2OBXA

Lumazine synthase ribh2 from mesorhizobium loti (gene mll7281, swiss-prot entry q986n2) complexed with inhibitor 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
HKDYETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRFFFEHFTVKGKEAARACVEILAAREKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase 1
publication title Structural and kinetic properties of lumazine synthase isoenzymes in the order rhizobiales
pubmed doi rcsb
source organism Mesorhizobium loti
total genus 51
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2obxA00
2VI5A 4J07A 1NQXA 1KZ9A 2A57A 1EJBA 2A59A 1KYYA 1NQUA 2C9DA 5IM5A 2A58A 1C41A 1KYVA 1XN1A 5IM4A 2OBXA 2I0FA 1KZ4A 1KZ1A 3NQ41 1KZ6A 2O6HA 4KQ6A 2B99A 2B98A 1KYXA 2F59A 1DI0A 2JFBA 1NQWA 1T13A 2C94A 1W29A 1W19A 2C9BA 2C97A 1NQVA 3MK31 1ZISA 1HQKA 2C92A 1RVV1 1C2YA
chains in the Genus database with same CATH superfamily
4J29A 3DLTA 4M2LA 1CRWG 2N42A 1HDEA 1K3TA 4MRMB 1ESZA 1VIYA 2ZUCA 3NEAA 3N2KA 1I6KA 2GKGA 2V03A 3PA8A 3R7SA 1CNMA 2HD4A 2AOUA 1G60A 3MJHA 3OTHA 4PQYA 3WRXA 3IURA 4LRSB 4OA5A 3KQUA 1SXQA 3WLHA 1AO3A 4GH5A 4ZDWA 4PXYA 2HPHA 2WSIA 2CV2A 2C04A 2VYNA 1E98A 4BWFB 4QRDA 4RA6B 3ZHOA 2C2MA 2ZAOA 3DE2X 2FMUA 2HZBA 4HH4A 4PFJA 1T8TA 1Q7EA 5FBKA 5BQFA 4Y6SA 3W6UA 2CY0A 4INZA 2C2ZA 4B84A 2VUSA 4KR2A 3B52X 3IPXA 3AHCA 1W46A 4K9PA 5D3ZA 2WAYA 1KE1A 5FPKA 3N7UA 3FGPA 5EHZA 4UUBA 4LBVA 2XNJA 5BN4A 4TYMA 1KFJB 1EJBA 2FOIA 2WG0A 3G68A 3GL9A 3JQFC 4KN5A 1L5YA 1CZKA 4H1TA 1MIHA 3DBHB 4EK9A 5AI6A 1ILWA 1PUXA 2OLKA 5E6UB 3WL6A 2H4WA 2QW1A 1Z56C 2DFKB 2M1XA 4B8WA 5C35A 3S8YA 4TTRA 1ISRA 2A1TR 1DMSA 2LXNA 5FI1B 5G0SA 2QNRA 2CGEA 1IVSA 4UJ3A 4B9EA 3UJNA 1FP6A 2W2KB 3FY4A 1P2VA 3Q6MA 4B6OA 4KV9A 1LDGA 2DWPA 3Q11A 3S2YA 3JATA 4TXNA 1FOEB 2GLUA 1ZGAA 3K20A 3B1JA 1JDVA 2BEVA 3IOYA 1C80A 1RJEA 1YB7A 2GN0A 3EWNA 4PE5B 5EHIA 1DTEA 1TVEA 2ZANA 3THRA 4EGQA 4AJ4A 2X8AA 3IESA 2VQ6A 3SICE 4AQYB 2JKYA 1JKJA 2B1RA 1X6VA 1LPAB 2ALJA 1UBNA 3GBVA 3LIPA 2R68A 2HLHA 3MXOA 1H4TA 3OM9A 5IJZA 2PE5A 1NZJA 1BJTA 1F0YA 4IIHA 3KLOA 2DSTA 5KQGA 1F0KA 3KZNA 3TOXA 3C70A 1ZRNA 2DOKA 1R5JA 1OBVA 4E11A 3D0KA 1YIAA 4RV4A 4EKGA 3WK5A 3WYBA 4TS1A 5ES4B 2A35A 1QH1B 1AS0A 4U7GA 2PGDA 1T13A 3VUEA 1VSUA 2DQZA 3CYFA 5HG0A 2ISSD 3I1YA 3R7BA 2GH1A 3PDUA 1RSZA 2JIMA 3IE2A 3KZ1E 1JHZA 3L7JA 5FO1A 2VF8A 4B3JA 4L9AA 3WYNA 1EBFA 1OI7A 1JE0A 3LZCA 4OHRA 2NYRA 1GLVA 3VR5A 4UPVA 2XUAA 4UM7A 4FFPA 3HVUA 3SBDA 2RH5A 4V02A 3ZIUA 3WFZA 3CIOA 1TM1E 3FZYA 2P78A 3ZH9B 3FHTA 4Q4LA 4UZSA 2DSNA 1ZMBA 1DKOA 2PTHA 3C3YA 1UEIA 5LP6A 1SN7A 3EDQA 3EIXA 5A5DA 4IJUA 4G1CA 4LF4B 5HCIA 1MMFB 1KOFA 1L5WA 4MA5A 4QXMA 3U40A 1A82A 1JQJC 2RGAA 2YMLA 1VLZA 2HSEA 1SBYA 1NSFA 3DH0A 3K8YA 4QOIA 4WKOA 3S5JA 4BWYA 4DADA 1SUIA 2Q8QA 3TL6A 3KQLA 4ID9A 2O5EA 2CYAA 3FM9A 3TI7A 3C3KA 3FPKA 