5FI1B

Crystal structure of the p-rex1 dh/ph tandem in complex with cdc42
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
FMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
total genus 53
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fi1B00
3OFNA 5UKDA 2V6JA 1G8HA 1HTWA 4RKFA 2QAGC 2MSEB 1SXJA 2RMKA 1QVAA 1XCGB 3MJHA 3K0AA 2FE4A 5DSZA 3MLEA 4JS0A 4J0QA 5KSOA 2H18A 3PQCA 4OQLA 2PX3A 4A0GA 4UJ3A 2ZRFA 4DT1B 2OUKA 2N42A 4KJZA 2QGNA 1LW7A 3BH0A 2WBLC 2WSSD 4IFEA 2EW1A 1Q20A 4OI0A 2GF9A 2ZI5A 2VO1A 4JJZA 4A0RA 2QBYB 3NBZC 1JAIA 5HR5A 1J90A 4A0HA 2VL7A 1U8ZA 4LC0A 2QT1A 4LSGA 1SKYB 3FVQA 3PUWA 1P72A 2DHRA 2GZDA 2ZETA 5FBWB 3B1ZA 2XAUA 2VSOA 3EASA 2C8VA 2JJ1D 2WIBA 2Q0HA 1AS0A 3EZ6A 4KFTA 3DKPA 2EWVA 5D3MB 1KI2A 1GL7A 2GA8A 4LJ5A 3TRFA 5B64A 1G5RA 3GLGE 5JLJA 3CRVA 2C5LA 3FHCB 4F93B 5B58C 4Q1FA 1U0LA 2VP6A 5GJBA 2RB4A 4GBMA 1DG1G 3QKSA 4BWYA 2GVZC 1Q3HA 2ZRNA 1OPXA 3D8BA 4DLYA 3TAUA 1O3YA 2H8KA 5E3HA 3MWKA 2OBMA 3KQKA 3HP1A 5HTKA 1Z3IX 2A7QA 1YQTA 3QF7A 4LGMA 4CYMA 2BBOA 2IHYA 5CYOA 4EKDA 4TN1A 2J0SA 5EUMA 4HATA 4X8LA 1ODFA 3GCGA 3NIBA 1NSFA 4XVRA 1YJ5A 4CW7A 1FP6A 3AF1A 1JECA 1P3JA 4JBYA 2DFLA 2O0KA 2LCFA 1W4BA 1FP7A 4V0LA 1SVIA 3U6KA 4AKGA 5L3VA 1KK2A 5CJPA 4ACBA 2R9VA 3K53A 4TZ0A 4HLQB 1Z07A 1F2UB 1LNZA 1VYUA 4UXIA 5K8LA 4TYWA 5AUOB 4C0BA 4KHZA 2QAGB 2KBEA 5JJKA 1E2MA 3LFUA 4D4KA 1ONBA 3L43A 3PEUA 1GSIA 4PO9A 1E9FA 1N6OA 4P31A 3R8CA 3ZH9B 2BJWA 1YR8A 2JDIA 3UG6A 5KTYA 3AQ4A 5A4JA 4XD7A 2IHBA 2DCUA 1G41A 5TXGA 3K0FB 3QKRA 1YZQA 3BD9A 4QHTA 3W90A 4DLZA 2J0UB 2C04A 3GLHE 2I1VB 1JI0A 2JLQA 3KKQA 5KNCA 1WXQA 5FTMA 4E09A 4YQFA 1KY2A 4IDNA 3U7FB 1I4DD 2PMDA 1N6LA 1MO3A 3AKEA 5JSZB 2OFXA 2ZSAA 4HB4A 4C0HA 1KI7A 4JL5A 3HPQA 4OK6A 3T5GA 2JEOA 2NZ8A 2QMOA 2XJ4A 2QT0A 4TWZA 1T5IA 5DH9A 3SJCA 4DJTA 3GJ0A 1LTQA 2VP0A 4NCIA 5IK2D 1XJCA 2HJGA 3VR4A 1J2JA 4M21A 2FZ4A 1L4UA 3QEJA 5HCNA 1UF9A 4OQMA 3CONA 3RS3A 1S9DA 2WKQA 3KDSE 3CH4B 3OIYA 1Z6XA 3M6AA 2O8FB 4O3MA 1WP9A 1EK0A 4G5QA 4AIIA 3TIFA 4NCJA 4AYXA 2WWFA 1F48A 1HV8A 2P6RA 1XEWY 5FL7A 5JWRA 5EE0A 3X1YA 5H68A 1NLZA 5JHHB 1YR9A 3NG1A 3NBYC 4LHYA 1T0JB 5EQTA 1CULC 1OB2A 3EAQA 2F9MA 4WXRA 3WYFA 4N0EA 4LHVA 1OXVA 4M1YA 4R9UC 5EZ5A 1RRCA 1GNPA 2O52A 2ZYUX 3T1VA 1TF7A 4AKIA 4UNPA 4LHWA 1SVMA 2DY1A 3NC1C 1TPZA 4G1UC 1XP8A 4LK2A 1W0JA 2BMEA 3WRYC 4MGZR 4N3NA 1MRSA 2AX4A 2QUZA 4NL4H 1SGWA 1DAHA 2IYRA 4PAOA 3P20A 1T5LA 2QA5A 2G83A 1JJVA 2ZSEA 2ZU0C 4PZYA 2EFDB 1T0HB 3KFVA 3B13B 4D25A 4TZ6A 2C9OA 1Z29A 4A82A 1FX0B 1G7TA 4LBZA 3I5XA 4PZLA 1ZNWA 3GLGB 3D3QA 1P6XA 2OO7A 1S3GA 3BWDD 3KJGA 1NMYA 1SXJB 1UKZA 4A8JB 2C96A 4TMXA 1QDEA 2CNWD 3ZZUA 3IIMA 4A15A 4QJ4A 4QGFA 5J40A 5AJYA 3SHWA 3D31A 3ND9A 1D9XA 2GEVA 4Q4JA 2H17A 2ZI9A 1PLLA 2QEQA 3RNLA 4ZIRB 4Q03A 2ZS9A 5F9FA 4US0R 2VP4A 3VHXA 1QRAA 1CP2A 2GETA 1ZYUA 4NYIQ 1KSHA 4ESHA 2WWGA 3IBYA 4AWXA 4HAYA 1MRNA 2QSZA 4BFZA 1GNQA 1G4AE 1SVSA 4RVCA 4LCBA 3ZVRA 1P73A 4LI0A 4LHZA 4YMWA 2YKGA 4YMSA 4D4JA 2NMVA 1OXXK 2O8DB 2G88A 2C98A 2KB0A 3B1XA 3BIFA 1KSJA 4MUAA 3CRRA 3ZIAA 4LBYA 4LYAA 1J8YF 1E79D 4LPSA 2ATVA 1E0JA 3AF2A 2ZRLA 1Q3TA 1N6KA 3LY5A 121PA 3WMEA 4DSTA 2CK3A 4ZIRA 3OE7A 3W6NA 4F4IA 1N6IA 1QHNA 4KAXA 1Y3AA 2XTMA 3CX6A 4PHTA 4Q4JB 4W7SA 2TMKA 2D7CA 2R8RA 4ZI3A 2OCYC 3LX5A 1LB1B 4V02A 2I1QA 4Q7JB 2IUUA 5DI3A 2XZLA 1XZPA 3L0OA 5HZHA 3SHFA 2ZUBA 3AV0B 2NPFA 1TEVA 4B6FA 3U4QB 2OFOA 1AZSC 2CE2X 2W6IA 3SI7A 2WTUA 3MSXA 4B74A 3H86A 4NU0A 4OHVA 5CB6A 4D0GA 3GQBA 3RWOA 1FX0A 3QBTA 1CEEA 2ORWA 1GITA 3LVQE 5FL3A 4BFWA 1QG4A 4RZ3A 1G19A 2ZR7A 3GLHB 3CLVA 1YVDA 5LPNA 3PENA 1G5PA 2FSFA 3EC2A 3MJRA 3U3RA 4QGAA 4DLUA 1VCIA 2P0EA 4YXWD 4V0OA 3BC1A 1R2QA 1KI4A 4TT3D 2JGNA 4M1MA 2C99A 1II8B 4ESVA 3BRWD 3B82A 1KAOA 3IKJA 1GILA 4WXPA 1IOZA 4UNQA 4Q4HB 1DO2A 4ZCMA 3FYHA 1E2HA 3OHMA 1A2KC 3I8XA 2N46A 4LY6A 2ZJZA 1W36B 1Q1QA 2RGCA 3U3OA 1A5TA 2BEKA 3DOFA 3PVSA 4IJMA 1P2SA 5TV2A 3CNOA 3EPKA 2YWEA 2WM9B 1VPLA 1N5KA 2CCJA 4FXPA 4G3XA 4QC2A 2MSDB 2OV2A 1K6MA 4KLZA 2FSHA 5KYKA 4UKDA 3UWKA 2Z0MA 1EXMA 4A2QA 3T1TA 3RYTC 3UIEA 5KSZA 2DB3A 1JB1A 4LYJA 5G3YA 1XX6A 1ZM9A 3SOPA 1KMHA 4D0NA 5CM8B 4EPVA 1TF5A 1PUJA 2KJQA 1S0UA 4A92A 3FWYA 4B32A 4H9GA 4QGGA 4A8JC 2Z43A 2GBLA 1NLYA 5HKKD 3BFVA 3PCRB 2P6UA 1AS3A 1H65A 1GDDA 2IYZA 721PA 1IY2A 2ANCA 3K0FA 2VH5R 2ZITA 3BXZA 4URYR 5SZKB 4V0ME 5C2JB 1E9RA 4BLPA 3GJ3A 1P61B 1F2TA 1II8A 1D9ZA 4JLKA 2F1IA 4TMZA 1COWA 5TMPA 3TSZA 3MD0A 3CF0A 4B6EA 3AM1A 3WY9A 1RYHA 2MSCB 3W6OA 4F91B 5JS7A 5EXPA 1KO4A 4KV9A 5JZVA 3L0PA 4LYHA 2VIIA 2QL6A 1FZQA 4POAA 2EFCB 3B1YA 1FTSA 3GJ7A 4IEEA 1KIMA 1NP6A 4ASUD 1ZUNB 1SKYE 2ZSFA 3TUIC 4IVPA 2XGJA 1JQJC 1FMJA 3NBXX 1CU1A 1Z28A 1ZD9A 3QVUA 1C4OA 1C9KA 5KU1A 1GM5A 3IPXA 2BMJA 1E94E 2YINC 4M9XA 1CRQA 2EYUA 4JIMA 2BDTA 1E2KA 1N25A 3U4QA 3A1SA 2ZXUA 2AR7A 4HB0A 2J87A 2MMGA 4FIDA 2ZRDA 4Q47A 4OYHA 4WVFA 4BZPA 1TEXA 4MKGA 2BV3A 4ERNA 2ORVA 3HU1A 1WCV1 4XVUA 1KSGA 4KSCA 1KI3A 1XNJA 1E9CA 4Q9LA 2YOHA 1XXHA 3L82B 4TMWA 5B2ZA 3AH8A 4P3YA 4RZUA 2OAP1 4MRNA 1A2BA 1EFHA 3R9WA 4CT4B 1Z6YA 4MA4A 