5FI1B

Crystal structure of the p-rex1 dh/ph tandem in complex with cdc42
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
b'FMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
publication title Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 53
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fi1B00
2O0HA 2QEQA 2YOGA 3KZ1E 2HCJB 3RANA 1GP2A 1YR6A 3SQWA 2GCOA 3PCRB 1L4YA 1TQ2A 1II8B 1IONA 4MDEA 1JPNA 2DWPA 5G53C 3AVOA 4D2IA 4O2LA 2ZRHA 1OXVA 4TL9A 1Z0JA 4G3XA 2WSSD 3B1VA 2QY9A 3MG9A 5JS8A 4TWZA 1JEDA 4M1SA 1SKYB 3TH5A 2QN6A 1F2UB 2WPDD 4F4IA 2J0UA 1GWNA 1N6PA 3M6AA 1P2VA 1S9DA 2IYRA 1OW3B 3B9QA 3P4XA 2KI5A 4DT1A 5K8TA 3BH7A 4EPWA 2A78A 3OEEA 3W90A 1NBMD 5IK2D 1Y63A 2NPFA 2F7SA 3CRW1 3L43A 4X8OA 1L4UA 3Q9LA 2FGKA 3HJNA 4PHHA 3WNBA 5AJYA 4JVSB 4QBHA 1VMAA 1YZTA 1KY2A 2ZRFA 2JJ1A 4W5JA 2DFNA 3AVXA 4LDJA 3B1XA 1EWQA 1E79D 5FTNA 1XTSA 1Z6XA 4BQSA 4LJ6A 5FBLB 2FEMA 4EJSA 5L3QA 2J5XA 3RC8A 2VQSA 1QRAA 2QBYB 1T91A 2IYTA 2VA8A 2VSOA 3CX8A 2IWHA 4B3XA 2OZEA 2ZVQX 3PUVA 1CRQA 3ZIAA 4EUNA 1FFHA 4C0JA 3E1SA 121PA 2ZXUA 2ODWA 5J5CA 4D4LA 1KI1A 1VCMA 4FMDB 3AV0B 2PZEA 3RS4A 2ZITA 1FMLA 4A0RA 4QJ4A 4LC0A 1RRPA 3D7MA 1LW7A 2FGJA 1OH5A 1JBKA 4I1UA 1HE1C 3ICQB 3R9IA 2GVDC 4WW0A 5B2ZA 1YR7A 2ZR0A 1ZUNB 2YC2C 5JS7A 3K8YA 4BECA 1DADA 1U98A 1Z07A 2EU8A 5CLQA 3PV0A 4X8LA 4BFWA 1E2MA 2B7BA 4JL5A 3T06B 1UBEA 4IVRA 1NIPA 1G64A 2HUPA 4LWZA 3RS5A 2XOKD 6Q21A 1P73A 3SR0A 4F38A 1HY3A 3KQNA 3ASZA 4P33A 2NZJA 1XTQA 4DLUA 1SHKA 2VBCA 4JLOA 3U7GA 1M7HA 1Z3IX 3LW8A 4YXWD 2F9LA 1Q12A 1RYFA 1IN4A 4JMPA 5AJVB 2QAJA 2GXSA 3DKPA 4HEJA 1A2BA 5BN4A 3FKQA 4PHTA 5E95A 4TLBA 5G3ZA 4DKXA 5J4HA 1KDPA 5KOYA 3GJ6A 4H9GA 3AGPA 4C9BA 4ZI3A 3U7HB 2V1XA 5TDHA 2P2LA 4LHYA 1Q3TA 2HEIA 1LFDB 1ZU5A 2ZIAA 2HXYA 4C7OB 5KDOA 4HB4A 1EFCA 2ANCA 5C4GB 4AWXA 3KKPA 3B1ZA 4QHSA 4FINA 3BIFA 1CRPA 2ZI5A 4ITRC 3TMKA 5JEEA 2J59A 3ZQJA 2QPOA 4P31A 1M1YE 2ZRPA 2QRZA 4DIEA 3H2YA 1EXMA 1FUKA 2Q21A 1ANKA 4YMTA 3IBGA 2BEJA 3EWSA 5H70A 4F4CA 3O8DA 1SVKA 5FPHA 2AWOA 5M04A 3C16C 3E5HA 1OH6A 3K1JA 1W2GA 2FV8A 2WJGA 1DS6A 3SJZA 2I3BA 3IDQA 1W36D 1W36B 3R20A 2GJ9A 4DBLC 4OQMA 2FU5C 3AVYA 2GWHA 4LBWA 1YZQA 1UKZA 2JLXA 4ZDKA 3IGFA 1OSNA 3CNOA 4V02A 4A92A 4L15A 3U6KA 1AM4D 3WRYC 2ZU0C 5EP1A 2QTFA 2J41A 2MSEB 4Q21A 2CL7X 1E9EA 3AP1A 4P4SA 3UMRA 4B3GA 2I1VB 5IRCD 4A8JA 2CE2X 3GJ8A 1HTWA 3UKDA 3AEZA 5JRJA 5J40A 2JLYA 2BMJA 3O8RA 2Z4SA 1W0KD 1NLYA 5FTMA 1HA3A 421PA 2CLDX 2ATXA 2I1QA 3WY9A 4WZ6A 1Z6GA 3DKVA 2FH5B 2IYWA 2ZAOA 3CF0A 1II9A 1W36C 4LPSA 1M6NA 4O25A 3VTKA 2B8WA 1XXHB 4MGKR 3ZD6A 3QEJA 3QENA 2IX3A 3GLHB 2H16A 3U6BA 2RHDA 2D74A 3AP2A 3PEUA 2O8BA 3THYA 2WZQA 5SZJA 4H1UA 4JLPA 3A1SA 2B6HA 1T5IA 3FTQA 1KSGA 3UG7A 2BCJQ 1UFQA 4YLGA 1RZ3A 5SZHB 2ZRCA 2F55A 3QPUA 4RFSA 2REXB 3EIQA 3TVDA 1E6CA 2HT1A 1QHXA 1CJUC 3DVLA 3OIVA 1FPMA 5SZKB 2H5EA 1U8YA 5CLLA 3ZH9B 2RGXA 4J0QA 2P67A 2VHCA 2J7KA 5FL7A 3Q72A 3NHAA 1W46A 2PMDA 2FA9A 3W8RA 3AF2A 3F3YA 1RE0A 2KBFA 4MRSA 3BS4A 1Q1ZA 2ZUBA 4YMWA 3TK1A 4F92B 4MRVA 1W5TA 2IYSA 2BM1A 4D25A 3C5HA 2E87A 1K6MA 1UADA 3D3QA 3TW8B 1GM5A 4PFSA 3RAPR 3PJRA 1ZNYA 4US2R 2L0XA 4KFUA 3BRWD 2ZRBA 3KQHA 2A7QA 4LHZA 1Q3HA 4I1SA 2XNDA 1CU1A 4FCTA 2V7QD 1ZIOA 1ZCBA 5C46F 1X86B 4LV6A 1KHTA 1S8FA 4M53A 4C0BA 1QBKC 1II8A 2F1HA 3NH6A 1TU4A 4ON9A 3QNUA 5JHHB 5CM8B 4NE2A 2WIBA 1RIFA 3IHLA 4HLCA 4NCNA 1VPLA 3A4NA 4UJ5A 5FBWB 2ZS7A 3SN6A 2NG1A 3BH6A 5JHGB 2GZHA 2WSSA 1P9NA 4M1TA 1KI2A 1GUAA 2RGEA 1UEIA 2QPAA 1F2UA 2WPDA 2YWEA 4PPNA 1HQYE 2NIPA 4W5WA 3A37A 1US8B 4Y0VA 4GL2A 4IDPA 3WBJA 3LQRA 2X2FA 3T15A 1TAGA 1NBMA 1TU3A 5IK2A 3N2IA 1O87A 3EASA 3EC2A 1KMHB 2LKCA 4AKGA 2YOFA 2QZ4A 4BWYA 3ND9A 1OLOA 1VHLA 4U02A 4TYYA 1P5ZB 2ZI6A 1KO5A 2IS2A 1EESA 2HF9A 1E79A 4TQUS 3T1TA 3A36A 2GNOA 3BAFA 5EQTA 1GNQA 1UDWA 1K5GA 2J1LA 3FPAA 2QBYA 3MFYA 1FUUA 1VCOA 2XGJA 1OHHD 1JR3E 4MYCA 4Q4JB 5IT5A 1D2EA 4OK6A 2VHTA 3W8NA 4PXAA 3P4YA 3LA6A 3CUEF 3LNCA 3T1VA 2QRNA 3NH9A 4CDGA 1RRFA 1Z6AA 4DLZA 5GVSA 1QHYA 3KKOA 4P4UA 4QGGA 1YZGA 1GRNA 2WOOA 1N6HA 3PFIA 5FR2A 1KIMA 1GOTA 5AJWA 3VFDA 1G20E 5J4YA 4PC3A 1EFUA 3BWDD 3Q7PA 2QMEA 3LD9A 4YMUA 5CB8A 4OI0A 2IA5A 2Q3FA 2NMVA 4IW3B 2W2XA 2CHQA 5GVRA 2ZRAA 1KK0A 4NHOA 1GILA 2YWFA 1I4DD 3BC1A 3OEHD 4JBXA 3WNDA 2DCUA 3KKMA 4EFNA 4HSEA 4L8GA 2XOKA 3DOFA 3U44B 3QXCA 4M21A 3DMNA 4B43A 5CJPA 3CX6A 5FI0B 1IHUA 3I32A 1IY0A 3SE0A 3ASYA 3CNLA 3CPJB 2PZGA 2VRWA 4LHWA 2ORWA 3CX7A 2ZI3A 1FW6A 1F6BA 3HR8A 3IKJA 3TUIC 4YXWA 3SYKA 3B78A 5BN5A 3VKHA 1WP9A 1T6NA 1FMJA 1EX7A 1EWRA 4ZKDA 1CULC 2ZJAA 2B7CA 1X8LA 2ZYVX 3AF4A 3L0PA 3QKUA 4TL7A 3MSXA 2Q0HA 4IJMA 4MGIR 5EP2A 5CYPA 3TSOA 4XD7D 5TVKA 3TR0A 4IKEA 2PEYA 2GBLC 1Z0AA 2GJSA 4KYIB 3T35A 3MGCA 4C0HA 4URWR 4CW7A 2X1VA 3B13B 1CXZA 1G8FA 2V55B 4W9MC 1JQJC 3WHLA 1RC8A 1L8QA 3CF2A 3HPRA 3RRNA 2CJWB 5KSZA 4C7OA 2O8EB 4D82A 1T5LA 1SKYE 4IDQA 4D0NA 4LV8B 1F60A 1KSJA 1E2GA 4V0MA 1NMZA 4TQAA 4MKFA 4GDFA 1P2UA 4L5BA 1E4YA 2F6RA 1NBME 1FNNA 3DOEA 1U8ZA 2BJVA 1XMIA 1VECA 3N2EA 1U90A 3KQLA 1Z83A 4HYYA 3EIEA 1CJMA 5KPJA 4A1FA 