5FI1B

Crystal structure of the p-rex1 dh/ph tandem in complex with cdc42
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
FMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
publication title Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 53
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fi1B00
4LPKA 4BFUA 1W0JA 1HE8B 2QSYA 1NNEA 1QHHA 2A5GA 2RGBA 3GCGA 3GEHA 3P32A 3DL0A 2QMHA 3B1XA 2VRWA 3H84A 5FR1A 3A4NA 3EIEA 2OSBA 2QE7A 3FVQA 2ANBA 1WDTA 2ZETA 1HEIA 2B8TA 3WBKA 1G41A 1AGRA 1LY1A 3K9GA 3CIOA 5HE9A 1E32A 2RGDA 1JEEA 2DYKA 4Z1MA 1XX6A 2WJIA 2DFNA 2GAOA 1W48A 2QNRA 1DO2A 1XCMA 2AD5A 2ZSAA 1H8HA 4KBFA 4FW9A 3KFVA 4Q21A 2WV9A 3QKSB 2BIFA 1MOZA 4TLCA 3WP1B 2ONJA 2ZU0C 2FFQA 4MRRA 4A4DA 4C0KA 3GFOA 5AUPB 1L8QA 4WA7A 4PZZA 1WB9A 2DFTA 1E0AA 2GXQA 4NCNA 3K0FA 4LYHA 4F91B 5FTKA 4ZDJA 5EP4A 4CVNA 1Q1EA 1XPUA 2WVJA 5J4LA 2O0HA 2ZANA 2NPIA 2QI9C 2CK3A 2YZ2A 1FPMA 3NBXX 1VMAA 1ZW6A 4D0GA 1P9WA 3E70C 1I4DD 5LPNA 1WMSA 2UKDA 5GJCA 5J40A 1DELA 1A7JA 4W7SA 2ZRFA 3R7WB 5K8UA 2IYZA 2C96A 4A0FA 3BIFA 2H16A 4ACAA 2MSCB 4A6PA 4CYMA 1PJRA 1JAIA 221PA 3PJRA 1GRNA 1YZKA 3K53A 5L3RA 1JXOA 1P2SA 3BC1A 3LW7A 5H68A 1R8QA 1TPZA 2A9KA 3DHWC 3AVUA 1TADA 3GJ0A 2Z83A 2OBLA 4D0LB 2AK2A 1M74A 4QGFA 2QP3A 2W6ID 1YZTA 4G3XA 4Q4AB 3A8TA 3VR1A 2F3TA 1IXZA 2IF2A 2QAGB 3OESA 1Q22A 3CZQA 5DNYB 2AHOA 4R98A 4ZCMA 1OIWA 2VHCA 4QBHA 5KO2A 4GI7A 4HDOB 3C5HA 4ON9A 4DCTA 1RW4A 4Y0VA 1JAHA 1W1WA 1II8A 3AVTA 3OIUA 4R7ZA 2J0VA 1ONBA 4DCSA 3SU8A 3OE7D 4QJ4A 4LRWA 2PMKA 1WF3A 3AB3A 5P21A 5B57C 2F43A 2IEZA 2L0XA 2F3RA 4JL8A 4QGAA 2OILA 2ZRKA 5TY0A 5KSPA 1E0KA 2V1XA 4A2PA 2IW3A 1HQCA 2BBSA 3ECCA 5FL7A 3LA6A 3VR6A 3MSXA 2VHUA 2QPAA 3H0KA 2J59A 2IBMA 4DXAA 3W3AA 4J0QA 3RC8A 2IYUA 4L16A 4PZYA 4A8JC 1LB1B 2YOGA 4A8JA 3KQLA 3UG7A 4Z54A 2BWJA 1M6NA 4HUQA 2IS4A 4M1OA 2BCJQ 3K0AB 4UKDA 4GFDA 5AJXA 3K9LA 1R10A 2EU8A 3LDAA 1JB1A 1EX7A 5JI3E 2I1VB 2A5DA 3OIYA 1XMVA 3QF4A 1WP9A 4RD6A 3SFZA 4ZPXA 1X8LA 3OAAA 1PV4A 3T1OA 2F1JA 2IEYA 1R7RA 5C2JB 4DLWA 1W0JD 4JLAA 1Q57A 1KSJA 1XD2B 1YJ5A 2QAJA 2QG6A 5AJVB 3RRYA 1IN8A 2ZJ2A 1ZNYA 1KTVA 3WMGA 2QE7D 1G3IA 2Q9BA 5FFMA 1FX0B 1N6PA 2H57A 1HQYE 3I8XA 1NVVQ 1QVAA 2AWNA 4JLOA 3MWJA 4XVRA 3T5DA 3VQTA 4Z1MD 3KDSE 4GOJA 1DO0A 3CRQA 3QJYA 1FQJA 2CL6X 4D81A 5SZKB 1RRGA 4UJ5A 4WVFA 4MUAA 3UG6A 3PUZA 1MABA 1AZTA 1N6IA 3TSZA 4MDEA 1G3QA 2J45A 3FDIA 5JBQA 1CJMA 2HYIC 3LVQE 3VR5A 2QMOA 3P4YA 4BEBA 5JFGA 1BS1A 3KQHA 2XTNA 4DLRA 3ASYA 4FMCF 1R0YA 3SHWA 3QI2A 1NJFA 3VAAA 2F55A 2GK6A 3ZS8A 1DOAA 3TH5A 1Z0DA 3R20A 2VF8A 3FTQA 1DAMA 2ZSEA 5D3MA 1Q1ZA 1DAFA 2QU8A 3GLIE 1CR4A 1P72A 2ZSBA 1QBKC 4IJMA 1ZUNB 4URYR 2YVUA 1UJ2A 1JNYA 4TMWA 3QG1A 2AK3A 1Z47A 5FUYA 4XOIA 4F4CA 5EJEA 4GOXA 5JRZA 4M1YA 3SR0A 4B35A 5HPYB 5KDOA 2O8BA 2Z43A 2D7CA 1JR6A 4MKIA 1XCGB 4LI0A 1C1YA 1ZYUA 1E9SA 4TSFA 2Q3MA 3S1AB 1GWNA 4NTZA 4UXHA 2BEKA 2G0NA 1NG9A 4LJ9A 3KQUA 4R2HA 1QG2A 3EC2A 4TTRA 3E2IA 1E1QA 5BW8A 1E0SA 3ZGXA 3B7GA 1DE0A 3QPUA 3X1XA 2JLXA 4F7WA 3AQ4A 3VX4A 1O87A 4B2PA 2W58A 2ORVA 3U7HB 3T06B 1OLOA 1GOTA 1MKYA 4Q1DA 1TMKA 2NZJA 3L8ZA 1U0JA 1DADA 2Q0HA 4M8NE 4LYFA 5UKDA 4CEHA 4OK3A 5TMPA 4CEIA 1CRPA 3NTUA 3P26A 2GETA 1W4CA 1AS2A 4EKDA 3DM5A 4KV9A 3GLIA 1ZP6A 3NEJA 3VKWA 4DEXA 1U0HC 1T91A 2QGNA 3BRWD 2XJ9A 3LBNA 4CGZA 4TYWA 1AM4D 4V0ME 2KBEA 3BD9A 2OV2A 1IJEA 2XZPA 2C03A 3RS0A 2WSMA 4B3XA 3CRVA 2GKSA 2R44A 2XNDA 3I8SA 2IYTA 2WBLC 4B3DA 2V3CC 1Z22A 1NVWQ 4AWXA 4OQXA 4ZV4A 3LNCA 4OHWA 1SHKA 4OQFA 3UIEA 3AF1A 3IPXA 2ZQ5A 3BH7A 3QKSA 2CCGA 4BEJA 4AIIA 1E4YA 1ZD8A 4L4UA 2NMVA 5FTNA 4C0BA 5GVRA 1D9ZA 2ZAMA 1CP2A 2PLRA 3N2EA 4ASUA 3TGPA 3W6PA 1KJZA 4MKFA 3TQFA 3C14C 1OF1A 3MWKA 1X86B 5DLQC 4F38A 3L0SA 1T3SA 5EE5B 1VCIA 3TKLA 4Q9IA 4ESHA 3ZD6A 1SXJD 3ONWA 3THXA 2CE7A 3ND8A 4BLRA 2NTYC 2UVQA 1E69A 4DIDA 4PSVA 4C3ZA 1KZGB 4NYIQ 3I62A 3VR3A 5LD2B 1NBME 4N0DA 2P0EA 3T1QA 1RKBA 4R71A 1XCPA 1N6RA 4DLSA 3U4QB 3N5CA 4BWYA 4D6PA 821PA 2V6JA 4NHOA 4AK9A 2J7KA 1GIAA 2ZYWX 1J70A 4MRVA 2YJTD 3K09C 2ANCA 1II0A 2QAGC 1G8YA 3AF2A 2QM7A 1Z0KA 4Q4AA 3THYA 1AZSC 5JMTA 4DRZA 2PT5A 3WP0A 2E1RA 3SNHA 4KXFB 4OI2A 4US0R 3ZVLA 2ZS9A 3NEYA 4V0MA 4FMDF 2OZEA 3QF7A 4G5SA 3KXLA 5JZVA 4NZYA 2VH5R 3T1TA 2ZJZA 3AVXA 5HKKA 2O8CB 4P4UA 5KHOC 1M34E 1E2HA 1X1RA 2XZLA 1RE0A 1UKZA 4F92B 5JCZA 2P6UA 3B9QA 3W90A 1XTRA 4OI1A 1BMFA 1CXZA 3UMFA 4O0MA 3LAWA 2OXCA 3KTAA 8OHMA 4WOPA 2IC5A 2VTKA 3JZMA 3KKQA 1E1QD 1W44A 3L82B 4R2IA 2J0SA 4DCNA 1B23P 1I4LD 1DTSA 1E2QA 3Q9LA 4OK5A 2JCSA 4JJZA 1RRFA 1XEXB 1NKSA 5A0FA 1PZNA 3TSOA 1XB2A 1GG2A 3P1JA 4DT1A 5DHFA 1NBMA 2ATVA 2PT7A 1G1MA 1W2HA 2XNSA 1L2TA 1NIJA 2W2XA 4U5XA 2CBZA 4RKEA 5EE1A 2OCBA 4PAOA 4IXMA 4OHYA 1RFLA 3IPYA 3BH6A 3NG1A 1AGPA 2J7PA 5K8TA 2FSHA 3BFXA 1TF5A 2W6JA 3LY5A 4TTPA 2RH5A 4RD4A 1KK3A 1KI6B 1G3RA 4TMVA 2OE2A 1ZMXA 4Q19A 3I4LA 3NBYC 4A1FA 4I81A 3QSYA 1QZXA 1UKYA 2WIBA 2GCNA 3AVVA 2ERYA 3CRMA 1XJCA 1CJTC 1E9RA 1D2NA 3KB2A 3QXXA 2D06A 1X8KA 3LFUA 4C0HA 1N6HA 1UDWA 2XZOA 1Z06A 3C4JA 3RRNA 3SJZA 3H2YA 2IYXA 2O8EA 3THWB 3K0CC 3U3JA 2I3BA 5CJ2A 