2OBXA

Lumazine synthase ribh2 from mesorhizobium loti (gene mll7281, swiss-prot entry q986n2) complexed with inhibitor 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
b'HKDYETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRFFFEHFTVKGKEAARACVEILAAREKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase 1
publication title Structural and kinetic properties of lumazine synthase isoenzymes in the order rhizobiales
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
total genus 51
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2obxA00
3MK31 2A59A 5IM5A 1KYXA 4KQ6A 1KZ1A 1RVV1 1T13A 4J07A 2C92A 5IM4A 2C94A 1DI0A 1NQWA 1C2YA 1NQVA 1ZISA 1KYYA 2A57A 2C9BA 1KZ4A 1NQUA 2I0FA 2F59A 2O6HA 2C97A 1KZ6A 3NQ41 2C9DA 1KZ9A 2JFBA 2B99A 2A58A 1KYVA 1W29A 1HQKA 1NQXA 2VI5A 1W19A 2OBXA 1EJBA 2B98A 1XN1A 1C41A
chains in the Genus database with same CATH superfamily
2HIMA 3PJEA 1R6VA 4F2GA 5DP1A 3MILA 1BG6A 3QA9A 2BDUA 1WTAA 3P9NA 3EZLA 3I76A 3KQSA 4QUIA 3V7UA 3OPYA 2SCUB 5TVKA 3CB4A 2GXQA 1I7PA 1XRLA 2FX2A 4XIYA 2O4CA 2BUBA 5HZMA 5U9CA 1L7XA 4IH1A 1H93A 2GGSA 3IV6A 3N2KB 4K03A 4M1OA 4ACBA 4GMDA 4RY8A 1BRMA 1GZ4A 1PR4A 4HN4B 3IUBA 4JYBA 4PTYA 5D3KA 3VR6H 2YMQA 3TBFA 2R751 3WLTA 4PX2A 1JS1X 1NLMA 4ALKA 2OILA 4RCVA 4YQYA 4OOFA 4Q34A 2PZJA 2OOKA 4X6XA 3IA2A 3RYFB 4PRKA 1PEYA 5A5FA 1P18A 1I0ZA 3II6X 4N65A 4B3BA 4IMJB 2EZ4A 2Z5VA 2QYTA 2WHPA 2VPYA 2YNMD 3LAWA 3DONA 4O4HA 4P7FA 4E5NA 1JG7A 4D9JA 2FK7A 3NYQA 5HW0A 4B35A 3KBBA 4LMAA 3C5VA 4YJFA 2BGRA 2HRDA 4IDHA 1B1CA 3U7QA 3W5BA 3O7MA 5AVTA 1KVTA 3T5AA 3I1IA 3CX8A 3EVEA 4JBYA 2VBFA 3L5OA 3C3XA 4U2KA 4N12A 4BQFA 2JJYA 1EHYA 3CU5A 4GKAA 1BSVA 1WCYA 1NXXA 3DW3X 4QUJA 5DX1A 1V16A 3OECA 4G25A 4NECA 2RDMA 5IVKA 1DAIA 2ILTA 3P2JA 1N1DA 5DBOA 3LPCA 1X86B 1FP4A 3NRJA 5EA2A 5J58A 1C9YA 1V35A 4PLTA 2NU9B 2OPHA 1KJ9A 1FXWF 2RGYA 1PK8A 1QQ5A 2FZEA 4X1KA 1U5BB 2B8TA 3EPRA 3PNSA 1QGAA 4PQFA 3KAPA 4PIPA 3WOHA 3ZHOA 1V7ZA 3TZEA 1T26A 1T5BA 3JWIA 4P3OA 3L7MA 4ND1A 4GSKA 1N5OX 2XA9A 1C9NA 2XEXA 2NZYA 3GP5A 5A5VA 4C7KA 4A0SA 5BMVB 1S7CA 2DLDA 2F2TA 2IYFA 3FSJX 1AHHA 2XQFA 4UFNA 3HZOA 2WSIA 4YRSA 1W5TA 1LEHA 2ZS8A 3U3ZA 4FN4A 3ML1A 4HSEA 3RPEA 2XB9A 1E3WA 2KI5A 2O6LA 3EZ7A 3Q7TA 4QELA 1GO2A 1SBHA 4A6XA 3WIUA 5IK2D 1UZMA 2XE6A 2XYRA 3F7TA 1B4DA 1WB5A 4HLUA 3UW3A 3ZTWA 2IWRA 1KQFA 2Z83A 3ZHCA 4O4IA 1HEYA 3LT5A 5JSUA 5MHTA 4FYIA 1ZL0A 4WH0A 3WLLA 3C6QA 3O8DA 3CH7A 4I50B 3HJNA 4W1RA 3DBVO 3TPFA 3H2IA 4RACA 1Q1EA 1BH6A 2HA7A 1OXXK 4TKMA 3W2HA 3O4IA 4J0EA 5IC5A 2ZB2A 1A8HA 1JG6A 1XQVA 2QPTA 2VHJA 3RV4A 4F38A 5ALGA 1EZ4A 2GPAA 5D51S 4ZTBA 3UKOA 2NU6B 1FDTA 4U7JA 4BP9A 1ZA1A 1DZIA 4C1NA 1ZUNB 3X1XA 3L5KA 4JBIA 5C3MA 1NASA 1VIDA 2QYSA 2AQ8A 3DP9A 3N28A 1ENOA 1NMEA 1CZLA 3ONFA 4IDAA 3S27A 2CDRA 1QZXA 3EXHA 4MR8B 3CY6A 5JBIA 4P4GA 4YCJA 1CD5A 4IO1A 3TQQA 2HPAA 2WMDA 4PIMA 3WJ2A 1CFJA 4PLYA 1L7AA 1V71A 3B6IA 2PGLA 4IINA 4KFUA 1FRFS 4Q9LA 3UB3A 4LYYA 1OWNA 4M99A 2CHEA 4NYMR 3UHAA 1KH1A 5IDQA 1BMFD 3FR8A 5AKKA 3R24A 2ZRNA 5FOSA 3GQVA 3WL7A 1C29B 4Q47A 4KUGA 1HKUA 4EW3A 3O8LA 1IK4A 1QOQB 1WEHA 5EWMA 5E7MA 1Y7IA 4NCHA 3WIEA 1RLUA 5L3QA 3M6UA 1V9SA 2PFKA 3I12A 2LP4Y 3HLKA 2UUBB 1T0UA 3OX1A 4BNDB 2EAUA 4ZVNA 5BSVA 4CKBB 1CE8B 1JG1A 5H81A 1PN3A 4HN9A 4CE6A 1JQ5A 5K1ZA 3PRJA 3RAPR 4MAMA 4J0KA 1PNVA 2FUG1 2H9IA 3NYRA 4J2OA 2GBPA 4N54A 4Q0MA 4RSGA 1HETA 4YB8A 3E82A 4UTOA 1VTKA 3NHKA 1IIRA 1GQ2A 1G2IA 4YNBA 2IS2A 4JASB 5E1MA 1USVA 4ZXPA 4IIJF 4EY5A 2FW1A 3GRFA 1J2RA 3E9MA 2ADMA 4QBFA 5CAEB 3K72B 2GRUA 2JBAB 4LJ5A 2OAQ1 2ZPAA 4LOLA 2PEYA 1L5ZA 4JJZA 1A69A 1Q84A 2P9ZA 5H80A 3NYWA 1LSSA 2FMIA 5LZ5A 3B78A 2B0CA 4IMPA 3DTYA 4RK6A 1A9XA 1J00A 3EGVA 3MVEA 2J45A 4BNHA 1UC5B 1TAUA 1E32A 3BWYA 4NS4A 2ENUA 4PZYA 1RC0A 2CHQA 4AQ7A 1CIJA 3EVDA 1BU8A 4M1KA 4XQ9A 2OXTA 3S0JA 1U8UA 3JWJA 1PNQA 2PRYA 4HGQA 4A6EA 5CFPA 4MIEA 2GBLC 4HFNA 4ARVA 1O5OA 4RJLA 4XDHA 4DSTA 2E2WA 2R68A 2WWHA 3ZI0A 3G68A 2FR1A 1G8FA 3FOCA 3S8YA 3IO5A 2BSXA 2CUTA 2IQ5A 3S2SA 2F90A 3K8QA 5LQMA 2IE0A 1B3BA 1NP6A 2E5FA 3ILYA 4ALMA 4YMHA 1BWQA 4KX5A 4RO0A 1PZHA 4EATA 4ZHQB 1XAIA 2QT0A 4KBYA 2IPAB 4ECEA 4KR3A 3NW9A 2B8NA 4ZVVA 4Z1MD 2VIIA 1IPEA 4LDJA 3UWSA 4TLLB 4HWOA 4C06A 5I9NA 4XLTA 1CEQA 1OB5A 1H66A 2PLNA 2VWPA 3MMZA 2JLBA 3TW0A 1KKUA 3VC7A 4EW2A 3TZQA 3DUFA 4OJTA 4TVSA 5L7WA 4IQGA 1XZCA 3P4UA 4RMIA 4FBLA 1WD5A 1RWQA 1YS2X 3MJEA 3RYTC 1I94B 3UPUA 4ZOLB 4B46A 3GJ4A 4QSMA 4QU5A 2PQ6A 5JJ5A 3SSAA 3UAVA 4L76A 1DBPA 2G83A 2G70A 4X71A 4XUDA 3AI1A 4G8JA 1SC6A 4X90A 3UAYA 1U4NA 4ON9A 3W5UA 3EPKA 3BIJA 4LF9B 4Z4EA 3FDZB 2ZBQA 4EZEA 2GX6A 2XA2A 3MB5A 5IDVA 1MAVA 4AULA 1HE5A 5DWDA 1VLMA 2BW0A 4MIOA 5F1YA 2DR2A 3SU8A 1D8AA 2VP0A 1Q7BA 1YBMA 2FUCA 5DNAA 2O1SA 4UTVA 2O8FB 3WK6A 4X6LA 3MWFA 4PGMA 4F9EA 1N3LA 2AT1A 3K20A 1Z22A 4XYEA 5FO1A 3AUYA 4BO1A 1SM4A 1LPMA 2CGEA 3PQ3A 4EVRA 2AFVA 2X2EA 3F7OA 2GASA 3NEJA 3WO0A 1L7DA 5AVUA 3V00A 3G9ZA 3K1YA 1NGSA 3D6AA 3QMPA 1M5TA 3B6KA 4I46A 4DXDA 4G0PA 4JU8A 1RLTA 5FPTA 3NHWA 2WZDA 1ARZA 2I1VB 1UEJA 1XLTA 2V5UA 4IYJA 3DZGA 4CM9A 5K6RA 1QYRA 1KY4A 