4LHZA

Crystal structure of gtp-bound rab8:rabin8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhzA00
2O8BA 2F1RA 2V9PA 4M1TA 4AC9A 3C5CA 2QI9C 1CEEA 2JJ1D 1RJ9B 4JL5A 1KJZA 2EYQA 4F4IA 2PT5A 4LJ6A 5ELXA 5EE5B 2XEXA 3WNDA 5D3MA 2FFHA 2VH5R 4OBEA 1N5JA 2LWIA 5GADl 2R6DA 3SJCA 3AEZA 4TT3D 4ACBA 4EPYA 1KHTA 2NTYC 1RFLA 2QMUA 4Q4JB 2XB4A 5JJLA 3FE2A 3BB4A 5EZ5A 2OAQ1 2QL6A 1WXQA 1Y63A 4RD1A 1KSFX 1AKEA 4LBVA 3CPEA 4HB4A 4Q7MB 4OHZA 4ESHA 3WYGA 2OBNA 4DCUA 2J1LA 4XD7A 3NEJA 2ZI6A 3K09A 2A9KA 1N25A 4PC2A 1HV8A 2ORVA 2KJQA 121PA 3HPRA 3C41J 1U9IA 3O8BA 4XH9B 4W5WA 4M4SA 4RFVA 2G77B 3CLVA 2D74A 4C0AC 2FSGA 2OG2A 3MWYW 3OIVA 4B3GA 2NQ2C 2ZI9A 4Q47A 4JVNA 1EWRA 4LYFA 4NTZA 2L0XA 4URWR 2DFKB 1E0SA 2ZI4A 3AB3A 3TBKA 3U44A 2IUUA 3KUCA 4Q5IA 1NY5A 1OFUX 4WW0A 4TYWA 4YLGA 1YJ5A 3MGCA 1TUIA 4BLOA 2C99A 2XAUA 5FPYA 1XRJA 4ZI2A 5FR2A 2XZPA 1E9AA 4P4SB 1T8UA 1R8QA 1FTSA 1L4UA 4I99A 5GJBA 1FP7A 5FBQB 1YR6A 1KDRA 1N6HA 4HAXA 1X1RA 1U90A 2ZUDA 4PQRA 3IO3A 2OUKA 2YWFA 3KKPA 4US0R 5CDFE 4XTRA 3BERA 2QQEA 4YXWA 1AKYA 2FH5B 3HDTA 4NU0A 1IJEA 1G9XA 2ZSFA 2W6JA 4HZUB 4ASUA 3KFVA 2C03A 4POAA 3KQLA 4B3BA 4GOJA 1Z08A 2CMKA 3CH4B 1MR3F 1NF3A 3LXXA 1E2HA 2FE4A 4KFTA 5J5CA 3EPJA 2DB3A 1X3SA 2VEDA 3THYB 2QORA 4LC0A 3RRNA 1YZNA 3OAAA 4IVQA 1QRAA 2K5UA 3ECCA 2N42A 2XXAB 4DDTA 5JLJA 2RGXA 4G3XA 3F0TA 2V7QA 1GAJA 4JVMA 2XZLA 2JLWA 2GJKA 1OXTA 4EPTA 1QDEA 3KZ1E 3I8XA 4P4TA 1WF3A 1KI1A 2R9VA 2IEYA 4GT1A 2HV8A 3I5YA 3L8ZA 3A4MA 2YVUA 4WA7A 5K8UA 1GRQA 1YQTA 3CO5A 3EZFA 3ICQB 1IY1A 3QKSA 5C4GB 3QOFA 4GZMA 3VQTA 4Z54A 4ZDKA 3B78A 4QGFA 1WCV1 2JCSA 1LS1A 2IYQA 4C3ZA 1Q20A 5FTJA 2J87A 1G8YA 2WWHA 5E7MA 2IF0A 2O0HA 1XP8A 1U8ZA 1E0AA 2C95A 2QENA 5KNCA 5FUYA 1ZIOA 1DADA 3BJIC 2NG1A 3G82C 3WP1B 4CEJA 1E9FA 4Q7JB 2IA5A 2X2EA 5EE3A 3RS0A 2C5LA 4V0LA 1T3HA 3P26A 1SGWA 2F1JA 2NO1A 4M22A 4DT1A 4QJ3A 2CCJA 3SYLA 4MDFA 1R6BX 3ZS9A 2CLSA 1S1CA 2AD1A 2ZS7A 4IKEA 1E2PA 1CR2A 1QHSA 5JBQA 2GCOB 1ZU4A 2WVJA 2KWIA 4LJYA 1FQJA 2VTKA 2RCNA 4O3MA 5KOYA 2Z6VA 2Q3MA 1G17A 1ZP6A 1XF9A 2CHVA 2HF8A 3EASA 3M1IA 2IEZA 3QXHA 2P5SA 4GPTA 1G8HA 5G3ZA 1GUAA 1O87A 2HXSA 1SULA 4EDHA 3EPKA 4B2PA 1UEJA 2P6UA 2C98A 4FWIB 1IQPA 3TK1A 4ZCIA 2ECKA 1ZM4A 2EFHB 2QPOA 3SBDA 3CWQA 1BKDR 3LWNA 4JBWA 4QBGB 1WRBA 1Z47A 4TMKA 1CJKC 5KPDA 4NDZA 2O8BB 4ZCMA 4PPQA 2QT0A 1GP2A 3RANA 1SKQA 2NO9A 4MRRA 5TVKA 5BW8A 4B76A 4BLRA 3E5HA 1N6IA 2R6AA 4M9ZA 3UMFA 4C0JA 1NVVQ 2O8EB 4N0DA 2C04A 4IDPA 3VNUA 2EFEB 2OXCA 3SI7A 4LHWA 4V0OA 2GILA 4FINA 1CRQA 2GA8A 1GIAA 1TUEA 2PCLA 4URUR 2W2TA 3QJYA 1KK0A 4DLWA 3BD9A 4W5HA 5DE3A 4U02A 3GJ3A 2WJVA 5D3MB 4PTLA 2CJWB 2W83A 5BQ5A 3BS4A 4PO8A 5GVSA 1F2UA 2GF9A 3ND9A 1OHHA 3DZDA 4C9BA 1W47A 3A37A 1R10A 4ON9A 4LBZA 1N6RA 5FTLA 1RYFA 1JEEA 5JS7A 2GBLC 1P60A 1UADA 2BBTA 5BYKA 1ZCBA 4BZQA 4MKIA 1VPLA 3SJBA 1UBFA 1NIPA 3BK7A 1UF9A 2SHKA 5LD2B 3QE0A 3SQWA 1OXUA 4JJZA 1P3JA 3CRRA 1DO0A 1WBBA 1G8GA 1SVSA 1S9DA 1JI0A 3DOEA 2ZJBA 1RRGA 4IW3B 1P9RA 4JLJA 3DKPA 2NO6A 1OIXA 1KOFA 1TQ2A 1VG1A 3DDCA 1SXJD 2GTPA 1E1RA 3N2EA 2CK3A 3DMNA 2LKCA 2BM0A 1NL3A 1IXSB 2X77A 3B6EA 4ZCLA 2WPDD 5FR1A 4URXR 2Q9CA 2O0KA 3MJHA 4BRWA 1N5KA 1XCGB 3Q5DA 2XOKD 2BEJA 2KI5A 1OF1A 3EWAA 4LJ5A 4M1WA 2A5DA 4Q9IA 5CB8A 4GNKA 1TTTA 4AYTA 2GVDC 4P32A 3KFXA 5KO2A 1FNMA 3EZ6A 3DPUA 2JAQA 2V1XA 4JLKA 4A6PA 2ZTSA 3GLGA 4M9XA 1JECA 2EWVA 5JI2E 2GVZC 3IBYA 1NG9A 1L8QA 1T3LA 2RGCA 3KQKA 2J0SA 1TU4A 4MRVA 2JASA 1II9A 1G5RA 2R65A 3FVQA 5CIQA 3QKRA 3QIAA 4NL4H 3BFXA 4AKHA 1GFIA 1MO4A 3MG9A 1J90A 4OL0A 4JBXA 2NZ8A 2CL0X 2ODBA 2QRNA 4QXAA 4QJ4A 2NZJA 4CIDA 3TAHA 4Q19A 4MGZR 2H17A 4MUAA 2AK3A 4UNQA 3FYHA 3U6BA 3R8CA 1AS0A 3EWSA 2D4HA 3GJ0A 3CZPA 4WZ6A 4F92B 3GP8A 1E4YA 5FBWB 2GJSA 5K8IA 3SFZA 1RZ3A 2CXXA 4YDHB 2ZJ5A 4EIWA 1IJFA 1T91A 3HP1A 4URYR 3GLHB 2N46A 4DUGD 1RJ9A 4HATA 4JSYA 4L15A 3Q8XB 1JAIA 3GLGE 1OH8A 2IYVA 3MCAA 4KSBA 3IEVA 2ZI3A 1NKTA 1R5NA 4JLAA 4M9QA 4Q66C 4ESVA 1OJLA 2BM1A 2IWHA 1XPRA 3LFUA 3CW2A 4HZIA 3TUZC 4XJXA 2WKQA 1UBEA 4W9MC 1E9EA 1JR3D 1M7BA 2IYYA 2KSQA 1TEVA 1T5IA 3CPHA 3IIKA 3QPUA 2FNAA 2REBA 3ZVLA 1KKMA 4PPNA 4DXAA 5C46F 3K09C 3K9HA 2CHGA 3QF4B 1U8AA 1U94A 5F9HA 1XEXB 1A7JA 3DKVA 2PLRA 3IEUA 4IFBA 3QQ5A 3WNBA 5EXXA 2ZAOA 3V00A 1TQ4A 1W5SA 1AK2A 3FB4A 4DCSA 2ZPTX 5EJEA 4L9WA 3T5DA 4NYIR 1AS2A 1DTSA 1TX4B 1US8A 2BBWA 2OM2A 4XOIA 3ADBA 1Z0DA 1DAKA 1UKEA 4EPWA 1VHTA 5DYGA 3UANA 3W34A 3B9QA 5G41A 3HU1A 2W0MA 3AVYA 1E2IA 1MV5A 1ZCAA 2ZRDA 3NTUA 2P5TB 3EC1A 4H9GA 1JXMA 1N3BA 1NN0A 4R9UC 3BH6A 4Q9JA 5LD2C 3EA5A 1ETUA 2G6BA 5DH9A 3Q9LA 3BXZA 2I1QA 4AKIA 2E9SA 3S1AA 3PFIA 3QPWA 4MRNA 4DEXA 4JLDA 3OIWA 1SZPA 5JRJA 1MOZA 2J0UA 3NIBA 3U2QA 3ZYCA 5LPNA 1CS4C 1LF5A 1RVDA 5B2ZA 3WYFA 5KUTA 1NBMD 5KHOC 421PA 2ZM5A 3B8HA 3U6KA 4Q9KA 2VF7A 1D8TA 1COWA 1OH7A 4NONA 3UG6A 4DLYA 3THWB 4CT5A 3EPLA 2ZRIA 4CRWB 4B73A 5F98A 4R98A 2NPFA 1KI8A 1W36D 4DSUA 1DBSA 1ZYUA 2OEPA 3QI2A 3GLIA 1NLYA 3RLFA 4ZKEA 1SKYB 3ZIAA 1TQDA 1XMVA 2ZRGA 4JYBA 5A0FA 3VX3A 4TMXA 4A0FA 1EFUA 4NYMQ 1EFRA 4HDCA 4DDVA 1MRNA 