3PEYA 2WWIA 3SBEA 1EX6A 2D2FA 1D8TA 1E2PA 4LX0A 2DFKB 4P32A 4OI4A 2ZAMA 4FWTA 1QG4A 3QG1A 1XMVA 1WMSA 2FOLA 3SU8A 3VR2A 3U60B 5JJKA 3O47A 2ZUDA 2Z5FA 2P3SA 2RCNA 1Q1BA 5LD2C 2NO1A 1SVMA 4Q03A 4A0GA 4AYWA 1J8YF 2IUSA 1HT1E 2C98A 1PUJA 2C96A 4GOJA 4Y0AA 3P26A 1LF5A 3GJ0A 4Z8XA 1NJGA 3KB2A 1ZMXA 3CWZA 2VHUA 3TUJC 3DPUA 2IS1A 2YZ2A 3PQCA 1BS1A 2DWOA 2G83A 1G18A 2KWIA 3BOSA 4G5GA 4HAYA 3B60A 3MWJA 5FI1B 2VP4A 1GL7A 2ZS8A 1E9AA 1WDTA 1KTVA 1W0KA 2UVQA 2DBYA 4DDUA 1YZKA 2MMCA 2PX3A 1JEEA 2XTNA 3ETLA 4OHWA 2IYLD 2YWHA 3B8HA 1G4AE 4TLEA 4RD3A 1N6KA 3NHBA 5FBQB 4RZUA 4BFZA 1XEWY 5F9HA 2C78A 1XXHA 4TMVA 4DLTA 4EJSC 4LJAA 3LX8A 1KNXA 3GLHA 4TLDA 4D6PA 1FL9A 1SVSA 1WB9A 4KXFB 1V43A 3E2IA 4BFVA 2P0EA 5HE8A 1QVRA 3AVTA 2PCLA 3DZDA 3GJ7A 4D0LB 2IEYA 1UJ2A 2REBA 5DI3B 4M1MA 3RRZA 4A6PA 3F8TA 3MCAA 4OHVA 1ESMA 2ONJA 1YJ5A 1RFLA 1KKMA 4L9SA 4LC1A 4XTCS 4Q7JB 3FVQA 5F9FA 1T0JB 3QXSA 4LYHA 2VP9A 1EFRD 2NPIA 1OXXK 5KTYA 1ZD1A 4XSHA 3TQFA 4IOJA 4QBGB 3VHXA 4JKIA 4CF7A 2R9VA 4ACBA 2BIFA 2K5UA 3HR7A 2YINC 2OBLA 3TVTA 5ANRB 1ZD8A 3FFBA 5BN3A 2TMKA 2JDIA 4X8HA 4GOKA 3NXSA 1KI9A 3EZFA 4IEEA 1E98A 3ZQ6A 1N2CE 4EPTA 5LPNA 2WMNB 2NO0A 2IK8A 3SFZA 4TYWA 4OQXA 1Q22A 3TJZA 1U94A 3CPEA 2OEPA 3GFTA 2FFBA 1DARA 1JJ7A 2V4ZA 1YRBA 3QXJA 2R6DA 1J7KA 2GAOA 4LJ5A 1XU4A 1E1RD 2V7QA 2H1LA 4C0QC 4HB3A 4WZAE 3K0SA 1N5IA 4TZ6A 2NOAA 4O0MA 4IOMA 3THWB 1YZLA 2OFOA 5JZVA 2ZYTX 1ZC4A 5EE3A 5KDDA 3WRXC 3V9PA 2BBTA 3I3SR 4FMCF 1M8PA 2V3CC 4DCNA 2FPLA 2WKRA 3ONWA 4A8JB 1NF3A 4HAWA 1US8A 2VP2A 4RCYA 4PQRA 2FJUA 3SOPA 1WA5A 2C99A 3V4FA 4Q9HA 5EP3A 3U3KA 1AZTA 3CLVA 4DJTA 2G6BA 2ONKA 4ZDJA 3GEIA 2OUKA 1KMHA 1E2FA 5FBRB 4O2RA 2CEAA 2GJKA 3K0AB 4DLRA 2VH5R 1OH7A 1XXHE 1YHNA 1TQDA 3SC3A 1E1QA 4TMXA 3U3JA 1OKKD 1WF3A 3FDIA 3GLHE 4HZIA 4MQBA 3T1QA 2QORA 2OG2A 4DLYA 5J4KA 4AG6A 2EW1A 3KKNA 1I2DA 1R0WA 4IEIA 2VF7A 3UXMA 1Z29A 4UNSA 2ZE6A 3NWJA 1G3QA 4Q4JA 4DIDA 1GNRA 4E03A 4YMSA 3EZ2A 2XITA 5B30A 4Q5IA 3AH8A 5IDVA 4A8JC 1DAEA 4DWJA 4TL6A 2BM0A 3IIMA 2R62A 1KKLA 2ZRKA 2C2HA 1W4AA 1ZD9A 1W5SA 2ZI9A 4RVCA 4AY2A 4UNPA 4UNNA 3OE7D 1KJZA 2D2EA 1BOFA 2I4IA 2GBLA 4PHGA 2C9CA 2QROA 1G16A 2OFWA 3K53A 5C18A 3MMPA 4QFMA 2HYDA 1UAAA 3OEHA 2QMOA 3B85A 4TTRA 4MA4A 4MUBA 4KFSA 1G5PA 3LLMA 3ZZUA 3U44A 1T3SA 1AJEA 5CM9C 4QJ3A 4Z1MD 1Z2CA 2FWRA 1G8HA 2WOJA 1VHTA 2YNMA 3FWYA 5H68A 1HYQA 1YRAA 2ZSFA 5JI3E 4FXPA 3ZYCA 4BFTA 3GLGB 2IWRA 1Q21A 4M8NE 2ZUCA 5DLQC 5CDFA 1FOEB 3RNLA 5DH9A 4BEBA 1ZM3A 4Q1AA 2CL0X 4XVUA 3W34A 1OXSC 3IPXA 1KI4A 5JBQA 2ECKA 3BB1A 2ZQ5A 1TF7A 5B64A 1P6XA 1CJTC 2WKPA 4XD7A 4Q9JA 4B32A 4Q9IA 3WBKA 5J4LA 5BWMA 2ZRIA 2KJQA 1E0AA 1VG8A 1JECA 4OK5A 3MJRA 4I81A 4ERNA 1NP6A 3LFUA 2ZREA 4YDSA 2E9SA 2ASEA 2O8EA 2JA1A 1P2SA 2CJWA 1OXUA 2QGZA 3CRVA 4DB4A 3BFKA 2IL1A 1XEWX 2CVHA 4KAXA 2H7VA 2NO9A 3QUSA 4A0FA 4B35A 4NMMA 1E9SA 1MKYA 3GD7A 1XPUA 3MWYW 4HB2A 5BXQC 1W2HA 1Z22A 4M1WA 4OJKA 4XTRA 5L3SB 1U0JA 2JASA 1ZU4A 3AB3A 2CL6X 1DEKA 3U4QB 3BB4A 4HATA 3GLIB 2R8RA 2XZLA 2Z43A 4UKDA 1C9KA 4WZBE 4DCVA 4GMDA 4BGDA 1QHNA 5HZHA 3JVUA 1FQJA 4JS0A 3C8UA 2FX3A 1DVRA 4GMXA 2FZLA 1XB2A 3U61B 2W83A 4TYNA 3RWMB 5EXPA 5DNYB 1UBGA 3CH4B 2RHMA 3QJYA 1PLJA 4Q9LA 1ZNXA 4IDOA 3IQWA 2IHYA 3KB1A 2VF8A 5GJWC 1UEJA 3JVVA 3AM1A 2WSMA 2W6JD 2UZ3A 2VIIA 2OBMA 4TT3D 2WJHA 2JGNA 2IS4A 2F1RA 2IHBA 1SKQA 1Q44A 4NONA 2J7PD 1AN0A 5AUOB 3CNNA 1CR4A 1GITA 1XJQA 2QP4A 2QUZA 4FMBB 4LBVA 2ZI7A 4TZ0A 1NY5A 1N6RA 3H4MA 1XEXB 2C95A 3BJIC 4O3MA 2HT6A 1E3MA 4Q4HB 3DDCA 3HYRA 2ZRNA 3IILA 4OQLA 3DZ8A 4JSYA 4TSFD 5AR1A 1D5CA 1EG7A 1ZM4A 3UPUA 3U5ZB 1GFIA 1A5TA 4IXNA 2PEZA 1UM8A 1G7RA 4QJ5A 4KODA 1JB1A 1VG9B 2WHXA 2O52A 1G5TA 4Q7LA 3ZJYA 621PA 1N0VC 1JAHA 4PAQA 5CDFE 1TNDA 4CGZA 4RKFA 2YC4C 5DI3A 1C1YA 3FMPB 4Q7KA 4US0R 2Q3HA 4Q00A 3VAAA 4TLCA 2FSIA 2XEXA 1FTNA 2W6ID 3CWQA 3L82B 4BLQA 4WVFA 1EFRA 2X8AA 4Q19A 1IJFA 1OIWA 3A1UA 4C30A 1IAQA 4JL8A 4NZYA 4BRWA 5KNBA 1S4QA 2CCJA 3GLFB 4JT2A 1N5JA 1GIAA 2WJVA 4JSTA 4K81B 3L2OB 4G5QA 3TE6A 1P4SA 4EPRA 5KPDA 5H8WA 5CIWA 3CM0A 2CLSA 3Q85A 4E5UA 4HUTA 3TGPA 3OIUA 3U3OA 1P75A 2RGGA 4R2HA 2FG5A 4V0LA 4FMDF 1CR0A 1DAFA 1J8MF 4HB0A 4QRHA 2AD5A 3OFND 1XD2B 2WWXA 1TEVA 4A2WA 4N1AA 1SULA 2GEDA 1OT3A 2RKOA 2FMXA 2WTUA 1MRSA 3PUYA 4BLOA 1E1RA 2XSZA 3B1YA 4Q47A 1S3SA 4URZR 4OHZA 3U3MA 2ZJYA 4M0LA 3UIEA 1VYVA 1FP7A 3UWKA 821PA 3T34A 3THWA 3HWSA 3ICEA 1XP8A 4TL8A 4A0HA 2OAP1 1BIFA 1GL9B 5KU1A 4QKQA 2VPPA 1OIXA 1ZVQA 4OHXA 4U00A 1HUQA 3QY0A 2H57A 1U0LA 3A4MA 4M9XA 1KO7A 2DWQA 3LVRE 5CJ2A 1HH4A 5HKKA 3AP3A 3LY5A 4U5XA 5HPYB 2CK3D 1QHHB 4MH0R 2EYUA 2J0SA 4AKIA 1SVOA 3I4LA 1GG2A 4M9QA 2JJ8A 4OJQA 1NNEA 2PH1A 3SJCA 4OKSA 3UMFA 4MGYR 3VR1A 2WMOB 4ASUD 4D81A 4AG5A 3K0AA 3AGQA 1NVXQ 4XWKA 1TUIA 3VR5A 1NLZA 2N42A 5HCIA 1LS6A 1WBDA 3AKEA 2D06A 1AGRA 4US1R 3C41J 1OKKA 2OO7A 3EZ7A 3LRPA 2P5TB 1OV4A 2QE7D 3PG5A 721PA 1E9FA 1CF4A 2XZOA 1G291 4E07A 1N6OA 1DAHA 1AS0A 1IXRC 4NL4H 4A15A 3SFVA 4PANA 2VHJA 2ZU6A 1ZINA 1U9IC 4QL3A 3UANA 3WHKA 1LTQA 4URUR 3CR7A 4B75A 2LKDA 2WWWA 4P4TA 4Q1CA 4Z51A 4BZPA 4NTZA 5JWOA 3M1IA 