1LPNA 2C2XA 4Z86A 3TSYA 4C4AA 4GRIA 1T9CA 4INZA 2C57A 2CXUA 2C9YA 4A91A 3RUHA 4UVIA 1RM0A 1WP9A 1DXHA 4JX9A 1E3JA 4QYXA 1P3Y1 1Y9DA 5FPYA 4XYLA 1RFLA 5C5IA 3KSRA 5FXMA 5B5SA 2PANA 5DXAA 4CLOB 1VL1A 3KTAA 1VCHA 2Z0MA 2C7GA 2IUSA 2B7CA 2YYZA 4A0RA 3UK2A 4JLWA 2Q6LA 3UB2A 4XGIA 4ARAA 3QU5A 5D7NA 4AUKA 4DUPA 3LL7A 2B35A 4GWGA 3CPSA 4UZSA 4A23A 4BB9A 1FUUA 3OQ6A 4ACAA 4C29A 2PUAA 1S02A 1NOKA 2C4TA 1XTPA 4GYYA 4KLRA 2PVSA 5AW4A 2ZATA 2ZIVB 3ROEA 2XE4A 3R9WA 2J08A 2Q07A 3GB9A 3MT9A 5DHSA 3U81A 3IVMA 3L77A 4G36A 3I8SA 4LNHA 1YO6A 4DUGD 4PHHA 3NTXA 1QH9A 3HJCA 2QK4A 1EGHA 4Z3DA 2BTOA 3UUEA 1V6SA 3CRVA 4KPGA 5F7ZA 4RTSA 1RI4A 2TS1A 3HO8A 4FMCF 4GOXA 4M1MA 1Z0JA 1Z4JA 3JQAB 3V1LA 3WO1A 3SD7A 3EUAA 2FNAA 2DX7A 2BV3A 1QJCA 4S1WA 5KYVA 3FCSB 4DQXA 1E94E 5DV9A 1F8UA 1NW6A 3P0FA 2P78A 1V96A 2WHYA 1V2HE 3U7IA 3B2NA 5AKZA 3B5JA 4R8SA 2P9EA 3WNBA 4AG5A 4D80A 2ZSBA 1HFKA 1XBTA 5IH3A 3FFAA 3L04A 3QWBA 1UDBA 5LXTA 1Z5PA 4MQ4A 4V02A 2O5EA 3RAEC 1AU9A 1W87A 3PCRB 3Q4GA 4DMMA 2GPJA 2QNBA 4EEKA 2NQ8A 5IBCA 2IHJA 3C8HA 2NMVA 4J0HA 5DNYB 1NJ1A 3GJYA 5C8XA 2P75A 5LLTA 4I0WB 1PT9A 1MJGA 1ZM4A 1AHNA 4Y0VA 2NUBA 3H5NA 1LBHA 2LTAA 2JCYA 1MKYA 3EZ9A 1O03A 1NYLA 3GAAA 1OBCA 1Z63A 3GI1A 3FZYA 2OORC 3DXZA 4WBNA 1JDBC 2GTPA 3ZZMA 1XJWA 3T7IA 4A6DA 1U7TA 2I5PO 2QRZA 3C6KA 4JR2A 3SJZA 4A8PA 1A2KC 5AVRA 2OHJA 5C52B 2AQHA 4DLXA 2XRMA 4BFXA 4G85A 1YVUA 2VPZA 1SEPA 1ETHA 1UWLA 3FNIA 4MVJP 3N0XA 2G8NA 3QITA 3RF6A 5FOQA 3G89A 1XEXB 1U2DA 1U7HA 4R1QA 5ITSA 5LMUB 2CNLA 4HADA 5KQRA 4G8DA 2MINB 2Q0HA 2Q8PA 1XNRB 1CJVC 2ZI7A 2RC5A 2XUHA 4L4XA 1Z9BA 1ZSNA 5HF9A 2OCAA 1W4BA 3T3MB 3CF4A 4XIGS 1NVXQ 1G5QA 3WQSB 4C87A 4DE5A 4M0EA 1DT3A 3BE6A 2FPKA 1E89A 4I4TF 4HAOA 3LY5A 1MEOA 1R74A 1NUAA 4LJ7A 2GETA 3N86A 1OLOA 4FT2A 4U6SA 2Z58A 5EJ2A 5BN3A 4MV4A 3AJRA 2AE2A 5L4NA 4W5RA 3VJRA 2NVWA 2YOGA 3IGFA 5L3SB 3ZDXB 4PYIA 2LNDA 1MOPA 4W1SA 1ZI6A 3U09A 2GNPA 2PL3A 2YWGA 5EZYA 4IFTA 3S2EA 4ZO9A 3DZIA 1IWOA 3GP8A 1XQ9A 1W19A 1UWKA 2Q4TA 3EQ9A 3ISVA 1Q0ZA 2YVUA 3PQ8A 1ZJ6A 2H59A 5BSTA 5C4MA 3ZU6A 5EJ9A 4ETIA 4OREX 3AH8A 1DKUA 2EW2A 2GDZA 1A5SB 4MYDA 1UEIA 2E1PA 1R8XA 1KJNA 4JJAA 1BQ4A 5HTOA 1CEEA 2FOLA 2X23A 1KU6A 2X77A 3RYCA 3UKJA 1MW9X 1ISGA 3ENKA 3K1TA 1E5XA 2EBFX 3A0UA 4BZPA 1KAQA 1Y48E 1P2UA 1R5NA 1OZ0A 2HRQA 4R2HA 4QQNA 3JQGB 4TLEA 4LX0A 1A4XA 4B47A 2XUKA 3ZBTA 2CXQA 5TX7A 3MQ2A 4YJ3A 1H05A 2WSBA 3WIDA 5ALJA 4JI4B 5DN6D 1UJNA 3NP9A 4B7AA 3HI6A 2IFTA 4EX6A 4E22A 4IQ0A 4RYDA 1BJKA 3AERB 4YALA 4Z9FA 1V26A 4AN0A 1ZFNA 3T5PA 1Q6YA 3MQFA 2DBRA 1WQ3A 1TZJA 4RGVA 5CLGA 5ICEA 4LF7B 2UUAB 3TLGA 2VDOB 4Z0PA 1UJ2A 1Z6PA 2FN9A 3E6AA 2ARKA 2G17A 3R3VA 5GJCA 4JC8A 4BMZA 1KPIA 1X7ZA 1F9AA 1C0EA 1OILA 3CO0S 3WTCA 4NNOA 4YAKA 1M1UA 4E1VA 4E5YA 5F4ZA 4KPYA 1UM8A 5A03A 5GZ3A 2CLLB 3VYWA 1HF3A 2Z04A 2ZXFA 4X92A 5EKTA 3LHDA 5HR5A 1SUIA 3CN7A 5IAOA 4NKRA 2B9EA 4RXMA 2A14A 3W5CA 3NGMA 2PT9A 2ZBFA 1P1KA 1CETA 2BGNA 1XMJA 4DDMA 1N3IA 1YB2A 5F2KA 5EJ8A 5AYVA 1K6JA 2G7ZA 4XZ3A 3WGZA 4GQIA 3ZE6A 1UP6A 3M82A 2UXBB 2DQ4A 5IZ4A 1PGQA 1TKRA 2HD4A 4JVOA 5FNVB 3BE8A 2K7FA 1K8QA 2OLJA 3HWRA 1ENYA 1BHO1 1VJ5A 4N0MA 2C31A 2FXIA 2I4LA 3NYIA 4EW6A 1CUHA 3QOWA 3SN6A 2V9CA 2WP8J 4RK7A 4TV8B 1IHOA 2HBZA 4YRPA 2PKRA 2FP4B 3IBFA 3M1YA 3CZQA 3FPKA 4IUCS 4QUGA 4W9RA 3VHXB 2CWWA 3WP1B 3CZMA 3ZZNA 5I9BA 3BRCA 4MYUA 3D8TA 4TQUS 4IQFA 3TFWA 1GFSA 1KIAA 3KZMA 2X5NA 4TMVA 1E9DA 1ULAA 2ZROA 2LR0A 2NTYC 1GADO 3OQVA 2Q5IA 2OAEA 4D41A 2ZUBA 4GRAA 4P84A 5AVWA 3P4XA 3U39A 4UU8A 1RYFA 2E7ZA 1WWKA 1W36C 4HRVA 1U98A 1GPBA 2EX1A 2PD4A 1V11A 1Z2NX 2IZ1A 4MICA 3P2KA 5D01A 5IYZF 1QQAA 2H9YA 1Q20A 1V1MB 3SY8A 1OBOA 1REQB 2ZIWB 1FFDA 2ASEA 2EYUA 3KTDA 1P1BA 4FYVA 4FOTA 4BV9A 1UJCA 1TT7A 3HBJA 2VXYA 4IVRA 5AD1A 5IHPA 3I64A 2XKBA 3EAFA 3IULA 3EDQA 1NU6A 3IPLA 2NVOA 4YI3A 4LNUB 3SOPA 3WYEA 1IN6A 3B1KA 1MCZA 4Q82A 1UL1X 4PYQA 1CQPA 3SZLA 1RZVA 3OZTA 1JKFA 5DK4A 5GJWC 1KE1A 5IKPA 1SXHA 5C8DA 4NV1A 2P4HX 4GKBA 3L0ZA 1T29A 4EVSA 1MA3A 5CXSA 1U6IA 3EDMA 4EKDA 3H97A 1E58A 4IJ5A 1UZLA 2VL7A 2YIMA 3OJOA 1D1TA 2JNWA 3VR5D 3LF1A 4BLOA 5JH7B 4Q48A 3IL2A 3KOMA 4DLUA 1GLNA 4QEDA 4WDQA 5E6SB 1UPUA 1Y8CA 2YWDA 2YX1A 3VPAA 2GBGA 3K1AA 3CNEA 4IZ6A 2VHTA 4RVNA 1AF4A 3RAJA 6Q21A 1B2LA 2ZW9A 1WMEA 4L28A 2XZOA 4YCSA 2P9CA 5DSXA 1T4GA 3SFZA 1Q50A 4N40A 4MZXA 1KY5A 4L9RA 1XWWA 1DTWB 3MWKA 2PZGA 4HJRA 1K88A 3S7TA 4F3TA 2ZB3A 1SXJC 1QPBA 3MINA 4DSAA 1R0YA 2WQ6A 2YNMA 1DBIA 3RNLA 1ISSA 3OHMA 2X2PA 2GYVA 2MSDB 4Q1AA 1XCJA 3DXYA 2BTEA 4BUCA 1ZWKA 2VUUA 4B3DA 5BWLA 5EJAA 3WGIA 4B3GA 1G6HA 2X7XA 4OGFA 5CVDA 4U2DA 3BFKA 2XYHA 2OBFA 4O2LA 2AK2A 5J2TB 2WLSA 3DBHA 1G38A 3GFBA 3N75A 2ANCA 3R0QA 1E69A 4A4DA 1UPCA 3LYLA 1UKBA 1BKDR 4ZI3A 5K8TA 1Z75A 1FZTA 5I8PA 1FCJA 1X6VA 1U0HC 1XKQA 1FA9A 3BF8A 3HU1A 5FJJA 3TPCA 3TXAA 3C8ZA 4F6RA 3VPSA 1RQXA 1KI6B 2V0CA 2HF2A 4CUKA 5E7IA 4KXNA 1UJBA 2G0TA 3VVMA 4KQ9A 3C3YA 5AM4A 2OFOA 1HE1C 2ABWA 3GFQA 2RGCA 3LOPA 4RQTA 4YGXB 5HJ7A 2J67A 4H7PA 4CG2A 4FZ3A 1ZGBA 2UVPA 3EY4A 3ZK7A 3U6BA 4RZ2A 2GZMA 4FDMA 2P1DA 1VYHA 3A10A 1E7SA 3RC8A 2MMCA 5E4FA 1M1YA 3WADA 3NHBA 