4LHZA

Crystal structure of gtp-bound rab8:rabin8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhzA00
1ONBA 2F1RA 3GP8A 4G5QA 1G8PA 2XOKD 4C7OB 2FSGA 4URVR 2BMDA 4IDHA 2OEPA 2ODNA 1IJEA 3PJRA 1CULC 1NBME 5J40A 3CF6R 2UZ3A 1ESNA 1AQUA 2ZRJA 1OXXK 1T9HA 1X8JA 4XVQA 3IQWA 5J4VA 1TF5A 1U8YA 3AP1A 1HE1C 4A9AA 2GCOB 3BH6A 3N5CA 1OT3A 4II7A 1DARA 2ZANA 3ZIAD 4CIDA 5FBLB 1R0ZA 2IS6A 3B9QA 4NYJR 1Z6YA 3EPHA 2CCJA 4KXFB 1NY6A 2BCGY 4JYBA 1E0JA 1KGDA 1OKKD 4C0QC 1XMSA 4FW9A 3UK6A 1SVKA 4BLRA 4TTRA 4MKGA 2J7PD 3K0SA 3WNCA 2P3SA 2VSFA 4BFXA 2WSSA 2ZRMA 1A1VA 4CZ2A 1M7GA 3QBTA 3K9LA 1ZRHA 2G88A 4GMDA 4NHOA 2X2EA 4HZUA 4RD1A 2UKDA 1KSGA 1OYYA 3SZRA 3TAHA 3K0FA 3ZLJA 4NCHA 4Q4AB 4RFSA 3RS5A 2C98A 1OXVA 3B2EA 1MOZA 4LDJA 4QM6A 1QHHA 3MD0A 4MKIA 3DKVA 2D4HA 5FL7A 2C5LA 2ZJ8A 2QMOA 5B64A 4UXHA 4BPBA 1HA3A 2ZE8A 4LK2A 4KITB 2BVNA 4JVSB 1VG0B 3TVDA 4AY2A 1QHXA 3EIQA 4A2WA 2IYXA 4QJ3A 1N0UA 1KSJA 1EWRA 4LUCA 2BBWA 4RD2A 3PUXA 1MT0A 3U61B 2B8TA 1II9A 1NSFA 1DO0A 5FR2A 1G3UA 1TUIA 2RGDA 1VCOA 1G7SA 1RVDA 3RWMB 1TU4A 3AVQA 3AGPA 2EVWX 3W5JA 3FHCB 3I4LA 5FUVA 2LCFA 3DO6A 2ZTSA 4JMPA 4M9XA 4QFMA 2RGXA 2QTHA 2A30A 3FKQA 4Q1AA 4A0HA 3B78A 1SXJA 2FV8A 4UNNA 4DC9A 1PJRA 1Z0AA 2FX3A 3TLXA 4A6PA 3W90A 1Q3HA 1BO6A 1E79A 3BH7A 2ZS8A 1NL3A 2WTUA 4IDOA 4B44A 1AQYA 5EE9A 2GJKA 4YXWD 4Q02A 2DBYA 1KO5A 4BLPA 2GXAA 1UDWA 4QRHA 4OHZA 3IILA 3F8TA 3IUYA 1ZVQA 5HE9A 2AX4A 4TMVA 1E1RA 1AN0A 2IF0A 3I32A 3GJ6A 2VHTA 3BORA 4F4IA 1GWNA 3B1YA 2R6FA 3AF0A 1KSHA 3EG5A 2RGEA 5J4LA 2FA9A 3FFAA 2J0UB 4FN5A 4Q4LA 4OI1A 2FZ4A 4L15A 3C5CA 5FPHA 3WYFA 3PEYA 3T34A 2VLIA 5BYJA 2CK3D 2J1LA 2ZI4A 3SJZA 1R10A 5AJWA 2EFDB 3A1TA 3ZVNA 2ZRKA 3TNFA 3U3JA 4DSNA 5IF9A 4HDQB 1FPMA 4KHZA 1HTWA 2FG5A 1M2OB 3N2IA 2VHCA 4MKHA 4C2UA 2JDID 5EP1A 4EPTA 1ZM4A 3VAAA 3O8BA 5HCIA 2GWHA 3GLIB 2OO7A 3QKRA 1LV7A 5DI3A 3MFYA 5H70A 1E2GA 4OHVA 1XNJA 4LJAA 4GI7A 2OBMA 5FUWA 3MGCA 2ORWA 4AYTA 4TL8A 2F9LA 3ZIAA 1JB1A 4M22A 2OILA 2ERXA 3FVQA 3IDQA 1NNEA 3D31A 4G5RA 3TJZA 3TE6A 2PLRA 4RZUA 1WB9A 1NVXQ 3AVTA 3VX3A 2AXPA 4HYYA 5E7MA 2J7PA 5DHFA 2QAGC 5BYKA 5KSPA 3CZPA 4N3NA 4B3GA 3PUZA 3VHLB 4Q1EA 2YC2C 3VR2A 4M1SA 4DCUA 5JS8A 2R9VA 3B5JA 3P26A 1Z5ZA 3LXXA 4HAZA 4MYHA 3ZZ0A 4P4SA 1GTVA 4HI0E 4DWJA 2H16A 1W5SA 2ZJAA 2Z5FA 4I4LA 4WXRA 5K8IA 4MGIR 2WAXA 3WP1B 1SKQA 2NO6A 1QVRA 2ZRCA 2DPXA 1JEDA 3I8XA 4KLZA 3BFVA 4FCVA 3C8UA 5KPDA 3A36A 5AUNB 4Q7KA 1RC8A 3H0KA 4IKEA 3GJ3A 3WMFA 1Q1BA 1NVVR 4EJSA 4MQBA 1KI8A 3B6EA 3E5HA 4UNPA 1CJMA 1DS6A 1GOTA 1KMHB 5HKKD 5G40A 3ADBA 5BQ5A 4G5GA 1R0XA 2KWIA 4HB0A 3S1AB 3WP0A 4YQFA 1IN4A 2P6UA 3QI2A 4B73A 3AVUA 4D82A 3VKGA 3ND9A 4BLOA 2CCKA 1G3MA 4BZXA 1ZNZA 4QBFA 1Z22A 3SEAA 1CBUA 4ZDKA 1NI3A 4LOAA 4PAOA 3QVUA 1XZQA 2CCGA 2ANCA 3GCGA 3IBGA 2BMJA 1NLFA 4NONA 5JWHA 1N3BA 5LD2B 1HEIA 4XTCS 3C41J 1X8KA 3MMPA 2QQEA 1XTKA 2QT1A 3A37A 4L16A 2ZVPX 4AG6A 4XSHA 4BEJA 4F92B 2BCJQ 4TQAA 2GCNA 4B74A 4AIIA 4EDHA 2O5VA 1SKYE 4A6XA 3HR7A 4L8GA 5KU1A 3U4QA 5BWMA 5B57C 5J4HA 4LBVA 2ZI3A 4BECA 4Q4JB 1ZU5A 2XSZA 4NDZA 4YXWA 4Z8YA 2XB2A 1OF1A 2QBYA 1H65A 2OFOA 4JLAA 2WWXA 3AVOA 1IXZA 2BWJA 4W5HA 3AQ4A 5L8VA 3QPVA 3LBIA 1E2IA 4EAQA 3EX7C 3SYNA 1XEWY 5E7IA 5HPYB 4GOJA 3HR8A 4Q03A 4BFZA 4MKFA 5L3QB 5A5GA 2PMDA 2Q9BA 4V02A 1FTSA 3AVWA 3CRMA 2CK3A 3LLUA 4PXAA 1W7AA 1FQKA 3EWAA 1NG9A 4RZXA 3F0TA 4LJ9A 4WZAE 1KK0A 3IIMA 4XSGA 4YLGA 4DLWA 3PFIA 5EE5B 2NGRA 3LX8A 3Q5DA 2BM0A 4OI2A 3NHBA 5HZKA 1F48A 3NBFA 2YWHA 1QG4A 2R62A 1EK0A 3TSZA 1DO2A 3K0CA 4QGAA 1BKDR 1CJUC 2GF9A 1AS3A 1CEEA 4D0GA 2FSFA 2CL0X 4NE2A 2PEZA 3THYA 3AKYA 2AKAB 4HZIA 3V00A 1WDTA 4RD0A 721PA 4MRVA 2RGNC 1G5TA 1MH1A 5TVKA 3IPYA 3RVBA 2FFHA 3IEVA 3HPQA 4AKEA 2W2VA 1COWA 1G3IA 1NN5A 1VDZA 1XTSA 2L0XA 2WJJA 4QKQA 1FX0B 3DZ8A 3EZ2A 2FPMA 1N5LA 2H8KA 1Z28A 1FNMA 2GTPA 4WZ6A 1BYIA 3IIJA 4ZDIA 1S3GA 1KDPA 3KUCA 2IS2A 4MH0R 1OXSC 2Q3HA 1M74A 4GZMA 4Q1BA 3QSYA 2JLYA 1Z6GA 5FOSA 1XB2A 1HYQA 1TX4B 4NYIR 1G6OA 421PA 4I1OA 5DH9A 2D3WA 4IFBA 1TU3A 2XZLA 1KSFX 3D7MA 1U2RA 3FKSA 4O2LA 3QPWA 3UG7A 3C15C 1QG2A 1VG8A 3MSXA 4W7SA 4D0NA 2YNMA 4JVLA 3MG9A 5J4YA 3U7HB 2ORVA 3N2EA 4R2IA 4NP6A 3CRRA 4KAXA 1GFIA 1J90A 3CO5A 2B6HA 2GESA 1N5JA 1P3JA 3AF3A 1X1RA 2QMUA 1ODFA 1XD2A 4TYWA 1WF3A 3B9PA 3DMDA 2D2FA 4IJMA 1G1MA 5AUPB 2WKQA 1HQCA 3NIBA 3T61A 5SZKB 3VU9B 3SC3A 4E07A 1KKLA 4ZI3A 4BLSA 2AD5A 2MSCB 3FMOB 3KX2A 521PA 4U7DA 3SHFA 3HWSA 2PZFA 1SXJC 4JLPA 3X1XA 2F1HA 3MUFA 1JPNA 1VIYA 4HAVA 4V0MA 3QQ5A 2E87A 4PPNA 3AM1A 1J7KA 2Z0MA 5FL3A 1DVRA 2A5YB 4R2HA 1QDEA 2J0VA 5BN3A 1TF7A 3M0EA 2ZE7A 3JZMA 3RHFA 3LDAA 3FB4A 4NYMQ 4GP6A 3W34A 2ZU6A 4TYPA 5KSZA 4HB2A 5C18A 5FI1B 1MO6A 1CIPA 1U0HC 1DAKA 3AUXA 4UJ5A 1Z2CA 5CM8B 3TGPA 4TMTA 2CNWD 5IDVA 4B6FA 5GADl 1W2GA 1L2TA 1NN1A 1XCPA 4B75A 5HR5A 3TUIC 2GBLA 4LHVA 2HDNB 2H17A 1JBKA 1G16A 3Q7QA 3VFDA 3FOZA 3DOFA 4URXR 4TYQA 1US8A 3NWJA 2HF9A 3KUDA 4OQLA 1NRJB 5CM9C 1VTKA 3DKPA 1EESA 4M0LA 4YC7A 4AYWA 5C46F 1DAEA 1KZ7B 4DB2A 3OEHD 3JZAA 1OJLA 1XZPA 1XTIA 4K8OA 4ZCLA 2IWHA 4HAYA 1KI6A 3TMKA 