2WJVA 3VR2A 1A2BA 1W0KD 4Q47A 1NG1A 1IXZA 3K0FA 1AIPA 4EPXA 2G1JA 4V0KA 4PANA 5FH9A 5FTLA 1N0VC 3K0CA 2QGNA 4FXPA 2ZXUA 2ZJYA 4BRUA 4CT4B 1CP2A 3TNFA 1X8JA 1XCPA 1G20E 1QG4A 5CB8A 5TY0A 2CHGA 1HYQA 2L0XA 4YXWA 2DB3A 4D4KA 1E9DA 2O8FA 1D6JA 1FFHA 5C4MA 2IYVA 5FR2A 1BS1A 2G9NA 4PX9A 1E2DA 2CE2X 1HV8A 1X86B 4Z8XA 4AG5A 4PZZA 4KYIB 1R0ZA 4G0NA 3ZS8A 3LX5A 1KAGA 2A2ZA 2ZJOA 3W6NA 1LF0A 5JLJA 2RKOA 1Q1ZA 1A7JA 5HTKA 4DCUA 2D7CA 3L82B 1OH7A 4CEIA 4NYMQ 4PZLA 1G7RA 5KNCA 4WAUA 2IXGA 1KIMA 5EP2A 3KXIA 3WRXC 3WYAA 2J46A 1OYYA 3EPJA 2FGKA 4FMCF 4PSAA 3THXA 3UIEA 3ZZ0A 1KAOA 2IXEA 5AUOB 2PJRA 3CBQA 4UNSA 4NMMA 4CEIB 3I3SR 3IEUA 2ANCA 2PEZA 1U90A 1UKZA 1E2JA 1VMAA 2FH5B 2WJGA 4OK3A 3G82C 4W7SA 4X8MA 2ZRBA 5FBQB 3JVVA 1II8A 4TT3A 1DBSA 3U3JA 1R5BA 1DTSA 1XPRA 1Y63A 1OH8A 1EFRD 4HDOB 5EUMA 3GJXC 4F7WA 1KI8A 3EWAA 5GVRA 5CB6A 1OV4A 3HJNA 1HEIA 4N0DA 3KUCA 4KVGA 2Z83A 1JAIA 2DCUA 1FQKA 3A6PC 4OYHA 3RWOA 2FSGA 3IQWA 5HZHA 2D74A 1UJ2A 2PZGA 1QHYA 4BZPA 3N2EA 5KU1A 3KQLA 3UMSA 2R44A 3BAFA 3P20A 1XJQA 2OEPA 4IEEA 1L2TA 2GZAA 3GLIE 2ATXA 5CYPA 3T06B 1ZAKA 5F3WB 1G5RA 5D3MB 2ZVPX 4BECA 2OG2A 1CJMA 4LHYA 4TLDA 3OZXA 3IUYA 4LK2A 3OEHA 4DT1B 2J87A 4JJKA 3CB4A 2IUTA 1KI4A 2NZ8A 2QT1A 2MSEB 2WWFA 2BDTA 2X77A 1PJRA 4WW0A 4B3BA 5C1BA 1LB1B 5AJWA 4JVMA 2OBNA 5E4FA 4LC1A 5C4GB 2VYFA 4TZ6A 3ZQJA 3MFYA 4C7OA 1DELA 2WSSD 3CX6A 3TBKA 5J47A 4W9MC 3KQHA 1TF5A 5LD2C 4RJLA 3I61A 5AUPB 3Q7PA 4GP6A 2GESA 2R6FA 4IOLA 3CPEA 4RZ3A 5FUWA 1KSJA 1A82A 5AUNB 4OQLA 1QHHB 2NO1A 2WWWA 4URZR 4F92B 2Z43A 1KK0A 4RCYA 2CCJA 1GRQA 2G0TA 4B44A 1J99A 1Z47A 2FOLA 3X1YA 5FTMA 1GG2A 1E96A 2EWWA 4JLDA 3RS3A 1SXJB 4JLJA 4Q9HA 3OFND 4LY6A 4O0MA 4Q4JA 5KDDA 2HJVA 2DFTA 2WV9A 3OEEA 4JLBA 3SDZA 2WOJA 3ZZTA 4B48A 3VKHA 2JGNA 4DCNA 1R5NA 4ZIRB 3V00A 2C04A 4D6PA 5JWOA 4C9BA 2FPKA 1JALA 3BK7A 4BZQA 4OJKA 2EW1A 2D2FA 2XTMA 4HLUA 1II9A 2H7VA 5E3HA 2BC9A 3U44A 3OFNA 3MLEA 4IDQA 3QXJA 4E09A 3MJHA 1OHHD 2GXAA 4FMCB 3TUIC 5CDFA 3O47A 1ZUHA 3CRMA 3K8YA 5L3VA 1KNXA 2EYQA 2DFNA 1I2DA 2ZR7A 3ZS9A 3SYNA 3VKGA 1AN0A 1LNZA 3DDCA 4EKDA 3GJ3A 4RVCA 4ARZB 5KUTA 5FTJA 1TF2A 2N1BA 3CRW1 2PCLA 3LX8A 1T3HA 4P4SB 4DKXA 5HKKA 2YWEA 4MRNA 1RE0A 3G5UA 4DIEA 3KQNA 4JL6A 3RC8A 3I8SA 3QY0A 1OFHA 4U00A 2NOAA 3VR6A 5F9HA 1NJGA 4DUGA 4YQFA 4QOSA 1KK2A 2ECKA 3QKRB 4XWAA 5EZ5A 2IA5A 1BMFD 1NN0A 4YDSA 3THOA 4DB4A 2ZJ5A 2B6HA 1NNEA 1NL3A 1N6IA 2VF8A 4G5OA 4OHXA 4QJ5A 5HKKD 4GDFA 4RY2A 1OH6A 4X8HA 3R9XA 3TIFA 2CNWA 1OFIA 2AFHE 1NRJB 3IO3A 4DLWA 1N6OA 5EUQB