1ETUA 1GRQA 3REGA 1CP2A 3OE7A 3VKWA 1QVAA 2JLUA 1GKIA 2GTPA 2WJJA 4BFYA 2WWFA 1QHSA 4URYR 4OQNA 1PLKA 2PJRA 3FE2A 3R7WB 2OT3B 4JLBA 4EPVA 4LJ4A 3EPHA 2Z0MA 4PSKA 2FSFA 2MMGA 2ZYUX 5JWRA 3K09C 1ZNZA 3UATA 4G1UC 1T3HA 2JDID 4Z1MA 2GEVA 3EAQA 2C5LA 1SGWA 3KUDA 2IC5A 2FZ4A 4FIDA 4WBSA 1R5OA 2OM2A 1WQ1R 3GLGA 1SXJD 1SXJB 1FZQA 4B74A 1W4BA 4M1YA 1P60A 3EIHA 2PL3A 1P7CA 3Q8XB 4LSGA 3CW2A 3H1TA 4PX9A 1TADA 3TKLA 1I4LD 4LY6A 5HTKA 4GPTA 5TB5A 4RD1A 2ZTSA 4ZO4A 1L7VC 2YKGA 3EPLA 2BBSA 2A5GA 3WMEA 5DN6D 4H1VA 3WMGA 1PVOA 1VG0B 3VX3A 3VR3A 3BFXA 1OYWA 2CNWD 1QHGA 4HI0E 2IXEA 5AJXA 2ZJOA 5FBVB 4QBIA 3ND8A 2GF0A 2FSHA 4I99A 1G8GA 3TW4A 5SZIA 1Z47A 4UXIA 2ZROA 5L3SA 3MD0A 5EZ5A 2WAXA 3MJHA 4PHFA 1TTTA 1KDOA 2JCSA 1BO6A 1SXJC 1UBCA 2G0NA 1O3YA 1ZUHA 5FOTA 3U4QA 3ZZ0A 4KSCA 1ODFA 3GLIA 4A4DA 4HDQB 1G5RA 3WYFA 2QTVB 1ZM9A 1E9CA 2X19A 1NIJA 1NSTA 3Q7QA 3THXB 1GNPA 1DAMA 2ZSEA 2R6CA 3KXKA 4DLSA 4LPKA 1R10A 3RS3A 1E1QD 1Q1QA 2DHRA 4Q7MB 3LW7A 1W7AA 2PMKA 3M4YA 1ZBDA 3NBFA 4AI6A 1JR6A 2ZJBA 3D6TB 1CJVC 1GVNB 4Q02A 2HCBA 3KKQA 2QA5A 3K9GA 4LYJA 4NP6A 2ODEA 4B33A 5C1BA 5CK4A 4PSVA 4N0DA 2W6JA 2B21A 4TT3A 3QBVA 3LAWA 4GT1A 2FFQA 1OXTA 4BPBA 1AK2A 2J7PA 1P61B 3KTAB 1CIPA 2F3TA 4EIWA 4MYUA 4DDVA 2UKDA 5A4JA 1S2MA 1DAKA 1AZSC 1EFTA 1COWD 5DE3A 4TMKA 3IO5A 3QEOA 2DFLA 3CIOA 3QBTA 4CT5A 4POAA 1D2NA 4QM7A 1XEXA 2OCPA 4NU0A 4Q4HA 1X8KA 4DZZA 1AQYA 3FHOA 1IY1A 1WCV1 2VO1A 1M34E 4TSFA 5GJBA 2QP3A 3RVBA 1KYIA 3REFA 3U7FB 3OAAD 1KNQA 4DLXA 3A8TA 3WNCA 5EJEA 1W47A 3EARA 4DC9A 3OIWA 4LRWA 4Q1FA 1R2QA 4ZKEA 3JZMA 4CEJB 1GKUB 4AYXA 3NDPA 5B58C 4DHEA 2GHIA 3GLGE 1ZP6A 1CJKC 3X1WA 3QKRB 1DE0A 1TF2A 3B7GA 4G5SA 5CITA 2QGNA 3RDPA 3VX4A 2EWWA 5LBIA 4MRNA 5FL3A 1WBBA 3VR4A 3I5XA 3AVUA 2HJVA 4G5RA 2W6IA 1JXOA 2OCBA 1KZGB 2ANBA 3A1TA 3P1JA 2HDNB 4PSAA 3GLFA 3NBZC 3W9YA 2BEKA 2PBRA 3MWKA 3I72A 3BGWA 4LHVA 3R9XA 3UG6A 4NCJA 1KK1A 1B0UA 4TYPA 2WVJA 1KJWA 2ERYA 2NQ2C 3EW9A 3HU2A 2ZR7A 4RFVA 2XJ9A 2WAYA 1KY3A 3RSLA 4KFRA 5FR1A 3OFNA 4ZCMA 1XD2A 1UPTA 1XPOA 1Z0DA 1Z6YA 3FMIA 1YVDA 4W7SA 1KO8A 1ZRHA 3QF4B 1XDBA 4DVGA 5F3WB 4JL6A 3X1ZA 4C0LA 2RGNC 2DFTA 2BJWA 1N6LA 2WBLC 3DM5A 5A5GA 1E2EA 1XMSA 4QOSA 4MRRA 4C0KA 2DYKA 2KSQA 3ADDA 1XMJA 5AUPB 1K5DA 3NEYA 3R8FA 3OZXA 3AKDA 5DHFA 3RWOA 4B3FX 2GXAA 4AIIA 3TRFA 1BMFD 1XCPA 2PCJA 2REOA 4LBZA 2BMFA 4JLJA 2FPMA 5DYGA 2EQBA 2QU8A 3P32A 3A58B 4A2PA 4EFMA 2IXFA 4B44A 1QF9A 3GFPA 4IFBA 1M7BA 3SJAA 5JI2E 1U9IA 2C04A 5JJIA 1LY1A 1QHHA 1XFAA 2CK3A 2VYFA 1NSFA 5K8LA 1H8HD 4GP7A 2BKEA 4B34A 1G8PA 1E2DA 1PLLA 1QG2A 1TQ4A 5EE9A 1FP6A 2WIAA 2VP5A 4PPGA 3MWLA 4ASUA 1ZM7A 4YMVA 5CK5A 4R2IA 2XJ4A 2GA8A 1LS1A 1CTQA 1YU9A 3L0IB 2PX0A 3QI2A 4L4UA 5FOXA 1HQCA 1N5KA 2FSGA 1ZM2A 3KX2A 4W5HA 3BH0A 1L2TA 3CH5A 3NEJA 1RPZA 3K09A 3U3RA 1NLFA 4B2PA 2C77A 3ZVRA 4BZQA 4YQFA 2QE7A 5JMTA 4EAQA 3LBNA 4XSGA 4G0NA 3P20A 1G8YA 1DO2A 5ELXA 3X2SA 2QG6A 3KFVA 5DHAA 1R0YA 2GETA 2AKYA 4GOXA 2YJTD 4UJ3A 2JIZD 3TNFA 4AURA 1Q0UA 3QVVA 4JVLA 5TXGA 1MT0A 3B1WA 3NVAA 3I1FA 4B71A 4ACAA 1RVDA 3K9HA 2O8DB 3RHFA 1NN5A 3IPYA 1G7CA 1TX4B 3CKLA 3GLFE 3AVVA 5HE9A 1SVIA 1W48A 2FE4A 1KK2A 1YE8A 3R7WA 4KV9A 1Z08A 5JLJA 4MKGA 4UQOA 1DPFA 1S1MA 3VNUA 1X6VA 2V54A 2XTZA 2BMEA 1T9HA 4KVGA 1E2KA 1F5NA 2OESA 4PZYA 3VHLB 3WP0A 2RMKA 4MRPA 2H18A 1DG3A 5AUQA 1KI3A 3N70A 2QPTA 4RD4A 2H17A 4V0ME 5FTJA 1Q20A 3AKCA 4R71A 1VCIA 1SXJA 1GSIA 2BHRA 3PUWA 4NDZA 1KAOA 1LVGA 5G40A 3L8YA 4E22A 4B76A 1NG9A 1ZNWA 1IQPA 4V0OA 2XSZD 4A6XA 1IN8A 3IO3A 3QOFA 4V03A 2OCAA 3QSYA 2QM8A 5DN6A 4KSBA 1Z06A 1MV5A 3N5CA 2CNWA 2OBNA 3AF3A 4DDWA 1GZSA 1W0JD 2DPXA 3SDZA 4KI0A 5C2JB 5FTKA 3L8ZA 2IF0A 3VR6A 1A7JA 3DL0A 5HKKD 1S0UA 1G7SA 4A36A 4ZI2A 2W00A 3CZPA 2P6NA 3AVPA 4XIGS 2XX3A 2ZI4A 3FYHA 4BLTA 3GJ3A 4Q1EA 4QHTA 3SS8A 1TUEA 2PT7A 2JLRA 1GDDA 1FQKA 3W6NA 1F2TB 5L8VA 3R8CA 1UKVY 1XZQA 1YR8A 2CCKA 2YOHA 3A1VA 3UK6A 2JLZA 2VSFA 1JJVA 1VIYA 1NN0A 1G6HA 3THXA 1IN7A 2AN9A 2GKSA 4NH0A 2WV9A 1NJFA 1G3UA 4S2EA 1ONBA 4PC2A 1MOZA 5EXXA 2V1UA 1U2RA 2AFHE 4S35A 1G7TA 5FH9A 2WWHA 3C7KA 1KMQA 3SI7A 3HP1A 3LLUA 4CIDA 1NG1A 1RKBA 2DB3A 4Z8YA 2MSCB 5FOVA 4RKEA 2WWYA 4KITB 1YKSA 3RSOA 4M9ZA 5K8IA 1I2MA 2IW3A 1RRGA 3BORA 5KSOA 1D6JA 2XAUA 2IT1A 1OYYA 4AKEA 3D8BA 1XNJA 4DCSA 1S3GA 3C14C 3TSWA 3ZGXA 4B2LA 3KTAA 2EFGA 2GXUA 4JZKA 5E7JA 2ZJ8A 5JRZA 1II0A 1S9HA 4QHYA 1COWA 2GZDA 2F43B 2ZJZA 1DOAA 2AXPA 4K8OA 2J0VA 3SZRA 3WYGA 2D7CA 4QG7A 3ZS8A 4CEIB 5AJZA 1W49A 3NKVA 4CRWB 1CR2A 1K8RA 2Q9AA 1N6IA 3I8SA 3SEAA 4FN5A 1Z6TA 3RYTC 4EQ6B 2D4HA 3KQUA 2WJYA 3OAAA 2KBEA 4IOLA 2P6RA 4Q9KA 1E9DA 2CVFA 1ZAKA 1RYHA 4BLSA 3EX7C 1W1WA 2ZRMA 5FOWA 4CEJA 5DO9A 2SHKA 1S96A 4MITA 5AUNB 4GP6A 3GEHA 2XTMA 1LF0A 4OI1A 2CDNA 4CEHB 3X1DA 3FGNA 1SXJE 3QPWA 1Z0FA 3WYAA 1SHZA 2QSZA 3GPLA 4XJXA 3QKRA 3QIAA 2OILA 3CONA 4IDNA 5EUMA 2J45A 1N0UA 2W0MA 1Z2AA 4KYUA 1CS4C 2AWNA 1GKYA 3QKSB 4KLNA 2LCFA 3MRSA 1ZYUA 2RGNA 3ECCA 2J9RA 4BEJA 1WRBA 4RD2A 1Z0KA 2ZETA 1DTSA 2VL7A 2NTYC 5EXTA 1MO3A 3IEUA 2B8TA 1ZJ6A 4UNQA 4OHYA 3AVQA 4LGMA 1IJEA 1T0HB 1HV8A 2FPKA 3VU9B 4F93B 