4LJYA 1G7TA 3P27A 4JZKA 3GJ6A 1ZC4A 3TLXA 3RYTC 4ASUD 3K70D 2E87A 1FW6A 3RHFA 1Z28A 2G3YA 1OW3B 2G88A 1OH7A 1F6BA 1YVDA 1S9DA 3GLFE 4RKFA 1E2LA 1JQLB 3FKSA 1S1CA 1U98A 3BB1A 4IOMA 5BQ5A 4A0HA 3BWDD 1HT1E 4G01B 2OO7A 3ZS9A 2WJYA 3F0TA 3D31A 3TBKA 3GLGB 3G0HA 1E9DA 5E3HA 1L7VC 3I1FA 2V9PA 4M9ZA 4LJ5A 5AJZA 1VG1A 2C95A 3T5GA 2IL1A 4JSTA 1KI2A 3CF6R 3QUSA 3N70A 4P4TA 4TLEA 4I99A 1KGDA 4GDFA 3BGWA 2Z0MA 2QORA 3GLHB 3RLFA 4ZIRB 1PVOA 1KYIA 1OE0A 5CYOA 1SVWA 4Q7MB 4DB4A 2GXSA 2KE5A 2PJZA 2QTHA 2R6CA 1QDEA 2PH1A 3VNVA 1W49A 1RYFA 2F1RA 3FHCB 1TUIA 3RANA 4DDTA 3IEVA 5HKKD 1ANKA 2WWGA 4HEJA 4O2LA 4DLZA 2DWOA 2B7BA 4PO9A 3U7GA 3HP1A 3QOFA 1VIAA 4XSGA 4NYMR 4PHFA 2YHSA 4DKXA 3E1SA 1YR8A 1E2JA 3B1VA 3BB3A 3I92A 3LWNA 2O0JA 1E9AA 2JLQA 4IVQA 1NN5A 2HUPA 3REFA 3U7EB 1KI7A 3GLFA 3KJHA 4WBSA 3QNUA 2NPFA 3AUYA 3I72A 3B60A 3ICEA 5F9FA 2OEPA 3FFAA 2GDJA 1CIPA 2EWWA 5FTMA 4Q1FA 4UXIA 1NN1A 2JLSA 4KYIB 2CJWA 1DAKA 4KODA 1SVIA 1T3HA 1IJFA 2NOAA 2RGEA 4GOKA 4HAXA 3CUEF 5CIWA 4GNKA 1YZNA 2XGJA 2C77A 2F6RA 3PFIA 1XXHB 2VA8A 1D2EA 1A4RA 3AKCA 5FBQB 2GHIA 2J7PD 3GJ5A 4Q9HA 1G17A 5K8IA 1QF9A 1TF2A 1NVXQ 2WKRA 2FPLA 2WOJA 2X19A 1ZC3A 2WHXA 4DHEA 2FSIA 3C41J 1P2TA 3QY0A 4LC1A 3RWMB 1COWA 3IQXA 3IKJA 2FDCA 3W6NA 1GKIA 2CEAA 1QHNA 4A92A 2R62A 1LV7A 3FYHA 3LLUA 2HYDA 4Q02A 2J0UA 2HJVA 3V4RA 4HLQB 4JBXA 1SZPA 2QSZA 4BGDA 4URZR 4PC6A 1ZUIA 3EX7C 5HR5A 5FUXA 1VYUA 1XDBA 4C0AC 2IHBA 1EX6A 1E0JA 2OAQ1 3QXJA 2CXXA 1ZUHA 5LD2C 1DVRA 4NBSA 3X1YA 1QRAA 3L0OA 3PR1A 2IYVA 3PUYA 3ZVMA 2RAPA 4TMKA 3GJ4A 5LDDC 4A36A 1W7AA 3GPLA 4NMMA 4QL3A 3I5YA 4AKEA 1KY3A 4HATA 5JS7A 4WAUA 4B6FA 1CU1A 1IN7A 2ZRJA 3U60B 1LF0A 2EVWX 4HAWA 2O8DB 5H1YA 1F5NA 2ZJOA 3SN6A 4LBVA 3HPRA 5B2ZA 5DI3B 4QGGA 1G8PA 1CEEA 1HY3A 5FPSA 3SQXA 3K9NA 2B7CA 2Z4SA 3MG9A 5EZ6B 3EZ2A 4BPBA 4JLBA 2V54A 3CBQA 2H7VA 4Q4HB 1G18A 3RSOA 3NC0C 1NRJB 3HYTA 2ZI6A 1E2DA 1MO3A 1W36D 2X2EA 4URWR 2VPPA 1OSNA 4HLUC 1GSIA 1TQ2A 5KTYA 1RZ3A 4CT5A 2FX3A 4UNRA 1XU4A 3HR7A 3OEHA 2DB3A 2P67A 4AG5A 3N2IA 3JVUA 3IBYA 2IHYA 5JRJA 1M7BA 2P5TB 4JKYA 1ODFA 2BV3A 3PUWA 1OH8A 3RDPA 1X3SA 2C9CA 4IEEA 4PQRA 4TMTA 4Q9KA 3T61A 1P75A 3QE0A 3VU9A 3C16C 3I61A 3U5ZB 5HZKA 1VKJA 4C4PA 3O8RA 3B1ZA 4TT3A 4DEYA 1OKKA 4TZ6A 2ZRLA 4ZO4A 1RRPA 4NCJA 1GRRA 1E2GA 3LQRA 4Q1EA 4HAUA 2G6BA 1R6BX 1R4AA 3NHAA 2R6AA 3HWSA 4Q7LA 1EGAA 5TXGA 1YQTA 2B92A 5JSZA 1KHTA 1TL7C 3U6BA 4XIGS 3AKDA 1SVMA 1VG9B 3LH5A 4I1UA 1XEWY 3BB4A 3GLHE 5ELXA 1JJ7A 5LB2A 3GJ7A 3L0PA 3NVAA 4MYTA 3UATA 1HYQA 4LUCA 4NPHA 4EQ6A 2BM1A 1KO4A 1ZU4A 5JJLA 5J5CA 2KJQA 5GJBA 2QRNA 5DO9A 5FL3A 2ZE5A 3AH8A 3FB4A 5FH9A 3FWYA 4BRUA 1T5LA 5KOYA 1XFAA 2A3RA 1COWD 5IDVA 1J90A 3EWSA 3U3RA 1OFIA 4IHQA 2CDNA 2VF7A 4BLPA 2C99A 1N6OA 5GVSA 3D8BA 5G3YA 2AN9A 4US2R 4US1R 2XSZD 2J41A 4Q5IA 1V5WA 4B6EA 4B47A 4V0LA 2X8AA 3CF0A 2RGGA 2FPMA 2G83A 3F8TA 4XD7A 2HDNB 4JLMA 3RABA 1AJEA 3SHFA 1OJLA 1ELOA 2IYQA 3VNUA 3W34A 4Q00A 3CPEA 4BECA 4IVRA 2QY9A 1BIFA 2A5FA 4HZIA 4MA4A 3ZYCA 4G0NA 3J81k 3WNBA 2FE4A 4LJ7A 2GF9A 4DJTA 3HPQA 3LXRA 4OJKA 2P65A 2FJUA 4Z51A 1DAIA 2N1BA 4QFMA 4GSYA 1NMZA 4KU4A 4M22A 5DI9A 4PHHA 1E99A 5IT5A 5CB8A 3GLHA 3KQNA 2ZJ5A 3WBJA 5DE3A 3IIKA 3U3OA 3DM9B 3TAUA 2ODNA 1SKQA 4LC0A 3L43A 2HLDD 5E7IA 2IYYA 4RD3A 1G7SA 2BBTA 3AVYA 4KYUA 2IYWA 3AKYA 1ZJ6A 1FP7A 2VSFA 4D4JA 3B13B 4IFBA 1Z6YA 1G4AE 3THOA 4IRUB 4YLGA 3SJAA 4DLUA 1ZNWA 1M2OB 5JECA 3ZVRA 4HSEA 4Q48A 3WMEA 3EXAA 4ARZB 4GZMA 2Q9AA 4FI3C 4YONB 5FBRB 4LV8B 3MJHA 2ZTSA 2XXAB 1OHHA 1KI3A 4MYHA 3ZIAA 4KSBA 2GEUA 1XP8A 2ZRMA 3UKDA 1AQYA 5BN5A 4B76A 3AVWA 1ZVQA 3AF3A 2Y8EA 4I4LA 1N2CE 5FPKA 5L3VA 2ZYVX 1R0XA 1AS3A 1KDRA 3D7MA 1XTJA 2F9LA 1KO1A 3IQWA 4LBZA 4IKEA 5J4HA 4PAMA 3W6OA 3BAFA 4C0JA 2W0SA 4TT3D 2R6GA 2QM8A 4B2LA 1UAAA 2ODBA 2XOKA 2JASA 1GVNB 2QPTA 5JWOA 3AGQA 3EPKA 4Q18A 2VL7A 4MDFA 1Z6TA 2ZJYA 4H9GA 1JR3D 4A0RA 3SYKA 4RD2A 3ZZTA 2VLIA 2VHQA 4L15A 4X8OA 1TX4B 3JZAA 1DEKA 1E9CA 3TUIC 3SS8A 2JJ2A 3WHKA 2MSDB 1IHUA 4Q47A 4JL6A 1XD9A 1P4SA 4WW0A 5L3QA 4MRPA 2CNWA 1EESA 1IY2A 1WXQA 4JIMA 4II7A 3QXCA 2ZVPX 1UFQA 4LJ4A 5SZIA 1W47A 3K9HA 2C78A 5HTKA 2ZI9A 4MRSA 3V9PA 1O3YA 4IDHA 3EIQA 3IEUA 4FMBB 4HAYA 2ZUBA 1H8HD 1KO7A 2AKYA 2ZJBA 1S9HA 4PAQA 1W2GA 3CH4B 3B1WA 1WQ1R 4NL4H 4JLPA 1E1RA 4WIAA 5CJPA 1Q1QA 5IK2A 4DCVA 2R9VA 4DSTA 4Q66C 5EUQB 3OFNA 2GJ8A 4XD7D 2P2LA 2YWFA 4L5BA 4B32A 1BYIA 2CK3D 1D9XA 4Q1BA 2OHFA 2PBRA 4XWAA 3VTKA 3TK1A 4BFWA 3AP2A 2GJKA 1NJGA 3AV0B 2VYFA 4KITB 2RHMA 4BQSA 1DG1G 1SGWA 2O8DA 1G5RA 1Z83A 4Q01A 5B58C 3AP1A 1M1YE 5DI3A 3DDCA 1SXJC 1RJ9B 4LHZA 3PEUA 2C2HA 2D4HA 2BJWA 2EFHB 4KLZA 2GJSA 2AFIE 2FV8A 4PSKA 2YWGA 1NMXA 2JDIA 3Q5EA 2CLCX 3OEEA 1J7KA 5JHHB 2RKOA 1GM5A 3UWKA 4RFSB 4IDPA 2JLVA 5B64A 4MGZR 4E09A 4XWOA 2CHQA 4GMXA 3B8HA 3MGCA 4PPNA 2WWXA 3T15A 5M04A 2JA1A 1I4TD 1Y3AA 4ZDKA 4MYUA 1EG7A 3CPHA 4JVNA 5F2EA 4NKRA 2D74A 1TU4A 2WJHA 1UBEA 5FPHA 4BLQA 3V00A 4B43A 4CT4B 2ZE8A 3KKPA 5C4GB 1MV5A 4NCHA 2H17A 2YC4C 5ANRB 2GNOA 4D80A 2QA5A 1N0WA 1US8A 2WIAA 4HI0E 5L8VA 4HZUA 3LW8A 1OHHD 3Q5DA 5FTJA 1G64A 3GEEA 