1S1CA 5B30A 1Q21A 1FW6A 2NTYC 2VEDA 5G41A 1WBBA 3M1IA 3L8ZA 4U02A 1CRQA 4DHEA 1XU4A 1O3YA 3SHWA 3QBVA 4Q18A 4UNRA 3ZH9B 5LPNA 2P6NA 3WBJA 2UZIR 1KI3A 1E2DA 4XD7D 5EP4A 4F7WA 1VYTA 3LA6A 3LWNA 4Q1DA 4UNQA 4DLVA 4XVRA 1TEXA 2LKDA 2VHJA 4DDWA 2W6ID 4PC7A 3U7FB 2ZI6A 4IOLA 2V1UA 1XWIA 4DEXA 4NCJA 1T0HB 1E2HA 1GIAA 2VA8A 1FUKA 2H1LA 4QBHA 1Y3AA 1M34E 5GVSA 4DEYA 2KSQA 1AK2A 2HUPA 5FUYA 2P6RA 1KNQA 1GRQA 1GNPA 3WYAA 1LVGA 1DADA 2HCBA 1KDRA 1KI2A 2QAGB 5TARA 4A92A 2ZJYA 2YVUA 1Y63A 5ELXA 4JJKA 3GJ8A 1QHGA 5LBIA 4IHQA 3TUJC 4FCTA 4Q4HA 4QBGB 1GKIA 2VF8A 5FFMA 1Z0JA 2IW3A 2C9OA 4EJSC 1QVAA 5EXTA 2C8VA 1DELA 2PT7A 2CVHA 1FL9A 5FTMA 2J5XA 4HATA 3EZ7A 4TSFD 2GJSA 4JLOA 5DO9A 1ETUA 2FWRA 1J8MF 1ZM9A 3GLHE 2F43B 2IL1A 3FMPB 4CDGA 2CLDX 4M21A 3ZZTA 3VHXA 1KI4A 2ZJ5A 1W47A 4WA7A 5EZ6B 2AFIE 5J47A 1OB5A 3SFZA 5AJYA 4A2QA 1N6NA 1P4SA 2PX0A 5SZJA 4P4TA 3R8CA 1M8PA 1MR3F 2J46A 2IBMA 3NBYC 5H1YA 4OL0A 3TH5A 4AC9A 4UNSA 2QSYA 5D3MB 4GSYA 4LYAA 4OQXA 4OJQA 3AEZA 5EP3A 4FMDB 3TQFA 3KKPA 3KDSE 4RY2A 4W5WA 2WAYA 4QGGA 4KLNA 2WPDD 1HQYE 1S0UA 1MO3A 2GXQA 2ZM5A 4A36A 3B60A 4ABYA 3SQXA 2X2FA 3EWSA 1UF9A 2JLQA 2ZRDA 4WXPA 4O0MA 4JLBA 1TL7C 1T3HA 3AH8A 2F55A 3ICEA 2OUKA 1NMXA 2ZYTX 4NKRA 3ZYCA 4M1KA 5DNYB 1DAHA 4LHZA 2CNWA 3E1SA 2OXRA 1VYVA 1I2DA 3AVPA 2AR7A 4R71A 1RYHA 1E9DA 2WZQA 2IWRA 4A4DA 3I62A 2V6JA 4QGFA 3CX7A 5JEDA 1UAAA 4N0EA 4TL7A 1Z29A 1W4CA 2ZUCA 2ZR9A 2ZS9A 5JCPA 1VKJA 1E9RA 2JLSA 2XAUA 4W9MC 4TL9A 3CW2A 2FDCA 2JA1A 2WIBA 1U98A 3FMFA 621PA 3JVUA 3OE7A 1II8A 1QBKC 3ECCA 3T1TA 3R9WA 2ZITA 3THXA 4X8HA 1VCMA 2ZR7A 1NIJA 5JRZA 4B43A 2IHBA 5FTKA 1NN3A 4I81A 5BW8A 3K0CC 2A5JA 3KXLA 3X1DA 1LS1A 2FZLA 4UJ3A 2DYKA 1HV8A 2IYUA 2J9RA 1IXRC 4N0DA 3RSLA 1AZTA 2O8BB 3VR6A 2PCJA 2ZYVX 1K8RA 4POAA 3ZQ6A 2G77B 4WOPA 4MITA 4PQYA 4G3XA 2VRWA 4HLCA 3QXCA 2A78A 1T3LA 2B92A 4OK3A 2W6IA 1OFIA 4Z1MA 1W0KA 4Q66C 2J0SA 2GJAA 3GFPA 4TT3A 4MYCA 1RRGA 4BFUA 2ZJOA 2A9KA 5AK0A 3X1ZA 2O8CA 1P6XA 4P33A 1M1YE 2CLSA 1OH7A 1XMIA 3D8BA 3CM0A 4JJZA 4F91B 1TAGA 3OIYA 1VPLA 1YR8A 1SVWA 2CE7A 1B0UA 1NBMD 2JJ1D 4NH0A 1EFUA 1G5RA 2AK2A 4HZUB 3W3AA 3O8CA 4Q48A 2B7BA 1NY5A 1EXMA 2OAP1 1YRAA 2QRZA 3GEIA 3LFUA 2D62A 2OSBA 1MO4A 4MDEA 3K0FB 1NN0A 2WWFA 4BZPA 4JIMA 1A82A 2G9NA 1G8YA 1CR2A 3K0AA 1YVDA 1N6RA 1Q0UA 2IYLD 2PJZA 3ZVRA 3DVLA 2O8DA 4HLDA 4B47A 1QHHB 3GJ5A 4ACBA 5KTYA 2QL6A 2R6GA 2EWWA 4GFDA 5DHAA 4Q5IA 4JT4A 1SVSA 4DCVA 4US2R 1RPZA 4MGZR 4LJ5A 4TSFA 3RRNA 2VP2A 4FMCF 1OIWA 5EUQB 4HUQA 3U7EB 4Q9IA 5F9FA 4G5SA 3K53A 2JJ2D 1KZGB 4D81A 1J8YF 3U6KA 4PX9A 4TZ0A 1OHHD 1CLUA 2J59A 2QMHA 4LZZA 2Z43A 3CPEA 4UXJA 4PZZA 1DAFA 2J45A 2VH5R 2C04A 1FTNA 2W00A 1U94A 3EC2A 4LBZA 4TLBA 3NC1C 4C0JA 2KJQA 2PEYA 2ERYA 5FH9A 2CBZA 4D26A 1ZINA 4LRWA 4Y0VA 3GLFA 5L3SA 2C77A 1E2FA 1SXJB 2WWHA 4S35A 2AWNA 4RD6A 4CVNA 2JLUA 2N42A 4LHWA 3P27A 2EFGA 2VIIA 1ZCAA 2WPDA 4TL6A 2RGNA 4EFNA 1KK3A 4BRUA 3N70A 5JFGA 2XNDD 5CDFA 4BEBA 2KB0A 2GBLC 4URYR 5CB6A 1E2QA 1A2KC 1UDXA 2Q9CA 2QT0A 4CRWB 2NO9A 1XCGB 1X86B 1KDOA 3QKUA 1G5PA 5CLLA 4KBFA 2D74A 3W5IA 1PV4A 1XBTA 3GLGE 1P2UA 2PL3A 2ORIA 4JLVA 3UKDA 1TQ6A 2N1BA 4GBMA 4IDNA 1XJCA 3GEEA 1GNQA 4RKEA 4C0KA 1IN5A 3I1FA 3OIUA 3BOSA 3ETLA 2JIZA 4EUNA 3PUYA 5CYPA 3K9HA 1YZKA 4Q19A 3GLGB 1KAOA 1YZGA 4BFTA 4CEIA 3BERA 1E2MA 2JGNA 1VG9B 3B82A 2IYVA 4ESVA 221PA 1IY2A 2WICA 4CT4B 2G3YA 1A5TA 4HAXA 4KSBA 2Q3FA 4GMXA 1BMFD 3DL0A 3EZ6A 1WQ1R 2WSMA 4MA4A 3CBQA 1OXTA 3CH5A 1P9WA 3QKRB 4HLQB 5DI3B 3QXSA 1Z83A 5JRJA 1T6NA 5JWRA 3FPAA 5FR1A 3NVAA 3Q72A 3HU3A 2NZJA 3GFTA 3CF2A 1IJFA 4C7OA 3U44A 1CJVC 3SR0A 4C3ZA 1YZNA 1X1SA 3QXHA 1QZXA 4FXPA 4US0R 4PAQA 4DLTA 1Q3TA 2OFXA 3AKCA 1DAGA 2PZGA 1F5NA 2JLRA 4NL4H 5EE3A 4KVGA 3P4YA 2GCOA 1G9XA 3OZXA 2BBTA 4QNRA 3VTKA 3L0PA 4X8LA 1NBMA 2IYYA 2JJ1A 3ZVLA 2IUSA 2ONKA 1R5OA 3PIRA 4LGMA 3W6NA 4V0LA 2HYDA 5LDDC 2PT5A 4LJYA 1UKEA 4A8JA 4LC1A 4P4SB 3DPUA 4Z8XA 4NCIA 1XD8A 8OHMA 2QP9X 3ZS8A 4TLAA 4WZBE 2Q6TA 1XEWX 4LV8B 2YWFA 4DSOA 4JLDA 2GVZC 2WIAA 4L4UA 1ZAKA 1NVVQ 1G4UR 4Q21A 4W5JA 1U8ZA 5A0FA 4C0AC 4JT2A 1R8SA 5P21A 4EJSB 3GLIE 4A15A 2OLJA 3KJHA 1KOFA 2FSIA 2V8OA 2XOKA 3W9YA 4EFLA 4CGZA 5KSYA 1L7VC 3QF7A 2JJ2A 3B7GA 3NG1A 4GNKA 3LNCA 4EPXA 5KO2A 1AZSC 2ZU0C 1G4AE 4IEEA 2I3BA 3Q8XB 2QROA 4PO9A 1LY1A 1II0A 1L4UA 2BEKA 2WOOA 5HZHA 2RH5A 3SQWA 5F9HA 3R7WA 3RYTC 3AP2A 3SNHA 4LJ6A 1YR7A 4Q9KA 5KNCA 3IGFA 1G6HA 1XTRA 3B85A 1YKSA 3LVRE 3MJRA 4RKFA 5CJ2A 1CTQA 4ZO4A 5FBQB 3CUEF 2ZE6A 2B7CA 3T5DA 1QRAA 3SJBA 4D25A 1OKKA 4DJTA 1KK2A 2VP5A 4DLRA 1ZU4A 3KKNA 4PC2A 1VIAA 5TB5A 2HJGA 3V4RA 3Q5EA 1OH6A 2FSHA 3DEFA 1NG1A 2V9PA 3U4QB 3KTAA 4DKXA 1A7JA 1UBFA 2CDNA 5GVRA 4NTZA 3KQUA 4EPYA 2QNRA 4H9GA 2CEAA 4QJ5A 2HLDD 3TSWA 1E2NA 1HT1E 4D2IA 2QBYB 3C7KA 2G83A 5KSOA 2ZUBA 1F2TA 4G5OA 2VQSA 2JLVA 1OXUA 2F1JA 5C4MA 1E4YA 4IVRA 4DUGD 3ND8A 3MWJA 1G8GA 3FHTA 1N5KA 1J2JA 1G20E 1ZIOA 3KJEA 2ZJZA 2BKEA 1VYUA 1JJ7A 1N0VC 4PZLA 5EJEA 2WWYA 3ZZUA 1KNXA 2D06A 5FOVA 1E2LA 2Q9AA 3UWKA 2H92A 4BE7B 1KJWA 1UBEA 1D5CA 4U00A 1N6IA 4CYMA 1K6MA 