chains in the Genus database with same CATH superfamily
2JLZA 1G3IA 1UFQA 3EB9A 1K88A 2XODA 2A4MA 3SYMA 3KTOA 2HJSA 2VH1A 2ZBDA 1AA6A 1EFCA 2ERYA 4Z9BA 3ZIAD 2IZ6A 3BCSA 1QIFA 4LY0A 2VT7A 5LJIA 3P9NA 3BUSA 1X7XA 4NS1A 4NZPA 4Q7LA 3KEGA 1E60A 3LP6A 5HF6A 4X6XA 1UMDA 2NM0A 3DXXA 3RHZA 1AO0A 2C0CA 4XCXA 4WPGA 3VBCA 3G7UA 3SU8A 1M34A 2WTXA 4QBGB 1H8EA 3M9WA 4HN9A 1U0JA 3L06A 4MMXB 2VNIA 2KB0A 4MS4B 5F12A 1A72A 3VU9A 3T5CA 2PTHA 1F8YA 4L5IA 5AW8A 2VHWA 3P0JA 4H3VA 4IM7A 3FTFA 1GEEA 1QORA 5JU6A 2IK8A 4AN0A 5FBVB 2GM4A 5LLSA 5JZ9A 1TM7E 3F98A 3AMVA 2IPOA 4EJFA 4U5QA 1Q91A 4AURA 1TI7A 1V1RA 2JGDA 1AKMA 1YR6A 4II2A 2YZKA 2PBFA 4JVSB 1ZUIA 2W58A 4O5OA 1I36A 1XWIA 2EQ5A 3ZVLA 1P61B 1JFFA 1SNYA 2CYAA 2J5XA 3DL4A 4PAMA 3WWCA 5LNK6 4KVZA 4OI2A 1BGWA 1HO3A 2F8SA 1XF1A 1RLOA 1KOJA 2R97A 2CV1A 1VM6A 2FXVA 3P45A 4DRZA 2Q6KA 2XW6A 3BT7A 3AESB 3JQGA 2ZITA 2PX5A 4L8WB 5EL0A 4MK4A 1Z0KA 2XA9A 3VR6H 1Z33A 1XVVA 4IS3A 4D4LA 1CRZA 1ECGA 1LWNA 1I33A 1XTJA 1QPGA 1VKZA 1FYFA 2IYYA 1DWOA 2VHZA 5A9SA 3B5IA 4HDAA 4IJWA 1JPJA 4FWIB 4DNQA 4CQMB 1IWPB 5EEGA 4K9QA 3AF6A 3UQZA 1Y3CE 5CM9C 2HTEA 2NUTA 3ZBTA 3GVHA 2GERA 2KQUA 3ADPA 3UW3A 4KLCA 4YV2A 1HMYA 3U37A 1O3YA 3D7KA 3HO8A 3KJHA 1R64A 1ZPDA 2IEAA 1XCMA 2HSWA 1W5BA 2P6NA 3BGSA 4FI3F 4PYQA 3COSA 3PWTA 3EMDA 1LLUA 1P72A 2VG8A 3JYNA 3ONFA 1P74A 3PNQA 1Y98A 4NPAA 2DJIA 3D1VA 4BQNA 1HQDA 1RAAA 2IY8A 2VSYA 1SJ9A 2II6A 4L2IB 3BXGA 2O2EA 4M1KA 1Q1NA 2G1PA 4YAKA 1VI5A 1DBPA 2VTVA 1PUIA 3GT4A 1ZIDA 4YJKA 1A69A 3JQ8A 2CNBA 2RHGB 4D3SA 3T4EA 3ZE6A 1HLPA 2FNAA 2FN8A 4EI8A 2BMDA 3GQBA 1CY6A 2B4KA 5D3ZA 1VC2A 1Y8QB 5K03A 1JR3A 4C7VA 1UKCA 1Y3BE 3BFKA 2WMYA 4PAQA 4AFNA 1UM9B 2R87A 1Q7RA 5E9JA 2I3AA 2YC4C 4A6XA 3EXHA 3JR7A 1G64A 1J0AA 4YO7A 3G02A 3T7DA 4B7AA 3EIHA 2C00A 3PX3A 1ZJJA 2X7HA 1E5VA 5K3FB 5K8TA 4I55F 5GINE 3BRWA 1VZ2A 4ZVPA 4M0KA 2Q5OA 2DJ5A 3LK7A 2F55A 2BGJA 4X7RA 2B8JA 2FKNA 1V5WA 4HATA 2AMYA 1MTOA 3GLVA 4W1SA 5LZ7A 1J8FA 1CJBA 1EX1A 1SBHA 4P2BA 5HNKA 5HJ5A 4LDJA 4S0ZA 2QQ0A 3FJOA 4MYDA 1Q0SA 1K8XB 3DJFA 1Z5ZA 5FX2A 1R9JA 3OTWA 2RGBA 5A2GA 4EAQA 1TM4E 2GYYA 5JW6A 2JJMA 4F11A 4QLAA 3N86A 4OHWA 4I1IA 4NJEA 1AGRA 2OBFA 3DZIA 4FMDF 1FU8A 1PJBA 1QPBA 3DEZA 1LJ8A 1ZIXA 3FGPA 2ZETA 5DOZA 3WY9A 5IVKA 1O6CA 1RQXA 3H3JA 4AN1A 4F86A 1LKZA 1TAUA 1A8SA 1GL3A 1DAPA 2Q9AA 5A2QA 2BEUB 3MJ4A 2X0JA 1QNLA 3CZ4A 5JCOA 3EMVA 4GKBA 3E22B 1DIHA 2BFPA 2ZEJA 3PNPA 1RAIA 4X6YA 2ZVJA 2V6BA 1G4HA 1N5DA 3FUVA 2CUNA 4BJ1A 1YF3A 5J2TF 1SY7A 3AY0A 1GKYA 3BBPA 3TQFA 3T9FA 1E2EA 1SKUA 2PS1A 4CEHA 3CO0S 4J0FA 