4MGKR 3ZIAD 5AUOB 1ESMA 1F2UB 1F2TB 1RVDA 2GVZC 4BASA 1CKEA 1G20E 4C7OB 4FMCB 5FL7D 3ICQB 3RS4A 2RGAA 3ADKA 2JATA 4A15A 2J0QA 2NG1A 4Q03A 4YDHB 1FL9A 3ZLJA 4QHYA 4TQ9A 1XPOA 1B0UA 2JJ8A 3QVUA 1G7CA 3B78A 3PIRA 3C15C 2XOKD 4HAZA 1KAGA 4EFLA 2Q3FA 3ADBA 1UKEA 4YMWA 2IUUA 2PZGA 3TUZC 3MWLA 4TWZA 1KDOA 2PEZA 5KPJA 2ZRPA 2ZREA 1E2FA 3OAAD 4P3YA 4EJSB 1GUAA 4LYJA 3FPAA 4DSNA 4PANA 1Q1BA 1U9IC 4MQBA 1KJYA 3O8BA 4MYCA 2XX3A 5KDDA 5EUMA 3NHBA 3IGFA 2OBMA 2OCYC 5BYJA 5CITA 1MO4A 4IOJA 3W8NA 5KPDA 4KFSA 4PPGA 4Q1CA 3DEFA 3A1TA 4RCYA 4XH9B 3LLMA 4S35A 1SQ5A 2EFCB 2GK7A 5C4MA 3B85A 4S2EA 3MAAC 2C9YA 2XITA 4M1WA 4TLAA 1VHLA 3VR4A 2ODWA 2ZSFA 1G3UA 2ZE6A 5CYPA 1XZQA 3C8UA 4DDUA 3EPJA 2HCBA 2VP2A 4BZPA 3CNNA 1FUKA 5EE3A 1D6JA 4B71A 3QIAA 4KJZA 4X8MA 1P60A 5IK2D 1BYUA 3SYNA 3R8CA 1PLKA 4P33A 5C46F 3QKUA 1M7GA 3DZDA 2BMEA 1P9NA 2QL6A 1YE8A 3EZ6A 1FMLA 4HLDA 3BK7A 4JJKA 3CZPA 3KQKA 3R7WA 5EE9A 4CDGA 2WWIA 3CNOA 4KO8A 4LBYA 3AVPA 3QEJA 2BMFA 1F60A 3NH6A 1N3BA 2CE2X 2GCPA 1HURA 3AF4A 4LX0A 5AWFC 5JI2E 2ZYUX 4JMPA 1UBCA 2FSGA 3K09A 3QG5A 1NKTA 1E96A 1DAHA 3OIVA 1X8JA 2QAGA 3A36A 3EAQA 4C0QC 3IO3A 2BCGY 2JJ1A 1VYTA 1Z63A 3OEED 4IVPA 4DLVA 2B21A 3A1UA 3IIJA 1XBTA 1ETUA 3RS5A 3NIBA 4OL0A 1E9EA 4FCVA 1JECA 1MO5A 2WKQA 4YQFA 5EE0A 4QKQA 1NSTA 4UNSA 2W00A 4O25A 4QHSA 1VTKA 4DIEA 4TSFD 1U0LA 2IA5A 1T5IA 2XTZA 5CK5A 1ZNZA 4NCKA 4JSYA 1Q21A 2IX3A 2XXAA 1T8UA 1QVRA 2WAYA 2OAP1 1IONA 1KMHB 1Q0UA 1W5TA 2H1LA 1SHZA 2IF0A 3LV8A 4D4LA 1F48A 4X8HA 4TYYA 1JXMA 4EFMA 3PCRB 3PQCA 1IQPA 4OK6A 1R0ZA 2WSSA 3M4YA 4I1SA 1UM8A 4TL8A 1E9FA 4FCTA 2UZIR 2WICA 3BJIC 5JJIA 4HB0A 1NI3A 4RJLA 3SDZA 2D3WA 4XSHA 4YMTA 4ILEA 3KFXA 4TYNA 2LCFA 3EW9A 3K0AA 1LFDB 2GJAA 3QVVA 3ADCA 1LW7A 5L3SB 4M0LA 4DDVA 1XTQA 5IRCD 4KFTA 2ZVQX 1P2UA 2Z4RA 3DVLA 2Q9CA 3KJGA 2IUTA 4JS0A 2X77A 3KJEA 2EW1A 2YNMA 1XD2A 1KI4A 1OYYA 1G8FA 3OZXA 5JWRA 3NBZC 5FBLB 1NY6A 2AWOA 4Q9LA 2VEDA 1S2MA 1LNZA 4PC3A 4W5HA 3REGA 3CX6A 4B75A 5KUTA 1FX0A 4M1KA 4FCWA 3DOFA 3Q85A 4C0SA 2GXAA 1K6MA 4V0NA 2XNDD 5LB4A 1E6CA 1OYWA 4M1SA 1YZQA 2OBNA 3X2SA 3C7KA 1ZU5A 3K0CA 5BYKA 1KZ7B 3BH0A 1I2MA 1HTWA 1NF3A 2GESA 2P3SA 1ZAKA 1T3LA 2AX4A 4D4MA 4F4JA 2HEIA 4OHZA 3D3QA 2VP6A 3QPVA 2A5YB 3RS7A 1YHNA 3FFBA 3MCAA 4PPFA 4RD1A 4BLTA 3E5HA 4OHVA 2W2VA 1CULC 4KI0A 1OIVA 3LX5A 5E95A 1ZM2A 3GQBA 1G21E 1F3OA 1SKYB 5H8WA 3K0SA 2QT1A 4PZLA 2OXRA 3DZ8A 1LS6A 1BO6A 1P7CA 3FHOA 1RJ9A 4DVGA 2NO6A 2DFKB 1FZQA 1XMIA 2HV8A 2OUKA 3K0FB 4JLDA 4QM6A 5F98A 2FN4A 1CBUA 1CR1A 1NLZA 2ZRNA 2JIZA 2JEOA 1TTTA 1NVVR 2IWRA 3QKTA 3TR0A 1VCMA 2ZAOA 4RFSA 4CF7A 1IXRC 4XTCS 1S96A 3U6KA 2QUZA 1T8TA 1UEIA 3S1AA 1S3SA 1L4YA 1KMQA 4HB4A 1XF9A 1JQJC 2RB4A 3JVVA 1VYVA 2EFEB 4C0LA 3EC1A 4YMSA 2BM0A 3WY9A 1S4QA 4D2IA 4D0NA 2GAAA 4ZKEA 1WBDA 3EZFA 3HU3A 1BMFD 1J8MF 2OFWA 1OB5A 5G41A 1XNJA 2ERXA 1F2TA 3P20A 4KAXA 4DSOA 4QGHA 2GBLC 4C7OA 4KVAA 4B48A 5SZJA 2GBLA 3EIHA 3UXMA 4EUNA 4PQFA 2R65A 2WSSD 4LY6A 2F7SA 3UANA 1II8B 1R2QA 1XPRA 5TV2A 2VBCA 1N5JA 2FGKA 3SC3A 5GADl 1NBMD 2KBFA 3RAPR 2C04A 1E4VA 2ECKA 4QNMA 1D2MA 3ZJYA 3MRSA 3TSWA 1U94A 1YRBA 4TL9A 2F43B 1OPXA 4RZXA 4A0GA 3Q72A 3DO6A 1D8TA 4PX9A 5HCNA 5KSYA 2OFOA 4EJSC 2VP5A 5AUQA 2VHJA 4EPTA 2W6JD 1R5OA 2V7QA 2XEXA 3OF5A 2YWHA 3RWOA 3B5JA 2VHTA 1U90A 4JVLA 5JWHA 4ERNA 5IF9A 3I5XA 1GKYA 4PXAA 5TARA 1RIFA 2PMDA 4B44A 4K81B 4AKHA 2HCJB 4G5GA 1PUIA 5BXQC 2BJVA 2BKUA 4JL5A 1U99A 2ORWA 4LK2A 1ZINA 1ZCBA 1A2KC 1P62B 3WRYC 4QNRA 4EPXA 1EFUA 1OXXK 2NIPA 3K8YA 4MH0R 4G5RA 4YDSA 5JHGB 3CH5A 3CX8A 3UWOA 1XJQA 4BFSA 3V4FA 5FOVA 3DMNA 1TAGA 4TYQA 4LJ6A 4OQNA 4I1OA 1IN5A 3LX8A 4NDZA 1E2IA 4LPSA 1R0WA 1NLFA 1MR3F 4B73A 2GWHA 4F93B 4TL7A 2KB0A 5KU1A 2RCNA 3QQ5A 5CIQA 3EZ7A 1UBFA 3FKSD 1VCNA 1KKLA 2MSEB 3CWZA 4OJQA 4LSGA 3W3ZB 3T12A 2ZM5A 1XZPA 2CHVA 3GJXC 3P4XA 3CRRA 3U4QA 1KK0A 5FUVA 1NSFA 1Z0JA 2BBWA 4ITRC 4DLYA 3TW8B 4PTLA 2ZYTX 4YC7A 1MO6A 2DBYA 4M9SA 2ZRCA 4NYJR 5J4YA 3LBIA 1H8EA 1MABB 1TQ6A 1OIXA 5DISB 3LBHA 1SXJB 1KDPA 2BHRA 2FEOA 3ZQJA 4BFYA 4EDHA 2AFHE 4JKIA 3PITA 4G1UC 2I1QA 4YMUA 2O8CA 4R9UC 3EZ9A 4UJ3A 3K0EA 2ZRHA 4AURA 2HXSA 4IDNA 1DPFA 5EP2A 1Q3TA 2XB2A 1TQ4A 4TTQA 2VP9A 4EPWA 2FFBA 1D5CA 1XMSA 1NN0A 2A78A 2QMUA 3A1VA 2ZROA 4HLUA 1XMJA 5D3MB 1P5ZB 4MGYR 2QMEA 3SEAA 2W6IA 3VMFA 4Q4JB 1G8GA 4A9AA 2P5SA 4JVSB 5FOUA 3TNFA 4U00A 4U7DA 1OH5A 2YOHA 2PZFA 4NYIR 4MKGA 4FXPA 1G8HA 1K5DA 2PLFA 2HT6A 3PXGA 4I1VA 3NXSA 4FIDA 4PFSA 5EP3A 1XEXA 4P0TA 3ZH9B 4BZXA 1WCV1 2F1IA 2PCLA 1NVUQ 5CLLA 2O8BB 4URVR 2ZE7A 2MMCA 3ZD7A 1ZCAA 3KZ1E 1P61B 2BOVA 2D2FA 4M53A 3UK6A 4RFVA 3GLGE 1WRBA 1E2MA 1VPLA 1KI8A 2FF7A 3GMTA 4DLXA 3WYAA 1GKUB 1Q12A 2GJ9A 1G3MA 1BKDR 2ZJAA 2W2TA 2V6IA 3KKOA 3KXKA 5L3SA 1VG8A 1DBSA 3IDQA 4KVGA 3TE6A 2HJGA 3I32A 4RZUA 1R8SA 2H18A 1BOFA 2QT0A 4POAA 5EXPA 2JLRA 1KI6A 2EQBA 2ZRBA 2CHGA 3RRZA 2DFLA 1ZNXA 1MRSA 1EFRA 1UDXA 1IN4A 3FMPB 4AYTA 2JLUA 2REBA 3LVRE 2GILA 2Q6TA 421PA 1QG4A 1S3GA 2VSXA 1NP6A 4GT1A 3ZQ6A 2CCKA 3AVQA 3RNLA 1Z2AA 4BLSA 5HCIA 2ZUCA 2AL7A 4CEHB 2EFGA 5BWMA 4QM7A 4OQLA 4QJ5A 3K1JA 2DWQA 3QBVA 