4O2RA 3WRXC 3KQNA 4FMDF 2ZREA 1JXOA 1T0JB 2C95A 3NBXX 3SDZA 1U99A 2F9MA 4NZYA 3AV0B 2GK7A 5EE1A 4Z51A 1MKYA 4DCSA 2J0UA 3H86A 2NG1A 4G01B 4PC6A 3RLFA 2O8EA 2XJ9A 1JAIA 4B71A 2RHMA 1E0KA 5KDDA 4C0SA 2A7QA 2FH5B 3G5UA 1C9KA 1W36C 1Q12A 1DPFA 1I4DD 1CS4C 5JHHB 4A0FA 4JVNA 1UKYA 3SJAA 3TVTA 3R8FA 4EFMA 1DAIA 3THYB 3PQCA 2VL7A 3C5HA 1GP2A 2C96A 3CKLA 1E2KA 5SZHB 2A5FA 2OESA 2QMEA 2FN4A 4TN1A 3K70B 1ZD1A 3UWOA 4A0GA 1XPRA 1K5DA 2A2ZA 1FP6A 3NEYA 1YZUA 4KFUA 1BOFA 3A1WA 3QEJA 1LF0A 1V43A 2RMKA 4LJ4A 4PSKA 3RS3A 4A2PA 1XD9A 2JLWA 3CRVA 2ZETA 1OW3B 4KYUA 2P5SA 2YWGA 5L3RA 3MWLA 5JHGB 3X1YA 3KFXA 3ASYA 5JSZA 2KE5A 4PQRA 1CRPA 4LPSA 1E99A 2J3EA 4FIDA 4D0LB 1T5IA 3NXSA 4MRSA 1TF2A 3DDCA 2HT1A 2CL6X 3LW7A 1SHZA 1L8QA 4MGYR 4PR0A 1KI9A 1DG1G 4AK9A 1FUUA 5JI3E 3VQTA 1Z06A 3L8YA 2IA5A 1P9NA 2ANBA 2MMGA 5H8WA 3U3OA 4BFVA 4AG5A 4HAWA 2EW1A 1OSNA 3NC0C 3IPXA 2ZE5A 3T12A 4Z54A 2VF7A 3THWA 4TYNA 3UIEA 4IDQA 4B2LA 3QVVA 4YMUA 2AL7A 3G0HA 4LJ7A 4MDFA 2VO1A 2JDIA 2VP6A 2YOGA 2ZSEA 1X6VA 2GZHA 1XXHA 2R44A 3PUVA 1U81A 2ECKA 3TUZC 4I1UA 2IEYA 4B3CA 4YDHB 2OBNA 1E4VA 1H8ED 4AKGA 4U5XA 2DWOA 4FMCB 3CPJB 3QUSA 2FJUA 1EGAA 3BS4A 3RS0A 3F3YA 2GILA 3EC1A 5JECA 4P31A 1OIVA 2QTFA 4S2EA 3CIOA 2BJVA 5C1BA 3CWZA 1Q20A 3VR5A 2OBLA 3KL4A 4TLDA 4ARZB 4TTQA 2W6JD 1DE0A 1NJFA 2YWEA 1XCMA 2R6DA 4KFTA 4IXNA 2V4ZA 4B2IA 3D6TB 2CL7X 1FQJA 1C1YA 2DFLA 1YZLA 2XTZA 3PR1A 3BXZA 1WBDA 3OAAD 4Q9LA 2R6AA 2HLDA 5FBRB 4LSGA 1KY3A 3A1SA 3ASZA 1SZPA 4P4UA 4PANA 4V03A 1Z2AA 3W8RA 1US8B 3BFXA 3W6OA 4ON9A 2KBEA 1CR0A 1HUQA 1ZC3A 4Q00A 1FMJA 1P9RA 4DUGA 1W1WA 2J41A 3NH9A 4XWKA 2FEOA 3ADDA 1RJ9B 2EYQA 5CIWA 1PVOA 5TDHA 3OFND 2OFWA 4JVMA 5JS7A 4B3DA 1CJKC 1KI6B 3BH0A 3K1JA 1NLYA 2QG6A 3J81k 2JAQA 1YZQA 4E03A 1Z0DA 3THOA 2CMKA 2IK8A 4ESHA 2IYTA 2PMKA 3KKQA 2H57A 5HKKA 2IEZA 3WHLA 4TZ6A 5EE0A 1NJGA 1ZCBA 4DSTA 1FP7A 2PBRA 2GVDC 3R9XA 1Z8FA 2ZSBA 5DE3A 2RGAA 4ITRC 1HE8B 1ZNYA 4FINA 1E3MA 4HLUA 4OBEA 4PO1A 1MRSA 4PQFA 2LKCA 2ZQ5A 3QF4A 1P2VA 2BOVA 2FE4A 2F3TA 3WHKA 2NQ2C 2JJ8A 6Q21A 1CP2A 1FOEB 1SGWA 4DLYA 3KB1A 5DIFA 5FPKA 3BRWD 3DOEA 2CHGA 1P60A 4P32A 1Q1EA 2DFKB 2X77A 4ASUD 1YZTA 1NF3A 5GJBA 1O87A 2P0EA 4C0HA 3ZVMA 1MABB 3BGWA 2BC9A 3OHMA 4XJXA 1E96A 5GJWC 3ZJYA 4A8JC 1IXSB 2AK3A 2HT6A 2RAPA 2V6IA 4L9SA 5LB4A 1NKTA 4US1R 4LBWA 5UKDA 2J0QA 4BGDA 1ANKA 3U2QA 1Q22A 4KI0A 2BKUA 3M4YA 4Q4HB 1F2UA 1P61B 1T3SA 1RRFA 5E4FA 3LQRA 4AKIA 3WBKA 4GZLA 1I2MA 4UXIA 2XXAB 2Z4RA 1P73A 1XPUA 1A2BA 2Q21A 2ZSFA 4AI6A 3FE2A 1G17A 1W4AA 2KBFA 1OH5A 4JBYA 4IVQA 3RSOA 2WJIA 3PENA 1AKEA 3T06B 4JL8A 3LY5A 3VKHA 4M9QA 4B34A 3SN6A 4QNMA 4ZDJA 1E9AA 2C78A 3HPRA 1WXQA 4LY6A 2CVFA 5JJKA 2VHUA 2HXSA 4IVPA 1JR3E 2WKPA 3K09A 2D2EA 1BS1A 3NHAA 2XJ4A 3BD9A 2ZRGA 2FFAA 4URWR 3BWDD 1PUIA 1J99A 2W0SA 4PPFA 2H5EA 4IW3B 4PSVA 5CK5A 1W46A 2F6RA 4M9ZA 1AKYA 5IK2D 1GKYA 1W0JD 4WIAA 2VBCA 1Z3IX 2VP0A 4B3BA 3EIEA 3QEOA 3RANA 4H1VA 1N6OA 3IHLA 3IO5A 4EIWA 4YMWA 1AM4D 2CJWA 1E9BA 2C9YA 3R20A 2AD1A 2BM1A 2NZ8A 3VU9A 2FEMA 2W58A 1LB1B 3C16C 3LQQA 2W6JA 1EFHA 4DLZA 1KK1A 2GXSA 3AVYA 3VMFA 3ADKA 4IXMA 4XIGS 4HUTA 5IRCD 2OAQ1 4OKSA 5E95A 2HF8A 1WE2A 4GT1A 2A5GA 3ONWA 2Q0HA 4V0KA 3O8DA 2DB3A 3A6PC 1AJEA 3CLVA 1T8TA 1IOZA 5KYKA 3H4MA 2QA5A 2QY9A 2CE2X 2VSXA 2YOFA 3EA0A 3K8YA 2GEUA 1KDTA 3T1QA 4NYMR 2YJTD 2N46A 3R9IA 3BC1A 2ATXA 4XWOA 1CJTC 2R8RA 3BE4A 4BQSA 2FFBA 3OFNA 4DDTA 4M1MA 1JI0A 2I4IA 2X1VA 2VPPA 1II8B 3TW4A 3T5GA 2NMVA 1D2EA 4KVAA 4KODA 3THXB 1ZNWA 5KNDA 4QG7A 1NSTA 2Q3MA 2PZEA 4X8MA 1RZ3A 1UKVY 3HYRA 5KUTA 2CLCX 5FI0B 1GZSA 2OCYC 1XMVA 4EPRA 4GDFA 1P7CA 5FPSA 1JR6A 121PA 4F4CA 3I72A 1AIPA 5EUMA 1KI7A 3UMRA 4EPWA 4OQFA 1E9SA 3TR5A 1TNDA 4LYJA 1G8FA 1OFTA 1W36B 1KO8A 2WWIA 4PFSA 3WY9A 2QTVB 2WMOB 4DSUA 2ONJA 4KBGA 4XOIA 5CK4A 1D9ZA 4YDSA 5DSZA 2BBOA 2F7SA 3LLMA 2YZ2A 4R9UC 4ZIRB 3A8TA 3RRMA 2ZRHA 2ZRLA 5JWOA 3CZQA 2JLXA 2ZPTX 1JEEA 4RD4A 3U5ZB 4LYHA 4MUBA 4LJ8A 1VHTA 3A1UA 3EW9A 1IHUA 1XTQA 3HU2A 3CONA 4DT1A 4M2LA 1Z63A 2OG2A 1PLKA 3K0AB 1JQLB 2QORA 3X1WA 1ESMA 2EFHB 2QN6A 2WSSD 1OFHA 3U6BA 4JKYA 5DN6D 2O8DB 1WRBA 1NKSA 3CH4B 4YMSA 2GA8A 3TQCA 2IHYA 3OEHA 4DIDA 5K8TA 4EPVA 4CEHA 5DYIA 5CJPA 4DLSA 3DMNA 1LW7A 1EFRD 4HUQB 1G3QA 2OT3B 1BIFA 1XMJA 3O8RA 3VNUA 1D2NA 1R7RA 2ODWA 1CF4A 1G8HA 1WA5A 4DLXA 4ZCMA 2GZAA 3QOFA 5AJVB 2IC5A 2O8FA 5FOXA 4QXAA 1Z08A 1NVUQ 1S2MA 2FGJA 1LTQA 1S9HA 2OE2A 5K8UA 1DAMA 4XD7A 5FL7D 1U9IC 2YINC 2BJWA 1R5NA 2EFCB 2YYZA 4J0QA 3AVVA 5GJVC 4NYJQ 3T1OA 4EQ6A 1ZD8A 2ZI7A 3QG1A 4FD2A 2RCNA 4KV9A 2NIPA 4EKDA 3QKSA 1OV4A 1KIMA 1SVLA 3SYLA 3GLFB 1ZP6A 1W0JA 5L3SB 2YOHA 2GJ9A 1LF5A 2P67A 1J70A 2I1VB 2QAJA 2RB4A 5B2ZA 5CITA 3RNLA 1R0WA 3GLHA 5KDOA 1VCNA 4PPGA 1BH2A 1P2SA 2QZ4A 4DBLC 5LD2C 1S9DA 3B13B 1U8AA 3V9PA 2J87A 3OIVA 4JSTA 3KJIA 3RRZA 2ATVA 5D3MA 3RS2A 5AR1A 5G3YA 4CEJA 1ELOA 1KMQA 1MRNA 3BBPA 2OV2A 5JJLA 3CR8A 4NCKA 1D9XA 5KPJA 3PEUA 5TV2A 4M8NE 4RFSB 3QXXA 3HP1A 1E32A 1S4QA 3KXIA 4TWZA 4HSEA 5EXXA 3FYHA 2OXCA 3OESA 2XZOA 5FTLA 2NO7A 4BRWA 3BFKA 3EAQA 1W49A 3AF4A 