4LHZA

Crystal structure of gtp-bound rab8:rabin8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhzA00
3FFBA 4CF7A 3UG7A 4FMCF 1OB5A 4YMVA 5JS7A 1YZKA 4ABYA 4DLTA 3RWOA 1ZP6A 4C0BA 3RS0A 1Q44A 4CRWB 2PZGA 4GPTA 1K8RA 2HLDD 1ONBA 2I3BA 5DIFA 2FV8A 4B3BA 3L8YA 4D4JA 2ATXA 2IYTA 2CCGA 4A0FA 4YC7A 1ODFA 2EFDB 4AKEA 1GL6A 3EZ9A 1M7BA 3WMGA 2CLSA 4DCVA 1D9XA 1OJLA 1QHIA 4KLNA 2IHBA 4TN1A 1F2TB 3QXHA 4A92A 4Q9LA 1Z47A 2IWHA 1DEKA 4URZR 2QM7A 3GFOA 3QVUA 1E9EA 2IYVA 1XX6A 1S9HA 5JRJA 3D3QA 1OSNA 3FKSD 1GKUB 4DSTA 5KDDA 1GZSA 2C9YA 2ZI5A 4RVCA 4BZQA 2ZUBA 1UKEA 5JWRA 1KO8A 2ZSAA 1GP2A 1N6NA 5KDOA 2IXEA 3AUXA 4B76A 3TJZA 2WV9A 1G291 3T5GA 1E9FA 3A4MA 5GVSA 1EFCA 4ACBA 2Q3FA 2BCGY 1V5WA 2WJJA 3A58B 4E03A 4KVGA 1KHTA 3SHWA 1KNXA 1QBKC 4QHSA 2WWHA 4GOJA 2HCBA 4II7A 1MO4A 1JR3E 1UKZA 5FUXA 4I81A 4M1KA 1YU9A 2NPFA 4K46A 1G7TA 1TADA 2RH5A 1RJ9A 1U8YA 1W36B 2FPMA 3U3OA 1EWQA 4MYUA 5DI9A 4NHOA 5FBVB 3PXGA 4BQSA 2F1RA 2GESA 4EFLA 4WZ6A 1ESNA 4BGDA 4D80A 2GBLA 4TLBA 2BM0A 2WPDA 4DUGD 2GCOB 2WWFA 4IHQA 3RLFA 4ZIRB 5BXQC 1KI2A 5KOYA 4B3GA 3PQCA 4QBIA 4BRWA 1KO7A 3SYKA 4BECA 4FWTA 3U61B 1Q3HA 3KXIA 4C0JA 1FP6A 4ZKDA 2HYIC 2XXAA 4LWZA 3QXSA 2ZANA 3IHLA 4F7WA 2IXFA 4KJZA 3CZQA 3K0FB 1EK0A 1NSFA 4AKIA 4DCUA 5L3VA 4KBFA 2ORIA 3OAAD 1G8YA 2BJWA 2H17A 1T5IA 3AM1A 1HE8B 2ZR7A 3OIVA 1JB1A 4RJLA 2ZAOA 3K9HA 3DOEA 1JNYA 3V9PA 3GEHA 1LF5A 5EE3A 2BOVA 3Q7QA 1F60A 1R4AA 2RMKA 2YJTD 4UKDA 5FR1A 1KIMA 1GL7A 1F2UB 1KI9A 4PFSA 4Q7MB 5DI3B 5EXXA 4B74A 1JQJC 4OHVA 5TARA 1QVAA 1MO3A 3MWKA 2CNWA 4L8GA 4GI7A 4R98A 1NBMD 2JGNA 3EA0A 3EPLA 1P2SA 4ESHA 1OE0A 3AGQA 4CW7A 3O8CA 1NG1A 1Z07A 3W3ZB 3SNHA 2NO6A 1ZM7A 4NMMA 2G0TA 4US1R 1ETUA 1G4AE 1E32A 1Q1EA 2ZJBA 1AKYA 4PPGA 2JAQA 3T61A 4A15A 1G5RA 2QORA 3LH5A 4Z8XA 1CKEA 3QBTA 5BW8A 5GVRA 4TZ0A 1XTSA 821PA 4AYTA 2NPIA 5JWOA 4HLQB 1TQ6A 1SQ5A 1HURA 1M8PA 4XVQA 4DB2A 1P72A 1Q1QA 2EW1A 3AKEA 5J4HA 1AQUA 3R7WB 3QE0A 1AN0A 3AQ4A 3C7KA 4NCHA 2YWHA 1E1RD 2WAYA 5EP2A 4OQMA 1W4RA 1O3YA 4M1WA 3SQWA 4URVR 4W5JA 3X1DA 2WWXA 4ERNA 1Z0JA 5DE3A 1R0YA 3U2QA 3AF0A 2NO1A 4HAYA 3VFDA 1FNMA 1E0JA 1KAGA 4EDHA 1SXJD 1IONA 3FVQA 2O8BA 4Q02A 1XEFA 2GVZC 1DAFA 1AS2A 4JLOA 4WA7A 4CT4B 1BKDR 1Q1BA 3CF0A 1G1MA 4AKHA 1B0UA 2QE7A 2V1UA 3IUYA 3BS4A 4LC1A 1EWRA 2CL6X 1E0AA 1HE1C 3CBQA 3CNOA 3D6TB 1SVKA 2QY9A 4GMDA 5JI3E 5DYIA 4C7OB 2G3YA 3SYNA 1TU4A 2IXGA 3GLFB 1OFHA 4JVLA 2VHTA 3AB3A 3IHWA 2ZROA 2F1JA 3N5CA 5J40A 5SZKB 1X1RA 3VU9A 3EWSA 3AVYA 2J41A 1AIPA 2EU8A 2GBLC 2EFHB 3B2EA 3CNLA 4EPYA 3SEAA 2JLUA 4DT1A 2FFHA 3EC2A 4TYWA 2NMVA 1BH2A 1XMVA 2FJUA 1NIPA 1KSJA 2QNRA 4ASUA 1W7AA 2J9RA 4JVMA 5CB8A 1UBCA 4QC2A 3NC1C 3KQKA 1ZM9A 4Q4AB 2ZRBA 3VX4A 4AG5A 1E1QA 5FUWA 4D0GA 4I1UA 1DAHA 3CWZA 2F1IA 1RYHA 2ZUDA 4P4UA 3RS4A 3QF4A 3KL4A 3AVQA 3ZS8A 4AYWA 1RRGA 1XEXB 4JLBA 2QEQA 4D2IA 1SKYB 2GEVA 4BLQA 2Z6VA 3C41J 5HKKA 3AF4A 3NBYC 1GSIA 2EFCB 4IXNA 4XSHA 1OYYA 1ZCAA 2G9NA 3WNCA 1XTQA 2QT1A 1MR3F 3UATA 2GRJA 1PVOA 3EW9A 2OLJA 3THOA 2DWQA 4ZO4A 1GNQA 4DLWA 1CXZA 1CTQA 3NBFA 4Q48A 3BFKA 1E9DA 4TL7A 4V02A 5E7MA 2D2EA 1D9ZA 1UPTA 1ZUIA 3JVVA 3X1YA 1OF1A 3ZZUA 1CRQA 3DZ8A 3CR8A 5JBQA 3ZS9A 4BFZA 4BUJA 1R0XA 3K0FA 3CX7A 2WVJA 3TNFA 1A82A 2A5JA 2X8AA 4HEJA 1RRPA 1GOTA 5HCNA 3N2IA 4MRNA 4RZUA 4KCGA 4HDCA 2CLDX 4M9SA 2PH1A 2BMJA 1YZQA 1XPOA 4GRAA 3P32A 4ZCMA 2HDNB 4EJSA 3U44B 4V0KA 4M1SA 4BASA 4HDQB 1G18A 4S2EA 4HLUA 1Q21A 3GJ8A 1DBSA 2DFTA 4U02A 3OFND 2CVFA 4U00A 4Q9HA 3SN6A 2YWEA 1XJ0A 4Q5IA 5B2ZA 1W5TA 4DWJA 5DI3A 1NI3A 5C4MA 4NCIA 3DMNA 3KB1A 4DBLC 3GLGB 3F3YA 2XSZA 3MCAA 4YMSA 2JEOA 3ADKA 2FDCA 1U0LA 1R6BX 3V4FA 4ZV4A 2W58A 3U4QB 5KTYA 2X2EA 5TV2A 2VHCA 4PAOA 4GOKA 4S35A 1OW3B 4YDHB 5IF9A 3VNVA 2C78A 2JJ2A 4LX0A 4F92B 3BIFA 3KFXA 3QVVA 5E3HA 4C4PA 1ELOA 3WY9A 2ODEA 4A2WA 4AK9A 1T6NA 1FMLA 1XP8A 5G3ZA 4C2TA 1A2BA 2ZYVX 3K0EA 4EUNA 2OLKA 3Q85A 5K8LA 1R5NA 3HYRA 4TYPA 1E79A 1SVLA 3NXSA 4OBEA 4TQUS 5KSYA 4Q9KA 2G0NA 3ADBA 1Z08A 1W2HA 2ZI3A 4TT3D 2IUTA 2PZFA 4FN5A 4B3CA 1AKEA 2C9OA 1TMKA 4I1VA 3VR1A 1ZVQA 4ZCIA 2FFAA 4UJ5A 4V0OA 4DLUA 3AP1A 1ZC4A 3WP1B 3HWSA 3NKVA 1LW7A 3FTQA 1QHHA 3OIUA 1OLOA 4GZMA 4U7DA 3RANA 1KJZA 2O0KA 2VP0A 1CR0A 1KSFX 3B85A 2C03A 1ZIOA 3T1OA 1E2NA 1NIJA 2PCJA 2ZRDA 1JAHA 2JLWA 2JJ8A 3I92A 3BFVA 3BXZA 4FXPA 1RRFA 2X19A 3A8TA 4DSUA 4KI0A 3TK1A 3CPHA 1E9AA 4LC0A 1OXVA 1XB2A 4QBGB 5EUQB 2W83A 3UMSA 2IA5A 1ZCBA 3W3AA 3ADDA 5FTKA 1WMSA 4RY2A 3OEED 4Y0VA 2JIZD 2ZRLA 4IFEA 3NTUA 3EWAA 4F93B 3ONWA 2CE7A 4TYQA 3CRMA 1YKSA 1IN7A 4LCBA 4D6PA 2OCAA 1E9RA 3A4LA 3GLHE 4PPQA 3RS3A 5JZVA 4OI4A 1AZSC 4OL0A 1EX7A 3PENA 4N0DA 3ZZTA 1G5PA 1KI6A 2W0SA 4RD0A 1FNNA 4RKFA 3DM5A 4Q7JB 2OAQ1 5D3MB 3RS2A 1N5LA 2QSZA 5FL7D 3TE6A 1UADA 5DH9A 3THXA 4CVNA 1IXRC 1US8A 4PANA 2IYZA 4LYFA 4P4SA 2F43A 5H8WA 4GMXA 4PHGA 2PT7A 2XAUA 1NBME 4TL9A 3S1AA 2BEKA 5F2EA 4DIEA 2V54A 1CJTC 3HJNA 2GAOA 3L8ZA 4EJSC 5KPDA 3T1QA 1II0A 3HDTA 1HT1E 1M2OB 3U7HB 2FPKA 1R5OA 2L0XA 1E0SA 4QG7A 3QPWA 5KU1A 4MYCA 1I4DD 1I2MA 3OHMA 4V0LA 2IS4A 2XTMA 5TY0A 5F3WB 