2VIIA 1DAGA 3THWA 3AF0A 4EPYA 3BS4A 4FINA 4LHYA 1G6HA 2J87A 1LS1A 3HU2A 3GLIB 4OQMA 3W8RA 1AIPA 3W5JA 3GFTA 3BXZA 1OT3A 1Z08A 4WZBE 2ONKA 4M9XA 2NO7A 4JLKA 2AKAB 2QROA 3T1VA 5SZHB 4TL6A 2FNAA 2E9SA 4FN5A 2WPDA 1C9KA 4OYHA 1HV8A 1FNNA 5EQTA 1W0KA 2YV5A 2ZI4A 4MUBA 1E79A 2GRJA 3LXXA 5FR2A 2O52A 3GLGA 4BRWA 2LKDA 2BEJA 2C5LA 4KFUA 2D7DA 2PEYA 1E2PA 3PVSA 3K70B 4PC7A 4G5OA 5CLQA 2YINC 3AEZA 4IDQA 1FOEB 1G19A 1XXHE 4ZDWA 1Z5ZA 4HB2A 1GAJA 4M1TA 4EPVA 2JLZA 1H8ED 4ZIRA 3ETLA 4QXAA 1E94E 3BBPA 5GJWC 2J5XA 1NL3A 1FTNA 1VDZA 1P6XA 1FP6A 4PSAA 4AD8A 3THXB 1J99A 3BE4A 2ZSDA 2ZPTX 1KO5A 4K8OA 2IWHA 2WM9B 4LHWA 1II9A 1GNPA 3A4MA 2J3EA 3RVBA 4GBMA 2QP9X 1EK0A 5DHAA 1UKVY 1WA5A 2GXUA 1G9XA 1Z6XA 3Q8XB 2ZRAA 4FD2A 2XB4A 5DN6A 4JLVA 5TVKA 2VP0A 2ZIAA 4ZDIA 1G5PA 3CNLA 3CX7A 4DB2A 3OEHD 3MMPA 2QPOA 2GA8A 3THYB 2BVNA 3EG5A 1AKYA 4EPRA 4OBEA 3BERA 3L0IB 4PC1A 4Q7JB 4IEIA 1GL9B 2J9RA 2DWPA 1S1MA 5HE8A 5DYIA 2IS1A 2WMOB 4JBWA 5G40A 2O5VA 2K5UA 4JLNA 5EZ5A 4DBLC 4A2WA 4HLCA 4L9WA 2Z5FA 2QZ4A 2ZR9A 3AP3A 4PR0A 1FQKA 1OKKD 3LD9A 4JYCA 1N0UA 1XTKA 1HUQA 3PEWA 3EARA 3B2EA 4CRWB 4TYPA 3FGNA 1Z6GA 2GVDC 1KOFA 1N5KA 2QEQA 1FTSA 1XEFA 4RZ3A 3R9IA 3KTAB 3U3KA 1XXHA 4M9QA 5A5GA 2PX3A 4DWJA 2ZRDA 5DYGA 3ASZA 4DSUA 1SXJE 4BZQA 5KYKA 3KKMA 2FOLA 2R2AA 5BN3A 3R8FA 1XTSA 4B74A 1W4AA 4ZCIA 4NP6A 3SFVA 1EFRD 4PC2A 4DT1B 4IDOA 2W83A 1A5TA 3B6EA 3Q7QA 1T6NA 1AK2A 3MWYW 5JJKA 2FWRA 5EXTA 4ZCLA 1IY1A 4LHVA 2XAUA 1GL7A 2R8RA 4JYBA 1QHGA 4Z8YA 3PV0A 2QTFA 4B3FX 3ADDA 1M7HA 2AXNA 4ESVA 3GEIA 5G3ZA 4E22A 3OIWA 1G291 4LHXA 1UBGA 5KDLA 4C2UA 4GP7A 5FOWA 2WJVA 1P9RA 1R5NA 3AGPA 3SJBA 4AYWA 2WPDD 4LBWA 3TW4A 5FPYA 1AQUA 4Q1AA 5TB5A 1W0KD 1E79D 2CVFA 1E9BA 3FOZA 2O8EB 4WZ6A 3PENA 2OG2A 3CONA 1G16A 2G0TA 1KK1A 3Q3JB 4WXRA 5DH9A 4X8LA 721PA 1MRNA 1R5BA 4LV6A 3SI7A 1WE2A 4BUJA 2VQSA 1SXJA 3BFVA 2WWWA 1PUJA 1L4UA 3QKRB 1SVKA 5BN4A 3PG5A 5KNBA 1Z6AA 4MITA 2W0MA 1UF9A 4NYMQ 4O3MA 3DKPA 4ZI2A 1IAQA 4OI4A 1AN0A 2FZ4A 5FOSA 4EAQA 5A4JA 4YXWA 4Q4HA 4TQUS 3FMFA 4C2TA 4CZ2A 1ZM9A 5EXXA 1OFUX 2XTMA 3CR8A 4JT4A 4RY2A 3A1SA 2HF9A 2EYUA 5JCPA 1W5SA 1YKSA 4UNNA 4OHXA 5E4FA 4Q4JA 2ZR0A 1Z8FA 2FA9A 4URUR 4JLJA 2CCJA 4QBIA 1KI1A 1ZIOA 2HXYA 2REXB 5DN6D 3MJRA 4HDCA 3TVTA 1I2DA 4C9BA 1AKEA 2H8KA 2C98A 3HYRA 3NBFA 2A7QA 3ND9A 3AVOA 3R9WA 4GP6A 3PUVA 4GRAA 1JPNA 4TLDA 3CWQA 4WXPA 4URXR 1W36B 4D26A 3GJ8A 1PLJA 1ZD1A 4ACBA 1YZGA 3PUXA 3CR7A 5FI0B 1A1VA 2ZI7A 3H86A 3EA0A 3CRW1 2IXGA 3UPUA 4U02A 4V03A 1N5LA 1EXMA 3EA5A 4PPQA 3EPHA 3WYGA 1SVOA 2O8FB 3W9YA 2R6DA 1Z3IX 3KXIA 1CR0A 3VHXA 5KSZA 2XJ4A 4G5QA 5FOXA 4PQYA 2AD1A 5AJYA 1E2KA 2QTVB 5FTLA 4JVMA 1KDTA 3GLFB 1Z0FA 5D3QA 1VG0B 3LQQA 5JLJA 1E98A 2D2EA 3SJCA 4QHTA 2JJ2D 3TVDA 3QENA 2ZXUA 4XVUA 3A58B 5AR1A 5EXSA 2QBYB 4GMDA 1U9IA 3U44B 2CJWB 2CNWD 2OESA 3GFPA 4Q9JA 3TQCA 3SOPA 4OKSA 5CB6A 3B1YA 2PX0A 1KKMA 2X1VA 3BORA 4EIWA 3IO5A 4BFXA 1EWQA 4W5JA 2HF8A 4V0KA 4NYJQ 3W5IA 2H92A 3NH9A 4M21A 1HT2E 1U2RA 1AA9A 2PJRA 4BFZA 4KBGA 3O8DA 2GEDA 3SYLA 1Q20A 4CEJB 1E1RD 4RVCA 4DDWA 1GFIA 2QQ0A 3TMKA 2RGCA 2SHKA 5IHPA 1SVSA 3OFND 3BOSA 1BH2A 1KSGA 1DARA 2YWEA 4ABYA 2ZJ8A 3ZZ0A 5KSOA 4RZ2A 3WXMA 1KAOA 3K70C 1QHIA 3SZRA 2J0UB 2P6NA 4XWKA 2OLJA 4M4SA 1WBBA 1EFTA 1G6OA 1U8ZA 2GCOB 2ASEA 2GF0A 2FFHA 1VHTA 1TNDA 3X1DA 1GZSA 5TDHA 3QBTA 2WOOA 1Z0AA 5H70A 1DAEA 1S8FA 3MFYA 2PZEA 2V4ZA 1CTQA 4Q7KA 3QXHA 4W9MC 4MRNA 2FGJA 2ZI5A 2JDID 5JEDA 3MLEA 1CJUC 3RS2A 4QBGB 1TEVA 2A2ZA 2BMJA 5CK4A 3B9PA 4YXWD 4LJAA 4AKGA 2IYSA 1E3MA 4QG7A 1NY5A 1G5TA 4CW7A 3I3SR 1OXTA 1JEDA 1XEWX 4WZAE 1KI9A 4ARZA 4E5UA 4A82A 3U7FB 3U3MA 2BMDA 5EP1A 3SBEA 4YMVA 4ZKDA 4B33A 1UADA 1DG3A 2YC2C 1GP2A 2PL3A 1SULA 3ZZUA 2B6HA 2N46A 2ZS7A 4Y0AA 521PA 1KK2A 4KHZA 4M2LA 1FMJA 3T34A 4P4SB 5JEEA 4KCGA 5AJWA 3VR2A 4DC9A 2WWFA 1YR9A 4DUGA 2JLYA 2NO1A 2B8WA 5FBWB 2QP4A 2AXPA 1XWIA 4TMZA 1JI0A 2LKCA 3I73A 1J2JA 2FZLA 2G77B 1OV4A 5LBIA 4KSCA 3HJNA 2OLKA 2GZDA 3C5CA 1NG1A 4IXNA 4LDJA 1GTVA 1ZRHA 2QRZA 3CO5A 2D62A 3NKVA 3O8CA 2JAQA 1U81A 1QHYA 1W46A 4D25A 1ZM3A 3VU9B 1EFCA 4PHTA 1MT0A 2HT1A 3B82A 4FMDB 1GNQA 1KY2A 3VX3A 5C1BA 3EWAA 4PHGA 3RSLA 1ZM4A 3GD7A 4EFNA 1OXSC 3X1WA 4HUTA 4FWIB 4JBYA 621PA 1RRCA 2FG5A 5JS8A 4GL2A 2CLSA 4M1MA 2WWHA 5FPTA 2ORIA 1KNQA 2FSFA 5AUNB 1XTIA 2C8VA 2CMKA 4NH0A 5JSZB 1H65A 4W5WA 4L8GA 2J1LA 2V55B 4XTRA 1LTQA 3KKNA 3TJZA 4MGIR 1XD8A 1N6NA 4O2RA 1YR6A 1X1SA 2AR7A 4E03A 1T9HA 3TIFA 4EQ6B 1QHHB 5B30A 2WKPA 1IN6A 2RGNC 2Z6VA 4QJ3A 3IBGA 1NLYA 1GRQA 3QEOA 2RGNA 2IS2A 1XJ0A 1T0JB 4IFEA 3GJ3A 3KUCA 2IXFA 3RRMA 1YU9A 3CB4A 3DOEA 5FUWA 3NDBB 1OXUA 3NWJA 4HYYA 1NIPA 4TMXA 2RMKA 3FHTA 4P32A 2ZR7A 5DGXA 2A5JA 4LWZA 4B3GA 1E2EA 1YRAA 3A4LA 5E7MA 1UPTA 3UMSA 1IOZA 1TU3A 2FEMA 2QN6A 2ZRIA 3QKRA 1K8RA 1RC8A 2RHDA 4KLNA 2OCAA 3UMRA 3DPUA 121PA 3D6TB 4AI6A 1N0VC 3ZVNA 1CS4C 4Q4LA 1HE1C 2FPKA 2N42A 4LOAA 4QRHA 4IW3B 3TAHA 2JJ1D 1CJKC 1Z2CA 3IHLA 1N6LA 1QHXA 3A6PC 3M1IA 4MKHA 1EWRA 3HU1A 4BFVA 3KUDA 1X6VA 2EWVA 1CF4A 1CLUA 2ZITA 1W4BA 1KJWA 2IS6A 1FFHA 1P2VA 1NN3A 1PLLA 2BBOA 3QXSA 1TF7A 1FNMA 