1ABBA 1J09A 4ZI7A 2VNKA 3RJMA 1RJ9B 2Y3IA 4QHTA 3KPVA 3DAHA 2C4HA 4DMRA 2AXEA 4RXTA 3M5WA 4RMGA 5IZCA 1YOBA 2FMFA 5HRAA 3LY8A 1N2BA 5JFTA 1Z5UA 4C14A 1HGXA 2Z57A 1J4AA 2P7HA 1PK7A 1ADFA 3AEQA 1GGHA 4ARBA 1BE8A 1Z35A 1QHFA 1ZJ4A 1YQQA 4L6IA 4N5NA 4W8HA 5JH7B 1GGMA 5MGBA 4ZT7A 3E82A 1V1RB 5E6SB 1JKXA 3NS7A 2G17A 1KERA 2ISQA 1RLUA 2NTYC 3A31A 4P9NA 3V1LA 4ETWA 3H5WA 3H5AA 3K72B 3PITA 3OF2A 4JBGA 1LNQA 4EI7A 1H6DA 3Q8XB 3SYKA 4G8CA 3RNLA 3W5VA 2FRVA 3QIAA 4MCIA 3ZE8A 3L7BA 4XD2A 5TXGA 5BW5A 4AL4A 1S3IA 4P92A 1BJRE 3WS7A 1RP1A 1JG3A 3MUNA 5CFOA 1OWMA 1ZH2A 1K8RA 3FYUC 4UEKA 4TQUS 1CJSA 2AOWA 2P30A 1XV5A 3NWJA 3PC7A 1XMQB 3KZ1E 3W8FA 2DR3A 1FFCA 3C3WA 3KZKA 4FWBA 1CRWG 1Z9BA 4OBXA 1PJTA 4TPKA 5LBIA 2PLNA 4MHTA 1ENPA 5AI4A 3WP1B 3MYRA 1NW3A 3T5DA 2QR2A 5C8VA 2WHRA 3KKMA 1R9GA 3AEYA 4N6GA 4WZBB 5BN4B 1FYDA 1L7EA 2PKEA 4HNAB 2AN5A 3EXFA 4YJ2B 1GL7A 3VJLA 4K0KB 2BY4A 4DUPA 3QMMA 4JT4A 1EFPA 1BS2A 2NSJA 1YU6A 2C84A 3NT5A 3BGWA 1Z7WA 2WRZA 4H4DA 2VNSA 3PXXA 2O1EA 1XD8A 2XB2A 2JJ1D 2HBRA 4LJKA 4H31A 1HLGA 3HQ4O 5BXYA 4NATA 3S1AB 4M8NE 3JVIA 4I55B 2Y0DA 3IUSA 3UJAA 3ZHRA 1CBUA 3A4IA 3T1VA 2ZIXA 3TIXB 1PG0A 3EXHC 4I1OA 1G21A 4OMUA 2PZFA 4JQSA 1D5WA 1ZH0A 3FDFA 4NK5A 1Q77A 2GJ8A 4IBOA 1ZCZA 1EUDA 2G76A 1P0IA 1HRDA 2E3JA 1IOLA 3O1HB 4OXRA 2D13A 4J7CA 4HNRA 1NQUA 5DCUA 5TT1A 3TE7A 3LU1A 1GCAA 2AFIE 3PSAA 2BV3A 5JI2E 2X13A 4HXEB 4GSKA 3M6AA 4EQ6B 2A6PA 1E2PA 2CEAA 4RTLA 4P5DA 2W4IA 1QG0A 1P4RA 4UAJA 1RM4A 3MWDA 1N7IA 1A2KC 1NIPA 1NM5A 1P2SA 3FTQA 5AW5A 4DEXA 2BMJA 1T8RA 4M0FA 1OT3A 1IHYA 1OFGA 1ZY2A 4N7MA 2O19A 1CJCA 3E35A 4UBKA 3R6DA 4RKEA 4MW6A 2OAQ1 1QB7A 2NMVA 2MSNA 2QTBA 4MR7A 1NAHA 1KMIY 1OXBB 1CTQA 4KU4A 5HQ3A 3FCEA 2E4UA 2IYUA 3LA8A 3PKZA 1KDRA 1UBJS 1QM5A 2FLKA 3ROPA 3ZDCA 4RD1A 3SKVA 5AI9A 1T6NA 3CKKA 2PNJA 2JIQA 1FS5A 2QQEA 1YRLA 4KMRA 4Q3EA 2DMRA 5DX8A 3Q7SA 2H3EA 2QMUA 5I7OA 3PF8A 3DVAB 4YDQA 4B34A 2BE9A 4IGEA 1ISFA 3CSSA 3I64A 1T2DA 2A0WA 3BS4A 3I1YA 2CVFA 4JN6B 5TGTA 2FMIA 5G4KB 2BHSA 1K8YB 2VXCA 1RBMA 3BGOS 4DCSA 3EW9A 3REQA 1V5EA 1KQOA 2CVQA 1P2VA 1HNNA 1V16B 3A9SA 2BWJA 2RG1A 2UDPA 3L6RA 4DS3A 2RK3A 4QTXA 1NU6A 3TTSA 5J58A 5EQTA 5JD3A 4R16A 3U7QB 4N7JA 1UKVY 4YXWD 4NJMB 3E3MA 1M6NA 4UZFA 2CVOA 4JIGA 5COQA 3O2NA 2F3SA 1TU0A 5HBGA 3QLVC 2J32A 1K63A 5K51A 5EHIA 1YHNA 3RSFA 3VVBA 4ZDJA 1NOIA 3GFTA 4QPJC 3F6PA 4KR9A 4LQ4A 5DBOA 4PC6A 3A1TA 2X5JO 3WIDA 1NYRA 3B7WA 3ZXSA 4DWOA 5IULC 5C53B 5E6SA 4B6PA 3G5MA 3OZTA 1DG1G 1CR1A 2R8YA 2FPLA 1WU7A 4E07A 1G5HA 4OXXA 4YJ2F 2J3KA 4KYUA 