5L3VA 1P75A 5JI2E 2JASA 2YC4C 4DIEA 4CEIB 3LX5A 5H68A 2ZXUA 4Q1FA 3UATA 2JEOA 1P62B 3CNNA 2HEIA 3Q85A 3GPLA 2QUZA 3RABA 3JVVA 1E1RD 5BXQC 1B23P 1OFUX 1E98A 3GQBA 4LV5B 2WMNB 5TY0A 1EX6A 4OK6A 4PHTA 4HLUC 4AWXA 2OM2A 1SXJE 5D3QA 4C9BA 3IO3A 4LBYA 3WMEA 4H1UA 4RCZA 2XTNA 2QU8A 3WRYC 5AWFC 2VP9A 3QG5A 1LS6A 4TLCA 1Z0IA 4B2PA 4MRNA 3UPUA 4AKHA 4P3YA 3P1JA 3U44B 2QM7A 1W48A 3K0EA 2ZRPA 4TLEA 3T1VA 2RKOA 1EFTA 2PH1A 5DI9A 4JBWA 2RGBA 2PX3A 4D4MA 3OEED 2O8BA 1G3RA 3A4LA 4MRRA 3QKTA 2QPAA 2DR3A 4ZKDA 4ERNA 1K5GA 5JMTA 4O3MA 2X19A 2DFNA 1GL6A 1GUAA 2C03A 3HJNA 4DDUA 3REGA 1IY1A 2GRJA 5AJZA 1Z07A 4PHFA 1XEFA 4A8JB 2A3RA 1GILA 1S1MA 4RFVA 3QY0A 1SQ5A 3EPLA 1EFCA 1XEXA 2ZJ2A 1TTTA 3NDPA 3DHWC 3DM9B 2EU8A 3EASA 1YRBA 4V0NA 2GXUA 3GMTA 4HEJA 5DN6A 1DOAA 2WKRA 4YMVA 1YQTA 1E6CA 3TAUA 1XX6A 4HB3A 5DGXA 1S3SA 3KFVA 3QENA 4M1YA 3OIWA 2OZEA 3MWYW 4Q47A 1QHNA 3B1WA 1EFRA 2GHIA 1IY0A 3K09C 3Q7PA 1GKUB 2REBA 4HDOB 4LC0A 1IBRA 4Q01A 1WMSA 1XDBA 4OI0A 2Y8EA 1ZW6A 3L43A 2H7VA 3NEJA 3KQHA 5J5CA 1G19A 3IHWA 3T15A 2NO0A 5FTJA 1IM2A 1DG3A 4LPKA 1MV5A 3ZGXA 1YJ5A 2G1JA 4RSGA 5DYGA 3R7WB 4DVGA 4L9WA 5HTKA 3L82B 2RGGA 2ASEA 2ZEJA 4RD3A 3KQKA 2GDJA 2O0KA 2PLFA 5J4KA 3GJ4A 2WVJA 4Q1CA 1T5LA 2JLZA 4G0NA 3GEHA 3TR0A 2OLKA 3RC8A 1HH4A 1UM8A 4CW7A 1YHNA 4M9SA 4KU4A 2VSOA 3ICQB 3SBEA 1GNRA 3KTAB 4JLNA 4M1OA 4GL2A 2YHSA 2EYUA 2X8AA 3G82C 5M04A 4LWZA 3A4NA 4D4LA 1E9EA 1JECA 1F2TB 4FCWA 1Z0KA 4DCTA 2D7DA 3WYGA 3CNLA 5JLJA 4NBSA 1ZM3A 3I73A 2EWVA 1Z6XA 2QENA 1WP9A 1KO4A 1TUEA 2ZYUX 4D80A 3NKVA 1ZYUA 2QGNA 2XSZD 1GAJA 3I3SR 1VECA 4B35A 4LYFA 5FOUA 1QHSA 4XH9B 4LHXA 1RE0A 4QHTA 5KOYA 4LX0A 5FOWA 4D6PA 1CR1A 1PUJA 2ZUDA 4Q4AA 1N5IA 5EQTA 2ZROA 3EXAA 4AYXA 4C30A 1OHHA 3LH5A 1KO7A 3A4MA 1GL7A 2KI5A 2O8EB 2DHRA 4MGKR 1E1QD 3RRYA 4DLUA 3GLGA 3FHOA 4WW0A 2WJVA 2P65A 2AN9A 2CXXA 2F3RA 2F1IA 3LAWA 3Q3JB 4PC3A 1NMYA 2BIFA 2XEXA 1Z47A 2FOLA 1JALA 4JKIA 2CHQA 2ZRAA 1TADA 5FOTA 2Z6VA 4E5UA 3MCAA 4LI0A 4L5BA 2XNDA 2IT1A 3OEEA 4OHXA 1TQ2A 2MSEB 1R2QA 1D6JA 2C9CA 4JSYA 2GK6A 3SI7A 5KHOC 3PXGA 4XVUA 3U3KA 5EZ5A 5JSZB 3FGNA 1Z0FA 1G7CA 3QXJA 1COWD 1T8UA 1F6BA 1UADA 2FGKA 1JNYA 4A82A 4F38A 3K70D 1SVIA 2UVQA 2V54A 1Z6TA 1N6HA 4PC1A 3LD9A 4AURA 3IIKA 1KY2A 2FPLA 1TMKA 4LCBA 3UANA 2DY1A 1Q1ZA 4BLTA 2IXEA 1XXHE 2XX3A 3P20A 3THWB 4FWTA 2WWWA 4OI4A 3BJIC 4IDPA 2VTKA 1BMFA 2IXFA 4OK5A 1E0AA 3FKSD 1LFDB 1UBGA 3SJCA 1E2PA 1XXHB 1QHIA 3C14C 2HXYA 2W0MA 3AP3A 2OCAA 1E0SA 3P4XA 3BIFA 3BB3A 1VCIA 3PCRB 3EPJA 2XGJA 2GCPA 3HU1A 5DLQC 1I4LD 1UJ2A 2GETA 3O47A 4X8OA 5C4GB 4PZYA 3B8HA 5EP2A 2ODBA 1UEIA 3KKMA 1X3SA 2WWGA 2R2AA 2AWOA 5SZIA 4C0LA 3U3MA 4F4JA 5IHPA 2W83A 3F5FA 3AKEA 4KO8A 3GLIA 2HJVA 5ANRB 4RZ2A 2D7CA 2HCJB 4RCYA 4JS0A 1ZC4A 1OB2A 2VYFA 1RKBA 2ZI5A 1ZMXA 4NU0A 3LRPA 1PLJA 3NTUA 5JBQA 2G1KA 3WXMA 2NOAA 4M4SA 4NYIQ 3SS8A 5KNBA 2IYWA 2ZIAA 1W5TA 3FFBA 2O0JA 3W8NA 5FPTA 5F3WB 4HDCA 1N2CE 3MWKA 1GG2A 1KTVA 1PZNA 3UXMA 3Q9LA 4URUR 3DM5A 4K81B 4K46A 3GJXC 1TQDA 1XF9A 4ZPXA 4B6EA 3WNBA 4HB4A 2J7KA 4CT5A 3GJ7A 4FWIB 2FF7A 4QOSA 1D2MA 3FDIA 1W2HA 1RYFA 1W44A 1SKYB 4NPHA 4WAUA 1AA9A 1G41A 1RRPA 1LNZA 3C4JA 1N6PA 1XD2B 2QP3A 4NCNA 4V0ME 2OHFA 1FZQA 2OCPA 2LWIA 3I5YA 2IXGA 3RS7A 1KJYA 3W3ZB 4RVCA 1VHLA 2E9SA 2ZSDA 4DB4A 1GL9B 1E1QA 1WCV1 3TBKA 3KZ1E 3SOPA 1W4BA 2WOJA 3H1TA 1U9IA 2QPOA 3ZDQA 5FTNA 4IRUB 1GRRA 3QF4B 4C4PA 1KMHA 4Q7LA 4DZZA 1Z6AA 1X8LA 1JPJA 2QE7D 3S1AA 3AGQA 4D4KA 3I61A 3VR1A 3E2IA 2FU5C 4TMZA 3V4FA 1E94E 2PJRA 1Q44A 2XB4A 4BUJA 4F93B 1D8TA 1H8HD 1L4YA 1FFHA 1NVWQ 1GRNA 2P5TB 1W4RA 4BLQA 1OE0A 1TPZA 3UMFA 4M1TA 5E7JA 3RAPR 4DRZA 4YMTA 2PCLA 4QHYA 3SU8A 1KJZA 1ZM7A 4IOMA 3IKJA 5BN5A 1Q57A 1KAGA 2ZRNA 4GP7A 1UBCA 4I1VA 4TMWA 1OIXA 4DXAA 1DBSA 2QEQA 1U0LA 4B76A 3L0IB 1ZBDA 2DFTA 1F2UB 3PG5A 1YU9A 3QPUA 3TIFA 3CF0A 1XRJA 4KFSA 1E69A 2MMCA 4OYHA 1DTSA 4PAMA 4Q4JA 1XFAA 2WHXA 4TMKA 5TMPA 1R0YA 1N0WA 4GRAA 3KB2A 1EWQA 4IEIA 2EQBA 4Q7MB 1M6NA 2G6BA 2V7QD 4Q7JB 3PVSA 1R8QA 1T4GA 4IFEA 2HV8A 2V1XA 1SVMA 4B32A 2REOA 5JJIA 1OPXA 1SHKA 4N1AA 2ODEA 4TMXA 5L3QA 4OHYA 2I1QA 2JCSA 1YR6A 2IYQA 3L2OB 3QJYA 3RDPA 2IUTA 2QM8A 3PUWA 4TQUS 3P32A 1VMAA 2XITA 3MLEA 4B48A 2FNAA 2ZRIA 3QIAA 1GSIA 1CXZA 1RW4A 1JJVA 2R6CA 1JQJC 3K9NA 2CJWB 3I92A 3BK7A 2CHVA 2FPKA 3TKLA 3SE0A 1NLZA 2O52A 4BASA 3NDBB 2GKSA 2GAOA 5HCNA 1N25A 2K5UA 4R7ZA 1JR3D 2Z83A 4JZKA 2IYRA 3D3QA 4FI3C 2Z4SA 4C2TA 1ZUHA 2MSDB 4G1UC 4O25A 1UEJA 3VR3A 1UFQA 2P2LA 2R65A 2BMEA 2G0NA 4I99A 1M7HA 3WMGA 1M7BA 4ZCIA 1A4RA 4ARZA 5FBWB 1FX0A 1IN7A 4QC2A 4TYYA 1ZUIA 2E1RA 4P0TA 2XNSA 2V55B 3SFVA 1ZM2A 3FTQA 1JXMA 4NMMA 4BZQA 1AS2A 4Q9JA 4M1WA 2W2XA 1ZNXA 3GD7A 3K9GA 3H84A 2WM9B 3L0OA 4ACAA 1OLOA 3CX6A 3L0SA 4LHYA 4D4JA 3UMSA 2YV5A 1RJ9A 3FMIA 4KJZA 1R6BX 4QL3A 3ADCA 3PEVA 1H8EA 2A5DA 4JLJA 4B33A 3OE7D 4QBIA 2XTMA 1F60A 3FWYA 3MAAC 3EZ9A 4JL6A 3CRW1 2VP4A 3CRQA 2GAAA 2QGZA 3HYTA 3ZQJA 3VX4A 1GITA 2QE7A 4MYUA 2IYSA 4GOKA 3U60B 4OJKA 4WBSA 1E9FA 2QP4A 4I1SA 3CR7A 1U0JA 2QSZA 4BFYA 5E3HA 1UKZA 2DCUA 5JEEA 1H8HA 1VG1A 