5A4JA 1HQYE 4NCJA 1YVDA 4HB4A 1P62B 2CDNA 1W47A 5DISB 2GF9A 1OIWA 1TQDA 1XZPA 4P4TA 1GTVA 1W4BA 2UZIR 4IOLA 2YWFA 4BPBA 3F8TA 5KNDA 4UQOA 3AKDA 2O8DB 2QTHA 1C9KA 3HR8A 2BKUA 1EFUA 1J2JA 5HE9A 1EESA 4DIDA 2PJRA 2NGRA 1X6VA 3PEUA 1K6MA 2C5LA 3U44A 1U2RA 3CLVA 4I4LA 2VP4A 5EQTA 2IYQA 4Q4JA 1EFRA 1EXMA 2ZRNA 2BC9A 5C2JB 1HQCA 4PPNA 3WHKA 4FWIB 3MWLA 2DCUA 2BEJA 3B60A 5JCPA 5JS8A 4OHWA 5J4YA 3SFZA 4LK2A 1SXJE 2AXPA 2A7QA 3Q5DA 3C4JA 2C77A 4DDTA 2NZ8A 2FEMA 4V03A 1QDEA 2CL7X 1N6OA 2YNMA 2EVWX 2QGNA 1NKTA 4LDJA 5ANRB 1SVMA 5FI1B 3IQXA 1UDXA 5HTKA 2QPOA 1NY5A 3UK6A 2QQEA 4JKYA 1E0KA 3K1JA 2JLVA 1P7CA 4LPKA 2XTNA 4PO9A 2R2AA 3ZIAD 2PZEA 1ZIPA 1D6JA 4PZLA 2PX0A 1VYUA 4LHYA 2ATVA 3OEHA 1BO6A 5C1BA 1UBFA 1IBRA 4N3NA 3CKLA 2ZRAA 2BDTA 3VHLB 3NBXX 3L2OB 4G5GA 1CS4C 2PX3A 4ZDJA 2DR3A 3LBHA 2GXAA 3EG5A 4IDPA 1VCNA 2HXSA 1N6LA 2AFIE 4E5UA 4TSFA 4P33A 1QHNA 4URWR 3B9QA 1RZ3A 2NG1A 5G53C 4EPTA 2F1HA 4G5QA 4Q1DA 2YWGA 2BMDA 3ECCA 2AXNA 4DLVA 3TAHA 3DEFA 1H8ED 2IEYA 1M74A 1G19A 3IEVA 1KJYA 1HUQA 2C99A 2XJ9A 4TTPA 5IT5A 3SS8A 2HEIA 2VO1A 4LOAA 4A1FA 4B75A 3HU1A 3LBIA 1JAIA 3Q5EA 4TMZA 1LY1A 1Q22A 1T0JB 3FPAA 4OQLA 4O2LA 1RRCA 1M6NA 4OJQA 2J0UA 1VG9B 3MRSA 4BFUA 1G3MA 2ZRFA 1LS1A 2FZLA 2ORWA 2GEUA 3W8NA 4LJ8A 2QE7D 1N0UA 1YHNA 1AK2A 4JYCA 4RFVA 3GJ7A 3LQQA 2ZRCA 1IOZA 2P67A 1J90A 4L4UA 4LJ4A 4D4MA 4LI0A 1MRSA 3HU3A 3KKQA 5JSZA 2Q0HA 1R0WA 4DHEA 2FWRA 3OE7A 4NL4H 4L9SA 1NY6A 1Q1ZA 4RD4A 2W2VA 3OF5A 1KI7A 1KJWA 1ZM2A 1RJ9B 3VHXA 5DHFA 5JHHB 4RSGA 4C0LA 4YMWA 1BYIA 1P4SA 1XNJA 2J59A 4MYTA 3GEEA 2J7PA 4LRWA 3KTAA 2IF0A 2OFOA 5FL3A 2QG6A 3H86A 3GLIE 2DYKA 3EZFA 3CNNA 1E4VA 3EIHA 2HUPA 1DTSA 4KLZA 4W5HA 3RWMB 1NVWQ 4AWXA 3TR5A 3M1IA 1P9WA 4QGHA 2OSBA 2F55A 3KXLA 1YZTA 4HZUA 1ZMXA 3FGNA 1W36D 5L8VA 1J8MF 3FHTA 2JA1A 1R7RA 3BORA 1VIYA 2V7QA 3FMPB 4KSCA 2XXAB 4M0LA 1Z0DA 4I1OA 2IS1A 1WBBA 4QJ3A 2W6JA 3R9IA 4RZXA 4IRUB 2DWOA 2GETA 3KQLA 3SFVA 1NL3A 1UBEA 5J5CA 2WWYA 4WZBE 4LJ7A 1YZGA 3BAFA 3RSOA 3B5JA 2BVNA 1VECA 2Z5FA 1U90A 5FTMA 2F3TA 3TAUA 4DXAA 2OXRA 4NYJQ 1G8GA 2B21A 2ZE8A 4KSBA 1V43A 2ANCA 3D8BA 1YZLA 4MDEA 3QKRA 1TUEA 1VCOA 3VKGA 4EQ6A 1GITA 1TUIA 521PA 4BRUA 1FQJA 4JLVA 2A3RA 5JEEA 1VHLA 3X2SA 4H1UA 5M04A 1G3UA 4B2PA 2ZE7A 2GHIA 1WXQA 2QZ4A 4US0R 3NIBA 2IYRA 1G7CA 2Z4SA 2KE5A 1L2TA 3AF1A 1E2PA 1ZUHA 2JDIA 1TEXA 3LXRA 4NP6A 4TQ9A 4D4LA 1IN4A 2ZRHA 2WKQA 5F9HA 1FTNA 1M7HA 1S0UA 2NQ2C 4Q1BA 1NN0A 1S3GA 4B6EA 3LV8A 5EZ5A 2P6NA 1IY0A 3BFXA 5GJVC 3U6BA 1S4QA 4QRHA 2ZAMA 3HYTA 1G8HA 2JLQA 2D4HA 1WRBA 3SU8A 3KX2A 3KKOA 1X3SA 5KNCA 3U60B 4PHFA 4PZZA 3X1ZA 2VYFA 1X8JA 2VH5R 1CJVC 5GJBA 2ODBA 1K5DA 2WWWA 4IVQA 4TQAA 3W6OA 1R0ZA 4ACAA 5KHOC 2QGZA 3EPJA 2QRNA 1XCMA 1KI4A 1DELA 4GNKA 2BHRA 3RYTC 4NPHA 2XEXA 4EIWA 4PPFA 2PMDA 3C8UA 5IK2A 2D7CA 2ZRKA 5DYGA 3SQXA 3PUVA 2B7BA 1KOFA 2DFNA 4DVGA 5FOUA 2KI5A 2JLYA 3T12A 2V3CC 5BN4A 2IC5A 2JLZA 4M4SA 4FMDB 3C5HA 1XZQA 3QG1A 3SR0A 1T8UA 1TAGA 2BJVA 1XEWX 4OHZA 2ZRMA 5FH9A 1R10A 2O8BB 2XZOA 3EA5A 1OHHD 2ZSFA 1Z29A 4G5RA 5AUQA 1OT3A 4GDFA 1NRJB 2SHKA 4M1YA 3FOZA 4CEJA 4PO1A 3O8RA 4RD3A 4MRRA 5CK5A 1E2EA 2IF2A 1NN1A 3WRYC 2ZJZA 5ELXA 5LB2A 5K8IA 1TNDA 4M1OA 4TMXA 2HT1A 4LYAA 4O3MA 2OBMA 1ZNXA 4Z1MD 2XOKA 3CB4A 3E1SA 2WSSD 5KPJA 2ZITA 4LBVA 3F5FA 3I72A 3VU9B 1KMQA 1R2QA 2CK3D 1U98A 4DT1B 3QF7A 1Z8FA 3RRYA 3EIEA 4JSYA 1YE8A 3TBKA 2R6CA 2ZUCA 1NG9A 2BBOA 2O8FA 3BGWA 3QBVA 1KMHA 4PQFA 4KVAA 1E2DA 5FTLA 3M6AA 2ZJAA 1X8LA 1CP2A 3QF4B 2PMKA 1W4CA 2NO7A 5AJYA 1Z5ZA 2DWPA 3AVUA 4EKDA 2XZPA 2H8KA 1HEIA 2CHGA 3IDQA 2ONKA 3KXKA 4PC7A 2QSYA 3CRW1 4DSNA 5FOVA 2YKGA 3QPUA 1E9SA 1GKYA 4NCKA 1G17A 1QHGA 2CE2X 4XD7A 4URUR 4IDOA 5DNYB 2W2TA 4Q19A 1NVVR 3QIAA 4XWAA 3DOFA 4JT4A 3W34A 2QP4A 4FI3C 4UJ3A 4D25A 1W49A 3ND8A 1G5TA 1YJ5A 4HB3A 4BWYA 2GWHA 2A30A 3RVBA 1PZNA 1COWD 3BBPA 1Q57A 4NE2A 4YDSA 3TVTA 4ZDIA 3K9NA 3AUYA 1L7VC 1NMZA 5CM9C 5TB5A 4Q21A 4CZ2A 4LHWA 2A5GA 2WIAA 3H0KA 3A1UA 3Q8XB 3R9WA 1BIFA 4EJSB 3ADCA 2RGAA 3P4XA 3P20A 3A1VA 5FPSA 2WBLC 4LV8B 4MGIR 1KYIA 1D8TA 4TLCA 2O8EA 1N0WA 2ANBA 2ZS8A 5BYKA 2Z4RA 4WZAE 3C14C 2ERXA 1XEWY 1ZU5A 1RW4A 2GNOA 1JR3A 4TWZA 4PX9A 5D3QA 2JJ1D 4UNPA 3MWJA 2V4ZA 4AI6A 2YVUA 1VTKA 2VP2A 4JLJA 1IY1A 1Q3TA 4ZCLA 3L0IB 1UF9A 1LFDB 1GWNA 2V1XA 2IYXA 1SULA 1VDZA 1X8KA 2WMOB 2E1RA 4X8OA 1AS3A 5FBWB 4D81A 4G1UC 4KHZA 2P6UA 2BWJA 2QMEA 3K09A 1TF2A 4L16A 4EFNA 4PQYA 1KGDA 3K70C 3H84A 1RKBA 4LJ5A 4YXWA 4IOJA 4F91B 4BFXA 3O8BA 3THWA 3RRNA 4TYNA 1GAJA 4HYYA 4OK3A 1RE0A 4BFYA 4OI0A 3UPUA 2LWIA 2PEYA 1MKYA 4DJTA 3EPHA 3SC3A 3GJ5A 2RB4A 2OXCA 2KBFA 2VL7A 3LBNA 2R44A 4DDWA 121PA 2K5UA 4MKHA 3W8RA 2UVQA 4JBWA 4GP6A 2R6DA 3A37A 4I99A 4MGYR 4NU0A 1NNEA 1T4GA 1G20E 1RYFA 3L0OA 4QM6A 1U94A 1QHHB 3KJEA 1VG1A 1ZD1A 4Q00A 3ZYCA 4GSYA 2WSMA 1XTRA 4WIAA 4Q18A 4TSFD 3BB1A 3BH7A 4JZKA 4PXAA 2ZEJA 5EE9A 1BOFA 1JEEA 6Q21A 2FZ4A 1U81A 3LW7A 1YRBA 2D06A 1IJEA 1QVRA 2YOGA 1OV4A 4O0MA 2WMNB 2LCFA 4BE7B 4A8JA 4DLSA 1DADA 1VG0B 2EQBA 1SKQA 1Z28A 4CIDA 1ZD9A 1CULC 4M1MA 2X1VA 3DM9B 3JVUA 3MFYA 