1AKUA 2E5FA 4ATNA 3HCRA 5D6NA 3J7AC 3N6RA 4HAZA 4FFDA 3A3KA 1U1IA 2AJTA 4HAVA 1YMUA 1AKVA 3H97A 4HPWA 2PQMA 1WDMA 3P0RA 2Y0PA 2DTXA 4CE6A 4YEDA 1U0EA 5ESDA 4NOJA 1X1AA 3FPHA 1LPMA 3IMCA 4R2LA 4BBZA 3AR2A 1KEKA 3QLUA 1PWHA 4UU0A 3OBBA 2H8GA 1DX9A 2BEVA 1LSSA 1N2HA 2P0YA 4HNAA 4FKZA 4L73A 5KZMB 4JMLA 1DC8A 4Y0AA 3PRKE 1PT8A 2XHZA 4C6TA 1U0FA 4CM9A 2XZOA 1LQTA 3NWEA 3Q4GA 3ENKA 4WKGA 2O2XA 2O57A 2YRFA 3LW8A 3F3MA 5JNRA 2CDNA 3UQYS 2CZCA 3HVJA 4U39A 2REBA 3NLLA 3H16A 5JZOA 4G56A 1P81A 2X8WA 4LDPA 2YVKA 5AOAA 3AY3A 4DSUA 1E0KA 2W6OA 4LBZA 4MQEB 2NUBA 4BLSA 5JRZA 1F51E 2EL7A 2OXIA 4F5EA 3AHIA 2WJ6A 5D8DA 4MUAA 1DHTA 1VLLA 1L5SA 5BNTA 4F4DA 1EK0A 3AKCA 3UAZA 2HCFA 1G8FA 3CKLA 4FCTA 3CT6A 4JI7B 1ZGCA 2JIRA 3R3ZA 1KJZA 1QF9A 2WJHA 4G89A 3D8NA 4E4YA 5B3KA 2C7RA 2MSCB 4YMLA 4I5GA 3R76A 5MHTA 1LTHR 3WYBA 4ARSA 2ZUSA 2LR0A 3ONVA 3FNHA 3LYAA 4DCOA 3MHTA 3QPVA 5JNLA 5ED4A 1NX6A 1II0A 1R50A 2DP4E 3BSFA 5FFMA 1XK7A 4NH0A 1TQHA 3U9LA 3WI7A 3QIVA 3WMGA 4FHFA 4PV7A 4B74A 5BY2A 3KQUA 5IS2A 1MO4A 2PUFA 1O0SA 1UBMS 2R7AA 3C5HA 3BREA 2VRWA 5HZKA 3JD3A 1KI9A 2JGRA 3MJRA 3PWKA 4F5DA 1HSOA 1FS4A 3G6WA 2XSZD 5K0FA 2H2FA 2F17A 4TMTA 3W0LB 1Y7PA 4YYEA 4GLLA 5HUHA 5TE9A 2GAFA 3RI3A 4R40A 1N9GA 4MPPA 3FCYA 2HMTA 2VJLA 4HDQB 1N57A 2C1ZA 1HDIA 5ALIA 3WBJA 5J23A 2Z2XA 3K1YA 4NESA 4D4JA 1UMBA 1I3LA 1R7RA 4UD2A 3MCTA 3QLVA 1SQ0A 1TA4A 1JKJB 4L9SA 3PXGA 3ES9A 1OU0A 1V8OA 2C59A 4UW9A 4HSGA 4EH1A 5LIPA 1H1DA 2RC6A 3M5CA 4D9GA 5CVEA 4EO4A 4OU5A 1RRKA 3LSTA 3FJ1A 2Q1WA 3GYGA 1MJFA 5EZYF 3BMNB 1QTQA 3OQ6A 5JECA 3H2HA 4Q3DA 3SSNA 3WX0A 4G37A 4U9UA 2JRLA 1NVBA 3M6UA 5IUNC 2H07A 2OCIA 3MPUA 2FG5A 1GL9B 4LJ7A 2FA9A 3NOQA 3INYA 5IABA 3AM1A 1V96A 5AQEA 1D1TA 5FNVB 3R9XB 1WD7A 4I81A 4WY2A 3E70C 5CDUA 3U5ZB 2AJLI 1BCRA 5JUWA 4B6FA 1G60A 1OJLA 3F71A 4GHWA 4HNHA 4NE7A 4X45A 3WGUA 5CD9A 2V3CC 5KYKA 4DLVA 1RMQA 2EVWX 5EVJA 2YMQA 1UEXC 1HT3A 5IBQA 3WLKX 4EFLA 2XUIA 3TM4A 4TKVA 2C2HA 2B0JA 3MAGA 4Q3CA 5AKZA 3TRKA 3S81A 2JI9A 1PL7A 3IILA 1IB0A 3OZDA 2WYIA 3ZJ4A 2FAXA 1QZ3A 2IX3A 2NADA 2QL6A 4QUJA 3KZXA 2QJWA 3G1TA 3LXMA 3GLTA 3MIIA 1QBKC 2IDZA 3HJUA 1KEEA 4P0QB 4MGYR 1IVNA 2RMKA 4X6LA 4MCHA 2HF9A 5F2EA 1PL8A 5L3RA 4KR7A 1Z6PA 2ZJ6A 1PF7E 2W6JD 4K1XA 3HNOA 5I9SA 2J59A 4BX0A 4JUFA 1FX0A 3KCQA 3N74A 3SHWA 3E0XA 3VSDA 5KWJA 1VYTA 1WB5A 2FVYA 2B61A 2G36A 5LDDC 1GGKA 2C4MA 2VZ0A 5EVCA 3H2KA 1W9HA 5E2IA 1Z5NA 3A26A 2P4UA 1OFTA 1DRVA 3TM5A 3TUJC 3TZHA 1MZVA 3GVPA 1Q1EA 2AKAB 2R9VA 3AF5A 3M6LA 5TDHA 4B3FX 4F04A 1AKRA 1YFKA 3PI6A 4GBGA 3ER9A 