1IQPA 4R98A 2GNOA 1KI1A 5IT5A 2JATA 2AXNA 3IQXA 4Z1MD 1W0KD 1E2JA 1NIPA 4PSAA 1XTJA 2DWQA 3OAAA 1W36D 3SBDA 3AF2A 3EZFA 4TT3D 5HE8A 4UKDA 4BFWA 5FUXA 1HY3A 2IYZA 2RHDA 4C0BA 5GJCA 1G21E 2DWPA 4M53A 4PPQA 4DT1B 2QQ0A 2REXB 2HYIC 3QE0A 2WBLC 1AGPA 4ZDWA 1IN8A 4ZKEA 2FFQA 1MABA 1MO5A 4AD8A 2BHRA 4V0OA 3GFOA 1Q1QA 3RS4A 4CEHB 821PA 4QM7A 4TTPA 2EFEB 3TK1A 1KKMA 3WNDA 1U90A 4LV6A 4E22A 4MRPA 1RRCA 1QHYA 4GPTA 3ZD6A 3B1ZA 5BN4A 2QI9C 2V7QA 3BB4A 1N6LA 4JBXA 3BAFA 4JYCA 5EXPA 3TW8B 1JAHA 2B21A 2O8FB 1G64A 3MJHA 4Q9HA 2ZYWX 1ZUNB 5TXGA 3W6PA 2FMXA 2XXAA 1ZJ6A 4KYIB 3E70C 4URZR 1S8FA 2WJHA 5CYOA 4KCGA 4EQ6B 3KQLA 1KYIA 3OF5A 3SYKA 2IX3A 1XP8A 4PHGA 4ZV4A 4IOKA 2B8WA 4PHHA 3QKSB 1HURA 2IUUA 2O0HA 1OYWA 1DEKA 1N6KA 2GF0A 5CIQA 2AKYA 3CWQA 2O8CB 3MRSA 3BB1A 3GJ0A 3PITA 3GLHB 5F2EA 2H18A 4ASUA 2AFHE 1P2TA 1EX7A 1R4AA 4B3XA 3LW8A 3KXKA 3CX8A 1RIFA 3IEUA 2GJ8A 2BMFA 4MYTA 1S96A 4CEJB 3U7GA 4PO8A 1JR3A 1G7RA 4OQMA 2AHOA 3EARA 4A0RA 1G291 2BV3A 2ZRFA 3EIHA 1FMLA 2BBSA 3X2SA 1NMZA 3QNUA 4UQOA 2BEJA 1OH8A 3I8SA 5CLQA 4IOJA 3CPHA 5F98A 1C4OA 5A4JA 4TQ9A 1IN6A 1KO1A 5LB2A 4YONB 5AUQA 5FBVB 3NBZC 4HAUA 4ZI2A 3U3RA 3LVQE 3ZS9A 2QAGA 2ZAMA 1IAQA 4WVFA 3DZDA 3VNVA 1P5ZB 1NP6A 1UPTA 4JLMA 2G0TA 2WV9A 1ZD9A 1YE8A 3AKDA 4KSCA 2ZI9A 3KJGA 1CU1A 2SHKA 2ZRBA 1P72A 4XTRA 4DCNA 3EPKA 4GOXA 3GLFE 2QRNA 1AGRA 2JIZD 2C99A 1PLLA 4JLKA 1BYUA 5DISB 3LV8A 2F43A 1SVOA 1CKEA 5CDFE 1GM5A 3M6AA 2XZPA 5IK2A 1YR9A 4ILEA 2OCBA 1G18A 1ZIPA 3TSOA 2ZS7A 3H2YA 4CF7A 3HDTA 3AB3A 1XJQA 3LO5A 2GEDA 4OHWA 2VHQA 3EA5A 5KDLA 3TRFA 1I4TD 3B1XA 1TEVA 1AS0A 3RC3A 5JZVA 3AF1A 1SULA 3LBNA 2WJYA 4FMBB 3T35A 3AVXA 4RJLA 3VR4A 5AUOB 2IS1A 2C2HA 3AUYA 1G7TA 3VKWA 2QPTA 3B1VA 5EXSA 4A1FA 1F3OA 2ZAOA 3RWOA 3K70C 5G3ZA 3A1VA 4B3FX 1SXJD 2W2TA 2GEVA 2NPFA 5AJXA 1EG7A 1QF9A 4E09A 3ZD7A 3IBYA 4XWAA 3PEWA 4Y0AA 4MUAA 1XEXB 5CB8A 1E2EA 1E79D 3NH6A 4BFSA 2NPIA 1E9CA 3LBHA 2ZVQX 3A58B 3KKOA 3CNOA 2IS4A 3LXRA 4QHSA 1IONA 1CR4A 4ZIRA 1RFLA 1XJ0A 2TMKA 2BDTA 2GZDA 5C2JB 2RGCA 1GVNB 3I5XA 2YKGA 2ZR0A 2ZSAA 3CB4A 4QJ4A 3UG6A 2ZJBA 4BWYA 4RZ3A 1KHTA 4JL5A 1GDDA 2WJGA 2V3CC 4QGHA 1HT2E 1T91A 1R5BA 1TQ4A 1FNNA 3PV0A 5G53C 1XPOA 5B58C 4PTLA 1V5WA 4KFRA 5FPYA 2NO1A 2IF2A 4OQNA 3REFA 5K8LA 5JCZA 4DDVA
chains in the Genus database with same CATH superfamily
3HBFA 3E2PA 1ONBA 5I8PA 1P2FA 2F1RA 4MTCA 3P9SA 4G5QA 2XOKD 3THRA 1LBIA 4QO7A 4PYIA 1TAHA 4RPCA 1IWOA 5ALQA 1IJEA 3K1TA 3WWOA 1NBME 5J40A 5DLPA 2JJQA 1EZZA 3EEQA 1NW6A 5B1EA 1X8JA 1Y7PA 5IT0A 1SOAA 1FUEA 2ZTLA 4OXYA 1QG0A 1HE1C 4AIRA 5DXAA 3V7NA 2GCOB 3ROPA 3U9TA 4MDHA 5KMGB 3K16A 1JKFA 1S8AA 2ZANA 4CIDA 5IZCC 1PEKE 2V97A 4PBSA 1GFWA 3WLRA 4ND2A 1WSAA 1KAHA 4I8IA 5CFOA 2SKCA 5AOBA 4D9IA 3MINB 2CCJA 4CN9A 3CXRA 4JYBA 4Q4CA 4CR8A 1TZMA 3UK6A 1SVKA 3AY6A 2E55A 3GNLA 3CEJA 4ZT7A 3WNCA 2JKVA 2P3SA 2VSFA 2GCIA 1C0IA 2C61A 4K9OA 4BFXA 1W9MA 1GU1A 1U5AA 3EVAA 4CZ2A 2PUVA 1SIOA 1WEHA 3QBTA 4E21A 1XRSB 1ZRHA 2H0RA 2YUTA 3ZU5A 4FEAA 1JBQA 1DKNA 1GT91 4NS4A 1YA8A 5H9VA 4BO6A 4DNPA 2P27A 2RGRA 2EJBA 2OOSA 2J31A 1AV6A 1OYYA 4WH0A 5CA0F 5ULLA 2P3OA 1FFAA 1T0BA 1P5RA 2C2BA 2ZJ7A 3KSRA 4BMPB 4CMJA 3K0FA 4CV2A 3DAFA 2ISSD 4XWKA 4CKZA 5AVVA 1E3DA 5EWJB 4FIZA 3PNOA 3IPCA 5EI5A 3SWWA 1CUYA 1JHZA 4I9HA 3L4BA 4QM6A 1QHHA 3PU6A 3H13A 3DKVA 4C29A 3PTAA 2DJ5A 3QX8A 5D5PA 5FL7A 4DABA 3PB3A 1CX9B 1QF6A 1I7PA 1YJ8A 4HGPA 3IVXA 1PEDA 1T8PA 2XUDA 4YCBA 4J0KA 4EVSA 1Q7TA 1SPXA 1EEHA 1ZJ5A 2XBLA 2NM0A 2ZE8A 3HO8A 4GLOA 3LQ2A 4KITB 2AI2A 2B7LA 3F47A 3A2NA 4GC9A 1TECE 1B3BA 1VG0B 2QRPA 2JIPA 3B6MA 1QHXA 2QR5A 3ND7A 3TRIA 2LIPA 3N5KA 4QJ3A 1UP6A 1N0UA 1CUJA 1FVXA 1KFJB 1T8WA 2Q5QA 2BBWA 2Y0CA 3DOOA 3BBLA 2J85A 3PUXA 2B8TA 1DC4A 1I7LA 1Y1RA 1NSFA 2O1WA 2ZWOA 4ISBA 1TUIA 4REOA 3RWMB 4RKQA 5HJ7A 1TU4A 1NXQA 3AGPA 5EWMB 4DJAA 3E82A 4OU5A 1T6YA 5DX0A 4LQDA 5E0KB 3V5NA 1ZH2A 4YTEA 4WDRA 1XZJA 1TA4A 4KIWA 4QFMA 1T3ZA 2A30A 1W96A 5AW3A 3B78A 3B3AA 1PJRA 4EITA 1HSOA 5FBKA 2NVUA 3GEBA 3GLUA 3BUSA 5IC4A 2IHNA 2H11A 3BN3A 3DE2X 3X0DA 5BPFA 1BO6A 1TYBE 2RSLA 9MHTA 2ZS8A 1NT2A 2C42A 4KQKA 5HIIA 2EX4A 1K8QA 3FNRA 3QUCA 5BMVA 4YXWD 1CEYA 1GZHB 2J33A 5BWCA 4BLPA 2CVOA 2GXAA 5A06A 1YFKA 2CV2A 3IILA 2OHVA 1CZKA 4KXWA 4LF7B 2BFEB 4KLRA 2EBUA 3VDNB 4TMVA 1AN0A 2KHZA 2QN9A 2XQGA 4GYWA 2B83A 1GGFA 2FLWA 4YDRA 5J4LA 1S8NA 3U7QA 3FFAA 2J0UB 1KQGA 3O1JC 4Q4LA 1V9SA 3C5CA 4O29A 2FW1A 5H7XA 5T5QA 2Q4TA 4AP5A 3T38A 1RXEA 4C78A 5HXAA 3WE7A 1R10A 3DTNA 2BUAA 2EFDB 1E61A 2SKEA 4FYKA 4DSNA 4HDQB 4D3DA 4NCAA 1UZLA 3HQ4O 2WWRA 4I36A 3ZUGA 1GAEO 4MKHA 3FKJA 2AC4A 4MUFA 4C2UA 1A0OA 1NX6A 2XWSA 5AT1A 4EPTA 1ZM4A 1QZ3A 5K1ZA 4CLOA 3A9CA 3O8BA 5HCIA 3JATA 1S8OA 2YY5A 1JFRA 3K94A 2CXHA 3KYBA 2NAPA 5AHKA 3DEIA 2Y6VA 3O3MB 1YA4A 4FOTA 3MUEA 1WCIA 4H17A 1QYRA 2XUPA 4N01A 5KU7A 5EPOA 5F77A 3DYBA 1S7CA 4W9NC 3H1FA 4HWGA 4AYTA 4EGCB 4XCVA 4FKZA 3P9XA 1ZZGA 2QIOA 5BV0A 5ERGB 2I6SA 3MS4A 1LRLA 4YNBA 5IJXA 4Y9SA 3EMDA 3ROQA 1FTWA 3FVQA 3T3IA 1XZNA 3IDQA 1NNEA 3H8WA 4CKBA 2BUBA 1GV1A 2HA7A 