2WJGA 1XHFA 2A0WA 3R0JA 1IN6A 1BWQA 1YA8A 4XQEA 2B82A 3IDSA 3L6CA 1VBKA 5AHRA 1T24A 4ZQFA 2ZB3A 4MVJP 4DV4B 1D07A 4JBWA 2G1JA 3DVRX 4RVGA 1P0FA 1MB2A 1MDBA 3D3EA 4YGYA 5H3HA 3T7JA 3ZVRA 4C5CA 3L93A 3OZFA 3VZRA 3NTXA 3AFMA 3EGCA 4JR1A 4O2AA 2F9FA 5DWDA 3MTAA 1GADO 5EL0A 3T7DA 1GSIA 4LV8B 2EJVA 1D6SA 3JWHA 2QM3A 3JRXA 5BQOA 1MJFA 1F1BA 1QFJA 3WJ1A 5IZCC 1PWXA 1NUHA 1GUBA 4PC6A 4PVCA 4WLEA 5LLTA 3E7WA 1MTOA 2FPRA 2LP4Y 3G2KA 5KNCA 2ORVA 3GEGA 3I9FA 2EKBA 3Q72A 3SYLA 5LIRA 4CV1A 4TVOA 3COZA 1TM7E 5KNDH 2MSDB 3RARA 3E7DA 2E21A 2WJZB 3GLKA 4FOSA 3PPWA 4L1KA 2J6HA 2FLVA 1AGYA 4ALKA 3NCHA 2VHJA 2YXDA 2AZ4A 4EJSB 4WNCA 1ENPA 2B20A 1MNQA 2H9IA 3QY9A 5KDLA 3O38A 5LPNA 1GVHA 2WNHA 3M6MD 2F3UA 3HMQA 2P3OA 1QZ3A 4OFWA 4GM1A 3S28A 3R20A 1J06A 4EG3A 5CFNA 3OWOA 1U2EA 4XA8A 4JVLA 1DC3A 1K92A 1Y6ZA 3A1NA 1SRRA 2OCIA 3GGOA 3NYRA 3QVKA 2CJWB 1AIPA 4I4IA 4N18A 1Z07A 4QGGA 1U9IA 3UO8B 5J47A 1CEYA 3BGWA 2X2PA 3QK7A 1YDWA 4W6ZA 3EIFA 4XAQA 1YSCA 3LXXA 4B40A 4TZ0A 3DNPA 2Z09A 4OG2A 5JFGA 3I8SA 3KUUA 1XGKA 1MV5A 3VKWA 2ZIZA 4D26A 1ONSA 1E2EA 1XDGA 4OQLA 3A3OA 2WYIA 2O1WA 1L0BA 1E63A 3R0ZA 4FB5A 2UAGA 1PK8A 4XE5A 4BP9A 3V8BA 1GTMA 1SNYA 1URPA 1IOVA 1UBUS 3ONVA 5CP8A 2B1IA 5FFFA 2HMWA 3D2AA 5BOSA 1KYWA 3U6KA 2VK8A 3OU6A 2XY4A 4O25A 5THXA 1CETA 2XGMA 4YRIA 2BZSA 5IKMA 2VDJA 3EOBI 3CO5A 2D1RA 4WFIA 1YR8A 1Y4ZA 2WJYA 1GZUA 2AC4A 3HA2A 1VKNA 3Q3CA 4Q4DA 4QFBA 3R75A 3OIWA 4CEIB 1F8GA 3KZCA 4NOKA 1A9TA 1IATA 1LI7A 4JOBA 2VTEA 1FY2A 2YJ5A 5CBPB 2AFHA 4G01B 3ZGYA 1V3QE 2JFYA 3KV1A 5G3YA 2D2FA 1A97A 1IB6A 1W5FA 4AWXA 4ZO7A 2YVLA 1Q57A 2O4CA 2P9FA 5CFZA 1OF1A 1G8KA 3RYIA 2CLEB 1QRUA 4HX2A 2A1TS 1KL7A 4H18A 1E6MA 1EFCA 3C6ZA 3PDHA 4WNYA 3GLUA 5JMPA 3ZU3A 4L50A 5GADl 3TAXA 2HSJA 2TSYB 1M8JA 3MELA 4B43A 4RTLA 4QPCA 4H1WA 4UTRA 4HNVA 5EZYB 3PLAE 2KSQA 3AOEC 4FQ8A 3ILXA 4JGGA 2O0KA 2ZBDA 3W3ZB 2ZAMA 4UATA 2F1HA 2OVFA 2J85A 2J9GA 3UUFA 1XL1A 1C3JA 4N54A 3KOXA 4WZBE 2X5JO 1ZI8A 4BZZA 3MM4A 1SR8A 3FG9A 1FCJA 1E6CA 2E4AA 2E48A 3A4YA 2D5CA 3N28A 3A28A 2A0KA 5IAAA 5CPFA 4JNKA 5ADHA 1OH5A 5JAQA 2ZRIA 2PZKA 3NTUA 3IJPA 4X71A 4BV8A 1IUOA 3VDMA 3EEQA 4FOPA 3TKYA 2JLXA 1ZD8A 2PMDA 2J0SA 3BFXA 4QQFA 3R5HA 1SY7A 3FNIA 2VHWA 3AVPA 2F43B 2HIHA 4GWKA 4E7PA 2XPCA 1JR4A 1P5JA 5BN4B 2BMEA 4U5XA 3UC9A 2QRGA 4C4XA 3QOFA 4D0GA 3RJMA 3DE5X 3M0EA 4IJQA 4RFLA 3T38A 2FP3A 3PNKA 2OG1A 2Q7XA 1FPQA 4L5IA 4MW0A 3DFKA 2I8AA 4GD3Q 4Q18A 3GLIB 1VOTA 1IUNA 2K4MA 3IILA 4Y7DA 2WIBA 2GPSA 1FYFA 2B5OA 5A9SA 5KTNA 3EODA 2NYVA 4R9UC 1JHUA 1U8CB 4JI1B 2JI8A 2WYVA 1PKXA 2W2LD 3FOCA 4FDVA 2Y2UA 3RVDA 5DXFA 5FPSA 3A9UA 3ZXYA 3I37X 2FWNA 4OP1A 4LXXA 5BSHA 3MIIA 2CXXA 3JATB 3M33A 4F4UA 2Q21A 4BTVA 3RDPA 5F9HA 2ABWA 2B4TO 2CVZA 2GRJA 3MN1A 4LZWA 4R54A 2UXDB 4HTFB 4FJ1A 1ZM9A 3TQSA 3R09A 4MYRA 4BNLA 2Y99A 3NW9A 1SQGA 4ENTA 3IMCA 