1SKBA 1J24A 4RK4A 1ODKA 2IK8A 3KEGA 4P58A 4CXMA 2ZSDA 2BKAA 5JZBA 1XUOA 3LH5A 3O6VA 5ERXA 4CM8B 4IUDS 5A71A 1XDGA 1YBVA 3TB4A 3H75A 3C5CA 3S1LA 6PFKA 1DCMA 2HFKA 2BBTA 2PT6A 4UJ3A 6ADHA 1G9TA 3I9V6 4D57A 3ROZA 2C88A 4XRGA 4YXFA 4G84A 3WV4A 4FSHA 1Y89A 2NZ8A 4F2DA 4W8HA 5LP6C 4FI3C 1YDGA 4TLDA 1GYRA 3OI7A 3U4CA 3V32A 4MDFA 2C20A 4REOA 4S1OA 821PA 3O8OA 4LCEA 1E1QD 1Q19A 2XADA 2V5AA 4I14A 1H6CA 4W7IA 4YP1A 1M9NA 1OFUX 3AR7A 1CS0A 4N4AA 5A5DA 1Q0SA 2DBYA 2JB9A 3I72A 5AQ1A 3BAZA 1TQ8A 4HD8A 1F0PA 4JH0A 2NYRA 3NM5A 4A7PA 2BFWA 2ODWA 1BX0A 2C9ZA 1R37A 4C9BA 3BTSA 4EK9A 4ZAGA 1GCUA 4DNQA 2LXNA 4BNLA 2F1KA 2C03A 5KJ6A 1H1LB 3L02A 4UHFA 3EY9A 5GINE 3U4HA 3M70A 5EE0A 4ZT4A 2PIDA 3P2OA 1I5OA 3EJWA 3L1JA 4ZYLA 1AQUA 3IKLA 4U8GA 4JUFA 4CLRA 4OLBA 3R2JA 3ESRA 2QTGA 3B7PA 3DWEX 1FMFA 4EH1A 3T9AA 2BKXA 5JVDA 3HKDA 1JU3A 3WQQA 1BMQA 4ZC1A 3PZBA 4DWJA 4DNFA 4RHYA 5C4IA 4ENQA 1BCSA 1KDYA 2C2GA 2X58A 1U0JA 1MX5A 3TM4A 3K5IA 2BOVA 2CFCA 5DB4A 1HYQA 3DCYA 3GRUA 2W6ZA 5HJ2A 1NMXA 4ND3A 3QE0A 2VF7A 3ZVLA 1K3TA 2CDCA 3FNGA 1PJQA 4IIUA 2BJWA 4N0QA 4DM7A 4WZ6A 3WWZA 3AEUB 3AIMA 2OB1A 3GIWA 5FPKA 4KQJA 2MYTA 2Q6TA 4U6NA 2X4DA 4JOBA 5E4TA 1PU2A 1YJ5A 1FJXA 3H5RA 3BMCA 1BAPA 1ZM2A 2NO7A 1SN7A 1P75A 3HYLA 4CIWA 1O8CA 1ZBDA 2H2IA 3LT4A 2WD9A 1Z6ZA 4HDQB 4PGGA 4CDRA 2QZZA 3HJBA 1OYWA 1T8WA 2CHFA 3OU6A 5IT9A 1IZ8A 1N57A 2D5IA 4Y6QA 3G0DA 3LHFA 3OMWA 3DE0X 1Y6GA 1VCNA 3QHAA 4IR7A 4LY9A 4WN9A 1GDHA 2ZCUA 4W1QA 4C07A 2Q62A 3QZUA 3TNYA 3CVXA 5EKSA 4GKVA 4J1SA 2CLMB 3ZDZB 4MKRA 6NULA 1IIBA 5H0IA 4D8UA 2GCNA 5DEIA 1PTJC 4BFVA 1NF8A 1DKNA 1HQKA 2PLRA 4WZBE 4YDHB 3TR6A 1M2OA 2GESA 2HSJA 1DRKA 3H4VA 4OMUA 2A5FA 5AI5A 3P19A 3GUVA 3LW7A 4MRNA 4U02A 1CVLA 3ECSA 3ANYB 3TVDA 4JGGA 4RAQA 4CR8A 3CO5A 3TMKA 4HNAB 3IRVA 4IDFA 5HSGA 4AY6A 4HVLA 4EJ0A 1JEOA 1XDWA 1RYBA 2X0NA 1CSEE 3ASYA 4IOKA 2JFFA 3QXHA 1P1CA 4GXTA 3UZUA 4ENWA 1ECPA 5KKAA 2XT9A 3RNOA 3VISA 4D44A 3V80A 3FTPA 5FD8A 3B6JA 4BQSA 2E85A 1SCUB 1SCNE 1L5RA 3I1FA 2ZK7A 2AMFA 3R3UA 1XCOA 2PDAA 4MUYA 3TBHA 3WX0A 5K45A 1V7CA 2ZI6A 4YT2A 3D0QA 4JBLA 4YIHA 2EG9A 1H0KA 2DQYA 4RZXA 1IY9A 1QYWA 3FSEA 5AQEA 2KS6A 3EA0A 5CYPA 5JC8A 1E3EA 1VOTA 2XMZA 3F4KA 4C7BA 3WRXC 1ORVA 1I5RA 1W0JD 2XKKA 3CGGA 2VNHA 4EKNB 4JZYA 2EL7A 1FB5A 3NB0A 2XUJA 1MF7A 5KVQA 3H9GA 3ZIDA 1K86A 4HYTA 1UDRA 3SYMA 4CM4A 5AHOA 4G65A 3TG2A 2BE7A 3U17A 3W5AA 2DUMA 4O2BF 2BEVB 4HV4A 2F00A 2V97A 3SC4A 1UT6A 2R25B 1QGUB 1B2RA 1A8UA 3I9KA 5JBQA 4AP5A 1ZGAA 2CD7A 5B4UA 2CDAA 2PRSA 3BEOA 3NTRA 1V2GA 1J21A 4J0FA 2PHZA 2Q5LA 2XQKA 3AHDA 3SIXA 1FYDA 2H9AA 3JU3A 3FCYA 4X6UA 5LOVA 3H1FA 4GUAA 1ZW6A 2IUTA 4PS1A 3F9IA 4B6QA 3AF0A 4JOSA 5KNCH 3ND9A 1MX1A 2Q50A 1Z62A 3ENZA 3LX6A 4IIJB 4ITUA 2EFGA 2QGZA 1PNOA 4TKVB 1H2HA 2PQMA 2QS9A 3CVVA 1KBZA 1X77A 3UPDA 4JLDA 1OE0A 5LLSA 3N0WA 1YS9A 2OM2A 3JASA 2FU5C 2OEPA 3E1GA 2ZRGA 3BDIA 2GNOA 4ED9A 2AI1A 3BKWA 4D8XA 3OKAA 5CA0A 4YT4A 3CZRA 3Q7RA 3QA3E 3RRYA 2C2MA 4A2WA 4HJXA 1LLQA 3MN1A 5AVVA 2IY9A 4EG1A 5FTWA 1EFKA 1P4AA 2WDZA 2AFRA 4NBNA 4D9FA 3OP4A 1Y63A 3ONWA 1NY6A 2JLUA 2COKA 1KDPA 3GJZA 1ZJ4A 1VE6A 4J0DA 4MDHA 3H87A 4TS3A 3SMVA 2MWMA 1RW4A 2B1RA 4BXOA 4BJ6A 2MTBA 3CNHA 3NAMA 1NR5A 2GEJA 1K4MA 4LOIA 2MSLA 4KN5A 1ZD3A 3ETJA 3G7SA 4B34A 3KB8A 3N5CA 5HMLA 1VBNA 3ZWBA 2UXDB 1SCIA 2YRXA 3VR2D 1VC2A 1R66A 2EBUA 4OP1A 3MTIA 4QL3A 3O21A 3HEAA 5KQGA 2DFLA 3U16A 3OQMA 2Q3LA 2NV6A 1AB5A 3MGGA 2Z6AA 2R60A 4TSRA 2YN4A 2W2LA 4YHBA 3M9XA 4QAJA 4N5NA 1ZYUA 4P5PA 2WY2D 3ACCA 3WBBA 4BNXA 4D25A 2FQWA 3BWCA 4QPPA 3ZBQA 1PL0A 3KVVA 3Q9UA 2PKXA 4NS1A 4HLQB 2X1HA 1RD4A 1BNCA 5A0TA 5DPMA 3AFHA 1FTWA 2BHSA 2ZYTX 3FW1A 1CG6A 4XGKA 1NX6A 2SBTA 2ZI3A 1IU9A 1JV2B 5JCPA 2WWXA 2WLTA 3DBLB 3L2OB 1J0DA 3T3GA 2AJ8A 3I4FA 1IONA 3M2PA 2C7QA 1T10A 2WM2A 4DNPA 4Q7MB 4NEHB 4KR2A 1DFHA 1GGVA 1QGZA 1Z3CA 1RYNA 2AZMA 3FLMA 3GUCA 1AK2A 3E9YA 4OQNA 5FBHA 1UQRA 3HCAA 1QIKA 3EZ2A 4FHCA 1NSYA 2DHEA 4WFIA 3WP0A 1KYIA 5IAGA 1O96B 4WNYA 3QPDA 4AKIA 4EJMA 2IYQA 1IOVA 3LXMA 3RHSA 1KYWA 4M36A 4UTPA 1GZVA 4BQOA 2IV7A 2VDVE 1PYGA 2ZUDA 3KKOA 4I2NA 4Q3LA 1S2GA 2BMVA 1ZVVA 3KR1A 3R6WA 3QEMA 3LVFO 4Z53A 4IIDA 1I2DA 2QSUA 1X3LA 3GA0A 1G1AA 1Y3DE 4DCGA 1I0IA 5DDIP 3DKPA 3KL4A 2RI6A 1PZMA 3HA2A 3B8EA 3JRNA 4RELA 4BKRA 4CL8A 2H4FA 2XWPA 4XSVA 4NR0A 1F2UB 1N8NA 4DYHA 1V5IA 2ZJ1A 2Q9BA 1L4YA 2Y92A 4MRPA 2OPBA 5A06A 4FYJA 5F1KA 5JYEA 3DR3A 5CEEA 5M5BA 5IKOA 3TGPA 3E61A 4FOPA 5CVTA 1NW7A 3LC7O 3O1LA 3VOTA 5BYAA 3ZIAD 5BW6B 4I5DA 5DGDA 2O8CB 1QNLA 2H2WA 2PRIA 3PFIA 4ILKA 4MHSA 1FJ2A 2FUEA 1N2ZA 4YCDA 3VBEA 4CFSA 3DMTA 1Y6RA 4HXFB 4R31A 3U19A 4KOEC 1IY1A 1BVRA 4B3IA 4P6VF 4GSYA 3JARB 1L7EA 5EJGA 3D7MA 4HEA1 4PBSA 2HWWA 1PS8A 4H7JA 5COQA 2RGDA 1M34B 4BNKA 1GQQA 1U8CB 3DWIA 4DPMA 3K0SA 5AKYA 3KO8A 3BS4A 4B6PA 4J16A 4EJSB 3PNQA 1JMYA 5AWFC 2K2QB 4HNTA 2DBVO 4GF5A 4ZV9A 1R0XA 2BN4A 3EVAA 3OX2A 3FWNA 4C03A 4JI7B 4ER5A 1DC3A 1A8PA 2BH2A 2BDTA 3D31A 1HMPA 2JKYA 4QJ5A 3RT1A 3C3MA 4EVQA 3QSYA 3LP6A 4GZ5A 1LU9A 4MNTA 1IY0A 1P5RA 1EIWA 4HBGA 3CEPB 1SNYA 3O26A 4OF4A 3E9QA 1G59A 2H57A 3AESB 2Q4EA 2WWGA 2GM5A 5JC1A 