3QPVA 4FCVA 2QBYA 1QHSA 4Z8YA 1RFLA 2RGDA 4RFSA 3MUFA 2J3EA 3QEOA 4OK5A 1FL9A 2NO0A 2AK3A 1OIXA 2C04A 3T35A 3CIOA 3PCRB 1U99A 2NIPA 1JI0A 4F38A 3AGPA 4JBXA 3MAAC 2QQ0A 2IK8A 1M34E 1KI6B 2FU5C 1N6IA 1VHTA 5KUTA 2FGKA 1E96A 2AR7A 2OESA 2ZE6A 3CW2A 2AN9A 4BEBA 1JJVA 4MRVA 2J7PD 3TVDA 5IRCD 1OKKD 4TMTA 3THXB 1JEDA 5FTJA 5H68A 1US8B 3K0CA 1XBTA 2NOAA 3NC0C 4P4SB 2F43B 3NDPA 2VLIA 1KDPA 3B13B 2IX3A 3S1AB 2ZXUA 1AJEA 1TX4B 4PC2A 4Q03A 1I4LD 4Q47A 5AJVB 3KQHA 5L3QA 1H65A 1TPZA 4ARZA 3U7GA 1GRNA 1W0KD 4KV9A 5F9FA 1IY2A 1R5BA 3MSXA 5B58C 2ERYA 2W00A 2AWOA 3QQ5A 5EP1A 4BLOA 1SVIA 2XNDA 3D31A 4BFVA 4DKXA 1VYVA 1MABB 2WWIA 4DB4A 5K8TA 3PFIA 3LVQE 2QAGA 4R7ZA 3LD9A 5DGXA 3UG6A 2GF0A 2OCYC 3EIQA 3B7GA 5FR2A 4LSGA 1ZBDA 1W44A 3JZMA 3WYFA 1T3HA 1XXHE 3VNUA 2ZIAA 2Z0MA 4A82A 1DAEA 1S1CA 4KFRA 4A36A 4C0QC 1KI1A 2F6RA 4HAXA 1Z0IA 5CM8B 3VTKA 2ZI6A 2J7KA 4EPWA 2BM1A 1CBUA 4ESVA 2I1VB 1Y3AA 2ODWA 1NLFA 1TU3A 1X86B 2N46A 4UNNA 1KZ7B 2CMKA 3CX8A 3K09C 1DG3A 4LYJA 3TSZA 4Q4JB 3DKVA 1GUAA 4FCWA 4CEIA 2QN6A 3I4LA 3NHBA 4FMBB 4DLZA 5DN6D 2OCBA 3U5ZB 2VRWA 1X1SA 1EFTA 2Y8EA 5IDVA 2AK2A 4OKSA 4M53A 1MRNA 3RRMA 1JECA 2XB4A 1BMFD 1E2QA 4JLDA 3OIYA 1P61B 2QMOA 1H8HA 5KSPA 1C1YA 3IGFA 2QU8A 3LX5A 1KY2A 3R8FA 4MKGA 2ZRIA 3LY5A 3GFTA 4KU4A 1Z0KA 5IHPA 4BFSA 2FSFA 1E6CA 2Q21A 4Y0AA 4AURA 4IW3B 2J45A 3WNDA 4OYHA 2ZVPX 3P27A 1ZAKA 5HCIA 1KTVA 1F6BA 2Q3HA 5CIWA 2AHOA 1G16A 1E94E 2BMFA 5AR1A 5A5GA 4A8JC 4TL6A 1JALA 4RCYA 1XXHA 1GDDA 3BRWD 5CDFE 4JLMA 3SZRA 1LS6A 2VP6A 3UKDA 3MD0A 1N0VC 2GJSA 1UFQA 1CIPA 3CX6A 1UEJA 3M0EA 2ZETA 2A2ZA 2XJ4A 3VX3A 2HLDA 3HR7A 4QGGA 5J4LA 4B3DA 2FSIA 3K53A 3B78A 4JSTA 1QZXA 2J0UB 1WQ1R 2P65A 3EC1A 1UDWA 4HLCA 4B2IA 1EGAA 1CU1A 2WICA 2JCSA 2EFEB 1R8SA 4GOXA 4LJYA 2FSGA 4PR0A 5JSZB 1KKMA 5EP3A 5DHAA 2H92A 3U6KA 3RS7A 1J7KA 1K5GA 1SKYE 2VHUA 3P4YA 4F4CA 2XGJA 3L0SA 3K0CC 1WCV1 3P1JA 4GP7A 4M21A 2XITA 3ETLA 4Q01A 2GZAA 4Q7LA 4NZYA 3EZ7A 4GT1A 5KO2A 4US2R 4LPSA 5KNBA 3NEJA 4BFWA 3KTAB 1E99A 1NLZA 4EPRA 5LB4A 1CR4A 1P9RA 3MMPA 2GJ9A 2LKCA 4WVFA 2KJQA 3B1VA 2QMUA 2Z83A 3THYA 4DCSA 3SBDA 4HZUB 2E9SA 3X1XA 4NCNA 2QAGC 4DEXA 3PJRA 4PC1A 2GKSA 4B34A 4Z51A 4NYIR 2H7VA 3UANA 1FZQA 2OCPA 4HB0A 4Z54A 3FE2A 1E2LA 2PL3A 1XD2A 2ZJ5A 4HAZA 1FTSA 4B3XA 2AFHE 2ZYUX 1PJRA 2AKYA 2CEAA 2B8TA 2RGBA 1OXTA 3IEUA 3LWNA 4KODA 2V9PA 1S96A 4QL3A 4YLGA 3QI2A 4Q66C 5CYOA 4QBFA 2WPDD 3CO5A 2ZS7A 3KZ1E 4KAXA 4JT2A 4LBZA 3A6PC 1KK3A 3ZZ0A 1OH7A 3PR1A 4DZZA 1XTKA 5FOXA 4EAQA 4XWOA 3L0PA 4AKGA 1E9CA 1SVSA 2CJWA 3GJ6A 2CL0X 4HLUC 3AF2A 3QKRB 2O8CA 5P21A 4IOMA 3IPXA 4P0TA 4MUAA 4EQ6B 4DUGA 3IILA 2R6AA 3GJ3A 1ZC3A 2BIFA 5FUYA 1MABA 4RD1A 1GM5A 1JR6A 2O0HA 3GLGE 4OHYA 2WJVA 3L82B 4I1SA 2P5SA 3VR6A 2OFWA 4R71A 1T3SA 3KQUA 1Z83A 4POAA 3DPUA 1D2NA 1Q0UA 3TH5A 2H1LA 3AV0B 2OT3B 2ZSDA 4QJ5A 4MQBA 4CGZA 3OAAA 1MO5A 2GK6A 3A36A 3PUWA 5FFMA 4QFMA 4UNRA 1UJ2A 1OH6A 3KJHA 2P5TB 3I1FA 2W2XA 4MDFA 4RD6A 2WOOA 3GLHA 1KO1A 3UXMA 2YZ2A 3FHOA 3H2YA 1AM4D 4LYHA 5AUOB 4LBYA 1ZRHA 4UNSA 4TZ6A 4Q7KA 4BZPA 1IJFA 2CNWD 2P2LA 2ZI4A 2G77B 2QROA 4MGZR 4DRZA 3B6EA 2BCJQ 1MV5A 3N70A 3CZPA 2DFKB 4HSEA 4A2PA 3T1TA 4EFMA 2IYYA 3QKTA 3QJYA 4DC9A 2AWNA 5FUVA 3B8HA 1NBMA 2QP9X 3IQWA 4OK6A 2YC2C 4NYMR 3FWYA 2CCKA 5EJEA 1GRQA 1GRRA 2BKEA 2P3SA 4MYHA 4L9WA 3R8CA 4Q9JA 3WBKA 2VPPA 4MKFA 1IM2A 3CM0A 1Z6TA 3G0HA 4Q1EA 3GQBA 1JXOA 2N1BA 2ZPTX 3K70B 4XIGS 3U7EB 1E69A 1HA3A 1HT2E 2QAJA 5CLLA 3K8YA 3LLMA 4C9BA 3UMRA 1OYWA 2WIBA 2Q9BA 5LDDC 2XZLA 2QTVB 5AK0A 1Z6GA 4LHZA 5GADl 5E4FA 5TDHA 4Q1FA 1E4YA 2IYWA 1L4UA 5A0FA 4DCTA 4CEJB 3KDSE 4R9UC 3TW8B 5HZHA 3KUCA 4M1TA 4UXIA 1UEIA 3SJAA 1QHYA 5EXSA 1GIAA 4PAMA 3Q72A 3U3JA 3TSWA 2V6JA 1E1RA 5G41A 2GZHA 4X8MA 3W90A 2VIIA 4KFSA 2W0MA 1GVNB 5CLQA 3AVPA 2EWVA 4TLAA 1XCGB 2ORVA 1F3OA 3CH4B 1VG8A 1KSHA 2OG2A 2FF7A 4B3FX 1S2MA 1SXJA 2D7DA 3W6PA 1II8A 3IO5A 5H1YA 2IS6A 2O8FB 2HXYA 4URYR 1KMHB 1N6RA 1WB9A 1XWIA 2WTUA 3KKNA 4URXR 2OEPA 1Z3IX 5EXTA 2GVDC 3QNUA 2J0QA 4G3XA 4JVSB 2GILA 2FEOA 2OE2A 5FOSA 3B1ZA 4WOPA 1WDTA 2GK7A 1KO4A 1JPNA 1QG4A 2J87A 3CPEA 2KB0A 4W7SA 4ZDWA 4ASUD 2IBMA 2EFGA 1ZM3A 1N25A 2HT6A 3IBGA 2RGGA 2GEDA 2OAP1 3IO3A 4JS0A 3E70C 2WJGA 3KJIA 5KDLA 1XMSA 2QUZA 1VIAA 1Z6XA 2ZRPA 5L3SA 1E1QD 2VHJA 4E22A 1WBDA 1VCIA 2QM8A 3GFPA 4ITRC 1E2GA 3SJZA 3WP0A 2W6IA 3CPJB 3RHFA 4W5WA 3FFAA 5HKKD 1G3RA 1TTTA 1D2EA 3PITA 5BN3A 4TL8A 2BBTA 4C0SA 5JEDA 1OXUA 2ZR9A 3N2EA 4HLDA 4PC6A 2ZJYA 2H16A 3C5CA 3O8DA 721PA 5FPHA 5EZ6B 2QA5A 1W48A 4HUQA 3LO5A 1HYQA 1AGPA 5HZKA 4JJZA 2YV5A 2O8EB 1ESMA 1G9XA 3WYAA 2IL1A 4XH9B 5AWFC 4DSOA 4KYIB 1IN6A 4XTRA 1T9HA 4KYUA 3T06B 2R65A 4DCNA 1KDOA 1NJFA 1TQ2A 3FMOB 3RC3A 3ZVMA 5CK4A 3U3RA 4AYXA 5TMPA 4MUBA 4KFTA 3TSOA 3TRFA 2Q6TA 5HPYB 5JFGA 1DO0A 1TEVA 2VSOA 4BLSA 4P3YA 3K0AA 4RKEA 3ASZA 1QRAA 1KKLA 4LV6A 2RHDA 4B48A 3VQTA 1FMJA 3ICQB 2FFBA 2RAPA 3WMEA 3ZVRA 2HCJB 5HR5A 1PUJA 3IIMA 3LX8A 2GJKA 1GFIA 3SE0A 3GLIA 1FX0A 1Z6YA 2YC4C 3HP1A 1KNQA 1CJUC 4B43A 2WOJA 2DFLA 3WXMA 2G1KA 4A0RA 5J4KA 3OFNA 2XSZD 3TQFA 