2BM0A 3A36A 4QBHA 4MKFA 4A1FA 4B3CA 2BC9A 4GPTA 1RJ9A 3ZQ6A 1M7GA 3U60B 1FW6A 3GMTA 4P32A 4WW0A 3DZ8A 1UKYA 4YDSA 2XNDD 3R8FA 1XMIA 3ASYA 4B35A 1NJGA 4UNSA 3FPAA 3VQTA 2YV5A 3F5FA 2H5EA 5DYIA 1T6NA 5JBQA 1W4RA 1YKSA 1NY6A 1VYTA 1QG2A 2V55B 4FN5A 2JJ2A 5FPSA 2FNAA 5C4GB 3NXSA 4IDPA 1G5TA 4B33A 4M1SA 2D4HA 2FZLA 2VPPA 5FTLA 1LV7A 3GJ5A 2Y8EA 4M4SA 3KQHA 2CHQA 2W0SA 1R7RA 4UNRA 5JI2E 2CDNA 5DI9A 1CBUA 2HEIA 2BOVA 4YXWA 2NO7A 1DAIA 2XSZD 4JJKA 4OQXA 1FOEB 4YLGA 5FPHA 2QQEA 3PUXA 3GLFA 4OK5A 2A2ZA 5B30A 4TMVA 5AWFC 4QNRA 3LAWA 3TQFA 2YWGA 1RFLA 1NIJA 2BHRA 3AUYA 3CR7A 1Q57A 3KJEA 2F3RA 1G21E 4UQOA 2G1KA 3QXHA 1P62B 2KI5A 3BJIC 4GZLA 1EG7A 3Q5EA 4AC9A 4C0AC 3QKTA 4URZR 3HU2A 4CT5A 3CO5A 2NZJA 1P4SA 1TF2A 3QNUA 1XU4A 2NQ2C 1EFTA 4G0NA 4I1OA 4NDZA 4M0LA 2OT3B 4LOAA 4L8GA 4W5JA 2P2LA 3IDQA 4NPHA 2XXAA 1B23P 4TTPA 3QJYA 2GAAA 3ZVNA 2XTZA 1KNXA 2R6GA 2RH5A 4QHYA 3UANA 2IEYA 4HLDA 3KUCA 3KKNA 1RIFA 2V1UA 2H16A 3CR8A 4UXHA 5J4KA 3B1WA 4H1UA 4B2PA 1GUAA 4K46A 1XF9A 4FMDB 4DCNA 4JVLA 5JI3E 3U7HB 1OH6A 4C4PA 3NWJA 1XXHE 2PX0A 1W5TA 4KBFA 1G7RA 1NVXQ 2KE5A 1WA5A 2HXSA 4MUBA 2JIZA 2OFWA 4LV8B 2CJWA 3R20A 4OKSA 1M7BA 1NL3A 3E2IA 4IKEA 4MYHA 4DEXA 1U0HC 4HI0E 1AGRA 4C0SA 2PCLA 3F8TA 1X1SA 1RE0A 4L16A 3TSWA 2FEMA 1MABB 3D6TB 2RGEA 3T15A 1SXJE 1H8HA 4DIDA 3KTAB 5CIQA 2QTFA 2ZR0A 2WJGA 3RHFA 4AD8A 3KXKA 3PXGA 3LVRE 4MGYR 4ZDKA 1NSTA 4IDOA 5FUYA 3SYLA 2CBZA 2DWQA 2OBLA 1BS1A 3I1FA 1E98A 5LB4A 3TAHA 4BECA 2ZANA 4D0LB 4XSGA 1KDTA 3VTKA 3IEVA 2WHXA 1G3RA 1FL9A 3ADDA 4MRPA 5EUQB 1HUQA 3VNUA 3F0TA 4Q1EA 4RY2A 2REXB 3IO5A 5FBVB 3DMDA 4M1TA 1MT0A 4DB2A 1LFDB 4LYFA 5FPYA 4TLEA 1AN0A 3FOZA 1N6RA 3UMFA 1NI3A 4QRHA 4BFVA 4BFYA 1E99A 1ZINA 1N6HA 3ADKA 1YZTA 3AP1A 1OFHA 1FPMA 4FCTA 2ZI3A 1DADA 2CLDX 3IGFA 4EPRA 4KFSA 1SVLA 3GLFE 2LKCA 1IN4A 3PUZA 4MRVA 1VCOA 5E7IA 1W49A 821PA 4MYUA 1UBGA 1XD2A 1P2UA 5AUPB 5HKKA 2QMHA 3QPWA 3QBVA 1RRFA 4G5GA 4BRUA 1TQ4A 4IOKA 1E0AA 3FHOA 3HYTA 3CPJB 2AWNA 2JIZD 2WJJA 4EJSA 1D6JA 2JLXA 2YYZA 2GAOA 4PSKA 1OH5A 4FCWA 3IBGA 4JLVA 5AJWA 3IHWA 5EXSA 4IRUB 1Z06A 4I4LA 3W5IA 5C1BA 2IA5A 5CK5A 3I72A 1D2EA 5KOYA 4NP6A 2OM2A 5IHPA 3RS2A 1K5DA 4B3GA 2YWFA 2W6JD 4D4LA 1TUEA 2MMCA 3FGNA 1GRRA 2JCSA 2QU8A 1IN5A 3SNHA 2V3CC 4NCNA 2X77A 3JVVA 4TL9A 4KITB 4CEJB 2FG5A 1XEXB 2GRJA 2ZM5A 1G9XA 4US2R 4PPQA 3K0EA 4QHSA 4RFSB 2QBYA 4A9AA 1OYYA 3ADCA 3CZQA 1NVWQ 1G7SA 2FN4A 3P4YA 3R9XA 3PEWA 3RLFA 5CLQA 4DSOA 3CB4A 1E9EA 5J4LA 1EGAA 1KJYA 2QRNA 2Z83A 2FDCA 3AVVA 2Q6TA 2DWOA 1XPUA 4O0MA 2FEOA 5EJEA 5SZIA 3UXMA 3A6PC 4Q4HA 4JBXA 1E2QA 1ZNXA 2A9KA 4DDVA 3C5CA 1JQLB 4TL6A 1Z2CA 4FWTA 4D80A 1DARA 4I1VA 1HURA 2F3TA 2OXCA 3I92A 2XZPA 2IYYA 1KTVA 5JMTA 3K9HA 1F2UA 2F55A 2IYLD 4ZCIA 4Q1AA 4R2IA 3RDPA 4D4MA 3K8YA 2R65A 4PO8A 2A30A 1FNMA 4Q1CA 2GCNA 4L9SA 5JCZA 1QHIA 2WOOA 3MAAC 5GADl 5BN3A 3GFPA 3KB1A 4DKXA 4EJSC 4QKQA 1XTIA 4G5OA 3SQWA 2O8CA 1US8A 1V5WA 1ZD8A 2AWOA 4JLJA 4NCHA 4CF7A 1LS1A 2Z6VA 1ZM3A 3C41J 4HZIA 1BKDR 2CK3D 1KO1A 5DNYB 1HH4A 1Z6GA 3Q85A 4BUJA 1E79A 1T4GA 1TQ6A 3EIHA 2Q3MA 5SZHB 4PC1A 4DDUA 1BIFA 2ASEA 4IEIA 4AI6A 2DBYA 3K09A 1IQPA 3CPHA 5DISB 2OCPA 3VMFA 4MDFA 2FU5C 3RSOA 3W9YA 2W6JA 2PZEA 1MR3F 3D7MA 3LLMA 4M1WA 1HQYE 5FUVA 5G53C 3TLXA 3VU9A 3PEYA 1GRQA 3UMRA 5JS8A 2PT5A 3VKHA 3KUDA 3TH5A 4TLDA 4C7OA 4B76A 2VLIA 4AY2A 3EZ9A 1NG1A 1P9WA 2QP3A 2EVWX 3V4RA 1FMLA 5BWMA 4F4CA 1NVVR 2E87A 1WRBA 2ZSDA 1L7VC 3AKYA 4ARZB 4BZQA 1T3HA 4G01B 4JLOA 2IS4A 2ZRGA 1E2IA 2AK3A 2WSSA 3P27A 5EE9A 3BAFA 4PTLA 1NVVQ 1D8TA 5FTNA 5J4VA 4W5HA 3NDPA 1SVKA 3HWSA 4PAQA 221PA 2WWWA 2VHUA 4U02A 3X1ZA 1BYIA 1S2MA 2RHMA 3NEYA 3FHTA 1WDTA 5G41A 4DT1A 2FWRA 3GLFB 3LBNA 2GZAA 2NPIA 3ZS9A 3MWJA 1SHZA 2GCOA 3U3KA 1GRNA 1Y63A 1QHXA 3FTQA 4WIAA 2PEYA 2X19A 3W3AA 2QE7A 5IF9A 1N5IA 3K9GA 1IN6A 1X86B 1UDWA 1H8HD 1VIYA 2UZ3A 4QFMA 4TQ9A 1EX7A 3W8NA 4DSNA 5GJCA 4TTQA 1VECA 2JLUA 3SQXA 1U9IA 3VKGA 2BBWA 2ZJAA 1R0WA 5GVSA 4Z1MA 1XJ0A 4CEJA 3G82C 2RHDA 3KXLA 1CTQA 1E2NA 2XTNA 3ND8A 2NO9A 4TL8A 2QPOA 1W44A 2F1RA 1DS6A 1QHYA 1IHUA 2OBNA 5FL7D 2PJRA 2O8EB 4QL3A 1M8PA 3S1AA 3MGCA 1G64A 1GL6A 3KKOA 1NJFA 1I4LD 2C9CA 3K0CC 2P67A 3TVDA 2GXUA 1KHTA 4MDEA 1ZCAA 1Z0IA 2VSFA 1FUUA 1R0ZA 1DELA 3LBHA 2JLVA 3RC8A 1OIVA 1CKEA 2YNMA 2OG2A 3UK6A 2WWHA 2J0QA 5LD2C 1D2MA 4JMPA 2KWIA 1VMAA 2QENA 3WYAA 2YVUA 2W2TA 3EWSA 2IW3A 4DLSA 2ZREA 3SYKA 1KK1A 3WHKA 2PLRA 1M34E 3A1VA 3GLIE 1II9A 5EXXA 3THYB 2IC5A 2WKRA 4HAXA 3U7GA 2IYQA 2QPAA 1DAEA 2GHIA 1KI6A 3ZYCA 3KJHA 2ZS7A 2GXSA 2HLDD 4JLNA 4LBWA 4KXFB 3N70A 1VDZA 1JJ7A 3VFDA 3TMKA 3A8TA 4UNNA 4TMTA 3UWOA 3AGQA 4HZUB 5JEDA 1E2DA 1VTKA 2RGNC 3T34A 4IDHA 3ZLJA 5IT5A 4JSTA 5AJVB 2LKDA 3QKRB 4YMUA 1GIAA 3I32A 4PQYA 2ATXA 4IXNA 5JHGB 4M2LA 4P4TA 3C8UA 2ZVQX 2GJ8A 4Y0AA 4QJ3A 2Q9AA 1KSFX 4MGIR 4OI1A 4MRRA 4O2RA 2G1JA 2OEPA 2WWYA 5EXTA 4E03A 4ZO4A 2QZ4A 1OYWA 1OXUA 2CHGA 2IF2A 1X6VA 2RGXA 3X1WA 2GESA 4A6XA 2QAGA 1KI1A 3ZD6A 2J41A 4JLBA 1GWNA 4B75A 3K70B 2A5FA 4KBGA 2I4IA 3AVPA 3B8HA 4JLPA 4GOKA 4RD4A 1VCNA 4URXR 2VHJA 1R4AA 2F43A 3MFYA 3DKVA 1XPOA 