1CEEA 4QGHA 2ORVA 2EVWX 1P9RA 2GK6A 3PXGA 4G5OA 3RS0A 1XWIA 5KDLA 5B57C 4C0AC 1VCNA 3MUFA 4A82A 2IXGA 2XZPA 3VQTA 1R5NA 3FFAA 4F7WA 5BYKA 4PZLA 1E9RA 2F9MA 2H8KA 2HJGA 3K9NA 3TR5A 2WWGA 4URXR 2F1IA 4GFDA 2YHSA 1ZCAA 2IYQA 2ZSBA 4XVRA 4X8MA 1PZNA 3QF4A 1RJ9B 4ZCIA 1DAGA 1XRJA 2R6GA 2QQEA 5GJVC 4QNRA 3F0TA 2JLVA 1W4CA 1MO6A 2QT0A 4R7ZA 4NCIA 2ZEJA 1ZW6A 2D7DA 2P65A 4AYTA 4C3ZA 4A9AA 3C15C 5FOUA 1BMFA 1NVVR 3FOZA 4OBEA 1DELA 2DY1A 2KE5A 3C5CA 3JZAA 1E99A 4LJ9A 1P9WA 2RB4A 4F91B 5K8UA 5DISB 2JATA 2OFXA 2NGRA 3PEVA 1E69A 1E0KA 3CZQA 4JLDA 1KDTA 3B6EA 1H8HA 3BFVA 2GJ8A 1Z0IA 1G17A 2AL7A 4PC6A 1G1MA 3FMFA 4EKDA 2V8OA 4P3YA 5JEDA 1LB1B 3PVSA 4Z54A 4HZUB 2AFIE 5G3YA 4BASA 1MABB 2W58A 3NTUA 4PO9A 1DBSA 1VIAA 4WXPA 5L3RA 4PQFA 3NG1A 1F3OA 5EE5B 2NZ8A 3FKSD 1SZPA 4WOPA 4V0NA 1JNYA 3AF1A 5FPTA 4DEYA 2JJ2A 3KUCA 2AR7A 4DSOA 4NCKA 2YV5A 3B82A 1A1VA 1BYIA 4LI0A 3KJGA 3LX5A 4DUGD 4BLRA 4ZIRB 4AC9A 2WM9B 4D4KA 2IS6A 2JIZA 3IUYA 1M74A 3QE0A 5D3MB 5FUYA 1XCMA 2YVUA 5F2EA 4YDHB 4DSUA 2X77A 1KJYA 3B9PA 2O8DA 4HLQB 2ORIA 4N0EA 1U8AA 2C9YA 3HU3A 3QPVA 2CBZA 5J47A 3AUYA 1XF9A 3AUXA 1E32A 4PAMA 2R6AA 2EYQA 4DLVA 4MYTA 4XOIA 1NVVQ 1V5WA 4TN1A 3Q5DA 1G19A 4Q4AB 1RRCA 1G4UR 3VMFA 5JCZA 2ZM5A 2ODNA 3H84A 3W5JA 5LB4A 1E0SA 2A5JA 3GJ5A 2BKUA 2VEDA 1OFIA 4IDHA 4RZXA 2QI9C 4TMTA 5TV2A 4QM6A 3K0EA 2JLSA 3FHTA 4IXMA 1MRNA 4M4SA 4P0TA 5EP4A 4JJZA 4LOAA 4OI2A 4WIAA 2VTKA 1XTKA 1D9XA 3ADKA 5KNDA 2QAGB 1NRJB 4B6FA 3J81k 1J99A 1FNMA 4DLWA 4JKYA 4NYMR 4NYJR 2QSYA 3TQCA 3EZ9A 4ARZB 4RD6A 3LVQE 1JI0A 3G5UA 1QHIA 4MUAA 3SQXA 4QBFA 2V6JA 1W0JA 2RGCA 1OB2A 4WXRA 2C03A 2W2TA 4CT4B 3OF5A 2OXRA 2QMUA 2N1BA 3PEWA 1KZ7B 4LYAA 4CVNA 2F3RA 3BB3A 3V00A 2OAQ1 1P62B 2IYXA 1RW4A 5EXSA 2EFCB 3DHWC 1XTRA 3T5DA 2Q9BA 2IYZA 3A1WA 2GAAA 2C9OA 5C4MA 1F2TA 2IYUA 3EC1A 5IF9A 1E2QA 1ZC3A 2QAGC 3ZD7A 5J4VA 1A82A 2QT1A 5DGXA 1KGDA 1EK0A 1SQ5A 2BMDA 3SJBA 4IRUB 4ESVA 1NY6A 1N0WA 5EUQB 4L9WA 4B3BA 2G1JA 2RH5A 1KI6B 1N5LA 2XB4A 2WKQA 4N3NA 2ZE5A 3NIBA 3ZZTA 4RZ2A 2AXNA 5LB2A 4TQ9A 4KU4A 2BV3A 3TBKA 2Y8EA 2EWVA 3K0FB 5GADl 1XD9A 1J2JA 1QDEA 2LWIA 2PJZA 4NYMQ 4NYJQ 4IVQA 2F43A 2OE2A 4NYIR 2ODBA 3B5JA 4HAXA 2XXAB 1NVWQ 3I5YA 2V9PA 1JR3A 2G0TA 2HV8A 4CEIA 3RRYA 2BVNA 3T61A 4BLPA 3BXZA 1AKYA 1CKEA 4EQ6A 2N46A 1T3LA 1D2MA 2V6IA 3I73A 4LJYA 5DSZA 2ERXA 3DM9B 1TPZA 1YR9A 4FCWA 2ZS9A 1X8JA 4JLNA 3PITA 4KJZA 4PZZA 1R0XA 1VTKA 3RABA 2IUTA 1NL3A 4CEHA 4DSNA 1Z5ZA 1ZIPA 3EXAA 3RLFA 4DSTA 3ADBA 4KVAA 2RAPA 5JWHA 2J0QA 1UDXA 1BKDR 2QL6A 3W5IA 3L0SA 3WP1B 1IXSB 1E0JA 3QKSA 1KOFA 2QM7A 4HLDA 4C2UA 5FOSA 1XEFA 4IFEA 1J70A 5JCPA 2QP9X 1BYUA 1CR1A 4UXJA 3TAUA 4EDHA 1E2HA 3MLEA 3NBXX 4HDOB 5TY0A 4QNMA 3LXXA 1XD8A 5DYIA 4AKHA 4JLAA 4L16A 1HURA 1LV7A 2B92A 3X1YA 2OSBA 4MDFA 1T4GA 1Z28A 1IOZA 1IN6A 4M1KA 1DG1G 5EZ6B 2C8VA 3QXHA 5JJLA 3VU9A 3FHCB 5AWFC 2GF9A 5KYKA 3A4LA 3EG5A 1KSHA 4Q01A 1NN3A 3G82C 3Q5EA 5HZKA 3R9WA 4M2LA 3THOA 1H65A 4PPQA 4WAUA 5GJCA 2ZE8A 4NYIQ 2R65A 3CO5A 1HT2E 1TEXA 1F48A 4LZZA 5JSZB 5D3QA 4DCTA 4EFLA 1N25A 2ZVPX 1R6BX 4HAZA 5IHPA 5KSYA 4E09A 3OESA 2YYZA 1RJ9A 5CB6A 3EPKA 1H8ED 5L3VA 1NMXA 5FUXA 2O8FB 3GCGA 1AGPA 1OFTA 1TL7C 2CHVA 2E1RA 2A2ZA 4MKIA 4AD8A 2HF8A 3FMOB 1OIVA 3IIKA 3HPQA 2OLJA 5E7IA 4CYMA 2R44A 2IYVA 2WICA 3SHWA 1MO5A 3Q3JB 4II7A 1IN5A 4B3DA 2O0KA 3LBIA 4TYQA 4UXHA 1OPXA 2CLCX 2PZFA 5HCNA 4BUJA 4PTLA 2O8CB 5KSPA 4JIMA 1UF9A 3O8CA 3K70D 3GMTA 2Q3MA 2ZJ2A 4IHQA 4QC2A 3K70B 4K46A 1SVWA 1N3BA 4B2IA 1NKTA 2ZSDA 3AKYA 3NBYC 4PC1A 3RS7A 4BFUA 1OE0A 3U2QA 4C2TA 1E2LA 1OF1A 2ZJ5A 2Z6VA 4M9SA 2PT5A 1R4AA 4D26A 4U7DA 1VG1A 3IHWA 3TLXA 4JYCA 1CBUA 3CRMA 3LDAA 1R7RA 1HE8B 1Z8FA 4BZXA 2KB0A 2EFDB 2MSDB 1XJCA 2CHGA 2VP6A 3CRRA 4Q1BA 1GTVA 4GZMA 4GRAA 4HZUA 1MABA 2IBMA 3EA0A 3CR8A 2WJIA 1AS2A 2G1KA 2JEOA 4ZPXA 4BFSA 2NO7A 3HU1A 2W2VA 3QG5A 3FKSA 2G9NA 2A9KA 3EZ6A 2J46A 2GILA 3GJ4A 2R6FA 4RJLA 4D4MA 2AD1A 3T12A 5LDDC 1G3MA 3K70C 5EE1A 2G3YA 3TUZC 2OHFA 4HLUC 1HEIA 2HLDD 3S1AB 1XPRA 1G3RA 1OFUX 1MO4A 2BC9A 2J3EA 2RGBA 1FX0B 3MAAC 4NPHA 1EGAA 4DUGA 4ZIRA 3CPHA 3SNHA 3QF7A 5D3MA 1W44A 4PO8A 1YQTA 1B23P 1Q1EA 1KO1A 2ZR9A 2IUUA 1N6NA 1OJLA 3LWNA 3H0KA 4KCGA 5TARA 2RGDA 3D31A 3NDBB 4HUQB 3BD9A 4FCVA 3TIFA 4EPXA 4D0GA 3BERA 1NN1A 5BQ5A 1J90A 4QGAA 3ADCA 1UKEA 2BBOA 4Q4AA 4B3CA 3SYNA 2BBWA 5FFMA 4ILEA 1IY2A 1FTSA 3B2EA 2A5DA 2VLIA 3K0CC 4GBMA 1XJ0A 4B73A 4C4PA 3AVWA 4DB2A 2GCOB 2HYIC 1KDRA 1X3SA 3DEFA 3KJHA 3OHMA 5AK0A 3PR1A 2D3WA 1WXQA 2FFAA 3GLIE 1JXMA 4V0KA 1IBRA 2R2AA 4GI7A 4D80A 1U0HC 3IBYA 1VKJA 2OLKA 5LD2B 2Z83A 3HYTA 4YONB 4TMZA 1NKSA 1YZNA 2QAGA 4NBSA 3W6PA 3LQQA 4ZV4A 4DCUA 3O8BA 3BK7A 2GK7A 2J0UB 2QMHA 2BDTA 3F5FA 1ELOA 2ATVA 3V4RA 1XTJA 4DT1B 3EA5A 4MYHA 4OQFA 5E7MA 1YZUA 3C4JA 4ARZA 2GVZC 5FTLA 3CF6R 2W0SA 3OEED 4LV5B 2QTHA 1WE2A 3WXMA 4ZDWA 4UNRA 2A5YB 1A2KC 4XWOA 1E2NA 1KSFX 1P2TA 2AX4A 2P6UA 1JALA 3KQKA 1AQUA 2BCGY 4A2QA 3G0HA 3IEVA 4DXAA 2JJ1D 2ZRDA 4AK9A 2QNRA 5FPSA 2ZRGA 2ZPTX 1OB5A 4NCHA 1CLUA 2AHOA 4MGZR 3T1OA 4JBWA 4EJSB 5KHOC 5L3QB 1DO0A 2O0JA 4XH9B 2O5VA 4QGFA 