5DO9A 1KAOA 3TQCA 2J1LA 4IEIA 4PQRA 3THWB 4MH0R 5C46F 3TKLA 5FPYA 4OHXA 1N2CE 2WKRA 3QG5A 3W9YA 2ZSEA 2JASA 1CLUA 1GKIA 2JJ2D 4PTLA 4ZPXA 4V0ME 2RGCA 3EX7C 2GCNA 2CHQA 1ZU4A 2JATA 1PLKA 4FCTA 5SZJA 3H1TA 1WP9A 4D82A 3AVTA 4YONB 3OIWA 1G3QA 3I61A 2OHFA 1DOAA 3QKSB 3RABA 4QGFA 1DG1G 4XWKA 1N5JA 1DAIA 1E79D 3LDAA 2E87A 5FOTA 3DVLA 5E7JA 4B47A 3QKUA 4JVNA 3IIJA 1SXJC 4M22A 2HF8A 3CRVA 4EPXA 3AVXA 1OXXK 2TMKA 2VEDA 3AH8A 4LHXA 3HU2A 4WAUA 2CLCX 3FB4A 3AVWA 4A8JB 5G3YA 1TL7C 3TUJC 3OESA 4TT3A 4B2LA 2ZJ8A 3EPKA 2D74A 2GAAA 1DVRA 2QBYB 2C8VA 2ZJOA 1T0HB 3WHLA 1A2KC 4RFSB 4PSAA 3EARA 3GJXC 2A9KA 4G5SA 3NH6A 5LBIA 5JRZA 1P2TA 2A5FA 2ASEA 5JCZA 3BB4A 4BLRA 3B1XA 3I8XA 1G21E 1N6HA 1KI8A 1U0HC 1W0JA 2QI9C 4M8NE 4JL5A 3RRZA 2ZSBA 5CB6A 3UIEA 4FINA 4V0MA 1XD8A 5KSOA 1IAQA 1A1VA 4IVPA 2YOHA 2PLRA 1GL9B 2XNSA 2NO9A 3ZH9B 4DLYA 5K8UA 4C0HA 2FNAA 2Q9CA 3UMFA 1IHUA 3OEEA 4JKIA 4DLXA 2JIZA 3DHWC 2C9CA 2ZRGA 4PO8A 3CR7A 1XMJA 2OBNA 2ZS9A 3A4NA 3ZDQA 1N6PA 5L3QB 1Z63A 4ARZB 3KKPA 1OH5A 3M4YA 3W6NA 621PA 4CEHA 3DMDA 1D5CA 1RIFA 1S8FA 3BK7A 3NBZC 1YQTA 3IKJA 2GDJA 3LRPA 4WW0A 2IUSA 3UWOA 4YMUA 4B44A 4A9AA 4UNQA 3LXXA 4LHVA 2QAGB 5JI2E 2FG5A 2Q3MA 5FL7A 3I3SR 3TUIC 5BN5A 1EX6A 1VKJA 3TUZC 3MG9A 1XRJA 2YINC 4C3ZA 4NTZA 2NTYC 4AIIA 4W9MC 1RPZA 1YR6A 4L15A 1VYTA 1XTIA 2YYZA 3JZAA 1TF5A 3FKQA 4JLKA 2EWWA 2I1QA 3KJGA 3CWQA 2LKDA 5CYPA 1O87A 1W4AA 1I4TD 3K0SA 1G7RA 1S1MA 4CEIB 1NLYA 5LPNA 1A7JA 1ZNWA 2XX3A 1NVXQ 1P5ZB 3IBYA 5FPTA 3VMFA 4FW9A 3WNBA 1OB2A 3EAQA 5L3RA 3WBJA 2HYDA 4JLNA 2H5EA 3ICEA 4TYYA 2VQSA 3EZ6A 4QXAA 3ZLJA 3A1SA 1IXSB 2QL6A 3DO6A 1BS1A 2GXUA 1EFRD 1AGRA 4MGKR 1NVVQ 3CH5A 2G1JA 3K9LA 4FIDA 4UXJA 1KK2A 1MOZA 4Q4HA 4A0GA 2VA8A 4E07A 3G5UA 2BBWA 1XPRA 2WAXA 1OFUX 2F7SA 1Z6AA 5CJPA 2C2HA 3EASA 3ZVNA 1EFHA 1JBKA 4FMCB 3RC8A 1UKVY 2XTZA 2A5DA 1CR1A 4M9ZA 221PA 5EE1A 4IDNA 3SBEA 5KYKA 4OI2A 4RCZA 4D0NA 4EPVA 1DO2A 1OFTA 1N6KA 1FUKA 4JLAA 3C16C 1FP7A 2UZ3A 3BJIC 4HI0E 1SVWA 4IKEA 3AP2A 1XXHB 1SHZA 2F3RA 2HJGA 3BH0A 1OH8A 3BWDD 3OEHD 3W5IA 5SZIA 1LTQA 1XTJA 2O0JA 3AKCA 4C0KA 4QNMA 1GILA 2FGJA 3VR3A 3ZIAA 4QNRA 3QKSA 2BV3A 4TMWA 4LGMA 2GZDA 3VAAA 2OBLA 2R9VA 2ZR0A 4RZ2A 1N5IA 2EYQA 3FDIA 3E5HA 2DBYA 2VP9A 3SJBA 3UWKA 4HB2A 4A6XA 3VR4A 2C96A 1F48A 3H4MA 3K9GA 4C2UA 4DDUA 2ZI9A 2RKOA 1TF7A 4HAUA 3U3KA 5EE5B 4IJMA 2FE4A 1XF9A 4LZZA 3U3MA 3ZVLA 1JJ7A 2IT1A 1XMIA 4M9XA 1H8EA 2RGXA 1IXZA 2RHMA 4IDHA 3GMTA 2X2FA 2QENA 1P2VA 1QF9A 1FFHA 1F2TA 1P9NA 5LD2B 3NG1A 4CT5A 4HUTA 1ANKA 3OE7D 3THYB 1NVUQ 2CVHA 4D0LB 2V8OA 3CF2A 4KFUA 3PG5A 1D2MA 1LB1B 2ZI7A 1G3IA 1I2DA 1W2GA 4AG6A 2OV2A 1ZNYA 3GJ0A 3I32A 1J8YF 2R6FA 2VBCA 1XD2B 2GCPA 3ASYA 2H57A 4NONA 3QXCA 3LQRA 1YZUA 4TLDA 2PJZA 3CF6R 1XCPA 3LAWA 1W5SA 1YZNA 5BWMA 2B7CA 1SZPA 2IYLD 5AUPB 2QPTA 2ZQ5A 1OXSC 2CJWB 2W6ID 1GNPA 1JXMA 2V7QD 2O52A 2O8CB 2ZE5A 4XJXA 4O25A 3GP8A 2W6JD 5CIQA 1G4UR 2OILA 4ON9A 1G8PA 1XU4A 3QUSA 2ZRJA 4QHTA 2G88A 2VHQA 5E7IA 2C95A 3ZGXA 1T3LA 1GG2A 3QSYA 3AVOA 1G64A 8OHMA 5EP4A 3RAPR 5AJZA 1TQ4A 4OI1A 3I5XA 2AL7A 1S9DA 3NHAA 1F5NA 2GCOA 4PHHA 2ONJA 4KXFB 4ZIRA 2JLXA 2IYSA 2JLRA 2NZJA 3EXAA 1GNRA 3CRQA 3IIKA 4J0QA 1E2KA 4JYBA 1E2HA 2WM9B 3GLHB 4D4KA 4M9QA 3VKWA 3PEWA 1LV7A 3OZXA 5JLJA 1E2MA 1KY3A 1B23P 1M1YE 4LJ9A 5FBRB 2FA9A 2VTKA 2JDID 2IW3A 4PAQA 4LUCA 4PC3A 1FOEB 3RDPA 3QXXA 2MSDB 2IEZA 4R2HA 4LBWA 5J47A 5C4GB 1P2UA 1NMXA 3B9PA 3HPRA 3DL0A 4R2IA 4PHTA 1G7SA 4WXPA 3SDZA 3T15A 2Q9AA 2R6GA 5HE8A 1RC8A 2FN4A 2DPXA 2VSFA 3MGCA 1SHKA 4KBGA 1PUIA 1WA5A 4OQFA 3GPLA 1XFAA 4AD8A 1NSTA 4A2QA 4PSKA 1OIVA 2AD1A 4Q9IA 1F2UA 1MH1A 3NEYA 2B8WA 4X8HA 2GTPA 1RVDA 2GA8A 4HATA 1DE0A 5JJIA 2YHSA 2HV8A 2UKDA 5FOWA 4ZKEA 4YMTA 1DPFA 1DAGA 2X77A 3KB2A 2MSEB 3A1WA 4OJKA 4TTRA 5IK2D 1AS0A 4GL2A 2MMGA 3T34A 1ZW6A 1HTWA 2R8RA 1J70A 4N1AA 3QXJA 5TXGA 421PA 3AKYA 3WYGA 3GLFE 3BE4A 1FUUA 2REXB 3K70D 3TIFA 1CEEA 1KSGA 2V6IA 4BLTA 1ZD8A 1KDTA 3L43A 3WMFA 4ILEA 3R9XA 1UM8A 4NKRA 2A78A 3FMIA 3LNCA 1OFIA 1NN3A 2FX3A 1Z0AA 1E2FA 4HAWA 1XJCA 2BBSA 4BEJA 2FMXA 1U9IA 1SXJB 5FBQB 5GJCA 4KO8A 3FHCB 1OHHA 3R7WA 1II8B 4IFBA 2FSHA 1G6OA 1C4OA 2XOKD 3WRXC 1KI3A 1UKYA 4D26A 3FKSA 3LW8A 3NDBB 1MO6A 1G41A 4U5XA 3SHFA 4HZIA 1AQYA 2CBZA 3ZJYA 3BB3A 4IOKA 4Z1MA 4JJKA 4TMKA 2WSSA 1NP6A 5E95A 1W0JD 1E98A 3ZQ6A 1CR2A 4BZXA 2AX4A 2CK3A 3CUEF 3PUZA 3RS5A 3PVSA 5L3SB 3PEYA 4LJ6A 2REOA 1U0JA 1W36C 1AA9A 1AZTA 3FYHA 4C30A 1NMYA 2OO7A 4C7OA 4B33A 3CONA 4TMVA 5CDFA 2R62A 3GLFA 3DDCA 4WBSA 1CF4A 2G83A 4UXHA 2QTFA 2F9LA 3BC1A 4XD7D 4QGAA 5DLQC 1L8QA 3AEZA 2JLSA 3REGA 2HF9A 3RSLA 2DHRA 4O2RA 5EE0A 2KBEA 1U8AA 5AJXA 4L5BA 2ODNA 1P60A 4GZLA 3B1WA 4HUQB 2G6BA 1Q20A 3B1YA 4X8LA 1WE2A 1W1WA 4Q4AA 1Z06A 1NN5A 4YQFA 3F0TA 2AKAB 3MWYW 1FPMA 5FBLB 5BQ5A 5TVKA 1FW6A 2GJ8A 1Q12A 1U8ZA 1XEXA 5G40A 1W46A 2IWRA 4ZDKA 2ZJ2A 1G8FA 1NF3A 3K0AB 2ZVQX 1COWA 1OPXA 3AF3A 1M7GA 3BOSA 4BFTA 2I4IA 2VF8A 2J0VA 3PIRA 3VR2A 3SYLA 2N42A 3GLIB 2ZYTX 2J0SA 2KSQA 2ZM5A 3PUYA 1FX0B 1ZUNB 5FI0B 1DARA 4NYIQ 2MSCB 4HDOB 1JR3D 3MJRA 2RGNA 