2HT1A 3FDIA 1E2GA 1G1MA 2VSXA 1U90A 2QNRA 4L4UA 5LDDC 3BS4A 2OCAA 1ZW6A 4L15A 4Q1DA 1OFTA 2CJWB 4FMCB 1FQJA 3DEFA 1KMHB 1VHLA 1UBEA 5DIFA 1E0SA 1V43A 1I4TD 3RABA 4URUR 3CW2A 4NYMQ 3ZIAD 3TKLA 4Q7MB 4BEJA 4QM7A 4LUCA 4ILEA 4M1OA 1RVDA 4C0JA 1AQUA 3GJ4A 3OEEA 4RD6A 3K0CA 1G3MA 3C5HA 1ZCBA 1G3UA 4NYMR 4TYPA 5ELXA 3CF6R 2FFHA 5K8IA 4BZXA 1U94A 2GF0A 4CIDA 2CL7X 2XXAB 4NZYA 1DEKA 1E1QD 3QXCA 1DBSA 2GNOA 2W2VA 1G291 5KDOA 4IFBA 1II0A 3TSOA 2C78A 1XMJA 2EWWA 1Q1ZA 2G0NA 1E96A 1CXZA 2ZR9A 2D2EA 1JXOA 3DZDA 4LJAA 3WP0A 1G3QA 2BBTA 3THWB 2R62A 2OLJA 2PLFA 2F6RA 2EFHB 4Z1MD 2ZRMA 3ZQJA 2A3RA 1E9SA 1E3MA 4Q7LA 3PFIA 2E1RA 421PA 4B2LA 4DLWA 1B0UA 5KNBA 1S4QA 4KLNA 1IAQA 1LF0A 3ADBA 2QE7D 3U3MA 2ZRPA 2B6HA 1QHSA 3OFND 3A4LA 2HF9A 4PC3A 3SZRA 3OF5A 2VHCA 1PVOA 1E4VA 1XRJA 3C4JA 4DXAA 1XMVA 2A5JA 4U5XA 3AVUA 1KI9A 5FR1A 3EPLA 1FTNA 3GJ8A 1ZU5A 3I62A 2ZJ8A 4PQFA 3LA6A 1KYIA 4EFLA 1N0UA 3EXAA 2J45A 4GNKA 3SFZA 1NN3A 2YOFA 3AVXA 2V1XA 3O8CA 4ZCLA 5TVKA 5HE9A 2B8TA 4NMMA 4C7OB 1BYUA 1XFAA 1A7JA 2B8WA 2X8AA 2YC4C 2IXGA 2DFTA 2JA1A 3BK7A 5JWOA 2GZHA 4PFSA 4US1R 1E1QA 3QG5A 1XD9A 4EFNA 4XWKA 1TADA 2PCJA 2VQSA 2REBA 2A5GA 1E32A 2BJVA 3I8SA 4ZPXA 1XWIA 3DHWC 2AFHE 1PV4A 2FFAA 2VP5A 2ZS8A 2FSIA 1A1VA 1WB9A 2IS1A 2WOJA 2ORIA 1VG8A 3LLUA 1P7CA 2AXPA 1KJZA 1M74A 1W48A 1CR0A 1VG9B 1RRGA 3CX7A 5FTKA 3IILA 5AUQA 2VHQA 3X1XA 3A1WA 1SVWA 4TYNA 3B9PA 5F98A 4Q4AB 3I61A 3M0EA 2RKOA 2GBLC 1ETUA 3BOSA 3Q7PA 1P2TA 1QVRA 4B44A 2QTHA 1SQ5A 1G8PA 2F43B 1OV4A 3LD9A 3ZS8A 4I1UA 4LJ7A 3U44B 3TQCA 2ZI6A 4W9MC 2BMDA 4BLTA 2GKSA 4LBVA 5KNDA 3RS4A 3WHLA 1KDPA 1TX4B 3HR7A 2GDJA 2EYQA 2ZRJA 1UJ2A 4OJQA 2ZJ2A 2CL0X 2J7KA 4R71A 1GNRA 5BN4A 2BKUA 5EP3A 4EPTA 1XZQA 3CF2A 1OJLA 1AIPA 2IL1A 4PZZA 1SVOA 2B7BA 3REGA 2O5VA 1U81A 4CGZA 3DMNA 3K1JA 2P3SA 4Q9HA 4EIWA 4M1KA 1IM2A 2QROA 3DVLA 1ZUHA 3W34A 2EFEB 3AVQA 3LO5A 5F3WB 1T8UA 5A0FA 2XSZA 1NF3A 1X3SA 5BQ5A 5FOTA 3L8ZA 5EZ6B 4PXAA 2ODBA 2PL3A 1KI8A 1YHNA 5SZJA 3OE7D 4X8HA 5CDFE 1GTVA 2Z5FA 1NRJB 2F7SA 4GFDA 2HLDA 5FOSA 5EP4A 4WAUA 4AG5A 1ZP6A 4PANA 5FUXA 1UAAA 3TR0A 4CRWB 2W58A 1U2RA 2CVHA 2R2AA 2G77B 2IYVA 1YRBA 2G9NA 3V00A 1TTTA 4RJLA 2VF7A 2O8BA 3PR1A 3U7EB 4OQFA 3IPYA 3QXXA 5FBLB 1NVUQ 3A1TA 1XTQA 4KI0A 3FMPB 1CJUC 4M9QA 5B57C 1PLKA 4K8OA 2O8FA 4K81B 1JEEA 3RSLA 4B48A 1YRAA 5CM9C 3SJBA 4BLOA 2P5TB 3C14C 3CNNA 4B3DA 3EIQA 4Q9KA 2QM8A 1UPTA 1RYFA 5J5CA 4D82A 3THXB 3VR2A 1UEJA 1KGDA 2ZEJA 1GL9B 4P4SA 2ZRBA 8OHMA 5F9HA 2Z4RA 3AEZA 2YC2C 4HB2A 4OHWA 4S35A 3LH5A 1KKMA 1G8GA 2JLSA 1HE1C 5FI1B 1UDXA 4V0MA 1P60A 3QPUA 3JVUA 1RZ3A 4IXMA 4R2HA 1E2PA 1CRPA 3WNCA 3B1VA 2Q3FA 2DFNA 1Q44A 3TJZA 5DLQC 4PHFA 3MUFA 2FSGA 3A58B 3C7KA 1WBDA 4FMCF 1KKLA 5J4YA 4GSYA 1Z22A 3THOA 3GP8A 4PX9A 1MO6A 1JEDA 1L4YA 3EARA 4HUQB 1XTKA 4LJYA 1IY1A 1KK3A 4KYIB 4XTRA 3R7WB 4ZKDA 2ZJ5A 2CL6X 4DCSA 4N1AA 4F38A 1XCPA 1E9DA 3DOEA 3C16C 4C3ZA 4GZMA 4DBLC 1N0VC 3MWLA 3QPVA 3FE2A 1W0JD 2QY9A 1COWD 4X8MA 2X2FA 3AP3A 3HR8A 1U8YA 4EFMA 1AS2A 3KX2A 1Q0UA 2D74A 4MITA 1DPFA 5BYJA 4QM6A 1P5ZB 2J7PD 3NDBB 2QSYA 3CRW1 4HAWA 4EAQA 3KKPA 2IUSA 4EQ6B 4QXAA 3U2QA 1R0XA 3VX4A 1XJQA 4QBFA 3EIEA 4PPGA 4RD0A 1XTSA 2HF8A 5IRCD 1UEIA 2CEAA 3L2OB 1E9BA 4MYCA 1Z0FA 5HE8A 2ZI4A 3RC3A 5JEEA 4Q21A 1ANKA 1W1WA 4KODA 1F6BA 1YZUA 4Q18A 1WQ1R 3DM9B 4Z8YA 2QTVB 1OLOA 4CVNA 1S9HA 5IK2A 4DDWA 3QOFA 1LVGA 1EFRA 2R6CA 4WOPA 3G0HA 4URVR 3RRMA 3SR0A 3TGPA 4B3XA 3RRZA 1X1RA 3GFTA 4Q1BA 3Q5DA 3GFOA 2IYXA 3RWMB 2AN9A 2ECKA 4UJ5A 4XD7D 1M6NA 3MMPA 5A5GA 1GAJA 3KKMA 3CKLA 2C2HA 1P2VA 2L0XA 2P65A 4U00A 1BO6A 1T8TA 2BBSA 2EU8A 1E2EA 4BLRA 1UKVY 3NC0C 4X8OA 1N0WA 4KVAA 4LV6A 5L3SA 3ZD7A 1JR6A 3SC3A 5KPJA 3KXIA 4TQUS 3UKDA 4DLVA 3ZVMA 3AVYA 1ZAKA 2C03A 2WZQA 4HDQB 3SJZA 4JBWA 3EPHA 2F1HA 4GDFA 2ZYTX 4AKEA 2IBMA 1NLFA 2NO0A 3TUZC 4CEHB 2QI9C 4I99A 3TW4A 4Z54A 3AF3A 4DUGA 1IN7A 4PHGA 1DVRA 4ZDJA 2VBCA 4KFUA 3QKUA 1OFIA 5FOWA 3I4LA 1TNDA 1OFUX 1XB2A 4B34A 3SS8A 2B21A 2PMKA 2WJYA 4NYIR 1E6CA 3UMSA 4HB3A 2A5YB 4GL2A 1BMFA 2R6AA 4XIGS 4DLTA 2QMEA 1EX6A 2D06A 5IDVA 1AZTA 2D3WA 2NIPA 2JJ2D 3H1TA 5FOUA 4WZBE 5ANRB 1JPJA 2ODNA 2ONJA 4BQSA 2JLYA 2FGKA 2HYDA 5J4HA 5BW8A 1MOZA 2EQBA 3LDAA 2FFQA 4ITRC 4C0QC 1RRPA 1YU9A 1S3SA 3H0KA 1UM8A 5G3ZA 4DDTA 5FH9A 1RJ9B 2FGJA 3T61A 3CZPA 1CJTC 1L8QA 2G6BA 3ICEA 1E2FA 4OI4A 3QIAA 3O8RA 1UBCA 2XNDA 5FI0B 2GJAA 2OXRA 2Q9CA 2V4ZA 3LX8A 3W8RA 1PZNA 1PLJA 3NH9A 4QBGB 1IXZA 4OHXA 1ZIPA 1DG3A 2HUPA 3LNCA 3Q9LA 2JJ1A 1MO4A 5JRJA 4S2EA 3NHBA 1XEWX 1P75A 1W2GA 1XD2B 621PA 4TTRA 3RS7A 1G20E 4IOLA 4ZV4A 1CR2A 1HA3A 1W4AA 2QGZA 4CEIB 2ONKA 1ZC4A 2CE7A 4BPBA 1CIPA 5AUNB 3BFXA 1R5OA 4Q00A 4E22A 4EPWA 2YHSA 4PSAA 3CPEA 3V4FA 3ZJYA 1A4RA 5JCPA 2OZEA 5DN6A 3QE0A 2CHVA 1NIPA 3EWAA 1US8B 4O2LA 4PO1A 1CS4C 1R0YA 1XCMA 4MYTA 3TE6A 1VKJA 1LF5A 2J0UA 2BWJA 2RCNA 3SJAA 3SEAA 1G3IA 3E5HA 3EZ2A 4WZAE 5H8WA 4RZXA 4ON9A 2OAQ1 1KO5A 3KQLA 2HCJB 3CRQA 1QF9A 4NH0A 3VR3A 4B73A 3R7WA 2GJSA 2V54A 4OQNA 2V7QD 2P5SA 3CM0A 4UXJA 1NKTA 1E0KA 4JZKA 2ZRCA 2ZTSA 3AB3A 4YDHB 1TQ2A 4H1VA 3OZXA 3U61B 