4R2HA 5H1YA 2GK6A 3WP0A 2JLXA 3AKDA 3F5FA 1XTSA 2J7KA 1GOTA 5FPSA 2BMEA 2FJUA 3ZD7A 3JVUA 4UXJA 2RGAA 4V0MA 2JLSA 1K5DA 5K8TA 1XEXA 1G41A 3KJGA 3HJNA 3RC3A 3Q7QA 4BFVA 3HYRA 4KAXA 4JLPA 4K46A 5FTNA 5GJVC 4DKXA 4JVSB 1KMQA 2OSBA 1BMFA 1PV4A 4DUGA 4OK5A 4CEIA 4GRAA 1HE1C 4L8GA 1GILA 1Z22A 1GKUB 1KSGA 1E2LA 3L0OA 5FOTA 3PUZA 3LA6A 3EIHA 1NG1A 4WVFA 3GLIE 3A1TA 4N0EA 4TLCA 4PZYA 3OEEA 3RWMB 4TWZA 1KDOA 1XJ0A 4GZLA 4B47A 1OFHA 3CWZA 4MH0R 5CYOA 5GVRA 1H8HA 4D6PA 3BIFA 4CT4B 4PR0A 4LRWA 1MABA 2AL7A 3AP1A 2WWWA 4RKEA 3ETLA 2FGKA 2Z5FA 5FOXA 4W7SA 3SS8A 2YWHA 2VF8A 4ZPXA 2F1HA 3QKRB 1R0XA 3I92A 1SVMA 2P6RA 2B7CA 2V4ZA 2BEKA 2EVWX 1D5CA 5B57C 1KYIA 3IILA 3CRVA 1KI3A 4BGDA 3EW9A 3QUSA 1N6NA 1JQLB 3WMFA 4YMVA 1BO6A 3MRSA 3KTAB 4PHTA 4TL7A 3FHCB 3K70B 2IYSA 2JLRA 2XNDD 2PT7A 3RWOA 2AK2A 3LLMA 3UKDA 1Q44A 4M8NE 1G3MA 5J4KA 2QAGA 3V4RA 2QG6A 5AUNB 2MMCA 3RSLA 1YE8A 1F6BA 1UKYA 1YRBA 3IHWA 3VR1A 3KJIA 4BECA 1W0KA 3LDAA 2ANBA 3D31A 1T0HB 1XMJA 2FN4A 5IT5A 3LX8A 1W44A 2QTVB 1UAAA 2OCPA 4HAVA 3N5CA 3VR5A 1Z29A 2WIBA 4EJSC 4B75A 4Q4AB 4JJKA 5KNBA 4YMWA 2ZE8A 1VCMA 4UXIA 3T35A 1M6NA 3KQHA 1E1QA 3GPLA 3FMPB 3UMRA 1BYIA 3B5JA 5E7JA 4AIIA 1ANKA 2VLIA 5HE9A 4TSFD 3K0FA 4LBWA 2QTFA 1Z0AA 3KXIA 1WA5A 2YC4C 1H8EA 1E0JA 1UDWA 3W3AA 3VHLB 3PEWA 1NSFA 1S9HA 1HA3A 1R8SA 2ZJYA 3FMFA 4HZUA 3WBJA 2YZ2A 1ZD9A 2IF2A 2ZRMA 5J47A 1DELA 2G83A 4BFZA 2DFTA 3RHFA 2CEAA 1XD8A 2FOLA 3CPJB 4OK6A 2DBYA 1T0JB 4JLVA 1OV4A 4L4UA 1HH4A 2XJ9A 4ZDJA 2O52A 4Q02A 5FPHA 3T1TA 1KJYA 2FGJA 5AJYA 3EZ9A 1NKSA 1BH2A 5LBIA 2RHMA 5EQTA 3GMTA 4G1UC 1LW7A 2FF7A 3IKJA 4PZLA 4D2IA 3LH5A 2ZXUA 2NMVA 4TYYA 1GRRA 3O47A 3P4YA 1JBKA 2QMEA 5FBVB 2ZU6A 2PBRA 1E2NA 2B8WA 2XOKA 4KBGA 2W6JD 1GRNA 4Q9HA 1PLLA 3SOPA 1JR6A 1P6XA 3AVTA 2W2XA 4RZ2A 2RGBA 3ICEA 1E1QD 1XD2A 5KDLA 3WYAA 3WY9A 4QNMA 1OXVA 4ZO4A 3G0HA 1H8HD 1Q3HA 2QM8A 3LAWA 4QGGA 3T5GA 3BGWA 4RD0A 1E9SA 2FEOA 1QHXA 1G5TA 2ZRHA 3LV8A 1QHNA 3UWKA 5L3QB 2OO7A 3C5HA 1WDTA 3THYA 2A5JA 3W90A 3H86A 5TDHA 3FKQA 4URVR 1CTQA 1FZQA 3AUYA 4LJ8A 3TAUA 4Q1AA 1P2TA 1QF9A 1X86B 2ZYWX 1R0YA 5AR1A 2XSZA 2BJWA 4E07A 5JSZB 1P2SA 4P0TA 3K70D 2FFBA 1JR3A 4IOLA 4KLNA 3MLEA 1KDTA 4IHQA 3KQNA 2XNDA 4BEJA 3TVTA 5KTYA 1HQCA 1EESA 4ZDWA 1KNXA 4HSEA 1II8A 2O8EA 4EFLA 2R6FA 4C0HA 4WZBE 3PG5A 5JJKA 4M9SA 4IVRA 1IN7A 2RGNA 1JEDA 3KX2A 2QGNA 1G3UA 2VP6A 1P7CA 4G5SA 1OKKA 5SZKB 2BMJA 4D4KA 2C77A 3CH5A 2HT1A 2OHFA 3M0EA 2C96A 1RYHA 4XVQA 3DHWC 2IC5A 1II8B 5JS8A 4D82A 2VP2A 5BYJA 3WRYC 4HAUA 4D4LA 1IONA 1AQUA 1SQ5A 4JL6A 4B74A 4TL9A 4JT2A 5DI3A 1BOFA 2XITA 4FMCB 4KYUA 1Q1ZA 4AURA 1NN3A 4B34A 1Z06A 4PXAA 3BRWD 3IUYA 3QF7A 1DAMA 4I1UA 2GHIA 2VBCA 4LJ7A 5HZKA 5FL7D 2OESA 1GTVA 2ODEA 4C7OA 3ND8A 1JR3E 4E5UA 2B7BA 1Z6TA 5E3HA 1KZGB 5H70A 2YOFA 3EARA 1CJTC 1Z3IX 3SU8A 2ZETA 3N2IA 4OHWA 2FEMA 1Z07A 4DBLC 1QG2A 1VYVA 3VR3A 1P73A 3QBVA 1KO1A 2CLCX 4H1VA 1P9WA 3AF0A 1WMSA 3EIEA 4NCJA 3MAAC 2QA5A 1IN8A 3ZGXA 2ZRLA 1CP2A 2ZYTX 3K9LA 4MUBA 1ZUHA 1HT1E 3P27A 1J8YF 1JXOA 4U00A 4D4JA 4CF7A 2JLVA 4Q03A 1RRFA 3Q72A 4AWXA 1IN5A 2EYUA 4O2LA 5JFGA 4JLNA 1W7AA 3ASZA 3C15C 4PO1A 4FMBB 5FOWA 4DLZA 1IAQA 1VCIA 1CKEA 1NJGA 3CRMA 5JWRA 1LFDB 5L3VA 3JVVA 1NVXQ 2FFAA 4UQOA 4Y0AA 3U44B 1N2CE 3GJXC 3ADKA 2OCBA 2JJ1A 2ZVPX 3RRYA 1Z2AA 4YONB 1KMHB 3HR7A 1VIAA 4O2RA 3RS4A 1F2TA 4UNRA 5KU1A 1TAGA 1VCNA 4LYHA 4TMTA 3SYNA 2O8FA 1QHYA 4FCVA 1LV7A 2WMNB 3UIEA 3D8BA 3JZMA 1G4UR 721PA 1U81A 2GJAA 3TRFA 2W6IA 4LX0A 1KJWA 4M21A 2ZQ5A 3LBHA 4XVRA 1ZNXA 3GFOA 3VAAA 4A0RA 2JJ2D 4HLCA 3LXRA 1IY2A 2ZSAA 4QBHA 2AWNA 4JLOA 3PV0A 4A8JA 1CF4A 4HUQB 2Z0MA 1TNDA 4XD7D 5EP4A 3AGQA 2A2ZA 2VP9A 3GD7A 3D6TB 3K0AA 3O8DA 1J99A 4DDWA 1Q1EA 1YKSA 2A5GA 1R2QA 2WM9B 2ZR9A 1U99A 3C8UA 3BBPA 1YZLA 3NC0C 1TF2A 2Y8EA 4RCZA 1G3RA 2CDNA 5SZJA 4DHEA 2W58A 3DEFA 3KJEA 1ZNWA 2XNSA 3UK6A 1NI3A 2IHYA 1SXJB 3PENA 4IJMA 1FMJA 3VR4A 2YYZA 4KSCA 3KKNA 3K0AB 2R2AA 1KSHA 4EPXA 2ZR0A 3B1XA 4EFNA 3K0EA 3HU2A 1J8MF 3IGFA 2CL6X 5HKKD 2IS6A 2JJ8A 1NVWQ 2ZRJA 3FMIA 1G5PA 2YJTD 3PR1A 1KI9A 2ODWA 1P2VA 1YR7A 2FX3A 2IXGA 2V6JA 1E9DA 2ZANA 2O0JA 4ZDIA 4Q1DA 1ODFA 3CR7A 4ZV4A 1G16A 1A4RA 4WBSA 2BOVA 3O8CA 4LY6A 3W6PA 2JIZA 1G7RA 4KO8A 2JEOA 2IWRA 1E0KA 2GCPA 2R8RA 3X1YA 3FMOB 4Z51A 2ZSBA 1Z0JA 3B1WA 2AKYA 1RE0A 2VHUA 4DLVA 3L2OB 5L3QA 3QENA 2ZSDA 3LQQA 1S0UA 5FUWA 4CW7A 2PMKA 4NH0A 3QSYA 3IO5A 5FPTA 5DNYB 4KYIB 5H8WA 2NIPA 4MA4A 1Q1QA 3M6AA 5FUVA 4EJSB 4OJQA 1F2TB 1R4AA 1YHNA 1ZC3A 2OV2A 4UNPA 1CXZA 3RSOA 2YHSA 3B1ZA 3BB3A 1JALA 4EQ6A 3MD0A 3OIUA 4OKSA 5C2JB 1N5IA 3GQBA 2OILA 3HWSA 4EUNA 4LUCA 2MSCB 5JECA 2Q9BA 3BB1A 3CIOA 1P4SA 2ZRAA 1OYWA 4B2LA 2GDJA 3PUWA 4EJSA 4QGAA 2ZREA 3N70A 3PUXA 1OLOA 3U61B 4AY2A 2DR3A 3K9NA 1MRSA 4RY2A 3A6PC 3SJZA 4NZYA 3DOFA 4JVLA 4DIDA 4UKDA 5IK2D 3KB1A 3QKUA 4ZIRA 3AF2A 4AK9A 4EPRA 1ELOA 4JT4A 4G0NA 2GJ9A 4DC9A 1UJ2A 4IDHA 2J0QA 1A2KC 4NCNA 2DYKA 1VIYA 3V9PA 2FPLA 3GLFE 1D6JA 1G8FA 4HB0A 2WV9A 4E03A 4Q9LA 2GZAA 4D0NA 2YV5A 1EFCA 1OIVA 1HYQA 3QXSA 1M34E 4PSVA 1MKYA 4GDFA 3CKLA 4OI1A 3QG5A 