4LHZA

Crystal structure of gtp-bound rab8:rabin8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
b'KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhzA00
2VP9A 1E2FA 2WJIA 1X3SA 5DISB 1BYUA 1Z28A 2P6UA 2VIIA 1XD2A 1FFHA 1U99A 4GT1A 3N2EA 2EFCB 1NG1A 2JCSA 3CIOA 1HEIA 4HDQB 4JS0A 3SDZA 1HQYE 2FGJA 2OLJA 2PEZA 2AWNA 3MLEA 4FD2A 1XD8A 2FPLA 2WBLC 1P9WA 4KCGA 5BN3A 1J7KA 2O8BA 4DCVA 3C4JA 1E1RD 4LJ8A 3QXHA 4P4SA 5CYPA 2RGNA 5EP1A 1FPMA 4TL8A 2JLYA 4LSGA 1W5SA 4AG5A 4WVFA 2NO9A 4HZUB 2W2VA 1WBBA 2RH5A 1GL9B 3LX5A 2YWGA 2GCPA 3KKOA 2GEUA 2WICA 3OE7D 1KZGB 1T3LA 1T91A 2GVDC 4JLJA 4UJ3A 4BFYA 5A0FA 5J4YA 4TYWA 4HI0E 3C41J 4Q01A 2ZJOA 4CZ2A 2HCJB 2XJ4A 3OFND 5JSZA 4E5UA 4EPYA 1GNPA 1M6NA 2W00A 2WTUA 3SJBA 4HAUA 4KJZA 2AWOA 4A6PA 4A36A 1Z0FA 2F7SA 4ZDWA 3UKDA 3FHOA 3B1YA 3GD7A 3A36A 2BBTA 2ZYWX 3CRVA 2KI5A 3EWSA 2PZEA 4IVQA 5DI9A 4M22A 2G3YA 3P4XA 4TMVA 1ZVQA 1HH4A 3WHLA 1SVLA 3TMKA 4LBZA 3MJRA 1KY2A 2DHRA 3S1AB 1WRBA 2AKAB 2FF7A 5J4LA 4RSGA 4DCUA 1RW4A 2YNMA 5JEDA 1Q12A 3BXZA 1XFAA 1O3YA 2XXAB 4AC9A 3T15A 4UXIA 3TNFA 3EPLA 2XAUA 1R5NA 1OXSC 3HP1A 3SU8A 3WNCA 1XRJA 1G7SA 4LOAA 4QHSA 1SXJD 3ZQJA 3VHXA 1IAQA 3OIYA 4PAOA 2VH5R 2ZU0C 4F4CA 2WHXA 4B75A 5K8IA 3VR3A 4A4DA 3EASA 3THOA 3TQFA 3DHWC 5M04A 1R6BX 4B47A 3WBKA 2H5EA 3WMGA 1Q3HA 1P3JA 1OXVA 2Z5FA 1G3IA 2IUSA 4B2LA 2Q3FA 2YWHA 3L2OB 1EGAA 1CIPA 4Q66C 3NKVA 4DLYA 1S96A 1HTWA 2C8VA 5KTYA 3K9GA 3KTAB 1RRPA 3KUCA 3TH5A 2WPDA 2J5XA 2YOGA 1RC8A 1W2HA 2LKCA 3AB3A 4BZQA 5DN6A 2OCYC 4Q1AA 3GLGB 4KFUA 4DIEA 5TMPA 3B6EA 1VG1A 1AA9A 2VP6A 4Z54A 4DB2A 5EP3A 1XNJA 4DSUA 4C2UA 4I1OA 2BV3A 1HE1C 4D0GA 1DAFA 4JBWA 1OFHA 2V54A 1SGWA 1W0JD 2I1VB 1KI3A 1RPZA 2VSOA 4FMCF 3KJHA 3UMFA 2KBEA 4C2TA 1IJFA 2C77A 5JWHA 3IIJA 2ZR7A 4DEYA 2Q3MA 4M21A 3GQBA 4NYJR 1CBUA 2J7KA 4OK3A 1CU1A 2EQBA 2YWEA 4GZLA 1HT2E 1VG9B 3SHFA 4WZAE 1OH8A 3DKPA 1FW6A 3U44B 4TYNA 4ACAA 1IXRC 3LQRA 4IOLA 2GCOA 2HLDD 3QOFA 2WJYA 2C9CA 2VP0A 1OH5A 4Q9LA 1RYFA 1EFHA 2CLCX 1MOZA 2R8RA 2ZRBA 1GITA 1W0KD 2WJGA 2VQSA 2GNOA 4BZXA 3FMPB 3M6AA 3EIQA 2IYRA 1H8HA 3ZGXA 4GFDA 3CPHA 1CJUC 4Z1MD 5ANRB 3AVQA 3IPYA 4B32A 4V0ME 3UG7A 2CHGA 1G7RA 3O8RA 1TF7A 3EZ7A 2FG5A 3A8TA 1FL9A 1KO8A 3B9QA 1DEKA 2QTVB 5E3HA 1P2SA 1Z8FA 1OIVA 1OLOA 1KJWA 1LB1B 3ONWA 4TTQA 2F43A 5LB4A 4Y0VA 1ETUA 1G4UR 3QG1A 2F1IA 4GOKA 1E0AA 4JLVA 3JZMA 2IBMA 3BGWA 3P27A 3UXMA 2UZIR 2WKPA 2XITA 3IGFA 4PC2A 4Q7KA 4RD0A 4UQOA 2ZRJA 3SNHA 1BH2A 2ORIA 3CRQA 5KPDA 1RJ9A 5BWMA 1DAHA 3KXIA 4PANA 3B85A 1ZNYA 1PVOA 5TV2A 4TQ9A 1IY0A 1MO6A 4NCKA 4LJ4A 1G5RA 1MO3A 3RRMA 3P20A 4JT4A 2O8DA 3IHWA 3MGCA 2ZJ8A 3MWKA 2J9RA 3SE0A 2JLQA 5TDHA 5GVRA 4OHWA 3MMPA 3GLIA 4JBXA 2PBRA 3GEIA 4TLBA 1ZNWA 2ATXA 2X2EA 5FL7A 2IC5A 2IYYA 5E7MA 1CEEA 4OHXA 4O25A 3LY5A 1L4YA 2QROA 4LZZA 1YRBA 4EPTA 2P67A 1YQTA 1TU3A 1UEIA 1J2JA 4FXPA 1SXJC 2QM8A 2HT1A 4PC7A 2Y8EA 1P62B 5GJCA 4C0BA 3LFUA 1ZCAA 3RSLA 4QKQA 1DTSA 3LBHA 1T9HA 1QG4A 1XPOA 4LRWA 1CRQA 5FBRB 1CF4A 2FFBA 3QJYA 3K0AA 4PSKA 4LYFA 3VQTA 2ZM5A 2O8FB 4CT5A 1TQ6A 4NZYA 1KY3A 5CM8B 1OF1A 4YMSA 1WXQA 2FFQA 1XCMA 4RFSA 2ODEA 2ZR9A 4Y0AA 2HYIC 2RGGA 3SJCA 2BBSA 1G3UA 1KDRA 1AK2A 5C2JB 2ZRDA 4CDGA 5BXQC 4EDHA 3TR0A 2IS6A 3RRNA 2G9NA 2PCLA 1VYUA 4TMZA 1F6BA 3DEFA 4HAYA 4WZ6A 1GKIA 5JI3E 2A5JA 4NYMR 2CE2X 3BFXA 4MGZR 4DUGD 1QG2A 2DFLA 1E98A 2EWWA 2GXSA 3A4LA 4DRZA 3C14C 4JSYA 2C04A 1Z0IA 4MRVA 3EPJA 1QVRA 2D7CA 3BD9A 1G19A 1KIMA 2J45A 4D0LB 2OT3B 2CLSA 4YXWA 1OHHA 3I72A 3KUDA 2QQEA 4XVUA 2G0TA 4CF7A 4EFLA 3C5CA 2AK3A 2GDJA 1W4AA 2QNRA 2WKQA 2HJGA 4V0NA 1DAMA 4DBLC 5KYKA 1KMHB 5IK2A 4B34A 1W49A 2ORWA 1KSHA 4ABYA 1C4OA 4C0SA 3AGPA 3C16C 3U3RA 4IJMA 3H0KA 5L3SA 4AIIA 1XTJA 3FPAA 3SZRA 5KNCA 1BOFA 2RKOA 2GEVA 4GP6A 4URYR 4JLBA 2QORA 1NL3A 2K5UA 2R2AA 3CR8A 2C03A 4Q02A 3I5YA 4Q9JA 1NP6A 1P61B 4A0RA 1YR8A 1D2NA 4IVRA 2W6JD 2XOKD 1VIYA 1TNDA 3K8YA 3TUZC 4E03A 2G1JA 2P5TB 1SULA 3LLMA 2V3CC 4JYCA 1E9CA 4LBWA 1CULC 4Q1DA 4DKXA 2V1XA 3KXKA 1U8YA 1PJRA 3NEYA 4PO9A 2XZOA 4TMKA 2J0SA 4F4IA 4BASA 4GZMA 1KHTA 2ERYA 4I4LA 2IS1A 3WRYC 3TSWA 2QAGB 1ZCBA 2CHVA 3AP2A 2F3TA 1ZU4A 4IOKA 4QNRA 5KSYA 4MA4A 2H18A 3QVVA 4EJSA 1UADA 5AJYA 3L43A 1DAGA 3B9PA 3B82A 5FPKA 3CF0A 3R20A 1NBMD 2GJ8A 4BGDA 2QP9X 2RAPA 1VCMA 4ZV4A 4UNSA 2VEDA 3OEED 1RRCA 4CYMA 3Q3JB 1G8PA 3TW4A 5AUNB 2RGDA 1ZM2A 4EQ6B 1S9HA 3THXA 5E4FA 3VKWA 1UBGA 1E9FA 3A1UA 3GEEA 3ZH9B 1Z08A 2DY1A 2HT6A 2QE7D 2VHTA 2RCNA 3UWOA 2H57A 1VDZA 3QXCA 1XTKA 1N6RA 4NONA 4Q1EA 4QBGB 3ZVMA 1KAGA 1YZGA 1NMYA 2BC9A 1YZNA 4BLQA 4TL6A 4QOSA 4BLRA 2R44A 4RY2A 4G01B 3N5CA 4OK5A 4IDHA 3AKEA 1Z83A 4UJ5A 2EW1A 5FL3A 2IWHA 4QBIA 2BMFA 4DWJA 1Y3AA 1Z2AA 4OKSA 3NIBA 4KAXA 1KMQA 3DZ8A 4UXHA 5CB8A 5F9HA 4QJ4A 3VR1A 4N0EA 1G18A 4US1R 2IS4A 3CZPA 2J41A 5AJXA 5L8VA 1JR3A 2IW3A 1ZW6A 2ZUBA 2C96A 3DO6A 3H2YA 3W6NA 2OBMA 3I8XA 3IILA 1UPTA 4NE2A 4DVGA 3AKCA 3KFVA 4F4JA 4WBSA 4NTZA 3AVTA 1EWQA 2D06A 3KJGA 4K81B 4TQAA 2OHFA 1Y63A 2IHYA 3K9NA 4KSCA 3RWMB 2RGEA 3AVYA 3WYAA 4M1SA 2FH5B 1Q1ZA 2WSSD 3BFKA 4MUAA 4PPFA 1KKLA 1JR6A 