3LRPA 4CEIA 4LHXA 5CJ2A 5DO9A 4TSFD 1MABA 5EP2A 4BLQA 2GXQA 5BXQC 1E69A 3THXA 2QORA 3X2SA 2BM1A 1NY5A 1UADA 1KNQA 3K70D 4HAVA 4JLAA 4DSUA 5KSPA 5TY0A 2BEJA 3DL0A 3BH7A 6Q21A 4DZZA 3M1IA 3GEHA 3LW7A 2D62A 3IQWA 4IOMA 1E1RD 3VX3A 3WXMA 4A2PA 3AVWA 4MGKR 3WNDA 3ASZA 1VCMA 3GLIA 1AKYA 3LV8A 3FFAA 2XB4A 2K5UA 3HU3A 1XEXA 4XWOA 2ODWA 1HY3A 3THYA 2AXNA 3T1OA 1W46A 2XITA 3UPUA 2B92A 4FI3C 4OHZA 1EWRA 1YR6A 1TU4A 1DO0A 4TLAA 3A4NA 1HT1E 3KZ1E 4HZUA 3CWQA 4NKRA 1X8KA 2QRZA 3T5DA 3B7GA 5KHOC 2QPTA 3AVTA 1KMQA 2ZUDA 3WMGA 2ERXA 4Q01A 4MKIA 2W0MA 4GI7A 2A78A 4JSYA 1FFHA 2GWHA 2HJVA 3B5JA 5EE5B 4DEYA 1U99A 2IK8A 1Z63A 3DM5A 3I73A 1DAGA 4DRZA 4HYYA 5FFMA 4RCYA 1AKEA 4RKEA 1TU3A 5JJIA 4GMDA 4D2IA 5K8UA 2GCPA 1E1RA 5KO2A 2W2XA 3BBPA 5FBQB 1TL7C 1CR1A 4B71A 3R9IA 4XVQA 4MKHA 2DR3A 3HJNA 1FNNA 2PT7A 1GZSA 2RGDA 4LV5B 4XOIA 4DCUA 1J7KA 1Q12A 2NO1A 2JDID 3T12A 2IF0A 1OHHD 4R7ZA 2UVQA 1ZC3A 4XJXA 2WJHA 3E70C 3HPRA 3Q72A 4HAZA 1F5NA 1CF4A 3VHLB 2FMXA 1OKKD 1Z5ZA 3CX8A 2IXEA 1R10A 3AUXA 3H4MA 5D3QA 4HLCA 5BYKA 2O8EA 2ZSBA 4BFXA 2ZYWX 1GP2A 1HYQA 4OBEA 1Z47A 3FKSA 1FUKA 2V7QA 4F4JA 4JVMA 4C9BA 2O0JA 2E9SA 1NN0A 1ZVQA 2Q3HA 1ZRHA 1T3SA 4Q9IA 3LQQA 1TUIA 1HEIA 3ICQB 3KQNA 1NBMA 4M22A 3VAAA 4XH9B 1VIAA 4TMKA 3V9PA 2V8OA 2IS6A 1U9IC 3T35A 3T06B 3KTAA 2WWXA 4FINA 3U44A 4ARZA 3L8YA 2JLZA 1R8SA 2YWHA 1W36D 5EP1A 1ESMA 1Q21A 3SYNA 3TUJC 4C0LA 5C18A 5DN6D 3SBEA 3QF4A 1G8YA 3BB3A 1FQKA 1N5JA 1CLUA 4EQ6A 1Z8FA 4TQAA 2FPMA 2IYTA 4I1SA 1SZPA 2AKYA 4DLRA 3QUSA 3LWNA 5P21A 4AYTA 3BERA 1WMSA 3M4YA 3TNFA 1KJWA 3P4XA 1H8EA 5FUWA 1G7CA 1LY1A 1M7HA 1OW3B 4Q19A 1XXHB 1SHKA 1IN8A 5GJWC 3ZVLA 2SHKA 2XJ9A 2IYWA 5H1YA 2OESA 4ZKEA 5KSYA 2V6IA 4WA7A 1K8RA 4OK3A 5AJZA 4Y0VA 3QY0A 2J59A 3OIUA 3RAPR 1IXSB 1L2TA 1S8FA 3GJ6A 3QVVA 1F3OA 1XDBA 4ABYA 4G5SA 3AF4A 3QG1A 3WMFA 3FMOB 4QBIA 2ZAOA 2Z4SA 2XZOA 3UATA 2IS2A 1YZKA 3KFXA 4FMBB 4BE7B 1IY0A 2ZRKA 5E7MA 2DFKB 4YC7A 2GXAA 2PZFA 4JLDA 1GFIA 2H7VA 4PC7A 4BFSA 5CITA 2NGRA 4YMTA 2QG6A 4IVQA 2JLWA 1LS6A 3SFVA 2D7DA 4ASUA 1JR3D 3GJXC 3WP1B 4WBSA 4KFRA 2RAPA 2F1JA 1IBRA 3EA5A 3FB4A 5DE3A 3IIKA 3FKQA 1A82A 4QNMA 1AJEA 1F2TB 1G6HA 4KSBA 5DYGA 3EA0A 1OXSC 4FD2A 4DCVA 4DC9A 1RW4A 1GKUB 1KO7A 1SULA 3U5ZB 1P9NA 2C95A 3NEJA 1VG1A 4M9SA 3W5JA 1E2LA 4CEHA 2WPDA 4OI2A 3ZZ0A 4Q7KA 3LW8A 2WMNB 3P32A 2QAJA 2AK2A 4YMVA 4FMDF 1TAGA 4C2TA 5L3SB 3PG5A 2WAYA 1OF1A 3TBKA 4CZ2A 4KO8A 3GD7A 5L3RA 2O8BB 4P4UA 4QJ5A 1Z0AA 3LQRA 4L9WA 1PUIA 3B85A 3MWYW 2EFGA 4D26A 3AVOA 3EZFA 2IWRA 1OH8A 4EDHA 1E4YA 2JAQA 2ZE7A 5JFGA 2ZJYA 4BFUA 1OB5A 4NBSA 5E4FA 1HQCA 2ZRIA 4GOXA 1XPRA 5FTJA 4NHOA 4A0FA 1KK0A 3ZZTA 3ETLA 2ZRHA 4I81A 4RFSA 4DB4A 2ZI7A 4PR0A 1G18A 4NONA 2LWIA 1BH2A 1OE0A 3WBJA 4EPXA 2IYUA 2AD1A 1SKQA 1GKIA 2J5XA 1QHGA 1VYVA 4RFVA 4JL6A 4JT2A 3N5CA 4O25A 4HEJA 5EE3A 4RSGA 2OCBA 4AKHA 3EW9A 2IYSA 1NMXA 1ZMXA 2IT1A 1U98A 3B6EA 2OHFA 1D2NA 5TDHA 2X1VA 4LJ4A 2XOKA 3PIRA 4C2UA 5HPYB 1R6BX 1ZM2A 4DVGA 4BEBA 4JYBA 3EZ7A 4LX0A 3TR5A 4PPNA 4TT3A 1KDRA 5AK0A 4BGDA 1E9AA 2VEDA 1IXRC 4D6PA 4URWR 2FFBA 1K5GA 3ZDQA 2B7CA 4HUTA 1Z6TA 4KYUA 4IHQA 4JL8A 5EE1A 1QHHA 4LWZA 5FPTA 2FPKA 2CCKA 1JR3E 3CIOA 1EFCA 2W6ID 1KI6B 2FPLA 1ZM7A 2WWIA 2IEZA 3NBFA 1W0KD 2H92A 1Z0JA 3O8DA 2A5DA 3QXJA 4JKIA 5LBIA 3RS5A 2BMFA 3VKWA 4BLSA 2IX3A 2Q9BA 3WBKA 3AP2A 1VHTA 2Q21A 1IONA 3AF0A 3A1UA 3TK1A 3MG9A 1GOTA 5CB8A 1JAHA 1ZD1A 1QZXA 3E1SA 4Q4AA 1IJFA 4A6PA 2CCGA 3QQ5A 4Q66C 1W5SA 1ZUIA 1JPNA 2JASA 1N3BA 4TLBA 5CLLA 4BRWA 1ESNA 4EPYA 4CDGA 1DAKA 2PBRA 4JT4A 3TW8B 5DGXA 4BFTA 4ZDIA 3LXRA 3BB1A 2GK6A 1DAFA 2VF8A 5KDDA 1CR4A 5JWHA 1OSNA 1W2HA 1NNEA 3I3SR 3Q8XB 3VR5A 5FOXA 4M9ZA 3AGPA 4DCTA 1JBKA 4C30A 1E2JA 1G16A 1I2DA 1JALA 1DE0A 5TB5A 1OIXA 2H1LA 3CUEF 2ZIAA 4A8JA 1EFUA 1G8FA 4ZI2A 1N6NA 4LDJA 1YZLA 3GLGA 4GP6A 2BCJQ 4NCKA 3NH6A 1UBFA 2CNWA 1P9RA 2ZROA 2ZQ5A 2WJIA 5TARA 2GCOB 5L3QB 2V9PA 4OJKA 3DPUA 2AKAB 3K70C 2YOGA 5J47A 1GG2A 3WRXC 1XTRA 2ODEA 3MCAA 3W6PA 2NOAA 2O0HA 4NTZA 3FKSD 1KO8A 3QEOA 5GVRA 2FV8A 2ZAMA 4FCVA 2PEZA 5G40A 1CJMA 2QQ0A 3QI2A 3THWA 4HLUC 1AGPA 3BB4A 4AK9A 1XEFA 4A36A 4JKYA 2FF7A 2FOLA 4GT1A 2FA9A 3IHLA 4E5UA 3K0SA 3HYRA 2W00A 2ZE5A 4JYCA 1U0JA 3KB2A 2CMKA 4OL0A 4JVSB 2XNSA 2BIFA 3IQXA 2IUTA 4PC2A 4TL7A 3VR1A 3L0IB 4GP7A 3CWZA 1G17A 3FMFA 2JJ8A 3WYGA 4HDCA 3B78A 4HSEA 4LPKA 3GLHA 4F7WA 1XMSA 3A4MA 5HCIA 2CVFA 3G5UA 3OIWA 1ZJ6A 2XOKD 2WVJA 1NMZA 4NYJR 2OLKA 5CIWA 4RD3A 5L3QA 3U3JA 1CJVC 4GMXA 1S96A 4Q4LA 4MQBA 3JZMA 2XEXA 1EFRD 4F92B 4P0TA 1W47A 3IEUA 1AM4D 5LD2B 2H57A 2WIAA 2DWPA 2HCBA 1XTJA 2NTYC 2FX3A 5JSZA 2UKDA 2HV8A 3GEEA 3Q7QA 2HYIC 3IO3A 3L0SA 3BH6A 2P6NA 1QBKC 3DDCA 4WZ6A 2VP9A 2WSMA 4Z8XA 2J1LA 1ZU4A 2WMOB 4AG6A 2WICA 5FPKA 2FJUA 2HDNB 4GRAA 4B2IA 1EESA 2F9LA 2WAXA 1YZNA 3RRYA 3HDTA 3U6BA 1YR7A 1Q1BA 3AKDA 4JVNA 4LZZA 5L8VA 1U8AA 3RANA 2NG1A 3REFA 2IXFA 2AFIE 2PH1A 3B9QA 4JLMA 1DAMA 3RRNA 1VG0B 4LC1A 1X8JA 1G4UR 2J46A 5JECA 521PA 3QF4B 1W36C 3BGWA 5E95A 2UZIR 3FFBA 1F60A 1R5NA 4TSFA 4PC6A 3OIVA 2WJVA 2WPDD 4E07A 3JZAA 3F3YA 1ZM4A 1OT3A 4PPFA 