5FI1B

Crystal structure of the p-rex1 dh/ph tandem in complex with cdc42
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
FMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
publication title Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fi1B00
221PA 4I1VA 1DS6A 1KHTA 2VO1A 1BO6A 3HPRA 3J81k 1ZBDA 2VL7A 4IRUB 2JASA 2JATA 4JSTA 3K70C 1IJEA 3SN6A 1RKBA 1N5LA 1HE8B 3FE2A 5SZIA 4GOXA 1MO6A 2ZRLA 3U6KA 2CEAA 5TY0A 2QP3A 3PFIA 2V1UA 2PCJA 3AVTA 2A3RA 1GL6A 1WMSA 4JS0A 5CK5A 4K81B 2ODNA 2OXCA 1DG3A 2NG1A 3ADKA 1N0UA 1UKEA 2I1QA 5SZJA 2P65A 1P6XA 2QT1A 1XTKA 2VSOA 1OXXK 1ZMXA 2ZE5A 3IPYA 1XNJA 4EPYA 1MR3F 1GM5A 4MKHA 3B78A 4X8MA 3TJZA 2O8FB 4UQOA 4NCIA 2HV8A 3AP2A 1SXJB 2REOA 1QHSA 3HR7A 2XAUA 1TUIA 4M1KA 1DAIA 2BBWA 3ADCA 1E96A 5CJPA 2OCBA 1K6MA 4PSAA 4Q01A 2P0EA 2RKOA 1IN6A 2ZS9A 5FTMA 2VP6A 1COWD 1HQYE 2HJVA 1PUJA 2Z4SA 2YJTD 2ODEA 2GZAA 3LXRA 3T1QA 1KI6A 1G8HA 3IPXA 4Q4AB 2RH5A 5JMTA 4JJZA 2O8CB 5KYKA 5TV2A 3B6EA 4HZUB 2JLYA 4G0NA 3W8NA 3VR5A 2YNMA 2CLSA 1OB5A 4NE2A 4NMMA 1N6IA 2F3TA 1XZPA 2ZRPA 3GJ8A 4P4SA 4F92B 2HLDD 4W9MC 1N0VC 1DE0A 2H92A 2ZYUX 1WE2A 4PO1A 1DO0A 2AK3A 5FUYA 3SJAA 4HB3A 4TYWA 4TLDA 3SS8A 1RVDA 1GWNA 5AUNB 3B7GA 3KJGA 2P6UA 4JKYA 3CPHA 5FL3A 2F43B 4CT5A 1VCMA 4WZ6A 1M8PA 3G5UA 1T6NA 4B3XA 3AVUA 4NYJQ 1SGWA 1E1RA 1EFTA 2BKUA 3OFNA 4MA4A 1NLFA 4CEHA 4AYTA 1KIMA 2ZSDA 1UPTA 1ESNA 1VCOA 1Z28A 1Z5ZA 3PEWA 3PUZA 4L8GA 5EZ6B 3S1AA 4DIDA 4XVUA 2MSCB 1GTVA 3E2IA 1N6PA 3KUDA 1GG2A 1DAHA 2O8EB 4Q7MB 2DYKA 1QHYA 1XEWX 4AIIA 1UKYA 2GAAA 3TVTA 4E5UA 4I99A 4BLQA 1KI8A 1GRNA 2XTMA 2CHGA 5FI0B 3GLFB 3UMSA 4NKRA 4NH0A 1GVNB 3E1SA 1IXSB 4RJLA 4D4JA 4KV9A 1GZSA 1SVLA 5J4LA 1VYUA 5TXGA 1ZUHA 3A1WA 3IDQA 1Z2CA 4LV5B 3UMFA 4DDVA 3MLEA 3I8XA 3VU9A 2IXFA 5KDDA 4AI6A 5FTKA 2DBYA 2ZRHA 4B71A 4U00A 1SQ5A 4JVNA 5JLJA 2ZSAA 5KNDA 2X77A 1CR0A 2NO6A 3GQBA 2XZPA 4JYBA 4A2PA 3HWSA 5HKKD 1EESA 2HCBA 1L7VC 5J47A 4XWOA 2YOFA 1NBMA 3DDCA 2BHRA 4EPVA 1S0UA 2ZRMA 3AF2A 3KL4A 5F2EA 2VH5R 1UAAA 3OE7A 2W2VA 3SBDA 4B3CA 2NZ8A 4JLDA 2ZJYA 2D4HA 2G88A 3SFZA 1FP7A 2VP9A 1ZINA 3I72A 3M0EA 4BUJA 1Q1QA 4TMXA 2ZRJA 3N5CA 1DPFA 1IN8A 4FMDB 3GLGA 3KQUA 3UATA 1Z63A 1G5PA 3GPLA 2RHMA 1UBCA 1NY6A 1ZP6A 1ZUIA 4M1YA 3MRSA 1XEFA 2B21A 4A15A 4UXIA 4MYTA 2WV9A 3TRFA 4DZZA 3G82C 5CIQA 2Z5FA 2CHQA 3MFYA 4B34A 2CE2X 4ZV4A 1DOAA 2O0KA 5KPJA 3ZQ6A 4L9SA 4WOPA 4PTLA 4A9AA 4D0NA 8OHMA 1DAFA 1N5KA 2QMEA 5CLQA 3AF0A 5JHHB 1D9ZA 3GJXC 1GUAA 1QHGA 4M1OA 5A4JA 5DYIA 4DT1B 1YE8A 2ZRCA 1BMFA 4QM6A 2CDNA 4CYMA 3KTAB 3TVDA 4AG5A 2J9RA 4OHYA 2W58A 4JLVA 2JJ1A 4W5JA 1SULA 4Q66C 1YHNA 5JSZB 2OFWA 2P5SA 3L0PA 3LV8A 3WXMA 1Q57A 3OZXA 4TQUS 3ZS9A 2E1RA 2QQEA 3L82B 4Q9KA 4LJ5A 3BERA 3X1YA 3EC2A 3QENA 3W6NA 4NDZA 1E98A 1KI3A 3DM5A 2FN4A 4FXPA 4D81A 1MH1A 2TMKA 3FKSD 1RPZA 5IT5A 4NCKA 2IC5A 5DE3A 2ZROA 5JJIA 1I4LD 3PUXA 2JCSA 2BOVA 4MYCA 3U4QB 1HV8A 4ACAA 1R0XA 2ZJ8A 1MKYA 2OAP1 1X1SA 4AKEA 3U3KA 3BORA 4XIGS 4XVRA 2QAGC 3L8YA 2GKSA 4Q1FA 3K53A 3A1TA 4P4UA 2ONJA 1TF5A 3UXMA 3THOA 3KJEA 3LBHA 4BZPA 4MYHA 2FH5B 4HLQB 3KJIA 4YC7A 2O8CA 1E0SA 2H1LA 1O87A 3SJCA 5FBVB 3QG5A 4RZXA 4FN5A 3LWNA 3RANA 5KPDA 1CS4C 1H8EA 4A0FA 4BFUA 1CR1A 2FJUA 4WZBE 3K0FB 1AS2A 1YZNA 3MMPA 1KO1A 1B0UA 3X1DA 1IAQA 4JLBA 3L8ZA 1R2QA 4BQSA 4D2IA 1A4RA 2OUKA 2OCPA 5FR1A 1OH8A 2IS6A 4MKFA 4EFLA 1ZC4A 4BLSA 4JL6A 5HTKA 1YJ5A 3L2OB 3K70D 1QVRA 2QZ4A 4PQFA 4QHTA 1KI2A 1NY5A 4O2LA 1G3RA 2CL0X 2BIFA 1QRAA 4IDPA 1CRQA 3GP8A 3U60B 2J59A 1D2EA 3IQWA 1Z29A 4POAA 3C7KA 4BRUA 5C1BA 3EIEA 4G5GA 1II9A 5AUPB 3BIFA 4YONB 4KCGA 4DCVA 1J2JA 2VSFA 2BEKA 2WBLC 4M9SA 4BWYA 1NLZA 2W6JA 1SVWA 1OIXA 4ESVA 2EFGA 3FGNA 1ZCBA 3DOFA 4FD2A 1KTVA 4DB4A 2BWJA 1Y63A 1TEXA 1IY0A 1E9RA 2P5TB 3AVQA 1ZUNB 2FSHA 3MJRA 2VHUA 4MH0R 3FMIA 4RFSB 4EIWA 3AQ4A 1LW7A 3ZJYA 3UWOA 2OFOA 1SXJE 4A36A 3QXHA 1UEJA 2W83A 3WNCA 2BV3A 4PPQA 3NBXX 4YQFA 1XCPA 2VRWA 4Q1CA 2NMVA 1KSJA 5BYJA 1FL9A 1OHHA 2EWVA 2W2XA 1KAOA 1FTNA 3ZVLA 2HT1A 1EK0A 1IY1A 1G291 2QM8A 4A82A 1U0JA 1KSHA 5CLLA 4KLZA 2AKYA 2YWHA 4C0AC 4HATA 1Q3HA 2C98A 3IBYA 3SJBA 2A2ZA 4PAQA 1BIFA 1A5TA 1OSNA 2PX0A 4DRZA 1OIVA 2V6JA 4PC3A 5FUVA 4HUQB 1BH2A 4LJ7A 4FW9A 5CIWA 3FVQA 1G9XA 2RGNA 3EPHA 2EFEB 4HUTA 4FMCF 2J41A 4AYWA 3AVYA 2Q9BA 1E2GA 1P9RA 4F91B 4KSCA 4HLDA 3ZH9B 2WKRA 3TSWA 4C2UA 2IK8A 3EZ6A 4AKHA 4RCZA 3W9YA 1EG7A 2ZUCA 1G17A 3AVWA 1Q0UA 2WJYA 2WWIA 4URZR 2R65A 1AKEA 4S2EA 1KDPA 3K9NA 1P72A 3TQFA 5IK2A 1XJ0A 1KJYA 4HAZA 2NIPA 2WKPA 4XWKA 4IDQA 1E3MA 1KDOA 3F0TA 4RSGA 3TW4A 4B75A 3KKPA 1S4QA 1NIPA 1N6KA 2ERXA 2IUUA 4NYIR 2FZ4A 4HAXA 1CLUA 4C7OB 2WIBA 2QPAA 2CBZA 3KJHA 1LF5A 2VPPA 4M1TA 3R9WA 1EX7A 3BAFA 4BLRA 4Z54A 2IWRA 5AUOB 4OQFA 1KI7A 1HT2E 2G0NA 1AN0A 2P2LA 3RDPA 4DB2A 2Z6VA 2B7BA 4IVQA 1T0JB 3ZS8A 1GL7A 2HT6A 1JQLB 4QL3A 4LHXA 3CIOA 1HQCA 3RSOA 1U9IC 1RIFA 3GLIA 1U98A 3GEHA 4A4DA 4JKIA 3AM1A 4B2LA 3VR6A 1OFHA 5JWHA 5L8VA 2GILA 3T5DA 3EZ2A 1S1MA 4ON9A 2VHTA 1FUKA 3H84A 4BLTA 3VAAA 2WOOA 1T8UA 3ZGXA 1F5NA 1G3MA 5FL7D 2QSYA 4F4JA 2Z83A 3L0IB 3MSXA 3CH4B 2G83A 1E9SA 