3DMDA 4FE3A 2HK7A 1WULS 1Y4AE 1IONA 5LXTF 3QEKA 1PW7A 1CVLA 1VKRA 2ANCA 1TU4A 2W6PA 3Q9LA 3CG0A 3MMNA 3RWMB 1AKNA 3PFKA 1GD1O 2I6XA 3STTA 1QIJA 2IBMA 4TV9F 3FRHA 2VKTA 5DDIP 3NB0A 3M6FA 4NFYA 2ZTMA 2UYYA 1J7KA 1CC1S 4AF6A 1IIBA 4G26A 1Q6ZA 2H54A 1IJEA 2CNKA 4LE2A 1YB2A 4LRQA 2XB2A 1EM6A 4NS4A 3K71B 3TDNA 1P2UA 2X4LA 3NM6B 3H5AA 4DB4A 3JQ7A 2WYWA 4YYZA 4BN5A 3RC8A 4JC4A 4CRWB 1EAMA 2AXQA 4DJJA 1L3BA 1ISSA 1DC8A 1BNCA 3GLHE 3EDYA 1MT3A 2V6MA 3HFSA 5KWIA 1K7EB 4FUQA 3QEMA 4LE0A 5LCXA 4FHFA 4OD0A 4WIAA 5EC8A 4BKOA 1TK2A 2HPVA 1HXHA 1RS0A 4TT8A 1K3FA 3IXQA 5DBOA 1KBOA 1P31A 1C9NA 4JB0A 2GPJA 2D5LA 4IJ6A 4TYNA 4Y6LA 4UAGA 2G40A 5JSZB 4BNUA 3HL4A 4FXOA 1D0VA 4RF2A 3I04A 3U7IA 2EJBA 3GUHA 1KJJA 3KDAA 3D6HA 4E6PA 2C2GA 1GV0A 1AGNA 2Y4OA 3HDTA 1FUUA 4U6QA 1SM4A 1TTHA 3LGAA 2C7BA 2O54A 4D9MA 1T2CA 2HA4A 1HMPA 4INPA 1UJBA 1YASA 2R62A 2GILA 3R5SA 2XBLA 3TOVA 1S8NA 3VYSB 4XGKA 4EPWA 1CRPA 2OXEA 3GYGA 1WWKA 1O6BA 2OTCA 1Q7GA 3IDZA 5D51S 4DNOA 1C0PA 1QR2A 1HTTA 2IPOA 1ZOLA 1UL1X 3GI1A 4D3FA 5HKKA 4X1KB 5EKTA 3NDJA 2ORED 4AMZA 1P3JA 5IAKA 5AVSA 5GONB 1VKOA 3QU9A 4G0VA 5JMTA 4WZZA 3PUYA 1LRKA 3GGJA 2P6RA 1Z12A 2OCBA 1U9CA 1UPUA 4B3DA 2A5GA 3U1BA 4HDRA 1SXJA 4CL8A 1MC1A 2CLLB 2A7QA 3C7AA 4QGAA 2JAPA 4C30A 4YJ2A 2J6BA 4M99A 5B64A 3WZ2A 2H1IA 1CE8B 2HJ9A 4Z9BA 5ELXA 5T41A 1GPBA 3CH4B 1CIPA 1WXFA 4PHHA 4G8BA 3T7RA 3QOXA 1CY0A 1TM3E 1MAUA 5A71A 2I4RA 4E0BA 5D6NA 1LNSA 1FMCA 4ZYTA 5J4KA 3VAZA 1NXPA 2WIFA 2AA3A 2HKIA 2ZB4A 5TJ9A 4UW9A 4ISCA 2VLIA 4AULA 2NO1A 3DG9A 3IAUA 4FCWA 5HSGA 3WGLA 1JDJA 1KFKB 1YZGA 2P5YA 4C88A 1D2MA 2P69A 3TR5A 1K6JA 1E79A 2NZ2A 1JEQB 2OMKA 1IYZA 3EXEB 3KG2A 3O83A 3DM9B 3R3ZA 4HNAB 5KCMA 2JJ2D 4DRZA 3A27A 1V45E 6CHYA 1UBSB 5FDFA 3KQTA 1JECA 1FSPA 3TRHA 1MOPA 3N87A 1R4NA 4FU0A 4H3KB 2FR8C 1NQ5A 2CUKA 3N74A 4GYYA 1Z7GA 3BMNB 4X1IA 1NPTO 1FUEA 1W5TA 5E8RA 1BVUA 3CUUA 5B6PA 2C03A 3V97A 1X7XB 2P2GA 2IYYA 3D4LA 3F4LA 1S5PA 1ZMTA 2NNWB 3IPAA 1WLYA 4W8OA 3RRFA 5LB4A 4X3PA 2KLHA 5JDCA 2XKBA 3WK8A 4MS3B 1F4PA 2BBTA 1DOZA 6LDHA 2P9JA 5JQWA 3H2IA 3OAAA 3UAZA 3SJ7A 1DAEA 4NYMR 4ZMSA 1YHZA 2W11A 3OKPA 5BNIA 1BJRE 4TWIA 4KR0A 4FKZA 4X44A 1THGA 3P9SA 4Y2YA 1HT3A 4AFNA 3MGAA 5EWLA 1V4VA 2QG6A 4JQSA 1NQVA 1DU4A 3MTDA 4OJTA 4O4HA 2QQEA 1FJ2A 1CNFA 3L1HA 1XD8A 4FOLA 4OFBA 5HR5A 1JXAA 4WKCA 4CTOA 4TMZA 1NP7A 1GUFA 2PMKA 1JJFA 2QQGA 1M34B 1DPFA 1UR5A 2YFQA 2ZETA 3FD8A 4K9KA 1KDRA 1XRNA 3TSWA 3RASA 2F7SA 1KR5A 3U4IA 1FSSA 3V4FA 1UMDA 3SDZA 3GFOA 2ATCA 2YZGA 3RTAA 3DEHA 3F7OA 3H2BA 4OK5A 3WNDA 2ZRMA 3EXG1 4D8VA 1Q20A 3AEUA 2VNHA 3Q7EA 3PENA 3H9QA 3BICA 4MUKA 5FOXA 4BLOA 4TZKA 4GP6A 2KBFA 2DQKA 1AXEA 3D8HA 3I9NA 1PWEA 1X1RA 1O54A 4G89A 5KTPA 1USKA 2SICE 4OUKX 3CCCA 1N92A 3WLJA 2J46A 3KHTA 5TVKA 2Q1YA 4EJMA 3JSXA 3WKBA 5AI4A 4ZI2A 1R5BA 4C0LA 4NX2A 4Q6WA 3EQ8A 