2B21A 2XTZA 2ZJ2A 4K46A 1P7CA 4JKIA 4OHYA 3EA0A 2WJHA 5EUMA 4RZUA 4C30A 1N3BA 1G8YA 4B6EA 5IT5A 3IIMA 4M9ZA 1W47A 1KO1A 2I1QA 3RS5A 1II9A 3EC2A 1ZBDA 4A8JB 4MITA 2NMVA 2OV2A 5EE3A 4LJ7A 3EPHA 3ZD7A 4U00A 2ZVQX 1EXMA 2CDNA 3LRPA 4RVCA 4U02A 1VCIA 2IYTA 1H8EA 1G6HA 4N0DA 821PA 2VLIA 3WNDA 5FUVA 5BQ5A 2OE2A 1AGRA 2QGNA 3VTKA 4PSAA 4AKIA 2LCFA 2JJ2A 3OIUA 3GJ0A 4FI3C 4IW3B 4DLXA 2VRWA 5LD2C 2FX3A 1GL6A 1X8JA 3BOSA 4URVR 2ZETA 2Q3HA 3AVWA 2EVWX 2GF0A 3SBEA 3UIEA 4CEJB 2V7QA 2E9SA 2IEYA 2GA8A 3PV0A 3X1WA 3U3JA 4B74A 4ZDJA 2YKGA 2QTFA 3GJ8A 3K09A 4I81A 2QPOA 1ANKA 1QHIA 1XTRA 4CIDA 3FVQA 4LBYA 1E1RA 5FH9A 1W36B 1GKUB 5DIFA 4IEEA 5UKDA 3TRFA 1ZRHA 2ODBA 3P1JA 2JLRA 2AX4A 4NU0A 1JEEA 3FMOB 1KNQA 3RWOA 2GK7A 4IFEA 2VO1A 1ZIOA 2NO0A 3CX8A 1NKSA 4KFRA 2GETA 4XD7A 2J7PA 1ZMXA 3OFNA 4TN1A 1Q1EA 1NMXA 4Q4LA 2DR3A 1MABB 3UWKA 1TF2A 2QPTA 3OZXA 3PITA 2OFWA 1KSFX 3UANA 1CLUA 3DPUA 2QY9A 5SZJA 1ZD8A 2FJUA 3BK7A 1R0ZA 1P6XA 4NH0A 1YRAA 4PPGA 2NO7A 3KQKA 4RFVA 2ZSDA 1NN5A 2AR7A 3LXXA 1E3MA 2REBA 1JPNA 3AV0B 1XD2B 3NC1C 3EIHA 4GI7A 2FPMA 5TXGA 4ZI2A 1VMAA 1X86B 1XTIA 1E32A 4C7OA 2C95A 4LI0A 3WP1B 1XMIA 1OW3B 3DMNA 3AP3A 3SYKA 2GXUA 4KITB 4P4TA 1Q0UA 2FEMA 2AK2A 4Q9HA 1SXJA 4NDZA 1KK3A 2GTPA 1XMVA 1N25A 3EXAA 1NBME 1JPJA 2A30A 2BBWA 4BEBA 5HKKD 1VKJA 1W7AA 2I3BA 4E09A 5JWRA 4MDFA 1COWD 3MFYA 3X2SA 3KKNA 3EARA 3X1DA 4BUJA 1X1SA 4KLNA 3ASYA 2ZXUA 3KQNA 2HXSA 1KO5A 3UPUA 2CK3D 1YU9A 1S0UA 2PT5A 4NP6A 1ZM4A 4UNNA 1GL7A 5EE1A 3OAAD 2P65A 1DADA 2A7QA 2NGRA 4NCNA 5K8LA 1LF0A 4ESVA 1NY6A 4TLCA 1E4VA 4S35A 2O8CA 3HU1A 4ZDKA 3ZIAA 1KJZA 1XJCA 3GFPA 3L0OA 2J59A 3SJZA 1VYTA 5FFMA 3LD9A 5FOSA 1WA5A 1ELOA 4NYIQ 1G1MA 3REFA 3FKSD 5FOWA 1R10A 5KSOA 2OZEA 2QSZA 5EJEA 1J90A 3QVUA 4OL0A 1XB2A 4CGZA 3BFVA 4LV6A 4Q4AA 4L4UA 1S3SA 5JJLA 1CKEA 2AXNA 4EPWA 2ZS8A 2HV8A 1O87A 1TL7C 1E2PA 2XSZD 4UNPA 4HUQB 1Z5ZA 2NPIA 2GEDA 2ZI9A 2WSMA 4DHEA 3AVPA 1I2MA 5CDFE 3H1TA 1XEWX 4JSTA 2QMUA 1L7VC 3PEVA 4C9BA 1CJVC 2QA5A 1L2TA 2XJ9A 2FSIA 1FQKA 1NKTA 4L16A 4Q9KA 1W5TA 5GVSA 3HJNA 4LPKA 2ZI3A 1XJ0A 1Z2CA 2WAYA 2ZRLA 2JJ1D 2R9VA 4QFMA 1EX7A 2YINC 3K0FB 1W0KA 3WXMA 2ZRMA 4RD1A 4BRWA 2Z4SA 3GLGE 3B1WA 4JLPA 4MRPA 2H92A 2WMOB 4B73A 4TZ0A 1RFLA 3RS7A 1QHXA 1YKSA 4OQFA 3JVUA 2BMEA 1NIJA 1XCPA 2CCKA 2KE5A 2FZLA 3EA5A 4M53A 2AN9A 1EFCA 1RKBA 1X8KA 1IBRA 1ZP6A 1R0XA 2JGNA 3AUYA 1OYWA 4IDNA 4YDSA 4EIWA 3QBTA 2GVZC 1DAEA 1SVKA 4XVRA 4D4MA 4M4SA 1ZUIA 2PEYA 4TMTA 3W8RA 2J0UB 2IYZA 4KFSA 2ZU6A 4A6XA 5EQTA 3ETLA 4FCVA 5JRZA 1LV7A 4L9WA 1U0HC 2ATVA 4FCWA 5LDDC 1EK0A 1CJTC 3GLHA 4Q4HA 3TLXA 2BM1A 2JA1A 2OXRA 2PL3A 3JVVA 4Q7MB 1FUUA 2CCJA 2DFTA 2W0SA 1AS3A 3D6TB 1PZNA 3LVRE 3HYTA 1U9IC 2FA9A 5CLQA 4HB0A 1OFIA 3WRXC 5JHHB 5TB5A 3FTQA 1J8YF 2W6IA 1J8MF 2A9KA 2B6HA 2XNDA 2YOHA 3CNLA 3H4MA 3IQXA 3REGA 1OV4A 4D0NA 1ZD1A 3AH8A 3RANA 1F2UA 4ZKEA 4A0FA 1CTQA 1U8ZA 5G3ZA 1ONBA 1WF3A 3NG1A 5DO9A 1QHYA 1XX6A 3A1VA 4MUBA 2BEKA 4MYCA 1KOFA 1UJ2A 2Q0HA 2HJVA 4ASUD 1QF9A 2GF9A 2CE7A 1P72A 2ZUCA 4H1UA 2CLDX 3MWJA 1OIWA 3IO5A 5JECA 2B8TA 2RGCA 5GJBA 4AKHA 3L8YA 3TSOA 1S1CA 3F8TA 2BM0A 3NTUA 4DT1B 5IHPA 5HE8A 4IXMA 3R7WA 4YC7A 2J0QA 1D2MA 2GRJA 2FFAA 4US2R 1QHHA 3GP8A 1RJ9B 3FDIA 5DYGA 2O5VA 1FTNA 1ODFA 1WMSA 4KFTA 1E2IA 3CR7A 2VF8A 3HU2A 5FR2A 5CLLA 3R8CA 3NEJA 5AR1A 4B44A 4LGMA 4OHVA 4CEIA 2DCUA 3U7FB 3CX7A 4QJ5A 4DLRA 4OK6A 2FFHA 4DLTA 1SHZA 1I2DA 1S1MA 2GBLC 5EXSA 2CEAA 1LF5A 5FTJA 1W48A 1QHSA 5CK5A 3LW8A 5E7JA 4DUGA 4QG7A 4F92B 1MRNA 3CRRA 1NN1A 4HAZA 5FPYA 1RRFA 4JLAA 3THWB 1OT3A 2F1HA 1JNYA 1RYHA 3QKRB 3SYLA 2REXB 2YV5A 1YZQA 2J3EA 4KV9A 4W7SA 1VIAA 2FE4A 2G77B 3QSYA 3CNNA 1SVIA 3I4LA 2AD1A 3Q5DA 3OHMA 2OILA 4BLTA 3LXRA 4DCSA 3PFIA 4HYYA 1FMLA 2QENA 3WBJA 1XEXB 1LVGA 5AJZA 1GOTA 4NYJQ 3ASZA 2W58A 1K5GA 2OAP1 3FMIA 3D31A 4D4KA 3Q9LA 3L0IB 4G5GA 1S9DA 4V02A 4POAA 1KSJA 2UKDA 1G17A 4D80A 1SVWA 4PTLA 1UAAA 4G5QA 3HDTA 1PLLA 1VCOA 4QM6A 2YJTD 1CJMA 4ILEA 2Q9CA 5EXPA 1XBTA 2NOAA 2F9LA 3A37A 2OG2A 2WM9B 4KO8A 3PEYA 5JCZA 4LHVA 3VNVA 4O2RA 4FIDA 4LJ6A 2XOKA 2ONJA 5JRJA 4LHZA 3BC1A 2V55B 2WWWA 3TUJC 1XEFA 3PUXA 3EIEA 4TL7A 3K0EA 3CLVA 3NBYC 4AYTA 4EPXA 3B2EA 1ZINA 4OI1A 3RABA 4UNQA 4BWYA 1NRJB 4LUCA 1CRPA 5FOVA 4DLSA 1JALA 2WZQA 4DSNA 3KXLA 1A2KC 5F2EA 2ZAMA 3MWLA 1BS1A 4U7DA 2IX3A 3GFTA 2MSEB 4QGGA 1G7CA 2WOOA 1W36D 3I92A 4L9SA 2ZI5A 1GDDA 3LNCA 3GLFE 1T6NA 4HZUA 1AIPA 2RMKA 3THYB 5JJIA 5EXXA 1ZNZA 5HZHA 3OEEA 1JQLB 2KJQA 3LQQA 4PAMA 2BCGY 4D81A 1N2CE 1NVWQ 4BEJA 1XZQA 2QAGC 1NN0A 3QXJA 3VR5A 3UK6A 3BB4A 3IEUA 2QE7A 1II0A 1NJGA 8OHMA 2VSXA 3W6OA 1SZPA 4YLGA 5J4HA 1RIFA 1H65A 3SC3A 3HPRA 2BMJA 4HB2A 3V4FA 5BYKA 1IONA 1M2OB 2IEZA 1P73A 1LW7A 1T8UA 3RSOA 1GWNA 4JLOA 5EP4A 2PX0A 3CRMA 1AQUA 2F55A 2EYUA 2VHQA 5H70A 5P21A 1Q21A 2C5LA 3GJ4A 3I3SR 4TMXA 3S1AA 2ZJAA 2EU8A 1J99A 5G41A 1DO0A 1XXHE 4X8OA 4TSFD 2XXAA 1AS0A 1RVDA 3NDPA 4DDTA 3PUWA 3KDSE 2QRZA 2LKDA 1ZJ6A 4A2QA 2FSGA 3AF1A 3AUXA 3G5UA 4PO1A 3I32A 1NVUQ 1S3GA 5CDFA 3A1WA 4URUR 3M1IA 1Q44A 3QF7A 3CZQA 3W9YA 1A4RA 2OXCA 1T5LA 