1SCBA 4TZTA 4TV8A 1JKXA 3I9FA 3P2MA 5IM5A 3ZTTA 1EE1A 3UJ8A 5DHFA 1J00A 3P2YA 1ZQ9A 1Z62A 4GG1A 2IPAB 1BJRE 3L7CA 4BO0A 1MO2A 4MTLA 3QP9A 3OQNA 2EKPA 3DJYA 4AO6A 3I4FA 1B74A 2W4IA 2WF7A 3R7BA 3E3MA 3VHLB 2OV6A 4QJIA 2YC2C 5TJ9A 2I65A 4DCUA 1ODSA 3B5JA 1FS5A 1FYEA 1QFYA 3ANMA 4MKZA 1VA4A 3LXXA 3RF7A 4B81A 5HP4A 3LE8A 3HNOA 4P4SA 1AKWA 2X2OA 4BLUA 3OPQA 4PM4A 1V3QE 4G5XA 4YRFA 4OXIA 4MGIR 1SKQA 4R7TA 4KAFA 1V9CA 1M2KA 3H11B 2CNDA 5F35A 4RIHA 4EHIA 3H0KA 4IKEA 2YNMD 3GJ3A 3DZKA 1M2EA 1UBRS 1H23A 3H5RA 5E9QA 4UCFA 3JYLA 4J1TA 4EJSA 4Z1OA 3E5HA 1XALA 2HDWA 3ZUPA 1NLUA 1USWA 2OGSA 4UNPA 2N9UA 4DF3A 2YQ5A 4HYEA 3UC9A 2ZBGA 3D8SA 1D7OA 2GD0A 1KMHB 3H05A 4QTXA 5G40A 2HA0A 2BP7A 3CTMA 5HKKD 1MEOA 3FI0A 3D5TA 2QT9A 2MYPA 1R0XA 2KWIA 1TPYA 5LBUA 1ZK1A 4YJ3F 4BTVA 4RETA 4ZGBA 4DBLE 4YJ2F 5K4AA 1G3MA 5J5VA 1ZNZA 4PZDA 1MOSA 5LBTA 2ECPA 2A5LA 1NI3A 5I9TA 4YCNA 4PAOA 2AKEA 2Z3VA 2ZB2A 3QVUA 2O20A 4BWGA 1NFQA 3ND6A 1VFNA 4DMGA 2PXXA 4RZIA 5T3YA 5IDWA 5K0FA 1IB6A 5EXEA 3EUWA 1RR6A 2BMJA 2X42A 5JWHA 4IXTA 1P3Y1 5AW7A 1HDRA 2HNBA 1PNQA 3I9NA 3OY7A 5JRDS 1ST2A 1XFDA 3RVJA 2QQEA 4L5JA 1XTKA 2QT1A 5BURA 1AMUA 4F92B 4AG6A 4LOHA 1EVZA 3GGCA 1WZNA 5TQ0B 5KYWB 2GCNA 2PH5A 3COSA 1MD9A 1F8GA 5IWCA 3H1GA 4A6XA 5L51A 3B1JA 1FU8A 1PF7E 2FFRA 5BWMA 1JG7A 1B2RA 3CJQA 4KI7A 4E5YA 1SG0A 1JPUA 4ETWA 3RRXA 4LBVA 3BAZA 2ZI3A 3NFRA 2PKQP 4OFWA 3F8SA 3SZGA 3BQNB 1R4MB 2XSZA 3M3HA 4YXWA 2QBYA 5CNIA 5BW5A 4ND4A 4X0EA 2WWXA 3AVOA 3KOMA 4W5HA 5DHUA 5E6RA 5AHWA 5L8VA 1QE0A 3T0FA 3LBIA 3ID6C 1VPWA 4X65B 2IV3A 5IJ9A 4ZOQI 1I8TA 4ZOLB 3UW1A 3SYMA 3KV1A 4M87A 4NF2A 2AQKA 4UPEA 3WQHA 4EFKA 1V3TA 3FYUB 4XQ9A 4FYWA 3GFFA 3M89A 5ICFA 4D3XA 2VH1A 3ZQUA 3C4VA 2PRYA 5EIHA 4R1NA 2QRVA 4Y2PA 4QAQA 2ZAYA 5K8JB 1NG9A 1FQKA 1V37A 1X7XB 2O2ZA 4RZXA 1W35A 4CPDA 1EFLA 1NVBA 2V9CA 2ZCJA 1TB4A 3D3WA 4O4LF 5K6AC 3KJZA 4Y1RB 4XSGA 4YLGA 3UV7A 4MOWA 3LX8A 3OZ7A 4KE6A 4LRUA 2HJ9A 3S3TA 3GGJA 4R9VA 1GTL1 4XX0A 5K0ZA 5FI5A 4Q3AA 1EK0A 1C3EA 2VPIA 2O2IA 3PEEA 1V48A 1H1TA 3TLBA 2OVBA 1XNRB 5HG0A 3M6XA 4RULA 2GF9A 3D6UA 2QMQA 4D0GA 2FSFA 3AJAA 1VPEA 2PEZA 2PMBA 4NE2A 3THYA 2AKAB 3G9TA 4QBTA 4RD0A 4RL4A 3LMKA 2Q7XA 4FQ7A 3V00A 5THQA 2UYCA 2JI7A 2VJMA 1T6BY 1N2XA 1HFKA 5ALTA 2CDRA 2GUWA 4AKEA 4MV4A 4BGEA 1ZCFA 4ZQCB 3U4GA 2Z6UA 4JBNA 1DUSA 4KLCA 3IAS6 2E49A 3ZWNA 4L0MA 2XNCA 4E88A 2CXRA 1OAKA 3D1LA 3LOUA 1U2DC 1Z28A 1T1JA 1FNMA 2GTPA 2IOFK 1BS2A 2WV7A 4HQFA 4WZ6A 1L5QA 1AX9A 4BNKA 1UZNA 1YB1A 4RF2A 2J4CA 4MH0R 5CG1A 2X5XA 1ZA2A 4E3ZA 2NO5A 3ACCA 2W71A 1XB2A 4YJFA 1HYQA 2GEKA 2QX4A 5GZ6A 4IGAA 1LFAA 5HQ3B 4C4YA 4I1OA 1NPDA 3R74A 1TVKB 4ARBA 5HWSA 3BX1A 1C1XA 3S8YA 4CQNA 3NS7A 2FEXA 3FKSA 4O2LA 1J8DA 2QTNA 1L6RA 3FOEC 1QG2A 4RZSA 1T25A 2HK8A 1FRNA 1WTAA 3GT7A 3MSXA 4W7SA 3HB5X 1QJ4A 2YNMA 2NPOA 5JJBA 3FVTA 3G02A 2LBPA 1V5GA 1WKBA 4BJ3A 2QYTA 1X87A 2JGKA 1UKCA 1J90A 3CO5A 1HE4A 3OSUA 1VKHA 5ECYA 4Q6WA 2QMUA 2O0MA 4P1ZA 1JG4A 4FNAA 5FWAA 4QFBA 4TYWA 1WF3A 4YBRA 2Q99A 4IJMA 3DWFA 3L6OO 4I1RA 4ICIA 4PX5A 4BEWA 2JEZA 2WKQA 3V4LA 3VU9B 5SZKB 3CISA 1KKLA 3F5DA 3OCJA 4ZI3A 1N8NA 4IHJF 1YFJA 521PA 3FMOB 4KP7A 4X62B 5LL6P 4U7DA 1TGVA 1CERA 1SQ0A 2F1HA 4K1XA 3RWBA 5MGNA 2P1ZA 3I9V6 4V0MA 4N18A 4PPNA 2MTBA 2D5AA 3H1AA 3O3NB 3ZDBA 1ZISA 4G0VA 2QS9A 3IQZA 3AM1A 4XE5A 3UEOA 4G65A 4PE5B 2J0VA 5E7QA 4E1VA 3M0EA 1L5VA 5KX5A 3HSSA 2ZBDA 3D0RA 3UF0A 3FB4A 4HBZA 4FNOA 4M88A 1C9YA 1IMOA 4RQTA 3T7SA 4TYPA 3WL5A 1M1XB 2Q4RA 3NO4A 4EX7A 3Q11A 1DAKA 1AUXA 1Z2CA 4JGIA 1M2FA 4JELA 1AF7A 1GR0A 1XCPA 4DM7A 3LC7O 1C50A 1D1PA 1E3JA 1XT6A 4HUJA 3UMVA 4YX9A 4JLSA 4C2BA 2HK9A 1TA9A 1RHKA 4KK3A 4URXR 3FOZA 1YMVA 1US8A 4TYQA 2QRJA 3FUTA 3NWJA 2WG2A 3K0HA 5FORA 2F8MA 4P7BA 4HN2A 5E8JA 1T8SA 4K5QA 4R8MA 4YC7A 1L5LA 4AYWA 5C46F 4UEQA 4J3NA 4DB2A 1PJ2A 3JZAA 1R27A 1XZPA 1CQJB 2Q3LA 3OQVA 2XVMA 4KTVE 3CZ9A 1YXMA 2DAPA 1TRKA 4U7HA 4UDNA 5G0SA 2JGFA 3QOWA 5YASA 4D3ZA 3RAEC 1IZZA 5AJTA 3DFKA 4JLUA 2NSLA 1LA2A 1QKIA 1CRQA 3L8ZA 4ZHQA 1Q7EA 3KL2A 2A59A 3TDMA 1O3YA 1R15A 4Z3KA 1XHEA 2XE4A 1YULA 3KLPX 3QBVA 3RBAA 3BZBA 1PUXA 4BB6A 4WJLA 3DP7A 5CHEA 1AA6A 4ZEMA 4O1HA 2HPZA 2I6TA 1AKQA 4PLYA 2C4MA 5EP4A 5AM1A 3CH6A 1SBTA 4UNQA 4DLVA 4BQRA 2C5AA 1I13A 3DBVO 2Y1LA 5BQXA 2AOUA 2LKDA 4GMGA 1SU8A 1YS9A 2W6ID 2TECE 3S2EA 3W9BA 2FQQA 1JYSA 3U5TA 3B3GA 4I5DA 5ALFA 3UUWA 1U1FA 1XWIA 3GN2A 3I6MA 3HXPA 1T0HB 1IPHA 2BFCB 4IIFA 1RADA 3WZMA 2VA8A 1C1DA 1UDRA 4FHEA 5CM2Z 2XMSA 2ZUWA 1H2RS 1W76A 1HORA 1HLGA 5CK5A 4UNIA 5C0OE 5GVSA 4F5YA 3NM6B 1HYGA 1X70A 2P6RA 4IF4A 4IDFA 4N8SA 4KMRA 1XKLA 1YDGA 1MG5A 2M98A 3QNWA 1KP3A 4CMIB 1N9ZA 4XM0A 5TARA 3DTYA 2YVUA 3DAOA 4QPZA 3EGDB 5FV7A 3G1TA 3CN9A 1QHGA 3HDYA 2QVCA 2QYSA 1V11B 4MCIA 1NM5A 4JI1B 5EERA 5CEEA 1VLVA 3BTSA 5LJIA 3T0GA 3V97A 3ROEA 4X1IB 4HFRA 4YP9A 2LNDA 3D5EA 3WVNA 1H05A 1C7EA 3ISVA 4EB6A 1V4VA 1GNTA 4JP3A 5DBEX 4L5AA 2R00C 5GM1A 5FTMA 2J5XA 1SUEA 1E7RA 2A9OA 4NJEB 2CF6A 3WGIA 1ZVJA 3F4BA 3LJKA 3QLEA 4JCOA 4JLOA 1A3CA 4MVJA 4ZVKA 2YUIA 1NWHA 2O3RA 1FSPA 3D4NA 3KSZO 