2J3EA 5FR2A 4PHHA 3DO6A 1YE8A 3CRMA 1JR3A 1O87A 3IIJA 2ZPTX 3BFKA 4GOJA 2QP4A 1C1YA 1AK2A 1XD8A 3SU8A 1D5CA 3OEHA 1NG9A 1OH7A 1OXTA 4ZDWA 2XB2A 4QGHA 3IUYA 4HUQA 1XBTA 4IDQA 1S1CA 2OILA 2GK7A 3EG5A 2JLRA 1QHHB 5FOVA 5KPDA 2WV9A 4HLUA 4HDOB 1JNYA 2GJKA 1Z08A 2GEDA 2RGBA 4OHYA 5FBRB 1M1YE 2ZJOA 3NKVA 4DIEA 1N2CE 1HT2E 1G6OA 2OE2A 3TVTA 3PITA 3OESA 4MH0R 1R8QA 2ZE6A 1Q22A 1AA9A 2HT6A 1KZ7B 3LBIA 4B3BA 3GPLA 2NO6A 4W5WA 2VYFA 3B60A 3FMIA 4Q5IA 1R5BA 2ANBA 3PJRA 3CH5A 1WBBA 3UG7A 1N6PA 4Q48A 4R98A 4Q9JA 3ECCA 2AHOA 3LXXA 5AJXA 1MKYA 3KJIA 5DHFA 4TLCA 4RZ2A 2RGGA 4EUNA 4AURA 4P4SB 5D3MA 4U7DA 4M53A 2C9YA 3BE4A 4A4DA 1DTSA 1H8ED 2AL7A 3K09C 2ERYA 3SDZA 2DPXA 5BN5A 3CBQA 4LRWA 4V0KA 1J8MF 1J99A 2KBFA 3WNBA 2G3YA 2R44A 4NE2A 2REOA 2ZJBA 3OEED 2ZUCA 1RKBA 2CXXA 2QM7A 4P33A 3Q3JB 3MRSA 1OIWA 2ZRAA 1J70A 1AQYA 4RD2A 1GKYA 4A2WA 3X1DA 2VA8A 4EJSB 1I2MA 2AD5A 2CLCX 2I3BA 4KU4A 5GJVC 3S1AB 3ZGXA 4NYJQ 1IJEA 4YONB 2YJTD 5LB2A 2VRWA 2QMUA 1KZGB 3SN6A 4DHEA 2R6DA 2WKPA 3P26A 5KUTA 3QSYA 3K0AB 3RVBA 2GVDC 1NBMD 4HAUA 4DWJA 2ZE8A 4D81A 1BMFD 3O8BA 3NHAA 4KCGA 3P1JA 3GLIB 1MH1A 2VP2A 2PZGA 3I5YA 2BVNA 2GTPA 2GJ9A 1YZGA 4PQRA 2X2EA 3N2EA 2C77A 4FWIB 4V03A 1S1MA 2R6FA 1W0KA 4B3FX 2XX3A 2J0VA 1SXJC 2CLSA 1SXJD 4LJ9A 4DUGD 4B43A 1TMKA 4B47A 1T9HA 2VHTA 1Z83A 1ELOA 5CYPA 4TYYA 5F2EA 1OKKA 4IVRA 3OEHD 1BOFA 3SE0A 5C4MA 1NKSA 2JATA 3QXSA 3PV0A 4N0DA 1RPZA 5HZKA 4XWAA 1OHHA 1KOFA 4C0KA 4LJ8A 2N1BA 2DYKA 4TYQA 1MV5A 1CJKC 4IW3B 4PAMA 1KDOA 5DHAA 2IWHA 5K8TA 1KY3A 4QG7A 1W7AA 1PJRA 3RS0A 3VNVA 3O47A 4IOJA 3K9LA 4FW9A 3PUYA 3VU9B 2BKEA 5JJLA 3H84A 2KSQA 1ZBDA 2GILA 2ZYVX 3EC1A 3ONWA 5H70A 4RD1A 5C46F 3EX7C 1HE8B 1Z6AA 3OAAA 4ACAA 3NTUA 4Q02A 1JXMA 2D2FA 4XSHA 3EPJA 4PSVA 3C15C 3NVAA 4Z51A 4LJ6A 5KDLA 1NN5A 4KVGA 3QKSB 5DI3B 1EWQA 2O8DA 2HXYA 1Z0DA 1T91A 4DLXA 4QOSA 3AKCA 3N2IA 3VR6A 1MO5A 2VTKA 2OSBA 3A37A 2ZVPX 1GVNB 3KQUA 3W3ZB 2BCGY 3PUVA 1W4CA 5CK4A 4AYWA 3GEIA 3K9NA 3KL4A 4G5RA 2PJZA 4BASA 2QP9X 1X8LA 2J9RA 2J7PA 5CDFA 5M04A 1WF3A 2GEUA 1Q1EA 2G0TA 2ZU6A 2FH5B 3SBDA 2QN6A 3OAAD 4MRSA 4V0NA 3PEVA 4II7A 4RCZA 5JRZA 1TQDA 3J81k 2O8CB 2YZ2A 1M2OB 1NN1A 1ZNZA 1N5LA 3H2YA 3CNLA 1ZNYA 4XTCS 2RGNA 1UKEA 1Z2AA 2RGAA 1Z0KA 1WE2A 1KAGA 2W83A 4M8NE 3QENA 1DOAA 5AR1A 1NBME 1UFQA 5E7JA 3T1QA 3BORA 1RC8A 1T3LA 3B2EA 4L5BA 1ZIOA
chains in the Genus database with same CATH superfamily
2C3YA 2P2NA 1JU4A 2OQVA 2V6JA 4KDEA 2QAGC 2MSEB 2RMKA 4MVJG 1RBZA 1LWOA 1QVAA 4MS1A 2CDAA 1OREA 4FKZA 2FE4A 1XEAA 1CZRA 1KAEA 3AI7A 1RLMA 3M83A 5KSOA 1TIKA 1GZDA 4OQLA 1HYGA 3AESB 3DO5A 1C80A 1O6BA 4A0GA 5AW6A 5I7HA 1WUHS 5ALIA 1P4RA 2NXNA 1TW3A 3RRXA 2OUKA 2QGNA 1LW7A 3K5HA 2WBLC 1V9LA 2Z30A 3UJCA 4C6TB 3KWMA 3Q12A 2VLBA 1FUEA 1Z7WA 2DAPA 1Q19A 1I36A 4O4JA 2WF5A 5LA6F 4PICA 4XCQA 3ZTTA 5HR5A 1JHYA 3JZDA 3H04A 4Q05A 1OC4A 2GZ1A 3H5LA 2JVKA 3PGXA 4FX2A 3OD1A 2GZDA 4F4UA 3AZPA 5FBWB 1CF2O 3B1ZA 1T5OA 2HWKA 2XAUA 4OMCA 5FDFA 2VF4X 1RYZA 4E12A 3LLVA 3GZJA 3K16A 4H35A 2Q0HA 2IEBA 5BQOA 3IAXA 3JQAA 1PFYA 1CE8A 1GL7A 1SQ0A 4RL4A 8MHTA 3JQBC 3A25A 3OEWA 3TW0A 5B64A 3TSYA 3QX3A 1U0BB 1ODLA 1NMSA 3G88A 4RMIA 4YHHB 4F93B 5B58C 2PVSA 2M6KA 2NU9B 3DCJA 3VI3B 2WILA 4XRGA 2XCTB 1CUSA 1RQNA 3QKSA 1ZHHA 2CVQA 4WGGA 1GZ3A 4BWYA 5AK5A 1GTSA 4FONA 2D1SA 3Q7RA 2O8VA 5HJEA 1OPXA 1BCSA 3EEQA 1O3YA 4P7KA 4YUAA 3T5AA 1K4KA 1VJ5A 1K08A 3HP1A 5HTKA 1I7SB 1YQTA 2PUVA 4NV0A 2JFWA 4UUNA 5JVDB 3OIFA 3DYBA 5EESA 3E35A 4LF5B 4EA6A 2WKWA 3L6UA 3OLXA 1DBWA 2ZULA 4JJAA 5CYOA 2C84A 2RH9B 3ZHOA 5EXDA 5HJ7A 4J2OA 4UTNA 4HATA 3AM5A 3O0TA 1ODFA 4KQJA 1L8AA 2R4TA 1NSFA 3EB9A 3KV1A 1BXGA 2C4TA 2QTRA 3KVOA 1YJ5A 3D6UA 1TIPA 3KT3A 3AF1A 3L7YA 1EVJA 1XG5A 4JBYA 4UVEA 5C1DA 2O0KA 3LG2A 1NW6A 4V0LA 3U6KA 4X7RA 1SVIA 3VM6A 4PRKA 3W5SA 4LEIA 5KYXB 2Y1LA 5CJPA 3QMWA 1EP9A 1L7XA 1EFKA 3BUSA 4HF7A 4X95A 4DA7A 4F9TA 2LR0A 4H6XA 4WK2B 1A76A 4Z9FA 2PSSA 1DWOA 1W2WB 1Z07A 1VYUA 2H5IA 1QLWA 1X7ZB 3KOUA 3PCXA 2PLNA 4MUXA 3FOBA 2Q46A 2IU6A 3HCRA 3MCUA 4TKUB 3I12A 2EGHA 3MJVA 5IF3A 3HJRA 2LDBA 3DTNA 3NBMA 3S0JA 4WINA 3L43A 3E0XA 4I3GA 5EIBC 1T8PA 3MBOA 4R9SA 3SX0A 3R8CA 1XZNA 1P80A 1YA8A 2ZWMA 4TRRA 3JAKB 3L8CA 1TVCA 3ZH9B 3D6VA 1MB9A 3NRCA 4P3NA 2IHZA 3HY6A 5PGMA 2F3SA 2HPVA 3ZGNA 4XD7A 2R47A 2IHBA 3SKXA 1GPDG 5LDGA 3WL5A 1G41A 2GH1A 3ANSA 4WLOA 5TXGA 1EDOA 2JKYA 3FRJA 1AKQA 2J0UB 3A6HA 3HKCB 3JY6A 4B6OA 1JI0A 3KKQA 3V80A 4YQFA 1VE5A 5KOHB 1H5QA 4IDNA 2YIVX 3VH2A 1H2YA 3JATB 4RADA 3R9XB 1N6LA 1MO3A 2QRLA 4M7PA 3HVIA 2OZKA 2OFXA 2NQTA 2FG7C 5I9NA 1XRRA 1W5EA 4JL5A 1QPGA 3PB3A 4F7DA 4MVYA 1WP4A 1T5IA 2XWQA 2A5LA 3N2GA 2IV7A 1ZICA 1DJOA 2TMDA 2VPIA 2C88A 5K0TA 1FVFA 3EOBI 4M21A 2E2WA 1GLNA 1CP3A 3EQZA 1WY5A 5JCXA 1UF9A 1A4IA 3CVJA 3CONA 1RYMA 3P4UA 4OQMA 4EL0A 2J67A 3KDSE 4JV5B 1J0DA 3NR2A 1RQPA 1NPTO 3M6AA 1NQVA 2VEOA 4HH1A 2O8FB 1DLIA 3AR9A 5B1SA 1FY2A 5AQ1A 4NCJA 4AYXA 2WWFA 4ANFA 3GBVA 1HV8A 2P6RA 3RVDA 5JWRA 3GRVA 4DCPA 2OECA 4KQXA 1T2UA 4L0QA 2H4FA 4NRDA 2D59A 3EAQA 4WXRA 2C5AA 2FX2A 3I9LA 1HDXA 3QA3E 4EO4A 2VPZA 4LHVA 