1OFTA 4MGKR 4XOIA 5CJ2A 3SFVA 4BFTA 4HAXA 3VKGA 2WSSA 2C9OA 1G4AE 2CXXA 2P3SA 1P5ZB 1XP8A 1R0WA 2Q9BA 1TTTA 3QKTA 4B43A 1NI3A 4W5WA 3THXB 1N0WA 4RCYA 1Z07A 3Q7PA 4ZO4A 1GSIA 4Q5IA 1KJYA 3KTAA 4QNMA 5AJVB 3GJ3A 5KU1A 4D26A 1GVNB 1JXOA 4RZXA 3MCAA 2HUPA 2D74A 3D8BA 4RD3A 3SYNA 2O8EA 2IT1A 3FHCB 2IXFA 5B30A 1NVVR 3GLGA 2B8WA 2JDID 3I61A 2FEOA 3U4QB 2G0NA 3QKUA 1FUKA 2QBYB 4ARZB 2GXAA 4XIGS 1QHNA 1YE8A 4HDOB 5HPYB 1DE0A 1N0VC 4OQMA 1EFRA 4Q47A 2PX3A 3T5DA 1OKKA 5DGXA 1UEJA 4PQRA 3QG5A 3PUYA 3QF4B 4I99A 4DSTA 4A8JC 5BW8A 2ZE6A 2ZSAA 4HB4A 2AFIE 1FP6A 4A0GA 3HR7A 4Q1CA 4MRSA 4TYYA 3ZZUA 3ZZ0A 1TADA 4ZDIA 1DOAA 2VTKA 1I4DD 2GK6A 1KI6B 1M8PA 2OLKA 2PMDA 4PC3A 1DO2A 4TTRA 5FPHA 3U44A 3RNLA 1HQCA 3QKSB 4KVAA 3GLFB 4N3NA 1DG1G 4A82A 1B0UA 5FTNA 4ZCMA 1Z22A 1EFTA 3AEZA 3AF3A 2JIZD 4L5BA 5HCIA 1V5WA 1TU4A 2YC4C 1OIXA 2VF7A 4V03A 1G3MA 1ESMA 2G1KA 2HF8A 4FMDB 4FINA 2AL7A 4KLZA 3KX2A 1KGDA 1YVDA 2WPDD 4IVPA 4K8OA 1G64A 4P31A 3EZ2A 2C98A 4Q4JB 5DN6D 1TEXA 1OXXK 4XSGA 5D3MB 1W36C 3GJ6A 2ERXA 4KYUA 1G9XA 5CYOA 5KSPA 1PV4A 2OFXA 1Z6AA 4FN5A 3W3AA 3EG5A 3ICEA 2X2FA 1Q22A 5DLQC 2KB0A 5DNYB 3Q7QA 4WXPA 1TQDA 4I1SA 2NPFA 4US0R 1D9XA 4ZIRB 1Z6XA 2XZPA 4QXAA 2HYDA 5JCPA 4O3MA 4UXJA 1YHNA 1N6HA 3TE6A 1XXHB 3FGNA 4KODA 4Q7JB 2Z83A 2QPAA 2RHMA 4B2IA 1G291 1F48A 4DDVA 2QGZA 3CO5A 3CX6A 2ZQ5A 4P32A 5G3YA 3RAPR 3AVUA 3F0TA 1T0JB 4LK2A 3WHKA 4URZR 1N6LA 1A5TA 2QQ0A 4NBSA 2IK8A 4P33A 5KNDA 5DI3A 2L0XA 1M7GA 1L8QA 3KKMA 1D5CA 1COWA 1VCNA 1XD9A 1IN4A 2ZRKA 3I73A 1P9RA 3K9HA 4QJ3A 5K8UA 1Z29A 2AHOA 4LPSA 2QI9C 2KWIA 1E9BA 4IDPA 1IN5A 4PXAA 2A5YB 2CNWD 3T34A 2Z0MA 1CP2A 1E2DA 1NN3A 1H8HD 3U3MA 3GEHA 2R6GA 3OEHD 4HUTA 4O0MA 2FGKA 1VHTA 2REOA 1VYVA 2WV9A 1TQ2A 4GNKA 2RGNC 3VHLB 3ZS9A 5F98A 4DIDA 5KDDA 3RHFA 4DSOA 3WY9A 4IKEA 1JQJC 421PA 1E2HA 4E07A 4BZPA 2O8FA 3DMDA 2YVUA 1C9KA 1KI1A 1Q57A 1MO4A 4DDWA 2CVHA 4GBMA 1TMKA 4GRAA 1D2EA 1ESNA 2C2HA 2XSZA 4JVSB 4JL8A 1NF3A 3A4NA 4KVGA 2EYQA 2BVNA 1P75A 1N6NA 4HSEA 1EX6A 4TWZA 2X19A 2AD5A 1FX0B 3ZVRA 3BB3A 3E1SA 4QHTA 3DOFA 4KBGA 5JS8A 3KFXA 2NZJA 2WOJA 2ODNA 4P3YA 4QC2A 3MG9A 1KK1A 1MKYA 2WIAA 2JLUA 3ZLJA 5FL7D 2P2LA 1MO5A 4OJKA 1U98A 1GRNA 2JJ1A 1E1QA 4Z51A 1ZAKA 4XTRA 1FZQA 3TK1A 5CK4A 1E0SA 4PQYA 2D3WA 2KSQA 5EUQB 3TW8B 1SHKA 1NMZA 2QMOA 4JZKA 1LFDB 3FB4A 3TQCA 1SQ5A 2BJVA 4V0MA 4B76A 1V43A 1EESA 1BO6A 2YOFA 3FWYA 2GKSA 1KMHA 4JL6A 3UMRA 3V9PA 1JBKA 2PT7A 4IXNA 1UBCA 4CEHB 3IPXA 4MGIR 4BFZA 2HCBA 2VP5A 4PHHA 5TY0A 2OBNA 3RC8A 4P0TA 3CKLA 1ZNXA 1II8B 4PC6A 3CBQA 3HPQA 4XWKA 2VP4A 1P2VA 3P32A 1R4AA 4TT3D 1GUAA 1S8FA 2WJJA 2ZE5A 3CB4A 3O8DA 1DG3A 1Z6TA 1ZM7A 4RD4A 121PA 3KJEA 1SVOA 1PLKA 2IYWA 2YHSA 3FFAA 3T5GA 1KDOA 2J1LA 2ZJYA 3O8CA 2WAXA 4AWXA 3CM0A 2QSYA 3BBPA 2NG1A 3P26A 4PZLA 4B3GA 2PH1A 1A1VA 1MV5A 3U2QA 5JZVA 4QM7A 1P2UA 4LJAA 3DL0A 2QAGA 1G3QA 3OE7A 3Q5EA 2ODWA 2W83A 3GJXC 1U90A 5H68A 2VBCA 1AGPA 3VX3A 4B3FX 1Q3TA 5L3QB 4JVLA 4H9GA 3RS2A 5J5CA 2FV8A 2Q6TA 3BRWD 1HURA 4BFWA 2Q21A 4D2IA 4DJTA 1AKEA 4EKDA 3VNUA 1XEWY 1KI2A 4BFSA 4YXWD 1OHHD 3U3KA 2N42A 3EAQA 1GP2A 4FW9A 3IDQA 1IOZA 4EQ6A 5IK2D 3RS3A 4BE7B 1XDBA 4LHYA 4YONB 4QGHA 4ZPXA 1Q1QA 3ADBA 3U3OA 2QRNA 2QUZA 2QMHA 4M1KA 4GL2A 2OFOA 3ZVNA 4OBEA 3B1ZA 4DLWA 4DB4A 4C0AC 5KHOC 4JLNA 3TR5A 1Z0AA 1KYIA 2HXYA 4RKEA 4WXRA 5FUYA 3K70D 5K8TA 4DZZA 1R0YA 3QEOA 5C4MA 4HLUC 3ZYCA 5IF9A 4PQFA 1X8LA 4MRRA 5JWOA 1Z63A 1LS6A 2O8BB 1UDWA 1XZPA 1IN7A 1E0KA 1KK2A 4P4SB 4RJLA 3RRYA 5FUWA 4IHQA 4HLDA 2ZYTX 3ZS8A 2E87A 1DELA 3LV8A 4G5OA 4RZ2A 2FSHA 3KKQA 5F3WB 3W8NA 3K53A 2O52A 4OI2A 3GPLA 3R9XA 1QDEA 3PXGA 2FN4A 2Z6VA 3BORA 1YR6A 1KI8A 1VECA 5GJWC 3NDBB 1IHUA 1QZXA 2IYXA 4M9QA 2MSCB 1E99A 1ZU5A 2IYLD 1KTVA 2F1RA 3LDAA 5JSZB 2JAQA 3JZAA 1CS4C 4PZZA 5LBIA 5J4VA 4D82A 1M74A 2D62A 3A6PC 5KDOA 5JS7A 4M1TA 5FBLB 2CL6X 4UKDA 3PJRA 4QGAA 3O47A 4LDJA 5D3QA 4EAQA 2H16A 4KU4A 5FOXA 5HCNA 5SZIA 3FHTA 4M9XA 4R2IA 3EX7C 2EFEB 3NHAA 1Z06A 2HF9A 3W90A 5AUPB 1BYIA 1E2MA 3L82B 3QY0A 4JLDA 4R2HA 4CVNA 1UBEA 4XJXA 1R2QA 4MRNA 4A8JA 2G83A 4AYXA 4A1FA 1W0JA 2NQ2C 4BECA 1YZLA 3AKDA 4NL4H 1FQJA 1QHHB 2OM2A 3BS4A 1P4SA 3DM9B 5DHAA 2WKRA 3WMEA 4PPNA 4CRWB 3IQWA 1DS6A 3U7GA 3AM1A 3C5HA 2ASEA 3RS4A 1IY2A 3X1ZA 1HT1E 1VPLA 1TAGA 4D4LA 5HE9A 3GLIE 4D4JA 1JR3D 3VAAA 2RB4A 2QEQA 2GJSA 1IN6A 2CL7X 2HLDA 2ZVPX 5H1YA 4XH9B 1Z0JA 5KOYA 2CCGA 1W44A 4CEJA 3WNBA 2HDNB 2CVFA 1E94E 3TGPA 2V6JA 4IFBA 2GJ9A 2H1LA 3X1YA 1BMFD 3C7KA 5C18A 1N5IA 1XU4A 4C0HA 3MJHA 4Z1MA 2WWXA 2ZSBA 4Q00A 1CR1A 2FOLA 1SKYE 2QM7A 3M4YA 2PZFA 4X8HA 3J81k 2P0EA 1ZUHA 3AVOA 4G3XA 2EWVA 1GKYA 4C0JA 1TUIA 2OUKA 2PZGA 1E6CA 3O8BA 3RDPA 4EPVA 3FFBA 2VL7A 3CPJB 4LJ5A 3CPEA 2CBZA 3DVLA 3B13B 3VR4A 2A78A 2FSFA 3CH4B 3UG6A 4JT2A 5FBWB 5C1BA 5J4KA 1XMSA 2WWYA 4TLDA 3U7HB 4A2PA 4DEXA 1MABA 1G20E 4JJZA 3DDCA 4ERNA 1TX4B 3IHLA 2GAAA 3PEUA 3Q72A 3QNUA 1AZTA 3IBYA 1H8ED 4QGFA 4M1WA 3SJAA 3CWQA 2QZ4A 4FWIB 1AM4D 3GMTA 2JJ2D 1TF5A 2CMKA 1NVXQ 3TIFA 1G16A 3QPVA 3L0SA 1NLFA 1RRGA 3VR2A 5FR1A 3ZDQA 4DCNA 2XZLA 2GCOB 2OO7A 