2BWJA 2CCGA 2OXCA 3I61A 2A3RA 2BOVA 4ZDIA 3ZIAD 1MH1A 2G88A 1NI3A 1XZPA 2A5FA 2J87A 4I4LA 2ZE7A 4PQYA 2ZRLA 3LO5A 1XBTA 1M7GA 4FWIB 4G01B 3X1XA 1Q57A 3KDSE 3GJXC 5BYJA 3UMSA 4RZ3A 1KI6A 2CE7A 4PO1A 4R98A 2JJ2D 4PC7A 4URVR 2H92A 1T8UA 1AIPA 1GL6A 3LH5A 2QQ0A 1W4RA 3FB4A 4BFXA 4JBYA 2FEOA 5E3HA 2JLQA 1R5BA 3K0FA 2F1JA 2NO6A 4TTQA 5FPKA 4GZLA 5DIFA 2GDJA 4B48A 4NKRA 1AA9A 3BE4A 3KL4A 4Q66C 1XTIA 4DEXA 3GEEA 1QZXA 2XXAA 1DAIA 4BE7B 3EPJA 3SYLA 4YC7A 4QXAA 4FMCB 4TMWA 2IYYA 5CIQA 2VHQA 8OHMA 3W3AA 4TLAA 3BBPA 5HR5A 3NC1C 5BW8A 4FD2A 4BRUA 1D9ZA 3HDTA 4OYHA 4PR0A 3CBQA 2AK2A 4FW9A 1IM2A 1X1SA 4ABYA 3IIJA 3W3ZB 1AS3A 2X2EA 3PIRA 3KFXA 4JLMA 3VKGA 3NC0C 2JAQA 1ESNA 2UZIR 3VNVA 2QENA 5A0FA 3UWOA 4OL0A 4B6EA 3L0OA 4I1VA 4RSGA 4EPYA 1U99A 1PJRA 2PLFA 4KLZA 4Q1DA 5UKDA 4JVNA 1XX6A 3KXLA 4JJKA 2EFEB 5F98A 3IQXA 2ZYWX 221PA 3QQ5A 4KBFA 2GJAA 1E2JA 3H86A 5FUVA 3GP8A 1R8QA 5JECA 2GEUA 4IOKA 4LK2A 4RY2A 1JPJA 2ZRJA 3AQ4A 4LJ8A 1NMYA 1VDZA 4LYFA 3M0EA 4B47A 1TF5A 3ZVNA 1TQ6A 5FUWA 1VYTA 4KFTA 4PPFA 1SVLA 1OFHA 5H1YA 1PV4A 1C4OA 1E96A 2GCNA 3GFOA 3E70C 1Y3AA 4RCZA 3KJIA 1G41A 4Q18A 1T8TA 2FF7A 1XCGB 2OV2A 3LV8A 2VP0A 3SHFA 4HDCA 3WMFA 4ESHA 1P3JA 1EFHA 4R9UC 4F4JA 2Q9CA 2FNAA 2VSXA 5JSZA 4WA7A 4JT4A 2P5SA 2CMKA 2HXSA 4LJ7A 3SBDA 3RRMA 1H8EA 1P72A 1ZUIA 2O8FA 2FFHA 5G41A 4P4SB 2A30A 4LUCA 3EWAA 4FI3C 3CRQA 4M22A 1E94E 3DO6A 1KI8A 4HAVA 1I4TD 5KUTA 1KO4A 1KK3A 4CZ2A 2GESA 2IEZA 1BH2A 2GRJA 4HAUA 4RD0A 4XWAA 3U7EB 2O8CA 1E2IA 1UBFA 1X1RA 2GXQA 3CB4A 4M1OA 1U81A 4HLUA 3RS2A 4DDTA 4KBGA 2JLWA 3ZLJA 3T5GA 2AKAB 3P27A 1MR3F 2FDCA 5JFGA 3QKTA 3GQBA 4PAOA 2DR3A 2G77B 2FN4A 3W6OA 1G6OA 4JVMA 1E9BA 3AF0A 1PUIA 3PENA 2PLRA 3ZVLA 4GNKA 4Q4LA 1E4VA 4JLKA 4XVQA 2XB2A 3LBHA 2Z4RA 521PA 1JR3D 4C0SA 1OHHA 5KNCA 2O8BB 1G9XA 3THYB 2ZANA 4KHZA 2D62A 3RC3A 1TMKA 5TMPA 4MKHA 1R8SA 3PUZA 2XNSA 4DRZA 1G3IA 1JQLB 1KAGA 2Q6TA 2CXXA 3KXIA 3OIYA 4LHXA 3QVUA 5P21A 3I62A 4RFSB 2IF2A 3ZS9A 4KO8A 4LBYA 4JLVA 1M2OB 1VYUA 4LCBA 3ZDQA 4ZCLA 3K0CA 4TTPA 1G21E 2GZAA 2RGAA 1LNZA 2HLDA 5FPYA 3S1AA 2EFHB 3DMDA 5FL7D 1FX0A 1GRRA 5DI9A 1KI7A 1NVUQ 3K9LA 2ZSAA 3LXRA 1IXZA 5E4FA 1GAJA 3ZVMA 1Z63A 3TSZA 2GCPA 1AKEA 5EE0A 3TAHA 4Q48A 4GSYA 1S1CA 4JYBA 5CYOA 4HUQA 4OK3A 1UKYA 3PUXA 5KO2A 3KJEA 3I8XA 4I1OA 4D4JA 1R0ZA 1JAIA 2OCYC 4IVPA 3QXXA 3I92A 2XNDD 2YWGA 3A6PC 1A4RA 1OH8A 2AK3A
chains in the Genus database with same CATH superfamily
4GHWA 1BW9A 1TJ3A 3PC3A 2X9QA 4GI2A 1U2TA 2QTAA 1YR6A 3QWFA 3SQWA 1TQ2A 4NMXB 1O5IA 3GT7A 2Q5QA 5AT1A 8LDHA 4MV6A 2NNLD 3R75A 5E2IA 3RVSA 1LLUA 3KOZA 4MWDA 4O2LA 1QOZA 2WWRA 2FLVA 3ISTA 1LVHA 4TL9A 4TMFA 3MYYA 3T3DA 1SXPA 3E7XA 3I9FA 4QQ8A 3BTSA 3LVFO 4P7FA 3OG9A 1E3DA 1I01A 4J7XA 3OT1A 4CMKA 3OZVA 3M6XA 1GARA 1WPXA 4CKEA 4F4IA 3M6AA 2PXHA 4MQLA 1S9DA 3P4XA 4DT1A 2JIQA 5K8TA 3AZOA 2H2HA 3OM0A 5LR6A 2A78A 1JQDA 2FOXA 3OM1A 5CUQA 4ZOLF 3DS8A 3ZY4A 1WX1A 2NPFA 3A6LA 2F7SA 4MPRA 3HJNA 1B8OA 4JVSB 4QBHA 1UPXA 1YZTA 5LNK6 3WB9A 1KY2A 3GFFA 5EJ5A 2AMLA 1JZSA 3GNTA 2DFNA 2M98A 2YFYA 5G1PA 5H7XA 3Q2IA 1EWQA 5FTNA 4E0BA 2J6BA 5HOQA 4FYWA 1O77A 1W75A 2H5LA 3RC8A 3DUFA 3W5VA 3LCMA 4CUZA 2QBYB 1WU8A 4K6MA 4AUEA 1T91A 4QICA 2IWHA 2ZIFA 2ET6A 3PUVA 2BFPA 3PE6A 3ZIAA 1TIPA 2Z95A 2DMRA 3V55A 1FFHA 121PA 2ZXUA 3RYCA 3QFRA 3ZNPA 2CVZA 1VCMA 4G8CA 2FW6A 1H4VB 2PZEA 2IZ7A 1OMOA 3N5KA 4N0MA 2WLSA 4I1UA 3R6TA 3R9IA 3IURA 4EYGA 1PNRA 1KP2A 1ZCJA 4YWHA 3JQAB 4GXTA 1NJ6A 1WQ4A 4DR5B 3DMRA 2NV6A 3I5MA 5TGDA 3JZFA 4H1WA 4BECA 3ELUA 1X8XA 1Z07A 3CEAA 3KCQA 3OSZA 4F4HA 2EU8A 1ZLXA 1C80A 3Q3IA 5CLQA 4BFWA 2GN1A 2B7BA 4P3PA 3LT0A 1LX7A 1HZZA 4IVRA 4RK1A 1JWBB 3FLMA 1NIPA 2FN7A 4A03A 4G0MA 3VI3B 2VTBB 1U2DA 3DCNA 4MHOA 3IBCA 1FRVA 1HY3A 3KQNA 2NZJA 4JXXA 3GLSA 1SHKA 2VBCA 4J4HA 4JLOA 2PZLA 3GWGA 3LW8A 5H0IA 4B6OA 2YJZA 1EWVA 1Y9ZA 3OLYA 2FRXA 3VISA 3OX3A 1NUTA 4YXWD 4M0MA 1LLDA 5LL6P 2HSWA 4BO4A 3DKPA 4TT8A 3HB9A 2B9EA 1KIAA 3KR2A 3HFRA 4O4IA 2FN3A 1QVWA 4CV1A 4J8PA 3C1TA 4PHTA 1NR5A 2QN8A 1J06A 1JRLA 5G3ZA 1V1MB 4LQLA 1AU9A 3S7TA 5JISA 3GUCA 5KOYA 1QE3A 1KRWA 4H9GA 4F3RA 4G37A 4RAQA 4CE6A 3VZDA 1KC3A 2OHXA 2LTAA 1LFDB 1PJAA 2VJMA 2Z1MA 1H1DA 2HXYA 1Z4OA 3IAUA 3P8ZA 4QYXA 5C4GB 2D4AA 2IYFA 1QG0A 3KKPA 1Y80A 1PGNA 3B1ZA 1EJ2A 3GL9A 3GLTA 1KZHA 3ZWWA 5BSRA 3PQ4A 4AVYA 1CRPA 2FAXA 2ZOSA 2C58A 2AZMA 2J4CA 3O0DA 1L5OA 4RHXA 4YRNA 1WIWA 3ABIA 1FIUA 3ZQJA 1M6EX 2QRZA 3H2YA 1EXMA 3I2IA 5AH0A 2FSPA 2BEJA 5FBKA 1J1IA 3GMDA 4HN4B 1NI4A 4ZQBA 2HU2A 3SVZA 3C16C 1T6XA 3N86A 3DTVD 5CM2Z 4EFKA 4TKVA 2BZ0A 5KWJA 3K1JA 3PEFA 1W2GA 1M75A 3VV3A 2GCIA 2A1TS 1DS6A 3F3KA 1M72A 4H7PA 4L0DA 3IDQA 1FLVA 4M7RA 3L7AA 5JALA 4GD3Q 1XQ9A 4R1QA 3EFOB 4BVAA 3QK7A 3AVYA 4MHSA 1YOVB 1Y8AA 3QVMA 1UKZA 2JFOA 2BUBA 3SM9A 4X5OA 1VKNA 3H4IA 3V32A 5KWIA 2ZTVA 4JJ6A 3OOSA 2WJZB 4LVOA 4OEHA 5IXYA 1AM4D 3RBVA 3OIGA 2HZBA 4FFSA 3QE4A 4RQTA 5A4AA 1SHTX 5KU7A 2ZT6A 4P4SA 4JOQA 2IPMA 3UMRA 1V8OA 1E4EB 4FDVA 4A8JA 2BFBB 3GJ8A 3N3AC 1C7JA 4WUVA 4NLLA 3UKDA 5CA0F 4V39A 4OXYA 1KDZA 5DHSA 5EWLA 1E64A 4P7GA 1NLYA 3W9BA 3OMXA 