1GPNA 4PYKA 2JJ1D 2NYAA 4DM3A 2YVAA 2J46A 1R0BA 3EFEA 1L9XA 1CJBA 1PTKA 1E6KA 5KYXB 1PLKA 2C99A 1L8OA 1QVVA 1WXGA 2QUKA 3RSFA 8GPBA 2XI4A 3L06A 2QN7A 2UU9B 1IQRA 3QF4A 4R84A 4JVMA 3ZKWA 5LP6F 2JG3A 4NDZA 2BVNA 4ZMBA 4Q39A 1TKAA 3CQ9A 3H5OA 4HWSA 4KR7A 4IFIA 1SO8A 4L2IB 1PDVA 4IXMA 1QH1B 1NIJA 2KQUA 3DHYA 4HL6A 4R1NA 4RWEA 4E7OA 5KX5A 3TKYA 3R5HA 3TRHA 2OXEA 1NNUA 1BYUA 1J8VA 4IWNA 1Y98A 2VNKA 4BX2A 3JQPA 4LCBA 3TQTA 3SDSA 2IPMA 1GAJA 4HLUC 3WB2A 3JRXA 5DCYA 4B3MB 2IIBA 1ECFA 1UOPA 1MPTA 5HUQA 3JALB 1CQZA 2O0MA 3IDSA 1FFEA 1SBTA 1O9HA 1P29A 2QL5A 3P5SA 5JE8A 3HBFA 3HWWA 3F5MA 1SQGA 3LSYA 1I7LA 2OWDA 1QCDA 1YMUA 3AYXB 3BIWA 5DM60 1W5SA 3JR3A 1Q1BA 3GOQA 1ZAKA 3KEOA 2EYQA 1AOXA 1VHTA 3JR7A 4U3JB 3OE1A 4EX7A 5LQNA 5J4KA 1TPYA 3R5SA 4KJZA 1C8LA 1H2YA 1TX4B 3ABOB 2H5JA 3CJTA 3LA6A 4IOLA 4UNSA 3H9BA 4BCCA 3ZDYB 4TSFD 5C7OO 1ILEA 3BJZA 4BAUA 4HQRA 3FPEA 1LX6A 3E22B 3OJEA 3RUEA 2CCJA 2CZQA 3EXHC 1T1EA 3FWYA 3FNQA 2JA2A 4K9DA 1V5WA 2ZR8A 2FSUA 1OY1A 2ZJOA 3TZKA 2QTHA 2CJYA 3L6DA 3EE6A 4F9FA 2YJZA 5FWYB 1U1IA 3F5QA 1T5DX 1OX4B 4YCBA 5AK6A 3X2SA 3BMQB 5CB0A 3EIFA 2B2CA 4EW1A 2IXTA 3IURA 1Y5MA 3AI3A 3B3QA 3IJEB 4KGZA 4BQNA 2QSYA 1DWUA 1HDXA 1X1RA 2VKQA 1LDBA 5KTRA 3OCXA 2A0XA 3QXXA 4URHA 1MOQA 2X9QA 1W4LA 1EGQA 1ZO8A 3TI7A 2Z2YA 3FGZA 2MHCA 3NHPA 4HAXA 3KU1A 1G2QA 3NORA 2E6UX 5JYBA 1HO3A 2J9FA 1UWVA 2AXNA 1NUPA 3N8HA 2AFIE 3NJ4A 4I66A 2FG5A 3G5LA 3H2SA 4P36A 5T41A 3UMFA 2CNNA 4YWHA 1XZJA 2WTXA 3F6BX 1YOVA 3G0IA 4QTYA 2CVHA 4F6CA 3L0YA 1NAIA 2Y93A 4JLMA 2G71A 1XU9A 4UUQA 3K15A 1TM7E 2E5WA 5CG1A 3LY7A 3OTHA 3O1HB 3WLMA 1FBNA 3CE6A 2IEIA 3LDUA 2XRFA 5E0KB 2QG4A 1F48A 1PGNA 1JEEA 2C94A 3S7ZA 3J81A 4PCVA 2XZDA 2ZJYA 2JGMA 4V1CI 1UXKA 2W58A 3JD4A 3NWOA 3Q15C 3ZW7A 3AB3A 1E3LA 4DIEA 1WUYA 1XD2B 1JQKA 3R23A 4MUIA 2H6EA 3OOSA 3PEUA 3VR5A 3ZYCA 4B6OA 5KZMB 4RZIA 3K9QO 1LTKA 4B6GA 4RPIA 1ZOSA 3NQ41 3PUXA 1FK8A 4KE7A 4R2JA 1XR3A 2Z2XA 4UARA 4YXWD 5KDDA 2DKFA 2JGJA 3ZNQA 2VJQA 4G63A 4UMDA 2C9MA 3L6OO 4CTOA 3I5XA 4OM7A 4QGSA 4KGXA 1POXA 5H4HA 3LM8A 3TLYA 5F2NA 2A4KA 3AC0A 1N2CA 2J3HA 1KVRA 5CDHA 2H52A 3AQ4A 4GI2A 2VDKB 2DPYA 5AXAA 2R8YA 3JWHA 1TMYA 1VPLA 3PF9A 5FUYA 1U2EA 3VNSA 5ILQA 1VG1A 1GTL1 4FJ0A 4CU2A 1I2BA 1WUTA 4CEJA 3K1ZA 1SULA 1ECCA 1ZM3A 2K87A 3LL4A 3NIGB 3ZZ0A 4EHBA 2ZE6A 1A72A 2YW2A 3TW8B 4AURA 4FJ1A 2UYOA 1IHXA 1EFCA 3E9EA 3K35A 5BYKA 4LWOA 1AVTA 4PFSA 4P0QB 5EC8A 3L7DA 2BR3A 2BLLA 2HF7A 1E8MA 3I8OA 3PXDA 4OX9B 5GOZA 1CUIA 4UBKA 1QIFA 3FDXA 4H3VA 1OREA 3CNQS 1RRMA 1QO9A 2CJXA 3WC4A 4KRFA 4CM1A 1E0DA 3KC2A 5I3ZA 1RABA 1NF3A 4D9BA 1NXTA 1PDOA 3C1OA 4L08A 4S1PA 2EQBA 2DERA 5G4KA 3G6KA 4UHEA 4BEWA 4M0FA 4H9GA 1WIWA 3EFBA 1GPLA 4Q18A 1YCGA 4LG1A 2R79A 4XM0A 4KSCA 4IDGA 4BBPA 5FWXA 5JMOA 4ZZ0A 3BN3A 2WA2A 3ELUA 1A9OA 3E1KA 4HATA 4DMGA 3MOSA 5IYZB 1QU3A 4UHCA 4UNPA 1ZUD1 1CR0A 1U9JA 4I9HA 1EA7A 4KWEA 5TC4A 4B4WA 1K8ZB 1G3RA 1N6OA 4L5CA 2Q3FA 3BKXA 3ORYA 3U0VA 3PC3A 3RBZA 1Z4MA 4RORA 2D2XA 1UF9A 1Z12A 1DT5A 3ODPA 3SBEA 3WK8A 4ZYZA 4NBTA 3KJQA 5HDQA 2ZJ7A 4C4SA 3O8RA 4QM6A 2Z57A 1W1WA 3Q8XB 4U0JA 4Q7QA 1XYYA 1TA4A 2DCMA 2FRXA 1XLTC 3THYB 2NO1A 1TE2A 1RLMA 2UZ4A 2O3RA 5KEIA 3OIUA 5CM9C 5B1HA 2I2DA 4EY3A 4BAGA 4FFBB 4QBGB 3ST7A 3OZ7A 1EU1A 4LEIA 2RHBA 2IJGX 3GQBA 3ZEAA 1JU4A 3UO8B 3ZWQA 1DL5A 1RJ9A 1Z4KA 4R9RA 4LY3A 4L9SA 4DC0A 1QLHA 3HLTA 4FQ7A 4B3CA 5G3ZA 2Z9CA 3QP9A 1GEGA 1W0KA 3RG2A 4X1OA 3C6ZA 3O2JA 5J5AA 4ES6A 2J9GA 2XNDA 3HO1A 3DO6A 1FDWA 4PZCA 4ZALA 1EIZA 4Q9AA 3SLGA 1KY3A 5LVAA 3NHMA 1R5JA 4YMLA 1NW9B 4TTSA 1QWOA 1W47A 3QUAA 4OXXA 5EPOA 1FSGA 4UUBA 4XW2A 1R6BX 2NP6A 2RKWA 4INJA 2J48A 3WLAA 1O1YA 3WL3A 5BOSB 3HSKA 7YASA 2NO4A 3R1IA 2C5BA 1JTVA 3E7WA 4RMJA 1YONA 2VF4X 3PIDA 2XVYA 2ZWAA 3HYCA 3P0HA 4CEHB 1S0UA 4TZTA 1P77A 4NPCA 1ZHFA 3AJAA 4C7OB 4DSNA 4YRBA 3KD3A 3D7LA 1JE1A 1RQ7A 4TRJA 3ZU2A 1R27A 2R6HA 3G2MA 1YK0A 3PL1A 2FPXA 4EHKA 5JFGA 1FTGA 3RKSA 4RQBA 3NKVA 2FPLA 2YBEA 5KAPA 3U56A 4QOJA 4A26A 4KLAA 2HTFA 2PE5A 1AGRA 3QV2A 1HG0A 3KUKA 2PG3A 4HDNA 2E89A 4RKFA 2BBOA 3PG5A 3VJMA 4Y6RA 4XYMA 2GPYA 2WMOB 2Y1LA 3DEAA 4GMFA 2V8OA 4OYYA 4UM5A 1R15A 3OPYI 1VYUA 2QUIA 1G7SA 2Q0XA 4NEGA 4BB5A 4HGPA 2EBWA 4KUHA 4HGZA 3HR8A 1OLUA 3JAWB 4N7MA 1TJYA 4R16A 4FCCA 3I9MA 3UA3A 3AZPA 3TZ6A 1AS3A 3EDOA 3H5IA 4Y67A 1JKIA 1EINA 2I66A 4XVQA 4ND8B 4BX9A 3LC0A 2L17A 4LNAA 4AMUA 1RCUA 2I6SA 1MIHA 1VLJA 1Z7GA 4HQNA 1COWD 5EIFA 4DPLA 2L2QA 1SVNA 4P3YA 2GEVA 5DIZA 4RMHA 1ZR4A 1Z6YA 4MAFA 3PUVA 1QYVA 1O2DA 3LRPA 3JAKA 5B7GA 2VH5R 3U7GA 4B6EA 3L7LA 1XHFA 1U2DC 3CC8A 4MV3A 3GJ3A 2WJVA 2A84A 5A4MS 1QVAA 5EP2A 5BSEA 4F12A 1HEIA 3RUFA 4OY3A 1DIOB 1G3IA 2EZ8A 1UK8A 1Z8NA 1Y9AA 4NV0A 5K0LA 2YC2C 2ROQA 1CZRA 5IXYA 4GQBA 1SHLA 1SVWA 1LTHR 4JJFA 3EPPA 1Q2XA 3JZAA 4JITA 5B6PA 2B4RO 2XF8A 3BL8A 3VDXA 1FFHA 4G3XA 2D2VA 1IN5A 3ILVA 5EWLA 4JLKA 4RHUA 4Y9TA 4GZMA 3DFIA 1FX0A 1NV8A 4TXHA 4CQJA 1SC1A 4MWDA 2UZ1B 1LPSA 5E4JA 1FXSA 1Z88A 3NBQA 1J7JA 5DM2A 1HRKA 1W0JA 4CL2A 1IJKA 2A3NA 3HM2A 4QBKA 4TYPA 1N25A 1K7YA 4YP9A 3HUEA 2EC5A 4H3KB 4PBTA 2CVPA 1DQZA 1K92A 2EU8A 2POCA 1F8FA 5DLDA 1U8YA 