2PLFA 3Q9LA 2Z43A 4FD2A 3QOFA 5KSZA 3ZD6A 1J99A 1P73A 2PT5A 3J81k 1SGWA 4OQNA 4OQXA 5B57C 4JL8A 4QKQA 3T5DA 4TTQA 4QBHA 2JJ1A 4XVRA 3FMFA 1YR7A 2D3WA 4B32A 1NJGA 1VPLA 4ZI2A 3BERA 3DZDA 4HAVA 1JPJA 1XDBA 3GEIA 2VP5A 4C0AC 1KDRA 3TW4A 4Q1AA 3HPQA 3D7MA 4YXWD 2QT0A 5BYJA 1E2JA 2IUUA 2CXXA 3CRRA 3LA6A 3LLUA 3MLEA 5UKDA 1N3BA 1XJQA 1R8QA 2FOLA 4A0HA 1PV4A 4MRSA 5JMTA 4B71A 3BD9A 4MITA 1WF3A 2OUKA 1U9IC 3GLGA 5AUNB 1QG2A 4PSVA 2QRZA 1KK1A 4AC9A 3U4QA 3TR0A 1KO5A 4IXMA 2HJVA 2VSXA 3DKPA 4V0NA 1VMAA 3O47A 1ZNZA 4H9GA 3Q3JB 4NDZA 1IN8A 2J46A 2OFXA 4LV5B 4Q1CA 1UAAA 1YR8A 1SVOA 1LNZA 3KKMA 4QM7A 1Y63A 3QEJA 2IS2A 1PLLA 3GJ4A 4RD2A 4JLPA 1YRAA 3R20A 3X1WA 5JHGB 2O5VA 5LD2C 4M2LA 4N0EA 1ZYUA 5EUMA 1VCMA 4FMDF 1A4RA 3GCGA 1DAMA 4GFDA 1A5TA 4WXRA 3C15C 3KQNA 1NKSA 1JQLB 2IHYA 4NYMQ 4QOSA 1IQPA 1CRPA 3RNLA 4DEYA 3ND9A 1P3JA 1IN5A 3VKHA 5DSZA 5F98A 1Z0FA 4XOIA 3A1TA 5B30A 4JBYA 5FPKA 1XPUA 4K81B 4QJ4A 2D62A 2ZU0C 1CJMA 1LVGA 2FPLA 2REBA 3E2IA 2KWIA 2FH5B 5AJWA 1E3MA 4MA4A 5JECA 2FFQA 3QY0A 3PUXA 4Q4LA 3PV0A 4MRPA 1LF0A 1T5LA 2OZEA 4CEHB 3NH9A 3PEVA 4NYJR 1FQKA 2CCJA 2CHVA 2V55B 3I8SA 4JMPA 2PBRA 4LJAA 1CJKC 2B6HA 2J5XA 4LY6A 4XTCS 2IYUA 2WJYA 2RCNA 2AD5A 4NH0A 1UBGA 1OKKA 4H1VA 4P32A 4F4IA 4CYMA 1G6HA 2WJHA 2WKPA 2WWGA 4A6PA 4IEEA 2C98A 5CJ2A 2GXSA 2GJAA 1ZJ6A 4NBSA 3T1VA 2WZQA 3I73A 3TLXA 4AY2A 5JJLA 4G01B 2XNDD 3AP3A 2PEZA 4JL6A 3BH6A 2ECKA 2ZYWX 4JIMA 1MT0A 1W0KA 3NVAA 5D3MA 2RGNC 2QPAA 3U7FB 3W5JA 2H18A 3I5YA 1DS6A 3AVVA 5J4VA 3NWJA 1HY3A 3EZ2A 4G0NA 2GXQA 2MMCA 4B6FA 1XD9A 3LVRE 3MJHA 5JJKA 3ZD7A 4K8OA 4G5OA 1Z22A 3IPYA 2B92A 1YR9A 2WJIA 2ZU6A 4P31A 1II9A 3P26A 4TLEA 3SI7A 4IVRA 3G82C 3LFUA 1N5KA 1Z2CA 1PLJA 4ZI3A 2WHXA 1BYUA 2XB2A 3Q7PA 2DY1A 1ZM4A 3I62A 4Q4HB 1L4YA 3V00A 2A5YB 1P75A 1HV8A 4DLRA 2DB3A 4KITB 1Z2AA 1S3SA 4B35A 1KZGB 3GD7A 4GBMA 1E9BA 1ZINA 2EYUA 5JWHA 5B64A 2P0EA 4CDGA 1DAKA 4RZ3A 5GJWC 2ZREA 4A4DA 3TMKA 4E09A 5DN6A 2O8DA 2OM2A 3KUDA 4MKIA 2QP3A 3B82A 3VR5A 4DDVA 1H8HD 5C18A 1T91A 1T8TA 3SJCA 4XVUA 3ZQJA 3SOPA 4QHYA 4XSGA 3KFVA 2QMHA 5CITA 4PZYA 4F4JA 4IDQA 1EG7A 2F9MA 1BMFA 2BMEA 5SZHB 2D2FA 3V4RA 2YOFA 2ZTSA 5FTNA 3TGPA 3QENA 2RGEA 3REFA 2VF7A 4BLPA 1KK0A 2P6RA 1P6XA 1HH4A 1QHXA 2PCLA 5EXPA 4B73A 5H70A 1E2IA
chains in the Genus database with same CATH superfamily
3ZHQA 1J6UA 3UG7A 1BFUA 3T6KA 1Q1AA 1ZEJA 4OLFA 1FMCA 1Y8CA 4KQ1A 5M29A 3T41A 5BOSA 2P9HA 3P2EA 1DZIA 2OWEA 4AJPA 2HHHB 1MAHA 2OXEA 4X71A 5E6SA 5CX4A 1FXWF 1M33A 2OM6A 5G4LA 1M5RA 4R1LA 2GBPA 3BRWA 5A03A 2B25A 3CLKA 3BL6A 3GARA 2Y92A 1MG5A 1ODFA 4AKEA 3OETA 1FS4A 1UMBB 2EZ8A 4OHRA 3UHOA 1LUAA 1M7BA 1QV7A 2HBYA 5JS2A 2CLSA 4DCVA 5I48A 1ZN9A 1IN1A 1QHIA 1LDEA 2E4YA 2YHUA 5GOZA 4TN1A 1H2HA 3QXHA 4MWBA 1XDSA 4QJIA 4Q9LA 3UBTA 4URZR 2IUEA 3SQLA 1PZXA 1NP3A 2VA9A 1XRRA 4L3OA 1TFRA 3H05A 5EVJA 3RU2A 2VJOA 5JRJA 3OCUA 4JELA 4K3VA 5IBCA 3D3QA 2GGSA 3BF8A 1E7RA 2WJAA 3C1TA 3IAEA 4O4HF 1GKUB 4DSTA 1ZK1A 4RVCA 4EGFA 2YQ4A 5KNBD 2BH9A 2XYQA 2ZSAA 3RTGA 1GP2A 1QH8B 2WQZA 3KOWA 5GY7A 4HDAA 2IXEA 1T1JA 2NM0A 3C6BA 2VWHA 3CG4A 3AUXA 3QE4A 4IM7A 4RS4A 4TTIA 1QVZA 2JCYA 1PNQA 5LDGA 2WV9A 3TJZA 3UV7A 4FS3A 2QL5A 3K9CA 1G291 4QELA 4W5TA 4E1AA 3WB9A 1EFCA 2PS9A 3MA0A 2RI6A 5F2KA 3VZPA 2PYZA 4E03A 2OMKA 1GEGA 3A58B 2B34A 4YAKA 5JSUA 1ZN7A 1QG0A 2XDWA 3HB0A 1R12A 3HCFA 2ZRQA 4J6EA 2IEDA 1KNXA 2X0JA 3GJRA 2XGMA 5AIAA 5B2FA 4M0UA 2JI8A 5BMOA 1JWBB 4PQGA 1K7EB 4ES6A 3AUTA 5JG7A 3N9IA 1SXIA 2Y1GA 2ZG6A 5IPFA 3R6WA 1T4CB 2FPMA 1EWQA 3SP1A 1XUOA 1XWFA 4KMRA 4MYUA 3QVMA 4DVJA 5C3MA 2O59A 3AB7A 4O2BF 2BISA 2GESA 1XDUA 3CSUA 3ON5A 4QPDA 4CI0B 1Y9JA 4AJNA 2DECA 4WZ6A 4BGDA 4WCFC 2A92A 2CVQA 4KQJA 2I55A 4TLBA 4QPJC 4ZPJA 4ZT3A 4L5AA 3UJ8A 3RG8A 1V4BA 3EFHA 4IHQA 4ZIRB 5BXQC 3G8BA 2WTMA 2E5FA 2R96A 3AR5A 4MW7A 1WM1A 4BRWA 1F0NA 1VL0A 2AMLA 2YJGA 3M34A 1Q3HA 1RR6A 4LW8A 3KXIA 4ZV9A 1Q17A 1EP3B 4QPCA 3QXSA 3M4JA 5C7OO 2ZANA 4I0WB 4CL0A 1YS6A 4A8HA 4MA5A 4JJGA 2PE5A 2IXFA 2HGZA 1AB6A 3UMVA 4ZOLA 1UL1X 1ZOLA 3INRA 4I55F 4AKIA 4DCUA 4UDXX 3KXPA 2ATIA 3V2IA 2ORIA 1G8YA 2BJWA 4CFYA 3WSTA 1HE8B 5IXSA 3OIVA 2RK4A 3QZUA 4P2BA 2UUPA 3BPSA 3V8QA 4UCXA 3DOEA 3OQ1A 4UAJA 3PQ7A 2CWDA 3RUDA 2QR3A 2FSVC 5IW8A 4YGXB 3FSEA 3AUKA 1LF5A 1KMMA 3O4JA 1T9ZA 2RAFA 2C5SA 1NQXA 4XRRA 3UA3A 1DZ3A 1F60A 1YAHA 2G0AA 5DCLA 4AS2A 3GBSA 2D2IA 4MLDA 1KIMA 1KI9A 4ND2A 4B74A 4BNKA 1R16A 1T4BA 1HC7A 4Q7MB 1HBJA 1JQJC 1TUGA 3PNPA 1IBKB 4ECEA 1KGSA 1NW5A 4EHJA 2RI1A 4O02B 3MWKA 4PN3A 3L0DA 4GI7A 3RU7A 4R98A 2JGNA 2BJHA 3TZ6A 5IKEA 1CZKA 2FWAA 3AGQA 5KSWB 5ICEA 3OCZA 1ISRA 3K4HA 1T5SA 3FYUB 5AOAA 2BI7A 1BN7A 2NO6A 2BTQB 2G0TA 1IZ7A 1D4OA 1M54A 2QJWA 4UMEA 5ESXA 1NAHA 1G4AE 5KYUA 3BTUA 5DHRA 3STHA 1GAXA 2XHEA 3NOOA 1BDJA 2AOTA 5KYVA 1ZH6A 1RZUA 1P8AA 3BHNA 5CGZA 4A15A 1G5RA 1UBMS 3HVIA 3IAXA 4NV3A 4BC0A 1JJAA 1A2OA 3I9V6 4IV5A 3LA8A 4BGIA 1EKXA 4TZ0A 3K8ZA 4AYTA 4Y7CA 1HURA 2OB1A 1PGQA 5DT9A 4EF4A 4UOZA 2O2ZA 2VKQA 5B7PA 1LC0A 2O2YA 5DBEX 2EW1A 1ECPA 2Z1DA 3EGXB 5C3UA 3QE0A 3GDGA 