3W8EA 3V8BA 5LOVB 4X85A 5KWSA 1NQXA 1YAHA 2I1QA 1Z6GA 3QVLA 1PI3A 1WDMA 2VDMB 3E3LA 1II9A 3HKEA 1ZR2A 3TMAA 2ZPAA 1DBPA 4WY5A 1W36C 1M6NA 4O25A 1OXKB 3O93A 3PZRA 1V7ZA 1SQFA 3QEJA 5BY2A 5AKGA 4F4UA 5ITZA 4G9EA 3U6BA 3HXQA 2RSLA 3HJCA 3BT7A 3PEUA 5EZYF 4X92A 1C29B 4KPGA 4K2HA 2O8BA 3IAAA 4HVCA 3BXFA 1Y9DA 3DUWA 4IIYA 4JLPA 2B6HA 2HADA 2ZYDA 4QO8A 4AY5A 4BU1A 5AVTA 5DN9A 1LRLA 1TTHA 1JKXA 3P2KA 4YLGA 2F55A 3ETDA 4IRMA 4HFMA 1T15A 3UB4A 4B84A 3ECAA 2VSQA 4NH4A 1QVVA 3ORRA 1MW8X 2ID9A 3RASA 1IUPA 1EXVA 4X65B 4P3KA 2EKLA 2HT1A 2H31A 3DVLA 2YW9A 4TV9B 4E4TA 2D5LA 1FSFA 1IHOA 1U4NA 1U8YA 2RGXA 4J0QA 2O0MA 1Q2UA 3H6KA 3I0MA 4OUDB 5H5JA 1ENYA 4ZAFA 4I7EA 3RAFC 5DX0A 5EESA 4BWVA 2CXSA 1P80A 2X6TA 4YRFA 3NHAA 2C20A 1CUJA 2GYWA 4HXYA 1RE0A 3U9SA 5CEFA 4YUAA 2FVYA 4L0QA 4Q3AA 1GZ3A 2B98A 1B8VA 1IEXA 2GBIA 4BTLA 1CJBA 3QV2A 1UMCA 4EUHA 3C5HA 3DLHA 4D25A 1A9YA 1DQSA 4XCQA 5TS3A 5CHYA 5FIUA 1H2FA 1Z37A 2HMUA 2Q5CA 3E9NA 4JQOA 3KKEA 4QOGA 5LLSA 5E9JA 1FP1D 2O3QA 3TW8B 4YCCA 4G0PA 3RAPR 1UXOA 4HLNA 1ZNYA 4PIMA 5C9ZA 2PUBA 2OD9A 4G36A 4XUGB 2VJYA 3G68A 2XPCA 3I6MA 4KFUA 2PKYX 3SIPA 2GTHA 4FZ5A 1Q3HA 2AX3A 3C70A 4WKGA 1CU1A 4KRFA 3RVNA 2V4UA 4LW8A 5E0OA 4FE3A 4NOJA 2P27A 5C5DA 4JSRA 1KHTA 4RJKA 4M53A 3NBUA 4B31A 3AHEA 3CLSD 4ON9A 1IN1A 1JFSA 3MVEA 2AQKA 5JHHB 3GGGA 1JSRA 3IHLA 4KO2S 3A4NA 2Q4OA 1YDEA 2G5GX 2ZS7A 4K9RA 1G9SA 3SN6A 1MJHA 2GZHA 2JHCA 2WSSA 4TLMB 1QFXA 3KKKA 1GUAA 2YMMA 1UEIA 5LFAA 2QPAA 1F2UA 1RE1A 1J9ZA 1HQYE 5FWNA 4B4UA 3WBJA 5H3HA 1ZIDA 1SBZA 3OD1A 3WWDA 1BOOA 3RFVA 3ESDA 4PZ9A 4DV1B 3PGVA 3HY3A 3D4BA 3T5BA 3UMVA 5BSHA 3EC2A 3EASA 1PN3A 1T0UA 3U81A 2LKCA 5H81A 1ZJ4A 3VH4A 2CXHA 1JDPA 2QZ4A 3STHA 1OLOA 2DZDA 4QYTA 3CVYA 4TYYA 1AVTA 3NIWA 3HXPA 2CFCA 1B43A 5ALVA 5DLPA 4AECA 2A58A 4TQUS 4N5NA 4M1ZA 2GNOA 2Q1TA 5EKDA 1L4HA 4QM7A 1K5GA 1F14A 2J1LA 2BAGA 3P9KA 3TFQA 3EOZA 1VCOA 3MFYA 4I66A 4LIPD 2QZSA 1KJQA 3FJ1A 3M49A 4H16A 5I8ZA 5C7LO 4B8ZA 5E8RA 4HG2A 5IT5A 4JC4A 1BFKA 4OK6A 4PXAA 1XV5A 3DCJA 4TV8B 1XL0A 5LLTA 4NWIA 1CY4A 1I9CA 1NAIA 1UBHS 3ZE8A 4D9CA 5EJ4A 1RRFA 1NZDA 1VKOA 4EKYA 1QCYA 3NP7A 5BXYA 3PFIA 1AQ6A 2CNBA 3AWIA 5FR2A 1V1RB 4R2WA 4X1YA 2KLHA 1EFUA 1WM1A 5CB8A 4HV4A 3TD2A 1F6WA 4PRKA 4LDAA 5IKMA 3Q88A 3HMQA 4GPZA 1LV8A 4KAFA 4L4RA 3WZ2A 4IJWA 3R9XB 1XTUA 3IJRA 3BC1A 5GOZA 3UK1A 3FOBA 2RCYA 2DCUA 1U65A 3VBCA 4UCXA 3DAGA 4LYEA 3V1NA 1NW4A 2DF8A 2IHTA 2XOKA 5CBPB 1ISFA 2P7IA 3ND7A 3UM9A 3JWGA 1T2DA 3DMNA 3MCZA 4WLVA 3FYDA 3DFIA 4ZVUA 5IM4F 1IY0A 2ASVA 3ASYA 4FHEA 4H08A 2PZGA 1IMOA 2YNMD 3URKA 1SCKA 3D8RA 3M4JA 1FW6A 2H8GA 3ZXSA 1M6HA 3F3MA 3ULKA 2AMYA 1RR6A 3EULA 3SOZA 3TUIC 4WY8A 3A6HA 1ESCA 3SYKA 4G63A 4K1LA 4RHFA 1XL1A 3O90A 3ZGVA 2O48X 1XKTA 2Q6IA 4CMCA 3CNBA 2O1EA 3K8QA 1NSYA 1ECJA 2ZYVX 4TL7A 5BV7A 3D4PA 3KBOA 1EXDA 3NTQA 1RYDA 3L8DA 2CXPA 2V5VA 1RLOA 2GHQA 4MGIR 2GCGA 3OQIA 3PC7A 1TAHA 4IPTA 4ARSA 2GPWA 1UBLS 3TSOA 4DYHA 5TVKA 3TR0A 4QDTA 1X14A 2GBLC 2D5BA 1Z2OX 3QVSA 3TNDA 3WLMA 1O8BA 1JEQB 4CW7A 3WO1A 3PC2A 3LRXA 2PYZA 3WGVA 3W5BA 3H6HA 4C7OA 1NXOA 3CF2A 1TM2A 5KSZA 2O8EB 3AIOA 1MV8A 1VJ5A 5JYDA 5EA2A 2J8ZA 1A50B 1SKYE 1NXPA 1C30A 2QRLA 2PRJA 4M49A 3GZNB 2FZEA 3BREA 4FBGA 4M0EA 3U0VA 2ZIGA 1ESEA 2GS9A 1E2GA 3GXOA 4JP1A 4CF4A 4Z4QA 1RLJA 1O0CA 1WPQA 3WAJA 5DTEA 2I8LA 3BE5A 4KGZA 5AKYA 1N2CA 2F6RA 3ENKA 2DPMA 4BN5A 1B3BA 2WK1A 1K1EA 5GTDA 3KHKA 3ROMA 3DOEA 3EEIA 3TG8A 1F1JA 1TW3A 5JPCA 1TM4E 3QUTA 4EEKA 3PQ7A 1H0HA 1X7ZB 3K1TA 4XASA 5C1OA 1TYBE 3EIEA 5CD1A 4A1FA 4KYVA 1PRYA 2DR0A 2NNWB 4MW2A 2UZ4A 1ZZEA 2C84A 4IKOA 2D2FA 4A6EA 3HB1A 1AC5A 2Y67A 3I5AA 4WZAA 2B94A 4UAVA 2RARA 3PDWA 5LDGA 3VC2A 1YJXA 3O82A 1PZXA 3NBAA 3ZTTA 5G4KB 3G8CA 5LD2C 1W85A 2AVDA 1TDJA 1VLZA 4P54A 3DWFA 4KQ6A 4A0GA 5BOVA 4DCJA 1PJ2A 2IUSA 3NYIA 4IQFA 1B42A 1LF5A 2ESRA 1V3UA 3GJ0A 2EX0A 3S28A 3ZNQA 3WR5A 1NJGA 5JVDB 4HOYA 1EAYA 1RQXA 1SM4A 1THMA 2VHUA 3CWZA 3OFJA 4UPDA 4ZV9A 2Q2WA 2MOKA 1ZZGA 3NAGA 4ZHQA 4IJVA 4HAYA 4LAFA 1TMGE 1G5HA 1GL7A 4LXUA 1E63A 1E9AA 3VJMA 4R3UC 4RY9A 1NVMB 1ODKA 3GQVA 1ZA2A 3GOHA 1YBVA 1M1ZA 1JEEA 4V1CA 1K68A 4NMWA 1SBHA 3ETLA 4I8XA 1GSAA 3QXGA 4JDPA 1ZMTA 3B8HA 4LSZA 4M99A 1SFRA 2A0YA 1N6KA 1E1CB 2D00A 3R0IA 5FBQB 1ZH0A 4RZUA 1H1LB 2OB2A 1XEWY 2ZATA 5ED0A 4JI2B 1O1YA 4NQRA 1VJ1A 3GGPA 3TEMA 1KNXA 4Q3CA 5D2CA 3VZBA 2Z58A 3L77A 4TLDA 5LQDA 3U09A 4WHMA 5IWAB 4D6PA 1FL9A 1AK1A 1Y3IA 4PX3A 4KXFB 3ON5A 5AXCA 1U7UA 2C5GA 4BFVA 3RJZA 1SCAA 2P0EA 3F9RA 4CXMA 1MPTA 2A9FA 4XPIB 5K9ZA 1GXSA 3DZDA 5IJWA 2R00A 1YRHA 4D0LB 2X22A 3CB2A 4LSMA 2REBA 5AM1A 5EFOA 5JG7A 3BXHA 2C4TA 4GQAA 4M1MA 1P9LA 4UD6A 2PIDA 3VM6A 1MJFA 4HJXA 2ONJA 1HLDA 4L9SA 2AUMA 2OZVA 3FVQA 4MIEA 1T0JB 1T9BA 3K35A 3PWZA 3PDCA 4MICA 1T35A 3IPAA 1MX5A 2V7GA 3KAPA 3IUSA 2Y1OA 3KT0A 3ZW7A 4DR4B 4GS5A 2OGTA 1DAPA 5K4HA 2D59A 1IHPA 3PL1A 1OI4A 2O1SA 5KQPA 3ZXIA 5SYAA 3Q3VA 4WT7A 2DECA 4RSRA 1ZD8A 4O8CA 3M82A 2GPYA 1BJKA 2Z3VA 1P1KA 3AWDA 4J0EA 1FLAA 1YASA 4YHBA 2BE7A 3G7SA 4JB8A 4KEAA 5EIOA 5BSTA 5BSKA 6REQA 1K6JA 1LSJA 3VH2A 2W2LA 3NCHA 1H2EA 2WF6A 