1EFHA 2LWIA 4P31A 4AG6A 1Y63A 3O47A 3QPWA 2H5EA 1LF5A 3M0EA 1U8YA 2X2FA 3FMOB 4B3CA 4BE7B 2NGRA 4B34A 1F2UA 1QHSA 2WJJA 1C4OA 2IXEA 3CM0A 1W36C 5F3WB 4RCZA 4F4IA 3DKVA 3NDPA 2IYLD 1KSHA 4A6XA 3ZDQA 3VKGA 1HH4A 5J4VA 2F1HA 3TUJC 1U8AA 4DUGD 4V02A 2IYRA 1N25A 2EFDB 5C18A 1OFHA 1SVLA 1IBRA 2REOA 3WMFA 3BFKA 1VIYA 5KNCA 5KNDA 1ESNA 1JPJA 2R6FA 2YYZA 2O8FA 3KL4A 1ZIPA 3EPLA 2QENA 2DCUA 4OI0A 1KNXA 1ZBDA 2CL7X 2ATXA 2QGZA 2JLWA 4NCIA 5GJVC 4IOKA 4EJSA 2P6RA 5CM8B 4AY2A 3RC3A 3L2OB 4DCUA 2GEVA 1VECA 4LGMA 2EYQA 2CLDX 3PEVA 2WAXA 4L9SA 2QBYA 1DS6A 1A82A 1S0UA 4TN1A 3U44A 2YKGA 5K8LA 1OH6A 1K5GA 4A8JB 4C30A 3MUFA 4HUQB 1XRJA 1P3JA 4NE2A 5E7JA 3FE2A 4TQAA 4D4KA 3HDTA 1KO8A 3RS3A 2G1KA 4QBFA 3R9XA 1M8PA 2RGXA 3G5UA 4LYAA 3TRFA 1GILA 3QF4B 2NQ2C 3X1ZA 4TLBA 3A37A 2A30A 2OT3B 3MD0A 4H1UA 4UQOA 4BLOA 3GP8A 4CEJA 4UNQA 2GZHA 3LRPA 1TUEA 5J4KA 3KJIA 1Q44A 5L3QB 4JT2A 4AYXA 2IK8A 2OFXA 2WJGA 4KFRA 3SBDA 3SE0A 2V8OA 4NONA 1OB2A 4DLTA 4UNPA 3U61B 3CW2A 1AS0A 3EASA 3FKQA 4IOLA 4V0OA 3CLVA 4RSGA 2ZS8A 4XVQA 4PO1A 4N3NA 2XSZA 4N1AA 1P73A 4NU0A 2GCOA 3F5FA 2WZQA 2O0KA 5F9HA 1Q3HA 3PEYA 1G7RA 1YZLA 3KX2A 3WNCA 3WRXC 1KSFX 1TEXA 3F3YA 2J46A 1JJVA 2DY1A 3CF2A 1GDDA 4RD0A 2ZU6A 2MMGA 3IHWA 5G53C 4AKIA 2DR3A 1LVGA 1CR2A 1VCOA 1W4RA 2JIZD 1OXVA 2BKEA 2ZRGA 2KSQA 1CJVC 2BC9A 4A2QA 1T4GA 2Q21A 4PO8A 4K46A 2UZ3A 2ZI3A 5J47A 4E07A 4FWTA 1RYHA 2I4IA 5FOTA 5CDFE 1JR3E 2CVHA 2DHRA 3M6AA 1Z0IA 3WYFA 4ZI3A 1NMYA 5HZHA 4QC2A 4QOSA 2VSOA 2VO1A 2HLDA 2FMXA 3WHLA 1YR7A 3DMDA 1KMHA 4TZ0A 1Z07A 4GZLA 3LO5A 4DZZA 3FMIA 2GZAA 1JBKA 1N5IA 4LZZA 4P4SA 5DIFA 4LCBA 3AM1A 2F9MA 3HR8A 1KIMA 3VKHA 2WMNB 3VHLB 2FH5B 4B2IA 3Q7PA 3KB1A 2ZUDA 5CM9C 1ZM7A 4XJXA 3CPJB 3OE7A 1V43A 5FBVB 4HAVA 2KI5A 1E2NA 2ODEA 1GL6A 2QQEA 4LV5B 3TR5A 1SKYE 1OFTA 4N0EA 5FI1B 1CRQA 1J8YF 2NZ8A 2G9NA 1RPZA 1IXSB 3L8YA 2TMKA 2V1UA 4GPTA 4H1VA 2PCJA 2NO9A 3CKLA 4D82A 1ZD9A 1US8B 1N6KA 2JGNA 3AKEA 3IIMA 4HZUB 6Q21A 1Z29A 2DPXA 3IUYA 4Z8XA 1A2BA 2CL0X 2IT1A 2VP4A 3VFDA 2WTUA 1GNRA 1MH1A 2FU5C 2IUSA 3NC1C 3IILA 2KWIA 1T0HB 1IM2A 4CIDA 4LJ8A 2V7QD 3H1TA 3U2QA 2C9OA 1TQDA 4BFTA 2GTPA 2OM2A 3AUXA 2BDTA 4UXJA 1YZUA 5DSZA 4HB3A 1HA3A 2WWYA 5CDFA 1JALA 4HDQB 1JR3A 3OHMA 3WNDA 4CEIB 2Q3HA 5AK0A 1UEJA 2NO0A 2OCPA 3G82C 3T35A 3SQWA 1GITA 1IY0A 2G1JA 4AC9A 2ZEJA 4B3BA 3H4MA 1FUUA 1G4UR 2FFAA 2YOFA 3A1WA
chains in the Genus database with same CATH superfamily
2EKLA 4WQMA 1HE8B 3MB8A 4Q3DA 1QHHA 2RGBA 1TK3A 3EXEA 3UKOA 3TCNA 1QGYA 3FVQA 1O6BA 2OSBA 4FW8A 1HEIA 2ETVA 3WBKA 2XCSB 3ZU5A 3ENQA 3CJQA 3JSAA 5JJBA 1NPTO 4KG7A 3QE4A 1XX6A 4IY1A 4MEJA 2W70A 2P30A 5LQNA 5CPBA 5G4KA 1Q1NA 3RFUA 3WWYA 2AD5A 2H0RA 1Q2UA 2WNSA 1YR2A 3Q7EA 4FW9A 3HUFA 1H0SA 3QKSB 1S2IA 4YRRA 4BNHA 5KB3A 1OI2A 2PAFA 5FFNA 1TVEA 4C0KA 6CHYA 4KN9S 2WC1A 1U2GA 2DFVA 2G5GX 2LGJA 4AY5A 1WB9A 1XK7A 3I23A 4NZPA 5JSKA 2J30A 1YDHA 2L82A 2PDAA 3O4FA 4UOQA 3C3KA 5D84A 4ZJYA 4F91B 1Q1EA 2VOEA 2XT0A 4JC5A 1JX6A 3SMVA 4UAVA 4GM4A 3NTLA 2YZ2A 4CU2A 3R44A 2O6HA 3NBKA 4LDQA 5JW6A 1I4DD 2YMQA 4R5MA 5B12A 3WLMA 2ZIUB 3K7EA 2BM8A 1MDBA 2J3IA 4W7SA 1YK0A 5FTWA 2PBZA 3M5WA 3AUAA 5KTPA 5K8UA 2MCFA 1XU9A 1DIRA 2H16A 2HEGA 2EZ4A 2MSCB 2XGSA 3LQFA 4ACAA 4C5CA 2QXTA 2R6HA 3NCHA 4LVCA 4MULA 5L3RA 2E5WA 4P6VF 1WDMA 3KB6A 5EHZA 1P2SA 3TWOA 1TPZA 3DHWC 3UH0A 4GBED 1TADA 1FDOA 5B7NA 2IPAB 1ZA2A 2IOFA 2OBLA 4BNDA 4D0LB 2V7WA 1ABEA 3GYGA 2QP3A 1YZTA 3A8TA 3VR1A 2QAGB 3L49A 1RI2A 1KYQA 2Z08A 1L4HA 5K0ZA 3FYUC 4XVHA 3VH2A 2HNBA 3LJKA 2H7YA 1EFLA 4GI7A 4HDOB 5DM2A 2EG5A 5KO2A 4IEFB 1HETA 3C5HA 4DCTA 2FPPB 5CFZA 3THRA 2XCOA 4PG6A 1JAHA 2VXOA 3OT1A 4QEKA 3F98A 4PGMA 4UHFA 5HRUA 1H23A 3ESXA 2J0VA 5T3UA 4EG5A 2QTAA 3SGLA 4Y8VA 3PLRA 3OE7D 3AERB 4EZEA 1WF3A 2AMLA 1M2JA 4UPVA 1GXSA 1ZOSA 5JVDF 1VJTA 2EJCA 3PXUA 4GX2A 1NUHA 3ZWKA 4TLMB 5C8YA 1C8BA 3OMWA 4BO7A 2F3RA 3Q15C 4KC0A 1Z9BA 1E0KA 1JIIA 1N1EA 1WZUA 5HZMA 3T5AA 3GRZA 1W8IA 2XYVA 4PYQA 2RG7A 3VPHA 1JHQA 2ZIVB 4J9UE 3QOXA 1PYDA 3EFOB 4Z9BA 2VHUA 4MI3A 1YS7A 1X7ZA 3QE3A 4MO9A 4ZP1A 2BUBA 2J59A 2IBMA 3H0KA 4BVEA 1I3LA 3VR4H 4MV5A 3LHSA 2IIPA 4WKNA 4D0SA 2IYUA 3OPVA 4PZYA 4R6WA 4V2IA 1V4NA 2Q3DA 4A8JC 4EKNB 1NF2A 4HNVA 1LB1B 3PR2B 5JFTA 4H3HB 1M6NA 5LBUA 5C1OA 2MHCA 3SWWA 3K0AB 4K7JA 3BMNB 5ALFA 2RK6A 3MPUA 5DBGA 1UJ6A 3KSUA 1JB1A 1OWPA 1IU9A 5AM5A 3G2IA 1ZXBA 2WSBA 2A92A 3CR3C 2A5DA 3OIYA 1XMVA 1LKZA 1WP9A 5EEHA 2R0QC 2QE6A 3SFZA 4ZPXA 4XQCA 2Z6UA 3V2HA 3T1OA 2IEYA 4FCCA 1M0SA 2XDQB 5G0TA 5C2JB 1PFVA 1UXGA 1W0JD 3C24A 4K1XA 4PV7A 5HFNA 1Q57A 1YJ5A 3HL0A 3SIPA 2YTZA 3HKBB 1JDBC 4HF7A 1NLUA 2ZJ2A 2D59A 4R9SA 3RRYA 1FTYA 1PWHA 3GDFA 4YT8A 4E4YA 3GGJA 4WCFA 3L05A 2Q9BA 3UEOA 3K32A 4YYZA 2H57A 5ALUA 3JZDA 2GM9A 2PYIA 1Y1PA 1QVAA 1DOZA 1SU7A 1CUIA 2AWNA 1KYVA 2BZ1A 3I8XA 4XVRA 3T5DA 1S2NA 4L6IA 5LBTA 1F8GA 4JSRA 4K26A 1FFWA 3RSFA 4RHYA 3OPYA 4KGDA 1FB5A 1VMEA 3WGKA 3CRQA 3ZHZA 1QGZA 3IQEA 1VBMA 3UJPA 3VO1A 4UJ5A 3ACBA 5AW3A 1MAHA 1CF9A 2O6LA 4DREA 2CLEB 1WO8A 5KTNA 3TSZA 3R6GA 3IKTA 2MT9A 1IBKB 3CISA 3G1UA 1PJCA 2QZ9A 4H59A 