3A1FA 4J0QA 2ZE5A 1JUDA 1M0EA 3AOGA 5FTKA 3U3OA 1PR3A 1JVSA 5ALIA 1KP3A 1M10A 1GN9A 2ZVQX 4D97A 4UNQA 1TAHA 4HUQB 4FD2A 4H3HB 1Q3HA 2GXSA 2NUTB 3BRQA 3QSGA 5IVIA 1H69A 2D7DA 1NL3A 4Z4HA 2F9FA 1Y3CE 3NHUA 2PAFA 5HBRA 3RJ5A 2JLQA 2HT6A 4L95C 3ZG6A 1JDBB 1UMCA 2D7JA 4HVTA 1F6DA 1NP7A 4O4IF 5FLYA 1I3OA 2JZNA 1W6UA 2DPXA 2Q5HA 4INAA 4MUXA 4BNUA 2FY8A 4E03A 1E3MA 1AK9A 2WJWA 2OENG 1SVIA 4TQ9A 3NNNA 5GGYA 3S55A 4KXXA 2JJ8A 2XH8A 4MJ3A 4IMIB 4US2R 1WHSB 1M7HA 4V0QA 2DHQA 3L40A 3KZOA 5EXEA 3WDMA 3TSWA 3UYKA 3FCEA 1JQAA 4OU5A 4CKWA 3CVOA 4PSVA 5LM3A 3FMVA 3ZCTA 2NP7A 1ULSA 3PI7A 3CSDA 5JADA 2IX9A 2OUIA 4TWIA 3STXA 1Z5WA 2Y71A 5B58T 3W2IA 1SVUA 1QUFA 5FPSA 5FORA 4C30A 5KYYB 4G07A 3I05A 3RT7A 1G21B 1HFJA 1C9KA 4O2RA 2HSEA 3OA2A 4XVUA 3CEHA 3JVDA 4FEYA 3O90A 1LK7A 4NZZA 4DHWA 3ETEA 3EC2A 3GEDA 2RG1A 4E51A 5IARA 4DLWA 2YKGA 3EUWA 5CCXA 1WZ2A 1MDFA 2AG6A 4II3A 4M54A 4EJ2A 2X9VA 4D0GA 1U8ZA 5H1YA 4B48A 3D0RA 4C21A 1AF7A 1UMDA 3NRBA 3CVUA 3I4LA 1IB6A 3LBYA 1NQXA 1IPHA 1UQTA 1GVHA 4NE9A 1U2SA 5A4DA 1AKWA 4KPUB 1JWBB 3OIYA 5KSWB 1J20A 3IAEA 1TMGE 2VK8A 4EO4A 2I2XB 4JYZA 2C5FA 3TH5A 4DXAA 1I9CA 3SJ7A 2Z1MA 3F3KA 4HX9A 4EEXA 2WIGA 4H4EA 3VXKA 2AD5A 3AY6A 4OHKA 4W8GA 2QI9C 4D81A 3L07A 4IG4A 4O4LA 1JHZA 1L4NA 3KSUA 2IU4A 1KERA 1LK5A 3HN6A 1KKMA 5ELMA 2IKSA 3EFOA 1INLA 2O06A 1XPRA 3UMVA 1QHXA 5ALHA 3NDBB 2XGJA 2PUWA 5DTMA 4EA6A 1B1AA 1A2OA 3J81k 4JQCA 5DLYA 2V7PA 3TI9A 1YJBA 3JQBA 4J9UE 4GXQA 5LWHA 5BRNA 1Z2EA 1APBA 1HDEA 3DHWC 3IOBA 4AN4A 2B7LA 3MBIA 3Q7SA 2FR8C 1HYEA 4W6QA 1ZRNA 3UATA 2QV7A 3GRPA 5JO0A 2WAMA 4N5MA 1XA0A 2VFAA 1V3VA 2NNLD 4O2BB 1KKLA 3MWEA 2R3SA 4N5IX 5FB3A 4DV4B 1QFMA 3BCSA 5D1HA 4OUDB 3IKMB 3K8OE 3P9KA 3ER6A 3LSTA 3OFSA 4DUYB 4DRXA 5I4BA 5ER6A 4WESA 1M8JA 3CIFA 2PT5A 1RXSA 2RAPA 2YXEA 4S0ZA 4K7JA 2BD0A 1EVYA 3KWFA 5DHFA 3NV7A 1JLMA 3Q1LA 5G2OA 3A1UA 3OLVA 1OOEA 3DE2X 4J3NA 3E9CA 3GCXA 2UZAA 1QG6A 2A0KA 2EF0A 3LVRE 1EA5A 4FQ8A 1JDVA 2HYDA 4RM2A 3BB3A 4ZANA 4YQZA 3QMVA 1VIVA 1WSAA 2WU3A 3AVWA 1UFOA 1EWQA 2XGOA 4G1MB 3KJXA 3SG0A 1SZCA 3PQ2A 1UAAA 2ZTMA 3IEUA 3OJXA 2AOWA 1GXSA 4W8OA 2JDIA 3QFSA 4EITA 1E1YA 3PUHA 6ABPA 2O8EB 3ERCA 1BGVA 1FX1A 1VJRA 3IP6A 2RKBA 3ON5A 3NBYC 3QPBA 1P5JA 1KMMA 4RL6A 4LX8A 5K2MA 3ZIAA 5BR1A 4DMHA 3Q40A 2VJOA 2WNSA 2V7TA 1OZFA 5HILA 1BDMA 1C1XA 2QTFA 2QUJA 3WGMA 3LWNA 1Z5VA 2C54A 2OR3A 1HE2A 1R6UA 1N36B 3KPVA 4V0RA 2EZUA 2YNMC 4TOIA 3JQQA 2XNCA 4JLOA 1R6TA 1DX9A 1EG7A 2AL7A 5ELXA 1WZNA 4CMAA 2G28A 2PSEA 3M6LA 1IULA 3CBGA 3HUTA 5JAHA 1HYGA 3KB6A 4UPDA 3GLHB 4FE3A 1DJNA 3CKKA 2I87A 4X63A 5BN4B 3ICPA 4CKYA 2X9LA 4DLSA 3ZU5A 3GZTB 2RHOA 2OGTA 2YV1A 3N2NA 4FC7A 3GMIA 3RU7A 1IJFA 2CV0A 1KP9A 1EDOA 4Q4JB 1G6OA 2QKYA 3IJ5A 2EKPA 1NVFA 1GUDA 3C6XA 1SG6A 2C9CA 1TUBB 3IQZA 4UXHA 1SOUA 2RB5A 2HSGA 5CT5A 3NI2A 1W36B 1JPVA 1E0AA 5K0BA 1GG5A 3W9YA 3K0CA 1HI9A 5DGXA 3VYTB 1DKLA 2I6UA 2IOFA 2WPNA 3HXOA 2YV4A 1SXQA 1SXIA 3UOGA 3KYIB 2W42A 1XZBA 4PINA 1L5YA 3VJLA 5DP2A 1N7IA 3ZE7A 3VPBA 4UPEA 5LJIA 1T9BA 1H9CA 4RULA 4PAMA 1XVVA 4YV0A 2AX4A 4K2AA 5AHKA 1SOWA 2XMQA 4JJEA 4JKYA 4K9SA 5DYIA 3ANLA 3SE0A 1MGOA 2OZVA 1VI2A 4NYIQ 5T4BA 3JYPA 3DMGA 2H06A 3J7TA 1K97A 4UM7A 4XIIA 3RFUA 4ZTUB 4QBTA 4WLUA 3OESA 5TMDA 5HF8A 2FJ0A 1XRRA 3KOYA 4MWOA 4XYBA 5ESWA 1OASA 4R3WA 2OCIA 2BFEA 3GLTA 4FEGA 5LNK6 4GP6A 3U9SA 3GHHA 4NJOA 3KQLA 1UFKA 3ACBA 3DAFA 4WY8A 4OK5A 1YAJA 4HK4A 1Z17A 1ZGHA 4BQRA 3KQHA 3QYAA 4Q15A 2DWPA 4J7AA 3AHJA 3ZJVA 4JI0B 1ZCFA 5FA8A 1VCIA 3ELYA 2XA1A 4GI5A 2BAGA 1JPJA 4HDMA 4CKEB 1OB2A 2VZEA 5KNLA 4TSFA 4F4UA 2H31A 3UJHA 4LS3A 1PJZA 1AJEA 1KQ3A 1V1RA 3ZY4A 1Y1PA 3IR6A 2VXCA 5DTEA 3BORA 5T6MA 4XI9A 4XWWA 2GLTA 3F6SA 1U11A 3BB4A 5FRDA 3R6GA 1X1SA 3FYUA 1KXJA 3VX4A 3USCS 1XZMA 4Q6WA 3QE9Y 1TPZA 4YRTA 1VBMA 2XR1A 4AICA 3MJFA 4PSAA 3ZJ4A 2G76A 4TX1A 4MVJA 3IALA 5IAAA 1YZYA 1JFFB 3HADA 3JWGA 4ZVPA 1IXRC 2OHGA 2PCJA 3D2AA 3AVXA 1S6YA 1M73E 1GFIA 3OPVA 2PV0A 4W5WA 1PSWA 4RZHA 1EGMB 5LXTF 1J33A 5C8YB 1KSJA 1JFTA 1EEHA 2DFTA 2ZR0A 4ZRNA 1FC0A 2IZ6A 4NSNA 5LKAA 3E2PA 5CTAA 1O6ZA 5GQSA 2H8KA 1QC5A 4IIFA 1DDIA 1K3FA 4US0R 1XNQB 2JIZD 3LUBA 4DQDA 3BFXA 4BO5A 4WJLA 1QORA 3O3OB 1PHPA 1Y3IA 1XVLA 3I9FA 1M5UA 1MOSA 1K66A 4O08A 5IJ9A 2BI8A 1E1CA 1MNQA 1VMKA 3GPDG 5ADWA 1G7TA 5KSYA 4LXUA 1SBZA 3NALA 2AEMA 4LVCA 3VHQA 1OZGA 2DH5A 4FCWA 2M98A 2V4UA 4YPOA 3BXZA 3V8PA 5K03A 4JS0A 3DOOA 4DHEA 2GZ1A 3OM1A 1ZMXA 1QV6A 1Z28A 1PJAA 4D3XA 1MUUA 1X7YA 1LS1A 4HGOA 4NOLA 1PEAA 4FNAA 4W4TA 4XDYA 4YXWA 3ZWVA 4U6QA 1ZJWA 3CZAA 4X1YA 4BB0A 3UG6A 4DJEC 1VHLA 2XWJI 4NOMA 1WD7A 1JMKC 2FPPB 5LP6B 3DVLA 4KYUA 4FMPA 3W5HA 5AW6A 1V8DA 1YR8A 1HNWB 1EE9A 1FVHA 5BQ5A 1UJ5A 3CZCA 3M33A 4MGHA 5HOEA 4F1WA 5ADVA 4PHFA 3LOQA 1H2RS 1HG1A 1OF1A 1P9RA 4P2GA 4B2YA 3QEAZ 2I6XA 5EQDA 3ROTA 1EFDN 1KGDA 1KTVA 4R6XA 1U0EA 1N5RA 1SBCA 3IEXA 3NHAA 1YHZA 2IOYA 3PQ7A 5LQRA 4KRGA 4LZOA 3PJRA 2CJWB 4TN5A 5F52A 1HC7A 5CB8A 5DU2A 4DEXA 1T0BA 1RJFA 2CYAA 5LIPA 3ZS8A 2AK3A 1T2NA 4RABA 1MO5A 2I03A 2QR3A 3QHPA 3RO7A 3HYNA 2JH8A 4L4SA 2WMNB 3GEMA 5A9TA 2FPRA 2R00A 2EFYA 1CZHA 5BSMA 1SOVA 4ZVQA 1MQ8B 