2AHOA 1FMLA 4JL8A 2BCGY 1J2JA 3Q7PA 621PA 4DVGA 4IDOA 4Z1MD 2QSYA 4NHOA 4LCBA 3J81k 1PJRA 4KXFB 1H65A 4LYJA 3GFPA 2ZJ8A 1FW6A 2ZI7A 1TF7A 3SDZA 1E9BA 2QP4A 2X1VA 2OFOA 2GKSA 2NO0A 1XNJA 3U4QB 1V5WA 2ONJA 2JJ2A 1XU4A 4ACAA 1J70A 4B3DA 1ZUIA 5EUQB 2RGNC 2E87A 2CBZA 4FW9A 4E09A 3ZQJA 2ZS9A 4IEIA 4N3NA 3NH6A 1ZC4A 2D3WA 2GCOA 3PUYA 2BMFA 2H57A 1OXXK 5LDDC 1GKYA 2OFXA 1A82A 3UPUA 2WJHA 2O8DA 3EX7C 5HE8A 1N6PA 1COWD 4BQSA 1HURA 1G19A 2QQ0A 3VNVA 3NWJA 1DAHA 2VSOA 3QPVA 2ZYVX 2F3RA 4A0HA 4CEJB 4I1SA 4QC2A 4LGMA 1DAEA 3QBTA 4DLRA 3TIFA 1RIFA 1OFIA 4DT1B 1R0ZA 3A8TA 3Q3JB 1ZINA 4Q01A 1G7SA 3KDSE 5E95A 4URZR 3T1QA 2G88A 3AQ4A 3OAAD 2DWOA 4G5OA 4MYHA 4DCVA 3R7WA 4F93B 3I3SR 1PUJA 3CM0A 1YZGA 4R2IA 1Z2CA 3FKSD 3OFNA 2O8FB 2MSDB 2YKGA 3L43A 3SE0A 4NYMR 1E2MA 1GSIA 4F4JA 2ZUBA 4DDUA 1QHGA 1AQYA 2AR7A 1ONBA 3MWJA 2ZRBA 4B3XA 2HYDA 2JLZA 3THXB 1XEWX 3ZZTA 5EE0A 4PANA 4C0SA 3TNFA 5IK2A 3SYKA 3WNCA 3ZVNA 1W1WA 1NRJB 2I4IA 4ZI3A 1OPXA 1W36C 4OHVA 1OB2A 3CUEF 1YZKA 1ZMXA 3PJRA 4KJZA 3NEYA 3MMPA 1G18A 2QP3A 4O25A 4GSYA 4Q4AA 1TMKA 4CVNA 3GJ5A 2F1IA 5FL3A 1KKLA 3K53A 4DLSA 2JDIA 4BZPA 1KI6A 2BBSA 1KY3A 2LCFA 3CF6R 2HUPA 1Z0FA 1XTJA 3GLHA 4YDSA 1DS6A 3NBXX 5KSPA 3IIJA 4V02A 4QG7A 4FXPA 4TLDA 5TV2A 3U3JA 1E69A 5FTMA 3DZ8A 4L5BA 5TY0A 1ZBDA 5E4FA 4Q18A 1AA9A 3SHFA 1E2QA 3OIYA 1OSNA 1XMIA 1KI6B 1L7VC 1U0LA 4A8JC 2GWHA 4D80A 3IBGA 2IXFA 1Q1BA 4II7A 2XZOA 1WE2A 1NY6A 2PX0A 2GETA 1FFHA 1ZNZA 3L0SA 1S3GA 5JRZA 4LSGA 2PJZA 4X8MA 5FI0B 4ERNA 4WAUA 4MQBA 2VRWA 2TMKA 4XVUA 1CR0A 3AVVA 3UWOA 2C9OA 4Q1BA 2B8TA 3CRW1 3NBFA 2UZ3A 4MDEA 5DHAA 4B44A 4FCWA 4Q7KA 2J7PA 3H0KA 3ZDQA 4I81A 5G53C 4B6FA 3AP2A 2G3YA 8OHMA 1WB9A 3TJZA 2ZJZA 1YU9A 3IDQA 1NSTA 1ZJ6A 2Q6TA 1XCMA 3A4NA 3C16C 3KXKA 2REOA 1QHHA 4F38A 4HYYA 3TKLA 3PIRA 1A1VA 3TGPA 6Q21A 1ESMA 4RD6A 3KL4A 3ONWA 4RCYA 2VP0A 4XWOA 2HYIC 2ATXA 3AVOA 3VTKA 2IS2A 3W3ZB 1NLFA 1KNQA 1IXRC 4RZ3A 2CVFA 1IXZA 4B2IA 1S4QA 1Z8FA 4DLXA 2H8KA 2P3SA 2P67A 1KK3A 1VDZA 3CX6A 4GMXA 3VHXA 1OH6A 5EP2A 4LHYA 2R6CA 3R9WA 1XD2B 4PHGA 5P21A 1Z63A 2PH1A 3QEOA 2JLYA 2J45A 2ZITA 4O0MA 4XSHA 2A78A 2ZRFA 5HKKA 1SXJC 1BYUA 4EKDA 2A5FA 4TMWA 1PUIA 2BDTA 5CLQA 3BC1A 1UM8A 2JATA 4FMCF 4CEHA 2GF0A 2AD5A 2BKUA 1XXHB 2KB0A 3R20A 2WOJA 2QUZA 4Q7LA 4GI7A 4IOKA 4AYWA 1CRPA 1BS1A 1K5GA 1OIWA 3G5UA 4GL2A 1AZTA 1H8ED 3A1WA 2IW3A 3QNUA 2WPDA 5KDOA 3CZQA 4TQUS 1HUQA 5CM8B 1JJVA 3AP3A 2GZDA 5JCPA 3TSOA 2B92A 2NPIA 1DEKA 3Q85A 1SXJA 4JLBA 4PSKA 3R9XA 2QGZA 2PJRA 2V55B 4B71A 3K0CC 1KAOA 5J4LA 5KPJA 3DVLA 5C18A 3SC3A 3BE4A 1UFQA 2FZ4A 3GJ7A 4OI4A 5DN6A 2B21A 3MJRA 3RS3A 4OQLA 4OJKA 4C30A 3MUFA 3U4QA 3VX4A 5UKDA 1OFTA 3KB2A 5M04A 4Q1EA 3U7HB 4C2UA 1LY1A 1PLKA 1B0UA 3UXMA 1HY3A 2GK7A 3REGA 5J4VA 3D7MA 5L3SA 4BFSA 5KSOA 1EFRD 2PEYA 5DLQC 2JIZD 3IPYA 1KSJA 1G3IA 2QZ4A 1LS6A 3QXJA 4RVCA 2WSSD 3T12A 521PA 2MSEB 4Z8YA 3W8NA 4NCKA 1XEWY 3EZ7A 1XB2A 4PHHA 3QKSB 1GNPA 5B30A 2OE2A 2QPTA 4YMSA 4JSTA 1ZM2A 3I4LA 4KCGA 4AG5A 821PA 2PX3A 2FZLA 1HEIA 3A1SA 3P20A 4GBMA 2IL1A 3AV0B 4G01B 1KZ7B 1PZNA 2F6RA 3GJ8A 4KHZA 2P0EA 2HLDA 2WTUA 4TLAA 3NH9A 2GBLA 1KGDA 2O5VA 1G7TA 3CNNA 4M0LA 4QFMA 1XZQA 3GEIA 3ZZ0A 1NIJA 1DAIA 3WHKA 4Q4HB 4JKYA 2YINC 3QVVA 4TN1A 5B64A 4MGYR 4YXWD 5DISB 3U60B 3I73A 2GRJA 1KI7A 1VYUA 4FD2A 1XJQA 2LKDA 4C0LA 1B23P 2A5YB 4IDQA 3KTAA 1HE8B 1OXSC 3OEED 5F2EA 1NP6A 5CITA 3OE7A 2WZQA 4M1YA 3FFBA 4QBIA 4ARZA 1VCOA 2DFNA 4LC1A 3GEEA 1XEFA 4BE7B 3FHTA 1UDXA 4KU4A 2ZE7A 3R9IA 3L8YA 1QZXA 2V6IA 3GFTA 1U0HC 4XSGA 1FX0B 4AKGA 3HR8A 2ASEA 4AKEA 4D0GA 2RB4A 3BFVA 4C0KA 1G21E 5EXSA 2XGJA 4AD8A 1G6OA 3BAFA 3P1JA 2XB2A 2VYFA 1N5LA 2EWWA 3EZ2A 5FOUA 2ZI5A 3PQCA 3CX7A 1QG4A 3TUIC 2Z43A 3C4JA 1GKIA 4MGKR 1MO6A 1N0UA 3LW7A 2PZEA 3VMFA 4QHTA 3NG1A 4R71A 1Q21A 5CJ2A 3SHWA 2IUTA 4KV9A 5SZIA 3K8YA 5KSYA 4LI0A 4TL6A 3RAPR 1XPUA 1MO5A 1E9CA 2WKRA 3IQWA 1X1SA 2YNMA 3FKSA 3OFND 4J0QA 2QRZA 4AYXA 5D3QA 3A4LA 3V4FA 4LHZA 3C14C 1P72A 1XTRA 3X1WA 2D7DA 4DLUA 3IHLA 4TYQA 1FUKA 2C9YA 2FSHA 2V54A 4JYCA 4US2R 3EC2A 2P65A 2N1BA 2GEUA 4DIEA 3B82A 3K0SA 4QGHA 3TVDA 3U3KA 2ZUCA 1KI2A 2EFGA 4A0GA 3P32A 2I1VB 3RYTC 3U7EB 3B1YA 1N0WA 2XX3A 4BFUA 2WJGA 1U9IC 3CONA 4KFSA 3CNOA 1FQKA 1E79A 3PITA 2H1LA 4WIAA 5AUOB 4FMDF 2RHDA 2A30A 4PC7A 4M1KA 1E96A 3RRZA 1TL7C 4Q4HA 2OLJA 1ZM7A 1IM2A 1GITA 1JQJC 2IS4A 2F7SA 3B2EA 5TXGA 5CDFA 4A6XA 2OAP1 5JJIA 2EFCB 1F60A 5IDVA 1N6KA 2JDID 4PZZA 2IHBA 3NKVA 3AKCA 4CYMA 4ABYA 2QTHA 2RKOA 3CF2A 3NBYC 3CF0A 1G4AE 1L2TA 4V03A 2WSMA 4IFEA 5AUPB 4KVAA 5G3YA 1E2FA 4LV6A 1JB1A 4I1OA 2VHQA 2XSZD 5EZ6B 3RVBA 2H7VA 1FX0A 4NCHA 1E99A 1W49A 4OHYA 1XCPA 5CJPA 1W4RA 2WMOB 3UMSA 3VR6A 4ZIRB 1ESNA 1NMYA 4CEHB 2E1RA 1AJEA 1E4VA 3KUDA 1Z83A 3PVSA 4NMMA 2ZROA 4UNNA 5DIFA 2IYLD 4V0NA 1VG9B 1LTQA 4RD3A 4B43A 3AF3A 1TPZA 1NJFA 2OBLA 2J3EA 1NN5A 2AKAB 5DO9A 1S2MA 4G5QA 2HEIA 2FG5A 1O3YA 5KSZA 4C4PA 2WWIA 1D9ZA 1SHZA 1CIPA 1XZPA 2DHRA 1CR1A 1R5BA 4LV8B 2DWPA 3HU3A 4DRZA 4F4CA 3B13B 1R7RA 1RW4A 1XFAA 4IXNA 5DYIA 5L8VA 4K81B 1XX6A 4LBYA 4Z1MA 1OHHD 