2VYNA 4YALA 1NOJA 1PL7A 5C35A 5JBQA 3KHSA 2HX1A 2HYIC 5JFGA 3R4CA 3EDRA 1BS1A 2EL7A 4MR8B 3W2TA 4ARVA 2CWWA 2QTWB 2OP1A 2XTNA 2I2FA 2X2OA 4DLRA 1YHYA 3ASYA 3LUCA 2IVFA 1UXJA 4HFRA 1WB5A 2V7TA 1WVMA 4KXUA 7ADHA 1BCRB 1U4NA 1JMYA 4F8EA 4AN1A 1R0KA 4JEMA 2GK6A 1BX0A 2H2DA 2AG5A 4IM7A 4ROSA 3TH5A 3ZS8A 4Q82A 5LMNB 4KZPA 1J9GA 2ZSEA 2XDAA 4D44A 1SCUB 2IFTA 4IIXA 5FWXB 5JV5A 1YUNA 1OXMA 3P97A 3Q7SA 2IP1A 4BMYA 1P72A 4IJMA 1TUBA 1QBKC 2FMHA 1RQLA 4O3FA 2P68A 2YVUA 4HNGA 1VHWA 3KO8A 4EG1A 2AMVA 4KNVA 2AK3A 2VC2B 1Y8QA 3Q87B 4XOIA 2DUUA 1SOWA 3AJ9A 3NVKI 5HPYB 3CVYA 1V96A 2C3UA 3H7IA 1P4HA 1S3FA 3FXAA 3VSEA 2O8BA 1P8JA 2AE2A 1XCGB 4LI0A 1GZVA 4AKTA 4BFCA 3Q1KA 1AHPA 4MS4B 4UXHA 3BG5A 5CT9A 4K3UA 1WZIA 2EF1A 2IVZA 1Q0SA 1E20A 1VHDA 3F5MA 4R2HA 4TTRA 3ZQ6A 3ILVA 4CM4A 2GN8A 3MWDA 4CDMA 3LLCA 4NJEA 5HKLA 3V8VA 2Z5VA 3ZGXA 4WACA 2JCGA 3RR2A 1NT2A 5JIBA 3X1XA 4GD3Q 3E9CA 3GVHA 1KQFA 3D3JA 5EMHA 3ROTA 3U37A 1T8PA 4OJNA 1PNQA 3VX4A 1O87A 3G2MA 3AL0C 3MLAA 1ULTA 4MLPA 1G55A 5A71A 2WTAA 1UMDA 2JH8A 1GOTA 4KIUA 1MKYA 1U1CA 5ALZA 2GRAA 2NZJA 1Z4LA 2EZUA 1U0JA 4LXUA 4CKEB 1G21B 3ZJ5A 5CD9A 1OUMA 4CEHA 1YWGO 3BJRA 4OK3A 1V8OA 2XDWA 4JGBA 1D04A 2XV1A 3PUHA 5K0FA 3RG2A 4TRMA 1AN9A 1SC6A 1K7EB 4IG4A 3ZWYA 4PNHA 4IO0A 3DM5A 4KPGA 5G4LA 2GBCA 2A14A 2YS6A 3BRWD 3DT6A 4UZFA 2XJ9A 4CMKA 4KKVA 5FO1A 5A0TA 4P3XA 4Z4FA 2VDNB 2IBSA 1M1NB 1E3DA 1E18A 2C03A 3JQRA 4B3XA 3CRVA 1JG2A 2WYIA 4N5IX 1DOHA 2IYTA 3N2GB 3ZXUB 1MEOA 4B3DA 1GA6A 1Z22A 3IODA 2PD3A 1BRTA 4IP0A 4OQXA 4MW1A 4CF5A 4YACA 4Z2YA 3UIEA 2Q8PA 4JC4A 3QVOA 4KQJA 2ZTVA 4DIMA 2B99A 2JK1A 5JSQA 2CCGA 1X39A 2IHKA 1ZD8A 4L4UA 4I4IA 2OG1A 2P91A 3FM9A 3OZFA 5FTNA 4BKOA 4C0BA 4D4HA 3EWNA 1KF0A 3TGPA 3WG9A 1IZ0A 2W22A 4MKFA 2HH9A 1C2YA 2PRSA 3C14C 3RSCA 3MYYA 6REQB 3MWKA 4F38A 1KZ4A 5LZ2A 3L0SA 4B79A 3HKDA 3UMCA 4EF4A 5EE5B 3EEOA 4Q9IA 2X7HA 4FMPA 1RE1A 1REQB 5CVCA 3UMBA 1F20A 2GAJA 2J9YB 3M1LA 1E1DA 3FPJA 1Y8RB 2CE7A 3ND8A 4W99A 4EHFA 2NTYC 5EJ8A 3I62A 1DO8A 5JZSA 3PS9A 1U7PA 1C30A 4ICIA 4PINA 3RGWS 3VR3A 5F33A 5JAQA 4N0DA 3IALA 2P0EA 3T1QA 4GSKA 4FJ1A 4Y1EA 1GGEA 4DLSA 1XQYA 1W1IA 3R5JA 1M76A 3ZY3A 3A9UA 1Q16A 3QEBZ 3F5DA 2CJPA 3EFEA 1J70A 1HWYA 2R8PA 3N0TA 4L50A 3DZFA 3LYLA 2YJTD 2JFFA 1SCAA 4U7PB 3B1JA 1PTJA 1Z74A 1G8YA 3AF2A 2RBKA 3IBTA 4QGBA 4Q4AA 2R1ZA 1AZSC 2RGYA 4MRMA 4Z9FA 4NJMA 1Z5PA 2GNAA 1PZXA 4BC0A 4OI2A 1SCJA 3NEYA 4XDGA 2BT4A 2PX2A 3A4IA 3MQFA 4V0MA 1QNLA 1XMXA 2HJHA 3QF7A 4G5SA 1G63A 4LVNA 4Z4EA 3QYAA 2VH5R 5ED0A 4DMLA 3V4PB 1M72A 2JI8A 4JT8A 1UWLA 4PSCA 2ORED 4QDOA 5KYGA 4BBAA 4GKBA 1X1RA 3AB8A 1MXFA 3UJ8A 4Y2XA 1I3OA 4KRFA 4G4SP 9LDTA 4TM8A 4HDMB 2YY7A 3PK0A 4FDTA 5I7EA 4RH3A 3LE8A 2OBYA 1RXSA 4HXYA 2W2NA 1ZN7A 3KKQA 1N2GA 1E1QD 1TM1E 2OBFA 4YJ3A 3L06A 4B17A 3G89A 2YV2A 1XG5A 4OK5A 3HCFA 3A7EA 5DFAA 2PRZA 3LOUA 4OHMA 4CR7A 4JJZA 4FP9A 4F2GA 4F2HA 1NKSA 4GMGA 2QV0A 2NPOA 4GNRA 2PQ0A 1PZNA 2B1IA 1DUVG 1R4NB 2EGHA 4IDEA 3TSOA 5CG2A 4ZODA 3P1JA 1GG2A 1WXIA 3PB3A 2I2BA 3W06A 2DF8A 2GTIA 3NI2A 5FF9A 1FLDA 3HACA 2C4TA 3M9WA 4I7EA 5SYMA 2AEFA 2OCXA 3T9FA 5B3KA 5J58A 3KDAA 1L2TA 3PA6A 1YOBA 4LNUB 4CN8A 1PTKA 5C5EA 1RAEA 4XWWA 4R05A 5HG0A 3U4MA 5JC1A 3BFXA 1TF5A 2W6JA 3BHIA 4TTPA 1X7WA 1QMGA 2XVAA 1G3RA 4QECA 4FQ8A 2NT4A 2OE2A 1ZLYA 3DTVA 4FJ2A 1WNFA 3HB1A 1J0AA 3NBYC 4R8LA 3QSYA 1F9AA 1QZXA 1UKYA 2J9FA 3LYHA 4AUNA 3AT1A 4LC0A 3AVVA 4YUWA 4YJHA 1XF1A 4DPLA 2MR5A 4FKMA 3Q5GA 3TVYA 2AFVA 2AI1A 1XJCA 2HKIA 3C48A 5AKXA 1CFJA 5IAEA 1M34A 5HK9A 1AQNA 3VOAA 2DQKA 5BN1A 2PS1A 2NV6A 1NNUA 1T1GA 1UDWA 2QAIA 3LFUA 3DV9A 3USCS 4R8RA 2C5AA 3THWB 4RV4A 1W88A 2ZK7A 4DWWA 2DVMA 3EQ7A 1GLNA 1G7TA 3COSA 4JZKA 3GJ6A 2GPAA 3WMXA 5BSFA 3TLXA 2BGIA 1GUBA 3N7TA 4NY1A 5IM5A 4M54A 4ASUD 3HBMA 4UZEA 3QX8A 3D8RA 1I6KA 3SF0A 1ATIA 1PWZA 1C3VA 1PX0A 3DXZA 4JQZA 4RKFA 3FKSA 5CLFA 4RDXA 4C4OA 1S1CA 1TAHA 3BB1A 4WZZA 4ZI7B 4RA6B 1GEEA 4G01B 5E2BA 1U1GA 4H4EA 4BO6A 4XB1A 3ZS9A 2WJYA 1PBTA 4MARA 2YCLA 3USZA 2R4QA 5C7LO 4DV0B 5D3KA 1L7VC 2Q46A 2V9PA 3E3NA 5AOVA 5AJZA 4RIIA 4ZYXA 2IL1A 1C0EA 2H2AA 1E5TA 1TXGA 3CF6R 4INAA 1QSGA 1SG6A 1U7ZA 1LDGA 1NKVA 3AU9A 3N70A 4TLEA 4D6XA 2B4AA 4K6FA 3BGWA 4QO8A 4X0EA 3BCRA 5LOVB 3GLHB 3UCXA 4ZIRB 5HS4A 1KYIA 3VC7A 1B16A 4EB8A 1OE0A 5AW7A 1SVWA 1TK9A 2HI0A 3C70A 3VO8A 3VR6A 2GXSA 5FHRA 2QTHA 1NVKA 3WGJA 2C1EA 1UJMA 1W49A 3K6KA 3KEOA 3MT9A 1KDVA 3ZY5A 1TUIA 3T9EA 3IPLA 1SH7A 4WASA 1IAVA 1ANKA 2WWGA 4HEJA 3VR2D 1VLZA 2WIKA 1KQPA 3KPYA 4O2LA 2E37A 4DLZA 3OJCA 1Y89A 4CG3A 4G8BA 3NT4A 2CFTA 3NHJA 4MQFB 1UC5B 1YQWA 4RTNA 3DF9A 4XSGA 4PGHA 1N0HA 2PWAA 4YBRA 2R1UA 1H22A 4PHFA 2G0AA 3E22A 3OE5A 2YL2A 5JSYA 1YR8A 4K03A 1P7PA 3OD1A 5I7RA 1E9AA 5HQ3B 4Q3NA 1ZCFA 2JH3A 1QV7A 3WL3A 1KOGA 3OOYA 4N0MA 2FE1A 2GK3A 2O7RA 3KJHA 3BXXA 3B60A 3TZCA 1EIWA 1K4KA 3ICEA 5TQJA 1PEAA 2PS9A 1CIPA 1ARZA 2JLSA 4KYIB 2CJWA 1SVIA 3C45A 1IJFA 1T0PA 2NOAA 4GOKA 4Q3EA 2DEUA 3KETA 4FYMA 1DRWA 4WXYB 2FEKA 1J2YA 2NX2A 5T8KA 1Y7LA 4YQYA 2Q1WA 4CL0A 2F6RA 2QUJA 2HA3A 3CX4A 2HOQA 2AG8A 1EH5A 1A4RA 1LDMA 2YJ5A 3AKCA 3C5VA 