1NBMD 2O8BA 3K09A 1XWIA 1T91A 1Z06A 2UKDA 4DLSA 4EDHA 3HYTA 3OE7D 4M22A 1R6BX 2X2FA 2XGJA 2EFCB 2HYIC 1NKTA 2N42A 3E5HA 3BB4A 3A37A 1ANKA 3AGQA 4W7SA 1KMHB 3V00A 4Q7JB 2REXB 5HE9A 5EE1A 2ZRKA 2ZR7A 4OHWA 1E2NA 1UBGA 4TMWA 1S3SA 1U99A 2DFLA 4MRVA 4KAXA 3V4FA 2IA5A 2HLDA 1ZJ6A 4Q4HB 3BJIC 2QTVB 1GP2A 2NTYC 5FPKA 1RJ9A 4OL0A 2RB4A 1RE0A 3LW7A 2GK6A 1F60A 5KDOA 2J0VA 4M9ZA 1HTWA 3KXKA 4CT4B 1KNXA 2VHCA 2DFKB 4RZ2A 2WVJA 3QPWA 4JBYA 2WWYA 1OE0A 3K0SA 2IF0A 1Z6GA 5DNYB 4OK6A 3IILA 3DEFA 2EVWX 4DLVA 1X6VA 2VHJA 3AKDA 4OI1A 1XXHA 3C5HA 1CULC 4B47A 4MKGA 4MGZR 1ZAKA 2V8OA 1Z2AA 1AJEA 1N6HA 2ZR9A 3W5JA 3TK1A 4RVCA 3QVVA 1NN1A 2PX3A 3KFVA 2ZI9A 1YZGA 3GJ6A 1E2DA 1P75A 1E2FA 1U2RA 3RS0A 1NG9A 1P7CA 1OFTA 2IYXA 5IDVA 1QVAA 3NBYC 4B32A 3GLIE 2VEDA 3D7MA 5FOUA 1PVOA 3BRWD 1WRBA 1HA3A 2DHRA 2O8DA 2KSQA 1OH7A 5EZ5A 4JZKA 1E2PA 4KJZA 5BN5A 1YZTA 4XH9B 1NMYA 1KK0A 3LQRA 4OHXA 4LSGA 4KBGA 3ZZTA 1BS1A 5EXTA 1CJKC 2ATVA 1GRRA 1FMJA 1Z83A 4TMZA 4O3MA 1H8ED 2G6BA 2IUTA 2MSEB 3CM0A 1JJVA 5G53C 4HB4A 4WVFA 1G8PA 1RRPA 1W4AA 3OIVA 1KJWA 2GXAA 3KB1A 1OXUA 2ORVA 3WYFA 4JLNA 1JPJA 1XRJA 3RS3A 3SNHA 2OXRA 4OQMA 5A5GA 3MD0A 1E0JA 4UJ3A 4B44A 3EPLA 4P4SB 621PA 4P3YA 4U7DA 5JRZA 3M1IA 1SHKA 3N2IA 2NZJA 1UKVY 1AIPA 2WPDD 2R6DA 4LK2A 2ZE7A 2CJWA 1KKLA 1W36B 2C77A 2C9CA 3TR5A 3NWJA 5EE5B 5AUQA 1W0JA 2QI9C 4M4SA 4TSFD 2AD5A 4ZI3A 2DCUA 4Y0AA 5KSOA 2OO7A 4GZLA 5KOYA 3ASYA 4CEHB 2V1XA 2Q9AA 4LPSA 4PQYA 3S1AB 3BC1A 4E22A 1E2QA 5JI2E 3U3MA 2FSIA 4C9BA 1NI3A 2FFBA 3SC3A 4D0LB 3HP1A 3NXSA 1FTSA 4EPXA 4TLEA 2AL7A 1EXMA 5KSPA 1KO5A 2D2EA 1TUEA 1NP6A 3WHLA 3AKEA 1XXHE 2YWEA 4OI0A 4LC1A 1XTSA 4DUGD 2JDID 2MMCA 3SR0A 3A58B 2ZVPX 2IYUA 5DI9A 2WWHA 2QSZA 1VMAA 1N5JA 2FFHA 4JVLA 1T3LA 3QIAA 1JEEA 3LX5A 1F6BA 1G21E 4KYIB 4Z1MD 4AWXA 2BMJA 3C16C 1LB1B 3FKSA 2OM2A 4TZ6A 3SOPA 3VU9B 5FOTA 4QRHA 5L3RA 3BXZA 3L43A 2PLFA 3ZVNA 2D3WA 1I2DA 1ZNWA 3K1JA 2B92A 1G18A 2LKDA 2GK7A 2GVDC 4NCNA 5FR2A 3LDAA 3U3OA 4ASUD 3QF4A 1G1MA 1S2MA 2JLSA 1HEIA 2J0UA 1OB2A 1ZM3A 1N6RA 3KQHA 2CK3A 4B43A 3NH6A 2QQ0A 2ZE8A 1GSIA 4NYJR 4JLKA 1VYVA 2UZIR 1UKZA 2QA5A 2A5GA 3MG9A 4F4CA 5JZVA 2J45A 1XPRA 1MO4A 4TL7A 2YOHA 5DH9A 2PT5A 2WSSD 2CVHA 4Q1BA 5L3SA 4B3DA 3AVOA 4F7WA 1DADA 1D9XA 2QAJA 1JB1A 2ZJBA 2WKQA 5KNBA 2F7SA 1T9HA 3GLGB 3FDIA 2C96A 1QHHB 4OK5A 4DLWA 1EX6A 2LKCA 1G8YA 1LS6A 2JLZA 4C0HA 2VP4A 4LJ9A 3B2EA 2AD1A 5BN3A 5G40A 3SDZA 3U3JA 2EYQA 2WM9B 3GCGA 2CCJA 5FTLA 3I5XA 1YRBA 4GOKA 4XWAA 3VKHA 5A0FA 3H2YA 1E2EA 4MGYR 3X1WA 5CK4A 2IW3A 3FTQA 2LWIA 1DARA 5JRJA 1ELOA 1ZU5A 3LBNA 4CDGA 4LJ8A 1E2LA 4P31A 4AD8A 3C5CA 1Q3TA 5EXXA 2GA8A 1ODFA 5F9HA 2Z43A 4TMTA 1KYIA 1MOZA 2YWGA 3W6PA 4JL8A 3PCRB 3H4MA 4IJMA 5FPHA 1C1YA 2YZ2A 5HZHA 3EZ7A 4GOJA 4ZIRA 4I1SA 5L3VA 2GJKA 3UKDA 2FX3A 2RGAA 4FI3C 1VG1A 2F1HA 4URVR 3O8RA 1GNQA 3PJRA 4OHZA 4D82A 2I1VB 5FPTA 4CW7A 3IEUA 3NHBA 2O52A 1NLYA 1MRSA 4Q4JA 1KO8A 3TMKA 3A4NA 2Q9CA 4GFDA 3U44B 1XJCA 1CU1A 3SYNA 1KMQA 3WP1B 1P9NA 1ZNZA 2R6GA 3EC1A 3Q7QA 3WP0A 4Y0VA 3WRYC 5LDDC 1XTRA 1FZQA 5FI1B 2QMUA 1MO5A 3CO5A 4GT1A 2GJAA 3CBQA 1JR3A 4D4LA 2AXNA 4XVQA 4Q03A 4GPTA 2WTUA 2D2FA 3EX7C 4B3FX 2JLWA 1NMXA 3BFKA 2QN6A 5CB6A 1F2UA 3CF6R 2F1IA 3GJ3A 3H86A 3M6AA 3M4YA 3FPAA 3IQXA 1AS0A 4TYPA 4Q1DA 2W0SA 3SZRA 4PC7A 1X3SA 4ZCMA 2R9VA 4WA7A 3U7EB 1Z3IX 5FBWB 3D31A 1DAMA 3DM9B 4KXFB 1P62B 3HU3A 2Z4RA 2QL6A 1Z0KA 2H8KA 3MUFA 2BMDA 4LI0A 4A6XA 1ZIOA 5J4HA 3HDTA 1E6CA 1GAJA 2PZEA 5TARA 1XPOA 2ANBA 4DIEA 2WJIA 4HSEA 5HR5A 1E99A 4C0SA 4HAVA 3U2QA 1G6OA 2OZEA 4L4UA 3SI7A 2XZOA 2R2AA 1FW6A 4ZDIA 1R8QA 4M2LA 1Z8FA 2D62A 1LS1A 3KKOA 1JNYA 1UM8A 3ND9A 4L16A 4LJAA 3B82A 3AEZA 2F9MA 3KDSE 4PXAA 1QHXA 4ZO4A 2VF7A 3VR2A 1A1VA 4EJSC 3ADBA 1UDWA 4H1VA 4GP6A 5BWMA 3IIKA 3FHTA 2BKEA 2RHDA 4OYHA 2BEJA 2CVFA 3EWSA 1W4CA 3WMGA 3AP3A 4V0OA 3ECCA 4NP6A 2GXUA 4A8JC 1XX6A 1JI0A 4LBYA 5AJZA 5DHFA 4TZ0A 1E0AA 3GLHA 1T3HA 5DYGA 3NIBA 3QPVA 1JALA 1FNMA 2A78A 5LB4A 4L9WA 1D2NA 1W49A 5AJXA 5FL7A 5BN4A 1YR7A 4G5RA 5DISB 2F1JA 3BH7A 2QY9A 4Q47A 5GJWC 2G9NA 1W1WA 4WXRA 4RD4A 2OFXA 2C8VA 2VIIA 1J70A 1NVVQ 4EFNA 5FPYA 3BH0A 1SKQA 2GZHA 4II7A 4BEBA 4LV8B 1R4AA 3UG6A 3TAHA 1LFDB 2ZJAA 2O0HA 1IM2A 2AKAB 4HDOB 4LGMA 1RYHA 2GNOA 4DHEA 1TU4A 5LB2A 3D8BA 4D0GA 5JJKA 4QJ4A 1EWQA 3AGPA 4N3NA 3FMFA 4XSGA 3RNLA 3EW9A 2FV8A 4BGDA 4C30A 2WZQA 5F3WB 5H70A 2PMKA 3R9IA 1C4OA 3ZYCA 2DFTA 3TUZC 1VG9B 1K8RA 5FTNA 3AVVA 4C0QC 1W0JD 3RABA 3K9HA 5C46F 4B3BA 4WW0A 3QEOA 2CLDX 4LDJA 2ZTSA 2AFHE 2V54A 2RGXA 3B9PA 3IGFA 3DZDA 4BFVA 4AY2A 1B23P 1VDZA 2OCAA 2A5YB 2QRZA 2ZAMA 4LHYA 3OIYA 4G01B 4KFRA 5FPSA 4FWTA 4KYUA 3T1TA 2AK2A 3CKLA 3CH5A 1T0HB 2FFAA 4JJKA 1BKDR 4TTRA 2ATXA 5KTYA 1QBKC 4XSHA 3CRW1 1YR6A 3WMFA 1LY1A 1OXVA 2G1KA 3QUSA 3WYAA 3OEHA 3SQXA 1XP8A 5KUTA 2WICA 3P20A 1VG8A 4IVRA 1E2JA 3SU8A 3A1SA 3OIUA 2HXSA 2F9LA 1MABA 4RD3A 4LV6A 5TDHA 3GLIB 2O8FA 2RGCA 4IHQA 1XB2A 4DWJA 1ZD1A 2FPKA 2A30A 2QPTA 2ZI6A 3FFBA 3QQ5A 4HAYA 2P3SA 3A1UA 4KSBA 4Q5IA 2OILA 4AURA 1L8QA 4GI7A 4Q1AA 4ABYA 3W90A 1X1RA 2RMKA 1CJUC 4NONA 3UK6A 