1IHUA 3KKMA 2WAYA 3WBKA 1I2MA 2F9MA 5FBLB 1LVGA 2QU8A 3AGPA 5L3SB 4NYJR 2D2FA 5IF9A 3TUJC 4QM6A 1Y3AA 3TMKA 1T6NA 3I72A 3A1VA 2IBMA 3SQXA 5TMPA 2ZIAA 4OI0A 4HLUA 4DSNA 1JPJA 2BHRA 5LB4A 4X8LA 1HQYE 3ZH9B 3R8FA 1DPFA 2PZFA 3P4XA 2FPKA 3U5ZB 1BMFD 1KO8A 2WHXA 3EXAA 4MITA 1TEXA 3RDPA 3MWLA 1SVLA 2DCUA 4PQYA 1E3MA 3AKYA 1QHHB 2H5EA 3HYTA 3HPQA 2EW1A 1CR4A 3RABA 3GLGB 1GWNA 1GVNB 4QJ5A 2CK3D 1U98A 2VHCA 4HLUC 2ZVQX 2IK8A 4ILEA 1E79D 2GEDA 3CRQA 2GXQA 5IRCD 3IIMA 3PCRB 4U5XA 1HT2E 4CZ2A 5BXQC 4TSFA 1R5OA 3SJAA 5FOVA 2IYTA 2AXPA 2Q3HA 2Q0HA 4YC7A 2DY1A 1KMHA 2J0VA 1W0KD 2J5XA 4Q21A 4BWYA 3NVAA 3THXA 3ZLJA 2BCJQ 3TR0A 4LJ9A 5JEDA 4GP7A 4OHXA 2OBMA 1TF5A 1OE0A 2YOHA 1DAGA 2RAPA 5CM9C 4U7DA 2Q21A 5EXTA 5FFMA 3R7WB 1K6MA 2WBLC 3WMGA 1NMZA 1EFTA 2ZE5A 1GL6A 1Z6AA 2CNWD 2VSXA 4QKQA 3GLFB 4D26A 4BFWA 2VL7A 1KI4A 2NOAA 4S35A 3RC8A 1Z6YA 1U0JA 2VQSA 2W6ID 2QY9A 3GJ6A 3U7FB 3X1DA 1Z0KA 2FPMA 3THWA 2X19A 3A1UA 2O8CB 2RGDA 1KK2A 2WKPA 3FTQA 1KO4A 5DGXA 1OH5A 3L0PA 4XWAA 5JI3E 2HJGA 4IRUB 4TQ9A 1IN4A 1ZUNB 4LZZA 1A2BA 4EFMA 1SHKA 1G291 5FPKA 3BOSA 3CNLA 3GLIB 4IXMA 5F9FA 1Q22A 1ZW6A 4LWZA 2QP9X 3W5IA 1M7HA 2A7QA 2GESA 3EAQA 2J7PD 2GNOA 5KDDA 4PO9A 4FMDB 1E9RA 4TT3A 2UVQA 3NDPA 2ERXA 2EQBA 2G1JA 2B6HA 4FN5A 2QMOA 2ZRNA 4LPKA 4MYUA 4A4DA 3ZVRA 4MYTA 4MGIR 3PXGA 1FTNA 3TW4A 2J46A 5DI9A 1YVDA 2WWFA 1XMSA 3H84A 5DI3B 1G64A 4X8HA 2BBOA 1X6VA 3VR2A 3DO6A 2QE7D 3EG5A 3PEVA 2ZJAA 2VHTA 3BORA 2ZRCA 3D3QA 1NMXA 3B9PA 2GXUA 4PPFA 1GDDA 4RJLA 4B48A 1NBME 1UEIA 2XTMA 5BN5A 1PVOA 4MRPA 5AJZA 4HLDA 221PA 4H1UA 1JPNA 5H68A 3U3OA 2CCGA 4M53A 3LVRE 3TQCA 1BIFA 2G1KA 2ZYUX 3B7GA 4LHVA 4YQFA 5JHGB 3OE7D 4FWTA 4QM7A 1T4GA 3AVPA 2BV3A 4QRHA 3KQUA 2DWQA 4YMTA 2D7CA 1VKJA 2QE7A 3TH5A 2P2LA 2FWRA 4PAMA 1C4OA 1QBKC 2QAJA 2QBYB 1FP6A 2Q9AA 1E94E 2IYXA 2VPPA 4BFTA 2QNRA 2GJ8A 5EUMA 2PEZA 3B60A 1AGRA 1LNZA 2AX4A 5JWOA 4LJ4A 1G8PA 4LJAA 2P6NA 1NLZA 1YR9A 4OI2A 5CK5A 3K1JA 2ANCA 4DB2A 4PFSA 2F3TA 1RRPA 4JKIA 1RKBA 1OYYA 3NXSA 3SEAA 4KFRA 1KO7A 1UKVY 1KO5A 1NBMA 3NHAA 2GAAA 2HDNB 3K0FB 4P4UA 1CLUA 1D2NA 1G3QA 1GZSA 1DO2A 4G5GA 4UJ3A 2CLDX 1EFHA 2D06A 3EIQA 2IYZA 3LBNA 1Q0UA 4PSAA 5CLLA 4F91B 2WOOA 1ZAKA 2AFHE 2HXYA 2WJJA 3TW8B 2G9NA 3K70C 3DM9B 2Z4SA 1XTKA 4ITRC 2G0NA 2G0TA 5KYKA 5FBRB 3U7GA 3AF4A 1VMAA 1IOZA 5DHFA 2PMDA 1ZD1A 3ZZUA 3A58B 4BRUA 5J4YA 3X1XA 1OB5A 2VA8A 5TB5A 2ZRKA 1CJMA 1X8JA 3CB4A 3LW8A 2RMKA 4JS0A 3RNLA 4C2TA 4CGZA 3AVUA 4JMPA 2JA1A 3CR8A 4MRSA 1AS3A 1CBUA 1EWQA 5G40A 3AVXA 4DJTA 1D2MA 4HLQB 5JEEA 4IOJA 2OZEA 5CYPA 2YOGA 1Z6GA 2NGRA 3OZXA 4D4MA 2BMDA 1X8LA 2HLDD 2ZS8A 4WXRA 4S2EA 3VU9B 2KBFA 5FUXA 4BLQA 1UKZA 1KTVA 2FMXA 1EX7A 3I32A 1ZRHA 2PLFA 1WQ1R 3I62A 1KAGA 5DSZA 5HCIA 2OCAA 4OK3A 1QHIA 1US8B 2QROA 1G1MA 4P4SA 4OQFA 4P31A 3F8TA 2H18A 1W46A 2WSSA 3SN6A 1MT0A 2ZEJA 2ZU0C 2FFQA 3SBEA 4DSTA 4X8OA 1Q3TA 2R6GA 1GL9B 3PUVA 4D81A 4QBFA 1IY0A 1TQ6A 1E2KA 4UXHA 4EPVA 5JSZA 4RFSA 1T9HA 1W48A 2BJVA 5F3WB 2CVHA 2OFWA 3TQFA 4TTRA 2ORWA 1KIMA 3PEUA 1VHLA 1N6OA 3SR0A 1E32A 2IYUA 1ZM3A 2CCKA 3KKOA 4HAWA 4GP6A 1FPMA 2JGNA 4OQXA 1TADA 4M1MA 5BN3A 4FIDA 2PCJA 1GG2A 3I1FA 4Q1CA 1P61B 4E22A 4HEJA 1G7CA 2FSIA 1AM4D 4KBFA 1M74A 1VTKA 4NE2A 1XPOA 1W4CA 2QSZA 2IT1A 1UPTA 4RKFA 1KDPA 1W2HA 3QG1A 4V0ME 2QAGC 2WWYA 4A92A 2KE5A 4GOKA 4JBYA 3BH0A 4C0BA 1DARA 5FTKA 4TZ6A 3AH8A 4AI6A 2V7QD 4TL8A 5FH9A 2R44A 2F43B 4L9SA 2J9RA 3VKHA 4C0QC 5JHHB 3QEJA 2BC9A 2WJYA 3FFAA 5DN6D 4ASUD 3AKEA 4TTQA 1WP9A 1I2DA 1YZTA 1F3OA 3OHMA 3TSWA 3LY5A 3U3MA 3GLFA 1U2RA 3CX8A 1A5TA 5AWFC 3QF4A 1YR8A 1AZSC 1CJUC 4QNRA 3MSXA 1FUUA 3WXMA 4DB4A 2ZR7A 2GXAA 4W5JA 3ZD6A 3RRMA 4CEIB 3H1TA 1SKYE 3TE6A 4HB2A 1XTIA 3EPHA 3QXCA 1FL9A 1M8PA 5TARA 4PPGA 5HPYB 4LYAA 2Q3FA 4BPBA 4IDNA 5IHPA 2AFIE 1LF0A 2C78A 5BWMA 4TYPA 2QMHA 4PAQA 2XTZA 5AJWA 2V3CC 4BFYA 3SNHA 4A2PA 2CL7X 4TZ0A 2AXNA 2OT3B 2QM7A 4HDOB 2C8VA 4GFDA 1W0JD 3T34A 5JCZA 3FPAA 3W6OA 2PZGA 4UJ5A 1MABB 2VIIA 2VP4A 3ASYA 4MKHA 4EAQA 4NYIQ 5EP3A 4XIGS 4BFXA 4IVPA 3VKGA 4R7ZA 5B58C 2ONKA 5CIWA 4DZZA 3GCGA 1OKKD 1D9XA 4KITB 5EXPA 2ATVA 1YZQA 3S1AB 3DMDA 3I8SA 5EE1A 3FOZA 4NBSA 4QOSA 4MKGA 4PC6A 4LHXA 1XD9A 2FA9A 4PC3A 4QHSA 4BZXA 4Q4LA 5JWHA 5A5GA 2HF9A 1XWIA 4PQFA 1C9KA 2CHQA 3M4YA 4A8JB 3QVUA 4L16A 1W4AA 4MYCA 2RGEA 4RZXA 3ZVMA 4TLEA 2F55A 2ZJOA 3QY0A 4KFUA 2D2EA 3W9YA 2C2HA 3B85A 5HZHA 4D25A 2H16A 4HI0E 2BVNA 3X2SA 1F2UB 4B35A 3THOA 1FNNA 2D62A 4QL3A 1E2EA 1VECA 3T06B 4RD4A 1EK0A 1U8YA 3I5XA 4JZKA 5FOSA 3ADCA 3H4MA 5EP1A 1W0JA 4KI0A 5GJCA 2WWXA 1J7KA 2BKEA 2GXSA 4D0LB 1T8TA 1I4TD 1N6LA 1MH1A 1T3SA 4GMDA 3NBZC 4P33A 1OT3A 1Z5ZA 1XXHA 2RGGA 2XJ4A 3OESA 2HJVA 1P75A 2V8OA 4NCIA 2VP5A 4OQNA 3AVQA 1E2GA 5AJVB 3I61A 1W36B 4TTPA 1UBCA 5HTKA 3LBIA 5L3RA 4OQMA 2EFDB 1DOAA 1EGAA 1NVUQ 3OF5A 2RH5A 1YZUA 2VSFA 2Z83A 3AF1A 1S3SA 4HUQA 3A36A 3RS2A 3NC1C 5AK0A 5J4HA 1R0WA 5CK4A 3RS7A 4WXPA 4PAOA 3T61A 1IBRA 2CE7A 2JLQA 2NO7A 2FU5C 4BLPA 4A82A 2IYWA 1D2EA 2MMGA 1EG7A 1SVIA 2IS1A 3LO5A 1IN6A 3LRPA 1YRAA 3GLHE 4KVGA 4DCTA 4A2QA 1I4DD 