4LKOA 5CM2Z 1SHUX 3NYQA 3UC5A 2QXYA 3LRTA 4M1YA 2O52A 3GRPA 3T1VA 1FFGA 3D7KA 4J16C 1W8IA 4UNPA 5A62A 1QS0A 2XE6A 3C6KA 3ZE9A 4G1UC 1ODTC 2B2NA 3MT9A 3C3JA 1TK2A 1YVRA 2GCEA 5KVSA 4N3NA 3MTJA 3ZHBA 1C7IA 2IYRA 5IG2A 3PQFA 2LZ0A 2I66A 4PAOA 2ZCVA 4QOGA 4N7RA 1JJVA 2PVPA 3V2GA 3R74A 2ZU0C 3F7OA 2A94A 2ZRQA 4YCDA 4BB0A 2J31A 5LSAA 3KFVA 2QYHA 1YZYA 4G97A 1G5HA 1WMBA 3PHIA 4KX3A 4FHGA 4EHLA 3DQQA 3TIXB 3MBIA 3OPNA 3E7XA 3CLRD 4JLWA 3NX4A 4B71A 2NXJA 2NYAA 2RDMA 3KJGA 1QF6A 1F1JA 1UKZA 3EXG1 4TMXA 3RC2A 1QDEA 2CNWD 5FBHA 3IIMA 4A15A 3CLTC 4K5QA 2A6PA 4MQEA 1AK1A 1RTTA 3D31A 4HNRA 1D9XA 3D4LA 1QKJA 5DP1A 2H17A 3ZWNA 5IANA 4G4IA 4CQNA 3LCCA 1UDCA 1B2LA 4C3VA 4ZIRB 2AG8A 4Q03A 2P1DA 1ZN8A 3WSWA 4ZVQA 3MUEA 2WA2A 1NM5A 2WU3A 3AFHA 4E3WA 1KZHA 4JENA 1M2FA 1ZH4A 3OPYA 4ESHA 3IBYA 5CFZA 5JDIA 1MRNA 2I3GA 4BFZA 1J9EA 1SVSA 1NUPA 3GO4A 4RVCA 1K9VF 1RKQA 2O2GA 2VTVA 3E8XA 3N2ZB 4IKOA 4X9XA 2IOFK 2X2OA 4L76A 2YKGA 1L4GA 1X74A 4D4JA 2W37A 3R7DA 4HXYA 2NMVA 2AZMA 1KSJA 1TQHA 4V24A 2Q5JA 4PLFA 3HA2A 4OAQA 1WIWA 2PA3A 3BL5A 5JMWA 1F4LA 4MNTA 3CUWA 2X14A 1E79D 4LPSA 5LZ9A 1KYQA 2GFHA 3BRSA 4ES6A 1Q3TA 2GB4A 2I03A 3F9RA 3WMEA 4CIYA 2ICAA 1YKGA 5C7YA 5G1NA 4LQLA 2UZ1B 3EFEA 3OE7A 2XMRA 7REQA 1JEYA 1N6IA 4KAXA 3RVSA 3QRWA 3CX6A 4EW2A 4PHTA 4M7WA 2OBFA 1L4NA 1HL7A 1ZA2A 1BDJA 3LX5A 4LRXA 1L4EA 3DE3X 3H2HA 4V02A 2F8MA 3RPEA 1MCZA 3V1MA 4E2ZA 4X62B 2XZLA 2FMUA 1AB5A 2CJYA 2YYSA 4G8DA 1C7ZA 2I6SA 2QX4A 4IILA 3LUPA 4KXNA 3EEYA 2NPFA 5EZSA 3RS7A 5C8DA 1IUPA 3SI7A 4EVRA 2PFSA 3OM9A 3GQBA 2UYCA 4ZJPA 4CLDA 1U2GC 4YQZA 4J16A 3KEOA 2J08A 3IV9A 3TTTA 5DFAA 2P1ZA 3UMMA 3GNLA 5FL3A 4FYMA 4XEUA 3VAYA 3E82A 3WRYA 2AR9A 5CIYA 3OP1A 2PGIA 2YS6A 4I50B 3O4JA 1V3UA 4PBRA 3TLZA 2GD6A 4L5IA 1E8NA 1EQ2A 1MXHA 3PJDA 4DCCA 4PSCA 4QGAA 2HIGA 4WPGA 4V0OA 1Z2PX 3BC1A 3EXEB 1KI4A 2EKZA 4JC0A 4L9RA 1REQB 2FP4A 4TT3D 2FZWA 1U3DA 2C99A 1II8B 4LFAB 3BRWD 1K2WA 2XUDA 2GT1A 3OY7A 1UM9B 4IHJF 4PN3A 5HQ3B 4C29A 2IUFA 5HXAA 4Q4HB 4I6GA 1KMNA 4LXIA 3VNSA 1DMSA 2J9FA 2MR6A 3OHMA 5I9TA 3CRNA 5C7OO 2ZIVB 4ZXFA 3WLLA 2W2MA 4LY6A 1XDZA 3F6PA 2CFIA 3MERA 1NX9A 1RYYA 1U2SA 1V3VA 2UUOA 3U3OA 1TM2A 5JFTA 1UBUS 4O5OA 1BCRA 5K0LA 3WOVA 1VKNA 1RQXA 3PVSA 4EY6A 1P2SA 3CNOA 4FFWA 2YWEA 4DUYB 3MGGA 3RFFA 1YD7A 4UTVA 2CCJA 4FDVA 4NMXB 3TZEA 4ZI7F 3N28A 3RSHA 2OV2A 1K6MA 5BVGB 3CVXA 4S1NA 1OAAA 2HHHB 5JROA 4BWGA 3USES 4BU1A 4Z0HO 5KYKA 1CC1S 1LTHR 4UBMA 4UKDA 3UWKA 4E5YA 2BUBA 3LDGA 2Q2VA 5EQJB 4A2QA 2UAGA 5SICE 2BEWB 4MWDA 1IN1A 3EFOA 4OFZA 2BT4A 4MR9A 1DCMA 3H1FA 5TQ2A 3W1EA 5G3YA 1TO2E 1XX6A 1VL5A 2C4KA 1ZM9A 2ID7A 2P79A 3FSGD 1GQOA 2PT9A 3K5WA 4KPUA 5CM8B 1TF5A 1PUJA 2VDPB 4HADA 4EPVA 3BD8A 3DD1A 1FC0A 1HX7A 4H27A 3D64A 3IAM1 1F7VA 2OENG 2JFVA 2Q6OA 4S3MA 3UPTA 3D4PA 4XYMA 4ML3A 2IEDA 1GFSA 1GDDA 1LPMA 3NBKA 3QPAA 4GX2A 3CJTA 5DULA 3TX6A 5FNVA 5DM60 5BP7A 1ABBA 2ZITA 3BXZA 5SZKB 4AJOA 1E9RA 1RM4A 2WHRA 3UAGA 3CB2A 4XB2A 3RF7A 1II8A 3R5FA 2F1IA 2FK8A 3H2ZA 4TMZA 4L4XA 4PHCA 2V59A 3WY9A 1RYHA 3W3AD 1NE2A 4FDMA 2ZDGA 4LZWA 1CVIA 1DTWB 1KO4A 3FNFA 4KV9A 4QO8A 2PGXA 3SC4A 1LQ2A 2WSYB 2B3TA 3ZCSA 4ER5A 5JZVA 3SQLA 2QRVB 4AJ1A 5FJIA 5IZCA 4POAA 2EFCB 1QYVA 3GJ7A 3HNOA 4IEEA 3ACCA 1M9NA 2K4MA 1WW3A 2PZKA 1GTL1 2H1VA 2QLFA 3DW3X 3ANXA 4B17A 1KGSA 1SKYE 3D5EA 4FWBA 3L9XA 4EVIA 3O91A 4FOLA 3TUIC 2YZ7A 3CZAA 4IVPA 4NBUA 3PX7A 4IIDA 1S8OA 1FMJA 3MT0A 2GARA 1CU1A 3NBXX 4J1TC 4P3PA 1PSZA 4QLOA 2YMQA 4RPCA 2I4MA 3ROMA 1GM5A 4P7GA 1FDRA 2BMJA 3IPXA 4FUQA 1H3EA 4C6RA 4OPMA 3ST7A 5ECDA 4OUDA 1XZIA 1J0XO 5KNBD 5ED0A 1XZLA 1KQPA 2PGNA 4G0ZA 1SCKA 5H7XA 2BGJA 1PX0A 3A6ZA 3EXIB 4Y1EA 2HA7A 2AUNA 1XA0A 4WVFA 3UYLA 2GKGA 3KXPA 4ER0A 5LNK6 2ORVA 2B1JA 5JC8A 2G9RA 5ALYA 1Q0TA 2GMWA 1WCV1 1ZWLA 3GRYA 3AHDA 3PQ6A 4N6OA 4XVUA 5KX5F 1KSGA 3F6YA 2M32A 1OI7A 3OA2A 3VSEA 1E9CA 1FSPA 1CD5A 2C3UA 2GK4A 2IUYA 3SHTA 5F2NA 2C42A 1DKOA 1TI7A 5B2ZA 1PFGA 4GM1A 4P3YA 1YNOA 4MQFB 4RZUA 4MWOA 3WAGA 1NRIA 3OX3A 3GRAA 1P9OA 3FLMA 3R9WA 3M89A 4NBTA 1K4MA 2EGGA 2FX5A 4NI5A 1AX9A 4U7DA 5KC8A 1OC2A 5AHWA 4ONEA 4QBHA 3AZQA 4EBFA 4MKFA 1E1LA 3EGXB 4P98A 1RJ9A 4L3WA 1M7GA 2HBZA 1O94C 4DAEA 3SF8B 4JQCA 1RMTA 3DZ8A 5KOIA 1UKYA 2EJTA 1JG2A 1PVVA 3RIYA 4EYKA 3R8FA 4BXOA 4B35A 1NJGA 3N3AC 4DDHA 4RK1A 3FPAA 4Y7CA 5CUQA 3F5FA 3VQTA 4MJ7A 1TZJA 3IC5A 1AKVA 4B6GA 2H5EA 5JBQA 3DCYA 1NY6A 2C2GA 3DOCA 2Q62A 3UA4A 5DDIP 3KHSA 4R8LA 5KTPA 5IJ0B 3FA2A 3KYBA 5SV2A 2IYOA 5A71A 5FPSA 1JYEA 5LA6B 1FMCA 4IDPA 3IERA 2R8BA 3WK6A 3GVIA 4CM4A 4N3BA 3EUEA 4UPEA 1ZJYA 2FZLA 4HMOA 5FTLA 4M83A 5DTMA 3L1JA 5U4QA 3KQHA 2W0SA 3ZD9A 4HQOA 3EYWA 2G07A 4FBMA 1Q7EA 1DAIA 4FHZA 4KI7A 4L4YA 1OX6A 3HDGA 2R6JA 4HAOA 3NANA 4JP3A 3GX1A 3PUXA 5FPHA 4EP1A 3LCRA 1B8OA 1T3ZA 2W4QA 3KZCA 1R4NA 4RWEA 4JGBA 1EA7A 1EXNA 1G2IA 4M1ZA 4WXHA 1UOQA 4NF2A 3P45A 5DLPA 2HA2A 1NIJA 3CR7A 4LTNA 5CA1A 4KIJA 2J48A 4UQOA 1UEXC 1FNSA 1VKRA 3EAGA 3QXHA 5BSMA 3FDJA 2GSWA 2PV0A 4D92A 2KI5A 4RGVA 1GTRA 2RHWA 2ZIXA 4W8HA 4UNIA 4MP6A 2Q27A 1EG7A 3RTDA 1V0JA 3MUOA 2PKEA 4AC9A 3NYRA 1P2BA 