1FNNA 4TSFA 2A5GA 2XTMA 4C0KA 3CRW1 4JKYA 2RGBA 1XPUA 2ANCA 3R8FA 2JLSA 4J0QA 1F2TA 2GWHA 2V7QD 1D6JA 1OXUA 2QU8A 4CW7A 4GMDA 2TMKA 4ACBA 3QPUA 2F1JA 4HEJA 3K70C 1QVAA 3U6BA 1F5NA 1DAKA 4F91B 1LS1A 2P5SA 3KB1A 4Q21A 2DWPA 3LWNA 4PC1A 4Q1BA 1XPRA 4Q1FA 1JAIA 4LYAA 3K0SA 1D8TA 3B78A 3W3ZB 2ZI4A 3ZQ6A 3BAFA 1YR7A 1P60A 1DAIA 1UFQA 1YZKA 4V0OA 2VP2A 5DSZA 2ZREA 1TEVA 4PFSA 4IOMA 5JEEA 3KQUA 3QEJA 2F43B 3CNOA 1US8A 5FOTA 4IDQA 4XD7D 1E4YA 2J7PD 1E96A 3DKVA 3EPKA 2H17A 4DLVA 1R5OA 2IF2A 3PVSA 4RKFA 2E1RA 5FBQB 2D4HA 5AWFC 2IF0A 4EJSC 1W46A 4II7A 1WCV1 2VYFA 1UKYA 1KI9A 1YR9A 3SOPA 2J0VA 4A92A 5BN4A 3IIKA 2JDIA 4NCIA 2QL6A 3F3YA 2JLZA 4A9AA 3B8HA 3BERA 3NVAA 2CJWA 3NWJA 2D2EA 2O8DB 1IXSB 3A4MA 3TJZA 3QUSA 4RD2A 3SHWA 2J87A 4M1YA 2B7CA 5F9FA 1ZM3A 1OB5A 3GLIB 3W6PA 4HUQA 1EG7A 2EFGA 1AS2A 1GNRA 2IXGA 2O0HA 2R6AA 2ZANA 3T1OA 4AURA 2OBLA 1Z6YA 2JEOA 2W2TA 3MRSA 3AKYA 3K0CC 4GMXA 4KHZA 5KPJA 3ZVLA 2MSDB 2VHJA 1LTQA 3E5HA 2W0MA 3VU9A 4GPTA 1Z6GA 4IRUB 1E9DA 1Z0KA 5FI0B 3QE0A 4URWR 1N5LA 2QAJA 1M34E 1SKYB 2IYUA 3MWYW 2JIZA 4XVQA 4JMPA 3GJ5A 4RD6A 3K0AB 4M0LA 4B2PA 1TPZA 4EPRA 1QRAA 2C78A 2V6IA 3Q8XB 2UVQA 3K0FA 3C8UA 1Z47A 5JJKA 4AKEA 2XNSA 1FNMA 5KDLA 1UKZA 2WWFA 3B7GA 4AG6A 1GNQA 1I4TD 3ZIAD 4BQSA 2A5FA 4DXAA 4BRUA 4RFSB 3N70A 2O8EB 4LYJA 4W5JA 3RS0A 2R6CA 1K8RA 2NTYC 3T35A 3T1VA 2W6JA 1B23P 1PUJA 4ZCIA 4PPQA 3FKQA 3TVDA 2AKYA 2ZRGA 1SVMA 2ZE7A 1U0LA 1ZD9A 3LA6A 1G8HA 2IL1A 1N6KA 4NKRA 5GJVC 4MDEA 1JR3E 3LLUA 1FTSA 2J0UA 1T3SA 1JAHA 3WYGA 1LNZA 2SHKA 1HV8A 1VHLA 4QBFA 4JBYA 2AFHE 2GJKA 2NZ8A 1UDXA 3NH6A 2N1BA 2IYQA 4FMCB 5LPNA 3BH7A 2ECKA 1E79D 2W2XA 1NG9A 3EW9A 3W34A 4D25A 3T61A 4ZKDA 2DBYA 1NBMA 5E7IA 3QXSA 3SQXA 3RC3A 4M1MA 4PSVA 4H1VA 4WW0A 4R71A 1D9ZA 2DFKB 2I4IA 4WOPA 4D6PA 4NPHA 3CF6R 4B33A 2G88A 4TMWA 1KO4A 3AP1A 1E2LA 1G8GA 4R7ZA 5EE0A 2JJ8A 2PJRA 2DWOA 1KO7A 1MR3F 4DCTA 4AD8A 5KSZA 5L3SB 2CNWA 2IHBA 1CXZA 3OF5A 5CM9C 2O0KA 1G5TA 5EZ5A 4PO8A 3OEHA 3K09C 1GFIA 1JEDA 3K1JA 2R65A 1KKMA 2ZRIA 2PLRA 4BPBA 2BOVA 4HLUA 3BE4A 3AF4A 3LW7A 3LAWA 1E2GA 4WAUA 2JATA 2ORVA 1F3OA 1HE8B 3K70B 2IUTA 4NHOA 4F93B 2H8KA 1VG8A 2ZRAA 1TQ4A 1UKVY 3NXSA 4DT1A 3BWDD 1MH1A 5G40A 1DARA 1R8QA 1W4CA 2KBFA 2ZRPA 3AF2A 2XX3A 1EFUA 3KJIA 5JLJA 4LJYA 2DB3A 2FDCA 1ZYUA 2GCNA 1G21E 4LCBA 2GZAA 1TUEA 2GILA 4YMUA 1W4RA 3MSXA 1CR2A 1E9RA 3T12A 4EJSB 3IUYA 1OE0A 2DFNA 2ZS7A 2IYVA 1EWRA 4FCTA 4PAQA 4RZ3A 5FPTA 4FWTA 3NH9A 1Z0DA 4EFNA 1OH7A 3ND9A 5DE3A 1NVVQ 2ZRCA 4PR0A 4OHZA 5DI3B 3ICQB 4HB3A 721PA 4C4PA 3D3QA 3LO5A 3RYTC 3ZD6A 2ZRFA 2XB4A 2OCAA 4JYBA 1UF9A 3PR1A 2W6ID 2XNDD 4TYQA 4MYHA 3MUFA 4QBHA 5AK0A 3TVTA 1T8TA 3OESA 3SS8A 3THWA 1HYQA 1E2KA 3QKRA 1KSGA 3SBDA 5LB2A 4MQBA 4DC9A 5CB6A 4NYMQ 1RZ3A 5SZKB 4PHFA 2IWRA 2PJZA 621PA 1OXTA 3HU3A 1WQ1R 1CR4A 4MKHA 1M1YE 1X6VA 1VG0B 2GJAA 1XEXA 2ZYVX 3SI7A 1OSNA 2ZR0A 3KKPA 4C3ZA 2IA5A 3QXXA 5ELXA 4MGYR 3ND8A 3QIAA 3QBVA 3PCRB 3T1QA 2GZHA 3B1XA 1A2BA 1GILA 1JECA 3EC1A 4LHWA 5EE9A 1E2EA 2CHQA 5E95A 1NSFA 5FTMA 5TARA 4BLOA 4C0QC 2ZJZA 2WJVA 3ZZTA 2FNAA 1IY1A 4TT3A 1DPFA 2IXEA 4HATA 3KQLA 1P9NA 1SXJE 1XJQA 3MAAC 3RRZA 4TZ6A 2PCJA 1GIAA 2Q9AA 4XWOA 1NSTA 4AI6A 1N6PA 3AVVA 2BEJA 1C1YA 3NBZC 3RVBA 1XTQA 2ZSEA 4M9SA 2YYZA 3Q85A 1G3RA 2MMGA 4KXFB 5DHFA 3SN6A 3W5JA 1NIPA 2Z43A 4FMDF 4LYHA 5TVKA 2RHDA 4XSHA 5IDVA 3CF2A 3NC0C 4MKIA 4QL3A 1S2MA 4JLKA 3ZJYA 3BH6A 2ZE8A 3WMFA 5JHGB 4LJ9A 1NNEA 3I62A 4WZBE 1UKEA 3THYA 2P6NA 4GOXA 3N2IA 2PMKA 2R62A 4OJQA 2LWIA 4OI0A 1AQYA 4O2LA 1T3HA 1GRQA 4LV5B 4JVMA 5JMTA 2ONKA 3UATA 2ZJ5A 3WP0A 5FI1B 3AQ4A 3AF0A 3DOEA 5L3RA 1JJVA 1IXZA 1KAOA 2OAQ1 3EWAA 4FMBB 1IM2A 1BKDR 1HY3A 1A82A 1PUIA 1U9IA 1G8FA 4GOJA 3QI2A 2QN6A 2RGAA 4YMTA 2V4ZA 1KZ7B 4B3DA 3PQCA 4MKGA 4KSBA 4AY2A 4ITRC 2GHIA 2ZROA 4LX0A 2R6FA 1JI0A 2BHRA 1OFUX 4HLCA 3KL4A 4TL9A 1DBSA 4Q18A 1OPXA 2FMXA 4CT4B 3IBGA 2FZ4A 2Z4RA 3E70C 4ON9A 3TBKA 3PENA 5JI2E 4HDCA 4IEIA 1W4BA 2AXPA 5HKKA 2X8AA 4HAWA 4JVNA 2EFHB 4L15A 5BN5A 1YJ5A 4BFVA 2ANBA 3BH0A 4N1AA 1U2RA 1W2GA 5HTKA 2CK3A 5AUOB 1A7JA 3DM5A 2VHCA 3U7EB 2ZYUX 3CW2A 2WWIA 3G0HA 1IN8A 2VHUA 2QTHA 3H86A 5FOUA 3OAAA 4B3BA 2V8OA 4UNRA 2JLWA 2JLVA 2BBOA 4ESHA 1FMJA 4V0LA 1GG2A 3R9WA 1UBFA 2DWQA 3VKHA 5A5GA 1N6OA 3HR8A 2DYKA 3H84A 3CH5A 3I1FA 4Q19A 1U8AA 4DLZA 2PLFA 3GJ7A 3RLFA 4M8NE 2WMNB 5J47A 2BMDA 5H8WA 3G82C 3SQWA 2ZEJA 2BWJA 2GBLA 3FKSA 1G6OA 4U5XA 5EXTA 4DDUA 4M1OA 2VPPA 2NO6A 1SVSA 3I8SA 2ZPTX 2RGXA 5SZHB 2HEIA 1ZC3A 5DH9A 2D7DA 4AK9A 3SR0A 5KO2A 2P6RA 4C7OB 1OJLA 4B35A 3U4QA 3K0CA 3QPWA 4Z8YA 521PA 1OB2A 2ZAOA 3HYRA 2BDTA 4OI4A 3GLHE 2QBYA 2ZJBA 5FUXA 4ARZA 2EFDB 3EZ9A 4AYWA 1SXJB 3QENA 3A58B 4P4UA 3U6KA 1YZTA 4MYTA 4R98A 2BKEA 2YWFA 1OH6A 3IEVA 3OIWA 1K5DA 3R9IA 3QF4A 1IQPA 4JLMA 1P2TA 3BJIC 3W5IA 4X8MA 4BLPA 4G1UC 3FOZA 3B5JA 3B60A 2IUUA 2A5DA 5FBVB 4M2LA 4A2WA 3CWZA 1L4UA 4LC1A 4W9MC 5L3VA 6Q21A 2ZS9A 3FYHA 3VR6A 3E2IA 4TTPA 2NIPA 1E9SA 4YMVA 1WB9A 2J46A 2IYSA 1BMFA 1KI6A 2WWGA 1N0UA 3V00A 3TAUA 4I1UA 2WVJA 3QKSA 3GLFA 1G41A 2ZIAA 4EUNA 3ADDA 3DZDA 