3P2KA 4G65A 4M86A 4KAXA 3G2PA 2GBLA 2FPOA 4I1RA 1BMQA 4FC7A 4JKIA 4TV8B 4YJ3F 4Q02A 1COWD 3RVKA 3TDNA 5C7OO 1E6KA 2AXQA 4NU0A 1E32A 2FJUA 1JDBB 2FRDA 4K2AA 2I80A 4QSHA 2WNIA 1XRQA 4BVFA 4ZCRA 1E2GA 4QELA 1N0HA 1GYQA 1AA9A 2R68A 4PQEA 1QF7A 4MWBA 1I5EA 1SMKA 1WUJS 3CVOA 2LKCA 4K1LA 3ZHSA 4IX9A 3NI2A 4HJRA 4OPMA 5SZJA 2AV6A 5ARBA 3WSWA 3ZWYA 4AT1A 2QMHA 5KOJA 4H7FA 4B7CA 1AQIA 4P1ZA 1ESZA 2BHTA 2G5CA 1EDZA 2GRJA 4JLSA 5CX1B 3EGOA 2OXFA 5IJXA 3SEAA 1L4MA 5B7GA 2XXAB 4LJ6A 3ZV3A 4Q6WA 5FUYA 1T6XA 1GZ3A 3EGIA 3NBAA 1JAYA 2XUQA 3QHPA 4L28A 2FPPA 4CL0A 4IMRA 3WHLA 1EGHA 1JKFA 2I54A 5KYGA 3QK7A 3V8VA 2C9CA 3A28A 2IKQA 4MB2A 4YCDA 2GKSA 3R3VA 5F1PA 3TR0A 3ZBQA 3R0QA 1FP7A 4E21A 1E18A 3N8DA 4QWWA 2EKQA 2VWPA 3H9UA 4O2LA 2LP4Y 2AG8A 1XROA 3A6GA 5EOVA 2O9JA 2OO7A 3KVYA 1DLJA 4JBNA 1BKSB 1XEWX 2QD3A 2ZU0C 3RU2A 1SHKA 5IKPA 5JISA 5L53A 1T3GA 5KQLA 3AI2A 1HSZA 3TPZA 1UAGA 4B84A 4IJMA 4OGKA 1OBCA 1ISMA 5C7LO 5IRCD 2H48A 4JYBA 2Q9CA 2QP4A 1H2EA 3EA4A 3ZU6A 4QBFA 4E5DA 5CURA 4ZRNA 4NCHA 1XX6A 5HJ7A 1P39A 3G2QA 3LY5A 1RHMA 2BBOA 3HP1A 5FOVA 4CKCA 4QDXA 4YRQA 2P3SA 1PL6A 3BB1A 5CW2A 1E62A 3OM0A 2WI8A 3DBIA 1Y4UA 3L6DA 1SQSA 4L3OA 4ON9A 4K9DA 4I8XA 1Y8ZA 3VNAA 1MOPA 2UU9B 2ENUA 1J0XO 2BONA 3B1XA 2BMVA 4REOA 4RPGA 4K9KA 5CFZA 3T41A 4MYTA 5LDGA 1IVYA 5I7FA 3OHMA 1RSZA 4DR7B 3BWCA 4C7XA 1YL7A 1PUJA 1A2QA 1OGJA 4YLEA 1KOFA 3BTVA 4V0SA 3AP3A 3GFPA 1AZWA 4C29A 1F2UB 4LI0A 3D3WA 4YV7A 5LXTF 3EVNA 2H17A 1Q0HA 3HV2A 4CU2A 1XGKA 1RQ7A 2HDHA 4UBJA 1LD3A 5TX7A 2ZYWX 1X7YA 1N3IA 1ODIA 1ZGHA 3SFVA 5JJCA 1JJVA 4EPWA 3EYWA 3DH0A 5EHZA 4JQOA 3V9PA 4PRLA 1BQ3A 1M1NB 4KI7A 4CBVA 5EMNA 4WZAA 4EL0A 1J06A 4Z4FA 2J30A 2EIXA 1AJEA 4BLQA 1I32A 4FFOA 1NVVR 1MQAA 2Y0CA 1L7MA 4ZAGA 2I2WA 3IVAA 3ELDA 5E3IA 3T61A 4ZYLA 1W85B 2I4TA 2OB2A 1J5EB 1QE0A 1E4OA 2JARA 4RV5A 4MZXA 1TB4A 1WQ4A 2XNSA 1E6UA 3X1ZA 2EJVA 2FSVC 2J8ZA 3BTOA 3VRHA 2JLBA 2GK3A 2NAFA 4J1SA 2C5EA 3OIWA 4C04A 1PS8A 2Z04A 2X4LA 4HG2A 4RLQA 3QWFA 4QPDA 3ZC3A 5JSUA 2VPTA 2VTKA 2HQOA 3FCCA 3IAUA 3CUSA 3PXCX 1L4GA 3QMWA 4R5HA 5DE3A 3WC4A 1SXJA 4D74A 3HB9A 1NJ5A 1WV1A 3AR5A 2YN2A 4LRYA 3OM8A 3LDUA 1OAOA 4PS1A 1Z0ZA 1VQ1A 4RLHA 1D2EA 1HYBA 2VO1A 1NDUA 1F2TA 3PKIA 2ZIZA 4F9GA 1RWNA 2HSEA 2ZJ1A 4B35A 1QRTA 3UV6A 3CURA 2VH2A 4OEHA 4DF3A 2YYZA 1GFSA 1I6MA 4OM8A 3ZWOA 4R1NA 2OFWA 2X0EA 4WMLA 3TLCA 4NICA 1ODLA 1PS0A 1TOAA 3CXRA 5TS3A 2VQEB 3VR3A 2DH6A 3X1DA 1ZI9A 3GPCA 2GOYA 1AHIA 2Q1TA 3EW7A 5B3AA 2JD2A 4YAWA 4MITA 4FFLA 4FMPA 4YAFA 2IHJA 2P6PA 3DEHA 3SX4A 4DDWA 4KQ1A 