1FOEB 3QKTA 2DFLA 5GJWC 1KY2A 4PX9A 3OEHA 1W5TA 3LD9A 4RSGA 2ZJ2A 3NHBA 1E1RD 4DSOA 2ZAMA 4Q4JA 1CU1A 2EU8A 5LB2A 4TYNA 1W2GA 5FL7A 3LVQE 2QT1A 2W2VA 2HCJB 2ERYA 1G6HA 1XTQA 3O8RA 1XXHE 4N1AA 1RPZA 2AWOA 4LOAA 4EQ6B 1S8FA 2FSFA 1AGPA 3NDBB 2O8DB 1N0VC 1CULC 1DG1G 2IXEA 1M7GA 3BH7A 3E2IA 1L4YA 3IQXA 1X8KA 4B6EA 4XWKA 4BLTA 1GM5A 2REXB 2GZHA 4Q00A 1RC8A 3GEHA 2OLKA 1XDBA 2H92A 4FCTA 5EE9A 3KKQA 1VG0B 4RZUA 3VU9A 2F9LA 4Q1FA 1DVRA 4KLZA 3ZJYA 1K8RA 1GNRA 1DG3A 1UBGA 1ZU5A 1M1YE 3CBQA 1II0A 4NPHA 3KXLA 4IOMA 3T1OA 1XBTA 2GCNA 4TQAA 3E70C 5C1BA 4MKFA 4V0KA 2QEQA 4HUTA 2QAGB 1AN0A 4WZAE 2PL3A 1OW3B 2V1UA 4ZKDA 1NN1A 1E2JA 3W6NA 4CDGA 1G20E 3K9GA 1C1YA 2XTNA 2J41A 4AG6A 3H2YA 1JAHA 3K0CA 1T5LA 4PHFA 2ZRPA 4RFSB 5FI1B 3W8RA 1KK1A 4JIMA 3FDIA 4ARZB 3REFA 1P9NA 1ZM9A 1S96A 2YC2C 2WJIA 2Z4RA 1JNYA 4BASA 3JZAA 4DCNA 3E1SA 2FDCA 5BN4A 4UNSA 3X1ZA 1M2OB 3QXXA 4HAYA 2J0UB 4WOPA 5CB6A 2X8AA 1TU3A 3DL0A 1S1MA 1W4BA 3FWYA 3LX5A 2VHJA 2GEVA 3Q5EA 4K8OA 4RD2A 4XTCS 1NVVR 3RS5A 3TLXA 2DPXA 2FV8A 3ZQ6A 4KODA 1Z0IA 3WMEA 4DEYA 5JZVA 1JJ7A 1PLJA 3AM1A 3LLUA 1ZNYA 4M2LA 2C9CA 3T15A 3ADDA 3EA0A 4LV5B 2JLUA 1LB1B 3GJ4A 2YWEA 2YWGA 1CJVC 2R62A 5HR5A 1EXMA 3AVWA 2A3RA 3LNCA 4BEBA 1Q12A 2ORIA 3B1VA 1F5NA 2ZE6A 4LDJA 4G5RA 2XXAA 3VKWA 2AN9A 3WHLA 4PC1A 1E2DA 3DM5A 4C7OB 1GL7A 1RRCA 3BWDD 1QVRA 1E6CA 3L82B 4BLSA 1QVAA 2F43A 3WRXC 2QN6A 4HAZA 2CNWA 3UG7A 3VFDA 3KJHA 2IX3A 2UKDA 1SXJE 5HCNA 4NYJQ 3UATA 1MO3A 4NKRA 4A15A 1HTWA 3ZIAD 1VYTA 2HT6A 2W00A 2BWJA 4TLBA 1P62B 2UZIR 1I4LD 4HDQB 1DE0A 4B3FX 2VO1A 2OCYC 5AJXA 3FHOA 3U3RA 4NP6A 4A2WA 5J40A 1XJCA 3C7KA 3ZS8A 2W0SA 1DAFA 3AUXA 1SVOA 3SZRA 3L0IB 4DLTA 4TMVA 4B3CA 4F7WA 4JLMA 4YMUA 1NNEA 3FGNA 2I3BA 3IPXA 1ZVQA 4QHYA 4A9AA 2IYRA 2O8CA 2CE2X 5C4MA 2X2FA 3MFYA 2IUSA 4GOXA 2ZSEA 1ZD8A 3BFKA 4FI3C 4LPSA 4P3YA 2J59A 4TMZA 4Z8XA 3T1VA 3W5JA 1V43A 4B32A 2ODNA 2WICA 2QBYA 1P2UA 3OEHD 1SVKA 1AIPA 4DWJA 2HCBA 1P5ZB 4Q48A 3TR5A 4HB3A 2WWGA 1E98A 4A1FA 1F48A 3MWKA 4M1OA 5A4JA 5SZHB 2KBEA 1SVWA 4M1SA 4US1R 3PEYA 1GNQA 2OXRA 4I4LA 1ZIPA 2CJWA 3F3YA 5K8LA 1VG8A 2BIFA 2GAOA 4A36A 1Z6XA 3TSZA 1EX6A 4I1VA 5AUQA 2QPAA 3LQRA 1WBDA 2WAXA 4IEEA 4Y0VA 1Q57A 4OYHA 4BUJA 4LK2A 5E7IA 4B33A 5JMTA 5KNDA 1Z28A 2WIAA 5ANRB 3SFVA
chains in the Genus database with same CATH superfamily
2GLTA 4LXUA 1MC4A 1XALA 4QX6A 5DOZA 4AC9A 2I66A 2BGGA 1YCDA 1A4XA 1N5MA 3A6JA 4JL5A 4PZAA 5CB4F 2VHYA 3E9CA 2A0UA 1QP7A 5AHKA 3RGWS 2FFHA 2ZWPA 3O1IC 3EY9A 3OKAA 1TMOA 5DV9A 5LR6A 2I33A 3ICPA 3WYEA 1JDUA 2PWZA 2V96A 4BO3A 4EPYA 2QMUA 1L7OA 1RFLA 3PWTA 5EIWA 4OM8A 4WD3A 1LCIA 3PDUA 1DOZA 2OAQ1 4LZJA 1E58A 3IAHA 1W85B 1EVQA 5MN6A 1Y63A 5JSUA 1KSFX 4LBVA 3CPEA 1N2OA 4Q7MB 3DE3X 3TCNA 2I6UA 2FZVA 3HN7A 1K7EB 2OBNA 3ST7A 3B3FA 4BC1A 1EP9A 4XD7A 1SG0A 1BVYF 1JKIA 1ST3A 3HWWA 2W37A 4K9SA 1HDCA 4CG2A 1ISFA 1Y98A 1C50A 3L92A 1IIRA 1HV8A 4KK3A 2O8NA 3RU9A 1VCHA 4BUCA 6LDHA 3CLTC 121PA 3O8BA 1XAGA 4PGHA 2MSNA 1U7WA 3C39A 3UZUA 3PC7A 3DLPX 4I9NA 2CJPA 1BKYA 4ND6A 3ZW8A 3LY8A 5B6JA 1Y7PA 3ELYA 2D74A 5J2UB 5I51A 3MWYW 1B0AA 2O0LA 3OIVA 4ZRMA 5GWXA 4AQ7A 3UTDA 4JVNA 2E4UA 3MBIA 3DDNA 1DJPA 3MA0A 2DVMA 2H2WA 4J7UA 4B84A 4ZK2A 1BN7A 4WW0A 3N3BC 2DHDA 2CZCA 2WZCA 3R3VA 1CUBA 4AJ2A 4EJMA 4TYWA 3JQGB 1YJ5A 3RSCA 3WSWA 4H4CA 3FY4A 1K7XB 5GQSA 4HP8A 3D4BA 5KHAA 3A10A 3IP6A 4ZALA 2GWRA 2XZPA 1C3OB 3T8YA 1E9AA 3H2IA 3U3XA 4UFPA 1Q0ZA 3JASA 1R8QA 1FTSA 5HQJA 4MUEA 4HAXA 1JHXA 3INGA 1Y9EA 4CMIB 1E4EA 5EYPB 2JFGA 1N78A 1INLA 4IQ8A 1PCXA 2OUKA 3FHLA 3RBXA 4F8EA 1FZTA 4TN5A 1SM4A 4US0R 5CDFE 2QQEA 3ECAA 3FWZA 1UOEA 3M6XA 5A02A 1BCRA 4TZKA 1JJIA 3M8KA 4OTZA 1IJEA 2W6JA 2ZIXA 4GX5A 1UMDB 3FPSA 4GYWA 3WWDA 2W9XA 1L7QA 1ZK0A 4Y2RA 5GGYA 1B1CA 1B7GO 2IZ5A 5FLKA 2CMKA 1SBQA 2PZMA 1TT7A 1W87A 1W94A 2GS9A 3HA2A 3HUTA 3LXXA 2FE4A 3MGAA 5J5CA 2B0CA 4I36A 4UQLA 1MJGM 4UBIA 1U4SA 2QORA 4MR8B 5T64A 3THYB 2KPOA 5IUKC 3A4IA 3DCIA 3WLSA 5HWSA 4K9RA 5AHOA 2K5UA 4XUCA 3TDKA 2XXAB 1N75A 1XNHA 1FTGA 1SURA 2R1TB 3D3WA 3KJQA 4JQZA 4WK0B 1VHJA 1Z18A 2B61A 3R7DA 2V7QA 3COVA 4EARA 4BX2A 1ZN8A 3WLAA 3ZN2A 1GAJA 4JVMA 3CPSA 4XJTA 4X54A 5EJ6A 2GJKA 1YULA 2LD4A 2PH7A 4PYNA 2ID4A 5ALTA 4AZ0B 4EPTA 5EHZA 5KJFA 1WF3A 4WCDA 3WDMA 1P5HA 1QV7A 2R9VA 5L6MB 3S40A 2MR6A 4XWWA 3JWPA 4E5YA 4XLZA 2YVUA 3UK1A 1GRQA 1NUUA 3CO5A 3WJ2A 1U2DA 1EXVA 2XUAA 4GZMA 3AONB 8MHTA 5H3CA 4ZT5A 2JCSA 3JQAA 1LS1A 1L6IA 1K3TA 1YT5A 1TUBB 1Q20A 2JEYA 2WJAA 3O8QA 1G8YA 1I3CA 3IAFA 3QI7A 3ESQA 7ABPA 3V80A 1XP8A 2Y0EA 3TZ6A 4RSHA 4DR1B 1E0AA 3E18A 1NXQA 1D3AA 4F21A 4EDFA 2MSWA 5JTUA 1FYWA 4DCMA 4QAQA 1AUQA 3N5KA 5CX4A 2CLLB 1K1EA 5J1SB 3PHGA 1TZKA 1TRKA 1AKWA 4CEJA 4Q7JB 3CTPA 4XPZA 1WMBA 2C5LA 3R41A 3VR6D 1TTPB 4YJHB 1JLLA 4DT1A 1SGWA 1WHSA 5KOJA 3NONA 2WM3A 2Y1DA 3JYHA 2HQSA 4FPXA 2ZS7A 3KYDB 4LWPA 1KR5A 2B5OA 4OQZA 1NQXA 3T99A 5DNVA 4N0QA 1GTL1 3BJMA 3K9FC 1YNSA 3KQOA 2ICAA 4RGYA 3DF9A 4PIVA 2A0KA 2RHCA 2WVJA 3RYFB 2KWIA 4LJYA 3H5NA 3TD2A 3W5SA 4BNTA 4MIOA 3RTAA 2EL7A 3F6EX 1R15A 4NNJA 5M2QA 