3WBJA 3THWA 4MRPA 1G3UA 2QAGA 2CK3D 3H1TA 1KKMA 4K8OA 4IKEA 2O8BB 1S8FA 3DOEA 3GFOA 2OBNA 3EIHA 4O2RA 2CL7X 3X2SA 2DY1A 2ZJOA 3GLHE 2NPFA 3I92A 4Q9LA 3F3YA 1P60A 3VR1A 4TT3A 1TEVA 4LYFA 2IYVA 1KI9A 1XZQA 1E94E 1NBME 5DO9A 5EP4A 1XCGB 1ZCAA 4B33A 4OQNA 2MSDB 1OKKA 4BFTA 5BW8A 521PA 5BQ5A 2X2EA 1XBTA 4H1UA 3RRZA 1ZM7A 3IIJA 4HYYA 3QXSA 3R8CA 3Q5EA 3LY5A 3OIWA 3R20A 3C4JA 4LBWA 5K8TA 1E4VA 1W0KD 1N6OA 4KLNA 3I62A 2OT3B 4JVSB 3UANA 5JEEA 1TQ6A 4HAUA 1JAHA 1GILA 3BB3A 2QORA 3GLGE 2WPDA 1M2OB 1RJ9B 4Q21A 2GAOA 2QBYA 1M7BA 1Q22A 1CXZA 2GF9A 4OJQA 3NC0C 1Q21A 3VR4A 5SZKB 2ECKA 4NHOA 3U7FB 2ZEJA 5FUXA 2P6RA 3CPEA 1Q1EA 2D74A 4TSFA 5EUQB 1AGPA 2R6AA 3NTUA 3PVSA 4O25A 5JBQA 2ZRIA 1JR6A 2UZ3A 1K5GA 4PZZA 4DVGA 3CZQA 3QXXA 1YR9A 4C0JA 2W0MA 1AGRA 1XXHB 1Z0FA 1G64A 1J8MF 1NVWQ 2PLRA 1GKYA 4M8NE 2WOJA 2JEOA 1QDEA 5EP3A 2XNDD 3AF1A 3RYTC 2FWRA 2ONKA 1CBUA 1D5CA 1U94A 4I4LA 3A1VA 3ICQB 2C9YA 2E9SA 4QXAA 5HE8A 4BE7B 1JPNA 3FMOB 3BH6A 4DLZA 4BFYA 4UJ5A 4DUGA 1NG1A 2JDIA 4JBXA 4EAQA 3V4RA 2ZRDA 3P32A 3NHAA 3RSLA 1EFRA 4X8LA 5KHOC 1CR4A 2GEUA 4Z1MA 1ZNXA 1JR3D 4HLCA 4OQXA 4QFMA 1ZD9A 4IOLA 2A5JA 2O8DB 2WIAA 5GVRA 4DCUA 3QXJA 4M9QA 4TYNA 4DDTA 2HYDA 2ZSEA 2VYFA 3THXB 4ASUA 3KX2A 2QPOA 1GFIA 2Q6TA 4CIDA 2JIZD 121PA 1KI4A 1YRAA 1AM4D 4IW3B 4RD2A 5EP1A 3BGWA 4HDCA 2JA1A 4RCYA 1LF0A 5DN6D 1Z6XA 1GNRA 1W4RA 3BS4A 5EUMA 2GWHA 4O0MA 4A2WA 3K0EA 2WSSA 2ZYWX 3LA6A 1GITA 2ANCA 5H68A 1WBBA 4OI2A 2V9PA 4F4IA 1Z6AA 4ILEA 1F2TA 3NKVA 1G3IA 2C04A 3RS5A 4CVNA 1JQJC 4TL9A 1OT3A 2W6ID 1J8YF 1E2KA 4TMVA 2VSXA 3TUIC 3Q7PA 2CJWB 1GKIA 4GZMA 4QKQA 1SVIA 4D4KA 2EFDB 3ND8A 2R6FA 3EXAA 3PUVA 1AQYA 4Q7LA 1KDTA 1S96A 2FF7A 3WNDA 4BFWA 1BYIA 1AZSC 2O0JA 5CYOA 1GOTA 2KWIA 2Q21A 3IHLA 5UKDA 1N0WA 2GJ9A 3OESA 1DO2A 2WWXA 1E4YA 5KSYA 1U9IA 2GCPA 5CYPA 3WYGA 3E70C 4LZZA 3I73A 3Q85A 1FQJA 1AS3A 3FYHA 4DSNA 1E9EA 3RC8A 3NC1C 2SHKA 2QGZA 2PZGA 1Z0AA 4A1FA 2AFIE 4JLJA 2ZVQX 1V43A 4ZPXA 3R8FA 1VKJA 3KKMA 2V7QA 2ZSBA 1WA5A 3C41J 3GEEA 2I4IA 4KFTA 3MGCA 1NNEA 4QBGB 4JIMA 4US2R 1J99A 1R5OA 3MJHA 1JJ7A 1II8A 5L3QA 2ZRAA 3I32A 4IEIA 5DIFA 4FMBB 1JXMA 4LHZA 1R5NA 3ZDQA 1CR2A 3B13B 3MAAC 2VHQA 4LBVA 2FDCA 4RZUA 4YDSA 5FOSA 2FPMA 1XEWY 1VPLA 2QEQA 1UBEA 2DWQA 4UNQA 1KZ7B 3CB4A 3WMEA 4Z51A 1F48A 2ZPTX 4ZDKA 1CF4A 5EJEA 2HEIA 2OHFA 4MGKR 3QF4B 4B74A 1UDXA 3EZ9A 2J5XA 2KB0A 2YC2C 2J0UB 3G0HA 2ZUDA 3MWJA 3BD9A 5LD2B 1CP2A 5CDFA 5K8LA 1XJQA 3O47A 1M7GA 4CZ2A 2IYWA 5J40A 1OYWA 3TSZA 2IXGA 3A4LA 2KI5A 5HCNA 2O5VA 2V3CC 1T3SA 2FPLA 4YMUA 2FGKA 3VX4A 3CPJB 2PT7A 3B85A 3T12A 5L3SB 4R71A 5K8UA 3IIMA 1KJZA 4MGIR 4RD1A 1X86B 3KUCA 5FFMA 3B60A 5C4MA 2W00A 4EPRA 1PLLA 2NO1A 2XTNA 3GJ7A 4ZCIA 1VYTA 1OYYA 3FKQA 4NYMR 1XD9A 3Q5DA 1N6LA 3OEHD 4FWIB 4LHVA 4RKEA 2IUSA 2XB4A 3K70B 3B1VA 2MMGA 2OLKA 1ZM9A 3IKJA 1ZRHA 2Q3HA 2QENA 1U0LA 2JJ2A 3GJ5A 1RC8A 2IYQA 2BC9A 4A0HA 2C9OA 4HAWA 4DLRA 2G77B 2V4ZA 5B57C 4TL6A 1HY3A 4IDNA 4GMDA 1TF2A 1OH6A 2JAQA 1OW3B 4ZDWA 3RRNA 2ZSFA 1XMVA 3BB1A 2WWWA 3A8TA 2FGJA 3W34A 3QJYA 5M04A 1FMLA 3C15C 1H8HD 1QHIA 3P4XA 4FMCB 3W6OA 1XD2A 4YMSA 3PEUA 2N1BA 4R2HA 2HF8A 3U7HB 4ZIRB 2IL1A 4WAUA 1OXSC 4PHTA 1G5RA 5FH9A 4RD6A 3VNUA 3TUJC 3QG1A 3FFAA 1U0HC 3FWYA 2AX4A 4TT3D 3ZVMA 5GADl 1EFUA 1KI6B 4G5SA 4Q4JB 4DLUA 4TYQA 3RS2A 1K5DA 2WSMA 4YMTA 1P61B 4C3ZA 1NN5A 3L0OA 3IO3A 3U3RA 1OKKD 1G8GA 4DEYA 5B64A 4C0BA 4KFSA 5AR1A 4HB0A 3OAAD 1QG4A 1W2HA 4UKDA 5E95A 1YU9A 4HLUC 3PENA 3JZMA 4GDFA 1CJVC 2IEYA 1OIWA 1G16A 5G3ZA 4LYHA 1TQDA 3RRYA 5GJBA 2XX3A 1A2BA 3CNNA 4A2QA 2ASEA 4F38A 1ZYUA 1RW4A 3ZIAA 1E79D 2WJGA 2BMEA 5KSZA 1OF1A 4KHZA 2BBTA 2ZU0C 2KBEA 3CR7A 2WAXA 4HB2A 4ZCLA 3LD9A 5CDFE 3LX8A 1E2MA 3BFXA 2B6HA 2X19A 5FBRB 2FU5C 3RVBA 4IOJA 1ONBA 2BJVA 3DMDA 3IEVA 2A9KA 3RHFA 1KK2A 2IYLD 4PSKA 1W2GA 1IBRA 5P21A 2CLCX 1Z0JA 2I3BA 3EIQA 5B2ZA 4DSTA 3RS4A 2VP5A 4C0KA 1WDTA 2H57A 5FOVA 3LAWA 4DSOA 1WP9A 2A7QA 4WXPA 3NBZC 1GKUB 1FX0A 2XTZA 2PBRA 1XTIA 4ITRC 1FNNA 4NYMQ 2XXAA 2OBMA 1GL9B 3QKRA 1S9HA 5JWOA 1LV7A 1G5TA 4U02A 1GNPA 1PV4A 1W47A 2EU8A 1PZNA 3NDPA 1EFRD 1QZXA 1RYFA 2ZIAA 3LLMA 3QPUA 4EPWA 2CCGA 2PJRA 3HR8A 2YV5A 2ZANA 3UWKA 1YZKA 2WJJA 1X8LA 1RRCA 3LH5A 4JSYA 1WBDA 4BZQA 5B58C 3P4YA 4ARZA 2EYUA 4CGZA 1G7CA 3TW8B 2VLIA 4JLPA 1P5ZB 1WF3A 2IHBA 2H7VA 3CRQA 3GLHB 1SZPA 4LY6A 1E9FA 1NN0A 2GZDA 1FP6A 2DB3A 4FCWA 3TLXA 2D7CA 4RFVA 2JLQA 5G3YA 1AKYA 5HPYB 3DZ8A 5DI3A 5CITA 4B73A 4IFBA 1G4UR 5JS8A 3PEYA 2REBA 5EP2A 4QBFA 2JLRA 1NF3A 1PLJA 2GESA 3CF0A 3B1YA 1P2SA 4RY2A 3LVQE 1Z22A 4D80A 1KY2A 1JECA 2OAQ1 4PX9A 5E7IA 5KNCA 2KBFA 4PQRA 5GVSA 3UPUA 2JLXA 3EA0A 1E32A 4BPBA 3KB2A 1NRJB 4WBSA 2BM1A 3CNLA 3GMTA 1CTQA 3QEJA 3CX7A 4OJKA 1TL7C 2J87A 1W0KA 2GBLC 1XF9A 2Q3MA 3CWZA 4BRWA 3B8HA 5EXSA 2H17A 4Z8XA 3R9XA 4QNMA 1UFQA 4HI0E 1IN4A 2ZI5A 3PITA 3B1XA 1SKYE 1UBFA 3I4LA 2JLUA 3L0SA 3BFVA 3K0AA 4DSUA 1LNZA 2ZJZA 3KQNA 3TAUA 2IS2A 1W5SA 2B8TA 3GJ4A 2QRNA 2IWHA 2WMOB 3AVPA 2ERYA 4PC2A 3T35A 4FMDF 1G6HA 2YYZA 2OV2A 3A36A 2V7QD 3PIRA 3TGPA 3CNOA 4LJYA 1NVVR 2HCJB 2BBSA 4KU4A 3AV0B 3KXIA 1L2TA 