1N57A 1DQPA 5LBTA 1BMDA 4JP3A 1ZK0A 1P9OA 2BJWA 3Q7QA 2GAIA 4FT4A 4OFXA 3GAZA 4PGFA 4BIMA 1U8XX 3JVIA 1KEWA 3RYHA 2B83A 3B36A 1U8ZA 4DV0B 1Y3CE 1D1TA 1SURA 1NN3A 5IJ9B 3EULA 4CMEC 3KXDA 3HUUA 1UMCB 3OP1A 3WL8A 1AGPA 4MHTA 2FFRA 2WKQA 4IQ8A 3TFWA 4F06A 2NMVA 4MQLA 1AQIA 4R1QA 5CA0A 3UQYS 3GRUA 1KYIA 1WO8A 1KR2A 2I7VA 2BSXA 4JU8A 4L6IA 5FB3A 4IIBA 2QZJA 3I2JA 4MDHA 4EDFA 3ASYA 3WQSB 4F8YA 5KDOA 1ZCBA 2Y93A 4IMJB 1JB9A 2JI6A 5FR1A 1FA9A 1DV2A 4V0LA 3EGVA 4HS4A 4DM3A 3T3OA 1ORRA 2QTWB 1M83A 2P3QA 3UHOA 1QZUA 3VO9A 1C0EA 3WAJA 5A9SB 4KNVA 3KQYA 4QU9A 4LXYA 4JLPA 1VJGA 1C14A 3A7DA 3ILYA 4CIAA 2XQGA 1IZ7A 1D09A 2IEBA 4TL6A 3IAS1 4BFWA 1MGOA 4LSWA 3DWEX 2Q5CA 1I3LA 3FETA 1M1YE 3ORYA 1P6XA 2QRVA 2R1TA 4L5BA 5EUMA 3L77A 2GS9A 2A67A 3E3NA 4Z4HA 2XTJA 1E9BA 4CMBA 1HDCA 1RTTA 5DTRA 2J0QA 3ZDXB 2BEKA 2GZSA 1H1DA 2BPOA 3H87A 4Z0HO 2IV7A 5BSKA 1KOLA 3NYQA 4Z49A 5JVDF 3FHLA 3DP7A 4N1AA 3AWDA 5J5VA 1PT8A 1ZHOA 3MHTA 1EVQA 3AF6A 5TB5A 2QVCA 2VTKA 3KPWA 3A32A 5KU1A 1EUQA 4ZEVA 3R6TA 3I5YA 4IMPA 3ISJA 5I7UA 4ND6A 5DK6A 2YMPA 5JFOA 4TLDA 5DTIA 3K9WA 1TCBA 1YV9A 1Z45A 4K5QA 2VPZA 1WY7A 3MNFA 1IY1A 5DNCA 1LW6E 4BKQA 2X15A 2H00A 3NOQA 4B5LA 4K9NA 1X15A 3QU2A 2WBLC 4HGNA 4KQCA 2B99A 3HHEA 4RU1A 4MUEA 5ALXA 1D0IA 4K3VA 2OSBA 2PSDA 4AIIA 3JZMA 3WBBA 1EHYA 4I50B 1YGPA 4B74A 1L8LA 1GGNA 4ZIRB 3IVAA 5EPEA 1K3UB 1OASA 1E1DA 1RFGE 3GRCA 3REFA 1WKVA 3CVYA 4H3SA 4G5YA 5TT0A 3UMGA 4RXMA 5ANRB 5BYJA 1JIKA 1K5DA 3A6JA 5EP2A 2HCRA 2VRNA 3B12A 1UODA 2B25A 1NTRA 2QG9A 4I9UA 4JJZA 1QHIA 4AO6A 4AS2A 5KCZA 2XMZA 1TTTA 1ISJA 1LWNA 5T6BA 1E1LA 1B74A 2IK8A 3L0CA 3M3DA 2HCFA 3T7TA 3DPIA 3L3BA 1IUPA 3QI2A 4KYVA 4FEEA 5AUNB 5K7SA 4FS8A 4NAHA 5CFOA 3PQ7A 2W6MA 4EUEA 3SBEA 5AO9A 1VG8A 3SM3A 3I6MA 2NVUB 1MX5A 3LY7A 4MCJA 2BL4A 3UC5A 3DUFA 3TLAA 3H0KA 4IDAA 1LPPA 3RRXA 2PJZA 1AHPA 4URUR 3N70A 4GKVA 1MVOA 1S9DA 4AB1A 2EQ5A 1DFHA 3JZDA 4KWTA 4YJ3B 4HYEA 1U2DC 2CNWA 2WQ6A 2JCXA 1U1IA 3KJXA 4L5JA 4QTZA 4ZVTA 4KIFA 1Q91A 1E1QD 1JVSA 3CZ9A 4ICIA 4BATA 3MEQA 3E1SA 5A9RA 2HA7A 4A16A 3R3VA 3PHJA 5AVWA 1NM5C 2VP6A 4R2KA 2MIIA 3UNXA 4BVAA 5IZ4A 2PFKA 3TNFA 3DCJA 4AU1A 1B2LA 1SXIA 2AYZA 3C6QA 3DD5A 1ZC4A 3N07A 3QFSA 1LLCA 1IPFA 2WT9A 3W5SA 5HS6A 5JWRA 3AR5A 3WRYC 1US8A 2JIQA 3FMGA 1YZUA 3D1LA 3R4CA 2SECE 3SM9A 2QIPA 3EVZA 3GFQA 3WLKX 2WICA 1HC7A 3L4BC 3O4JA 3CX3A 4EDHA 3HP4A 4MGYR 3G9ZA 3K1TA 3VBCA 3EVGA 1EGMB 3KQOA 4G97A 3W6OA 2OZLA 1PT7A 3AQIA 4ZOEA 4GC5A 4KN6A 5K8TA 5FEMA 3MBKA 1Q2XA 2ZE7A 1MFPA 4BFVA 1C7QA 2W6QA 4PGAA 5AHWA 1J8YF 3NT2A 3OE1A 1QVVA 3W7VA 1Q7TA 2RK3A 4PWZA 4A6PA 1XR3A 2FJ0A 1ZMXA 3HCWA 4G0XA 2IH4A 3FYSA 3OIUA 4I1UA 2YHSA 2XA1A 1NR7A 2CXQA 4F3YA 5BYBA 1PG2A 1QHSA 1NRJB 2B4KA 4IOLA 5TDHA 2K7FA 1SHJA 3P2IA 3IJEB 3P5BA 1CUHA 1K8RA 4I66A 4MW2A 4Q19A 3ZCXA 2W98A 1T5LA 1AZSC 3P45A 2XZLA 4PRLA 