3U61B 2O8CB 5DYIA 4KI0A 4NMMA 2FU5C 4PHGA 1E9EA 5AUQA 4AKGA 4W5HA 2BJWA 4Q7LA 5CJPA 4WIAA 3D7MA 1W1WA 5EP2A 1WDTA 2V9PA 4Q48A 3T06B 3ADCA 5C4GB 5GADl 1E69A 2UZ3A 4V0KA 4RCZA 4Q4AB 1ZIPA 4S2EA 4TYPA 2YZ2A 4Q4JA 5J40A 2GAOA 3FMFA 5D3MA 2ZUDA 1YZUA 1WBDA 4I1VA 4OYHA 3U5ZB 5B57C 5G53C 5FTLA 4WA7A 1I4LD 4HZIA 3K9LA 1CR0A 5B2ZA 1EFRD 3TAHA 3BB1A 1CJKC 1OKKD 1M7HA 4G5SA 1NLZA 2XTNA 3IO3A 4ZIRA 2BIFA 2ZI7A 3AVXA 1KDPA 1E0JA 4B3XA 1XXHA 4HLQB 1M7BA 1GRRA 1FOEB 1RE0A 2GZDA 4QRHA 5FTKA 4BFXA 5FPSA 1K6MA 1G7TA 4PHTA 2ZRNA 1WP9A 3TKLA 4YMWA 2X77A 2F9MA 3FE2A 2G6BA 1T0HB 4TQUS 2OCPA 2NO1A 5HR5A 2O0JA 4MKFA 1KI4A 2A3RA 2QT0A 3V4RA 4ASUA 1E2NA 1E2QA 4ZI3A 4LHXA 4JL5A 3EZFA 4GSYA 4KBFA 3VMFA 1NLYA 3C15C 1R5BA 3GFOA 4URXR 4A15A 3ECCA 3UMSA 3VX4A 3KZ1E 4Q9IA 2OCBA 1QHGA 5B64A 1G5PA 5B58C 3LH5A 221PA 2QP4A 2ZSFA 4YDHB 1MRSA 4B6FA 2ZI6A 3PUVA 1E9AA 1XF9A 4IOJA 1AJEA 1XTSA 3PEWA 2XEXA 1X1RA 4PZYA 3GLHB 2VA8A 3KB2A 4Q4HB 5CIQA 1NY5A 1KI7A 4DLUA 3A1SA 2DPXA 1E2JA 4MH0R 3X1XA 1KK0A 4QHYA 4E22A 1VTKA 1WE2A 2FPKA 3F5FA 1PLJA 1GAJA 1F60A 3LBNA 3T1TA 1U94A 4NCJA 3GCGA 3PIRA 1OYYA 3OIVA 1GTVA 4ZCLA 1F2TB 1Q1BA 2IS2A 2BCJQ 4B71A 1AN0A 3QQ5A 4JJKA 1QBKC 1JJ7A 1KNXA 1N5KA 2JLXA 1F2UB 1FX0A 2B92A 4GP7A 3TSZA 3LX8A 4LC0A 4C0LA 5KNBA 2V1UA 4OQXA 1U0JA 3NBXX 1N6IA 2QG6A 2QMEA 1NJFA 3HWSA 4LWZA 3NBFA 3IKJA 1IJEA 1AZSC 3EZ6A 3P4YA 3LVQE 1GM5A 3SEAA 5EZ6B 2QT1A 2WIBA 4XTCS 1T4GA 4OQLA 3I5XA 5CITA 2QP3A 4TLAA 4OQNA 4BFUA 1US8B 4Z8XA 4BLSA 3NHBA 3R7WB 3MD0A 1GZSA 2ZRHA 4GDFA 2XB2A 1XCGB 5JFGA 3WYFA 1Q20A 4NCHA 5CIWA 3TUIC 1ZUNB 1R8SA 2X1VA 3LBIA 1ZC4A 3B1VA 5JBQA 2MMCA 2D2FA 4LV8B 4CEIB 3L8ZA 4CEHA 3VFDA 4EFMA 3M0EA 3A1TA 2CJWB 1SKQA 1T5IA 2F6RA 2H7VA 5IRCD 4X8LA 4LBVA 1II8A 3CONA 1LY1A 4G0NA 5HZKA 4JIMA 2FWRA 4Q03A 1KDTA 2OSBA 2OESA 1DVRA 4HAVA 3BIFA 5EE5B 2ZTSA 4L8GA 3U60B 1Z3IX 3PG5A 5AJWA 2N46A 2YC2C 1E79A 1J70A 4NYIR 2A2ZA 1MT0A 1XMJA 1JB1A 3VU9B 5A4JA 1UM8A 4LY6A 2CL0X 4A0HA 4TLEA 4IDOA 5BYJA 2JASA 3PUZA 3SFZA 2R6DA 1S4QA 1HUQA 4F38A 1XWIA 1U81A 1E1QD 2GESA 2ZITA 5L3QA 4PX9A 4F7WA 1AKYA 1N5JA 2GXQA 2BKUA 1JXMA 1BIFA 4YQFA 3AGQA 5LD2B 3ADKA 1R7RA 2C99A 4B48A 5KUTA 2F3RA 1FP7A 3KQHA 1ZM9A 2C9YA 3L0PA 1HA3A 2WWHA 2OEPA 4B3CA 4G5RA 4KYIB 4MYUA 2VSFA 2XGJA 3CUEF 4XWAA 4R9UC 5C46F 2B7BA
chains in the Genus database with same CATH superfamily
1I6MA 3PE3A 3Q6IA 2WJIA 3DMHA 1TCUA 1V4VA 4HDSA 4HL6A 4RIFA 5DISB 2VNAA 1Z28A 2P6UA 3I01A 3INTA 3R6WA 3L8GA 4WOKA 4GT1A 5KTMA 5AXDA 4WCFB 3TLKA 1JLHA 2JCSA 1E4EB 3DEAA 5D86A 5JNWA 3SDZA 3Q88A 3MLBA 1HQYE 1HYHA 1TJ4A 1WB5A 2FGJA 4KIWA 4MI9A 5SYMA 1RWBA 5BYAA 4AS1A 1QKIA 3JWEA 4WDQA 1EE1A 2RHLA 1B8VA 3OE1A 4TTSA 1KFBB 4Z9YA 5HS4A 3HB0A 4DJAA 2FPLA 2PBZA 2WHRA 3NIFB 3T4UA 2VUSA 1P9WA 4MKXA 1J7KA 3AJ8A 5ESDA 2CC2A 1E1RD 1GEEA 4LJ8A 3OZ7A 3C3PA 4W9NA 5CYPA 2G9UA 1FPMA 3JQGB 2J07A 1W5SA 4LSGA 4R9NA 2W2VA 2RH5A 1YR2A 5K8JB 1A5BB 1GL9B 3HADA 3E18A 3QE4A 3IURA 3KKOA 1AZWA 1OLUA 4XIIA 2WICA 4HWKA 3V8MA 3ZTTA 4JLJA 5A0FA 5J4YA 4DBVO 3G9ZA 4HI0E 1J42A 3PXXA 2ZJOA 4Q01A 5TQVA 4CDRA 1NR7A 1I80A 2YYAA 2A9RA 1CZKA 1ISFA 2GYWA 3OFND 5AKGA 4OKNA 2OCLA 4E5UA 2HMVA 5JSZA 3O2QB 4G65A 1GNPA 1KJQA 4H18A 2VF4X 2W00A 1XNHA 3KYIB 4JOSA 1SC4A 2AWOA 4OAQA 4DHWA 4C14A 4ZYZA 2XGOA 3DQPA 4JC0A 4KWHA 3WLQA 3CRVA 3EWSA 3AEUA 3TFWA 1BVUA 3BYZA 4CMAA 1Q3KA 3O83A 1CX9B 3G1TA 1KY2A 1C14A 4G84A 4MJLA 4CIYA 1HFWA 2XDAA 4G0PA 5T41A 2Q4DA 2IZOA 2YNMA 2I6XA 1N3YA 3JQ9A 1Q12A 3HQ4O 5FAXA 4TTIA 3BXZA 3OQIB 4ADSG 3D3EA 4BDSA 2XXAB 4YK7A 2J09A 1E7MA 4UXIA 2IIBA 3TNFA 5KC9A 1R5NA 1NPTO 1XRJA 2B8EA 2BGLA 4LOAA 1Z74A 1WP4A 2JIDA 4MZXA 4YAEA 4FOPA 3VHXA 4RH0A 3I2HA 1E5DA 4CKBB 5M34A 4DV1B 3OIYA 4IGFA 3K5WA 4QVIA 1YQGA 3HLKA 4CWAA 4A4DA 3TQFA 4ZJYA 4N76A 5M04A 1DZ3A 3I6ZA 2H5EA 2DWUA 3EVZA 5B30A 2WA1A 3TL3A 2AMFA 3PNBA 4U2CA 3OZCA 3NFYA 1P3JA 1YVRA 2Z5FA 1Y5IA 4R41A 1JHQA 5KQSA 2IUSA 4B2LA 1FJGB 3ELUA 1B2LA 2F8SA 3FZNA 4HMPA 2Z1NA 5EIAA 1L7BA 3EH1A 3MJVA 1HTWA 2AEEA 3K9GA 4RQTA 2AUTA 3Q0TA 4QPDA 1NQAO 3TH5A 5CA1A 1EMDA 2WPDA 1J49A 3V8VA 4U2KA 3PHLA 2LKCA 4BZQA 2CW5A 5T6MA 3HBJA 4KFUA 4Y2HA 1USKA 1V7ZA 5TMPA 3AJAA 4JP5A 3LY7A 1AA9A 2VP6A 3H2GA 1AKNA 2V7BA 4ER0A 2QL7A 5CM2Z 4DB2A 3IFSA 1VLMA 3PHGA 1V2HE 2BV3A 4FFBB 4I1OA 3QA3E 2Z1DA 5DEIA 5FIUA 1DGQA 3FBGA 3PF9A 2CXHA 2QRPA 2AXEA 5K05A 1FLNA 3KJHA 5C53B 3DLBA 3CT4A 1IJFA 4XX0B 1NYLA 1UXOA 3AZOA 4XUDA 5JWHA 1JDSA 2YIDA 2A58A 6AT1A 3U9LA 4DEYA 5A9SA 2AXQA 1RFGE 2J7KA 3ZX4A 2ZSHA 4WOJA 1M2VA 4HEHA 3A32A 1HT2E 1VG9B 2OY0A 4RU1A 3TIGA 4MVJG 2WTXA 5AVUA 1DOZA 2GCOA 5G0SA 2RK3A 1Q74A 3SHVA 3GNSA 2ODPA 1NJ6A 4P7GA 5AHWA 5F78A 3N2GA 5EJGA 4R6XA 2RHHA 3C6KA 1FA9A 2DMRA 2F67A 4CLDA 3SIXA 1RYFA 2R8RA 2ZRBA 1Y1SA 1GLNA 2WJGA 1JEOA 4MS3B 2GNOA 4BZXA 4OU4A 4BMDA 3P9PA 3WMRA 5A5EA 1RI3A 2VYCA 1HSZA 3DL4A 1Z7BA 4MR7B 1M8GA 4RTSA 3D6AA 4V0ME 3TS1A 2GEKA 2CHGA 1G7RA 4GOOD 1TF7A 2AOWA 3AUTA 5KVQA 1LWNA 1ZUD1 4FGZA 5FA5A 4G6ZA 1FL9A 3AUAA 4C7JA 1V1JA 1G59A 3B9QA 1MB9A 4UZSA 1P2SA 1Z8FA 2GLUA 5DHQA 3E8XA 2WKSA 