5I8WA 3T7JA 4IO1A 3RRMA 3SHOA 2XXAA 3O74A 4CMBA 1ONNA 3CEJA 1T9DA 2FR8A 2ZDHA 2N42A 3NALA 1C41A 1CF9A 1G8PA 4II7A 1F3OA 4ZTZB 1SBQA 1SKAA 3PJFA 3KOXA 4XUEA 5AICA 3GH1A 3TN7A 3ZWXA 4HUJA 4DLXA 2PGIA 2NSDA 3GGOA 3CF4A 3G2IA 1OGIA 1I3KA 1OVGA 4ME6A 2FE4A 4ZRMA 3CNQS 1VI6A 1FXSA 2BD0A 1XCOA 1Y3DE 3DBHB 3D8RA 4BO4A 5KC8A 5BVHA 1Z5GA 1XDWA 3MG9A 3WYFA 4NU6A 3QKRA 4AZVA 3D0OA 2VDVE 2Z1DA 2F00A 1IN5A 3M9XA 4YRRA 3BJZA 4CM4B 1QAOA 4EYKA 4RTKA 1Y89A 2WSBA 3R7NA 3R3XA 4LWPA 3TLBA 2WQ6A 3ONNA 3R2JA 2P78A 2BMFA 3R40A 2FCRA 2FUG6 3KX2A 4L5JA 5AK6A 3IT3A 1D8AA 3RS9A 3IFSA 5J2UF 4RTOA 2Z4SA 4Q34A 4EITA 3FMGA 1NVDA 2ERCA 4WZBE 2QVXX 2HIGA 3KUUA 1V3UA 3LF1A 4JT2A 4OV6B 2XXBA 1JWBB 1X38A 1NHGA 1XJCA 3AETB 4I1YA 4B09A 3CZ5A 1UPCA 3CPHA 3Q9LA 4FYMA 3HBMA 2BDUA 2IIQA 4K9LA 2RHTA 1YUBA 2BEWA 4X00A 4L4ZA 3JV7A 1HTBA 4XEUA 1RYFA 3OLCX 4XQ9A 4C7BA 1QYWA 5I4KA 1PT7A 1TIKA 7YASA 4NBSA 2OM2A 1LPNA 1V3TA 2IU3A 3DGFC 3ROGA 4ABYA 4P8RA 3W9SA 3K9LA 1B2RA 2X5NA 2PE5A 1O1YA 2Y1XA 1FRNA 1QIMA 4HB4A 4HLUC 1AM4D 3KB1A 1LI4A 2AZXA 1JS1X 2FFQA 3PZBA 3ZY2A 3R7BA 1D2MA 3DLCA 4KL8S 4CTMA 2C61A 1DQYA 4QDZA 5DULA 4PG7A 4D0LB 1NW4A 2FHSA 1S8FA 1QP0A 2IU0A 1PT6A 1VIDA 3HKCA 2H1HA 4XW2A 1B15A 1N5KA 1RQGA 2SKCA 4RJKA 2DZDA 3CUYA 1EWTA 4MWOA 4N3AA 4UHKA 3ZUPA 5CCXA 2WM9B 4QUAA 1X87A 3THSA 2JLYA 4YUYA 4K6CA 5B7NA 4ZEVA 4X71A 2C5FA 4MRSA 1CNEA 1DUVG 1RIIA 1Z6TA 2EKDA 2ZR9A 3FTDA 3NIBA 1RJFA 4HB0A 4ACAA 5AW2A 1I01A 2O8FA 5EJAA 1WP4A 2ZUUA 4DMFA 2ZPUA 3QKUA 3DWGA 1YJAA 1X70A 3IS3A 4N0EA 4BNTA 3KR0A 1Y8CA 4XPZA 1SXJC 5FQOA 3QNUA 1HM5A 2DHRA 2Y1FA 4FD2A 3RT1A 3GMDA 5L3ZA 5A3QA 1NN1A 3PFGA 1QMPA 3QELA 2EWMA 2PMBA 3DC7A 3ICCA 3IULA 1UQTA 1QAQA 1KYXA 2ARKA 3GJTA 4EL5A 1NA5A 2VPWA 3AL3A 4ETIA 1CZNA 4M7RA 1RI5A 3SEFA 4U2FA 4DSOA 4PLHA 3N59A 1BHSA 5T7BA 3UGKA 3QJ5A 1M2FA 2PT7A 3BULA 5ITZB 5DNAA 4PG4A 3DV9A 4QFDA 1FDTA 2DUWA 1GN8A 3BG5A 3GLKA 2JFUA 2A84A 3GWZA 4MVJM 2BGWA 3RG8A 4F5WA 3JQEA 1N77A 2X4GA 1A9PA 3R3HA 4TV9A 3LYLA 2HXSA 1WABA 3RWMB 2O8NA 3NVAA 3IIMA 4JBHA 1YQUA 1NRIA 4EO7A 1ULAA 3WP0A 2ILVA 4J4BA 2V6GA 3LT2A 5MFZA 3NATA 4CIWA 2JD0A 1C1YA 1CRQA 1VPLA 2ZRPA 1PNQA 2XYHA 3O1LA 1TMGE 1MIOA 1XRSB 3AINA 3KVOA 1Q57A 5KPJA 4PX3A 4RUKA 3BMOA 2A0XA 3BMQA 1NI4A 2RSLA 3LO8A 3EY4A 3ZGZA 4N3CA 2GPSA 2D1YA 1P4SA 3LBFA 2NX2A 3EQ7A 2EZ9A 3FCAA 1I2AA 1KDOA 3EUFA 4PQFA 3UHJA 4H60A 5IHXA 3FOZA 1VHLA 3WLFA 3D81A 1N2IA 4N4AA 4DWWA 1ZC3A 3QVWA 4V0QA 3WGQA 3RD5A 2JH9A 5BVHB 3DFZA 3VH1A 1SUIA 1DTWA 2YOHA 2FQWA 4HADA 2GJSA 4B3GA 3TQIA 4BBAA 1FTSA 