4E03A 2NO9A 2W2TA 4LYJA 4PHFA 3NEYA 2XNDA 3RAPR 3AB3A 4EQ6A 5JCPA 2XOKA 4IVPA 1MABB 2D7DA 2V6IA 2ZRNA 4MUAA 1SVKA 2IYTA 3NG1A 4EFMA 4PPFA 5F9FA 3F8TA 2PZFA 3T15A 5LBIA 1X8JA 4JLOA 3EPKA 2XJ9A 3ZLJA 2ODWA 3VMFA 5HZKA 4CEJA 4NBSA 1DTSA 3ETLA 4DLTA 1P4SA 4TMKA 2XJ4A 4FCVA 5BXQC 2K5UA 4LYAA 2NQ2C 4PZYA 4YLGA 3TSOA 2OE2A 5KO2A 1TU3A 3MWYW 3THWB 2DPXA 1SVMA 2QAGB 4FCTA 1KSFX 4LOAA 421PA 5J4YA 4TWZA 2NOAA 3NH9A 4QGHA 3EWAA 4IOMA 4LX0A 3EZFA 4CEIA 1HE1C 2PEYA 3QKUA 1YZQA 2DR3A 2G1JA 3P27A 2J7KA 4HZIA 4QNRA 2PH1A 2QTHA 4G1UC 1DAGA 1T4GA 2JIZA 4NPHA 2R44A 5C4GB 3VKWA 2H16A 2ZI3A 2H5EA 3ONWA 1GDDA 1VIAA 3N2EA 5DN6A 4TTQA 3CZPA 4ZKDA 4LJ4A 1RRFA 4Q9IA 4AKGA 2XZLA 2FG5A 1XCMA 4DEXA 4Q02A 3IBGA 1W36C 4N0DA 2PJZA 2RCNA 1TPZA 1NJGA 1P73A 4BECA 3EG5A 3SJZA 2EQBA 1XEXA 1HUQA 1XMIA 2W6IA 1Z6TA 4LWZA 4CF7A 1T8TA 1US8A 1KO7A 3QKTA 2JJ2D 2FFQA 2ZETA 2XSZA 3OF5A 2QBYB 1HH4A 1NKSA 3LW8A 4IFEA 4L15A 2X1VA 1EFCA 2FE4A 1J7KA 4JYCA 4UNSA 1OLOA 1A82A 3TQCA 2FA9A 3PG5A 3U5ZB 3BE4A 4HDQB 1DAEA 1NN3A 3DPUA 2G0TA 1CEEA 4LBZA 1S9DA 2AWOA 2FZLA 4M0LA 4P33A 3K0CC 2J7PD 3HYRA 3ADDA 4EJSA 3HU1A 3THYA 3Q8XB 2VP2A 4OKSA 5AJYA 4UNRA 2IYRA 2QE7D 5AJVB 2YKGA 2VF8A 3CX6A 3K0CA 4GP7A 4DDUA 4US0R 1R0ZA 2QTFA 2P6NA 4BFSA 2FEOA 1KO4A 1XU4A 5D3MA 3QE0A 1OH5A 3AUXA 4A8JA 4DC9A 1FFHA 3DHWC 1MT0A 5J5CA 5E3HA 2RGGA 4C4PA 3B9QA 5DLQC 1VTKA 2QUZA 3R7WA 2AHOA 1Q1BA 1IHUA 2WJVA 1VG0B 3AP1A 2EFHB 3N70A 3QOFA 4AKIA 4QBIA 2GF0A 4A0GA 1R0WA 2BM0A 2KJQA 3CF2A 2GCOA 3W5IA 4P0TA 1MRNA 4YXWD 1NSTA 4TL8A 3VTKA 3AVXA 1NMZA 3I1FA 2FMXA 4TLBA 3ZZUA 1EFHA 4N0EA 4XTCS 1VHLA 1I4TD 3ZIAD 1Z0IA 4EPTA 4PPNA 1SVSA 4BZXA 2HUPA 1JR3E 2RGBA 1C9KA 1G19A 4ESHA 3QKSA 4NZYA 2AR7A 5FUWA 2CNWA 2OCYC 3I8SA 1R7RA 4PAOA 4MYUA 5D3QA 4B35A 4B3GA 1AK2A 1Z08A 2QU8A 2YWFA 1KI1A 5AJWA 2Q0HA 4I1OA 3X1ZA 1F2TB 3C14C 1L4UA 3B5JA 1QHHA 3CRMA 3EA5A 1OPXA 4UXJA 3W8RA 2FOLA 2ODBA 4BEJA 2CMKA 4GSYA 2GTPA 1IOZA 5EE9A 4QJ3A 3DKVA 3HPQA 3RWMB 1ETUA 3VX3A 4QGGA 1KK1A 5EE0A 2VBCA 3NDBB 4G3XA 2XITA 4AYXA 3LVRE 3WRXC 1HYQA 4QOSA 3QY0A 1M1YE 2ZRBA 2BCJQ 4G5QA 5C2JB 3D3QA 1SXJC 4XD7A 1E9CA 1NSFA 4PAMA 2CXXA 2DWPA 3AKCA 5FTJA 4QHSA 1M7HA 1N3BA 1SXJA 2WWGA 3CW2A 2D06A 4IEEA 4LRWA 4PHGA 3U6BA 5BYKA 2ZXUA 5DHAA 2ZQ5A 2IEZA 2C95A 1ZW6A 1G7TA 1R10A 2QM7A 4Q9JA 1KAGA 3QF7A 2WMNB 4IXMA 1H8HA 4ACBA 4PZLA 4QJ5A 1QF9A 3Q3JB 1XTQA 1IY2A 1DAKA 1RFLA 3I3SR 3KKQA 1IXZA 1JEDA 4LJ6A 2ZM5A 1OFUX 3FHCB 3A6PC 2BJWA 4Q4AA 3U44A 5FBQB 4TQAA 5L3QB 1II8B 2E87A 1ZM4A 1DG1G 1E2IA 4PHHA 4Q9HA 3DMNA 1YZUA 1JBKA 3CONA 4HZUA 4IDHA 4LPKA 4M1MA 4IDOA 4TLAA 2OSBA 2ZI7A 1CIPA 4NL4H 2JGNA 4QM7A 3WNBA 3RS7A 4D26A 2GJ8A 4JT2A 1KDRA 3KKNA 4IOKA 1ESMA 2QT0A 1E9AA 2BMFA 1U8AA 1W5TA 3OAAA 3VR3A 3PXGA 1SHZA 1ZNYA 4MRRA 3SE0A 4DLYA 5EXPA 1WB9A 1FOEB 1YVDA 1E0KA 2QMHA 4X8OA 2IX3A 1D2MA 4P4TA 1O3YA 3KZ1E 1T5LA 3ZVRA 3OEED 3Q9LA 4JL5A 3K9LA 1FUUA 1HURA 1S1CA 2F43A 1E79A 2GEVA 1ZC3A 4AC9A 4V0LA 4DXAA 2GRJA 2QG6A 4IXNA 3WY9A 5FBLB 2NPIA 1VHTA 2F6RA 4KO8A 4JLMA 3REGA 2IYSA 3DL0A 2IS4A 4B6EA 2GHIA 2Q3FA 4URYR 4URWR 1KNQA 5GJVC 2OBLA 1IN7A 5EQTA 3W3ZB 4UXHA 2O8EA 2EW1A 1Y3AA 1P9WA 2J46A 3I5YA 3VQTA 2R62A 3TKLA 4DCSA 3LRPA 1RZ3A 4TTPA 3RC3A 3CRRA 3QSYA 3PUWA 2RGDA 4AG6A 4DCNA 3SFVA 5IF9A 2XOKD 3GLFA 4FIDA 3VNVA 4F93B 2BCGY 4TQ9A 4W5HA 2A5FA 3QI2A 4Q48A 4X8HA 1UF9A 3T61A 1XPUA 5GJCA 3REFA 4V0NA 5J4VA 3DO6A 3SEAA 2UVQA 4I81A 1D8TA 1PLKA 3TBKA 4R2IA 1Q20A 1ZM2A 2CL6X 1S3GA 3ZQJA 1Z6YA 4XJXA 3SBEA 1WCV1 2Y8EA 1Z0DA 2ZS7A 3K8YA 1GRQA 1YQTA 1E1QA 1XD2B 2HDNB 4XOIA 3NVAA 1VCIA 1KGDA 2C99A 2IT1A 2GVZC 3PUYA 1T5IA 3PV0A 4B76A 4GBMA 5C18A 1VCNA 4MITA 1EGAA 1DVRA 3MWKA 3LLUA 1W44A 2BDTA 2ZAOA 4WZAE 2L0XA 2GEDA 2YINC 4PO8A 1KY3A 1NL3A 3GEIA 1BOFA 3H0KA 2VQSA 5CJ2A 1F3OA 3DKPA 3T5GA 1FPMA 2RAPA 1SVOA 5CM8B 2CCKA 2WJHA 5TMPA 721PA 2RGNC 2ZE6A 1UADA 1N5IA 2BBOA 3IO5A 4KVGA 3CLVA 1V5WA 3AF3A 1MO3A 2FEMA 2GJSA 1U8ZA 2XEXA 5EE3A 1J90A 5H8WA 1W36D 4BFZA 4W5WA 6Q21A 1FQKA 4FINA 1N2CE 1R5BA 2XSZD 2PMDA 1OJLA 4JLAA 1UEIA 4YDHB 1SKYB 4KODA 2AN9A 2ZU6A 4QG7A 5F98A 3LFUA 1E1RD 2QP4A 3OFND 5KDLA 2C78A 3JVVA 1ZU4A 3FB4A 2HJGA 4DDWA 3SHWA 4H9GA 1G8FA 2J3EA 2ZITA 3LQQA 1R0YA 4DKXA 2NO7A 3RRMA 3QVUA 5JEDA 2JLVA 4DT1A 4URUR 3O8CA 3KTAA 2VP0A 3ZD7A 3OHMA 5DSZA 4A6PA 1CRPA 1Q1ZA 2X8AA 1TAGA 2C2HA 4TLCA 2GXQA 3T1OA 4LUCA 5JSZA 2NO0A 3ASZA 4KBFA 4RZ3A 4AK9A 4MUBA 4DLXA 4PFSA 4TN1A 2F3RA 5H1YA 4YMVA 1FX0B 4NTZA 5E7MA 2XXAB 1IXRC 3QKRB 5JWRA 2PL3A 1KSGA 4Q19A 4TYYA 3T1VA 3U7GA 1WXQA 3K9GA 4NCHA 3EAQA 3P1JA 4QGFA 4K46A 2AXPA 3FHOA 4JVMA 3SYKA 3GLFE 2VA8A 1G4AE 4A0RA 1NVUQ 3U4QA 1XD8A 1W46A 2QROA 2HXYA 4A92A 3BBPA 4XTRA 5CM9C 2BVNA 1TADA 1ZD8A 2G3YA 3C8UA 1OXTA 1VECA 5JCZA 1IN5A 2YC4C 4PO9A 4ARZB 2JJ8A 1TQ4A 4M21A 3K09C 3Q72A 2ZYVX 1UJ2A 3GFPA 2FNAA 3KQKA 2R6CA 2DFNA 3ZZ0A 1Q44A 2OLJA 1E2HA 2ORWA 2XB2A 2ZRFA 5AK0A 1COWA 2FSGA 3WBKA 3HU2A 5FOXA 1YZLA 2C5LA 5DI3B 4MQBA 2OESA 2CNWD 3SHFA 1TQ2A 1Z47A 3FOZA 3ZD6A 2IF2A 3CWQA 3K0FA 2J1LA 4R98A 1RRGA 2QGNA 2IBMA 1QHNA 2EWWA 4BASA 1IJFA 1DEKA 5ELXA 