5EKUA 4AUKA 1GU0A 3R5TA 2F3SA 4IJ5A 5JAIA 4M49A 2UZIR 4Q7KA 4RD0A 5E4YA 3TRFA 2XYVA 3PXCX 2ZRJA 3FSJX 4JZYA 3CRQA 5JBIA 2FP4A 2X40A 5FNVF 3GRUA 4JB8A 5BWMA 4YRQA 2C8JA 1FBNA 2XB6A 3GPBA 3HWRA 4ZO8A 3CYFA 1A77A 2I4LA 1AHHA 4ZXFA 4BDTA 4UTVA 1IY0A 2NXWA 1K68A 1NUSA 1MPXA 1TJNA 4S0XA 4D3XA 2EF1A 1QGUA 8GPBA 3VAZA 2JBAB 5CFNA 3QHQA 2LGJA 2VWPA 4JT4A 4KYVA 3W2FA 1XL0A 1B2RA 3G88A 3UXYA 1QWOA 4IYJA 5JXIA 2QQFA 3C8HA 4LF9B 4PY2A 2J9RA 1B16A 2C8KA 5CBPA 3MMPA 2Y9MB 1KAMA 4JBXA 4IIBA 4TLBA 4IG9A 3AJ9A 3E84A 3KCQA 2IYYA 3OKCA 3DZBA 3I9KA 4QE3A 5IJAA 4WBXC 5A7HA 3GJQA 2NYVA 4FGKA 1CEEA 1V11B 1L4YA 3KJQA 4EENA 5BV2P 1MP0A 1UC4B 2TS1A 2I76A 4INPA 4LZZA 4ND3A 1YQTA 4G0OA 1UEIA 1HMYA 3L0BA 4FXPA 4MLPA 1V4BA 3FNBA 2VHYA 1K06A 1RZVA 4PC7A 4BZZA 2Y8EA 1P62B 1I4WA 5MF6A 1K7FB 3LFUA 1ZCAA 3ASVA 4OXXA 1DTSA 3HB9A 4ID9A 1TGVA 2MU1A 4UCWA 5HCUA 5FBRB 2WYOA 3HKDA 4DR3B 1CF4A 4MX8A 2FFBA 3QJYA 2ZM5A 3C2QA 3KQPA 1D2RA 2A33A 3AYXB 1A95A 2Z2IA 3WL8A 5K9ZA 1CCWA 2JEZA 3EF0A 4NZYA 5ADHA 3PEFA 2XYQA 1TMOA 3WHPA 1L7XA 4YMSA 1EM8B 4Q9DA 1CEXA 2XBUA 4D4HA 1IJKA 2J9YB 3IC5A 1QX3A 1ADGA 1VCHA 2CVQA 3MVEA 4OOEA 2HYIC 2BZ0A 4ROSA 2BBSA 1GPKA 3TPZA 3WKBA 5MGNA 2I4NA 4IIUA 5B2EA 5IYZB 3IKVA 1AK2A 4WEOA 1VLVA 3QWHA 4JEMA 3UQYS 1R66A 2ZRDA 1A1SA 2VWHA 3LC0A 5BXQC 1V37A 4BMCA 3KK0A 5I6DA 2B3DA 3GXBA 2G9NA 4JJ7A 4KQGA 3TNJA 1LBSA 3A7DA 4TMZA 4XJSA 1D6NA 1QPZA 1VKNA 4HAYA 2J9ZB 5LLSA 4KNYA 3FY4A 1P29A 1VLHA 1JEJA 2A5JA 3EUWA 4NYMR 4DUGD 5I4BA 1QG2A 5BQPA 3LK6A 4Q7QA 2AUNA 3C14C 4JSYA 2C04A 3L1UA 3SC2A 3II6X 4CM6A 5DM70 1U2ZA 4QDJA 5KQPA 2WQ7A 1N5DA 2X6TA 4MVJE 2YUIA 1KIMA 3MLAA 3IJPA 5F76A 3U31A 2JAPA 2WZCA 2KM1A 3B5EA 5F7ZA 3WOHA 4RTQA 1JIJA 4Y2VA 3ZC3A 3QPBA 3GRFA 4H1HA 4P7JA 3KUDA 5KAMA 1NXQA 1DKPA 4F1JA 1U2DC 2ZT6A 3SMVA 5MFZA 3EVDA 4D9HA 5JVDB 2AK3A 3LQKA 4YAOA 5DLPA 4DBLC 3JSXA 1KH2A 4ZQCB 5HQ3B 4IXWA 3DOOA 1VL2A 4C0SA 3AGPA 3FDZB 5IMBA 2Q8NA 4B3MB 1ZVMA 2NSJA 3LGAA 4R8MA 1EB9A 1BKSB 1I01A 1N9KA 5LZ9A 1NPYA 1YJ8A 2C4KA 2Q29A 2QORA 3R3XA 4LZJA 2R2AA 1IM5A 3DJYA 4KE7A 4Y2QA 3I5YA 3FDFA 1NP6A 1ZKDA 1P61B 4GYWA 4ZHQF 1N8NA 3G3EA 3LDHA 5ARBA 2XOKD 2YIJA 1K66A 1Z5GA 5DBHX 5E0KB 1VIYA 3M1LA 5J63A 3TSCA 1U0RA 2WUDA 5COQA 3JATB 1SULA 3FVTA 1G5QA 1LX6A 3U40A 1I13A 1Q0LA 3D4OA 4JQOA 4JYCA 2LV8A 3ESDA 1ZG3A 2G28A 4TMKA 4X9XA 1EBBA 4J3NA 2NZUG 4YV1A 4QZVA 3KSMA 4YH1A 3V4OA 3KT8A 4BASA 5JAUA 3M3PA 2CUZA 4JBIA 3W2IA 1A4UA 2Z8ZA 2DP4E 5IFKA 2XNJA 3D1JA 4R1OA 4Y98A 4IOKA 3N0TA 4GL4A 2DTDA 5FLEX 4EVQA 4EJSA 2QK4A 4ZRMA 1U7OA 4KDCA 5FWXB 3N8DA 4IS3A 5AJYA 5J2TB 1NOKA 2RKWA 5FPKA 1E4OA 3L6UA 3HH8A 1MENA 4ESOA 4KP7A 3AO0B 3ITDA 1QFJA 2QP9X 2RAPA 4UM8B 3SDBA 2R1VA 5ENZA 4BNTA 4ZV4A 4CYMA 1RTKA 2LDXA 3UOWA 2IY9A 3KWMA 4HDMB 4IYRA 2HMYB 3TXAA 5JHHB 3AF6A 4WHMA 2WW8A 3A9VA 3GEEA 3GUZA 5EWLA 4BJ3A 2QLLA 1AKRA 2A86A 2RCNA 4GS5A 3QLTA 4RHEA 3QXCA 1XTKA 4OP2A 1N6RA 1EVJA 2WTNA 1CE8B 3HGTA 4NONA 2IJGX 1NMYA 3ZGLA 5T4BA 1REQB 1YO6A 3VC3A 4BLQA 1Q84A 2X13A 2V7XA 3BXEA 4RY2A 1FFCA 5AI5A 4FKBA 2W8ZA 4OK5A 4IDHA 3QFSA 4UJ5A 1CDDA 1U8TA 1X7DA 2EW1A 4IO1A 1DBWA 2OCXA 2IWHA 4UTNA 2BMFA 1O0BA 2O2EA 1JTFA 1BNCA 4DWJA 4JEUA 2XUGA 3EAFA 3CN9A 5CB8A 4UXHA 4LF4B 3PNKA 3ORFA 3RJ9A 1R6VA 1GQSA 1L5SA 4C1NA 1LBQA 1UK7A 1LPSA 3HKBB 3JR3A 3M5WA 3QX9A 2V7PA 3JVEA 3O3OB 4AQ7A 3ZJVA 5L8VA 3S2SA 2FEXA 3CZ4A 3K32A 1ZW6A 2YFKA 1YUBA 2C96A 1G8MA 4KE6A 3I8XA 3G9QA 4D02A 5IJXA 1JHMA 1L5YA 4EHLA 4XRGA 2ENUA 5ADUS 4DVGA 4C2AA 2AFIB 1EI9A 1PR9A 2H7XA 3UMBA 3QLJA 4F4JA 1YNOA 1Y3IA 5F3DA 3AVTA 5J5VA 1VL1A 1KOLA 1W2WB 3ZU4A 2RGEA 1MDFA 2CYCA 4L8LA 3AVYA 3QELB 3S5UA 3TO5A 2FH5B 1VJ5A 1Q1ZA 3SXPA 1A9XA 4WZAA 4CG2A 5E1BA 1DEXA 2Q6IA 2E18A 2ZJ2A 1YS7A 3GF4A 3FCAA 4C30A 1RM5A 3N28A 4X6UA 2BR5A 5CVDA 3OIFA 5IT5A 3PEEA 3WNZA 1KO1A 3A9RA 1UL1X 1VHDA 1IHXA 2I1QA 4GI5A 4B0PA 1YL6A 2HSGA 3ASUA 4KOEC 1FDSA 1SBCA 3BXOA 3EC2A 3MTEA 4HAIA 3U3ZA 3NT5A 5AVQA 4KXNA 4MITA 5HIIA 3UJ3X 5B1SA 2FR8C 4JI1B 4F8JA 4CMCA 1AK9A 2JCVA 4LJ7A 4BEVA 3LPMA 4S0ZA 3EOAI 1VHWA 1PRYA 1QM5A 2JJYA 2IZ0A 2OKGA 2NLOA 3TNLA 1WEKA 2YS7A 1K8ZB 3WNDA 5FUVA 5BQ5A 2OE2A 1AGRA 1XQ9A 2XMSA 4LDRA 3VTKA 1W88B 3QITA 2UUCB 1SN7A 2JJ2A 5A9TA 5TPZD 4E5NA 3P94A 4QXMA 7ABPA 7ADHA 1YI1A 2EBFX 1TM7E 3SY8A 1H1DA 2YZGA 4IW3B 3BG5A 5AKEA 4WBNA 3FVRA 4MPPA 5DW0A 2W2NA 2ZETA 5DIZA 3ZI0A 3ZKWB 3AVWA 1NC1A 4NDAA 3SBEA 4C4XA 4PHCA 4UU7A 2V7QA 1P7ZA 2UVDA 1G21A 4OGKA 1F06A 2GA8A 3CF4A 3AT1A 3H0EA 3PV0A 4KQWA 4OHCA 3U3JA 4ZDJA 1C9JA 1UC9A 4HDKB 2AC7A 4I81A 2XB8A 1ANKA 2I80A 4MTLA 4LBYA 2YHBA 1E1RA 4AJ9A 1EUYA 5FH9A 1PSZA 1KZ1A 4PYNA 5UKDA 3ZV4A 1ZRHA 2NAPA 1LZKA 1A8SA 3P1JA 4NU0A 1QTRA 3FMOB 1KNQA 1H6BA 4J0JA 5DGIA 4U7TB 3RWOA 3FCUB 1POXA 3CLRD 2VO1A 2BFBB 3ZHSA 1DC3A 2MYNA 2YHUA 4OSPA 3M49A 1NKSA 1ZEMA 1ZXLA 4V0RA 2OM6A 4H3HB 4KFRA 1KVUA 3ZDZB 3ZNPA 4ZMRA 2IV2X 4ENWA 3OFNA 1ZMXA 3HA7A 3QOXA 4Q4LA 4ECAA 1TVKB 1P3DA 4P92A 1KARA 4H0CA 3D64A 3WS7A 2QPTA 4PIMA 5DOZA 1QCDA 3EDOA 3EZNA 1D09A 4G26A 1SOUA 3SBXA 3DPUA 2J48A 2MINB 2WY2D 1QKJA 3LE8A 1BG6A 2HWXA 