3B48A 1UZAA 2Q1WA 3N3BC 2R48A 4B9AA 1N2CE 2WMNB 3MJ4A 4LVNA 2HREA 2GYYA 2X8JB 4LNAA 4V2UA 4LF7B 5B1IA 3T3HA 2WR8A 1A4XA 2DUMA 2VPZA 1O6ZA 2H1LA 2ZULA 4C0QC 4JXZA 2X4LA 5EMLA 1IM8A 4WZAE 2ZSHA 1RAFA 3M9LA 3LGSA 2ZB4A 4REOA 4ND8B 3M3PA 4PGGA 4U6NA 1Y8QB 1P7YA 3JYPA 4YY3B 4O0MA 5KBYA 5BNTA 3THWB 1YZLA 3RJMA 2VK2A 1ZC4A 5JSHA 3V8PA 4HNAB 1ORHA 2EBHX 3SX4A 5CT6A 4B82A 3BQ9A 1G8JA 2XWQA 3SZUA 3V9PA 1M8PA 1R0SA 4IINA 2FPLA 2W11A 1YB1A 2WFLB 3MJDA 4PEVA 5HMLA 2M2IA 3ONWA 3T5PA 1JLHA 4IFTA 4A7PA 4E51A 1MAHA 5E9WA 4RCYA 1Z63A 1DDIA 4O4IF 4PQRA 2YJGA 1MW9X 4ECEA 1KYZA 3EF3A 3D3JA 4M9CA 1U2PA 1COZA 4R6WA 2R85A 1DQNA 4QUBA 3GP5A 5CP8A 3WBBA 5KX5B 2HSJA 2UVPA 3A7DA 3CVJA 4Z51A 4J3JA 4QTUB 3QVGB 1ONOA 1NMEA 3K0AB 1EIZA 1DCKA 3GEGA 2QW8A 3ASVA 5IAEA 2XNJA 4UE2A 3MT7A 2OO3A 3L4BC 4GEGA 4IHJB 2QXUA 4Y2GA 5B6JA 2ZR8A 4PYNA 4WKCA 3U3JA 1OKKD 3FDIA 3H7IA 3FJOA 4MQBA 2YXEA 1BJRE 1QHFA 3A9RA 5DU2A 3T1QA 4MS3A 2OQRA 1H94A 2OVBA 4FYVA 4IEIA 5CCEA 5AM5A 2J3KA 3IKMB 3GUUA 2IU3A 2XVMA 4U1RA 1G3QA 1LEHA 3R7FA 1NW8A 2XITA 2R1VA 5B30A 2OPBA 3DE6X 4ARVA 1DAEA 1DCFA 2K4MA 3PGMA 3GVPA 4JR1A 3OZRA 2R62A 4RTSA 2ZRKA 2Z8XA 3CE9A 4WNAA 4D9MA 1W4AA 2AQIA 3D3KA 5I7OA 5LUAA 2ACEA 3H2IA 3FPCA 5JAOA 3EDMA 4FHCA 4AS1A 3AINA 2DH6A 1DLJA 3NOOA 4R16A 4UNNA 5JW6A 2D2EA 4L4ZA 4KXLA 3WL5A 2GBLA 2W93A 3KD2A 3AUJB 1GG5A 3MYRA 1QDUA 4MS4A 2W8BA 4IDDA 2NU8B 2A8YA 1SCQA 1KEVA 1CS0B 3S1LA 3QPWA 4TTRA 4KR9A 3IJPA 5F2OA 5JAPA 4P86A 1G5PA 3L0CA 3ZZUA 1PP4A 3AJEA 4IIUA 2NLOA 1AJEA 1RPNA 4DCCA 4QJ3A 3CT4A 5A2GA 1MZPA 2FWRA 2EF1A 3I09A 4MR8A 3RRXA 3R8XA 3IRUA 6ADHA 1RABA 5F5LA 1LRJA 3FWYA 4WN9A 2BELA 2VCYA 1SB9A 5TS2A 2ZAGA 2ZWMA 3E3OA 3G59A 5DM2A 3WQHA 1A8IA 5HS4A 4BFTA 3GLGB 2J3DA 3D5QA 5DLQC 4ZVQA 4BEBA 2A0FA 3I9JA 2CL0X 2HMSA 3WGYA 1JQKA 5A9TA 2ZYRA 2VXYA 5B37A 3FYUB 2C9MA 3S55A 4HY3A 4D44A 5L51A 5JBQA 4LHSA 4NCAA 3UWMA 1TF7A 5B64A 3STXA 2XIJA 2WKPA 4Q9IA 3WBKA 1T1JA 4YJHB 5BWMA 2KJQA 3DDWA 4OOEA 1X2EA 2VHWA 3TFOA 1JECA 5KYUA 3HVJA 4LNHA 3RU2A 4ERNA 2IODA 1NP6A 3NYQA 2Q6KA 2ZREA 3H9CA 4IJ6A 3UENA 4YV2A 5BSFA 2E9SA 3VR6H 3QE9Y 3VR4H 4CR7A 1ZW1A 4IIEA 2Q4BA 3CG0A 5KNLA 2ZJ3A 3CRVA 3TZCA 3BPSA 3BFKA 1XEWX 2C3MA 2IL1A 3ROFA 2NO9A 1ZSYA 2QUHA 1UJCA 4R5HA 1XPUA 1MKYA 2J3QA 2MR5A 3ROKA 2I8CA 2ODPA 1I7PA 3B70A 4IIJA 4XTRA 2RC6A 3ZWPA 4BNJA 2CL6X 1P0MA 3Q9SA 4BKOA 2G28A 4K88A 5FWDA 1BX0A 3R0VA 2B4RO 2HA0A 2WUWE 2O7RA 8ABPA 4EY6A 2UVDA 3IAM1 3DBHA 2QQFA 3D0QA 1LJ8A 2WAMA 3EDQA 3CZAA 3B38A 3F67A 3GJYA 3Q7SA 4F3YA 4UFPA 4MSUA 3VJLA 4I6GA 2PUGA 3JVUA 1CRWG 3DAFA 1EK5A 4GPBA 4I1PA 4GMXA 4RQBA 1P2GA 1USVA 3NJ4A 1PWXA 1X0VA 2W83A 4YWJA 5REQA 3C8MA 1WAMA 2HRDA 3CH4B 4G5FA 4UMFA 1H2RS 1S8AA 1O97D 4WD3A 4IDOA 1VYHA 2HU5A 1ISPA 3KB1A 3NFRA 4YP9A 1JAYA 1UEJA 5GJWC 3UOWA 3JVVA 3RUIA 3VYSB 3W8DA 4X64B 5CG2A 3ESAA 2RHRA 2OBMA 3LGXA 1NW5A 1DX9A 3EZGA 1K2VN 2Q6OA 2J7PD 1AN0A 3G7NA 5L6MB 2RI0A 1U0TA 3AM5A 5E6UB 4GMGA 3ZV6A 5KOIA 1VE1A 1EUCA 3DAHA 3N8GA 4FMBB 4R4JA 5CJJA 1W1IA 2VUUA 2ID8A 4TZ0A 4O0LA 3H4MA 2NZWA 4L3WA 5EHZA 5LU8A 2C95A 2JHGA 4O3MA 4JFRA 1USUA 2E4ZA 2XWSA 3OEYA 4GOMD 4YCDA 3HKDB 4H6VA 3TW6A 4OQLA 3ZJVA 3BQMB 4JSYA 3FKJA 3MINA 4P0PB 3RWBA 4LZWA 5I5GA 1ZM4A 1EE2A 4K6KA 1GFIA 4IXNA 3IAS6 3QBJA 3V7WA 1ZMBA 1JHXA 2PEZA 1UM8A 3L7BA 3BCRA 1G7RA 1OZHA 5EHNA 3REQA 3USES 4MPPA 3MAJA 2CUNA 2Q6LA 3O2QB 3OQJA 1QRSA 1XRMA 1QLJA 4QDUA 5TE9A 5CPBA 1VG9B 4RLSA 2B5VA 2O52A 3UW3A 2EL9A 1GCIA 4Q7LA 4NJMA 4RBNA 5U1PA 2G1UA 4PAQA 4RNCA 3RTEA 1C1YA 2V6FA 3L6BA 4M8LA 5HIAA 4BBZA 1B41A 3ZHCA 4BX2A 3AONB 2Y76A 2AKEA 1Q2XA 4D92A 4HP8A 3VAAA 3B7PA 1J5XA 2RI1A 3OF3A 1PSWA 4EUSA 4RK0A 2O2EA 2W6ID 2YBDA 2C9ZA 4LRTB 1FJXA 1EFRA 2PWAA 2X8AA 3UICA 4DMUB 4TTTS 2WTEA 4JL8A 2CCJA 4FCCA 2P5YA 3UMGA 5GV8A 3GN2A 1OAOC 2Q2NA 2WLTA 4UHKA 2B0JA 3NIDB 4PZAA 3RTCA 3TLGB 3CVXA 5H8WA 4XGNA 5EI5A 3IRVA 5CA0B 1QQBA 3U3OA 2HHJA 1QYIA 2FG5A 3LUGA 4PYIA 4FMDF 5ALHA 4KQWA 3KXDA 3PNSA 1CR0A 1DAFA 3OPQA 4BRSA 1N2SA 4DG5A 1YVUA 4IZIA 1B1CA 3OFND 4UD2A 1XD2B 3U4GA 1WTCA 2N0SA 2WWXA 3WQBA 1EZ4A 1QZUA 1N2ZA 3BXPA 3DP9A 4MYSA 1SULA 3CUKA 3VMMA 1MAAA 1OT3A 2PFSA 3H0EA 3FSEA 1QH1B 1XZAA 3DBRB 1YCGA 1NNLA 4GC5A 3MF4A 1O9GA 3STVA 3K05A 1IH8A 1UMBA 2X13A 1S3SA 2Z56A 3L4BA 4M0LA 4BFLA 1OWPA 2NVBA 1B0AA 1CZUA 1YQEA 3KL2A 1XZMA 1IZ9A 5EPEA 1FYWA 821PA 1KZ9A 2R8ZA 2IBTA 2Z09A 5EIFA 3LHIA 3F78A 3IOMA 4C7MA 3ICEA 3P94A 5HRUA 2A9PA 1YWGO 3X3HA 2NV2B 1OU0A 5K0NA 4Z4IA 4KH1A 2PLAA 3DD1A 4BX9A 3NGLA 3JYHA 2JFQA 3KHUA 4M9XA 1P5FA 4GLFA 1RWOA 4PWZA 3STYA 2GN0A 4JR2A 3LY5A 4GU5A 3VOBA 3N58A 3FOFC 4OGFA 2IOQA 5HPYB 2CSXA 3HDVA 5ADHA 3BQNB 3ZJUA 2NZXA 1GG2A 1UZMA 3JV7A 3TECE 3WRWA 1H9BA 1NNEA 5CFLA 4EL5A 1B0PA 1NLUA 3VR1A 2HK8A 4IRXA 4DPMA 4ZICA 3IESA 1KWGA 2CLIB 1Z7GA 3QKWA 2EC5A 5FKJA 1CHNA 4DTCA 1UT5A 4E5SA 3J80A 4R8SA 3VR5A 4CHGA 1IUNA 3IMEA 2AFHB 2N42A 2JCGA 3IL2A 1L6IA 2AG8A 3RF6A 5FHRA 1AH2A 4OYLA 4YRQA 4PYRA 1SG0A 3OY2A 1TFRA 2C5FA 2V59A 3THRA 5BSVA 1CIJA 1ZCFA 1GGFA 3PXCX 4ZZ1A 3KYCA 1I10A 3ZBUA 4Y1RB 1CF4A 3KSAC 1AS0A 3EB9A 2ZIWB 2RHHA 2M1XA 