1UC9A 2JAXA 2FN3A 1U2QA 2X1MA 5DW0A 4FB4A 1WZ2A 4XQGA 5JDCA 2PUDA 3L1UA 3PGLA 3PT9A 1NWHA 3C8ZA 3C1TA 1T36A 3G49A 4F4DA 1UR5A 5TQVA 4I1RA 4A8TA 2WKRA 3FUUA 1NVGA 3R24A 4ZGBA 2WHXA 3QY0A 3RWMB 4K28A 3T4EA 2FXVA 5KJCA 2FDCA 3AEQA 2PUTA 3EXFB 3W6NA 4GVPA 1FFCA 4UMFA 1RKUA 3PI7A 3ZTTA 4L5IA 1GGVA 2WHPB 3RJTA 5TF0A 3N2KA 4HYQA 5HJ5A 4K9DA 4UBJA 4M1QA 1JDNA 4Q02A 5FORA 5K3FB 3SICE 1XRPA 4R8MA 1T3TA 3S2SA 1EUCA 4HLQB 2VCEA 2AW3A 4JBXA 2BFMA 4NAVA 5TR9A 4FHCA 4YJ2F 4URZR 4HWGA 2I9KA 4XM0A 4HXGA 4NSNA 1QZZA 3PDHA 1M6EX 4J0DA 3UVEA 4GBJA 3UHOA 1K66A 4FOTA 4V1CB 3JWPA 4YECA 1WBJB 2NTJA 1KVTA 1N2CB 2OAQ1 4L2IA 4CI0B 1BGWA 1ZUHA 3CB2A 5E7QA 5LD2C 1DVRA 1N2EA 2GD1O 4JLUA 5IARA 4CV0A 1ILWA 1QFZA 5AW1A 3PR1A 4DRYA 2QVYX 4Z4QA 4D57A 3GJ4A 3DLAA 2C61A 4JNKA 4TZKA 1W7AA 4KIWA 5H16A 3W4JA 1NQTA 4B3JA 5KC9A 1P74A 4G65A 3TZKA 1PI3A 4B6FA 1AU9A 5JXJA 4TWRA 1VSVA 3OQNA 2H2FA 5AMXA 1KMMA 4HAWA 3U60B 5H1YA 4O6VA 4LBVA 3AUUA 3HPRA 3M4NA 1K86A 3ZLBA 1W87A 3A6JA 1LLUA 1CRPA 3NONA 2XMBA 1RYYA 1KH3A 1P1KA 3AIKA 5IH3A 3SEFA 1RCFA 4BPBA 1BWQA 2PKRA 2WJ6A 3CINA 3CBQA 5IWCA 5JNTA 3P9ZA 2GPYA 1SNYA 4YRBA 2J67A 2ZI6A 1MO3A 1W36D 4MI9A 3RIHA 1EUQA 4ZT3A 5D3ZA 3K6JA 4YT4A 5IX8A 2BGWA 3DBIA 2RI6A 2VPPA 3HKEA 4CM6A 1OSNA 1GSIA 1R15A 1ZBQA 5KTYA 2PN1A 4O02B 2YFQA 5EJ5A 1U3DA 1PZEA 4RJIA 3OEHA 4CKBA 2C9BA 2IYEA 4QDXA 1ZIXA 5HS6A 3DQZA 1X2EA 1J1UA 3IBYA 1X70A 2IHYA 4OOEA 3E48A 1M7BA 2P5TB 3GN2A 4JIGA 2BV3A 4DABA 1X3SA 2E4XA 2VJQA 4M8IA 3CEMA 1A76A 2JGDB 1EUDB 5HZKA 1VKJA 2Y1XA 1YOVB 1IEXA 1K8XB 1PR2A 2YDYA 4DEYA 1EWKA 2DZDA 2JHAA 2O50A 4G5YA 5LMZA 3NJ8A 4R1NA 3C98A 3WNVA 2DPHA 1RRPA 1ZNQO 2ZIFA 5E9WA 3KEMA 2Y27A 1FSZA 2V5UA 2YQZA 3BYZA 4ZVMA 1QO0D 1XPJA 2IH5A 1TZMA 2HMYB 3KM0A 3FDZA 1VLVA 2J09A 3ZGZA 4P84A 1R4AA 3NHAA 1EPUA 4LNAA 4YJFA 1EGAA 2IKSA 3DFMA 4EG6A 4P7BA 1M1YB 1RI4A 4DMHA 1EBUA 3AKDA 3R6DA 1VG9B 1UJBA 3BB4A 3L7DA 1W85A 4HH4A 3BXGA 2ZULA 5J5VA 2OY0A 1Z8NA 2NZUG 3GFSA 3GJ7A 2NVOA 3L0PA 4WKOA 2RGUA 5LB2A 1MZVA 5DT9A 2MSKA 5EZYA 5E0KB 4OB8A 5K2OA 3S2FA 1ZU4A 3PYLA 2DERA 1S01A 4V3CA 3HKCA 4HX9A 2FMIA 1E3QA 2KJQA 5GJBA 3JWGA 3ROXA 3HH8A 1L5WA 3FWYA 1W75A 1T5LA 5COQA 4A91A 4I4TF 3ZV3A 4I50F 3MFQA 3THSA 5A5FA 4C4XA 3EWSA 2HIMA 2Z2XA 4IHQA 3I6BA 3PJGA 4BIIA 2C99A 1VSBA 5G3YA 5I7VA 1CB7A 2AN9A 2ISSD 4GL4A 4US1R 1MCZA 4WNCA 4JI3B 3UUWA 2ENWA 2XSZD 4QDJA 5ALXA 1V5WA 4B6EA 4V0LA 1I2AA 4EY3A 2RGGA 5JMWA 4BO4A 4FX5A 5GM1A 2CNOA 3EXIA 3F8TA 4IQFA 1LK0A 4XD7A 1VLMA 2C5EA 2EJWA 1OJLA 4R1QA 4HRAA 2JIPA 1ES9A 4HKTA 5EQFA 3UT6A 3QRWA 3VNUA 5EJAA 1XU7A 4MI1A 3I0NA 3W34A 3CPEA 4MWGA 5CFMA 2BFFA 1C9MA 1JHUA 2AYXA 2YRFA 4YCBA 3VGPA 1TFRA 1YNSA 1BIFA 3OM8A 3ZYCA 2R7AA 5AI4A 2GF9A 4DJTA 2QYTA 2P65A 2YVAA 3PC6A 1AG9A 1XE3A 2DBVO 4JOBA 5G2OA 4QFMA 4DVJA 4KU4A 2SECE 4JP8A 3KJNA 3CY6A 3LOPA 1W29A 2E55A 4M22A 1IPHA 4GLJA 2IY9A 1E99A 2GO7A 3A1CA 3QFHA 4LRUA 5CB8A 1DKUA 5IT5A 1CQZA 3WGQA 4CIAA 2HGSA 2Q3BA 2YJGA 3DM9B 3TAUA 3VVBA 5BNTA 3CSUA 1HMPA 1SKQA 3IAFA 2HADA 1ZVMA 2F3UA 3HDVA 1Y3CE 1UAGA 3HA7A 2OQRA 2AZMA 3Q6NA 4N7BA 4AWBA 2B8NA 1PSZA 1VE5A 1ZJ6A 2GUWA 3IUEA 1CC1S 3ZE1B 2A9JA 3AUKA 4J6EA 1FP7A 4WD3A 4D4JA 1T15A 4TXJA 5DEIA 1VI2A 1Z6YA 4CTNA 3THOA 1J23A 4YLGA 1KEEB 3LC0A 3RK1A 1M2OB 1VSUA 2V7PA 4WKBA 2FEAA 3ZVRA 4UHKA 2IY8A 3OVMA 3WTBA 2H1IA 1RRMA 1X1TA 2REQA 2CMHA 3MD9A 3UJ3X 3VSAA 4EJFA 1BCSB 2QRPA 2Q9AA 1XZAA 1C7EA 3M1YA 4FI3C 4GZMA 3H65A 2O14A 3MJHA 1RWOA 4QXOA 2QRMA 1LRKA 3ZIAA 2QL9A 4O4JF 2GEUA 3BXOA 4XWYA 3ZQ4A 4H7FA 2UUAB 4MVJE 1AQYA 1KBZA 3QFCA 5IKEA 4B76A 1E66A 3OSUA 3TM4A 5CAEA 5IFLA 2ZIEA 4ZVLA 5FPKA 5JADA 1QIHA 2ZYVX 2GEKA 1AS3A 1LC0A 3D7MA 3VYTB 5L3VA 1O4VA 2WTMA 1ZH6A 3IQWA 3PXBA 3L7YA 4D9CA 5J4HA 1M1UA 3T1TA 4PAMA 4PAGA 3W6OA 1K6EA 1U8EA 3BAFA 3JQFA 2ZZNA 1IUKA 2R6GA 2XHEA 1P33A 1QWSA 1MO2A 1UAAA 2O54A 1Y4UA 1EA7A 4TLLB 2QPTA 1GVNB 4ZVTA 3HV0A 1KVRA 4OLFA 3AMVA 1UL1X 2M6SA 1QQ6A 1UZNA 4ZQCB 1JIKA 4Q18A 1ENYA 1MX9A 2ZJYA 4H9GA 4YCLA 2E4ZA 4I3HA 1J5PA 1I3NA 5AVQA 3HEBA 4WN3A 1J25A 4L15A 3C85A 4NBTA 2H11A 2AKEA 1CQJA 1TX4B 2B8JA 1USWA 4J9VA 1CERA 3D2AA 3TUIC 1IJKA 2VWPA 2NYRA 2JJ2A 3WV5A 2Y0CA 3AIIA 4N9QA 1IHUA 4NG4A 1IPFA 5DRYA 3PL5A 1KAHA 4DR7B 3B9BA 3REOA 1HQDA 4JL6A 5IBPA 3AR5A 4MRPA 1EESA 2J07A 2YHIB 3DC2A 5AVUA 4YRZA 6AT1A 1JLLA 2QRVA 3QXCA 1JAXA 1UKBA 2G5CA 4KRGA 1UFQA 3P2JA 4UW9A 4YI5A 5FADA 1FRFS 3H2KA 2C78A 3ONNA 5H82A 3ZE0B 4CUZA 2IEIA 1IDN1 4BFLA 1GO2A 2OV4A 4G23A 4E3ZA 4HAYA 1U5BA 2AC4A 4TXNA 5ESRA 1DUIA 3INGA 5LA6A 1E64A 5DYYA 1S9HA 1QM5A 3PE3A 5HQTA 3EA4A 3PNLA 2NVUA 1NJ8A 4JLPA 1E1RA 3ZNOA 4H08A 3N7AA 1B4DA 4PU0A 5IK2A 3F73A 1CUDA 1QF7A 2R9VA 2XYGA 5CX1B 4MKRA 3TDKA 3LUFA 5ECYA 2ESRA 2GJ8A 2ZVDA 3FCUB 4ZAXA 3VDRA 3PQ5A 1DX6A 4ZMBA 3DTTA 3E05A 3QHAA 4CMJA 3FCSB 2A94A 2GJKA 3AV0B 2VYFA 1Y3BE 2X1HA 3U26A 4KITB 1Z83A 5LL6P 2BE9A 3L8DA 5CHYA 2XCRB 1Y4DE 3ORHA 4AO8A 1WSWA 5FDFA 1ORTA 2RKBA 4WINA 4WLOA 1RJ9B 2J3DA 3HXMA 1KJIA 4QO7A 1OTYA 4LOLA 1QQ5A 3N9IA 2V65A 5K0NA 3W4IA 4RTMA 4KLZA 3OLXA 4H0FA 4IMRA 1J9ZA 3R5KA 2DAPA 4J7AA 5L53A 1HRKA 2XOEA 