2YOGA 3JZAA 5J4KA 2ZJ2A 4NCJA 2ORIA 4YMWA 4ZKEA 3BK7A 4E09A 4QC2A 1KK3A 4MKIA 5KU1A 1G41A 2F1RA 1I4DD 4R7ZA 1CKEA 4MRNA 1OFIA 4V02A 1XFAA 4QGAA 1QG2A 1II0A 2P67A 3BWDD 1OV4A 4PPGA 3UMRA 3W3AA 5B30A 5CB8A 3CRVA 2XNSA 3SQWA 4QHYA 1A2KC 4S35A 5IHPA 2WWFA 1LTQA 4XD7D 3TNFA 1XDBA 3LBIA 5JS7A 4OI4A 2KE5A 1BMFD 4C0LA 1SXJD 5K8IA 1X8KA 2PEZA 4EUNA 2N46A 3UIEA 3K0AB 3CX8A 4OBEA 4M9XA 1JAIA 3VHXA 2JJ1D 4ZI2A 1G3QA 3GFTA 1IQPA 4J0QA 4RFSA 1N6NA 2PCLA 4ZDJA 821PA 4GMXA 3AH8A 3KQLA 2J7PA 2Z0MA 1CJMA 3NBFA 2IXEA 4NYIQ 5JECA 2QE7A 4UNPA 4KI0A 3MCAA 4D6PA 1MV5A 3LNCA 5FOWA 2YVUA 2F55A 4EQ6B 2DWOA 4KFUA 1A7JA 3DVLA 3I61A 4N1AA 3T06B 4L5BA 3X1XA 4PC6A 3GJ0A 2QMOA 2FSFA 1TMKA 5G41A 1DBSA 1P2TA 2NGRA 3TH5A 1GIAA 1LVGA 3RLFA 2HF9A 3TIFA 4U5XA 4B2PA 4PSVA 4CEJB 4V0KA 1U90A 4Q1EA 4V0MA 2QNRA 4HUQA 5E4FA 4B2IA 4E07A 2B7CA 1E69A 4G5OA 1U81A 3VHLB 3LXXA 3FMPB 4GNKA 3AF4A 1PJRA 4I1UA 2IS1A 4URXR 4YXWA 4MDFA 3F5FA 4HLUA 4UNNA 1W7AA 2OG2A 3THXA 5HKKA 4HEJA 1D6JA 1NVXQ 1WQ1R 1XMSA 3LO5A 1ZIPA 3QXCA 5DGXA 3TE6A 4CEIB 1F2UB 1KZGB 4RKFA 4WIAA 4EKDA 3KXLA 2LCFA 1W4BA 3O8DA 1M34E 5E7JA 1P3JA 2RGEA 4C2TA 4GL2A 4B48A 3VFDA 1ZVQA 3U61B 1AQUA 1U8YA 4OQLA 4M1SA 2J0SA 2YHSA 2A5DA 1DELA 3IUYA 4C7OA 1E9DA 1TTTA 4Z8YA 5ANRB 4Q4LA 4B6FA 4KITB 1XEXB 2GDJA 2OEPA 2WHXA 3AUYA 4V03A 3VKGA 2QP9X 4LHWA 1US8B 1EWRA 4NU0A 4MRSA 2W6JD 3QBVA 1TF7A 3B1WA 1TNDA 2R8RA 3UG7A 4M53A 3ICEA 3CUEF 1IONA 1L4YA 1JXOA 2ZJ5A 3EASA 4RD0A 1BYUA 2ZRGA 1I2MA 4BLOA 5JJLA 4R9UC 4OK3A 1TX4B 2C03A 2CHVA 4US1R 5HCIA 4ERNA 5SZHB 3T34A 1N25A 2CE7A 2AWNA 1XTJA 4DJTA 2ZUBA 1KOFA 4Q00A 2ZR0A 2IYYA 3EARA 1E1QD 4EJSB 3THYB 4CRWB 1E9BA 1VIYA 3D6TB 3TR0A 1R8SA 4OHVA 1OHHD 1XMJA 2V55B 3A4MA 3NEJA 3EPJA 5D3MB 4M1WA 4PC1A 4A8JB 4JMPA 1P2UA 4JBWA 1HT1E 2ZREA 3SYLA 5LPNA 4LC0A 5JI3E 1M6NA 4Q18A 3PQCA 4GRAA 3R7WB 4PR0A 5IRCD 1YKSA 1YR8A 1Q12A 4JT4A 3KFXA 2IYZA 1H65A 1KMHA 3PEVA 4D4MA 1M74A 3HJNA 5JHGB 3RWOA 3B1ZA 2GCOB 3CR8A 3MWLA 3WHKA 3P26A 3QNUA 4BLPA 5LD2C 1G7SA 2IHYA 1AZTA 1NJFA 2ZYTX 4BFXA 3BOSA 4MDEA 2J0QA 3V9PA 4LCBA 4V0ME 2B8WA 5TB5A 5TVKA 2GETA 1G7RA 2GXSA 3O8BA 4Q4HA 1NIJA 4D25A 3AKYA 1W48A 2ZI4A 4Q7KA 3QKSB 4DCTA 2VTKA 1CJTC 2ZS8A 3GD7A 3PR1A 4P32A 5JFGA 1G20E 3OEEA 2H18A 4PANA 5IK2D 3IHWA 4KVAA 1AA9A 2GBLA 1PUIA 3JVUA 4DBLC 4QBHA 5AWFC 1P2VA 2WAYA 3QBTA 2GCNA 1Z07A
chains in the Genus database with same CATH superfamily
4D96A 4ZI7F 1VFPA 1TMYA 4I1VA 2H5JA 3DDZX 3RJ9A 1DS6A 1BO6A 1YNSA 5G0TA 4GQBA 1YQQA 4ZO9A 4EL0A 3SN6A 2I6UA 4NBTA 2MU1A 1HE8B 2DR0A 5EKXA 3V4OA 3ZQKA 4F97A 2V58A 2A9QA 4UBMA 4Y6PA 1N2IA 4KLRA 5TY0A 5ES4B 3AVTA 1U8CB 3PVCA 5ICEA 4PLCA 2XKAA 1BDIA 5GQSA 3VOSA 1SHJA 3EGXB 5CK5A 4K81B 2GBGA 2ODNA 2OXCA 1DG3A 4H31A 2X7JA 4INPA 3K72B 1CP3A 2ZJFA 4QU8A 4FXOA 1P6XA 5BO5A 2VJYA 4LDRA 3TTUA 4Y2TA 3GOHA 2VYCA 3HJTA 1ZMXA 2ZE5A 3STTA 2CV2A 3F9CA 4J7UA 4WN9A 4MKHA 1C50A 1BE8A 1NE2A 1KP3A 1OUMA 5JBIA 3AP2A 1YAJA 4WBNA 4Z0HO 1L4BA 4K6GA 5EFOA 2REOA 3KYCB 2ICAA 5HUHA 2PS1A 4WV3A 5DSTA 4FGLA 5I47A 1AF4A 3L4BC 2AFRA 5CJPA 4C01A 5CVEA 5BQFA 4PSAA 1WJGA 2Z3ZA 2PKQO 3EFBA 3ETEA 3GF4A 5KYWA 3E9NA 3KL2A 5FTMA 5KAPA 5ALLA 3N28A 2AOXA 2HJVA 1RXEA 1PUJA 3KEQA 4YAOA 5IN4A 1NLUA 1P9OA 2IY7A 2YJTD 3HJRA 2GZAA 4JQYA 4PBTA 3N39C 4MUGA 2J0EA 3IPXA 5B7GA 3CUTA 2RH5A 3AUUA 2EDCA 3B6EA 2FSUA 4HZUB 4G0NA 3LCCA 1HT3A 2DSNA 3T3MB 2CLSA 3W8EA 2Q8PA 3C1UA 3NVDA 4UM8B 2X1MA 1G2OA 1OB5A 1G66A 2GEBA 5G4KB 4RLFA 4DV0B 2F3TA 2OXFA 2OOSA 2ZRPA 1H5NA 2ZIVB 1ENYA 3GJ8A 4F92B 5EHGA 3N2ZB 1N0VC 4U9IS 2R48A 2OYCA 5K3CA 3SJAA 5F2KA 3DVRX 4HB3A 4TLDA 1OXKB 5LQDA 5I7SA 3VZSA 1P4HA 1ULHA 5HOEA 3LUBA 4G85A 5ITSA 4ZO8A 3B7GA 3KJGA 3ID6C 5AUNB 3OWHA 1CZLA 4NBVA 1CYDA 1QH8B 4P84A 2PVSA 2WFAA 5LFAA 2VNJA 3HFJA 1JR2A 1U0GA 1X0VA 3FUWA 1XTZA 2VJLA 3AU9A 3A9RA 1B73A 4B3XA 1Y9AA 4JP3A 4Q16A 3SS7X 1C8LA 3LK7A 1IZZA 1Z0ZA 1E1RA 2ZUUA 2UZ1B 3LTEA 4IIBA 2WPNA 4MA4A 1K5PA 1FP1D 1NLFA 4R1SA 4LRXA 1TW2A 3B8EA 4MW6A 1UPTA 2CXHA 5ISMA 2GR9A 1Z28A 3PEWA 2IX9A 4CKCB 3S1AA 1V8DA 4JXZA 4BVLA 2V0NA 2OAGA 2YMLA 4KIWA 1GTVA 1N6PA 1OXBB 1GG2A 4RBNA 3ZY6A 2O8EB 1VI6A 1HYHA 1NAIA 3HVIA 2DYKA 4GPEA 4AUNA 1YZFA 4D0RA 5F78A 4XVCA 2OUIA 5CB4A 4JDPA 2V6MA 3LP8A 4ZRDA 2GAIA 4COOA 1PQYA 3VHQA 3OO0A 5H9WA 4LE1A 5HK8A 3L93A 3NONA 3SF8A 1IY8A 1C30B 3UJDA 1XZEA 1EHCA 1PJCA 3MUOA 1GCOA 1A97A 1MXHA 2AQKA 3OURA 4NH0A 1VPEA 3VNAA 3ZE6A 7REQA 4C78A 5C5EA 3E4DA 3T95A 4X00A 4YJ2B 1NBEA 3DQZA 4BB9A 3A1WA 3PPYA 1Z2CA 3H7AA 3HO1A 3MLEA 2KW5A 1UBTS 3BMNA 3F78A 4C4YA 4PSUA 4C22A 1E1NA 4OP2A 4MJ7A 5FTKA 4YCAA 5IBCA 3U62A 3JASA 3KT8A 2ZSAA 1GZVA 1H85A 1K1EA 2J33A 2JI9A 5A4IS 4H18A 5C8YB 2C9MA 3EDYA 4CLXA 3BREA 2W4MA 2NO6A 2VT3A 1E6EA 2XZPA 3FW1A 1G55A 2B4TO 1J1UA 3O2QB 3WGNA 5DOVA 1DRUA 2UVPA 2I5PO 1TYCA 1L7VC 2HMSA 3GRAA 4OCZA 3WDLA 2FFRA 3PPIA 3KT6A 3EEOA 1NVGA 1S0UA 1DP4A 2ZRMA 3AF2A 3KL4A 5FOQA 5K05A 5F73A 4MB6A 2VH5R 5E0KB 4ZXPA 3H9QA 4YDRA 2W2VA 2GUWA 1NXWA 5I9MA 4JLDA 2XA2A 3IQDB 3EVCA 3ZNPA 5C8ZA 5HJ2A 1AUPA 2UXBB 1FYEA 3I72A 4BUJA 1WNFA 4B8WA 4Y67A 5LKAA 