3AQ4A 4NCHA 2XCRB 2YYAA 3S2UA 4OQMA 1O3YA 3DZFA 4URVR 4H4DA 4W5JA 3U81A 4RYDA 1EVIA 4ERNA 4FOTA 2C5FA 3VKUA 1R0YA 3NWBA 3DDWA 3U2QA 2NO1A 2XNKA 2PVSA 3R7FA 3CH7A 1ZAYA 5MHTA 1I30A 2C2OA 4R8KA 2YN4A 3I64A 4OTZA 4I1YA 1Z4NA 1IONA 2O8BA 2BCEA 2PUJA 3A31A 3I58A 4ZZ2A 4P53A 4KRFA 5EJMA 1AS2A 1IZ9A 4CT4B 4D74A 2JLCA 4JYAB 1B0UA 4KN9S 4ZAFA 3CBGA 1K0UA 1DT3A 1QRTA 5C5DA 1U4SA 4RK1A 4DOMA 1E4EA 1MZPA 4IAOA 1HE1C 1ZN2A 1Y7TA 3NEPX 1NVFA 2QY9A 1UPCA 3O8OA 5JI3E 5CDYA 3JWGA 1NUHA 3IVCA 3GLFB 3AB3A 4LFAB 4GDMA 5GM1A 2PD3A 3AHGA 1X1RA 1IMOA 3EWSA 3LI2A 4K9NA 3TTTA 2UVPA 4ZMRA 1AIPA 3LY9A 4M49A 2G7MC 3HH8A 3UCFA 2X41A 4DT1A 2QTLA 2W2KA 4R2LA 1IU9A 5LNK6 4KNYA 4IIJA 2NMVA 1BH2A 4KREA 4DS3A 3TW0A 1KSJA 4UAUA 4GQIA 4FNAA 1SZJG 5MN4A 1AUOA 5K0TA 2ORYA 4XWWA 3KQKA 2FR0A 2EZ9A 5AM0A 3NCTA 3UPTA 4H18A 4UEKA 3CHYA 3VX4A 3ZUPA 2CFSA 1U2TA 3CWZA 3VOTA 5I5GA 4P4UA 2CXQA 3KL4A 1EP1B 2HPVA 3AVQA 5AKIA 2XNJA 2J3DA 5K03A 4UQPA 3IKMB 4A8TA 4D2IA 2GEVA 3E3NA 2Z6VA 4DE5A 3QFHA 5JNSA 1CUGA 1GSIA 2YVKA 1JHUA 2TMDA 4MV8A 4XSHA 5JARA 2G9NA 1BA2A 2QG9A 4WN3A 1P1HA 4DREA 3W5CA 2C0QA 3OECA 3OPYA 4P4NA 6CHYA 1MR3F 2CB0A 3UATA 1PVOA 5EPEA 1XAJA 2H06A 3BMOB 1ZESA 1IBCA 4L8VA 1GNQA 4DQUA 4ZHQB 1LPSA 4H08A 3NBFA 5B3LA 4BX8A 2QS9A 4MQFB 4TL7A 5KCMA 3R24A 3T9BA 3KWFA 3LRXA 4ZU6X 3X1YA 1WNTA 5E8JA 3SHVA 2J3JA 5KWIA 1SKMA 4UTNA 2WHYA 4J6FA 4EJMA 3MFQA 4FSHA 1DXQA 5FTWA 4BFZA 2VDLB 3EUAA 3ONDA 4IZ6A 4BUJA 4XUGB 1R0XA 2CBXA 2JEZA 5KINB 2WVJA 1A82A 2BHSA 2X8AA 1RRPA 4YCAA 5NLLA 1WV1A 3G59A 4MRNA 4BAZA 3FYCA 3ZKWA 1RLMA 1PW5A 4DQVA 5ALRA 5IARA 2CLDX 2ZJ7A 1YZQA 1RLIA 2ONZA 5JANA 4GPAA 5IKXA 3D3JA 5C1IA 2FN3A 1PX2A 3KE8A 4M1SA 1G18A 4WL0A 3S2SA 1PSZA 2UUOA 2DHEA 4DG8A 4HLUA 1Q21A 3ABQB 3MJSA 3SR4A 2I62A 2DFTA 2AEJA 3OFND 5M7EA 5BOVA 3DB1A 3RSZA 1XJ0A 2R6ZA 4Q5IA 1UZMA 5B2ZA 2Q1WA 2P40A 3K15A 2CFIA 3CKKA 4E4RA 3SIRA 4ZTZB 1NI3A 5AXBA 1QRSA 1CE8A 1ZGZA 5FXMA 4ZVNA 3SLRA 3GAZA 4LCEA 2WQ6A 3KB1A 4DBLC 5IFKA 2XSZA 4OAQA 1TI7A 1VP3A 2JEOA 2FDCA 2GOYA 1U0LA 3QKWA 5HVNA 2G7ZA 1X7ZA 3N87A 4BTEA 1NNLA 4WGGA 3NKFA 4R54A 3FAKA 4UVEA 4S35A 2EV9A 3KB6A 2W8BB 2C78A 3MWDB 4QU8A 5KVSA 3KFXA 4YWJA 4C4PA 1ELOA 2WZDA 4PYQA 4RV5A 1QP7A 1LU9A 1WR8A 1ULTA 1XP8A 1EU1A 1YIDA 1ZX1A 2F64A 1CNFA 2PKYX 4KWEA 2I9KA 3QSGA 2ZUEA 4YQYA 4HMOA 1HOXA 2A1TS 2QD4A 3Q85A 2AS0A 3H6GA 3MELA 2OYSA 3V55A 4UMDA 5KJ6A 5HUHA 2WUGA 4YFYA 3NXSA 3T7AA 4OBEA 2PL9A 3HHPA 3ZCPA 3R1IA 4Q9KA 2HNKA 2A9PA 5CDSA 1R6AA 1N3LA 1B8OA 2ZI3A 4FN5A 2A0XA 3GPBA 4JFRA 4X6XA 2C20A 2C9OA 3SLKA 2PAAA 3SY8A 3TMAA 1QQAA 2O0MA 4ZCIA 1KE2A 5HEKA 5JVDA 1V0JA 3HUFA 2JAOA 4LMPA 1JG3A 4R1PA 2PS3A 1SBCA 1HYEA 5L53A 3PL5A 3HWSA 3NKVA 5JNTA 4U7DA 2DPHA 4JHLA 2PKCA 3WAKA 3ES9A 4NAUA 1PSDA 3GHHA 4MIEA 3ZU5A 3PDJA 3V42A 2A0WA 2DG2A 4AZ0A 1BDBA 5EKXA 4N7RA 3V1MA 4KFCA 3W5UA 5GPBA 2BFFA 3Q12A 5BNTA 3CR3C 2YUTA 3RO7A 3I92A 3BFVA 3L8FA 1GHTA 1RRFA 1FU4A 3V4LA 3VZCA 5B6PA 3AHHA 5BMVA 2RB5A 3TK1A 3CPHA 3B48A 4PYJA 1SQFA 1E9AA 2JANA 3HZRA 3W3AH 4LC0A 4KXUA 5TQVA 3W3AA 1ZCBA 3M49A 5FTKA 2ZUVA 3SF8A 4LF6B 1BMTA 3QWAA 2JIZD 3VPSA 4CXMA 4ZAWA 4IFEA 3NTUA 2IHZA 1VRVA 4BP8A 1JEOA 4HQ0A 5BW4A 4D3FA 1NUAA 1M5TA 1YKSA 1KVUA 2JZCA 1IN7A 1I8TA 2Y1WA 4LCBA 5B3KA 3FJYA 3GLHE 4PPQA 1M3SA 2E4WA 4PXSA 3U17A 3LCRA 3NC4A 2RHJA 3IULA 2QJTA 4NQRA 1Y5RA 3PENA 4KDCA 3ZZTA 2W0SA 4B3MB 5AVZA 1FNNA 2Q3BA 4BP9A 3VC1A 1OU0A 1N5LA 1Z34A 4OYYA 3I04A 1KQGA 2NU8A 2C3PA 1F1JA 1NFFA 1ZDMA 2HO5A 3Q2OA 4G1VA 1CDOA 5DH9A 5FX2A 3DZBA 1ORVA 4RPIA 1PYGA 2Q2WA 3THXA 3BJRA 3MC1A 3NVMB 3PUIA 1ECLA 5IMSA 3QITA 4TL9A 2NZVG 1NBME 4L76A 4NPAA 3MHPA 1Y3IA 5F2EA 3A6JA 4OGGA 3PQ4A 4MMXB 4RH1A 2CDBA 3E9CA 1TK9A 1WMAA 4MNTA 5HUJA 2WD7A 1JX6A 4JJ4A 2O20A 5EIOA 5LJLA 2IEAA 2XDAA 4WCFB 4Z4FA 1YMUA 1DC3A 2QYOA 5D5QA 5JPIA 3TKAA 4FVTA 4C4XA 4MYCA 2HSJA 4X61A 2GX6A 1I2MA 3OHMA 4CCAA 2IS4A 3DLTA 2OFPA 4NZ9A 2IHJA 1V16A 4UUMA 5I7HA 1WD7A 4J49A 4YECA 3EOBI 1IAVA 3IMFA 4PPYA 5AKKA 3DBIA 4FFRA 4LOIA 4TGLA 5A5FA 1Z4MA 1GTVA 1H2AS 2UZIR 3F3KA 4HVLA 4EJ2A 4ZZ1A 5LJIA 4IZHA 3MB5A 1LA2A 1A9ZA 1NE2A 2IQ5A 3EFOB 2Q2OA 2QY6A 3O1IC 1N9GA 4RH3A 5I4KA 4HH3C 1EESA 2FKAA 4UVIA 4KPUB 3GGOA 1E0DA 2QJOA 4ZVOA 1L4GA 3I2YX 1U2RA 3CLVA 3V46A 1CY1A 3OC0A 4HPJB 1T26A 2VP4A 1X1EA 2IYQA 2WFMA 1EXMA 1TYBE 1JL3A 2QDXA 1G6KA 3DDNA 4R0NA 2Y1XA 1HMYA 2OC9A 1P19A 4IFTA 4JC8A 4F4FA 2FPGA 4Q9AA 1O96A 5JCPA 2CXRA 5J4YA 2NUPB 1THTA 1S2OA 4YRFA 3SIWA 1KBZA 2YY6A 1K8QA 1EWKA 4JODA 4V03A 1QDEA 1QVWA 2VPIA 3NGXA 2BZ0A 3ENQA 5FI1B 3LHKA 3ELWA 2V0CA 5HFAA 3IQXA 5BOSB 3OMXA 4WK4B 4G2TA 4RWEA 1DC4A 1E4OA 3IRVA 2VZEA 4QBKA 1NNI1 2I9PA 3IQGX 1DUIA 1XZCA 4RXMA 2V7PA 1R64A 5E6SB 3DCJA 5B12A 3L41A 1G8AA 1C1HA 1MNAA 1T2VA 1WPXA 2VYVA 4TS3A 4XQGA 3VR3D 4D46A 1ZIPA 3O4GA 2OQ2A 4LHYA 2BSXA 3FPKA 1TIKA 1ENPA 2ZW9A 1KU0A 3OEHA 4BB6A 2ISQA 1BO6A 4Z0NA 4CV1A 5C1BA 1IBRA 3CKLA 1TU0A 5EWLA 4NJMA 1AQ6A 3A3NA 3L2OB 3MTDA 1CS4C 2PX3A 3VC7A 4Z7OB 4ZDJA 3FZQA 3LBHA 5DM0A 4JI5B 2WJ4A 2AFIE 3LUHA 1Y81A 4YASA 5A9TA 3UT6A 4YJGA 1EDEA 3O5AA 