1RCTE 4AX8A 5BSKA 4GBED 4HK4A 1VPDA 2IEZA 4NFLA 2OP0A 5D1NA 5G3ZA 3U0BA 3WO0A 1LFAA 3T7SA 1YQ9A 1O87A 2HXSA 3UMCA 4CM4B 2H08A 4WXMA 4B2PA 3KJZA 1HKHA 5JQWA 2VXCA 2P6PA 2YHIB 4ML3A 3F8SA 4OXRA 1BKDR 3LWNA 4JBWA 5ADUS 2A9RA 2JI4A 5KPDA 4PPQA 3LQYA 1GP2A 1JXAA 3WZMA 2NO9A 4MRRA 2AR0A 2G08A 3EUWA 1Y3BE 2DJIA 3E5HA 1UR5A 4JNCA 4IG9A 4KMOA 1SZCA 3PDHA 2CVOA 3MS4A 3PE6A 5KKCA 1C9MA 4C08A 3VNUA 3ND6A 2OXCA 4HXEB 1PJCA 1AKNA 4FINA 5SICE 4JI1B 1U9YA 1TUEA 4URUR 4YRZA 1M83A 3K8QA 2W2TA 4TM8A 4ZJUA 4KXXA 1RS0A 2Y1EA 2P2NA 4IUYA 1OWOA 5I7WA 2JFYA 3BE5A 5DE3A 3GJ3A 1ZBQA 2XBMA 4PTLA 5F7JA 2Y9MB 5EINA 1K08A 2XIJA 2MTBA 1KIFA 2VF2A 3KRTA 4HEHA 5GVSA 3FDFA 1OHHA 3DZDA 4YDQA 2J0EA 1IUNA 1LNQA 1W47A 2CC2A 4PCUA 1L5GB 1A69A 5DGCA 5I8PA 1RBZA 1N6RA 4G9GA 2VG8A 2VZ0A 5FTLA 1JEEA 1P60A 1UADA 1KH2A 3CZCA 3OPXA 3TR6A 4EB8A 1AKVA 3GJTA 3KTOA 4G89A 5KWIA 2VPIA 2YXLA 1VE3A 5ALHA 1XDUA 4GOND 4EJ0A 1F6DA 3D43A 4QECA 3DOIA 1GY8A 1GYQA 5FFNA 4TWBA 4N3CA 2RD2A 2DBVO 4L9AA 1OFVA 2XVXA 3L0ZA 3WDLA 4Z4GA 1DO0A 3LZ6A 1SVSA 1UMBA 1GPWB 1T9GR 3DOEA 4WFKA 1HYHA 2H9AA 4GPZA 9LDBA 1IZ9A 2SCUB 1PFKA 2NO6A 4NIMA 1OIXA 1VG1A 3DDCA 4LECA 3CLUC 3QEMA 2VDNB 3GDGA 5LZ4A 2E4WA 5IDWA 3S44A 5AESA 5FR1A 3NYIA 5CCEA 1RU3A 2O0KA 3WGTA 3E35A 2C83A 1H6BA 3VSCA 5EJ9A 4F7DA 2PNJA 2KI5A 3UJHA 2DUWA 3E2PA 4KO4S 4LWQA 5INTA 1V5EA 2BEUB 3HN2A 4W9NA 1IH8A 2RONA 3GUZA 4AW9A 2JAQA 5CFOA 1PW7A 4V0QA 3TXXA 3LNTA 3VSEA 3HJCA 1DFGA 4GXRA 1N9GA 1ZK3A 1U5BB 2P2SA 2YWDA 3IBYA 3PI6A 1T9DA 5IBQA 3R75A 4W63A 1PSWA 4MRVA 2JASA 2FDRA 2JK1A 4FNAA 2TECE 4NOLA 5HDQA 1UMDA 5B53A 4Q7QA 5IC6A 4JROA 1GFIA 3SYMA 1MO4A 3GH1A 2EKZA 1J90A 3HCAA 4JBXA 4OL0A 5JXJA 2ODBA 4QXAA 3QIVA 3EIOA 3PFWO 1RKVA 5TPZD 3DVAB 2XE8A 3PD1A 5DM60 4DUYB 3K30A 4Q19A 3A2KA 4OA8A 4HWGA 1P91A 4I4CA 4J16A 3FYHA 1B76A 1RXWA 2GOYA 1AS0A 3V4PB 2F62A 4JOQA 5TR9A 1JA1A 2OCIA 4CG0A 1JPUA 4YQZA 3S2YA 4N3BA 1KYXA 1SIBE 2DPHA 3MJFA 4IFIA 1IHYA 1KVSA 1Y3IA 1RZ3A 1LJ8A 2OORC 3P9SA 4EIWA 4IJQA 1IJFA 2GD6A 4URYR 1UKCA 1X7WA 3SSMA 4HDMB 3Q8XB 3AR7A 3GLGE 1R64A 1J1IA 3INTA 4ZVLA 5YASA 4FOPA 3WWPA 1DGQA 4BL5A 3C7DB 2NUAB 1XCOA 2OHGA 1NVMB 2HU2A 1OOEA 1NKTA 1OYOA 2HZ7A 4M9QA 4DDMA 1R6UA 4MV4A 1KYZA 2IWHA 1VBMA 1XPRA 4GMHA 1ZAYA 3CW2A 2O1XA 3VDXA 2WYHA 5JVDF 3RYCA 3TUZC 2PLAA 4XJXA 3ZY4A 1DBVO 2ZYIA 3CNBA 3DVSX 4EAAA 1E9EA 3PXXA 2B8JA 4Q34A 3AR8A 4YROA 2PVCA 2P9EA 4PWYA 1ULSA 3O91A 5JISA 1B41A 3UC9A 1DKRA 1EK5A 4COKA 2Z3WA 1U94A 1D2RA 5EUCA 1U7OA 1VPTA 4OCZA 4R7GA 4B6JA 2EJCA 5FADA 3JYOA 5EXXA 1GCAA 4KDEA 5JNLA 1RQLA 1FFEA 3MCWA 3V00A 5HW0A 1W5SA 1JT2A 2ZB8A 2FN9A 2OC9A 2VWPA 1F5SA 5IAJA 3LFHA 1AK2A 3WKAA 5EJ8A 3U4MA 1A8IA 2ID8A 2ZPTX 3PFHA 4UBOA 2A4MA 2VNJA 1G2IA 1AS2A 4MB2A 3JU3A 3IBFA 1WY5A 4R41A 3TTSA 4H7EA 5IT9A 1SA0A 2DTDA 5HUHA 4BVJA 2VTBA 4DR4B 1UKEA 5LXTB 1YJAA 1Q7TA 1TI7A 3RVJA 1RXVA 4JI7B 4EABA 4UTVA 3AVYA 1LDBA 3FVTA 1E2IA 4H9GA 1ZCAA 2ZRDA 4QUGA 3FTCA 4R9UC 5JZ9A 5LD2C 1LPSA 5B1YA 3EA5A 3RIEA 2VJKA 3GN2A 1B6GA 1NZFA 1VE1A 1NA5A 2V7TA 2WTXA 4AKIA 2E9SA 1A5SB 2OA0A 3QPWA 4BO0A 3AB8A 3QWAA 3OIWA 3AL2A 4JLDA 5JRJA 1Q2UA 3C6KA 3MBOA 3RUFA 2WTEA 3U2QA 5LPNA 2JGDA 4X61A 2PV0A 2RKWA 3AY3A 5AK4A 1LF5A 5B2ZA 5KUTA 3H97A 5DFAA 3IQEA 1NBMD 2QTLA 2NQ8A 421PA 3SIPA 4QVKA 5ADVA 3G2NA 1OGYA 4RV9A 2B2CA 1OH7A 3UG6A 3BZUA 5DW0A 3MYYA 3AEQB 4CT5A 2CZGA 1W93A 2ZRIA 4CRWB 4WINA 2ZWVA 5EKTA 3T7TA 2LPMA 3T5AA 3K6SB 2NO5A 3L1JA 5F98A 3PP8A 2HA2A 3I1YA 2F4NA 1IBCA 2CUKA 1L1QA 4TZTA 4DSUA 3ZWXA 2YRXA 1YMQA 3DO8A 2VAMA 1KAQA 2E0IA 2REQA 2X8JB 1E3QA 2QXYA 4E2XA 3ZHTA 5L4LA 2H8GA 1NXVA 1YR3A 3GLUA 1SKYB 4HR7A 4G0OA 5P8WA 3RLFA 2BFBB 3ZIAA 2OECA 4FFPA 4JYBA 4AJJA 3PGLA 3B2QA 3VJRA 3VKUA 1JIUA 5TJ9A 4AF8A 1MRNA 1LDMA 2GZMA 3SS7X 1H0SA 2IHZA 3WP0A 4Y1EA 3WL3A 5K0TA 1SG9A 4OBBA 1RBQA 2R3SA 1U0GA 1XQ9A 4S3MA 4XE5A 2DKOA 4ARCA 2ISSD 1IRXA 3ZD7A 3JVUA 3ZHUA 4PLCA 1K5DA 1KXZA 1QANA 1JDZA 3LC1O 4J07A 5B7PA 3UHFA 3NBQA 3GR6A 1CQWA 4EKYA 3AR2A 4GYJA 2ZXEA 3WJAA 5DDIP 3Q7QA 4KAXA 5GJVC 5TPZA 4E46A 3BXGA 4TWJA 1EDEA 2C57A 5FTNA 5B4UA 4EQZA 4YGYA 1IN1A 1V11A 3I61A 2HK8A 4PX3A 2SECE 3C6QA 1SKBA 2COEA 3TOXA 4YT4A 1NPTO 4KH1A 3RPEA 1P0PA 5KYYB 1PV4A 2Q3CA 4C7BA 1LBQA 3N74A 4NNPA 4R1MA 1Z22A 4C4ZA 1E2LA 1ZVMA 2NZUG 4MWDA 3WICA 2WU8A 3WBBA 2IX9A 3EE6A 3PCTA 4HNRA 4PZYA 3OEEA 3WLQA 4QULA 1H2FA 2FJPA 1RI5A 3CWZA 1G63A 4MR9B 5TGDA 4D7AA 4D6PA 3BIFA 3H1AA 4MS3B 2NSLA 1KOLA 3NS7A 3VR5H 3CLSC 1B42A 3GCXA 1NC3A 3NOVA 1JQBA 4OQEA 1LPPA 4W7SA 5ELMA 5TVGA 3T95A 3QK7A 3RSGA 1FFWA 3KKZA 5IJXA 3QKRB 3I92A 4NBRA 1UMBB 3OMWA 2XWQA 2BEKA 2EVWX 3NYQA 3V55A 2CUTA 5TQJA 3B9BA 3CRVA 3M5WA 3RT7A 5AKJA 5BSGA 2YV2A 5T8KA 1AUVA 1GGEA 1N6NA 3UXHA 1T36A 4YMVA 3L18A 1U1DA 4PHTA 1DSSG 3FHCB 3OEWA 3C1TA 3NAMA 3K70B 1G8AA 1S5PA 2XNDD 3BULA 5K6AA 3GH3A 3MXTA 3ZY6A 4F8JA 4M8NE 2X76A 5FUMA 3KWMA 2I6TA 2QAGA 5JXIA 4XQCA 4EY8A 1OI7A 2MMCA 5K8VA 2JZOA 2SICE 5F2OA 1AKMA 2X7JA 5F51A 2HF2A 2ZSIA 3E22B 3PWSA 6GPBA 2JCVA 2XOEA 2VT7A 3GARA 2WSLA 3D31A 1T0HB 1ULZA 2HCRA 1MIHA 2L82A 