3RJ9A 5LVAA 2JK0A 2O2SA 2QX7A 3R7WB 2OYRA 4K88A 4XZ3A 1W2HA 4F7WA 4R2JA 4AJ9A 5EHGA 4R6XA 1KKUA 1C7IA 3K9HA 3U3KA 4D25A 1WXWA 1EESA 2YMQA 3A1CA 1SH7A 2VHEA 5TLSA 5M34A 2PD4A 1W4LA 5BNFA 3AVVA 2B0CA 5BV1A 3QPCA 1A69A 2FG6C 3Q5EA 1ID1A 5K0NA 2ZATA 4H77A 2ASVA 5DP2A 3G49A 2ORWA 3VJKA 1CULC 3DAHA 1JJBA 2ILTA 4X3CA 4COKA 3FWKA 4KC0A 3KSMA 3DHEA 5BW8A 3AHDA 4TZ6A 4KO1S 4YMVA 1ZQ1A 5FLYA 3HDQA 3NYWA 1T2VA 4EZIA 1X2EA 3WADA 4OX9Y 1H4VB 1J70A 2A1UA 4BC0A 4LY6A 2FFQA 5JJ5A 1H2AS 1MLDA 2XNDA 4JSRA 1L5SA 5J9FA 4DCVA 1KARA 3M6AA 3OPYI 1M5TA 4ZVMA 2FWJA 4EYQA 2AC7A 2ODWA 3IBYA 3W8DA 1HMYA 1DAKA 3IBGA 3OQJA 1IXSB 4C6TA 4NE2A 4TYYA 3B6KA 3M2TA 2VF5X 4IDQA 3CRZA 2M32A 3P94A 2J4DA 3ZCQA 1BQEA 1JQDA 4U0KA 3WGUA 2ZJZA 4W5NA 2IYVA 2Q49A 3AT1A 3PGA1 3WMWA 4AY4A 2JLSA 5K0GA 1EM8B 4WKNA 4UUOA 4F8JA 3IRUA 2K5UA 3B5IA 2W93A 4NMHA 4V0MA 1L4NA 2XD4A 4Z86A 5JEDA 4DLXA 3ANNA 2MYPA 3VR6H 2CXNA 3R1IA 3CUKA 4L4ZA 4PRYA 4L57A 4FEAA 4TXHA 1M2JA 1R0WA 2WU4A 1ZHHA 3TBKA 3QMMA 2YXNA 4YCAA 1RQ7A 3IV9A 1D6NA 3P9IA 4GX0A 4Q9NA 4UM5A 3LHIA 5F52A 1G42A 5EPOA 2O57A 5E7QA 3DZBA 1JIVA 1V11A 5HP4A 4EF4A 4FFDA 2IHBA 2IBTA 1SVUA 4L16A 3RFCA 3PC3A 1FFDA 3CSDA 3CTMA 3ELDA 4L0MA 4E2FA 3U5ZB 1O6GA 6GPBA 1VDZA 2VJQA 3C3DA 3FI0A 4HZGA 4C0AC 4BLPA 5KOHA 2QXYA 3THWA 3AB3A 3ND8A 2J45A 5KNDA 4JC0A 1OD6A 4P4NA 3S2SA 2GDZA 2ZSBA 2HJWA 4QLBA 3GUZA 5GQSA 4JKOA 3PJGA 3N7TA 5IJAA 2QRVB 3T54A 3WHKA 3PVSA 5BYKA 3OETA 4RE6A 1Y6QA 3U48A 1U28C 3CVWA 4IH4A 4DCGA 2JS7A 3ADBA 1WF3A 3HCBA 4C78A 3RAEC 5JD5A 5CVDA 1ZMRA 5EXPA 1E9EA 4BLRA 1A9YA 3OIFA 4ROSA 1HSZA 4MXDA 5ILGA 4ETIA 1KVRA 3DHWC 4YAIA 4LX0A 3U7EB 1YVPA 2ZROA 4HVCA 4Q15A 3FSGD 2WTNA 4QUAA 1PFWA 2YN4A 3E5MA 4QOJA 4Y2XA 2AEFA 5J2TA 1QFYA 1DCKA 2MJLA 5A0FA 5JZBA 2ZIGA 2MSNA 3DV2A 2B0JA 2KB0A 3L7YA 3UXEA 4D9JA 2ZYUX 2I8LA 3EVFA 2OAGA 1I4TD 1LJLA 1MAWA 1O77A 2JHAA 4DT1B 2VQSA 3IUNA 4ZZ0A 2GDJA 2CMDA 2ZB7A 3UPUA 1DEHA 5FBHA 3HWX1 4LHZA 4LF5B 4L76A 1NUUA 1OJLA 2AQHA 4UMEA 4RV5A 4HVLA 2D54A 5JPIA 4D9KA 4RAQA 3NC1C 2OQRA 221PA 1X92A 4BMVA 4TMWA 2BT4A 1UZMA 2N3ZA 3GAAA 2AG1A 4BAZA 1FBTA 1N9GA 2CL5A 4UUNA 5K1ZA 2LKCA 3PXXA 4QPZA 2J5RA 3DDNA 4B2LA 2CHGA 3OE7A 4LMRA 1K08A 2J87A 2PMCA 2PGNA 4Y6QA 5DN9A 5CT5A 3NV9A 3RLIA 4UOEA 5KX5B 3R77A 1NIPA 4IOJA 5AI9A 3D59A 1OFIA 2MWMA 2RH8A 4HEA6 4HQFA 1NQWA 4JLSA 4D9BA 4CF7A 1NI4B 3T9EA 4GWGA 1GN8A 4F2GA 4EMUA 1MRNA 5CCXA 1MABA 4HLDA 4WZBB 4NFSA 4E09A 2PT9A 3W6ZA 2CDNA 1XEWY 4M1WA 3H11B 1KKLA 4RKQA 1P74A 2NSYA 2OZEA 2NZWA 4JSTA 3IT0A 4Q9JA 5H70A 2JGMA 3Q87B 4IWXA 4BJ1A 1B23P 1FS4A 5TXGA 2WP8J 2JANA 2HWUA 2QVYX 3T9CA 1KYYA 3HYCA 3OQIB 1ZGGA 4LDNA 1IBRA 4EKIA 5JAPA 1T6YA 4ITVA 1JA9A 2DKOA 3T1VA 5CT4A 1XD2A 1VP3A 4LZPA 1SKBA 4IDFA 5JTTA 1LLQA 5BW6B 2XGJA 1TMYA 1GAQA 1AXRA 2AOWA 2BWJA 4ALNA 4BO7A 4BY9E 3N2ZB 3OLYA 1VE3A 2C7QA 1M2GA 