3CJRA 2WU0A 2ZJ5A 3VDQA 4MAAA 1FDOA 1T5TA 1YVEI 4KWIA 3JAKA 3ZDRA 6ABPA 3QJGA 5J47A 3HY3A 2BGGA 2Q2VA 4UDXX 4QYTA 2JHFA 2WJ6A 4MQMA 4EHFA 4GR5A 4GQAA 1IG3A 1UZMA 2ST1A 5FWYB 1TM1E 3IQIX 5DGDA 1U7UA 4AC9A 3HKEA 3L77A 3WJ1A 3QYJA 4UNSA 4WLUA 2NT4A 1O58A 3PA8A 2R6JA 3AEZA 5C1PA 1IK6A 4A5OA 1JN0A 2PFKA 1VB5A 2W98A 1Q0ZA 2ZWPA 1FJHA 3KKPA 3KDSE 2KMLA 4RY2A 1R9JA 4UCQA 2RHJA 3R44A 5BRNA 5ALVA 1NOKA 1WLSA 1PWZA 4A36A 5KHLB 1WXIA 1J0DA 4CMCA 2P6OA 1WP4A 3AFNA 4ABYA 4Q7QA 1XTZA 1UF9A 1KFBB 2EERA 3V33A 3DOCA 4WXPA 3ER9A 3UKJA 3F78A 4JLBA 1SQFA 3AH8A 1UIMA 1JKIA 4OGWA 2CXUA 1UC5B 1DNPA 4U6NA 2R7LA 2GO1A 3WADA 3E1SA 1C2YA 3RQIA 1CS0B 1EMDA 3PYXA 4R2MA 3T7KA 1VYVA 1ZNQO 3TVYA 1J8FA 4DIOA 1LLUA 2PX8A 2WD7B 3D5QA 4HQRA 2CF5A 2IWRA 3I62A 5DX1A 2V6JA 4IJVA 4ENPA 5CLJA 3CX7A 4Y1GA 3EG9A 2AHRA 3IBCA 3TZLA 4I4TB 1MC4A 1UQUA 2VQEB 1IULA 1J21A 1H4SA 1MXHA 1Q0PA 1HZJA 1T4CA 2RC5A 2ZUCA 4TV9F 4U2CA 4UPDA 2ZS9A 4GICA 4YRPA 4F4UA 1G2IA 5IAAA 3EVNA 1E77A 1XA0A 3A9SA 2D2XA 1LD3A 4XI9A 4BVHA 3DFMA 2IELA 4IP0A 3TGWA 2FDCA 3WTBA 3GUUA 1U98A 3FMFA 1CJSA 3JVUA 3M6UA 1BWPA 5JYEA 1A4IA 1QBKC 3VU3A 4MPJA 4X8HA 3THXA 1A2QA 2NVOA 4CF3A 3IOYA 1GTZA 1J25A 2I54A 2VYVD 1JDUA 1NIJA 1U8CB 3ANYB 3CEMA 4LZPA 5FTKA 4B43A 5JXWA 3WRXA 2JGEA 3Q1LA 5BUCA 3NC4A 5DTRA 3GP5A 3LUJA 3A31A 1HE2A 1BH6A 1HV8A 3EFEA 1KVSA 4N0DA 4O4IB 3I2HA 5B1DA 3ZQ6A 3MM4A 2IITA 1OPRA 4MITA 4N41A 4OLJA 3QXCA 2A78A 2B92A 3OPYI 2E6KA 2W6IA 1U6IA 4HDKA 1OFIA 5DEOA 3LKBA 2GLXA 5KEIA 2A1IA 5BT9A 4OXKA 3VPCA 2B94A 5LP6B 2WIGA 4MJ7A 2HQRA 4B8YA 2GJAA 2XVYA 2DWCA 2B0JA 2CNNA 2DR0A 2ZT8A 3GFPA 4MYCA 3SZMA 3UT0A 4BFUA 2WVHA 5AK0A 4D99A 1M1UA 3LUGA 1XRNA 4BNMA 5GIOE 3TM5A 2A94A 3ZTYA 1PQYA 4ZJZA 3NHYA 3OIYA 1DT5A 1XLTC 1TXGA 1YR8A 3BQMB 1L5GB 1B0UA 3RPEA 2JJ1D 3V48A 5A6VA 3FTEA 1EFUA 1G5RA 3D2AA 1ULBA 1YR2A 2JFOA 5BWBA 1KYXA 2WNHA 4EGJA 2XRMA 5E1MA 5U9CA 1DJPA 1OZHA 3PQDA 2OV4A 4G1VA 4BMZA 4L95C 4R8VA 2D62A 2OSBA 4DRXA 1MO4A 1EGHA 1H42A 2W6OA 1KZ4A 3DGEC 4EP1A 1J2UA 4MDEA 1TTPB 2WWFA 3UCEA 1AHHA 3F6RA 3NHPA 4JIMA 1G8YA 3ZLUA 2QW0X 3OOYA 3CLRD 3KJQA 3LPNA 2IYLD 3EXHC 2PJZA 4K6MA 3ZVRA 4AZWA 2O8DA 1PJ4A 2PH3A 4HLDA 3GZJA 3WLSA 3LXUX 2EWWA 3RYIA 4L7QA 3FBWA 4Q5IA 3WKEA 5BR4A 1RPZA 3EGXB 5J63A 4LJ5A 3AIIA 2ARKA 3A6LA 3SIPA 1DBPA 3K6RA 4XAQA 2OBYA 5F9FA 4CLEA 2JJ2D 4JBLA 3SLKA 1I3CA 1J8YF 4GE3A 4I4IA 3HBAA 1Z2NX 1IG0A 3MB5A 1YOVA 2HQ1A 1OHHD 2IGBA 3CIFA 4FVTA 3H9UA 3LRTA 4WEOA 3WQSB 1N7HA 2Y1GA 4W6QA 2Q1XA 3CPEA 4OP1A 4W1RA 4G36A 4MQFB 4G2TA 4MROA 5PNTA 3C6MA 1PW5A 1O6ZA 4H18A 2FEAA 3BTUA 2QLFA 3F6BX 1ILWA 4G5YA 3ZCVA 3RE1A 3KYIB 3TIXB 1U94A 1UXJA 3WGOA 1OBCA 1PZFA 1AQJA 3DA8A 3NC1C 5LXTA 1YB4A 1B93A 1Q6ZA 4J4BA 4OOEA 3UT5A 3SC4A 4D26A 1DDIA 1ZINA 4LRWA 2V65A 4RHYA 3GLFA 5CGZA 2C77A 3VYWA 1E2FA 1SXJB 4PFJA 5BW8A 4RD6A 4CVNA 1Y3IA 2N42A 1O9BA 2ZDQA 3P27A 5F21A 5FQNA 3I64A 1X74A 5AHRA 3ZHQA 2WLTA 1UMBB 3T7IA 1QR6A 3K73O 1ZG3A 5ALXA 1W85B 2GBLC 2GN9A 2JFQA 2GYWA 4FS3A 3R3ZA 1L5RA 5BSFA 1RCTE 1CEXA 4M46A 4CRWB 1G5IA 4GU5A 1LPBB 2NO9A 4KPYA 2KS6A 1KDOA 4IV0A 1WUIS 1PV4A 3DMGA 3FTPA 4DMMA 2H2IA 2CJPA 3SEQA 1UPBA 3A9RA 4GBGA 4MEBA 3GLGE 1EFAA 1IK4A 1VP9A 3EULA 2BTQB 1QORA 4BMSA 3FVRA 2VF4X 2P4SA 1Z38A 4Q93A 4F2WA 3WYBA 1GPBA 4HP8A 1MORA 3L0ZA 3GEEA 8ADHA 1GNQA 3UBTA 4CUKA 4C0KA 1WM1A 3H16A 2PPVA 4JXZA 3OIUA 1V41E 3K2BA 3ESYA 2V03A 3PUYA 5CYPA 3RB8A 2W2MA 2KW5A 3A25A 3H1PA 4BFTA 3E81A 5JBNA 4KEAA 3A7DA 4AUNA 2VSNA 4ESVA 3FZQA 4P5DA 4CT4B 2RG1A 4D8XA 1K3TA 2ISQA 1CNFA 3P0FA 3LZ6A 4KSBA 4WCDA 3IV9A 5D5QA 4CMEA 1GADO 2WDPA 3EZ6A 3N0TA 2VYVA 3OX3A 2CFSA 2NYUA 4LX8A 1O95D 4HLQB 4X1KA 5DI3B 4CMGA 5JRJA 3ZWYA 1NUAA 3UJPA 1QGED 2JGLA 3NBAA 3S70A 5JWRA 3N6VA 1OLXB 1P8AA 3QU9A 1HLFA 2W6CX 3VVMA 3B1FA 2NT3A 4RTKA 2NZJA 1KYZA 4FWBA 4PIMA 3JTMA 2PUHA 1L3CA 1IJFA 3WGYA 1CJVC 4C3ZA 4DLKA 1CB0A 4IUYA 2WAOA 4DCJA 1EFKA 3L02A 5EIOA 3PVZA 1H2EA 3KSBC 3P5BA 4DV3B 3ZPXA 2B4QA 3NKFA 4HX9A 3PRYA 4DSAA 2EKDA 4LNUB 5KAMA 5HBGA 4KWEA 2F3PA 2GCOA 3MYRA 3PXCX 3Q3GE 1EK6A 3VTKA 1BSVA 1C8KA 3ESBA 2IYYA 2JJ1A 3B5IA 3OQJA 3PIRA 5KNBD 3IP7A 1USGA 1I2ZA 1Z12A 3RVNA 3UJAA 4YAFA 4RY9A 2PT5A 4LJYA 1FE8A 1DDOA 3IAAA 4A8JA 3KSAC 5BV2P 2A3NA 4Y67A 1E64A 2FX5A 1XD8A 1USKA 1QYCA 4HOYA 4NENA 1M75A 3G6WA 1XEAA 4X3PA 3WB1A 1UZUA 4QDXA 1A72A 4TLAA 4Z7NB 1QP7A 4LV8B 3C5VA 4QOFA 4DSOA 2GVZC 3PZRA 3S28A 2Q50A 3CKYA 3KTFA 1ZOIA 1LVUA 2OO3A 4TRNA 4ZAYA 2WHEA 4OIMA 1G4UR 3I58A 3F6CA 3PP8A 3VUEA 2IPLA 2ID7A 1R8SA 3R3JA 5AI5A 3NXKA 3TZKA 2CV0A 1LDGA 3UJ7A 4BQFA 2FSIA 2V8OA 4PYQA 1P44A 5HIAA 3HJFA 2CDBA 5KSYA 1L7VC 3T7TA 2JJ2A 5F7OA 2WSYB 4KQ1A 3JAMA 3L4EA 4UU0A 5CA1B 5KO2A 1MHPA 1USUA 1YBAA 2PANA 3I28A 4GKBA 4LZNA 4WN3A 3ZI4A 3Q8XB 3EFOA 3FCYA 1II0A 3OT1B 5EIAA 2BEKA 1GPKA 2ZIXA 1KPHA 5D3KA 1SNYA 5IYZB 1WABA 4PRZA 4DA7A 1EDBA 2G5PA 2JBHA 3R7WA 3RYTC 3SZUA 3SNHA 3S44A 1ZAYA 1UK6A 4REQB 4E5DA 3RHSA 2XIJA 3ILSA 3R6LA 4FFMA 3FVWA 3L0YA 5HDBB 1CTQA 2VTBB 4JXXA 3WDKA 2OCDA 3BIJA 2VNKA 2FMUA 4KDEA 2B7CA 1LX6A 2NUTB 1YJAA 4GEGA 4Q3EA 