4RMNA 1CVRA 4JLSA 3DEZA 3R3HA 4BDSA 1ODSA 4XX1A 2GTIA 4DGQA 4YEDA 4IQ8A 1Q57A 1AXEA 2QORA 1WB6A 1D04A 3VO8A 3T1VA 3QFCA 5BWMA 1QAQA 1YAHA 2EXXA 1GAEO 5F5NA 5KREA 1TU4A 5EPUA 1DO0A 1C4XA 1KGSA 3BGWA 3CW9A 1Z7YA 2YWJA 2VJAA 2ZAMA 1CRLA 3I6MA 4YQFA 2QXUA 1H2WA 2W71A 1X42A 1LVHA 2Y2VA 3EXEB 3WLJA 3ZW8A 4U2GA 3BE4A 1LKZA 1NN3A 2EW1A 4YJ3F 2OP0A 4IS2A 2LGJA 4QUBA 3V6MA 4AJLA 4DSOA 1V25A 3CVJA 5JPCA 4FDLA 2WM9B 4Y6PA 1TTPB 3SGLA 1KAHA 2XUZA 1YDHA 3HY6A 3Q1KA 4KHZA 3Q7IA 4C0JA 3KVYA 1KJYA 2HFJA 4BJ5A 1IBLB 3DG9A 4DCUA 3OKCA 2X1LA 1T36B 4CTNA 3OTWA 1GA6A 3SNHA 4HAWA 4N5LA 2EZ9A 2ZREA 5SY6A 3RV3A 2C59A 3VZBA 4GYKA 1QG4A 1TM3E 3BBLA 3F4BA 3NO4A 2OD9A 3MQ4A 4HAZA 3A4IA 5BW8A 1E8NA 2J87A 1NW8A 5JASA 3OC0A 4EMSA 4V1CB 1SBNE 3WGJA 1UH5A 4B3JA 3DT9A 4UW9A 1XL0A 2LRHA 2XT0A 2DR3A 2DTEA 1RQRA 1B0PA 2KM1A 3DLIA 1L7NA 4YRGA 2AV6A 2ID8A 3W8EA 5E9QA 3C1TA 3ZH9B 5K9ZA 1CJKC 2H1WA 3Q6MA 3UAZA 1JHYA 3THSA 1QG2A 1E0SA 2HQSA 1TYEB 1SUPA 1JLLA 2MSKA 3HHPA 2A1TS 3OY2A 2QA5A 3DDNA 4RFLA 5ETJA 5A6SB 1YS6A 3QXGA 4LYAA 4F97A 1Y33E 3UB4A 1GZUA 1G8HA 1WXWA 2NSYA 2B4TO 2GTHA 3HGQA 4XYGA 4EHIA 3RIMA 3HRKA 5DXJA 3HZRA 4CM5A 3KJEA 4DWWA 2JIDA 2OC9A 4DEYA 3A28A 4ALLA 1S2NA 1VLQA 2SNIE 4IHJA 3J80A 1U80A 1R16A 2AQKA 4AF6A 4PLZA 2AMLA 3WNQA 1X0XA 1THZA 1RAHA 2AN5A 3HL0A 4GX0A 4OGKA 4EKYA 3KJGA 5HFNA 3G5UA 2VJCA 4J76A 3OQHA 5HKAA 4DADA 4PC6A 2AOTB 3HO6A 4O2AF 4BQEA 5I7VA 3GLQA 4DAOA 1GYPA 1OLXB 1Y9EA 5AM5A 2RH4A 2PRZA 4A5OA 4R2XA 1WA5A 1PZGA 3MOGA 1W88A 1VIAA 2V9PA 3G5TA 3HVHA 3LKVA 2INGX 3LJKA 4IXWA 3SYNA 4BO9A 1EP3B 1T9GR 4GBJA 4YRQA 2FA9A 4Z54A 1V4NA 2ZT6A 3OKPA 3ZE2B 4YTEA 1YRAA 1D2RA 1DS6A 4A27A 1LBIA 2OV8A 4UM9B 2RGNA 3U3KA 1MORA 4V2UA 4NYJR 3FLAA 5D86A 4CLOA 3ADPA 1VMDA 4AKEA 2BF7A 2C5GA 1F4PA 5BN5B 3IP8A 3ETLA 4WKNA 3STTA 3KQVA 1KZ4A 1YUBA 2G1AA 4X65B 1II9A 5FI3A 1KI4A 2DSNA 4JIGA 4NF2A 4AROA 1U04A 1YD7A 1Z4IA 2OB2A 3F5FA 2J3EA 2FW0A 3RVRA 2W22A 2H4XA 4LK2A 3RLFA 2Q2OA 5JCJD 3WFIA 1S2IA 2TSYB 3R76A 3UJCA 5CFZA 2AHOA 1TTQB 2ZRCA 4DN6A 3AG6A 1DFIA 2A94A 4G4IA 4D4MA 3THXA 4DA7A 3FCUB 3FMFA 2JAPA 1PVDA 2C95A 1QF6A 3M3DA 3ND6A 1QO0D 3FROA 1Y8QA 1PL7A 2NXEA 2REOA 3Q9NA 1BS9A 4DOMA 5IWCA 2P90A 4DR1B 1HURA 4RTMA 1OD6A 3CWZA 1Z34A 1JU9A 2XQJA 5ALEA 2F1OA 3IE0A 5KTYA 1YB1A 3EVBA 4GS5A 1QOPB 2V4MA 1JXMA 4IHQA 4FHFA 1ZLYA 2JD1A 4G5FA 4L3WA 5BV8A 3VH3A 4GKJB 2B78A 1JDTA 1KRWA 2PSFA 2FWAA 3UC9A 3BB1A 2NUAA 3HE3A 4R7GA 4UEKA 3NUZA 1RM5A 4CETA 2DWUA 5DFAA 4NCBA 1Z16A 2Y77A 4LQDA 4B3XA 4F1KA 1U2PA 5A2GA 4WNCA 1YJAA 3GBSA 1PZXA 2CL7X 3FMPB 1G42A 3DMTC 3QKRA 5KMGB 4BVFA 1PAUA 1Y0BA 1OA0A 3AHCA 4ABYA 2VJMB 4C4RA 3OD1A 3AG5A 3LCCA 2HHHB 1LLFA 3FPJA 5AR1A 1CR4A 3T9FA 4YYZA 2W8BB 4OH1A 1QDUA 2DR0A 2RI1A 3A26A 3ESZA 3F3YA 3K5PA 1V9LA 3I9OA 3M6IA 1I7SB 4EF5A 4LXQA 3E58A 3E15A 1B16A 4XR4A 2CMDA 4EB6B 3ZY5A 2W6OA 4XM2A 1E2MA 2NSDA 4I1YA 4HGNA 4E88A 4LJ8A 4U4AA 2PO5A 2W2OA 1CQWA 1LJ8A 3WE7A 3IEIA 2XQIA 2V45A 1SVMA 3IAXA 4QVKA 2YXBA 1ZXLA 2J3QA 4IZHA 3V2HA 3N58A 3FOZA 3G8CA 2J5BA 5AVSA 1V37A 3A31A 3LY9A 1OWPA 3PQ5A 5DVZA 1ZWLA 2PMDA 2QOEA 4DR4B 1PFKA 1NVVQ 2P9QA 2GZDA 2LD4A 4RVCA 2AMYA 2BEWA 4YS6A 2HRCA 3NAQA 1LLUA 2OYRA 4CL0A 4DLRA 3AWIA 3H9CA 2E4XA 2XVAA 3GGPA 4H6XA 3RF7A 2GJAA 4FEAA 3OCWA 4FPXA 4O02B 4BZXA 5I9LA 2AFIA 4UEQA 4FTWA 5LJLA 1R5OA 2R47A 5L6LB 1ULUA 2AR9A 2GAOA 1RPJA 4IKOA 4QHYA 3TQSA 2ZSAA 4ZAWA 4Q4HA 4UMEA 1UP7A 4ESVA 4A8TA 2Q6OA 3I73A 3OPYB 2Q2NA 5C2JB 4E7PA 2Y1FA 4BDTA 3PIRA 2QUBA 2QENA 4MA0A 4BMCA 1L4LA 5CT9A 3R40A 4KIWA 2QLNA 4G37A 3TW4A 5IXJA 2G67A 2VP9A 3M2TA 1U9IA 3M6AA 2DAPA 1DKMA 3H2HA 1SHTX 4JL8A 3HU2A 3M5WA 4ZYVA 4JWKA 1XZAA 1OGJA 3V4SA 1NMQA 1XHLA 4ENPA 1YMVA 1U7DA 5IBQA 1R0RE 1NP3A 3E3LA 4A82A 1ETUA 4B73A 2WHPB 1E4EA 2PXAA 4NU6A 3KHUA 2VK1A 1LW7A 3U7FB 3GYBA 5B12A 5DNEA 3IAM1 2P3QA 4WTOA 2CLOB 2IRWA 4XQCA 5DYGA 2OV1A 4Q3DA 3QPCA 2Z8YA 3TQIA 3TTUA 1OYOA 3E3NA 3K32A 4X84A 4BP1A 4C3VA 1M3SA 3DP7A 3U7QB 3IXMA 3AW9A 4YJFB 3REFA 1WVGA 5ALOA 4K05A 1YUMA 1M83A 1H0HA 1QHGA 4CF5A 1S3FA 4I9GA 3HMKA 5FR2A 2CLEB 1UP4A 1TCBA 2G08A 5GV7A 3KL2A 3P9RA 1V16B 3ZJ5A 2WW8A 4EO9A 4W5TA 2GCEA 3UMRA 2PX5A 2YZMA 5D5PA 2B1JA 5KVSA 1FP4B 1M6EX 1OJ7A 3EH2A 3PENA 4A0GA 1JIQA 1Z74A 4M7RA 2J3KA 1NOJA 4X1KB 2R0QC 4OSEA 1MTOA 3H1EA 4YN3A 4WJZA 1CTQA 1XK6A 2JCXA 1ID8A 3CM0A 5DBGA 5FJIA 4D56A 3D6NB 4G67A 2QT1A 3PLNA 4GR9A 1GG9A 3VR6D 3EFHA 1XL1A 4XJTA 1QRAA 4PO8A 1M8PA 4XWAA 2JLYA 1SY7A 1CPYA 3EHEA 3N6XA 4L7QA 4RTQA 3QTLA 3C8UA 1P74A 1P1IA 3KKPA 2I4OA 1QE5A 2YJ3A 3ZDEA 1E3WB 3FPAA 4ZC8A 4TRNA 3KUXA 4Q66C 5F9FA 1YRLA 4CG3A 1C50A 2G7MC 2X8LA 5MGNA 2ZZMA 1IATA 3P9SA 4O4IB 3F46A 3U37A 3DZ8A 4PWYA 2WHQA 1JEDA 1C4OA 3WHKA 1NSFA 4YUAA 4OA8A 3AEXA 4BY9E 1WXEA 4NCIA 4TTAA 4YO7A 2IX3A 5DYNA 4KXWA 4AKSA 4WKPA 1SUDA 1L8AA 2XUGA 4X54A 5CJJA 1BDHA 1QU2A 1CY1A 2OUKA 4QYIA 1UBCA 4C5CA 5DM4A 3O0DA 2P62A 2GD2A 2ZBGA 3GXBA 4NL4H 5CUQA 4ND7A 1RFGE 3OIFA 4XR9A 4LWZA 5EN4A 5GIPE 4GM4A 2WTUA 3EXHB 4HQOA 2XMRA 1O7JA 4UNRA 4U7GA 5DYWA 1AGNA 3AR6A 3RS2A 3PNYA 5HYVA 4WV3A 3T9DA 3EARA 4DDTA 1K7XB 5ALDA 1J8DA 2GFQA 5FA5A 1NZDA 