3BIXA 4DLUA 5IVIA 4N49A 2FPIB 4Q4CA 2FMIA 1W47A 4ZFNA 4H0FA 3RIGA 2FFJA 1R8XA 1YI0A 2B8EA 2YWRA 1SCIA 3JYOA 3O26A 4IJKA 3KS9A 4IXDA 3TTUA 3H1TA 1ZBDA 2AJTA 2B5VA 1EH5A 1TO1E 4CLEA 4JIMA 5HFNA 4DREA 5KREA 3KKNA 3G9UA 3P2OA 1BXRB 3HN6A 3MJDA 4QGFA 2CJFA 3QF7A 3C1OA 4G5XA 3ES9A 4BVKA 3EZ2A 4CDNA 2QMOA 2YV3A 3AUAA 3GCDA 2I4TA 3WLSA 2R4QA 4RDHA 3TWOA 3URMA 2BH9A 2RGEA 1VRVA 1LSUA 3E0QA 3BE8A 1U3VA 3NPMA 4E4TA 1K68A 2RB5A 4Q5IA 2RI6A 4KFRA 4YV7A 1YOVA 4KGVA 2IHTA 2WWYA 2DERA 1P4SA 3JYNA 1JEEA 5TMDA 3ZE2B 5LWQA 4CGZA 4QUHA 2ZSAA 1JR2A 3BJIC 1CR1A 3FAZA 2AZMA 3BK1A 5ALVA 2W2QA 4XVHA 1BG6A 1DMRA 1HNNA 3MVEA 4ZZ3A 2P2ZA 4OK6A 4O8ZA 4WGGA 3ETJA 3G9TA 5F3RA 1O0CA 4E88A 3NTVA 1QANA 1QGED 4G24A 4I1RA 2D4AA 3QYAA 4IAOA 4U7DA 4TKVA 5TV2A 1YT5A 3ROGA 1OX4A 3B70A 1VC2A 2QT9A 2ZRJA 3B20A 3WHIA 5CJ2A 5LM3A 1Z4IA 3GN2A 4ZZ1A 2P6OA 5HK8A 2HJVA 4Z0PA 3GLHB 1QOZA 3SYRA 3WDKA 2OCPA 1CLUA 1A8HA 2IYFA 4KQEA 1TF5A 1VMKA 1QPZA 5AIBA 1V1JA 3BFKA 5DHUA 1E3MA 3BMCB 1OXKB 3G5UA 3GJSA 1T5IA 1S7GA 2J31A 4KX5A 4W5JA 1VI6A 3Q88A 5BT8A 1CF4A 2DPGA 1TYCA 3THXB 5ICFA 1AA9A 1UZLA 4HWRA 2RHLA 3PGMA 1WSBA 5I4IA 1DPGA 3X2FA 3P97A 3AERA 3G8DA 4F2WA 4YRDA 1GPLA 1NVVQ 1Y9EA 3ZK9A 3I01M 2R4UA 2EKQA 1R5OA 1C9YA 4G09A 3WOHA 1DKUA 1Z74A 2A1UB 4PEVA 2ZS7A 3LOUA 4IDDA 4GLOA 4CMIB 3SD7A 1W75A 4KFUA 5D1HA 5G40A 4CL2A 4OQNA 1LVUA 1NZDA 3R8XA 4DYHA 5F21A 2VR1A 1HE2A 4HLQB 1GPH1 1V47A 2FUG1 2GCEA 2RK6A 4NZNA 1YACA 4P92A 4DVJA 1CD5A 2BLNA 2B1JA 3CF4G 4L8WB 4PAGA 2NGRA 1ZH6A 4R1NA 4LZZA 5COBA 3TCNA 1EE1A 1NNSA 1OHHA 3DVSX 3ORFA 1J2RA 3VV2A 4C76A 3KBBA 1QP0A 2AF4C 1W30A 3UMFA 1PZFA 2OFXA 3SHVA 4NARA 1RLJA 1QCYA 3PXDA 3HM2A 4U7FA 5AKZA 2XQKA 1SJ9A 1T0PA 4NK5A 5B5SA 1RHUA 4FC7A 4OQZA 3UHFA 1ZGZA 1I0IA 3FCSB 2A0UA 3MHPA 1IQ0A 2NX2A 2WF9A 3MWEB 3QA9A 1V16B 4IICA 2GD2A 2F48A 3FHJA 3VKVA 3BREA 4NATA 2ZYGA 2CHVA 2XLBA 1RAGA 1B42A 4TMXA 5FI5A 5L3SB 4KWHA 4C7OB 3OTWA 3IP9A 3S4YA 2XUJA 2PZGA 2CLDX 1BCSB 1MG0A 3NRJA 2WD7B 2FEOA 3OKAA 3I32A 3MFQA 3PC7A 4NHEA 1WUTA 4UVHA 4Y18A 5ALPA 4DAOA 1Z2EA 5HK9A 3H1GA 1NJSA 1NP6A 2B92A 2QX4A 4PO3X 1CJBA 4P7BA 4DEVA 4V0RA 5I48A 4LNUA 3I9V6 3FB1A 4RFSB 1SXPA 1W5SA 3MWFA 4ESVA 3Q2IA 2DFTA 4LV6A 2WMNB 2YASA 4KQMA 1TRHA 4NXNB 2FW1A 2PNFA 2I8CA 2PS3A 3H8WA 4OB6A 4F71A 2V98A 4DE5A 2B4YA 1TT5A 5GJBA 3EXHA 1AZWA 3E0XA 2IZ1A 1V43A 2J3EA 3FVQA 3QKSB 1RQ2A 1TX4B 1U7WA 1V3UA 2N47A 2A0FA 4KYIB 2OESA 3MYRA 2WYHA 3K2QA 2PT6A 4RLSA 1E3DA 2WFLB 4DBLE 4Y98A 4N5HX 1GZ7A 1NG9A 1GAJA 4TL9A 3ESAA 1DNPA 2I66A 4IHAA 4LS3A 3HUTA 1WETA 4YCJA 3FNEA 4IZ6A 1OH7A 3M89A 3DL7A 3HU2A 4JCOA 1NYRA 4OYLA 2XVXA 1EK5A 3L8EA 4Q3NA 4BNXA 4ZYWA 4DXAA 1WPXA 2NTNA 1PK9A 2OCDA 5FYQA 4NJEA 1PQ4A 2IL1A 2Z6AA 5ICGA 2XUPA 4HGRA 4AXXA 3RKRA 3HBAA 3G88A 5BUQA 2PSHA 4JI5B 4X63A 2WV7A 3FYUA 3RSQA 3BBPA 1QQ7A 4ERXA 1HURA 