2Z30A 2ZIXB 4NENB 3VBEA 3DBLB 5IT5A 3LX8A 1W44A 3ZNNA 4HAVA 3VHRA 4M0KA 4QLBA 1ZIXA 3PC8C 4FEGA 4J3NA 3PXCX 1G2PA 4EJSC 1VPEA 2YY5A 1O08A 2E5LB 2DLCX 4TV8A 4Y1GA 4RYLA 2FG7C 2ZE8A 4F3YA 4FC6A 3RYCB 4JR2A 4CCYB 2QX9A 5FPQA 4TS3A 2H65A 5DHUA 4FN4A 3WIEA 1UJMA 4IIVA 4UU7A 4DV4B 5HIIA 3FMPB 3KE9A 1BYIA 1WMEA 3ZDRA 1EKXA 3KSRA 4NPCA 2GFQA 1H69A 3I4FA 5HE9A 1MJHA 4TSFD 1F38A 1XYGA 3NHWA 3EJ6A 1NXTA 1Y89A 1WA5A 2IVZA 3LUDA 1Z13A 3GI1A 1T1GA 3RKUA 1HA3A 3PDIA 4F5YA 3OLWA 2L17A 4ZO7A 2IF2A 1Y6JA 3ZWQA 4BFZA 4C2BA 1HDZA 2BONA 3ANNA 3QXGA 4TS9A 2J4DA 2EIXA 2RARA 4BBPA 4CV1A 3QKWA 4JLVA 5ALKA 4RTMA 4BAZA 1HH4A 5DWDA 3SBOA 4QYSA 3WK6A 2Y99A 4CKZA 3N2YA 4KE9A 4P98A 5DNAA 1XR3A 2O52A 3T0GA 1TO6A 5FPHA 4EFMA 3T1TA 2QR5A 3BXOA 5AJYA 4XUEA 1TAHA 3G7NA 5LBIA 1BFKA 1DRUA 4K26A 4FYHA 1CZHA 1N2BA 2ERCA 5HS6A 5DTEA 3RRXA 2R66A 4L4SA 4Q05A 4R0MA 5BVHB 2C9MA 3CLTD 2XW6A 3QGMA 4S24A 3V4ZA 5JROA 2PSEA 1M1UA 1NAHA 1RRMA 2YICA 3ROGA 3S1LA 3O47A 5CVJA 2Y27A 5LL6P 3HCFA 3GWZA 3TQQA 1TXGA 3PNMA 2XWJI 3GFFA 2XCTB 1ML4A 2I6GA 4N5LA 3MMZA 2IEAA 4MVYA 4MWSA 2A67A 4WASA 4XM2A 3AVTA 3MCTA 3I34X 2RGBA 4RZ2A 4MJ3A 3WYAA 2HRBA 4ZO4A 2BR3A 2O14A 1Q3HA 2Q4OA 3UJDA 3W3AH 3BGWA 4RD0A 2FEOA 3DE6X 3IP3A 3LBAA 3UMBA 1ESZA 1CX9B 4AX4A 4RAQA 4QTYA 4IMJB 2D1SA 4CGYA 2H0QA 3OT4A 4DJFC 5I6DA 3RTGA 3EGOA 3ZWYA 2EDCA 2R8BA 4YRDA 1NFQA 3OZ7A 2MCFA 4CKEA 4DSAA 2C5BA 2HPAA 3PLRA 1K4YA 1EVEA 2BZGA 4XB6B 5E9JA 1POXA 3Q9UA 4CQLB 4URVR 1CTQA 3MTIA 1QRTA 1X1DA 1QF9A 2IYNA 4INJA 2ZYWX 2Q5IA 3Q98A 5AR1A 2BJWA 4JJFA 1I5EA 1Z62A 1M54A 3GNTA 3IPCA 2OD2A 2X4IA 1NFFA 2IHKA 3S2IA 4CKYA 2BUCA 1H2BA 1UM9B 1KDTA 2Q27A 3MLEA 1EUDA 1XVUA 4AMBA 4NXNB 1CY4A 1E0DA 1EESA 3OZAA 2OKGA 3A3PA 4ZDWA 1KNXA 4HSEA 2FSSA 1MUUA 1B73A 3M33A 4WZAA 3MFQA 5K8CA 2R6FA 3U56A 2O8EA 4WZBE 5EZYF 1DQPA 3MLAA 5JJKA 3NKLA 1U2GA 3L40A 1UFOA 3P9NA 1L1EA 1LSUA 4AS3A 4IVRA 2VQFB 1A2QA 4RH3A 1JEDA 2Z2KA 3SX0A 4S04A 2QGNA 4QBTA 1SBZA 3CKYA 5DF1A 1GLVA 4EB3A 5BN1A 2XMGA 2BMJA 3FAKA 3TB6A 3CUSA 3QFHA 5AI9A 3U81A 3WGOA 3OCCA 4R81A 4TWRA 5HF5A 3OTOB 2HT1A 3E3MA 1I2BA 2A7XA 5AIBA 2EKPA 3P96A 1W73A 4N5DA 1Y42X 1II8B 1TVMA 5TT0A 1BW9B 4WDRA 1U0NA 3ZNQA 1GZUA 5CT6A 3ZR4B 4Q3BA 5JS8A 1N77A 2FUG1 4JL6A 4XKJA 4TL9A 2KX7A 1UFRA 3ME5A 1V4NA 5DI3A 4FMCB 4MP8A 5JS1A 1QYVA 2B9EA 2ZJFA 4I0WB 4ZQEA 1NYQA 4AURA 4NWIA 3DEIA 2QM0A 3QF7A 4LJ7A 4CM7A 2GHIA 3R3ZA 4H7HA 2WF7A 1GTVA 2ODEA 5JDCA 4C7OA 4ZMRA 1JSLA 3IP9A 1Z6TA 2YJNA 1KZGB 4C05A 1D03A 1PJ4A 3TW6A 4OHWA 1ZA1A 4J3FA 1OLSB 1JPVA 1QORA 2OXEA 1T3TA 2UYHA 3HKBB 1JG1A 1RWQA 3TLKA 4DG9A 4P9NA 3IALA 4ISCA 3UAWA 2QJOA 1P9WA 4WFJA 6CHYA 2TMDA 1UMCA 4KQKA 4E5KA 4LRSB 1M2GA 4NCJA 4F72A 1C0KA 1M0SA 1Y1PA 2QA5A 3DKRA 3IE2A 1GZ6A 3ZGXA 3ZGNA 2O0MA 1Y5MA 1E9VA 2P3QA 2YZGA 4KEAA 1HT1E 2FSUA 3I4CA 4U00A 1GUZA 1FP1D 3EIXA 1TAUA 2QUHA 4AIRA 2UYCA 3ROQA 2FXVA 1GTMA 2C2GA 2DQYA 4UOQA 1W7AA 4FMBB 2VDLB 5GM2A 2V8BA 1CKEA 1NJGA 3PU6A 3CRMA 3VZQA 4TKZA 2ZBVA 5JWRA 3QMVA 5L3VA 4QRDA 1H1DA 2PNFA 3U44B 1RRKA 3FNBA 1U63A 3KOUA 3ZXUB 4IUCS 3A9SA 1JG3A 4N8DA 2JGDB 3S6JA 4FC7A 1LI4A 1RKUA 1VIAA 4LNHA 4NEGA 3PICA 3STTA 3QEMB 1Y6GA 5KU1A 1TAGA 4UPDA 4BWVA 4E31A 3SYNA 3RUHA 1YH3A 3L1HA 3UIEA 2XVAA 3TRFA 2JRLA 3AC0A 4IMRA 1XIVA 1Z33A 4UU0A 3RS9A 1IZYA 1KJWA 1O8BA 3AJ9A 4NV3A 4FYYA 2ZQ5A 1PGOA 5I7VA 1E62A 1GZ3A 3GFOA 2DPGA 4A0RA 4CLHA 2FWJA 2JJ2D 4HLCA 1IOVA 3SQOA 1IY2A 3FDJA 2OHXA 1JQKA 4JLOA 3IKLA 3A3OA 2D0OB 3EOZA 3IMGA 4J91A 4RMIA 2JLBA 4QREA 1PZMA 1YCGA 5EP4A 1RQ7A 3AGQA 4N49A 2NACA 1U1IA 1IHOA 1NDHA 3A6LA 5EPOA 3UT5A 1NWHA 1X2EA 1ZVKA 3G5LA 3O8DA 1J99A 4DDWA 2X5OA 3S27A 3RT9A 2X1HA 2VI5A 1YKSA 2I62A 1D0SA 2A5GA 2WM9B 3HFGA 1P8AA 4M6WB 5HOEA 1P5FA 1JEYA 5K0JA 1CHDA 2W2PA 3T0IA 2ONCA 3C8UA 3OWHA 1N2CA 5A2QA 1X7ZA 2OMKA 2PVPA 2Y8EA 4L6AA 5ARDA 5SZJA 3TL2A 4Z6KA 5KWVA 4EG7A 4B17A 1DP4A 2JVIA 3D4IA 3FJYA 2WHEA 2MIIA 3QVJA 3A9WA 3NKFA 3SK0A 1PJ3A 2GB4A 4OX9B 1RCUA 1OBHA 2IHYA 1DBPA 1SXJB 5ALQA 4JJIA 4ZODA 3BRCA 1R9JA 2G17A 4LRQA 3KKNA 3K0AB 4KN9S 1G55A 2P1ZA 1KSHA 3ELWA 5HKLA 3X1JA 1Y8QA 4HFNA 3G49A 5C4IA 3O4VA 2CL6X 2IS6A 4OX9Y 2JJ8A 3RFCA 2XKKA 3DBIA 1NVWQ 2ZRJA 5C8YB 2YJTD 3CEJA 4KB5A 2NTVA 1EYZA 3R7NA 2FX3A 1ZPDA 2IXGA 2ZSUA 2BSQA 1E9DA 1Z75A 2O0JA 1NBHA 2FUG6 2GEKA 2IOYA 3MZ0A 2AVNA 1KMIY 1E1CA 2GDZA 3OJFA 4WBSA 4JR1A 3O8CA 3WKDA 1FS6A 3NRBA 4UARA 2DHEA 2B3TA 3TTVA 4YV0A 1OLUA 4EHBA 2BM9A 1CDZA 2PX8A 4Y9TA 3AW8A 2R8RA 1WXFA 2ZM6B 2D8AA 3ZOKA 2EG9A 4JX8A 2C0QA 3IBSA 4RL6A 2CL5A 2JGFA 3B1WA 3I09A 2AKYA 2CMHA 3V1UA 2VHUA 4BMXA 1WHTB 5F1OA 1E60A 3BMOA 3G8AA 3L2OB 4Y1RB 4AKTA 2ZSDA 5BR4A 1OX5A 1S0UA 2PMKA 3DUFB 3QLEA 4NH0A 4YO8A 1Z82A 3SZUA 3UAZA 1KAEA 2DQKA 3M4ZA 2NIPA 1RWKA 4PIPA 1M8JA 4OYYA 1ESEA 5GY7A 4RF2A 4P7JA 1Z7YA 1TTHA 1R4AA 4L6IA 5E2IA 3U7QA 3S3TA 3RSOA 1MBZA 4PPYA 3BB3A 4ONEA 3L9WA 1V25A 1UC5B 4CFSA 4H2DA 3V3TA 3AEUA 1IWBB 1DKLA 1ZZEA 1MX5A 2YR0A 3QELB 4RWEA 4WDQA 2FLVA 2OILA 1JDNA 3HWSA 3PC3A 4LUCA 2MSCB 2Q9BA 3RFXA 1B43A 1RHRA 2ZCUA 3HB9A 5KOHA 3P9KA 3VVMA 5E6RB 3BE8A 