1BE6A 2A0FA 2P7HA 5EQTA 3S99A 4PGAA 2O2XA 4WCFA 5DNCA 3IHKA 4GM0A 4Y2TA 2XD9A 4YAEA 5HA5A 2G82A 2G3YA 3G5AA 3EOZA 2FMUA 2KBFA 1DPGA 5GV8A 3T1OA 4BX8A 1Y1TA 1SHZA 3FX2A 1J1UA 3CUSA 5EWMB 3KS9A 5F77A 4E5VA 3LC1O 4BMDA 4TTJA 5BNIA 5L3QB 3R3SA 2QUHA 4ARUA 3QJ5A 2OSVA 1VG0B 2ZTVA 4FOSA 1B42A 3I23A 1FPMA 1L1FA 4RANA 1SBYA 1ZN8A 2MOKA 3CRRA 3MS7A 3EBPA 4C01A 5IKEA 1TD9A 2CMHA 1V45E 3M1LA 1GZHB 3BXHA 3NT5A 4O59O 4TV9A 4K28A 1IAQA 5T6BA 3VBCA 4E3ZA 2QMUA 4H15A 4MW7A 1TADA 3OUUA 5LOVF 2F1JA 3CVWA 1LJLA 5C53B 1P0IA 1V48A 4DZZA 3PGVA 2VEDA 3P4YA 1FE8A 4EDFA 4RH0A 1I4OA 1H9AA 3DAYA 1RWBA 2BHTA 1VJ1A 3EW7A 4ZCSA 4N9WA 3D5QA 2CJFA 3VR5H 3OZDA 1SB8A 2ZWVA 2A8YA 4JJIA 3ZZ1A 4C0HA 4EI9A 3SWWA 4CTMA 5D3QA 1BIFA 4EKGA 3LX5A 1A9XB 2C2OA 3AR5A 4CLHA 5CA0F 3LNTA 4EHHA 3SR3A 4HF7A 2XIJA 2WB4A 1XPUA 2PV7A 5JWOA 2ZUFA 1JJAA 3AP1A 4L57A 3Q10A 5AO9A 1X38A 3AVVA 3MBKA 4QSHA 3H42B 3GT4A 5EAIA 1VYVA 1UDXA 5LLDA 3ZK8A 1QTNA 2GD0A 1B8PA 4R9UC 2P79A 4TN1A 3T4UA 3VPGA 3SICE 3WKAA 4EG0A 1B6GA 4TGLA 2JEZA 1MRSA 2CFSA 3R5KA 4QGFA 3GEPA 5JAUA 2FHSA 1HQDA 4YI5A 1NULA 4C2AA 3LK7A 3FNRA 2J4FA 4GECA 4PONA 1X8LA 3AUJB 1MJGM 1GU1A 3T5BA 3PHJA 2I7VA 4MCIA 3DUFB 1SQ0A 2CNBA 3CW8X 4WA8A 1JYSA 2RJOA 5DWQA 1Z7EA 4ASUA 4RDXA 1UOQA 1VHWA 1XTBA 4TT3D 2JFWA 2PZAA 1S8AA 1DXOA 1ENPA 3H8JA 5AJTA 3WXMA 2B0JA 2SICE 4J94A 3N0RA 1GRNA 3WAKA 3B7GA 2Q4DA 1G4AE 1L5GB 3PCXA 2VOJA 4K6KA 3PRHA 1GKKA 3ANNA 2HJRA 4OHUA 2QVYX 4HDSA 2ZB4A 3AP3A 3DLPX 3DL2A 1FBTA 1PV2A 3COPA 3EMDA 1KYVA 2JIZA 4YRAA 1JEYA 4FW8A 4J49A 2ZJZA 4LC0A 5AJWA 4DZTA 1XRQA 1Z5UA 4ITRC 4EY8A 5L40A 1RQPA 4G5QA 1ZN2A 5JALA 4QICA 3O8CA 1JDPA 1XLVA 4ZJPA 2B3DA 3WDKA 2GN4A 3OWOA 4O0LA 3DUWA 3NHFA 4K9MA 4BGUA 1W581 3FCCA 5EIWA 3FNHA 2ZVDA 4DQLA 2CFTA 2XDQA 2Z4SA 1TTTA 1UC4B 4TMTA 4TYNA 1JG3A 3MJ4A 3BFJA 3OA0A 3L4BA 3N7AA 1EB9A 1VJDA 1YCDA 1Z0UA 3SEAA 2COUA 4CMIA 1U90A 2AZTA 2QXTA 5CFRA 4DJJA 3VR3D 4M60A 3A1VA 3PNLA 1HLPA 3FOAA 1OXVA 2QSZA 3RU3A 3WKEA 4H1WA 5CDTA 3LKZA 4AQDA 2YFYA 4DL9A 1DKQA 1OROA 5LA6A 2NU8A 4B7XA 1SC4A 2CSUA 2OFXA 4IQ4A 4CF4A 5M7EA 4AF8A 2GZHA 3DL0A 4DUZB 2HU8A 4KIUA 3SM3A 3NCTA 2C58A 4QT4A 2QJWA 1Z4NA 2XCQA 1KPGA 1RR6A 3NP7A 4KJXA 2GD6A 3ZVRA 4H4DA 4IEEA 4MA5A 2ZWMA 3M83A 2ZQ5A 4JLUA 1AKTA 3RHTA 3IJRA 3KTAB 3SZ3A 2PUBA 1F14A 3UAXA 4HX5A 2B9VA 5ALXA 3HDQA 4C05A 5LU9A 4OIFA 2GD1O 1E6WA 1Q1GA 5I5GA 5I7HA 3CMCO 3IJPA 3DLCA 3FFBA 3W6UA 1KEZA 2Q2WA 1SCQA 4NICA 1XDDA 3SDZA 2ZWIA 2AXEA 4F9TA 4MV7A 3R3WA 2A5JA 4E08A 2OL4A 2PXCA 4YRRA 1C3OA 3AZQA 4HB0A 5MN5A 2WP0A 4JX8A 5FV4A 5F1PA 4ZEOA 4DGSA 4FFPA 2PO7A 5DCUA 5ESRA 3T3PB 4EGCB 1AV6A 3FR7A 3V4VB 2NUPA 1TK3A 3IUNA 3C43A 3WJ1A 1PKXA 2OP1A 1AXGA 2V1XA 2X5JO 1Q21A 1NTRA 3C3BA 1E5QA 2N42A 3MWDA 3PL5A 4P7BA 5CYOA 2HPZA 2XPCA 3ET5A 4BE4A 3N05A 4KE8A 2IIPA 3GEIA 1GKLA 1XN4A 2ATIA 2VDWA 5LD2B 3AIKA 5E3JA 3C8DA 2B7BA 4TMKA 3UW1A 4E1AA 2OV2A 5KVVA 1AQNA 3FBWA 1MW8X 2QM0A 3G59A 3BQMB 3ZI4A 1PDWA 4B8ZA 4LXTA 2X8WA 3VO1A 4BRUA 5LXTB 1CB0A 2P4SA 5IM4F 1JTFA 3ZNPA 3KZXA 3GDWA 1VJGA 1SFRA 1S3SA 3NV9A 3HVUA 4BX3A 5CU7A 1RADA 3H84A 4UD2A 3CWQA 4EPWA 1SXGA 3FGOA 2QRUA 4Z1OA 4LISA 1GPMA 1RJEA 3P0RA 2C8JA 3PITA 1BW9A 5F35A 2O57A 2JLAA 2VHEA 2WWFA 4M7WA 4RZ3A 1RBMA 1SOAA 5CNIA 3VZPA 7AT1A 3TVTA 4JEMA 5J43A 3VRHA 4TM8A 4S2UA 1DO8A 2HWXA 4ZJUA 4RA6A 1D2MA 3IUPA 4MGEA 1UODA 4P9NA 3SP1A 4Z9XA 1OAOA 1KBOA 3LQFA 1PJBA 4OYHA 1XKXA 3T0FA 5L7TA 4IDQA 2CYBA 4JUDX 4LC9A 3T5DA 1EPUA 4WBNB 2R2GA 1CDEA 2CVZA 1CUFA 2ZIZA 3LG2A 1SUEA 5AOAA 4EY4A 3WSVA 1TQ4A 3BD8A 3A27A 2Q5EA 3KT0A 4NBSA 3W6OA 4CF7A 1LC0A 5DGIA 3ED5A 2EFHB 4YRDA 4MA4A 3RI3A 3MIIA 3TPZA 4IOJA 2I29A 3IMKA 2Q4BA 3M5PA 2AR0A 2YVQA 5THXA 3AUSA 3AGPA 3WAGA 3L8FA 3IEPA 2L42A 3D6MA 3B5IA 1AGYA 1AT1A 3NDRA 4J0JA 4MI6A 4QOGA 5LZ2A 3CX3A 3MUEA 1NVTA 2BZSA 4DMKA 3WSWA 1LI5A 3TIVA 4FR2A 1J5PA 1I2AA 2J3JA 1DQRA 4L0MA 4ZQHA 4OB6A 4S04A 3IDZA 3UMSA 3LQRA 4JQSA 2ZYAA 1S1MA 4M9QA 3T3HA 5I7SA 1GDDA 3PVCA 1SQSA 2QROA 3F0TA 3WK4A 8ATCA 4JHLA 2SKCA 4CR6A 1EBUA 4JI1B 5BN3B 1LJUA 4K9RA 4LPKA 4XFDA 3COJA 2WICA 3E7FA 2H07A 4L5IA 1UKZA 2DB3A 3MXTA 4D0RA 1RYMA 2H7YA 1G8KA 3BYZA 3ZHRA 2OFWA 3DOUA 5EZYB 2II6A 4L3VA 4NK4A 1TDJA 1WULS 3IOCA 2I34A 3KVRA 4ZO7A 1R00A 1NI3A 4QHTA 4R2MA 4UFOA 2NU7A 4HGRA 4TTVA 4PLCA 1TU0A 3E03A 4WX2B 1UXGA 2QTMA 2BGIA 1FUKA 1W2GA 3PFGA 4DG8A 1VSBA 1XZEA 1RKQA 4JBHA 3VU9A 3GT7A 1XSEA 5TF0A 3UV6A 3NTOA 1OIXA 3MEQA 1DIRA 3RYCB 3S6JA 3FYTA 6AT1A 3G1TA 1AIPA 4IDPA 1YIOA 2JGKA 5L3ZA 3TDNA 4F5WA 2Z4RA 1CUCA 4H2DA 4F45A 3PX7A 4JJGA 1PT5A 4O8CA 3ONEA 5ENDA 2ZBPA 4KN6A 5IJWA 5JXIA 3A7DA 4YJ3B 4QO7A 2FMFA 3TL3A 4LE0A 3K2EA 1KR5A 4QXRA 4BEVA 3K2QA 4TTIA 4JA0A 2AZDA 5LUAA 3BXGA 2DJIA 2O07A 1T5SA 1TNDA 3T54A 3KHTA 5BN1A 4B75A 4B9AA 5EJ6A 5HPYB 4I3GA 4ZWNA 3RTCA 4DJFC 3N76A 2B94A 3FG9A 2MT9A 2BFDA 3HZHA 4OJMX 3TLGB 5B7NA 5KYWA 2UUCB 2Q3MA 4XWYA 1W30A 2FF7A 1X7ZB 4ISBA 2F59A 2F8LA 1T3SA 3OY7A 5HKLA 5HM8A 1PJLA 1QO0A 3WS7A 2O3UA 2X4IA 4BFWA 1TTHA 4GGOA 4QFBA 3DGFC 2A67A 5BUQA 3PQFA 3MGAA 4FOLA 4NCJA 4AM8A 1YS1X 2HSDA 2XMCA 4HR7A 5CB6A 1VJTA 3LIIA 5D84A 4MYHA 1ODFA 