1IXKA 1PSWA 3RREA 1ODKA 2C31A 2FPUA 3CZQA 4AZ0B 5IT4A 1GPKA 1NMQA 3CZRA 1JZSA 1OLOA 4KWTA 5IJ0A 4W5RA 5GIPE 2ZIVB 2C7OA 3HM2A 3UJCA 1SBNE 4ZJUA 3F8SA 5HKAA 2D0PB 3VKWA 1D9XA 1JKMA 2C5BA 2R66A 3QXSA 3W77A 3TIGA 3W34A 4A4DA 3EK2A 5JROA 5KWIA 2KHZA 2YY6A 1ZXBA 3E2IA 2PGJA 3ZGOA 3NYWA 5IH7A 4FWTA 1U4SA 4LSGA 3OFSA 2PWPA 3GCZA 1BOFA 3QEJA 1JDPA 4R31A 3KYBA 4IIEA 1OBFO 2VDUE 2DY1A 1ISJA 4ZK6A 4I9NA 2JAPA 2HLDD 2DH5A 3HU1A 1ZUWA 2P90A 3H2JA 2H2GA 1YTLA 2OORC 4LXHA 3RS2A 2FG6C 1EESA 1E0JA 1ST2A 3HJAA 3I9OA 1QE5A 2XLBA 3V4SA 1E5LA 1UK9A 5CIWA 4C1NA 1M66A 1TMOA 1L7QA 5ALPA 4A23A 1NY5A 4TWJA 3CIFA 5FL3A 1T9AA 1XLWA 2HPAA 1SOVA 4XZ3A 4R8VA 4CYMA 4AY6A 1I3MA 2YHIB 1E2IA 3BORA 4HPJB 1ZCFA 2VDOB 4C0LA 3CF2A 4RTJA 4UJ3A 5GMOA 3CZPA 1WUHS 5PNTA 3HZZA 3T9CA 4QUDA 1L5KA 3O8QA 4ZICA 3QU9A 4M0LA 1DARA 3O2QB 1SC1A 2VK1A 1E7MA 1U7XA 2ZRIA 3D3EA 1UBFA 2GKOA 2C2BA 3KJNA 1N6RA 3HA7A 3T3NA 1O6BA 2V96A 2YXDA 3EIEA 4R01A 1EQ2A 3DD5A 1E6WA 4BMDA 1NBOA 3HR8A 3W5SA 1R2QA 1B8VA 5IW8A 3FN4A 1UMCB 1QK3A 2REQA 3C1OA 2JAOA 1THGA 4HEA1 2A0FA 3CB2A 5DRTA 1N9ZA 3KR1A 1NXWA 1ATZA 1KEEB 1XU7A 4KYTA 1UBLS 3CRNA 1F4PA 1XLUA 1C0KA 4KKVA 1N2ZA 4QG7A 5GM1A 2I03A 4DXAA 4REQB 4CUZA 2NPFA 1S2MA 1GU1A 1UFVA 1WXEA 5T4EA 1WSDA 3UJDA 2JK0A 621PA 2QRQA 3QH4A 1K6JA 4FGJA 3L92A 1GGNA 3R3YA 821PA 2IELA 2C5SA 2QVCA 3H1AA 1R4ZA 4MKIA 3LQQA 2LCQA 1ID8A 1SH7A 4CIYA 2HU2A 3BRSA 4JUDX 1G20B 4GZMA 1SVMA 2EIHA 2P2DA 1SRRA 4WBNA 2OD2A 3DFUA 3UGJA 4NENA 3HJFA 5LVAA 1R0KA 3C74A 3D7MA 2GK4A 3TKYA 1FLDA 1VSVA 1E58A 2BW0A 1ZK0A 1B76A 4UUOA 1NF2A 5G53C 1JLHA 1GFWA 2OYSA 3SNHA 4ER7A 1JIXA 3HGMA 4FBMA 3HYSA 2EJCA 2X2PA 4K40A 2IP4A 2WTMA 3COWA 1BHQ1 2NSLA 3ANXA 3DZJA 3HKBA 2FPRA 5J5VA 4ZVOA 4NULA 1L8AA 2OXEA 2GCGA 3L7IA 4LHZA 3SHVA 3FPFA 3AHGA 2UZAA 4DSTA 2XNDD 4IV8A 4ZT4A 5LA6B 4JJ6A 4QBKA 2I4IA 4Z4GA 2ACVA 2IYQA 5JS7A 2KPOA 4OXQA 2DETA 1VE9A 2OMKA 4LYJA 1FFSA 1G2IA 2EZ8A 3DKPA 3KSBC 4ZTBA 1JP7A 1VRVA 4DG9A 4XTCS 2QL5A 4UNPA 3NGMA 5JCJA 1MX1A 3HRKA 4M9XA 1D7OA 4GSYA 3W1VA 2XD9A 1VJ0A 3JWJA 3WK6A 2BF4A 2GTHA 2NW6A 1JFRA 4MIKA 3EPPA 4NDNE 3CF6R 2FEWB 4R84A 2B37A 1LW7A 4L78A 3U62A 4UE6A 1B93A 2J07A 3PIRA 4JEMA 2Q0HA 4L1KA 1X7WA 2NVUA 1EHYA 4E5MA 1NMSA 1MZPA 4BVKA 2D5LA 1Y48E 1GZVA 2R5WA 4TTTS 1IN8A 2V4MA 3FF4A 1VIYA 1R6UA 1G9TA 3LAWA 1OKKA 4QDKA 2ZCVA 1SB9A 1E79D 2ZCUA 4TTSA 1RR6A 1ZIYA 4NCKA 3RUPA 1FSPA 1U7DA 2GCNA 4U3JA 4Z53A 4IRMA 4YAOA 3OICA 3NKFA 4IGIA 1HR0B 3RTCA 4IIBA 3NTUA 4GGOA 5J1SB 1T5IA 721PA 2D1TA 4F2WA 1JJIA 1EDOA 1GPH1 2EJUA 4R1OA 3K73O 