4F9EA 3UMGA 4CI0B 5KTMA 4I2VA 3OQJA 2JVJA 1C14A 3PUWA 4B2LA 4EJSA 4RTOA 1E66A 5AJUA 1YVRA 1GTG1 3FOAA 3TOZA 4H0NA 4N8SA 1N57A 3PYMA 4LDPA 3G2PA 3DOFA 1BAPA 5CMLA 2X15A 4K86A 4UKDA 1A9YA 3K94A 3KB1A 3UJCA 3BBLA 1QFZA 5IG2A 4EPRA 4G0NA 4MARA 4GQAA 2GJ9A 4R83A 4XM0A 4DC9A 1UXHA 1FIUA 2C8JA 3CLHA 5AW0A 1N9ZA 3SZLA 5TIIA 1C80A 2MYNA 1N2CB 1RTKA 1D6JA 1G8FA 3G7UA 3R4VA 5GONB 3M82A 5HCUA 2WV9A 3UMVA 4CM6A 1YIOA 1P77A 2YV5A 1EFCA 1T8WA 1WD7A 3KAJA 1M34E 2CYCA 1JX6A 2EHJA 2HMTA 4FK8A 2EFYA 4P2BA 4RIFA 1QIDA 5AMXA 3ITDA 4O3FA 3BEOA 5JVDA 1ZITA 3LKZA 1FMLA 4JL8A 1C2YA 4R8VA 4XIJA 2H48A 3Q7PA 1ZD2P 1U80A 2WD7B 4NHOA 3E53A 4LCBA 1T24A 3A9VA 3LC2O 4ZYYA 4LA4A 3J81k 3TG2A 4LYJA 2ZJ8A 1SC3A 2ZI7A 4QGSA 4DQXA 2QP4A 1SBTA 2X1VA 2OFOA 3M5CA 1Z0ZA 2BFBA 4PBRA 3RK1A 2X41A 5IAKA 1XU4A 2E4VA 4J0CA 4B3DA 4LOJA 3HA5A 1I33A 3GRVA 4PGMA 4EI7A 2E87A 2FI1A 5DT9A 1Y4AE 3RF6A 1J49A 4TRJA 3ZQJA 4UFOA 4ZCRA 5DSXA 5CT4A 1E8MA 1S8AA 1NMSA 2HWWA 1ZC4A 3KQTA 2GCOA 3PUYA 4DC0A 2H57A 1OXXK 2MSKA 1GKYA 2PBLA 2ZT7A 2X6TA 1IHXA 3DMPA 2FETA 4PLGA 4UM7A 4EHHA 5BUCA 1FX1A 1J0CA 4KUEA 4P81A 1HURA 4ND5A 1L5NA 4ZTUB 2GPTA 5KX5A 2QQ0A 2X2PA 1XTTA 3O4GA 3WISA 4ZYLA 2JKVA 3ZDCA 2VSOA 3QPVA 2Z8ZA 2F3RA 3BICA 2ZIEA 3DC2A 1MORA 1MB0A 4Q9AA 5ETJA 2H1FA 4QEKA 5GGXA 5KIAA 1X15A 3Q87B 2YHIA 1ZINA 3Q6NA 4DF3A 5E95A 5EMMA 2PWYA 3NB0A 3PBKA 1FJ2A 1QNFA 3E61A 3HEAA 1PWZA 2QTMA 2YBDA 4MYHA 4DCVA 1Q0SA 3U31A 1PUJA 3A31A 1YZGA 2JHCA 4JVOA 4CQMD 3SKVA 2C2MA 1F9AA 1XQXA 2YFHA 2ZYGA 3OM8A 3FKSD 3OFNA 2FMTA 3RARA 2O8FB 1FSGA 4Z9XA 4CU5A 3R74A 2F8LA 1PZFA 2QX7A 1QQ7A 3BCSA 4UM9D 3NBMA 2G4LA 1P31A 2Z5GA 5K0BA 3A6FA 2ZRBA 4OMFG 5EIAA 1UDBA 1UT6A 1XEWX 4D96A 3U4QA 1EE9A 1WCYA 3C1AA 2ARKA 1O1YA 5AJTA 2NQTA 4X64B 3QU2A 3SYKA 2ZUSA 3D9QX 3HY4A 1J0EA 1FFSA 2EATA 4NLLA 4OXYA 4ES6A 3FLMA 3PC6A 2JAXA 3O95A 3KR1A 5CXSA 1TZ2A 1XHFA 3JD2A 3BE6A 1Y9DA 2IZ0A 2YW2A 5JYDA 1AV6A 3OCYA 3GJ5A 1E61A 4NFHA 5IARA 3VH4A 5FL3A 5A6VA 2XADA 3WZ2A 1JE0A 1OTHA 3TM5A 4BZPA 2WUFA 1KI6A 5EMNA 2LCFA 3DEZA 2E7ZA 5CAEA 2HUPA 4RHFA 4YRIA 2GBPA 3M83A 4FHDA 1DS6A 4JZYA 4LJSA 3BK1A 3OZTA 3HA3A 4QG7A 3GA0A 5EKSA 3A11A 4RMGA 4BQQA 2C7OA 3U09A 5CDHA 5CG1A 1MVNA 3IHKA 1THMA 3MT9A 3GRFA 3DZ8A 4ZOCA 1YZHA 2VRCD 1Z12A 1VL1A 3F46A 5JAHA 5K2MA 1E18A 2BTQB 1T0IA 1Q7BA 1KY4A 2YIMA 1JJFA 1OSNA 4U7TB 2RSLA 1L7VC 1WR8A 4IIJA 1T13A 1TYEB 4ZU3A 4A8JC 3BL6A 1YS6A 2OCKA 3A6DA 2CLKB 3HYLA 3CJTA 5TT1A 3QLJA 4D80A 5MF6A 4II7A 4ZOBA 5DULA 2VAPA 1DDOA 2KW5A 1NY6A 2PX0A 3LOQA 2WAMA 5KSWB 2VATA 4JB0A 1CR6A 2W7TA 4RA9A 3X0DA 2C54A 5JRZA 1QFSA 2O05A 1ORVA 3AVVA 3SDBA 1QGUB 2PL1A 4ZVSA 1GFWA 4L1KA 2XWBF 4Q1BA 1KPGA 3CRW1 5I3CA 2H9IA 5DHAA 3T0FA 1D4AA 4RHCA 4AJ4A 1BDHA 4I81A 2ODQA 3ZDBA 2C1ZA 5L9AA 5T57A 3U1TA 2WWTA 3H2HA 2G3YA 4JCOA 4CKBB 2C8LA 3K1AA 1YU9A 1YDHA 3OSUA 1NX9A 2Q6TA 1XCMA 3NYWA 1GPAA 4M0PA 4RWZA 2HRDA 1QHHA 2B8NA 5CA0A 1RWVA 2V03A 3ESXA 3TKLA 1RJEA 3JRNA 5BSEA 2ZBFA 5ALZA 2PMBA 4AL4A 5KYGA 2FP4A 1JT9A 3TGPA 3GBSA 1A1VA 3I9V6 2DUMA 1ESMA 4WEQA 5HJ5A 3KL4A 2QL5A 4CL8A 3ONWA 4RCYA 1RWXA 3E6AA 5J23A 1E3LA 3HYNA 1T2NA 4H27A 1RACA 4ZJPA 3DXYA 3OVMA 1RLUA 4WLFA 5HVNA 3G1WA 4V38A 1ZICA 3IUQA 3OTWA 3PQ5A 2CVFA 1IXZA 4L5AA 2J0QA 3BDAA 1S4QA 3N0XA 2H8KA 3DE5X 5CXUA 1ZD5A 1NW7A 1VDZA 3KBOA 3T3DA 1FP4B 3L05A 2ZWOA 4GMXA 2QZJA 4WXEA 5KNDD 3S8YA 1OH6A 2PSFA 3ZLTA 1QGYA 3L84A 3NO4A 2Q2WA 2R6JA 3GHHA 2R6CA 4G5XA 5IDYA 4ZCSA 2A9FA 4PHGA 5FNZA 1J21A 2BAGA 2J45A 2ZITA 4WECA 3BIJA 3FIJA 3PQ7A 4ZZ3A 2ZRFA 1SXJC 1BYUA 4DV7B 1A76A 2QV0A 1BE1A 1PUIA 3EH1A 3KG2A 2FRVA 3MS7A 5CLQA 3BC1A 2GNPA 4OLHA 4ZARA 3NU1A 2AD5A 4W8HA 2KB0A 4S1VA 1UIMA 1DHTA 2I5PO 2NW6A 2CXQA 1F2DA 1F20A 1RM3A 4GI7A 4IOKA 2NU6A 3GCWA 1IMOA 1BS1A 1OIWA 1QMPA 1Q1GA 4V3BA 4GL2A 1PEDA 1W581 2WPDA 1VMIA 1S2NA 3G9QA 3P52A 4RY8A 3UJ7A 4RPHA 4FKZA 3O0TA 1UWCA 2QRMA 3MGKA 3R23A 3I39X 4JLBA 1DEKA 3Q85A 1SXJA 4NARA 4WOCA 4ZN6A 3R9XA 2PJRA 1G0NA 4BKUA 1NX6A 3HBNA 3JVEA 1FXWF 3K0CC 4FT2A 5F23A 4RHEA 5J4LA 1J0DA 3SC3A 1CFJA 3LCCA 3BE4A 1UFQA 3KQYA 4KXVA 4QYWA 2B21A 2PYZA 4RH0A 3MJRA 1JQ5A 5EWLA 2OM6A 1WKCA 4OJKA 4OQLA 3EBLA 4C30A 4EX6A 2HGZA 1WNTA 5TF0A 1DIGA 1P6QA 3ANYB 3T9EA 5B58T 3VX4A 4TOIA 4F6RA 5M04A 1U3CA 2NV2B 2RG7A 4UZFA 4OUDB 2IYPA 1Y1RA 1JHOA 4QO8A 2QQFA 3IUSA 3MWDA 4H18A 4MP3A 1JSCA 2OHVA 1N1DA 1FE8A 2EV9A 2WD9A 1B0UA 2YYAA 4YUWA 5LFAA 5D3ZA 2FRXA 2P7HA 1L7AA 3ANXA 5NLLA 1JDVA 1NXPA 5CDSA 3PPYA 3PX7A 3HHEA 4RIHA 3BTSA 2J48A 2OV8A 2ZCVA 2WU3A 3DFUA 3VO2A 1X80B 3ODGA 4PYIA 4FB5A 1DFHA 2AR9A 4ZP1A 2MSEB 4Z8YA 1I4OA 1IPHA 1TZBA 4NCKA 3OY7A 4MCHA 2Z6UA 1QTQA 1GNPA 1OBVA 4RK4A 4YB8A 2I1WA 3GAMA 4P86A 4XA8A 2BF4A 3I4LA 3V8EA 2PX3A 3A1SA 3BSWA 2LGJA 2IL1A 3BZWA 3EGXA 2IOHA 5A3JA 5E7QA 1H23A 1WETA 1VLVA 2QYHA 5I4KA 2JFUA 1PWEA 3DKIA 4CF3A 3Q5GA 4DMLA 4YVFA 3FUVA 4Y6RA 2GBLA 2BFFA 2CXOA 5BSUA 2FMKA 3PB3A 4QU8A 1QG6A 2BGLA 3FMGA 4WJLA 2F3UA 2JH3A 4P58A 1G42A 2YINC 4Q4HB 2IGBA 4XX0A 3WVNA 5B6PA 7MDHA 1PFUA 1H4SA 4TRMA 2BRUC 3UPTA 3U60B 1NPDA 3CH6A 3HVHA 4PIMA 4PLWA