5AM1A 2HU7A 5TQ0B 2WIDA 3HC7A 2NUTA 821PA 1AU9A 1DKQA 3O4FA 1QE5A 3DE6X 1N9GB 4F4FA 5K3BA 2IS2A 5CURA 4QVKA 1UXKA 4EL0A 1IOZA 1DLIA 3BZBA 3ZGOA 1NMSA 1UPXA 1GAEO 1C1XA 3KOUA 2WTBA 4TLEA 3NFYA 1OTHA 1OZ0A 2VL7A 3FDZA 1U3WA 2XOEA 1QS0B 3MCVA 1FQWA 2H8KA 4I5GA 1U7DA 3DFFA 1FLNA 4FMCF 3FDXA 3K6JA 3HUFA 3WDSA 2E1RA 2R84A 4Q4AB 4R7ZA 4B4UA 1R0ZA 4Q03A 1W19A 3EGDA 3ONFA 2QMQA 1I7PA 4EKDA 1U3UA 1E5QA 3AHEA 2PEZA 5JDCC 3JVUA 3NMUF 1HQDA 1UINA 5LP6F 5IC6A 3NANA 4GZLA 4KXFB 2GNPA 1BJKA 3HJAA 3V34A 3M6LA 3PGJA 4ZPJA 1VPTA 5JT1A 4LKOA 2A9RA 4JGIA 1U3FA 3ONEA 3DULA 2B9VA 1VPLA 4ZXPA 3TOCA 3WYCA 1BSVA 3EZXA 4M21A 4ER0A 3DLHA 4ND8A 1G5RA 2O9JA 1MA3A 1EUDA 2PM8A 2XLCA 2BEUA 3OLVA 4RM2A 5DW0A 4ZAFA 3LT2A 4KE8A 2BFMA 2ZTUA 3QEBZ 1JBEA 1SKYE 3Q0IA 2VHQA 3H9BA 5AQEA 2BFNA 3N6XA 2Q3CA 5JNUA 3SQDA 4CV2A 2ERYA 2RJ3A 2PUCA 1F7UA 2ZYDA 3MINA 4AJJA 2JI7A 2OK7A 4NBUA 4LRTB 2G9NA 5IJWA 4A82A 3T34A 4IMIB 1M1YB 3K8OE 1NQXA 4O2AF 3GQBB 4YT5A 1T1EA 5LZ8A 3FYTA 2FE1A 1I9CA 5CX1A 4FD3A 2H2GA 2RG7A 1WU8A 2X76A 1X7WB 2EFCB 2HRQA 2BMVA 1PU2A 2IF0A 3U09A 4PINA 6ABPA 2H5IA 1CUAA 3B7WA 3L04A 4FWIB 3UJ6A 3ZTYA 5JWHA 3VSAA 1NP3A 3HKCB 1JGTA 4TTIA 2V74B 3M83A 2A86A 4TRRA 3UMSA 2HMUA 1HRDA 1UM8A 1F6WA 2I2FA 3HJHA 1RKQA 2GTIA 4IINA 5ALYA 3D8TA 5IUJC 5KPDA 4JV5B 1Z3CA 1LXCA 1N8SA 1F6DA 3PX2A 5LMCA 5JNWA 3RYCA 4HY3A 1T3GA 1Y80A 1FSFA 4MLDA 3U4GA 1QHHA 3PDJA 4AG6A 4NLLA 4IIDA 1QO7A 4MJ7A 3NHPA 2HDOA 5G3ZA 3S44A 1EFVB 3P0JA 3TS1A 3OPQA 5HQ3A 5K0SA 5ILOA 4UPEA 1AK1A 2B6HA 1AT1A 1F0PA 1YDFA 2X7XA 4FI3C 3QLVA 2L19A 2HMSA 2RBEA 1NOJA 2FDRA 2JEOA 4JUCA 5FPPA 4BDSA 1TA9A 3AIKA 1OW3B 2CNOA 3QMPA 2CMFA 3UK6A 1GNSA 1N78A 4YRQA 3ONNA 4QRHA 2F55A 4LBYA 1DDGA 2HSZA 2YNMD 4PX2A 4XPZA 2LDBA 4TVKA 1UANA 3S2ZA 1RIIA 1QFMA 2FW8A 4KH1A 2GBLA 2VF2A 3EOAI 3DMRA 3Q10A 4NZZA 3RRJA 4NMLA 4PWYA 5CVEA 3UA4A 4HK4A 3IEUA 2HY7A 2VP4A 5E8JA 3NAGA 4X1OA 5FJJA 2NOAA 1N0HA 2DF8A 3AJEA 4QU0A 1CQJB 5EQFA 3VR6D 2MTBA 4MRPA 1RWKA 1XRQA 3EMDA 3HN7A 1Q1BA 1E2QA 1YQEA 4XQ9A 5EOVA 5BT9A 5CR9A 5LOVB 5F76A 1D2NA 1NRXA 4BWVA 3K31A 4QAQA 5CB8A 2X9QA 5LQKA 1JG3A 1JHMA 2VDRB 3HO6A 1ML3A 1N3BA 5G41A 3OUUA 1OKKA 3D3QA 3A0RB 4B31A 5LDHA 3PKJA 3WYFA 1QP4A 3AUTA 4LXGA 1OC4A 2XRZA 2VSQA 3AEXA 4JR0A 2DY1A 1TFUA 5MFPA 4MARA 3IVXA 2JHPA 1VZ2A 1D04A 1M1NB 4M0LA 3SHTA 3F7TA 1FZTA 4Y0VA 2C7RA 2V6IA 1RJ9A 3A26A 4PPNA 2ADMA 3WIOA 5CMLA 2X8JB 3ND7A 2EV9A 5EZ6B 4BO3A 2RH4A 4NBRA 4C4ZA 4XDYA 4CMCA 1YB5A 5AJXA 5L40A 3FTEA 2IXGA 1M0TA 1Z4MA 4P3KA 1A5SB 2P3SA 2O0HA 4I1YA 2HIAA 2HMTA 1SC4A 1W48A 4FZJA 2BHRA 3EFHA 5I4BA 1UFOA 1W88A 4P58A 5HIKA 4R2WA 3HJFA 4NFLA 3IBSA 4MW5A 4XX1A 1ZO8A 4QHTA 3X1ZA 5L9AA 3LOQA 5JASA 1NW3A 3HJRA 4PR0A 4YAKA 2WOOA 1PV1A 1KU6A 3NBAA 4N6OA 5CK5A 1NC1A 3KOZA 3CUTA 1P2TA 4D97A 4F6CA 1LVGA 1KI8A 1WJGA 1RPTA 5FOUA 1N2HA 1C30B 2JW5A 