2YS7A 4URWR 3TZBA 1RZ3A 5G53C 4EPTA 3IKVA 4G5QA 5HF9A 4OGLA 1SRRA 2AXNA 3LHFA 3P9ZA 3RVLA 2JF0A 1KYQA 1L1EA 3JALA 2R2GA 1EK1A 1ACMA 1A76A 1B16A 1H8ED 1V5EA 3DEFA 4HGZA 2C99A 3VZRA 3FPBA 5MGNA 3PGJA 1T25A 1JXQA 4DRYA 1ZO8A 3EEBA 4LOAA 4A1FA 4HH4A 1Y98A 4M7PA 3DTVD 3TFQA 2NXEA 3Q0EA 4ZV7A 1QYCA 2R66A 1GPDG 4AZ3A 1T0JB 2WSYB 3FPEA 4OQLA 3VNBA 1A8SA 1M6NA 5EXDA 2J0UA 4I5GA 3TBFA 2DTXA 1RRCA 3RFTA 4GVLA 3QU7A 4LJ8A 2GN0A 4OOEA 1I10A 1YHNA 4JYCA 3UXEA 4IF6A 3V1NA 5F64A 3WAGA 1EFVA 2F3PA 1E64A 4M0PA 5F23A 2HA4A 4YYEA 3A3YA 5JSZA 1R0WA 3FRIA 4CLRA 3U7IA 3MJDA 5FV7A 4H7FA 2DVMA 3NRCA 2IP2A 1Q1ZA 4N54A 3WGGA 1KEWA 2NP6A 1A1SA 4JVOA 1K6XA 1RE1A 2I6FA 1WUHS 2VNHA 4X1IA 2KLHA 5THXA 4F46A 1I01A 4E13A 3GLSA 3MN1A 4GVPA 4UVGA 1BYIA 1M1XB 1UWCA 5FFFA 1XQWA 2J59A 4MYTA 1WY7A 1FP4A 2NVBA 5YASA 2EKBA 3ZI4A 3ZY2A 5AW8A 3KTAA 2NZ2A 2C54A 2OFOA 2WAMA 3R09A 1DDIA 1FXUA 3IOCA 4HQ6A 4PGMA 2XE4A 2IZ1A 3G85A 1C0IA 2HUPA 4W5HA 1H2YA 3MJVA 4N5DA 3FLMA 2EZUA 4AWXA 1WEKA 3OVMA 1URPA 2RHHA 2PAFA 5JYEA 2BFCA 2VJKA 4L8FA 1YZTA 2RC5A 4H16A 3C5VA 4RNCA 2J8ZA 2VJDA 1HDYA 1VIYA 1RXEA 2ZQZA 2F2TA 1RKUA 4M0LA 2IS1A 5I7FA 3AIOA 2ISSD 4KHPB 2V6MA 4OXYA 3R9IA 4QJ3A 4IRUB 2JHPA 3IURA 1S7GA 1C0EA 3VVCA 3D6UA 3L7CA 1ENZA 3FCSB 4ZOLB 5K1ZA 5AKGA 1RRVA 1RI5A 4WZBE 1MQSA 4LJ7A 2VZ9A 4G56A 4CQMD 2UYHA 1PNRA 3OM1A 3QOWA 4FGUA 4NYJQ 1DRVA 1I7NA 2B21A 2PD6A 2ZE8A 2X22A 5B55A 2ANCA 4FX5A 2SICE 3OI7A 4MDEA 4ZAYA 3OO1A 3VKGA 1DQRA 3TVYA 5EJ2A 4BRUA 4GLLA 2JVJA 1PFYA 3EIXA 4HH0A 3F7OA 2A3RA 5JEEA 1VHLA 5ALWA 1EJ6A 4H1UA 1N2HA 3AYZB 3IR7A 5M04A 4NJEA 1SUSA 3TKYA 1IM5A 4JP3A 3GFVA 7ABPA 4F9FA 1ZIDA 2GB4A 4AG3A 2J4DA 4JC0A 3BFJA 1C3LA 1C30A 2KE5A 5D6NA 1L2TA 2HBQA 2V9ZA 4IO0A 5HXAA 1TEXA 3TFOA 2AVNA 2NXJA 2LUOA 5AW2A 4K0KB 1EM8A 1S0UA 2G4VA 2QUBA 4H60A 1NN0A 2NXWA 3OQJA 2EBFX 4K8RB 2GKGA 4BVHA 5CA0F 2P6NA 3A6DA 3CLHA 3BFXA 3LQFA 4X6YA 2W6MA 4AVYA 4YT8A 4P58A 4CLDA 4JR2A 5AOCA 5FBHA 3WXBA 5KYUB 4XYEA 4A6DA 2AOTB 3H2KA 4D4IA 4DARA 3TGWA 4AO8A 5H7XA 3TXAA 1X3SA 5ALQA 4QU5A 4PHFA 3E35A 1T2DA 3N8GA 2O1XA 4PZZA 5ALIA 3GZJA 5I9SA 1X8JA 3UO8B 2VH5R 3UGKA 3X1ZA 4E88A 4KQ6A 1IEQA 1D1TA 2D00A 2VF2A 1DJPA 2ZB2A 3HADA 2GK4A 1RKVA 4WBNA 3FCCA 2QRNA 4RGVA 3RYTC 1P7VA 2EJVA 3IEPA 4QATA 1LLUA 3A70A 1K7SN 1F0YA 4EY3A 2XEXA 5F7ZA 2WSIA 2FQQA 3E8SA 1TZ2A 2FQWA 3VTZA 4A0QA 1VB5A 4WECA 3X0DA 3PUVA 5H3LA 3HHEA 5JTUA 4R40A 4K6GA 2DFNA 1JW9B 3JSAA 5FOUA 3EIWA 3TLZA 5TGDA 2GR9A 3BWXA 3C5HA 4YJ3A 4OBXA 1OOEA 1T8UA 1W6UA 3NYRA 1XEWX 4IX9A 3NHJA 4AMZA 2ZJ4A 1DIOB 3I9OA 5FH9A 2O8BB 2Q5CA 1P0QA 2QTVA 1OHHD 3QFFA 1QO7A 3BDIA 4R2WA 2ZSFA 5JSQA 1Z29A 1P6QA 2KQUA 1OT3A 3BX1A 4G5RA 4L8WB 1NRJB 5AUQA 5FI3A 4BBAA 1CEXA 3AWIA 2NSDA 3DCYA 2B4QA 3EBPA 1S5PA 1G2OA 1TW3A 2NU7A 2X0EA 1TECE 1NWHA 4KRYA 2ZSHA 2JAPA 1F4LA 1E4EB 4ENTA 2W2LA 5ELXA 1TNDA 4RVFA 5ALMA 3O8OB 4GMGA 3C8ZA 3RUHA 3I53A 4G9GA 4II3A 2VRCD 2Y2UA 4BIMA 4KXWA 5KPJA 2ZITA 2A0KA 4MP8A 3Q3HA 2UVPB 5G0UA 4XQ9A 1OR8A 1R2QA 3LT2A 2H4YA 3OSUA 5A05A 2W2KB 3RTDA 2P5UA 1QMPA 4DT1B 4HC4A 1YVPA 4M0EA 4IIJB 3VGJA 1BWRA 4P92A 3DH0A 2PGJA 4EWLA 2HM7A 4FFSA 1GU1A 2FQYA 3R44A 2WTXA 4OQ4A 5FA5A 1SD5A 1W8IA 3WLIA 4CTJA 3ANMA 4PQFA 1AH2A 3W2GA 3M6AA 2J07A 1R6VA 3DWGA 1R0LA 1VGRA 1MW9X 3WTCA 2YHAA 1E1CA 3BIOA 2UYCA 2M6SA 4AJ2A 1Z62A 2PMKA 5AJYA 3R6TA 4BB9A 3HRHA 4F2HA 1V25A 2X9LA 1EG2A 4ZVQA 3WBBA 4CCYA 2CHGA 3QMWA 3EXEA 4PC7A 4BYGA 5BRAA 4J4HA 3CRW1 4KXLA 4ZQIA 1SM4A 1ESEA 2QTGA 2YKGA 3IP3A 3M1AA 3OPYB 4HS4A 1E1NA 4DNXA 3JQCA 1PFKA 2Q1TA 4L4XA 2ZIVB 4URUR 4E30A 5DNYB 4UTRA 1OUMA 3QWFA 3MXOA 1JZQA 2ADFA 3HFJA 5IASA 3QIAA 2MJLA 4XWAA 2QP4A 2Y27A 3OQMA 1K2VN 4UJ3A 4X95A 5ALPA 2XAAA 1G5TA 1ZXLA 1VBFA 3PNKA 4C1BA 3L8MA 1PZNA 4NE2A 1NASA 4DG9A 3ORHA 5I47A 3WFJA 2GYWA 3K9NA 1WUJS 3V7FA 2C1XA 3GVIA 3HBJA 3ZKWB 2PV7A 2RG7A 2HK6A 5A4KA 4LHWA 3UN1A 2WIAA 3VI4B 4E5YA 4R8LA 2AIRA 3G0IA 3L1UA 1BKYA 1CWUA 5KJ1A 3ZK7A 2YQ5A 5FPSA 4BATA 1KYIA 1FCJA 3OUUA 3S1LA 2O8EA 1Y6ZA 1JQAA 2ANBA 3IQZA 4QPNA 4A03A 1MX3A 4EX6A 3L4KA 1QQ7A 1KS9A 4J2HA 4B0OA 1XEWY 3D3NA 1ZU5A 2GNOA 1JR3A 3O3OB 3R3WA 4PX9A 4TWZA 4WESA 5I8PA 1C50A 1CE8B 2GEKA 4UNPA 5AKHA 3G2JA 3AJAA 3UT5A 3WMWA 1IPEA 4DWVA 1RS0A 3RTCA 2Z2YA 4AIRA 4AN1A 3NRJA 3GR6A 2ZUFA 5KTOA 2Q28A 1OZ0A 3MJEA 1CJBA 1X7ZB 4CG1A 2IYXA 3P0RA 5T4HA 1VDZA 5KU7A 3ZGOA 3RYFA 4KQGA 1MC1A 4F4DA 2X86A 1N32B 1YO6A 4TRMA 1K4KA 4X8OA 5FBWB 4KHZA 2P6UA 5C8VA 4EFNA 3DV9A 3IXQA 2Q5IA 3M2PA 3K70C 5BORA 4LJ5A 1XDZA 4IG4A 1D2AA 3E3AA 3DEHA 4X3CA 5H82A 4MIOA 1N33B 1CNMA 4MVXA 3OZFA 2H4HA 4YXWA 2WSLA 1ZWKA 4RMIA 5HA5A 4C29A 5CBKA 1GAJA 4OK3A 4BFYA 5AVQA 1ZVMA 1P45A 3MRVA 4DJTA 3TOVA 5DYNA 2DUMA 3UZUA 1QUEA 5EMNA 3LBNA 2H9YA 2OXCA 2VL7A 3AR9A 5IF3A 2GRAA 1J5EB 2B82A 2GM3A 5MF6A 2BSQA 1U28A 4Q16A 3W6UA 2AC2A 1T6YA 2P4EA 1XQYA 3L6CA 4QOEA 5JVDB 4NU0A 3TL6A 3A37A 3VNRA 4F86A 2BM9A 4NV0A 4LS3A 3RADC 1G20E 1RYFA 3L0OA 2JZOA 4P38A 4L4RA 4QM6A 3KJEA 2VI5A 2VXOA 3ZYCA 3JSXA 1ENOA 3FPFA 4GSYA 3G9XA 1XTRA 1NRXA 3BB1A 2FFRA 3V8BA 3TRKA 2LDXA 4MTCA 