2DFPA 2X8JA 2ZJ0A 2FTKE 4OY3A 5HM8A 1WXXA 2G67A 3M6LA 1Y37A 2B4KA 4XWOA 4GMXA 5F78A 1SQFA 3U4IA 4OMFG 2AZXA 4RMNA 3ECAA 1EG7A 3CPHA 3W5UA 4EVRA 2HCRA 1KH2A 1B6GA 1TU4A 4N5DA 3QI7A 1UBEA 1XQ9A 4B43A 3ROEA 1OTXA 5JUWA 1UFOA 1MV5A 3CU5A 2BEVB 2YC4C 5L8VA 5DKFA 2QA5A 4HI0E 3QOYA 4UBIA 1OHHD 1NW4A 3Q5DA 4U6QA 4D41A 5AKIA 5DBFA 1DXYA 1AKWA 1ESMA 3D7KA 5DU2A 3N0RA 1F2TB 3OCCA 3OEWA 2WYUA 5HP4A 3FFWA 4YJKA 1I0LA 3MTIA 4M38A 4PTZA 3QE2A 2RGAA 3ADKA 2J8ZA 2ZT8A 3PXDA 4ZO7A 4UHJA 3RUHA 1RQPA 1FL9A 4M9UA 1DC8A 1EDOA 2RHRA 3G9UA 2H4HA 3KSMA 1XWFA 3NHSA 4MO2A 4B40A 4YMGA 2H59A 3B78A 3E18A 4IXTA 1FYDA 3PIRA 3R75A 4O4HF 2GPSA 5K3SA 4YXFA 4RGQA 3RC9A 5J3JA 4WE3A 1Y6FA 4MUXA 4D4GA 1EDBA 3W6ZA 4HVLA 2J5RA 5JYEA 3ADBA 2R86A 1UKEA 3LVBA 1OLSA 2W37A 4YMWA 5DNAA 2VRCD 2PZGA 4E2FA 1BWPA 3BRQA 4MVWA 1BE8A 5AI5A 4ARCA 3MWLA 4CKEA 4C6SA 2AFIA 3OFVA 2C5SA 3FLEA 1GTSA 2A6PA 4E31A 2PUFA 1FSPA 3L41A 2HO5A 3OAAD 4ENQA 1C8VB 4EJSB 2LZ0A 1Z5UA 4GR9A 4P5PA 4B3SB 4UAUA 1JLSA 3FPAA 2OXTA 4QOHA 3RRBA 1VA4A 1L5NA 3O4IA 1Y1RA 3DE0X 3IGFA 1RJFA 3NHBA 4JA0A 4LVUA 1MO4A 1T9ZA 4FNMA 3E7PA 4HQ0A 2IV7A 3W8NA 4EY5A 2A58A 2V6FA 4XH9B 5KKNB 3T1YB 5CVTA 1ETHA 4DV5B 3B85A 4U7HA 5IVDA 4ZHQB 3MAAC 4XIIA 1CRLA 5FD8A 3MW8A 3E7DA 3DA8A 3H13A 5ALEA 4EFKA 2ID9A 5GZ6A 2XNKA 1T1EA 4FBMA 4DDUA 2HCBA 2RHCA 3W5HA 1N8SA 1T4DA 3H5TA 4M46A 4GGMX 1XOIA 4KJZA 4OYLA 3W9UA 4B71A 1G20A 1C0LA 4UFPA 1RPJA 3CUUA 4ZPJA 3SYNA 3HCPA 5CGQB 4P33A 5C46F 3F3SA 2DQYA 2WVGA 1M7GA 1YRYE 4M0KA 1GU7A 1E1MA 3M3PA 1T5HX 4HLDA 3GDGA 1UBUS 3G0GA 4IHJB 3OX3A 3KWLA 8AT1A 2E4UA 4HQ6A 4CDGA 2WWIA 3CNOA 1XYYA 3O94A 2P9QA 5CLGA 2YWCA 2VDWB 3HEMA 1GCOA 2ZWVA 4OQYA 4LMPA 1N3BA 3AF4A 3SVZA 3RWBA 2DR2A 2NUPB 4WESB 4L07A 3EUWA 1V6CA 5EMNA 2FSGA 3PIDA 1OVGA 2Y1CA 2QAGA 3A36A 1VYTA 5EEGA 1YMVA 2O2GA 1WHSB 5EERA 4RMJA 3OEED 2FXIA 4DLVA 3CVJA 2B21A 3A1UA 3IIJA 3NHWA 5COAA 3MGAA 4H7JA 4JLWA 2XD4A 4WI1A 3UUGA 1LVUA 1AKUA 3SKXA 2PK3A 2WKQA 1XKQA 4QKQA 4D96A 1NSTA 4NU8X 5JBNA 3R2JA 1VTKA 4MQMA 4KPUA 1E61A 4S1PA 5FA5A 3TEFA 3UPDA 2Q49A 2PZAA 4JSYA 4YR7A 3NKLA 4DDWA 4IJ5A 2OV6A 3JD4A 3K5WA 4OFBA 5EGSA 4KVZA 2QOEA 2WAYA 2XR1A 4V24A 5DV9A 1SQSA 4IUCS 4JUBA 5EQDA 1XKXA 4NBWA 3RODA 5M3BA 3SBXA 3QWFA 4Z1OA 5TQ2B 2XVZA 1CCWA 1YRQA 4LWQA 5BNFA 2OA0A 4CIWA 3PCRB 3PQCA 3QLTA 5K8VA 1JAYA 2FR8A 3JARB 3M4YA 4I6EA 2C4HA 4TL8A 4ML3A 4FCTA 5CVJA 3W2GA 3WKBA 4AB1A 3IA7A 3FNHA 4LA4A 4WECA 4HB0A 1OOEA 1E5DA 2YX1A 2LIVA 1OBOA 3KLOA 4RJLA 1Q83A 1LBQA 4YX9A 5KHAA 5L51A 3KBBA 2VHZA 1SU8A 3DZJA 3F71A 4HDRA 1BKSB 1NDHA 3K0AA 4IILA 3BMNA 3R6LA 4P7KA 4FOOA 1MAVA 4TUYA 1UBOS 1LW7A 3BREA 4W63A 3GLIE 2CXUA 4PQEA 3EDOA 5IRCD 1XMQB 1YJCA 2PM8A 2ZVQX 5FEUA 4ZXPA 3RS9A 1G2PA 2PMFA 4LX8A 4JS0A 4KKXB 2G17A 3WGIA 1ECCA 3RUEA 3L7IA 1OYYA 3HKBA 1MNQA 3R0VA 4RE6A 4BQEA 1YTLA 4AJ4A 2QV7A 5ITZB 4W5NA 4ZT7A 2QI9F 4W5HA 5FCDA 5FQNA 2VAPA 1KEKA 5DNCA 1YNOA 4ZTUB 3F5SA 2DBZA 3EGXB 1K6MA 3TCXB 3QMWA 4BDSA 1WW3A 5H83A 1E6CA 3H1FA 3I34X 4Z4HA 4M1SA 4NI5A 3I37X 1XV5A 3CVWA 2BGRA 4B6GA 1NMEA 1GFZA 1YH3A 5THXA 4BLVA 3VR0A 2KYRA 1ZU5A 2W93A 1OX4B 3LPAA 3PNKA 1KZ7B 3JR7A 4NATA 2YV3A 1NOKA 4YPFA 4C5AA 5I4CA 3S81A 1ZRNA 1V16B 2GAFA 4R7GA 3V8RA 1BWRA 2MYTA 3IRVA 4F5WA 1ZGBA 1ZAKA 3GGSA 5C7YA 1EVEA 4QVGA 4MR8A 4BO8A 1OBHA 4L51A 1YGYA 3G9QA 2A5YB 3KWMA 4PPYA 1YHNA 4OGWA 1NE7A 1WR8A 2VK2A 3MMXA 1CULC 3B70A 5T6MA 3N75A 1T3ZA 1U7WA 1Z4KA 3AY6A 4EB6B 4W4TA 2A0YA 4QUEA 1OIVA 1XXLA 4R3WA 4Y98A 2A8YA 2C3YA 1BEZA 3EOBI 4PZPA 4DG8A 2WIDA 3STWA 4PIPA 4GXRA 5H8WA 4Y3UA 3AEUB 4IIGA 3SQLA 1RJGA 3VPCA 3IEIA 1EGMB 1LS6A 1PUXA 3AJ8A 2VF4X 4IYJA 2AN5A 4LZOA 2DH5A 1IPEA 4PLZA 1P7CA 1SBNE 2FN9A 3P2OA 2WWRA 1ZJYA 4FI3F 1SCUA 2NO6A 3RVKA 5FWXA 3WOVA 3GT0A 3HU5A 4PZCA 2JVIA 2VPWA 4CNQA 5CJJA 3G1TA 1UXHA 2PLNA 2XXBA 2Z1NA 2HN9A 3K0FB 4HGPA 2P2GA 4JLDA 3HQ4O 5F98A 3AOEC 4EY4A 1JL3A 3I83A 4HXEB 4AMVA 2XMSA 1JEQB 2ZRNA 3RBZA 4YREA 1FDTA 1JPUA 2O5RA 2ZJ6A 1SD5A 4CF7A 1VCMA 4RFSA 1ULUA 5A4DA 1PW5A 3Q10A 1H9CA 3T41A 3AG5A 4COKA 5LP1A 1IBMB 2YIDA 1N1DA 2WNHA 3H9UA 4K9QA 3A1FA 1T8TA 2GN4A 1T13A 3RKUA 4CU5A 2GK4A 3BQMB 5BT8A 1D6MA 3N59A 4MS4A 5FPQA 4EY7A 1FU7A 3WZ2A 3TOXA 1KERA 2RB4A 1BXRB 3C6ZA 2VI5A 1LJ8A 3B52X 1KARA 3GUZA 3N3BC 4PR3A 4RZSA 3P0IA 4YMSA 4BNKA 2BM0A 4DN6A 4DQXA 5ECDA 3ELUA 4N6NA 3S55A 3WY9A 4ZKEA 4EYEA 1WBDA 4RYLA 3WLQA 1OB5A 3MUEA 3UB2A 4JQCA 4WN9B 3MK31 2HRRA 3TNYA 3U80A 1N2BA 2FQ1A 3NWOA 4DSOA 5IJWA 1IRXA 1VE1A 3GW8A 4QYMA 4RANA 2FVXA 4O4IB 4YP7A 4C7OA 4LXTA 5EPOA 5KKCA 4ZGWA 4PQFA 1DRJA 3W2HA 4KV7A 1AHNA 1MJFA 3EZXA 1II8B 1CQIB 2J31A 4A27A 1G21A 1N5JA 1RPNA 3HA3A 3HO6A 3WLSA 3W8DA 2KBFA 5GADl 3NIDB 1E4VA 1DKRA 1D2MA 1FP2A 3MRSA 3STVA 3ZJYA 1VLHA 1A7UA 3DT9A 5IC5A 2F43B 5IYZB 4RZXA 3OF3A 3IS3A 4A0GA 3E81A 3Q72A 1PR0A 1JQDA 3CNEA 4KAJA 5IMBA 1JSRA 5HCNA 2AXQA 2QVGA 1WDKA 2Y1EA 1JJFA 2VP5A 1U28A 1U1IA 3IQIX 1R5OA 3E9DA 3OF5A 2VDKB 3V7FA 2YQ5A 2YWHA 3RWOA 5EC8A 1U90A 3OQBA 4KWEA 2XECA 4OL9A 1B41A 3EMKA 2ZJ7A 4PXAA 2PMDA 2YNMD 1ADYA 3TIIA 1R37A 1O6GA 2CXRA 2HCJB 2QDXA 3G88A 3V55A </