3MFQA 2JGRA 4DMRA 1Z8FA 1UBRS 3BK1A 1B74A 1ACMA 4UAJA 4KREA 3R8XA 3OTOB 3OOHA 2RAFA 4D79A 1OGYA 3QELA 3W1VA 2QMEA 3DE3X 4BLTA 4NFYA 4MULA 3F6RA 5JCOA 3UHOA 1ZN7A 4JYAB 3B5EA 1GCOA 2PMCA 2QVZX 2XUPA 4WMLA 4CI9A 1UFVA 2GYYA 5J23A 2GCOA 1NR7A 2EERA 3DFMA 1EFTA 5FBRB 1CF9A 4QWWA 3TAXA 1YR3A 3O95A 4G56A 3AIIA 2J9ZB 1YV9A 3K3PA 3FTDA 4FVTA 4RBNA 3T1QA 2X5OA 5AOBA 1GM5A 4AK9A 2JAWA 4NABA 4N18A 2AOUA 4Q4LA 2J9RA 4FFOA 2EKDA 3QMWA 1ZRHA 4F04A 1ONSA 2O3QA 4H16A 4K6CA 3TLZA 2WHRA 3DO5A 5EMJA 5ITZA 5K2OA 4YK7A 1C4WA 3I2HA 1Y3AA 3NMUF 3L4EA 5DISB 3GY0A 4RTNA 2ACKA 3ED1A 1ZAYA 2H4JA 3GN1A 3NBAA 1GRCA 3QU7A 3QUQA 1V11B 4GAEA 1F0YA 1MIOA 4WUVA 1PJSA 4W5NA 5D6NA 5C81A 5IJ9B 3K0CC 1YZVA 2H7XA 3SHQA 2CXRA 2X42A 3WGUA 5CFNA 1XZIA 1JECA 2IH2A 3HKCA 3NM4A 5CIQA 1R2QA 2EG5A 3HBAA 3O75A 4MOWA 4WFKA 4HAYA 1IZ9A 1YRHA 4Q9IA 4DABA 1V5EA 1P2BA 3DXFA 4Z7JA 3NXKA 3VNUA 1ZIDA 1P0QA 2DHRA 3KBOA 3ORHA 4NC9A 5HF5A 4YCLA 1T5OA 2IWHA 2WBLC 3ZHVA 1BMTA 2DTXA 3IHTA 1T24A 1LK0A 1RIIA 2Z98A 2PBZA 5JATA 4H1TA 1CP2A 5FOXA 2D8AA 1SCKA 2FLVA 4YAUA 1AA6A 1HL7A 2OKCA 1LQUA 2C2KA 3K1AB 1JDSA 2YWBA 1N6RA 3HDYA 3W4IA 3TSZA 4AZ0A 1YIDA 5KTKA 3OQOA 1HT1E 3NT2A 4PHCA 3UGQA 1IAVA 3N39C 3ROPA 3MSCA 1PLLA 2WWVD 1FNDA 1T15A 1PQ4A 3TEFA 4ZZ2A 4CTKA 2FZGA 1Z45A 1ZVJA 4M8IA 3MPUA 4F11A 4L8YA 1P91A 3F8TA 3MINB 3RIHA 5MN4A 1RCTE 3WLRA 4QNNA 5IT4A 1EWYA 1QK3A 2CF5A 4IMRA 4POAA 5L53A 5LSAA 1BGXT 1EE1A 3A7EA 3OJWA 3S2GA 5HX7A 3NBUA 4PZPA 4A1OA 1UADA 3KIPA 4W6ZA 3GXOA 3OT5A 3U7RA 4TYQA 2MCFA 2AC4A 3DBHB 1M2VA 4RK0A 1AD2A 1N2JA 1TZBA 1NUTA 1U4SA 3GUZA 1EESA 4K1LA 4RDHA 1XGKA 3FYUC 3TJMA 1QHIA 1B8VA 3X2EA 4BBAA 1KORA 3ID6C 1M6HA 2CBGA 3I1JA 1EFVA 4UDYX 5CK4A 3VR0A 1AO3A 3TYXA 4LJSA 4DV3B 1L5VA 3R3JA 4F6RB 3N8NA 4L5YA 3AX6A 4MV5A 1U7XA 1HORA 2IEBA 2V6GA 3TTYA 1PGJA 1KE2A 3ROGA 1AXRA 3OJCA 4YGYA 1YZQA 1CUEA 2EP8A 4L51A 3HN7A 3E8XA 3MMXA 1P2VA 2QQEA 2PKQO 4HS4A 1NNSA 1RM3A 4FONA 2FMXA 3TGWA 1Y6QA 3UMBA 4BVGA 4NFHA 2GBFA 2UVPB 5HE8A 1JH9A 1PG5A 1X7WA 1MDBA 2A5LA 3FOWA 3OX4A 1D6JA 2GCIA 1BJTA 1DKPA 1OFTA 3B1XA 1M1YB 2RK6A 3DZKA 3I28A 3JATA 3KLMX 5C0OE 1WOYA 2EKZA 2VDLB 4C4PA 4PNPA 4BIMA 1IHUA 1KZ6A 5DMHA 3RADC 3WQRA 4DPKA 1FTQA 1SB9A 2OG2A 2P7IA 3WIBA 2IYSA 1A2QA 2IXAA 3NC1C 3W2FA 1QPZA 1U1EA 4ZA2A 1N8TA 1QVZA 2B83A 4DIDA 3EEBA 2C8KA 4OQZA 1C7QA 3PNOA 5BUSA 1B00A 3JYOA 4E2FA 4J3FA 5JG7A 1M67A 2A2ZA 3QVSA 3WY9A 1C3XA 4MR7A 1F8YA 1Y4SA 3B51X 4RKEA 3SHTA 3WGYA 1N2XA 5D1NA 5THQA 3G6WA 4O3FA 2FXVA 2R62A 1Q7TA 2ZJ5A 3O4VA 1G5HA 3PTLA 5EYPA 1AE1A 2IXBA 1KEEA 3U60B 1GL9B 4GP9A 4H31A 1CUZA 1OPRA 2FP3A 4J03A 5GONF 5LYJF 5IKMA 1QX4A 2C3MA 1NAHA 1OSNA 4FHZA 1AKVA 5LIRA 4URVR 1RACA 1T9ZA 3C41J 3O8OB 3UK1A 3EQ2A 2CDBA 2GAAA 4XX0A 2VUIB 5JR3A 2ZOSA 4YREA 1R4MA 1K9SA 1BFKA 3QVUA 3R8FA 2QVBA 4Z6KA 3SEZA 1CS0B 1WZEA 5HFJA 5H7XA 5E1OA 3V3KA 1H4TA 1US8A 3FDIA 3KKKA 3AF2A 3H8WA 4MMYB 5TPZA 1VLHA 1XMIA 1ZICA 3N3AC 3GL9A 3O9VA 4KYVA 4D9GA 3E9RA 3HCCA 5WRFA 3KM0A 1JPUA 1UPAA 4MVJH 1JDNA 1Z38A 2IPOA 3NNDA 4LZJA 5I9TA 4MKHA 3P52A 3AKZA 3Q6IA 4B2PA 5KWVA 3DZBA 4CLRB 2B6NA 3ILSA 2C3OA 1XPOA 1E9BA 3ZHXA 3CF2A 5IVHA 8AT1A 2A9VA 2R00C 2W43A 3K8ZA 4K1XA 1Z29A 2RH8A 5DHUA 4IDBA 2LKCA 4I08A 4IRMA 3HKDB 2O2IA 5ALUA 5JVDB 5IH7A 4WFJA 2GJSA 1E60A 4UXIA 1BCSB 3OEWA 3RHZA 3UFBA 5MFZA 4L9AA 1TK2A 5KYGA 1P7YA 2Y1CA 1QNFA 3LECA 4IY1A 4DWVA 3AZOA 1JE0A 1AUXA 5A7FA 1P17A 1NSTA 2NVUA 5KWIA 3M6FA 3VOSA 2NT3A 1UANA 3HSSA 1E9VA 1JB1A 4M21A 3D5TA 4HY3A 1BD4A 2XMDA 1DI0A 3EWIA 1XCGB 4RJ2A 5KC8A 2AX3A 1C80A 4WE3A 3BMCB 1MN6A 2QTVA 2WSLA 3B70A 3H1BA 4UUNA 4OX9Y 4AYWA 3F5SA 2VTBA 3PI6A 3QV1A 5ENZA 4BYGA 3WYNA 1KQPA 3Q0IA 2OBYA 4C89A 3FYSA 1Z0DA 4OHCA 1QMGA 1S8FA 2H29A 4QU9A 4CFYA 3E7DA 4WN9B 3MMSA 3BVPA 5AOCA 1HT0A 5BMOA 4F46A 5JAZA 1HKHA 1IB0A 4OQEA 2NZWA 4K6GA 4R3UC 4LQCA 4RD2A 4KVFA 4ME6A 4YA6A 5TGDA 3PA8A 1MENA 1T5LA 1V1JA 1O0BA 2WDPA 1IJBA 4MSUA 3CT4A 2FG7C 1M2OB 1BU5A 1FQJA 1MEJA 1ZJZA 1A7JA 2YH2A 3GN2A 1FQOA 2JAQA 3AF5A 3LBAA 4WASA 1LDMA 1GTJ1 1U0FA 3WLKX 2PZKA 2GPBA 2QTCA 3OLXA 4Y1EA 4ZO8A 2Y1KA 5AK5A 1DJOA 3MIZA 4GZ3A 7REQA 4ARIA 2WVGA 2HCJB 2R7NA 1PX2A 4OI4A 1QR6A 3OLZA 3VU3A 1JTEA 4RYLA 1XX6A 3DLAA 1UPBA 4ZEMA 3UAGA 4GSLA 1Q16A 2VPXA 5HRCA 4NMXB 3OLWA 2ZCJA 2XAAA 4TT3A 4KXUA 1QHSA 3QPVA 2IYRA 1TQ6A 3K9LA 1PS9A 3LP8A 4O4LF 5FT9A 4FN5A 1E2FA 1N2EA 5IN5A 3R7DA 3SF0A 2ZZNA 2HZ7A 2B20A 2Q1WA 2J4DA 2Q27A 1OWLA 3SS9X 4JR0A 3ZV6A 1DAMA 3WLSA 2HLPA 3WHPA 3LE8A 4Z2AA 1L7OA 1QK5A 2FEOA 5HK8A 3UT6A 2D59A 3SX4A 1SD2A 5GP1A 5AVJA 2VOEA 5JANA 4TXLA 4BZZA 3SIPA 4OK6A 4WADA 2CZGA 4XB6B 2FVYA 3VVCA 4Y2PA 1XT6A 2IDKA 5EUQB 4ZV4A 1N5IA 1M6VA 2LWIA 3E4DA 3HWX1 3L1UA 4CM4B 4PGFA 4GXRA 4I2VA 1T2VA 1HPLA 1MOZA 3U40A 2ZIXA 1T2CA 3LLCA 2CNWA 2VH1A 2DECA 1ZD2P 4F2HA 1P4RA 3GWZA 4QU8A 1L3BA 3VKHA 1C2YA 4MV8A 4AIIA 1XYVA 2R1TA 3OEHD 1O9BA 1H2XA 1R9NA 3L0OA 4PXSA 2JCGA 4TSKA 2N46A 4URFA 5TEVA 4EYOA 4YV1A 5LOVB 5E6RA 1DCTA 5T8KA 1C81A 2YXPX 4JB8A 3GZJA 3WIOA 2VK4A 4S05A 2ODPA 2RGNC 2TMGA 3IUJA 2QM3A 3AUXA 3PR1A 1GZDA 2ATEA 2HR1A 3UGJA 4H6VA 1VE5A 1OYVA 2EVWX 1PJ4A 4DCCA