4GRIA 5A4AA 1T35A 3MC1A 5I7VA 4ZOEA 4FX5A 5KCZA 1XU4A 3FGZA 4TMFA 4RE6A 1AUQA 1R9JA 1KOJA 1I7PA 4LOAA 4DANA 2P62A 4EO9A 1G5FA 2P2LA 3IDQA 3P96A 3MMSA 4NPHA 1JFFA 4GSKA 2XTZA 3AL0C 1CDEA 2FPIA 2IEYA 1D4ZA 3D2BA 2Q1WA 3OQHA 4E7OA 4ZAVA 1RIFA 4DG9A 4MI9A 2AQHA 3QHPA 4HUJA 5JY1A 4WKGA 4BIMA 2H16A 3GEDA 3DGEC 1F14A 4H7FA 5GV7A 4FFRA 4TLMB 4ZVRA 1GT91 4H1UA 1K27A 4OP1A 4UHCA 5DK4A 3KG2A 2IKQA 1PTJC 3LGSA 1YXMA 4XZ3A 1OH6A 1IATA 4EGJA 3NWJA 5DEIA 3W6ZA 2WUGA 1QIEA 3F49S 4KBFA 1G7RA 1QFZA 3GDWA 2OFWA 5EWMB 5E2IA 3HCAA 3NHLA 1CQJB 3AOEA 3R3VA 3VVCA 3D7RA 5CT9A 4R1TA 2JARA 1YCFA 3UGQA 2DT8A 3AFMA 1L3BA 4IKEA 1FVXA 3SP1A 4DEXA 2PCLA 4I4TB 3CXUA 4ZVTA 5EMHA 4H2DA 1WHSA 2H1WA 3A2NA 3PF9A 2FEMA 3BREA 2H06A 1Z0ZA 3BBLA 4NSNA 2P9YA 5FLEX 2QTTA 4HN9A 3ACDA 1E20A 2QTFA 1DKNA 2WJGA 2XHZA 2ZR0A 5CIQA 5ENZA 3KXKA 5TMEA 3SZOA 1UH5A 3PXGA 4L28A 4P1ZA 4BS9A 2OB2A 1NSTA 2EBWA 4IDOA 5FF9A 5FUYA 5DYYA 4LTMA 2C31A 4JT8A 4HQLA 4Y2RA 1YFKA 3CXRA 4WXYB 1D03A 1MVNA 4RDCA 5D6OA 3DPSA 2ZANA 3TAHA 2DQSA 3BGOS 4KN6A 3RV4A 3VUEA 3ZBUA 1M5RA 3C7AA 3WGLA 2HU2A 1LSOA 2R11A 4MRPA 1P1FA 4B8ZA 1IZ9A 3D4IA 3RG2A 4C0XA 1XDDA 2REXB 5G4LA 1H5NA 3DMDA 4M1TA 1BHQ1 1LW6E 5EJFA 4DB2A 5JAZA 5FPYA 3UMVA 1WMAA 2XHEA 3PNLA 2BYTA 4M76B 4QRHA 1ISRA 1QC5A 1T6YA 4YO7A 5EOVA 1N6HA 3AP1A 1YZTA 2PGOA 3QBEA 5ALPA 2FPUA 4RVNA 1CIVA 2XQJA 1L5HA 4DMCA 1JUDA 2PRYA 3PYMA 3DE0X 3T4UA 4CG3A 1PHPA 2ZI3A 2CLDX 1ZK2A 4LRSB 1TECE 3VZQA 3WK9A 3ZI4A 5IM4F 2PE5A 3I4FA 1BA3A 2Y0BA 2IY9A 1DDIA 3PUHA 4C2BA 3VNRA 5DT2A 3GLFE 1U7ZA 3PUZA 2FWBA 5E7IA 1VCOA 1FFDA 1W49A 1RM3A 2ZDHA 5C5EA 2QU7A 4C05A 4R81A 3GGCA 2IPAB 3KYCB 5FOQA 4Z99A 3CO0S 4FJ1A 4R41A 1F1BA 1QRUA 3D2AA 1U8CB 1TQ4A 1UK9A 3LGXA 1E0AA 4OQPA 3SJ7A 1C9YA 1N5DA 2YV4A 2WJJA 1THTA 2JIZD 1PJAA 3GAAA 1PJLA 4FKBA 4L57A 4QQRA 4TZKA 5DGTA 4DY6A 1WETA 2EXXA 4OEHA 5C3UA 1T9DA 2GAOA 3C6YA 5D01A 1AHNA 2IY8A 3AY6A 3C2QA 1GZ4A 3IHWA 2PR2A 4IRUB 2ENWA 3TD6A 2GD0A 4YUWA 2D0OB 3H2IA 2B61A 1P4JA 3GR6A 3B1FA 1BVUA 5CK5A 1K3UB 4GE3A 5ALWA 4NP6A 5IHPA 2V65A 5KJCA 3CQ9A 1V8PA 2YWFA 3TLAA 3PGVA 3FGNA 1GRRA 4UQPA 2AC7A 4BBPA 4ENPA 5HTOA 2JCSA 2Y6VA 1Q1GA 3Q3HA 1IN5A 1GO2A 4ITUA 4CLOB 3LVBA 3PXEA 3IJ5A 4TL9A 4KITB 1G55A 1LLUA 3O4VA 4PCVA 1DC4A 3WNZA 1R18A 1DXQA 4L3VA 1JHRA 4Y6OA 1P7YA 1G9XA 3K0EA 1PDWA 3AILA 2QBYA 4V3BA 2H1CA 2XUPA 1C7EA 3CZQA 4JYZA 2DBQA 3IDOA 2NUTA 2FN4A 2D0PB 2G63A 3R9XA 5GMOA 3CB4A 2Z83A 3GZ4A 5DSXA 3AVVA 2DWOA 4D8VA 2FEOA 3HKCA 3T7JA 1SEVA 3PWSA 3A1CA 4KQFA 5TEWA 2CD7A 3D1VA 3FPHA 3QE4A 4Y6QA 5T6MA 4KOEC 2A9KA 1UJBA 4EI9A 2XUZA 3QWBA 1ZGZA 3C5CA 2R7LA 3D59A 4TL6A 1CT9A 5EUBA 3INNA 5B4TA 5DNCA 5EHZA 2XCQA 4GLBA 3H18A 1DARA 4FYKA 1QWSA 3JALA 4MWTA 4LOIA 2IH5A 1PWZA 4G1EB 1X1QA 2HMSA 3QE3A 3GCWA 3I92A 3SFTA 1COZA 3GARA 3KV3O 4TSKA 3WXBA 1CVRA 1C3OB 4LRTB 5JMTA 5JPIA 4IGFA 5KTNA 4CKBB 2XOEA 3Q10A 2PU5A 2R65A 3NCTA 3W2FA 2A30A 1FNMA 2V7UA 4GEGA 1ORDA 4A23A 1GPWB 1LQUA 2XADA 3P2MA 5DLYA 3VPHA 5EY5B 4WCDA 5GADl 1M8GA 1HWYA 3C5VA 3H3XA 4IHJA 4ZVMA 3KB1A 1YI0A 3DE5X 3F1KA 5BN3A 4DKXA 3JVEA 1K7FB 1US8A 2AI2A 1PIWA 1V5WA 2FZKA 2WT8A 4GWKA 4IUYA 4JLJA 1LS1A 2FG6C 1RLTA 3C41J 4HZIA 3UAOA 2GO1A 3I42A 3FWZA 3WTCA 1NF8A 3SIWA 1U3WA 4KAAA 3TKYA 3SS9X 4EY3A 1TQ6A 3ZXUB 3Q4GA 3UGJA 2Q3MA 1E3JA 5BN1A 5SZHB 1PBTA 4DDUA 5A7GA 1BIFA 1UBKS 3ICVA 3QUTA 3NZEA 3C87A 2DBYA 3PFFA 1IQPA 4GKBA 3I76A 3ZK7A 3CPHA 1CF9A 4XGRA 4YNBA 2GPAA 1YGYA 1FYVA 4FE4A 2WJZB 3S8MA 4E46A 2COEA 1KH1A 1M2JA 4TS9A 3D7MA 3LLMA 2OK7A 3VU9A 1HQYE 3AIMA 1UC4B 3IA7A 3PNYA 3PEYA 2KM1A 3L7KA 5IJ9A 1L7PA 5LYJF 3TH5A 5JJ5A 1JAXA 1ZD5A 2VCEA 3QPDA 4TLDA 3K9WA 5AKKA 2VLIA 2ZB3A 1NG1A 1C7JA 3OMXA 2EVWX 3H83A 3EH2A 4RV5A 1R5JA 2CLOB 1HT3A 1C2YA 1D2CA 4W8OA 1D2RA 5CVVA 4RTJA 4ZALA 1MEOA 1Z0SA 4YRKA 3LBYA 1K7YA 2DKNA 4D79A 1EGVB 1WRBA 2XT0A 4CTJA 1L7VC 3IBFA 1YHYA 3R41A 3EXFB 4TTVA 5AYVA 3ADPA 4JLOA 3GBSA 2QTAA 3OBBA 2WSSA 1QB7A 3LQ4A 4ZEWA 5T41A 4MVJD 4ZAWA 3VZCA 1V2GA 2I1WA 5ECGC 4PTLA 1NVVQ 5EE9A 5FAXA 5HKLA 1YTUA 2FSUA 4OIMA 4RTPA 2W11A 4W5HA 1I32A 1T24A 1SVKA 3NDPA 4MICA 4PAQA 4BX3A 5A9SB 2VHUA 1EIWA 1BYIA 2RG1A 2RHMA 2CF6A 5JAQA 1KY5A 2CBGA 4LHSA 2CMGA 2PLWA 1WDTA 2JK1A 5ITWA 2J9ZB 3LBNA 2GZAA 3ZS9A 4BO9A 1ECBA 3P2JA 4XFDA 3U3KA 1GRNA 2AC4A 2XV1A 1O5IA 4Q24A 1KYWA 3AEQB 1FB5A 1Y4ZA 4TS4A 4WSOA 3DAOA 5E6SB 2PEYA 2X19A 4H0FA 1SIOA 3O4HA 2JHPA 5DK6A 2FVXA 5LMUB 3OZUA 5I3CA 4AMGA 1JDPA 4NZNA 1VIYA 1X70A 2XKBA 2YMPA 4I19A 2F64A 4I8XA 4PPYA 5HFJA 3W8NA 5F9MA 3OP4A 1XN1A 3SQXA 1Y3CE 1LKZA 4MLCA 2PWYA 2XCLA 4LZPA 3JYLA 4GR5A 1XJ0A 3FYUB 3QKWA 4JD5A 3ZWPA 4D3XA 4KTTE 1UWLA 4AUEA 1SXPA 1XZEA 2C07A 4KKVA 2F1RA 1FNBA 3GGJA 4LOHA 1FP1D 4HBZA 3EQ7A 3LE8A 1EUCB 2O8EB 2BRUA 3EVAA 4QOEA 3U13A 5KX5A 1IQRA 3PC4A 1U7HA 2H08A 2QNBA 2C9CA 1WUKS 1Q3KA 2B8NA 2ONCA 1ZCAA 4O4JF 4J4TA 4KLRA 5LA6A 1DELA 4WNCA 3PQDA 1ZUD1 2Y2VA 4N82A 2FPRA 2WWHA 3TVYA 5T3UA 3EDMA 2J0QA 1G8KA 2IELA 2OWDA 3NT2A 1SCUB 2X6RA 5MN5A 3LTNC 4JMPA 1VMAA 3PC7A 1HDGO 3LDUA 3LQ2A 2JD2A 1EMDA 2OUIA 2PS3A 3GRZA 3MFQA 1BEUB 4KBYA 2YVUA 