1EWYA 1GKLA 2FB9A 2VJAA 1KS2A 1KVTA 4G1VA 3F73A 5L6LB 4GDMA 5GTDA 1EBUA 4KO3S 4WECA 4KYVA 3QWAA 2G5GX 3QNWA 3V4OA 1XMVA 2F9LA 1FJHA 2F8MA 1BE0A 1NBHA 1U2GA 2G6TA 2I2AA 1D8TA 2P1ZA 2HCBA 1AKNA 1G21E 2QSYA 1DJLA 4FDVA 4FOPA 3ZR4B 3A0UA 5JQGB 3U7GA 3CX4A 3PLRA 4NAHA 1SCBA 2OESA 2HV9A 1TM5E 3G8CA 1X39A 1T29A 3FMVA 1T5TA 1EP9A 1TK2A 2VDLB 3BL8A 4N65A 4OSEA 3ZV6A 4H6VA 3A6DA 3NPAA 5JAPA 4TZKA 3R3WA 4Q37A 1WOYA 4BX2A 1KH2A 3OTOB 1AURA 3EDCA 2P0EA 4CIVA 5IAGA 2CXTA 4QATA 4HBZA 1ZD1A 3B5JA 2VSXA 2QX9A 1KGDA 4FXOA 4UKDA 1GCIA 3BH0A 4J7UA 1CZHA 5C0OE 4QYSA 4TRJA 5CRIA 1Z7GA 3ZNPA 3N0VA 1PV2A 1JECA 4WVLA 2JIZD 5DP2A 2F7SA 1C3LA 1WBBA 4WESB 1WEKA 5FWXA 3SHQA 2FU5C 4LRUA 1DS6A 3GGJA 1N2OA 2Q3JA 2V54A 1ODFA 3OZBA 4OU4A 4AJNA 1A8PA 1SA0A 4N48A 5AVSA 3D3JA 3INRA 3MLAA 4RMIA 4B31A 4Q4HB 3BHIA 3QUCA 4R8SA 3Q2KA 5ALNA 3HR7A 1NRWA 4N03A 4IQFA 2REXB 2YWRA 1K7FB 2YXNA 3QF4B 3TG2A 4G0QA 2ZBUA 3AJRA 2C2ZA 1A27A 1E5DA 1R9MA 3SQXA 1OC4A 1M8GA 4I4TA 4KBFA 2WPDA 1B6TA 1H1LB 3KL4A 3JTEA 1J21A 1H3NA 1Y6RA 4N0QA 3SEZA 8ATCA 4DR3B 2H54A 2FZLA 1JJAA 4ZAYA 5EHXA 1RE1A 4FN5A 1ZK1A 1OYVA 1ZKDA 1XZQA 3LBAA 1GUAA 3RYHB 4JS0A 2IHNA 1VGQA 1HT2E 3EQ2A 3HXLA 4YMWA 3MXTA 1U8EA 4PQYA 4A0QA 4WZZA 5CG2A 4QNRA 1H8HA 4ER6A 1TUBB 4Q12A 5IBPA 1XNRB 2F67A 1KL7A 1MKYA 5L3SA 3ZDAA 2AYYA 3A6KA 4W4TA 4UMEA 5CLHA 4B4OA 2JHPA 1R8JA 1S2DA 4ZYYA 3OOJA 3SJ7A 4TT3D 4MI6A 1ZNWA 3MWJA 5KSYA 2O7VA 5LMUB 4KB5A 2K2QB 4NYJR 1WCIB 4PYNA 2F3RA 3M6FA 3HDJA 4KLAA 1S96A 2JAHA 2Y1LA 3KWFA 5SZHB 4LMPA 2W4QA 1SELA 2H5IA 5SYMA 5CB4A 2E2WA 1NUPA 4Y2QA 5M5BA 2WVJA 5K3AA 4GICA 2JZCA 4J29A 1LDBA 4WGFA 5A0FA 2UZ4A 2YH2A 5AJZA 1EDBA 1E8DA 2RHWA 3AFIA 2BR5A 3PR2B 4IINA 4JBXA 2GPJA 4RPIA 4DQLA 6ADHA 1PFGA 4F2HA 3SQDA 4OP2A 4K8OA 1U0HC 1MX5A 1SG0A 2SKDA 1FFBA 4DW8A 1DQZA 2AK2A 3LT1A 4XQGA 2AF3C 3VC2A 3G3EA 3ZW8A 3J80A 4QM6A 3ZVRA 1E8NA 5IFKA 5IH3A 1YZKA 4KFTA 1Z25A 3SQLA 3STWA 1H0KA 2H2WA 5BWBA 4NYIQ 5DVZA 1F60A 2CL6X 1XRMA 4RADA 4MW1A 3P26A 4DC0A 4GQAA 3ANYB 5GJBA 1ZONA 1CS4C 3I76A 4KAAA 4L02A 1V7CA 3HDTA 3LMKA 4Q19A 4HB3A 1TVEA 1GEGA 3R9KA 8MHTA 3JZAA 4AKTA 2Q0SA 1XHFA 4JQZA 3IMEA 1WQ3A 4YB8A 4L27A 4TL9A 1OROA 4KLZA 2X4DA 1JNYA 3I0MA 4IEFB 3X43A 1I0LA 3K4PA 5EIBD 3SNKA 4HXYA 5IM4F 5EE9A 2FSIA 1K8QA 1SOWA 4DWJA 1IPHA 2IXAA 3FPCA 2XGJA 4XRRA 3GJRA 3R5TA 4KE6A 1CUJA 3CH7A 4ND3A 5EUBA 1I7QB 3X1KA 4J1NA 4KE9A 4DT1A 3NT2A 4TN1A 4MAMA 2PVCA 5AI0A 3QVOA 4QPPA 2G8NA 2IUUA 3UBTA 1CP3A 1EG7A 2P1RA 1O77A 2OFOA 1W5AA 4OLHA 1ULZA 2NO6A 4HRYA 4NCIA 1RQRA 4GOMD 5FB3A