3VPHA 3QVJA 4ZCRA 4BVFA 4HRYA 2ZSDA 1NN5A 4XWYA 5JY1A 3AHEA 1JSRA 3FZQA 3SR3A 1J39A 3DL2A 4C6SA 2LPMA 3SVLA 3CGWA 2FPMA 4P3XA 1MNAA 3TW0A 1MBZA 3FJ1A 4EVRA 2VRCD 3QPCA 3FCXA 1E32A 3N2ZB 4MQUA 3NETA 2C95A 5JMWA 2WZBA 4HTAA 3SLRA 1QV7A 2NT4A 3JQPA 4UEJA 4HADA 4P4TA 1U3VA 3L8DA 3WGVA 5EMNA 1JAZA 1RQNA 3DE5X 4BPRA 3V7NA 4U63A 1GV0A 3TOCA 4ATNA 2F59A 1N25A 1YZVA 2A30A 3GOHA 2BBWA 4PR3A 1CRWG 5C1OA 4NXNB 4E09A 2P62A 3BMXA 4ZOEA 5IN4A 4G1EB 3T3MB 3X2SA 1QRSA 3OPMA 4UHEA 4Z4QA 2DCMA 3EUFA 1WDMA 1Z8HA 1UBRS 3DFZA 4HX2A 3UPUA 1SHTX 1CVLA 1GQ2A 1YU9A 4AMBA 2YRXA 3HRKA 1XAIA 3G68A 2WE7A 2ACVA 3GRYA 1V96A 3E3AA 3PWKA 4JP3A 4KQIA 4UNNA 2ALJA 3I04M 5EE1A 3HCDA 4HO1X 2QTGA 2B78A 2A7QA 2NGRA 4U7WA 4JJEA 3EVGA 5AVYA 1MJGM 4EHNA 3DE7X 1QIGA 1E4VA 2O8CA 4ZDKA 3WRVA 2VHWA 1XJCA 3VR0A 4I4TA 5EQFA 4HH0A 3SJZA 1QYCA 4UOEA 3ZQ4A 3OBBA 4ISCA 1NA5A 2ZRQA 1XNQB 4M88A 1ELOA 2Q3EA 2O7RA 2P4HX 3FKSD 2J31A 4E2ZA 2PL9A 4OQEA 3V55A 1RABA 4YYEA 3B36A 3WIUA 2OZEA 3FOWA 5CDUA 3DPSA 2B7LA 1PR1A 2GB4A 1DIRA 3DLAA 5T8KC 4CGZA 4LV6A 2BD0A 3U49A 4L4UA 1S3SA 4JYAB 4FFLA 1MQAA 4E14A 4H7PA 5JJLA 1JILA 2ZS8A 1FP4B 4XCXA 3NTRA 4MVJM 1E2PA 5FYDA 2FDXA 2VRNA 2NPOA 2H06A 2NPIA 4BNXA 4PZ9A 1N75A 4I2VA 5DTEA 2IQ5A 1I2MA 3RI3A 1Y4UA 3R41A 2QM3A 3EMVA 5CH8A 2QMUA 2EGHA 3DEHA 4R1TA 5LZ5A 3QX8A 1CJCA 3NAGA 2ZSUA 5WRFA 3ROGA 2FSIA 1QQBA 1KEPA 5J59A 3B5IA 4PRLA 1ECLA 3JSAA 1D4ZA 3HCEA 3I9LA 3DCJA 3BSYA 4B8ZA 3F7MA 5GVSA 4BRSA 2JK1A 3D7SA 3LYHA 5L6LB 1IVSA 1DEAA 4KO1S 1XJ0A 1Z2CA 2WAYA 2ZRLA 4XFKA 4XWTA 4AG3A 1J07A 1EDEA 2X3YA 5IKPA 2EBHX 1WKCA 3FOAA 4BXOA 3RGWS 2I3ZA 4XW2A 3OTIA 2JIOA 1WU8A 3K1AB 1HBJA 1J2YA 2VZEA 1RSZA 2ZDGA 4EQZA 5F2NA 4G0ZA 1ID8A 2SKCA 3GLVA 4J3FA 1L1QA 4DV4B 1PZMA 2I9PA 1XKTA 3GLGE 2NZ2A 1P1JA 2B0CA 2H92A 4ZTBA 3D8UA 1RC1A 5GGXA 3GGDA 4TZ0A 1L7PA 1RFLA 2CNOA 3KPYA 4PGHA 5AVZA 5AW6A 4QTUB 4RIEA 3HC7A 1NIJA 3ITNA 3BREA 2EW8A 1NASA 2FZLA 3EA5A 3RJMA 3X1KA 3PDIA 3E9RA 1X8KA 2JGNA 1ZP6A 1R0XA 3AUYA 5THXA 1GN9A 2QTRA 3WLRA 1P7YA 1JQ5A 3CLRC 2LXNA 1RKXA 3HM9A 3EQZA 1ZUIA 2QLNA 4BB9A 2C57A 7REQA 2F4NA 3ZCRA 1EBFA 1FRQA 1U4OA 3G2JA 2ZG6A 3KBOA 3TB4A 3U4MA 4OV6B 1WKBA 2QVGA 4UC0A 1QANA 4IIHA 3DUWA 1F9AA 3QHPA 2ATVA 2BZGA 1ISSA 3LECA 4NFHA 4X95A 3EGEA 1C3VA 2ATCA 2BM1A 1XNGA 4ND7A 2OXRA 4IX1A 3BA1A 4EHHA 3JVVA 2DFTA 4X1KB 3KOMA 2INGX 1D0IA 1TK9A 5EGNA 4BO9A 2HXGA 3ROKA 3RSFA 4RULA 1A7AA 2PS3A 5CLQA 4HB0A 1ADBA 1KRHA 3WRXC 5JBNA 2Y4NA 5JNLA 4GMHA 1G5IA 3QW4B 4YS6A 2NN3C 2XNDA 4X7RA 3CNLA 1N1GA 1NVEA 4RPHA 1OV4A 2DX7A 1SCUA 1W85B 2YWCA 4W1SA 3WAJA 1NXOA 3RANA 1E5QA 1F2UA 2HV9A 2Q4TA 5KWIA 3D3WB 5CJJA 3TYXA 2JRLA 1ONBA 4CLRB 4WXHA 3CH7A 4FJ1A 1XX6A 4LFAB 1I10A 1XQVA 3LFHA 2BEKA 3PFHA 4FBLA 1KOFA 1JW9B 3P2YA 2Q0HA 3KHUA 5EWJB 3ROFA 3VDRA 4FYIA 3ORSA 4V39A 3S28A 2CE7A 1P72A 2R5NA 4KSYA 4ZAZA 1OIWA 3RJTA 1SA0B 2RGCA 3PFNA 4KMSA 5GJBA 4AKHA 1Z2EA 3L8YA 3TSOA 1A9PA 1JZSA 5JQGF 3AI7A 2F8LA 4DT1B 1VGQA 1D04A 5I01A 2EX1A 3PR2B 5DTQA 3V80A 5H83A 4YPFA 1E3EA 3IA7A 2P77A 1DAOA 2LCQA 4YC7A 2V7GA 2F4VB 2C1EA 2YY6A 5AICA 5DYGA 3SFTA 3A2MA 4W5OA 1E62A 1FTNA 2C5SA 5JTTA 1J0CA 4J1QA 2YWRA 2A0UA 4NOJA 2RDMA 5CLLA 1TYCA 5FR2A 3BE5A 4LF5B 2POQX 4LGMA 1AMOA 2X4DA 4CEIA 3R7AA 1J25A 3LQ4A 3TI7A 1BCRB 3T4PA 1SHZA 3L4BC 1QJ4A 1T9KA 1ZN7A 3K4PA 4JDPA 3RODA 1YIOA 2GBLC 2X2OA 1XZCA 2CEAA 2BUCA 1EZ4A 1U5BA 2IDKA 1YKGA 4M89A 1X1EA 2Z9DA 1V16B 5FTJA 5JTUA 1KVSA 3V9AA 2FXIA 5BOSA 2HK7A 4DUGA 3PQ6A 3X1JA 3I9OA 2A88A 4YMIA 5IT0A 4QUJA 1RRFA 4JLAA 1DXYA 5JUWA 4F06A 2BM9A 2H1FA 1JNYA 3G2HA 3THWB 2FR8A 1CD5A 1YZQA 3DDWA 3FZEA 2AZXA 3CNNA 3I4LA 5EMLA 5BY2A 2AD1A 3D2AA 1YHZA 4KK4A 3OHMA 2OILA 1P9OA 3CG4A 3HFSA 4XQGA 5FNZA 3ENKA 3C74A 4DCSA 3SXJA 1DFHA 3VHQA 2RK4A 4D96A 1JLMA 1GA1A 3LGSA 2A0FA 3P0FA 3CVWA 1J5EB 3I6QA 2BEVB 3Q0IA 3FMIA 4D4KA 4GOMD 2WM2A 3L0IB 3AFHA 5JADA 2DULA 3ZWYA 1S9DA 4CLXA 3V2UA 4BC1A 3UXHA 4YJGB 4D80A 3EEQA 1NJ5A 1UAAA 4MXDA 3WIVA 4CF3A 1PLLA 4R1SA 4GLLA 3EHDA 4WK6A 4PLTA 5JMOA 4JJFA 3L40A 4D3SA 1OT5A 5HGJA 1VB3A 3C1TA 2G1AA 1IEWA 4QWWA 3RAEC 1SXIA 2FUG1 2OG2A 2WM9B 4MJXA 1XRRA 3V1LA 1G20B 5DBOA 4P86A 1M1XB 1WNFA 4FIDA 4HVTA 4LJ6A 2XOKA 1SU8A 2PIAA 2OO5C 4RYDA 4AY6A 1IBCA 2DH6A 5FI5A 2QJFA 1BHSA 3T3NA 1SUFA 2I34A 2WWWA 2QLJA 3AHFA 3KLBA 1XZAA 1MU0A 3WYDA 3ZGNA 2C3YA 2O7SA 3P97A 1FYWA 3D3NA 4K1XA 2NQ8A 2Y0BA 2FN3A 1WKVA 4DLSA 1C1DA 4FDMA 1JALA 2WZQA 3C3MA 1YGYA 1JKXA 4MNTA 4IBOA 4MP6A 4R8VA 4XFJA 4H7KA 2P2DA 2C4VA 3PS9A 4CL8A 3MWLA 5ADWA 2XYRA 2O0MA 1B3BA 3R3WA 2UUPA 2YW2A 3HEMA 4XWGA 4Z3KA 5BSHA 4BMYA 1G7CA 2WEKA 3D6NB 4LHEA 5EFZA 5CDSA 1Z75A 4ILKA 2ZI5A 1IY9A 1U7XA 2IGTA 3LNCA 2BHLA 3SC4A 4O2BB 2P68A 4HZUA 4B7ZA 1GJRA 4F4FA 2HIMA 3OQNA 2ZBPA 5EXXA 3PC3A 1HNWB 4S1TA 1EWTA 3CG0A 5P8WA 3OJXA 4BNFA 3OM9A 4L7VA 1RD4A 4RWEA 1N2CE 1NVWQ 4D81A 3RYCB 1XZQA 1U5CA 4PWYA 3QXJA 4X6LA 1ISPA 4EJ6A 5LMZA 3CMCO 3IEUA 5EZYF 4YRMA 3OD1A 1AMNA 1SUAA 3DNPA 2PFGA 1II0A 3K73O 4FYMA 4RZHA 5EIFA 3WGHA 5M29A 1WBJB 2GNPA 1QK4A 2VSXA 2GN6A 4FGSA 3ZKAA 1PD0A 3HYLA 4JU8A 4PRYA 