2ZUVA 4LQ4A 1KERA 1SCBA 1TKAA 4DLSA 2ZREA 4FLFA 3SYKA 3WHKA 3A1VA 1M34E 1JA1A 2O7VA 3H9CA 3NTVA 4WFKA 5FHRA 1A27A 4GLJA 3VDXA 2WKRA 3EGXA 2O57A 3OPVA 2BJHA 1GNLA 4NZ9A 3DT9A 5J59A 3WKBA 4BMOB 5KNCD 3TTXA 3L7BA 3TPCA 3NB0A 2FOXA 3MWDB 2HK6A 1CZLA 3ELYA 1XYYA 3KLNA 5FWYB 1PQYA 3N70A 1CZOA 1B43A 2BSAA 1ZY2A 3AGQA 4G8BA 4AZ3B 4R3WA 1BS2A 4CKCB 4IDHA 3FDZA 4XX0A 5HOEA 3ZLJA 1JQEA 2LP4Y 1VLVA 3O83A 3P9IA 4ZQEA 1GIAA 1H2BA 1F5SA 3NHJA 3C8DA 4ZPJA 5JHGB 5L45A 1U4NA 4P4TA 5AVYA 2ZVQX 4DREA 3TQIA 4Y0AA 4QJ3A 2R8YA 2Q9AA 3M6WA 2YJ4A 4XJTA 1UZNA 2HSGA 4BLUA 4BYGA 3Q0IA 4I3FA 4IRXA 4OXYA 1E3EA 3ZX4A 5EXTA 3G0IA 4ZO4A 2GCGA 2WSBA 1SUIA 1BU8A 1LPPA 2C5GA 3R5XA 1MZVA 1EE9A 4FFNA 3EAFA 4E13A 3ZD6A 4JLBA 4QDZA 1GWNA 4B75A 3CYFA 4NENB 3K70B 4JLPA 2NV6A 1XE3A 3AVPA 4GOKA 3NJRA 4ZD6A 2HEGA 4EW6A 1SOMA 2X5XA 3FROA 4CI0B 4RPGA 3M5WA 2F43A 1XVTA 3GN2A 4HNUA 1XPOA 4G0UA 2HT1A 3FDIA 1BVRA 1JIJA 5EINA 3WR5A 2OXFA 2VSXA 2QNRA 4L4UA 5DNVA 5A05A 5LDDC 4LS3A 4R8VA 1HM5A 1OLSB 4ZVVA 3TNLA 4G09A 1R4MB 1EUDB 3C43A 4KYTA 3NAMA 3UYKA 2Z1NA 1ZW6A 3B3AA 3DEAA 1FQJA 1DZIA 3DEFA 3HBFA 5KWJA 3KKZA 5GV8A 4LJRA 5EMLA 1E0SA 1V43A 1WL8A 3E53A 3IPRA 4J1QA 2QVZX 1OROA 1U4SA 3BMOB 3H65A 3OO1A 3ENQA 1HQKA 4FEYA 4HQNA 5L7YA 4W7HA 3WGTA 4I9HA 4IDEA 1EK5A 4N8DA 4CCAA 1RVDA 4HBGA 5DTIA 5DYWA 3IB3A 2X5OA 3OEEA 3K0CA 1EBUA 3H5RA 5EKXA 5LQKA 3C5HA 4WN9A 5LIPA 4PY2A 5ABPA 4ALIA 2J3JA 3C3BA 3HM2A 3TB6A 3NMUF 4YROA 4CE6A 4FXOA 1RKXA 1L7EA 4CIDA 1KZ9A 2BEWA 3G2PA 1DPGA 1E1QD 4DQ0A 1DBSA 3HU5A 3GCXA 1LBEA 1F7UA 4YRMA 5KDOA 4IFBA 1II0A 4QELA 5GZ3A 5B37A 1YBHA 2XQVA 5KQLA 1XMJA 2O0MA 1W87A 1M2KA 1Q1ZA 2EWWA 1ZJ5A 4WKCA 5L3ZA 1MIHA 1E96A 4RM2A 4ENRA 5LMCA 1CXZA 3DZDA 4LJAA 2FPWA 3FKJA 3EMKA 1G3QA 1OFVA 2JAHA 3OLVA 4IJUA 4FDUA 3LL4A 5I7AA 2OLJA 2Z2XA 1EI9A 3BZWA 1RAGA 2G25A 2ZVJA 2AHRA 4Z1MD 3FPBA 4FKMA 4W99A 4BGUA 1F8UA 4FGWA 2J5KA 1HBJA 3MTEA 3VC1A 4Q7LA 4PG6A 1FUIA 4B0OA 4EB3A 4MWGA 4L6AA 4EJFA 2E1RA 3ESXA 5EVCA 421PA 2V9CA 4DLWA 1B0UA 5ALNA 1UXOA 3WGMA 4DYVA 3LK6A 4F2HA 1PJ4A 1VBKA 1G66A 2WA1A 3LHKA 3G0BA 4HDSB 4V38A 2VTBA 3OFND 4L5AA 4OLJA 3A4LA 4KR6A 4PC3A 3FZQA 2JAWA 4CTMA 1IFXA 1PVOA 1UMDA 3O21A 2JJQA 4V2IA 1WZIA 1RI2A 2A5JA 2W8ZA 3DBHB 3RS5A 3GAZA 3HWWA 2EBUA 5I9BA 3TZHA 1FTNA 2DUWA 1DBRA 2OCDA 4PZDA 1ZU5A 1MC4A 4FT4A 5AVJA 3VO1A 3WL8A 1WABA 2OAGA 3ABZA 1FJHA 5IM4A 3NOVA 5KTOA 4Y7DA 3SFZA 3U4CA 3AVXA 5B4UA 1M2VA 3F6CA 1TGYA 3VPDA 2QT9A 3VOSA 3ZW7A 3RBZA 4MA0A 2B8WA 2OGTA 5B53A 4OLFA 2X8AA 3IP9A 2AJDA 1UP6A 1OZAA 2GZHA 1QDUA 3ELDA 3K0HA 4XSVA 4Y67A 3SDBA 1PZFA 4N01A 3SIXA 3V6MA 2PH5A 1EDEA 1NBEA 1E2UA 2Z6AA 3IR5A 4RXMA 4GL2A 7REQB 2PCJA 3O6VA 2A5GA 2CFSA 2REBA 2BJVA 3I8SA 1OLUA 1XWIA 4MS3B 3DHWC 5F35A 1PV4A 2QM3A 2WZCA 1JAZA 2VDKB 1W94A 2FSIA 2VP5A 3CT6A 4QOFA 1QAOA 4DEVA 2EJWA 2QNIA 2BSXA 2C2ZA 1UPBA 1IULA 3AFOA 4IR7A 2ORIA 4JUIA 2OFFA 3L77A 3F98A 1BDMA 3EVFA 1KKUA 4CKXA 1E18A 3QQPA 1UBRS 1VG9B 3VRHA 4Q9AA 4HMPA 5AUQA 5EERA 4OQEA 1SVNA 2HNBA 2ZZNA 3G7UA 3B36A 3S5JA 3HJUA 3B70A 2YVAA 5F5NA 4Q4AB 4Q6BA 2GBLC 4X90A 2J5BA 4HZGA 1L4KA 1PFKA 3MB8A 3NHRA 1CHNA 3PD1A 1KQ3A 1YL5A 1JHXA 2I4OA 2QS9A 5KNDA 2HRCA 3NOXA 3HL0A 3ONFA 3C5WP 2OHIA 2B34A 2ZRJA 4W63A 1Z4QA 3C6QA 4FYVA 4MSUA 2HZ7A 5BQFA 2IXAA 3HTXA 4EVSA 2CL0X 2J7KA 3OKCA 5KVQA 2H3EA 2OCLA 5EP3A 3TSAA 4EPTA 3FBWA 1HE2A 4F85A 1YONA 1OJLA 2IL1A 3ZZNA 5BORA 1X1EA 4CGZA 3HV0A 4O2BA 3K1JA 1NBHA 2D2IA 1I1NA 3NEAA 4EJSA 3ITNA 2EFEB 5CA0F 3Q3EA 4PSUA 2XSZA 4JK3A 5KS2A 5BQ5A 3FUTA 3N0TA 2QTGA 3LT2A 1YHNA 4C3OB 2VKTA 3SHVA 3M4XA 4M9RA 4X8HA 1MX9A 4TRNA 4Y30A 1GTVA 5AKEA 2G8LA 5CDFE 4Y2GA 1SZCA 2DECA 5JSUA 4ZEVA 3THRA 1O0BA 5BSEA 5MDHA 2WG0A 1YK1A 2WMYA 3A4TA 1U2RA 3FNEA 3WQSB 4XIYA 3CUUA 2G77B 3AWIA 1YRBA 1NXPA 1Y7HA 2VF7A 1QJ4A 3LZDA 4UEOA 1RBYA 3GLTA 1USGA 4N03A 2J30A 2G5GX 3IPYA 3U56A 1ML3A 3O3OB 4I9NA 5DM1A 2ZK7A 3A1TA 2NW6A 3LU1A 1XTQA 2A1IA 2IDKA 2PQ2A 1NJ8A 2JW5A 4IRMA 5CVJA 5G0UA 3L49A 1FYEA 5B57C 3PT5A 1PLKA 5JQGF 2Q3CA 4K8OA 3GP3A 4K81B 4CT0A 5CT5A 1VMDA 4KN9S 4YMIA 4ZAGA 4AJIA 1AK9A 1ZI8A 1NLMA 1I2BA 1MDFA 1DRJA 4ZOAA 1SUEA 2VJPA 2YNMD 3GA5A 3NJ4A 3AY0A 3IT0A 4Q9NA 5CM9C 5FI3A 3S2GA 3GEGA 4LN1A 1GCOA 3MXOA 3C3EA 1M75A 4PXYA 2GD1O 1OLXB 2YS7A 2PY6A 4QFDA 3EIQA 5COAA 2ROQA 4EGAA 4Q9KA 1XCLA 2XMDA 4D82A 1O6FA 3N2GB 1ONPA 3BL6A 1KGDA 3GD5A 1GL9B 4M8LA 5AK6A 3A14A 4DA6A 1M1YA 3IXLA 4FDLA 2ODTX 3LFHA 5BWOA 8OHMA 4N41A 5F9HA 3AEZA 3E7PA 1NU8A 2IKSA 5I4BA 1HE1C 3REQA 6REQB 1G2OA 1UDXA 5AK4A 2BR5A 4HGOA 5E6SA 3SEZA 1MT3A 1K0UA 4B87A 2EC5A 4R2HA 4WA8A 2R60A 3F4KA 2AE1A 5G0TA 1KS9A 2Y3IA 2Q7DA 4DRYA 1YRYE 5G4KA 3I0ZA 1PF7E 2H1HA 1PJTA 4MW9A 4PHFA 4ROSA 2QQ5A 2FSGA 3G68A 1ISIA 3A58B 2A0YA 3C7KA 1WWKA 1M3SA 4HN2A 1VJ0A 4LDZA 4GSYA 3R76A 3AY7A 3TNJA 5CH5A 1T4BA 1YA4A 1EFVB 2XI4A 1GQRA 1TEHA 2H00A 1MO6A 1GUDA 4HXFB 4IIHA 2DH5A 1SC1A 3K2IA 1JEDA 3VISA 3EBLA 3EARA 1U1FA 3RB8A 3RIEA 5KHLB 2JL1A 1GDTA 1XTKA 2BGMA 1UDBA 4KXVA 4MYRA 4B7CA 3C7CB 4XA8A 4II3A 5EIOA 4C3ZA 5ETJA 4IJKA 4CV3A 2ZTHA 3WB9A 4EB0A 5FEUA 1VC2A 2B4YA 3FMVA