4IZOA 4RHFA 4BC0A 3IVMA 4D9MA 1JFFA 1DPFA 3KQUA 1Z63A 1VIVA 2XCIA 3GD5A 5FA6A 1G5PA 1VJTA 4NXNB 1PT6A 1CNMA 1NY6A 1ZP6A 3BXHA 3X44A 2JD1A 3ZLBA 5JXGA 3TL6A 3MRSA 1CF9A 1NMQA 4UXIA 4MYTA 2WV9A 2B0JA 4DIMA 1L7EA 4WCFA 5DWVA 3TRDA 2WD8A 1COZA 4MWGA 4X91A 3OD5A 2O0KA 3WIVA 4ARBA 3RHZA 4BO8A 3PFGA 5DN9A 1RRVA 3WSTA 1EK6A 4RV5A 3T7KA 3T7JA 4TXNA 2Z30A 4D3SA 4D4GA 3ZCXA 1PR5A 4FYWA 4A6EA 1GUAA 3AONB 5DYIA 2G36A 1YE8A 2RHCA 2ZRCA 1N9GA 1SVUA 3M4ZA 4CYMA 4LZPA 3TVDA 1X2BA 2XVXA 4AG5A 1T8WA 3ZCPA 4B4OA 3QX7A 4OHYA 2IIVA 2W6MA 3NETA 3OJCA 4G25A 1Z4OA 2QQFA 3KETA 1Y9ZA 2BLLA 4HNTA 1DNPA 1PEDA 5JSZB 3O3MB 4WY2A 4KPYA 4P1ZA 5A03A 1UXHA 2P5SA 4ZO7A 1R00A 3WXMA 3OZXA 4WKNA 3Q87B 3QVTA 4R2LA 3RTBA 4M7WA 3ETHA 1HYGA 1X7HA 3ONNA 3Q40A 2O4CA 2X1LA 1A9YA 3VA7A 2C4HA 3FKSD 5IT5A 3ROZA 2GBPA 3ZLTA 3C0KA 3DD1A 5TIIA 4IX9A 4J1TC 4ENPA 3HJAA 1QYRA 2XE6A 2RARA 2VNSA 3T9EA 4U2EA 2PRZA 1MKYA 3QLUA 3U3KA 3BORA 4DGQA 1Q1GA 1ZX1A 2XRZA 1JDJA 3K1AB 3K53A 1YBMA 4KQ6A 1ID8A 1T5OA 4PFJA 5T5QA 4BU0A 1TF5A 1VJ5A 2F59A 1UWLA 2V65A 3GFGA 3KJEA 5U4XA 1EINA 1FFBA 1CQJB 3LBHA 4MUMA 4NEHB 5G0SA 4S1OA 4DM4A 4EA9A 2NUPB 3KJIA 1O87A 3BGIA 1KA9H 3F47A 1ZH0A 4H08A 5EJ8A 3HNRA 4QYWA 4YP6A 5ULLA 3I4CA 1M73E 1PL6A 1SG9A 2VVTA 3RBZA 4BUCA 2W70A 3KR1A 4NARA 3UUGA 2FJUA 4QDZA 5K0JA 5CDUA 2NYRA 1YOVA 1ZRSA 3EOAI 3K0FB 4P93A 3JAKB 1O4VA 1S01A 4DZRA 3H04A 1BXGB 1R2QA 4BQSA 1Y8ZA 1I4EB 3Q1KA 5FR1A 3N87A 3P2JA 5DYYA 3GRUA 1J07A 2X9VA 4FOPA 4UTVA 1ZC4A 2ES4A 1NWCA 4HZGA 3L2OB 4LXXA 5DTQA 4UUOA 3D4LA 5HTKA 3ZCRA 4DRYA 4QHTA 3QA9A 4J2TA 4DQVA 3QE4A 4ZO6A 2CL0X 2BIFA 3FETA 1QRAA 3P8ZA 1E1LA 2FI1A 1B26A 1CRQA 4IDPA 5IT4A 1C4WA 1DBPA 3IQWA 1FNSA 5GM1A 1AXGA 2Z09A 4JQSA 3WQSB 1N78A 3R3UA 4BRUA 2I7DA 5C1BA 4BO1A 5AUPB 4KCGA 3NYRA 1U04A 4R2MA 4DCVA 2VSFA 5AIBA 4RMNA 4KGDA 1ODCA 3RU7A 4BWYA 9MHTA 3IEPA 3LQKA 2WC1A 1YFJA 3MGBA 1D04A 2ZYGA 4ESVA 4KR2A 2EFGA 2H5IA 2JW5A 1ODKA 2R8PA 3DOFA 1KTVA 4TS3A 5JW6A 1CUUA 2BWJA 2P5UA 1UMBA 1EFPA 1TM4E 1U4SA 2I65A 2IDZA 3OQJA 1IDOA 2JS7A 4YRFA 1ZUNB 1ISJA 3CZMA 1QUFA 2FSHA 3MJRA 4E70A 1H2RS 1TB4A 5JNTA 3ELBA 3FMIA 1A50B 2EJVA 3LXUX 4J9UE 1WB6A 3ZJYA 4Z5XA 1JU4A 1NXPA 3DHVA 1P77A 3OCCA 3QELA 2PQ6A 4FDAA 4PX3A 2NU8A 4C5AA 2OFOA 1SXJE 2I9KA 4FX5A 3NZEA 3QXHA 2W83A 2I55A 2JRLA 5E6UA 1U2DA 3WNCA 3ZWAA 4P2GA 3LQYA 2VRWA 4BNUA 3I0NA 3ZI7A 4OXNA 1FTNA 5JASA 3DAYA 3UJCA 4LTDA 1S02A 4OHOA 2QXUA 4A8HA 2GTHA 2QM8A 4DC1A 5JISA 1ODLA 1QGDA 1RAHA 4HWTA 1RPJA 2I0FA 2Q9UA 1P4JA 3FIJA 1USUA 4D57A 3V4VB 2Q5IA 3GMIA 4JJ4A 4BTEA 1M6EX 1BIFA 1TCCA 2XUHA 4KIGA 1K89A 1O2DA 1OSNA 1YMQA 2I2FA 1NC1A 1Z25A 3ZZ1A 1YAHA 5IC4A 4L3VA 3K6SB 3R7BA 4MLPA 3OZEA 2Z5LA 1PR1A 2IU4A 1G5FA 3KG2A 4H3KB 4LWOA 3U49A 3NV7A 2FCAA 2OP1A 2RGNA 3EPHA 1R27A 5D8DA 2J41A 5J59A 1EXVA 1P9RA 1GTZA 3M2PA 4GQAA 4K9KA 4PRZA 4YN3A 3UAWA 3VJMA 2WKRA 2PL5A 2XDWA 3MB5A 4QXOA 1QS0A 2NAPA 3L4SO 3W9YA 2J3KA 2R8EA 5LQRA 4J29A 1JU3A 2VI5A 3JYNA 4F60A 1HDRA 3K9NA 4KPGA 3TQFA 1RCUA 2I34A 3OE1A 1ODJA 1IBCA 3MMSA 1OX4A 3TXXA 1MEEA 1QFSA 4HAZA 2Z1NA 2Q1UA 3L0ZA 4G0QA 4E2ZA 1CHDA 4I2VA 3TW4A 3QVWA 4WJLA 2V6GA 1NIPA 3H6GA 1BN6A 1P6QA 2XV1A 2WYUA 3QU2A 4HAXA 4MVYA 1PT7A 3LIIA 2CKDA 4A5SA 2QPAA 3DBRA 3E84A 1LF5A 5TT0A 4ABTA 4NCBA 3GW8A 4FFPA 2O2HA 4KKVA 2CZQA 1VSTA 4UARA 4BLRA 5AUOB 1PV1A 3O38A 2G0NA 1AN0A 2P2LA 4BVKA 1SXPA 4IZ6A 4DB2A 1U9YA 4YJHA 3VGPA 3VO8A 4ZGGA 1T0JB 4I5DA 2B82A 1GL7A 4QL3A 4LHXA 1W30A 3CIOA 3NJ4A 1D07A 5IAJA 1RIFA 4IIJF 4K6MA 1FY2A 2VYVD 4IJUA 4F46A 2SKDA 3HMKA 4JKIA 2WHPA 3COPA 1EZ4A 4M0DA 5FNVF 4EZEA 3GH1A 3VR6H 3VR6A 1YCGA 2NO5A 3MUEA 1A7UA 2JFUA 5C31A 1OLSA 1FP4A 3KUXA 2VHTA 3H84A 3B51X 2D1RA 3MK31 3OY2A 5DMXA 1M1UA 4C5BA 3BWCA 2WOOA 1T8UA 3ZTTA 3WKCA 2CYCA 2XLBA 2EP7A 3M6IA 5FL7D 3RIEA 3ZWWA 3EXEA 4C7KA 2B61A 3CH7A 1GFZA 2Y1WA 2Z83A 3F49S 4FYHA 3V42A 3H9UA 4EQZA 1PRYA 1NBMD 4YRNA 1V6AA 3Q8WA 4PCAA 5KMGB 1KYXA 4PSDA 1UINA 1P0QA 1Z06A 2PWZA 2PSEA 3CLTC 1QF6A 1I4OA 4D79A 4UQLA 3M9WA 2J32A 4NJOA 1J97A 5BR8B 2HYIC 1E7YA 2N42A 5FFNA 3ET5A 3RBAA 3PVZA 3DJYA 1VHWA 4KO3S 4XPIA 3AGQA 3R7SA 3GGCA 1QOPB 1FDWA 1K66A 3C98A 4Q7JB 4MEJA 3TEJA 2OMKA 3M5WA 2CUZA 5EESA 3KZMA 2DFVA 5EE1A 4CBVA 4PG8A 5DBGA 3UCXA 1PFQA 1V7ZA 3TW0A 2NZYA 4HG2A 3N74A 1CZUA 2IOFA 2OG1A 3GAFA 5AKKA 4L0CA 1XL1A 4P5PA 4PWZA 1UUFA 1HQDA 1CT9A 5LBTA 2OHXA 1ZJ6A 1VPVA 2H51A 4DG5A 2DQKA 1GP2A 4X66B 1FVFA 1BX3A 3FSJX 3QEMA 3O1HB 5TC4A 4I1IA 5EKSA 2IUYA 1C4KA 4KL8S 3WJ1A 1YO6A 1RE0A 2Q0SA 4AU1A 4CI0B 2ZTLA 2L2QA 5I9TA 2CFTA 1U9CA 4RK1A 4CM1A 2ISQA 5J2UF 4CT4B 4XJVA 1V41E 2PWBA 1KNXA 4CL8A 3TS1A 1XKLA 4I6JA 4K6KA 3SXUA 3K16A 2WZCA 5KQMA 1T9GS 1JG1A 4K7JA 4F2DA 3OCVA 1UBSB 2IYEA 4GLFA 1I2BA 4A23A 1I94B 3DEFA 3FDFA 3IV7A 3PU6A 3LIPA 4TLLB 5THKA 1JJFA 1X6VA 2VHJA 3D2CA 3EEFA 1XXHA 4MEAA 1UIRA 2Y4NA 5EIXA 1CULC 3ZY4A 3JAMA 1GPYA 4MKGA 1NUHA 1WCIB 2XQJA 3BG5A 2DQZA 3DNMA 5B2EA 1AJEA 1N6HA 1WCYA 4NECA 2ETXA 2G76A 1V7CA 4RHTA 4X1OA 5B3JA 2V7TA 3BMQA 3TK1A 4WN3A 3MTAA 2HJSA 1NN1A 4GKAA 4R7TA 1P8AA 2Y77A 3AL2A 4ADSG 2ZCVA 3GJ6A 1BVHA 4AIRA 