1XKTA 5FLYA 4AZ0B 1NVKA 5EG5A 2BFFB 3M7IA 3A26A 1PHPA 3GZ4A 4B85A 2CB9A 1CYEA 1T9KA 2D06A 1C2TA 5BMVB 2XB9A 1QVRA 1S2GA 2YOGA 3WYNA 4BE7B 4DLSA 2CLMB 3SSNA 1DADA 3QLUA 1G5HA 1SU6A 1TMGE 3MOGA 5LCXA 1Z28A 4CIDA 4LYYA 1CULC 2Q4TA 4MO9A 4OHFA 1ZHOA 4LZWA 1NRWA 3V8MA 3SF8B 2QBYA 1NVDA 2FPRA 1TM4E 4U9HS 4EYSA 1IEXA 2AMYA 1U31A 2J3EA 3QEOA 4OK5A 1YKFA 4D6YA 5LVAA 2RIRA 1G60A 2EXXA 5H9VA 2B35A 4BO2A 4CKYA 1GQQA 3OBBA 3GNSA 5K3DA 3SXUA 3FNQA 3I9V1 3NTQA 4PX3A 5DHPA 2TS1A 1BVRA 2IYPA 4JBXA 4EO7A 2IK8A 1M34E 1G6Q1 3PI7A 5IJWA 2IYAA 3DL2A 8AT1A 1UWKA 2FU5C 4FFVA 4XDZA 1JHPA 1N6IA 2Q5OA 2XCTB 1BMDA 4CMJA 2AR7A 1AXGA 4RHTA 2AN9A 5AM1A 2J7PD 1ND5A 3E53A 4QD3A 2NU8B 4Q9DA 4YDRA 2P9BA 1K4YA 2CDCA 1JSRA 2OO3A 3NALA 4TMTA 3THXB 5H68A 3HO1A 2NOAA 4Q6BA 2EX0A 1NXSA 4FBMA 2VLIA 1KFKB 1CT9A 2ZKLA 2IX3A 4Y2RA 2ZXUA 5IZ4A 2AG8A 1PJ4A 3BMCA 1W30A 3IR5A 5EOVA 2HA6A 5CFPA 3C6YA 1QS0A 2RHWA 3AFIA 2WD7B 5L3QA 3ITKA 1H65A 1HLDA 3FPCA 1M6YA 5E4TA 3U7GA 4RDIA 3SZMA 4KV9A 1WVGA 1IY2A 3D64A 3G3EA 5HG0A 3TWOA 1R5BA 3JS5A 5CVEA 2VUTA 4YREA 3WDSA 2WTNA 5B58C 2UYOA 3W4JA 2BH2A 1A8QA 1SVIA 1E7YA 2XNDA 3D31A 3PIIA 1TM1E 4GI2A 4KBYA 2VFAA 4G67A 3MTBA 1V16B 2BELA 4EKIA 4DCJA 3PFIA 2QAGA 1JG2A 3ID6C 4N3AA 2H1SA 4XI9A 2CMGA 2OCYC 4IXTA 4CMBA 5FR2A 1E5VA 1EZZA 1SNYA 5HQTA 3DZGA 4LSGA 1ZBDA 3H1AA 3H3XA 1W44A 3Q3EA 3OLCX 3JZMA 3SZGA 3WYDA 4IMJB 5D84A 5KTKA 1XFDA 2AQKA 3NIFB 1DAEA 1N9GB 1S1CA 1D4AA 3HCPA 4IIYA 4A82A 3KR2A 2A57A 3BHMA 2PS1A 3LDFA 1EK5A 2OD2A 3QRWA 4IV8A 2J7KA 3UW3A 4F3NA 1KJ9A 1KZ9A 4FMPA 3TG2A 2IBTA 3QVOA 1CF9A 1SQ6A 1T4DA 1SR8A 1MNQA 2Y4NA 3JQ7A 2YJ3A 4UOEA 1Q91A 5LNK1 1Z7WA 5EINA 3L02A 3TIVA 4HBZA 2FRVA 3DKVA 2CMDA 2ALJA 1W0CA 1NLMA 2PSSA 3H2BA 4FMBB 4CUKA 2XCIA 2FPGB 1O96B 1ZFNA 1D3AA 4UD6A 4ONEA 1SOMA 2P2ZA 4KPYA 3W9BA 2O1EA 2OC4A 2QPLA 4KTVE 1UBJS 2AK2A 2V4MA 4D9BA 3L6DA 3RSQA 1RWQA 4NFHA 4KP7A 1I14A 3CLTD 1BMFD 4CDMA 2B1QA 2DCMA 2ECFA 3JQ8A 3OIYA 3DAGA 3QLVA 4GAEA 4JLDA 4UW9A 4EYOA 1U28C 4PYNA 4PX5A 2QU8A 3R8FA 2ZRIA 2Z6UA 5DEOA 1ORDA 1Z0KA 5IHPA 3OC6A 4WGFA 4BKRA 3JXEA 1FDUA 1OPRA 2FSFA 3A9WA 4BGUA 5DFAA 4BV3A 4IW3B 5B1YA 5HQ3B 1XVTA 4UQLA 1XMOB 1X80A 1RJFA 3KZCA 4AU1A 2QQ5A 3G9QA 2XA9A 3LWBA 1WXGA 4NJMB 5EPOA 5EWLB 3WKAA 4JQCA 4Q24A 2UUAB 1I3LA 4H7EA 2YZGA 4JOBA 3KFLA 5CIWA 4YNBA 4LTMA 3UYLA 4BO9A 5JSKA 4OB7A 4ZREA 4YJGB 1FVOA 1ZLXA 2R25B 2WIFA 3KJNA 4E3WA 3MGGA 3NOVA 4PW0A 4Q3EA 1JALA 3QLUC 4OKIA 4RCYA 4TL6A 1GZ6A 5CDFE 3JALB 5BVHA 3H5AA 3FOFC 1LX7A 1RCUA 4FHEA 4QOHA 3CX6A 3MTGA 4KWCA 4LGYA 1U8FO 3V3KA 1FW6A 2A2ZA 3CVXA 3VX3A 4P4LA 4IIGA 4JI3B 4QGGA 3HR7A 4AZ3B 4ZOEA 4O1IA 3ZW7A 4HX5A 1O4WA 1U3FA 3KU4A 1J00A 2I65A 2J0UB 2JHAA 1DX6A 4RLQA 2W6PA 4GMKA 2OK8A 3KSBC 4JUCA 4B2IA 2Y6UA 3DKRA 2GH1A 4R16A 2EGUA 2ETXA 4GYJA 3UGJA 3WK4A 2EFEB 5LLDA 1EFVB 3GA0A 4U2CA 4YX9A 5FT9A 1R8SA 2PLNA 5DM70 1Y1QA 4UUQA 1LGYA 4QAJA 5JSZB 3TDKA 2AC4A 1KKMA 2DBVO 3IB3A 4CLRB 4YUWA 1Y3FE 3MCTA 4DJAA 2DQ4A 1YF3A 1SKYE 1NHWA 2XGJA 4PBSA 4X1IB 2DHCA 1AQNA 2RGRA 3CURA 1V37A 4TS9A 5HIMA 1VSVA 3ETLA 4Q01A 2GZAA 5KNBH 2XMCA 4QOIA 4YIHA 1FP4B 3ZU3A 5AFSA 5KNBA 5BR4A 1ZLYA 3KTAB 3QUBA 4GI5A 2RK3A 1E99A 4WY5A 1T0IA 1PJCA 4U7HA 4XD2A 1MZVA 1A9QA 1J8QA 3B1VA 2ZM6B 1I1QB 3LL7A 3RFUA 1LPPA 3JRWA 2Z83A 3LK6A 1JI3A 2QX8A 2P62A 1JEAA 2BFCB 1ZI9A 1F17A 4EW6A 3EVCA 3ZXXA 2W2MA 4BX2A 4R8RA 1XXLA 2FPXA 3ESXA 3X1XA 2QAGC 5A62A 1HDGO 3ABOB 1XAIA 1CUBA 3GUYA 4GZ5A 5H5JA 4B34A 5THKA 5I8WA 4BTVA 5B1IA 2ABWA 2QLFA 3NHPA 2OCPA 1L7BA 1J0BA 1XD2A 4HAZA 1FTSA 4FYXA 4MZDA 4P86A 3CINA 3UJCA 2GHQA 4GWKA 3CW9A 5K05A 1C8LA 3A6GA 3LWNA 4YLGA 5JWHA 1A5BB 4Q66C 1USGA 3OPXA 4QX6A 5IT4A 2ZS7A 1ULAA 1XIVA 4LBZA 4A5SA 5IVHA 4RLSA 1H2ZA 1KK3A 3BKXA 2QUAA 3T9CA 4RW0A 2HHLA 1XTKA 4LQCA 4WNCA 2BI8A 4NNOA 5FOXA 3QEKA 4EAQA 5CXXA 1WQ3A 1YONA 1GQYA 1WSAA 5P21A 2DZDA 3IPXA 4IOMA 4YT5A 3PNBA 4KGXA 3O3NB 2O8CA 3IILA 4J1QA 1FZTA 5T3UA 1DKMA 1K92A 3NV9A 5FUYA 2BIFA 1CHNA 2E4ZA 3LXUX 2D1YA 3DDUA 4NJEB 3ZE2B 1ISJA 4QLAA 3OZUA 4OHYA 3RQSA 2ZWIA 2C4NA 3L82B 4BNTA 4R71A 1C30B 4Z9XA 4DZRA 1F14A 2VF4X 3HWRA 1Z26A 4J90A 4DCOA 3PE3A 3O83A 3TFWA 3E0QA 1EM8B 3DTTA 3ENNA 4CGZA 4GF5A 4KQKA 2Y1CA 2GK6A 1UJ2A 5FADA 2V3WA 3FUTA 3KJHA 3OKAA 2P5TB 4LK3A 4Y9TA 3U39A 4MDFA 5ITZA 4KG7A 3TTWA 1KO1A 4DQDA 5IKMA 3KQPA 3V4SA 4LYHA 1PFQA 1GO2A 5IBRA 1GDHA 4AUEA 1U3UA 4UNSA 4BZPA 1BJKA 4R1OA 4HFRA 3SXJA 2CNWD 2HIGA 2QROA 1Y80A 3GY0A 4UBJA 4IH9A 3BRQA 1AHPA 4ZYVA 4J9UE 3IAM6 3RRZA 4DUYB 4OGFA 2IUFA 2BMVA 4WBNB 2G5TA 4EFMA 3T1TA 2ZWOA 3WGLA 4DC9A 4GX1A 2B7LA 2ZCVA 4K2AA 2W4IA 4A91A 1SVUA 2CNKA 4WXYB 2INGX 4HBGA 4B6GA 3OLXA 3LX4A 2VK1A 2ZCJA 4UM7A 2G4LA 3L0YA 3ONEA 1LBTA 4MYHA 5K3EA 4BJ1A 3JD4A 3WBKA 5EUBA 4BRZA 3LHIA 4BNNA 1K9VF 3QVGA 2G9UA 4MVJF 2G40A 1PDVA 1WEHA 3GQBA 2ZPTX 3LP5A 4YJ3B 3K70B 5HM6A 4D02A 1YHYA 3IEMA 1L0BA 3WBFA 1TFUA 4C9BA 1UOOA 2Q9BA 1MXHA 2R8OA 2QTVB 3FPLA 4JYZA 5AK0A 1Z6GA 4LZPA 5GADl 1PEAA 3BCUA 1L5WA 2IY9A 2KLBA 1UXHA 3KEFA 2PJDA 3E22A 1E4YA 3OJWA 5FJJA 3NHSA 3PSHA 1N0HA 1PSWA 2I66A <