4MAMA 1SZJG 3ZK8A 1IXRC 4NL4H 4HTFA 4ZMRA 4A15A 3VO9A 3M5WA 1D4OA 2XQFA 4OSPA 3O26A 4URUR 1NUHA 5IVPA 1O5OA 4Q1CA 1R74A 3BMNB 3GZ4A 3U62A 2Y0DA 3IFSA 3MT8A 5JWOA 1GAWA 1GRQA 1A9XA 3MD9A 5CD9A 2YQZA 4RDCA 1HZJA 1CP2A 2YV1A 3E8MA 1F3LA 2DGDA 4YAFA 5IJZA 4NIMA 1Z12A 2GTPA 3TCXB 1I2CA 4KREA 5JNRA 1TZJA 2BMAA 2HBQA 1QHSA 2CFTA 4R6XA 1QQ7A 1TJYA 1OAKA 4H35A 2UZ0A 4BO2A 4DV3B 4JV5B 1D2GA 3B20A 4P0QB 1NHGA 3EPHA 1VZ3A 1Z4MA 4ZRNA 1V7PC 2DCMA 2FJPA 4C7KA 1ZNZA 1K9SA 2DG2A 1HG1A 4MR9B 1JQ5A 1L5MA 1T3HA 1VJ0A 1Z17A 3DMFA 3FZNA 4G1UC 4MAFA 4MLCA 3CVWA 3AERA 2C5LA 3EAQA 1Y37A 4G1CA 2ODTX 4UTOA 4KG7A 4JEUA 3P52A 2NXJA 4N5DA 1R5OA 2YJ5A 4OGKA 1IRIA 1DKLA 4KMRA 4ZJUA 5HIKA 1WQ1R 5E4YA 4EZBA 1SXJB 4FQ8A 3RSSA 5KNDH 3HV2A 1NVDA 2V6BA 3EIHA 3UBTA 1RYZA 2G9QA 3PC8C 4LSGA 5E9AA 4NV3A 4PX9A 2RJ3A 1T2EA 1MIOB 4LY6A 4OG2A 4CM6A 5C80A 2WJWA 4DYDA 4GPTA 5TB5A 4RD1A 2YKGA 1U7XA 2BTOA 3UKJA 3T7TA 2A5GA 1P7PA 1PVOA 4CODB 4J91A 2BPOA 1G63A 3USZA 4FKZA 3D5EA 1TCUA 3LWZA 3R6DA 3NM6B 4GX2A 2IXEA 5H83A 3N0WA 4J16C 5FBVB 1IM5A 2NTVA 4QBIA 3ANTA 4I99A 1U3VA 1EGMB 3RU3A 5AVWA 2AMFA 1X7XB 3MD0A 4D5EA 4E33A 4E7OA 3HVIA 1WEHA 1EA7A 2YWJA 1YZ3A 1SK9A 3MJHA 1TTTA 1HL7A 2HBRA 1L5VA 5DBHX 2R6R1 4KSCA 1ODFA 2QTNA 4BJ6A 3HDHA 5ABPA 3FTFA 1RP1A 5CTJA 3WL4A 2X19A 1LK7A 1NSTA 1IZ7A 2FN8A 3QP9A 1PW7A 3LLSA 1L8OA 4OOFA 3KXKA 4KLAA 3HBMA 4AIRA 3ZWDA 4AUMA 1QGYA 4EA6A 1U7WA 1T9ZA 1Q1QA 2DHRA 3UPDA 1EE1A 4Y2VA 3WIDA 2XBLA 3V34A 1G98A 1ZBDA 4AI6A 1JR6A 1C9NA 2C7QA 1T8PA 5NLLA 1KEEB 2DULA 4DM7A 3EEOA 1T8YA 5EWMA 2NZVG 4NP6A 3HCBA 4V2IA 2X5NA 3PX7A 4OJMX 4DXHA 1WABA 1FNDA 4TT3A 1ODIA 1UBNA 2VQ3A 2X9LA 1CE8A 1AK2A 2W90A 1P61B 1EHIA 4DA4A 4HN2A 2HH9A 2LCIA 3OBIA 4I2VA 4HDAA 4MYUA 1U7TA 5KZMB 1AZSC 1EFTA 3I2HA 2CSUA 3QEKA 1XWFA 5EYPA 2HHCA 5EY5B 4RPHA 5FBZA 4OGGA 1YIAA 3IEPA 1WXIA 2JLBA 1XEXA 3OJCA 4D56A 2OCPA 4PN7A 4YUZA 5IDQA 3IQDB 5LXTA 5SY4A 4PGHA 1X8KA 3QMPA 3SQNA 1K2WA 1AQYA 4XLZA 2QJTA 3L6DA 1WCV1 5AKXA 4TSFA 1OAOA 2QP3A 1KYIA 1ADJA 1YDHA 4WECA 2ZT7A 3DW1X 2PX4A 4RF3A 1K63A 4MW9A 5CYFA 1DG9A 3G02A 3OZGA 1MA0A 3EARA 5GY7A 1VFPA 3N6VA 4Q1FA 3H9UA 4LRWA 1MJGM 1R2QA 1ISJA 3BMOB 3MLBA 4F3CA 1L5GB 3DMTA 3JZMA 4XEHA 4QECA 1XDGA 3NDPA 1P6QA 2JVIA 4WINA 3HVRA 1XPJA 1XU9A 1QWOA 2YZMA 3PI7A 4U5QA 4E30A 1CJKC 2PKWA 3Q12A 4JQZA 3WKDA 5HF6A 5CITA 4RWZA 3VBEA 3WTBA 3VX4A 1KBQA 1C3JA 1W6RA 5FL3A 3KUXA 3M1LA 4G4SO 2GERA 4G5RA 4K87A 4U7JA 1JXOA 3GRPA 2A1UA 2YY6A 1KJIA 2BRUC 2R60A 4ZOAA 5JNTA 2DUJA 4H7EA 4WDRA 4D57A 2J4FA 3S99A 1DQPA 2BEKA 1U11A 2FMHA 2VR1A 4NZ9A 5A0VA 2VAVA 2IGBA 4DQUA 4AMYA 3F3SA 1Z73A 3I72A 1SNYA 1QCDA 3NTOA 3GFSA 5A03A 1VL1A 5GGXA 1HOXA 5JCOC 4P84A 1FS4A 4MDHA 3UG6A 5EHXA 3D9QX 1KK1A 1B0UA 2KLBA 3KDAA 4ZODA 4ALLA 3W06A 2XJ9A 1GTMA 5ADWA 1KY3A 4IIHA 2C4HA 1XTVA 5K0SA 4ZYYA 4ZCMA 1GD1O 1UPTA 4B17A 2ZBRA 1BFUA 4I4TB 5LDHA 1GNTA 1F8UA 4B1FA 3ZLTA 1Z6YA 1V3TA 1WCXA 1YVDA 1UBSB 1UXKA 2OMEA 3JARA 4YT5A 4JP5A 1D6SA 1Q7RA 3KSMA 4J2HA 1XDBA 4DVGA 5ULLA 4JL6A 3X1ZA 1XK6A 2RGNC 4N40A 3UCFA 1DEAA 2HM7A 2QOEA 2DFTA 1FP4A 2RK6A 2X5XA 2YDXA 3VAYA 4AMGA 5BWBA 1XMSA 4QJBA 3RODA 2PUWA 2WW8A 1KY4A 3LX4A 3M5DA 1P8JA 2XCSB 1K5DA 4LVCA 3HJHA 3AKDA 4MW7A 5DHFA 1STOA 4B3FX 3IYLW 5KYXB 4TS9A 1BVRA 2Z5VA 4RTJA 2BMFA 1N9KA 4L27A 5DYGA 4FT4A 4B7UA 2EQBA 4YRJA 2ZUFA 2UUOA 1M8FA 3COWA 4EFMA 2GSDA 4B44A 2V3WA 5KVCA 4YRDA 3S70A 1Q15A 4G8DA 2C04A 2NZ2A 2CK3A 3K2QA 5BOSB 5CFMA 3PL5A 2VYFA 1QTRA 1QORA 4KQEA 4Y18A 1JG4A 3HNRA 4GI3A 4BDTA 3A2LA 1PBNA 2J9ZB 1FP6A 2WIAA 2VP5A 2W6MA 1TEHA 2V58A 1CQJA 2REQA 1TYAE 3DDZX 4DYVA 2I3DA 2EATA 2WIDA 3K96A 1GTSA 5B4UA 3MXOA 1LS1A 3L0IB 1EUDB 3FF1A 1AE1A 3AG6A 3BD6A 1TCBA 2Y92A 3ISVA 2JF0A 1I1HA 3BH0A 1L2TA 4L3VA 5EHIA 3T8YA 4HDNA 3INGA 1EP9A 1NLFA 3D4IA 3V4OA 4DQLA 4MVJI 4BQNA 5IT9A 5DLDA 5JMTA 2DBQA 1JPVA 3E2MA 3R5FA 1MB3A 2B3TA 4WCFB 4XSGA 3P20A 4AJJA 1HDGO 4XM2A 3I2KA 4ARBA 5DHAA 1XAIA 3QPBA 3ELDA 3ESXA 4QUIA 1N34B 5FX2A 2AKYA 5YASA 1K0FA 3I39X 3NR2A 4R8MA 2YJTD 4LZOA 1VLLA 2HIMA 4DMFA 2Z98A 1DINA 3ZDXB 4LEIA 3ETHA 3LHSA 1RVDA 4HPJB 3RVOA 4ND5A 1QWSA 3KYDB 1VJRA 4EY5A 1LLFA 1ENPA 2VTEA 1E3WA 1JUDA 3G0IA 4TKUA 3AVVA 4K5QA 1SVIA 1E5XA 1W48A 1KK2A 2FE4A 4GAEA 3NHLA 1BKSB 3EVDA 5AW0A 5JZ9A 1Z08A 3LDHA 2WYHA 2BUAA 1C5KA 2WKSA 2FWNA 3EBLA 3GG2A 1T9HA 3PNMA 1E2KA 1F5NA 4PZYA 4XDZA 4Z5XA 3DCYA 1ZKMA 1FYFA 2RMKA 2BF7A 3EYAA 1DG3A 4AJNA 1YS9A 3BN3A 1KI3A 4RD4A 1IU9A 1UJ6A 2H17A 2QPTA 4GBJA 4XUDA 4HNUA 3AKCA 5ENVA 1ZHFA 4ZQGA 1NLMA 3CEPB 4Q82A 4C2BA 3HWWA 4WI1A 2PVPA 4C4YA 1CF9A 2D6FA 1T4BA 3C6QA 2G9UA 3PUWA 1V3QE 1LVGA 2Y1EA 1Z13A 1UPFA 3L8YA 1A7AA 4XB1A 3DFZA 4QVKA 4YCMA 2AUNA 4YDQA 5K8CA 5KVAA 1YU6A 4ZMBA 3IEIA 5KNDD 1IQPA 3IBTA 3PFFA 3PRKE 4QLAA 3SEZA 1XZBA 3B2NA 1GGNA 1C8LA 3DOCA 3QSYA 4JDUA 5DN6A 1DPGA 5E1MA 5DV9A 2DLNA 1B2RA 1QIMA 3B8EA 3H5LA 3N1UA 3U3ZA 3WIOA 1Y4UA 5ALDA 2FB9A 2BCEA 3OCYA 4ZYTA 1W0JD 2HDHA 2B2CA 3SDZA 4OSOA 4KI0A 7ADHA 2QUIA 5AVUA 2GHRA 2BR4A 5L53A 2F8LA 1FTYA 3C39A 3DL0A 1W93A 1S0UA 1OZAA 3FSJX 1G7SA 3W2EA 4A36A 3JCZA 4EBFA 3B6IA 4UQLA