4S0ZA 1E2DA 1D4OA 4ZAGA 5KC9A 1QQ5A 1E2FA 3ZWCA 3H05A 4PYOA 1BCSB 1U3CA 3O7WA 2G82A 3T9FA 3PYMA 5EMJA 3DWGA 3ENNA 4AZ0B 3EOZA 3R0VA 2FYTA 2QLMA 4CQMD 4LVOA 1DWUA 5I7HA 1U8XX 2HCTA 2DHRA 4BX9A 2R00C 2O8DA 4YDQA 1ULTA 5JTTA 4L07A 3KSBC 1HRKA 1G5HA 5IN5A 2H1WA 2ZBRA 3H2IA 2PLWA 3NYQA 3RVNA 4Z7QB 1YZTA 1NMYA 4DL9A 1U80A 1KK0A 3LQRA 1JQEA 4UBIA 3X43A 2YUIA 4BQOA 3DDUA 5AVRA 1Z83A 3ITNA 4ZVVA 3ZEIA 1D1TA 3FYTA 1QRRA 2WTXA 1U8TA 2MSEB 3CM0A 3OM9A 1R6DA 3WFJA 1H6AA 3W7BA 2DT5A 4AQ7A 2HPAA 1ZITA 2C9DA 1AY0A 2QIPA 3WGJA 1RRPA 4XYMA 1YS9A 3C7TA 3OIVA 3GRKA 2GTIA 1KJWA 2GXAA 3KPWA 2H5LA 1OXUA 3WYFA 1MB9A 2LVBA 3FZEA 1WVIA 1PWZA 1EPUA 1CQIB 1E0JA 5A5GA 2KS6A 5LZ4A 4NMLA 4U7DA 1NVFA 2OCXA 3DTNA 4P3YA 1H9AA 2PSDA 2C4MA 5E6RA 1SHKA 2YJZA 2WK1A 3H1BA 3M7IA 2NLOA 2PK3A 1Q77A 5HGJA 1E4OA 2C7PA 1IPEA 2I76A 3JW8A 1ZK0A 2YXPX 1MU0A 4FFRA 5GONB 4B8ZA 3A9VA 5EE5B 2AE2A 1ILEA 2WM8A 1W0JA 2QI9C 4B17A 4C7JA 5KI6A 4J2HA 3LBFA 1IC6A 3GLQA 1MC8A 1NYQA 4DA9A 4ZJUA 3OQHA 1OBOA 1T1GA 2JIQA 2YMPA 2PRIA 1NZJA 1KJ8A 1MC4A 1O03A 3HCEA 3NWPA 4U8GA 3VVMA 2RC5A 3O82A 3AY3A 4KO4S 4F4FA 5K8VA 2AW5A 3LHSA 4MMYB 4CEHB 5TPWA 3F8SA 4HXFB 2Q9AA 4LPSA 1BE6A 2HRBA 1WXIA 4XASA 3U3MA 3NHUA 3D3JA 4M8LA 4D0LB 2QUIA 3G0BA 3HP1A 2WWTA 1OILA 5JSKA 4YAIA 1FTSA 1RRKA 1NKVA 1NJ5A 3HCAA 5EZQA 1GGEA 1EXMA 3KKLA 4OHKA 4ZODA 3LS2A 2RC6A 1PNVA 3EIOA 1JDTA 1JG2A 1TUEA 4P82A 4B87A 4LZWA 3WHLA 3AKEA 4EUSA 1XXHE 2V6BA 4ETNA 1CQZA 5ALSA 1Z88A 2ZK7A 2CY0A 2C2GA 5ETJA 1EQUA 4JA2A 3L6CA 1XJWA 5DI9A 3AHCA 3GAMA 4HRAA 3LX5A 1M9NA 4ZAVA 1AQIA 4AWXA 2XIQA 4J0HA 5A3JA 1LB1B 2XUZA 1TVMA 4TZ6A 1MLDA 4EDFA 5GZ3A 3DF9A 4YCLA 1MFPA 2VATA 3GN1A 2D1QA 2H85A 1P5HA 2AZ4A 3G2HA 1F2VA 3GAZA 4N5NA 2HTEA 3CVUA 2C7QA 4QPZA 5IS2A 3QF4A 2P35A 2JLSA 1WL8A 3AR5A 3O73A 4RZHA 2GZ1A 2F3PA 3CXUA 2FWPA 3LP5A 2VG8A 4MW1A 4AMBA 1IIBA 4Z0NA 2AE1A 2CDRA 4JLKA 1VYVA 4P3PA 2MIIA 4F4CA 3A0RB 2R1VB 4UBOA 1RPAA 2J45A 3CCBA 3ESZA 2GN1A 2CMFA 3INTA 3KEGA 2DVMA 2YOHA 3NHWA 3OKAA 4OSPA 3VPAA 3WGUA 5I51A 2WSSD 3HUTA 3H8JA 2JBAA 4Q1BA 1J8QA 2QL7A 2HY7A 5C81A 1RYEA 3AVOA 3DVSX 4HYEA 3V8NA 1U0SY 4XDGA 3QFCA 2MHCA 3EOBI 4WACA 2GN0A 3RC2A 2ZWVA 2WKQA 3PF9A 4KH0A 4NS4A 5C4IA 4P3XA 4LF5B 4L57A 4TPKA 3VV2A 2F7SA 1OV6A 2JGAA 3EUEA 3FDIA 2C96A 1F17A 4NF2A 1EX6A 2LDXA 1TYZA 2XB9A 4KN8A 1LKZA 3G2LA 4C0HA 3NUQA 2QL5A 2VP4A 2AD1A 2BP7A 4P3NA 4CKYA 4O1MA 1GTMA 1NTOA 2CDCA 3R0ZA 1QJCA 3SDZA 2OGUA 4ZFNA 1HLPA 3OEWA 1GPUA 1YRBA 3OUTA 4GOKA 3TQOA 3GPDG 3ZK9A 1EMDA 1LBIA 1E2EA 4QODA 3HK2A 1SOVA 4RJIA 4OXIA 2ZJ1A 4JUFA 5CEEA 3OTHA 2BGMA 3N8HA 3WI7A 5JRJA 1ELOA 1S2LA 4WTOA 3ACDA 1B41A 1M76A 4LJ8A 1E2LA 3RRXA 2I2BA 3FSGA 4AD8A 4Q7EA 1TYBE 4XM0A 5JO9A 5K8CA 2Z43A 3KLPX 3VYTB 4WOJA 3HDVA 1ONOA 3AHGA 3OOEA 3PCRB 3LT4A 1L4GA 1UQUA 1GUDA 2G5CA 4GM1A 4XR9A 4JWKA 5CVJA 1KEPA 1QFMA 1O6GA 2IIBA 4I1SA 3ROXA 3KJZA 2GJKA 3UKDA 2RGAA 1JVNA 2FWMX 4HXGA 4RTRA 1TA9A 3O8RA 4G84A 1N2SA 4D82A 1IRIA 5FPTA 3A11A 3NHBA 4LTMA 3UY4A 1XUOA 1G98A 1HFJA 3D8SA 1MX9A 4JQOA 4K9QA 1KO8A 3A4NA 4GFDA 1EM8A 2QAIA 1CU1A 3AB8A 4J6FA 3ZWMA 1ZNZA 4AB1A 5K99A 1MOSA 3ABZA 3NYWA 3WP0A 3WRYC 5KYUB 2G28A 2BKXA 3MJEA 2BEVA 4GT1A 4FKZA 4EM6A 1L3IA 4L4ZA 4PLFA 1BEEA 4I0WB 5C1DA 3EVGA 2B20A 3G7SA 3G2JA 1VE3A 2YHUA 3GZNA 3R4CA 4XVQA 1HX7A 3EH2A 5ALXA 5BUCA 1P2FA 1KAHA 3EUFA 4RK4A 3SY8A 3TCKA 1WTAA 1NMXA 3NTOA 2LV8A 3LCJA 2X13A 3OCWA 5CNMA 3ZDZB 2PGNA 2GZSA 2QRUA 4CLRB 1A8UA 1E20A 5A9SB 1V8ZA 4FFVA 1IHPA 1X74A 1XA4A 3LWBA 4PC7A 4XUCA 3HZOA 4DMRA 2R9VA 4RDIA 4WA7A 6NULA 1Z3IX 2HSWA 1C81A 1DAMA 3D31A 3M4JA 3Q9NA 4WKGA 3PLRA 3P96A 1FK8A 4KXFB 1KH3A 1EP9A 3HU3A 5KTOA 4EI8A 1QVVA 3PZRA 2QL6A 4AP5A 1PJBA 1YK0A 2H8KA 2C84A 4RAQA 3CGWA 4A6XA 1DBVO 3L1IA 4MROA 5ECGC 5LOVB 1V5IA 1E5VA 1R50A 4MS1B 5JARA 4K6FA 1Q16A 2YXBA 4K6CA 5TARA 4TMYA 1XPOA 5IYZB 1V37A 3GNSA 1K3FA 2Q3JA 3DR3A 1E99A 4C0SA 3O90A 1G6OA 2OZEA 3OT5A 1VSVA 2C9BA 1B8OA 3G6KA 3L4JA 1SU4A 2IOFK 1Z26A 2G72A 3LL7A 3TZEA 2PGXA 1LS1A 3P4UA 5AVXA 1JNYA 2GWRA 4TV9F 1UM8A 5CM2Z 5FADA 1P18A 3ND9A 4I36A 4L16A 3B82A 4Z3KA 1XQ9A 1QG6A 3TOXA 3AEZA 4HTFB 5A4AA 3B2NA 4OOEA 2F9MA 4PXAA 4QVIA 3IR5A 4Y2HA 4N5DA 4ZO4A 3LUCA 5LYJF 3RTDA 1A9OA 1KC1A 4G41A 4KVZA 4RENA 3STWA 4OLJA 2H31A 3VR2A 4B7AA 4EJSC 3SXPA 4WLUA 5FUBA 1LSOA 5BWMA 3EZNA 3IIKA 4RY0A 1W1IA 2RK6A 3DYIA 2VZ9A 3LQ4A 2BKEA 3AV3A 3P9PA 1NT2A 3DR5A 1IEXA 4OYHA 2LCQA 3USZA 3WVNA 2FXVA 3WMGA 4AL4A 5JDIC 5FLXA 3AP3A 1KF0A 3AZPA 3ECCA 1GPWB 2GXUA 5JDIA 5IVHA 1XMPA 1ISGA 2O2DA 4HQKA 3PXDA 4JELA 5FBZA 3RH0A 1GAWA 2AYZA 3AFGA 4HN2A 5CLGA 5LIPA 5SYAA 2FJ0A 4L9WA 2ZSJA 2G1PA 1UZAA 4QTXA 4GAEA 2XMBA 1Z8NA 2WSBA 3QWBA 2F1JA 2QY9A 2HHJA 1R9MA 5GJWC 3I76A 4JB0A 1JS1X 1UCFA 4WXRA 3U37A 1DX4A 2OFXA 4UAUA 1Y81A 4JJ7A 4XQ9A 2A6PA 3PNQA 4EFNA 1OGJA 1T6BY 5IULC 2A1TS 1KAMA 2EG9A 4ZI7B 2C3PA 3N05A 4HWGA 4NOJA 1NX9A 2VFAA 5BVHB 4I9UA 5FPQA 1B1CA 5DM70 1IM2A 1EWVA 1MPXA 1XZMA 3W77A 3PA6A 3ZU3A 3ZCTA 4DHEA 4QJ4A 1EWQA 3AGPA 4N3NA 3CUYA 1NE7A 3CY6A 3IV6A 5EGNA 4BE4A 1O5IA 2HRRA 4BGDA 2M9MA 5ICCA 2Z6UA 2UUOA 