4TWBA 3T5DA 3HXOA 1P0PA 2EW2A 2IYOA 2R8BA 2UYQA 4KQXA 5EIBD 3TOSA 1RS0A 4RW0A 4DJTA 4B7CA 4IPTA 1J49A 5FOQA 3TGLA 2VP5A 3KKNA 4L4RA 3O4GA 3DV9A 3ZD9A 2HJGA 3V4RA 4XEHA 5TQJA 5JXIA 1R8JA 1Y8CA 3OZBA 2I87A 1PS8A 1VJ0A 4KKVA 1SPBS 2WIJA 2CDNA 4G5HA 4MMZB 4NTZA 3WLFA 1ILEA 1TKRA 3PD1A 3AL0C 1DPGA 1WTCA 4QJ5A 2HLDD 3TSWA 4I19A 5LUAA 1JU9A 2C4KA 4YHHB 3LSYA 3GV0A 3VYTB 4B3MB 3U7JA 3SLRA 3EVGA 4FBGA 3G2HA 2B5OA 2GZMA 2J9XB 1Y82A 2VQSA 3HJCA 3QU2A 4G1CA 4RH1A 4IVRA 4RIEA 3BCSA 3FHTA 1J2JA 1G20E 3C3BA 3R09A 4BWVA 4RTOA 1ZIOA 4YRAA 2ZUVA 1Z4OA 4D7AA 5LZ8A 1N2ZA 4LXQA 1VYUA 1JJ7A 1N0VC 2G28A 2V5AA 4PZLA 5FHRA 3ZZUA 1GNLA 2G80A 2NTVA 3NYRA 5IC5A 4D44A 4FKBA 5KJCA 3ICCA 2H0AA 1E2LA 2Q9AA 2Y1EA 3I39X 4ZI7A 1MNQA 1NVMB 1D5CA 4U00A 1BA3A 4RGQA 3HVRA 2F3QA 1K6MA 1H0KA 5CIYA 1MHTA 3KQNA 3WB0A 2G7MC 2ZJ4A 1JXOA 1STOA 3R24A 4IGKA 4R8RA 4OVKA 4NZYA 3EIFA 3HGTA 2VUSA 4MGHA 2DHEA 2OCXA 4OBXA 3O8OB 2J0UA 2Y4OA 3P9QA 3TFWA 2HU2A 2XJ9A 5BNFA 1O95A 4DY4A 1KJJA 3FWPA 3GHYA 3IUBA 3SY8A 5F2KA 4WZZA 2IYFA 2ID8A 1PWYE 1PNTA 1P2BA 4TWJA 3AHHA 1T15A 1Q12A 5D00A 3PE6A 4OX9Y 4C5AA 3NOQA 3BXGA 4NU8X 2H29A 4OJMX 1Y48E 2DSNA 1DCMA 2PD4A 3HCRA 1C0EA 2C96A 2IOYA 3RIEA 2CV1A 1E2KA 5SZHB 4HK4A 2QMEA 3E05A 3TBHA 5CCEA 1GAQA 2CD7A 1LK7A 4NAVA 1M5RA 2CD9A 3BE5A 1ZD1A 6ADHA 3UWOA 1KRWA 1Y5MA 1X2BA 4NOLA 4EECA 1RBQA 4WJKB 5CLIA 1UJMA 1Z8DA 1XPRA 4KFUA 5I7SA 1BOFA 3A1WA 3HB9A 1GUBA 4PSKA 4R1QA 4XZ3A 5JZBA 1XD9A 1YQGA 2WT4A 3CRVA 4HS4A 2E4YA 5BNWA 4G0MA 1W52X 1LPMA 4KYUA 2VRCD 2P5SA 4O2AA 3OQOA 1G5QA 1RI1A 1TUGA 2FWMX 3E35A 3JWIA 3MWLA 3O2QB 2Q1SA 2D0PB 2FF5A 3MA0A 3KFXA 3ASYA 2KE5A 4PQRA 4MARA 5DNUA 1CRPA 2VBFA 2PZKA 4EHDA 4RIFA 3IV6A 5GZ1A 4FIDA 5H4GA 3BYZA 5BQOA 4MRSA 4M7WA 4CNQA 5DSXA 5HKAA 2GEJA 1GEGA 4MGYR 4Y9TA 5JI3E 3ENNA 3VQTA 3AJRA 1Z06A 1P9NA 3D8NA 3BK2A 4RYDA 4EMUA 3ILXA 4ARUA 5ADWA 2IYPA 4O4IF 3MJSA 1CP3A 3PFHA 2ZQZA 4OX9B 4GLBA 3NC0C 4OKNA 3RJ5A 5IDYA 3T12A 3H04A 2VF7A 3THWA 1DKLA 4ONEA 4IDQA 1V6CA 3T8YA 3KDAA 1UJ6A 4TRMA 1X92A 3QVGB 5LP6F 1BXZA 3AERB 2Y1FA 1RLTA 3HB0A 4G8DA 4LJ7A 2VP6A 5TQ2A 3BREA 4L0DA 2YOGA 1X6VA 2GZHA 5CW2A 1R16A 2QL7A 3S99A 3MS2A 3ELWA 4MUKA 5HR5A 3TUZC 1NVEA 1VOTA 4A8PA 3TLGB 3I5UA 1OA1A 3JQ9C 1UXGA 2DWUA 2C8KA 4LKRA 3OA0A 3ZW7A 5IKMA 1M1NB 3DDNA 4FMCB 5GGYA 4AKGA 3CPJB 2WB4A 1EGAA 4LYEA 4N7MA 1FBNA 3F3YA 1UOQA 2ET6A 3HYLA 4B7UA 4MA0A 4EAAA 1OIVA 1WD7A 2QTFA 5LYJB 5AO9A 5IAJA 5IU6A 4RTPA 3CWZA 1VIVA 1E5TA 4M0PA 3IL2A 4PLCA 4ZGGA 3DV0A 2JZNA 3VZCA 2O57A 4TTQA 3ZHVA 5BVHB 1RPTA 1RAHA 2R6DA 4OJNA 4KFTA 5JFOA 4F9TA 3QMPA 5F2NA 3OX4A 4EJMA 1Z0SA 4B2IA 4YO7A 3D6TB 1BFKA 1YZ3A 1FQJA 1PR6A 3BL6A 3FTDA 1Y1SA 1I7NA 3WZLA 3UAZA 2XTZA 2E37A 3KT0A 4O3MA 3BXZA 3QVOA 1XLTA 1WCWA 1YONA 2B1IA 2G5GX 2HLDA 2R6AA 2HCFA 3NDJA 4RF3A 5FBRB 2ZQYA 1Q0QA 3ASZA 4P4UA 4BNDB 5B36A 4JP8A 2CKDA 4HYTA 1Z4KA 5DM1A 3NUGA 5TQ0A 2KBEA 2AYYA 2FW9A 3WLEA 1CG6A 1HUQA 1NQTA 4YREA 4DGSA 4QULA 4UAJA 4OQEA 4Q00A 1E1LA 1FMJA 4TROA 2UUAB 4EJFA 5AVXA 4E2ZA 2B6NA 4ZALA 4D79A 2FEOA 3OTOB 5CIWA 2OC9A 3EXHA 4OV6B 4PICA 3WYCA 3SGLA 1PR5A 1Z7WA 3ENQA 4ENUA 1Z4QA 1QQBA 1KI6B 3HXMA 1Z17A 3OFVA 2QG6A 4QXOA 2VDKB 3TSYA 3THOA 2O1XA 2IK8A 2XEDA 2MINB 1XHLA 1AOXA 2P9QA 3N8HA 5DCUA 4WY5A 2X4DA 3WHLA 1UAYA 1KAQA 2VJPA 3UWSA 4D9EA 4ZOLA 2MT9A 2E3JA 4DSTA 4NE7A 2GVDC 3EW7A 3PFNA 4RCVA 3R9XA 2HF2A 3WDMA 2YVQA 4URFA 1REQB 2A9RA 2EJTA 4KR2A 1B6RA 4FINA 3DSRA 3BWEA 2OB1A 4PO1A 3NP9A 1JLKA 1BE8A 2C4HA 2G9UA 2LKCA 3PSAA 5EEGA 3QF4A 1XU9A 1I01A 3SMVA 1GA1A 1RXCA 3HJGA 2F3TA 3L1HA 1P74A 3G9QA 1LZLA 2Q29A 4JX8A 4J7CA 5DU2A 5F73A 3EGCA 4P81A 4ZYTA 2VNHA 3PSHA 3CG0A 4KV7A 2Q4OA 3OQIA 1SGWA 4MAFA 4DLYA 6REQB 4KMMA 4FEYA 3BRWD 2VDVE 2RHWA 1P60A 5SV2A 1Q1EA 1YZTA 1NF3A 2XR1A 5H3CA 2UXCB 3H17A 1GHTA 1ADGA 1CVRA 1O87A 2W6QA 5FRDA 5HCUA 4UOEA 1HG0A 1LC0A 2K4MA 3OHMA 1HK7A 1TM5E 1AUPA 4DR2B 5EHQA 3DLAA 2PZ8A 3B8EA 3EYWA 4LNAA 3CLTD 2JFGA 2X8JB 5DYWA 1Z37A 4BNYA 4BGDA 3Q12A 1IY9A 3GPDG 4M6WA 3VXKA 3LZCA 2AYZA 4MVJE 1WPQA 5HMLA 4GVXA 4F96A 4X94A 2V4MA 4LRSB 1RNLA 4MLZA 5LQSA 3S68A 1T3SA 1RRFA 1H2FA 3LQRA 3OECA 3LY8A 1VZ3A 2YFQA 3KQVA 3KJXA 4AKIA 4XGRA 3B48A 4BP1A 5ARBA 2GN0A 4FUQA 3KUKA 5ERXA 2JH8A 5H80A 1XPUA 1XO1A 3WR5A 3FE2A 3OBBA 5KVQA 3FRIA 2BGMA 2HI0A 3KQSA 4JBYA 4MVJG 4AJIA 3WGVA 2PTGA 2ZB4A 4IVQA 3P9CA 1JDBB 1L4LA 3PENA 1NMEA 3LY5A 1R8XA 1AUVA 3FRJA 3OZTA 4MUIA 5BYBA 5IM4F 1E9AA 1NYQA 4R2WA 5B37A 4D9KA 1UMDA 2QNBA 4YJKA 5FNVF 2VDWB 2HXSA 1G8SA 1L5HB 2ISCA 1PZXA 3KO8A 4BUCA 3K09A 1QLWA 4XGIA 4B85A 3BD9A 1FS4A 4KLAA 4EHLA 1GCOA 2ZRGA 1SN7A 1CV2A 3E5RA 3JX9A 1ULTA 5A1TA 1PUIA 4PGHA 1YB7A 4XOUA 4DQKA 1S2LA 1IEWA 3NKLA 1OI7A 3T7RA 1CUSA 3BGDA 1JIVA 3I34X 4MQ5A 4PSVA 2F6RA 4PLPA 1AKYA 4TUYB 1W0JD 4IJKA 2VBCA 3ZKWB 5AK5A 4B3BA 1T0PA 1XL0A 1FB5A 3AXSA 3NGLA 3PNQA 3WISA 3ZHXA 2YN0A 1JLMA 4D8TA 1E9BA 2BAGA 4WNAB 3R20A 5BRAA 3K2EA 3VU9A 1W34A 1Z15A 2Q8QA 1LB1B 3OPNA 3OLXA 4KN9S 1PZGA 4L3VA 3UAOA 4ROTA 3MK31 4DLZA 1C7RA 1KFEB 2GXSA 3SBXA 3VMFA 4IXMA 4XIGS 4HUTA 3UB3A 4F9FA