3AI3A 5BW6B 1IONA 2I65A 1P73A 4CFZA 2ZUVA 3HB7A 5M7EA 3RSOA 1Q83A 1H85A 3IMKA 2OA0A 2D5AA 4LN1A 3F3SA 4JXXA 3CRMA 1Q7GA 1XJ5A 3I6BA 2Q7OE 3ZDEA 5BQFA 1AQUA 1BXRB 2IIVA 3WQHA 2F55A 2B9VA 2EYUA 4U7HA 5H70A 2O6LA 4DCCA 1DBIA 3BXGA 5LBUA 5L9AA 1Q21A 1ZISA 1F6DA 2C5LA 3FCOA 4DMUB 3V3KA 2QYTA 1M67A 2ZJAA 3OICA 4GAEA 2VNKA 3WWYA 1DO0A 4WX2B 4DWWA 5CA0B 3K5HA 3UAXA 2V9ZA 1FDIA 2HMUA 4IP0A 1YWGO 4TKVA 2OKCA 4DDTA 2QRZA 4CKCB 2EKBA 2HH9A 4YJ2B 2LKDA 3OQVA 2GM3A 4FGLA 2PGJA 1JQAA 2FSGA 3AF1A 4PO3X 3VO9A 4R1NA 1P8AA 3EUEA 4DL9A 1MVOA 1NVUQ 1QUEA 3JQFA 5CDFA 3HUDA 3CZQA 1OROA 3OOEA 3BCSA 1PGNA 1GGNA 4LXUA 1B42A 2OQIA 2A1UA 1SU4A 3NAZA 2P3SA 3I2FA 3OLYA 4D8UA 1DI0A 2QZPA 1TTTA 2Q9BA 1NI3A 3H6HA 4IHJB 1X74A 3BX1A 1XO1A 1U65A 5F73A 4HBGA 1E3WB 5T8KA 4P8RA 4EI2A 1VC2A 1XAJA 4N7BA 5KU1A 1H23A 3JAWA 2OFFA 1EBUA 2VJMA 3ETCA 1JXOA 5FWDA 4BV9A 3OJEA 4C20A 1Y48E 2HUPA 3GYGA 2QPLA 3SYNA 2F1KA 2XAAA 3FGZA 3OM8A 4C3OB 3HI4A 2O8EA 4M99A 3FYTA 3SQMA 3LC2O 3I61A 3OF3A 3OZAA 3S2GA 1NRWA 3DLTA 3GAFA 2R1TB 3QKUA 3D54D 1T8PA 3V7FA 5JNTA 1AN9A 2DPGA 1DV1A 2GXAA 4XIGS 3C3AA 2CKDA 3SQLA 1DE0A 2IYFA 5TPZA 1N0VC 2VJYA 4TKUA 1EFRA 1EUDA 2BKLA 3T5DA 4YAWA 5J2UF 3ESAA 4MWBA 5IC4A 4E32A 5TEWA 2YY5A 3SX0A 2CDBA 3UJCA 4HB4A 3IUNA 1A9SA 2Q5JA 3HYNA 3HR7A 2H1VA 1J5XA 2IHKA 1U7HA 2YJZA 4GPBA 1ULHA 3UT0A 2ILVA 3G2QA 2I8CA 2XRMA 3WLHA 1AC5A 1TADA 3ILXA 3KR9A 4KQXA 3UUFA 4CUJA 2XB9A 1XZMA 3T5CA 3O4RA 5E0OA 1KI6B 1OBHA 5EIHA 5FPHA 4TTRA 3STUA 4S1OA 2ZBQA 3L7YA 3GLFB 4N3NA 1DG1G 4YJDA 3JD2A 2FX2A 2OB1A 4D44A 1RP1A 2ODQA 1EFTA 3W4KA 1JWLA 4L5BA 4KN5A 2VATA 4BGIA 1AHPA 2YC4C 4CUKA 3O38A 2DAPA 2HF8A 3HJBA 4IMIB 1I5EA 2I71A 2PWYA 3LHFA 1N5OX 3N58A 2OV4A 4G9GA 2O4UX 4BX3A 2WYHA 5H3CA 3T5PA 3BEDA 4NEQA 1R0RE 3T7AA 3T5MA 1OQAA 1LEHA 2C98A 3KQTA 4Q4JB 5AJHA 1TEXA 4GRIA 4XSGA 4QVGA 5DN6D 5LKRA 5CT6A 5B6JA 1DT3A 3CUWA 4ZZ2A 2FW0A 3GP5A 3GBSA 4JN6B 1T10A 3LQYA 1R00A 2OFXA 5DPMA 5KSPA 4A0QA 4R0NA 3VPAA 3LDUA 3AETB 3L6DA 1JEYA 2W2KA 3L4KA 4G37A 3I0ZA 3HI6A 4H16A 4BNNA 2NTVA 5JIBA 1LX7A 3GA0A 4ZI7F 2O3JA 2H52A 1IDOA 2O3UA 4IJVA 4K9MA 4HGNA 4MYRA 4US0R 2NPFA 1K0FA 1Z6XA 3WRXA 2B34A 5JCOC 1P18A 4UXJA 3D02A 1PWYE 3T3DA 2VRCA 4ZZ3A 5IH7A 4NECA 3IT3A 2ZT5A 2J5KA 3BTUA 3K8ZA 4X54A 4MUXA 2HK6A 2IPLA 3AVUA 2AQHA 3L1IA 3RAPR 3H83A 4HDNA 2Z5LA 2NXCA 4XFDA 3OKAA 2WILA 2YFHA 2A6PA 3U17A 5A6VA 4OMDA 5IKMA 3DMFA 2X1MA 4XLLA 1SC1A 4NBSA 2NQTA 5LDGA 3RRXA 4BEWA 4QOGA 5KNCH 4YUVA 1GPBA 1D5CA 3K2IA 4YYZA 5CD1A 1NOIA 1KF0A 3K9HA 3MIIA 1XA0A 4GYJA 4D9NA 3DCIA 4CR8A 4YLEA 4RABA 4XJTA 2QI9C 2R68A 3GUHA 4OHOA 5F5XA 1N2SA 3ET4A 2D1TA 3ETHA 3AWDA 5CMLA 3VKUA 1NN3A 1JYFA 1LI7A 3QU9A 2R6GA 3OEHD 4RVGA 3PGVA 4FGWA 5LMNB 5TMDA 2G9QA 4L9AA 4M55A 4RMHA 3AU8A 3D59A 1M66A 4MUHA 1XC7A 3D4IA 3DG9A 4JUDX 1BWRA 1UWLA 1GPNA 3IP5A 1KR2A 5IAAA 4WE3A 4IGEA 4OMCA 4ZZ0A 1DQYA 2QR5A 3A14A 1MH9A 1AUVA 4DIDA 1O08A 1U4SA 3PHIA 3L4BA 3OJCA 5D5PA 3LF1A 3L6RA 1RLTA 1X7YA 3E5NA 1V8DA 2ID7A 1CDZA 1QYRA 2OP1A 1H5UA 3EVCA 3FVWA 3KTOA 4C87A 1YE3A 3I4CA 4W1RA 2IV7A 1ENZA 2FPOA 3TZCA 1MO4A 2Y1DA 2VSNA 4DDWA 4LGCA 5CVCA 1FPQA 4GRAA 3BMCA 2VA9A 1M72A 2EFJA 3EZXA 4CNBA 2BEWA 3KCNA 2CFSA 3A4NA 4Q9AA 2A0XA 2Z8YM 4MVJF 1C0KA 1IZ7A 4UMVA 1C0IA 1PJCA 1Y8AA 3MMXA 5ICFA 3VV2A 1FX0B 3JYHA 1UUFA 1W5BA 5FI3A 4C76A 4P5DA 1H0SA 4R9RA 4UM5A 4QHTA 2OQ2A 5IKOA 3NHWA 1IBLB 3L8HA 3KFXA 3L7LA 2WMDA 1PJTA 3CRZA 2NZJA 2WOJA 2ODNA 4L8VA 2CDRA 4M83A 4P3YA 4WFQA 3M6XA 5K0LA 1MKYA 4CM7A 5ITZB 1OA1A 4DQVA 3LUCA 2I91A 1WVMA 3GLQA 4LY3A 3IBSA 5FL7D 2B20A 1U98A 2WINI 3V6LA 1IBSA 5KJEA 4YP1A 4Z51A 1ZJ4A 3TLJA 3QLUC 2HK9A 3TK1A 1KFCB 1ADFA 4LQLA 4PQYA 5CK4A 5AKKA 2V65A 4QT4A 2Q6VA 2UZ0A 1Q11A 4J07A 4TV8B 3UUEA 4CM9D 5E2AA 2Q5CA 3FB4A 1ZOPA 2BMAA 5G0TA 4E5KA 1JHOA 1YNSA 1POWA 2O1EA 1EESA 4HX5A 3OTOB 2VH2A 2ZZKA 2OO5A 3ZU5A 3U5TA 2FWBA 3N1UA 1IVNA 1Y8QB 3O21A 3PXEA 4RPJA 4DMLA 4FFDA 2PZJA 4C6RA 3JQ7B 5GZ1A 4O2AF 3KZNA 3BF7A 5D84A 1XZGA 2VP5A 1R6DA 2AIRA 1ZD4A 3RVQA 5CEFA 3A27A 5BT9A 1T5HX 2IZ7A 4YXFA 3ABZA 3OX3A 2R66A 3CKLA 1ZNXA 1DRVA 3EOZA 3OZWA 3Q6NA 4BP9A 2I29A 1WV0A 2Y99A 2VUTA 5EHQA 1KMCA 1R4AA 4KE8A 4TT3D 1ECBA 1GUAA 2NVWA 4B2YA 5KWSA 4LOIA 1AKTA 4RD4A 4QXOA 1SBIA 3IMEA 3AR6A 1EGVB 4KZKA 5I5GA 4DVJA 2QXYA 3TD6A 1EUQA 1EIWA 4NMLA 2VR1A 1YCDA 5F2OA 3RVLA 3CM0A 3ORYA 4G8CA 4UUNA 4MA5A 3HCAA 4PZLA 1A1VA 2O3TA 1NDUA 1SBYA 1Q77A 4H4EA 4E1AA 3IUQA 3DL0A 1OI2A 2X9QA 3IOMA 3MJSA 3OE7A 3Q5EA 4WFKA 3IT0A 4A7PA 4BBZA 3EWNA 1U90A 4GIBA 3CZ9A 5H68A 5JR3A 1AGPA 4RKWA 4XYMA 3VX3A 4JVLA 1PFKA 2FR0A 6ABPA 2G8LA 3B2NA 1RNLA 4BFWA 4GMKA 4DADA 4EKDA 1AKEA 5CH3A 2VBGA 4ND1A 5HVNA 4QFBA 5BUSA 1XEWY 1Z16A 1KI2A 4YXWD 2NO4A 1OHHD 1EDZA 1U5AA 4MPDA 4ZVNA 2A9OA 3EAQA 3U3KA 1D1TA 3VU1A 1QU3A 2C7RA 1GP2A 1OX4B 2BFFA 4I9NA 4IR7A 5IK2D 3RS3A 4BE7B 4HTFB 2WU0A 4MPTA 2XQFA 3O9MA 2IITA 1DHRA 4E5SA 1HDIA 1XROA 1OGYA 4RELA 3LLSA 4YV0A 1UPBA 1FYXA 2QJWA 3HBLA 2QRNA 2QUZA 2QMHA 4V1CA 5IG2A 2D6FA 3NV7A 4COOA 1DP4A 2XMCA 4BX9A 3NV9A 5KHOC 1YFJA 2G71A 4JLNA 1UDCA 2PN1A