1V0JA 4QDOA 2WZQA 1KFKB 1V1RA 1JILA 1W75A 2WQ6A 3MVEA 4R01A 4EEZA 4S1PA 3ZYCA 2DFTA 2JCGA 4MAAA 1VG9B 3TUZC 2XD9A 1T3ZA 3QPBA 3UXEA 1JDNA 2B3TA 4B3BA 2XMGA 5LQKA 4DQLA 4ZHQA 4N4AA 1E2UA 4RTOA 1LTHR 2BY4A 1A77A 2RGXA 3JWHA 3RWBA 4BFVA 2ZB4A 4FUTA 1Y37A 1B23P 1VDZA 4XB6B 4CDNA 2DKFA 5JNSA 1A72A 3I34X 3I04A 4NU8X 4I8IA 4J0CA 1Q0HA 4JB3A 4HDAA 3GRZA 3AJAA 3T1TA 1OTYA 2XNJA 4JJKA 1L5HB 1UXKA 1PBNA 2VPZA 4LE2A 1K2WA 3LOQA 3PQEA 3HBFA 3WMFA 3WYAA 3IKLA 3PGVA 3OEHA 4OHBA 2H3EA 5KS2A 3EGXA 2ZUTA 2FVYA 3SQXA 1KKUA 2NVUA 4OXKA 4YT8A 3P20A 2Q5FA 4QDUA 2RGWA 2JGDB 5GWXA 2A1UB 3A1SA 4UASA 1F2DA 4DMKA 3E9MA 2F9LA 1MABA 4PYJA 2WUDA 4RD3A 1L7NA 2XXBA 2GHQA 4KQGA 4CLDA 4E4YA 4IHQA 2NSJA 5P8WA 3IL2A 1LDGA 2H07A 1Y80A 4DWJA 3EQ9A 1WKBA 1HG1A 5IKXA 4OIFA 2QPTA 2FPKA 3C7CB 2Q6LA 4ZV9A 1O4WA 2LZ0A 3A3KA 4YAEA 3BL6A 4V0RA 1JX6A 1L8QA 2FW6A 3RAFC 1ZA2A 1O6ZA 2RH4A 5JZ9A 1XZKA 3W90A 1M2HA 2CYAA 1CJUC 2RMKA 4M7OA 3UK6A 2Z2ZA 1DRVA 1Q0LA 3N6RA 3WK7A 1G3UA 2XOXA 3THRA 2CK3D 5K8JB 1D2AA 3ZHYA 2PUVA 1Y8RB 2VAPA 3DE3X 2VA9A 1C14A 1R8YA 3GFOA 3RBXA 2O8BB 3JYLA 4ZU1X 4HNVA 5HZGA 1IAVA 1RKUA 2EX4A 3DOJA 4GBGA 2NPFA 3RSCA 3X2SA 1YI8A 1G2IA 1G5QA 3K0KA 2DPYA 4MVJI 5TJHA 1IM8A 2VF5X 3KR9A 2BDEA 2IYVA 4M87A 4DWOA 2FPGA 1OWMA 1MF7A 3DUWA 4LXQA 1CUJA 4I55A 3RIMA 4B33A 4OQNA 5KNBD 4A1OA 5GZ6A 1JE0A 5A5VA 3AR3A 3PC8A 5BW8A 5ITVA 3KNZA 5ENZA 2X2EA 3LT5A 1K06A 3HFSA 5FPPA 1SCJA 2P9TA 3G0DA 3LY5A 3ROPA 4AJOA 5KU7A 1O8CA 2O6LA 1H2WA 2XE7A 5BWLA 3CKKA 5K8TA 2AIRA 4GMHA 2EJCA 1M2VB 3BMOB 4LDZA 1X13A 4Q3NA 4QYIB 4CM3A 2VRCD 1JAHA 3GLGE 1QH8A 4GPD1 1N3LA 1VL6A 2P69A 2F67A 1UJ6A 3HI4A 4EW1A 1C29B 4EGJA 3FNIA 5CR9A 1EX1A 4ER5A 1EDDA 3V32A 2Z9BA 2ECKA 4GSKA 4ZOAA 3PT5A 4LNAA 2BTQB 4BX0A 4DSZA 4DG8A 1E7WA 1L5FA 4KMMA 1AGPA 1MW9X 2XQIA 1AE1A 3ENWA 3NTUA 4BQRA 5JBQA 1JR6A 4NJMA 1NV8A 1K5GA 3LQ2A 3WLIA 3X3HA 1XSEA 1YRWA 2QVLA 2YICA 3CZQA 1JHAA 1H93A 1JQAA 2R25B 3KQVA 3QXXA 4JGBA 4WI1A 3IXMA 3OE4A 5HCUA 1UEXC 4HGYA 2EP5A 2W0MA 3BBLA 4Q1VA 4BO0A 4C0JA 4D41A 4X92A 1GKYA 3ZDCA 5D7NA 5K0EA 2JEOA 3HDYA 4MB0A 1H4SA 4P36A 4M46A 4JBLA 3AF1A 3JQRA 2FWRA 2QVZX 3NQ41 4I4LA 1JSCA 4KXNA 4B4KA 4V1CB 4NFSA 3D3NA 2E9SA 4QXAA 3H4IA 3D7NA 3HSSA 1JPNA 4DLZA 4ICIA 4FYJA 1NG1A 2VZEA 4OA5A 3WQQA 1C8BA 1BC5A 2Z3VA 4P7KA 3TLYA 3RT1A 3NHAA 4EJFA 3JQ6A 2CSUA 3HJHA 3O95A 3OJFA 4X8LA 4CR7A 1KEKA 1BN7A 1Z2EA 4Q93A 3VO1A 4Z1MA 4BVHA 3QP9A 3F1LA 3EBOA 4IOLA 1E58A 1FMCA 2HK8A 2ZPUA 3N86A 1D3AA 2FRDA 1LBTA 1VB3A 3GR6A 5C7YA 3RC1A 1ZJ5A 4G86A 4MVJH 4MVJA 5GVRA 1PJQA 5T64A 4M9QA 3CZAA 5DWQA 4CODB 1JHOA 1LJLA 5TPZA 3KX2A 4ASUA 1JBEA 2BFEA 2OV1A 3PC4A 3TNLA 3TEMA 2Q6TA 4CIDA 1SM4A 1KEWA 5IDWA 1TZCA 2ZVDA 2ZTUA 3KV1A 1KI4A 1AKWA 5C1PA 1JRLA 1AM4D 3TBHA 4RD2A 4RIHA 3DOHA 1CY2A 3BGWA 1M1NB 2HHAA 1FUEA 4HDCA 4RCYA 4ZZ2A 2ZWPA 5DN6D 3WQHA 1FX1A 1GNRA 4FHDA 1W4RA 4CM7A 3T5AA 3W9UA 2CBGA 2ZYWX 4FT4A 4DC0A 1MGOA 1LQTA 1SVNA 2ANCA 5DT9A 3HWX1 3DO5A 1Q0SA 1WG8A 4OI2A 3B9RA 3IQHX 4ILEA 1F2TA 3T99A 4CU2A 2ONZA 1Q74A 3H19A 3PGLA 5I9IA 1MJNA 4TL9A 5EG5A 5IM4A 4YAGA 2AEEA 1U2GC 2IU3A 5DDIP 3MA0A 1A5AB 4I1RA 5K0FA 2YUTA 4IILA 5IEBA 3MJCA 2WF9A 3H6KA 5CMLA 4E2FA 5CDGA 1LUAA 1Z6QA 2CVPA 2OZLA 4OGWA 3HHEA 4GUAA 2IH4A 4KRFA 1CUWA 1SVIA 1XA0A 3ND8A 4G4IA 4D4KA 3DFMA 4IICA 1Y5RA 3D0OA 2R0QC 2RG1A 8LDHA 3SNKA 3UNXA 2UUCB 4NXMB 3OSZA 4O2BF 1A4XA 1KDTA 1S96A 4MPTA 4IH4A 4RIFA 4K3VA 3WNDA 1HETA 1N2GA 2IDKA 3HYNA 1Q3KA 2IXBA 4GBED 3L8EA 4HS9A 3UWPA 4BX8A 3G2NA 1GOTA 5CYOA 1JU9A 5UKDA 3HLKA 1GU7A 1N0WA 4C6TB 2ZWOA 1IZ9A 1IE3A 4X61A 3BD7A 2UYOA 3AESA 3JS5A 1V3TA 4IIDA 2WU3A 1DO2A 2E4XA 2WWXA 3HDQA 3WV4A 2F3QA 5CYPA 3L1VA 4ZTUB 1FQJA 3BGDA 5CDSA 3PD7A 4QGSA 1AGXA 4UE3S 1AS3A 1RWVA 4X6LA 3UQYS 4DSNA 1E9EA 1NJ8A 2VXBA 4J91A 3NC1C 1YJCA 3RC8A 2VWPA 4A1FA 2JLBA 4ZPXA 3IOEA 2QYTA 1PEAA 3KKMA 2FQXA 3U48A 3C41J 4FPXA 4QNNA 3WB1A 1DBIA 4GBJA 2ROQA 2B5VA 3ANNA 1NNEA 4JIMA 2G04A 3MJHA 3U4IA 1UPFA 4V0QA 2WA2A 5DIFA 1JXMA 2ZYAA 4WNAB 4HK4A 3ZDQA 4ARVA 3JQAD 5EIBC 4IJVA 4E30A 4LBVA 5NLLA 1QWSA 1UK8A 3VU8A 3FIUA 4YDSA 4EBFA 2YRWA 5FOSA 2FPMA 2IUEA 3HXMA 1SKMA 4JK3A 4WXEA 2O5CA 3L7IA 1LD3A 2XOEA 4LQDA 5ALRA 5AHXA 4QDJA 3TXYA 4RDXA 1CEQA 5EMNA 3DOUA 2ZPTX 3I83A 4CLOB 5EJEA 5EIEA 1ZEMA 5KYTA 4F2GA 1GSAA 3EZ9A 3UENA 3WIEA 3G0HA 1G60A 3R3VA 1F20A 2HIGA 4PYMA 4DQ0A 4OL9A 3T1NA 1YIAA 3QIVA 1XJQA 1R8XA 1VE5A 2XCLA 4CZ2A 4KPUB 3UJ6A 4WFJA 2IXGA 3A4LA 3V5NA 4BATA 1WR8A 4CN8A 3U26A 4ZAZA 4NI5A 5I5EA 2PT7A 2ZIGA 1BXGA 4ZOLA 2CVOA 5L3SB 5EEHA 4AJ4A 3I53A 2UXDB 5KYXB 3BMCA 3ZD8A 4EG7A 1X86B 2A8YA 2O0MA 1IB0A 3B60A 4H15A 4EPRA 1AKRA 5C4MA 5LQMA 3TF5A 3JQ9A 3JRWA 3PWZA 2NO1A 3WL3A 1OI2A 4XGNA 5TGDA 4L8VA 1U11A 3HKDB 1E61A 2GYVA 2P9QA 5EY5B 3QSGA 3RIXA 4FWIB 3NS7A 2O3RA 2XB4A 2Q8QA 4DPLA 1O9GA 4YCMA 2A0WA 1ZM9A 2FW7A 1NW4A 2QV7A 4J0DA 2QENA 5FA8A 4IJ6A 5CCXA 1XRSB 2F64A 1Z4PX 1FVXA 2V4ZA 3MC1A 3EIUA 4TL6A 5CYGA 5HQ3B 1MD9A 4PQGA 4IQ8A 4IDNA 4GMDA 4K86A 5FA5A 3K35A 3UB2A 4PZDA 4ZDWA 1BDMA 5G0WA 3S8EA 2IEBA 1K7EB 2XQVA 4J0KA 5A1TA 2P9CA 2ZVJA 3QJYA 5F52A