2WWIA 2XSZA 3IUJA 1SCUA 2I34A 4UCWA 1L5GB 2P90A 5BN3A 1WU7A 3NAMA 4DLAA 5HIJA 2JJMA 4OJKA 2J3IA 2WYUA 4RTPA 1SD5A 3OCZA 2R1ZA 4DPMA 1VMEA 2Z2JA 3OZUA 2E49A 2IC5A 4IM7A 4TQ9A 3AJDA 1T1JA 5C2JB 2PGOA 1N77A 3ADPA 3L6EA 3A36A 4K28A 4D4IA 2IY8A 2SBTA 1CY8A 1EGAA 4ZALA 5IT5A 2FPPA 2W6JA 1N34B 3EGIA 5EVJA 1RQRA 5IULC 1PG5A 3AIIA 3OECA 5DGCA 3HBLA 4AQDA 1IY9A 3RRMA 4RVCA 3Q2OA 1RRGA 1Z17A 5MHTA 1DS6A 2G5PA 2Q3MA 5JFTA 3FF4A 4G0QA 3WGKA 3D2CA 4Z4QA 1M0SA 3I01A 5I6DA 3C87A 3VX3A 2ZBGA 3WGNA 3WLEA 3BZUA 3F96A 4X7PA 4DLTA 1AX9A 1K5HA 2JGIA 4CEHB 4CQNA 1IRIA 4U8GA 5EHXA 1T36B 2I2CA 1JLRA 3ND6A 4G0NA 3TN7A 2RGXA 5FORA 1U7XA 2Z1MA 2ZYIA 3FBTA 3PV0A 4BO2A 4FD2A 2H59A 3IRVA 1WSDA 3E03A 3NBZC 4GR4A 5BYAA 3GCZA 1ZSNA 2V7WA 4ZVVA 1EE2A 2H4YA 4CKBB 2VO1A 3FYUB 3KQMA 1MJGM 1Z4JA 1V5GA 1E3JA 2FWBA 3CR8A 4LKRA 2HFKA 5LUBA 2R1VA 4PLTA 4JXZA 4LZNA 5DGXA 3ECCA 2C00A 2BUBA 4UHKA 5EWMB 1XP8A 4MPPA 3WGMA 1I2BA 2O2IA 4LJAA 5ALNA 5HQTA 3OCCA 2WVJA 1L5MA 2B8TA 1RI2A 2Y1EA 3WYAA 5FL3A 2PSFA 2D0DA 3UCXA 4RQTA 3BIOA 5EIWA 1Z5GA 1NW9B 4IP0A 4CMGA 2ANBA 3COSA 1U65A 3C7TA 3WMRA 3DHVA 4UFPA 1L7NA 3LFTA 4XR4A 1KAEA 2AG5A 3H6HA 5AR1A 4EWLA 2BW0A 3LRXA 6ADHA 4DNFA 3EGDB 1K8YB 2W5UA 4D3ZA 1M2KA 2KS6A 2UVQA 4LYHA 4CMAA 2AFIA 4M1YA 2P0EA 3LD9A 4MWEA 3T3DA 3OQVA 3U3ZA 1Q16A 4OBBA 4Q7EA 2R79A 2JAQA 4JI3B 4ZHSA 5H68A 3LXRA 2V7EA 4QJIA 1J5XA 2BMDA 1Z0SA 1I3CA 5CK4A 3TOSA 3B78A 1HYQA 3C39A 3VR2A 2B9EA 1DIBA 4QODA 1H2FA 3WL5A 1A4UA 2RCNA 1EUDB 5EJ4A 2BEUB 1GIAA 2DUNA 3N8DA 4PQEA 2D0OB 1FFHA 4MVJI 5DLYA 2Y3IA 2ZT6A 3HB7A 4FK8A 2R2AA 4OHVA 4B7XA 4D0LB 3N5CA 4NCHA 1VZ3A 3G0HA 2EQBA 3OF3A 3Q3HA 4UHDA 2XDWA 4R9RA 4QOGA 1IMJA 5GWXA 4D9FA 5LQCA 1I6MA 3KZKA 1XDUA 2YIDA 5KJCA 3P7MA 4H4CA 5LYYA 5SZHB 3FOZA 4Q1CA 2GEFA 1JKIA 3QVLA 1P8JA 4ZVLA 5JXHA 1V7CA 2CC2A 4JP5A 3CY6A 2C88A 3PZRA 4J1QA 4JLWA 4NYIR 3SMVA 1TPYA 3RD5A 1SQFA 2GARA 2AQKA 1A4XA 2HOQA 3BXFA 1H2WA 1PE0A 2BTQB 2DPXA 2RGRA 1G3MA 3FJOA 3N0XA 3RTBA 3LBFA 1HDGO 1TLTA 2V5UA 3SI7A 2WC1A 4QFMA 4P4UA 2P0YA 2B61A 3IHLA 4TLAA 2FN4A 4JLMA 5B3JA 3IPCA 4B7CA 4LVCA 4A0SA 4CQMD 4EI2A 1UJ2A 3AJRA 3I4CA 4KLZA 1E4EB 3RYCB 4PZCA 1QKJA 3M6IA 1ZRSA 4FFVA 1TZBA 1G8HA 1R7RA 2FUEA 1FJHA 1Y8RB 1Z82A 1XAJA 4IVPA 3G2LA 4GGPA 5JXJA 4QVIA 2R00C 4YI5A 2QX9A 3CVXA 3L05A 4R68A 3J7TA 3HCEA 3CLRD 2OFOA 3LUAA 3KTOA 4L9WA 2XE8A 1NY5A 2IUSA 4PYOA 1APBA 3OQMA 4JLJA 7REQB 3DTNA 3I4LA 3P2YA 4H3HB 2X42A 3OZVA 4LSZA 2IE0A 4RK7A 4C22A 4DZZA 3H2SA 4BQIA 1FK8A 4DSNA 1A8QA 2XVZA 2QG4A 1AKUA 2QDKA 2WOJA 3MXTA 4UARA 1ZD4A 5ETJA 1N2ZA 4UBJA 4ILEA 2XUFA 1PNTA 2G76A 4EA6A 1CPYA 3PR3A 3LYAA 4CN9A 5CDTA 5DP1A 3ZDEA 4F5DA 4KYTA 4YRBA 3TG2A 3FBWA 4I1IA 4I55B 3IP6A 4EA8A 1DSSG 3DHNA 5D86A 2BM1A 1ODLA 2YVAA 4UZFA 3TTYA 1EGQA 3UT0A 4XWKA 3HY4A 1SPBS 2H92A 1WCYA 1YR6A 4UREA 1FFXA 3RU3A 1HT2E 4EI7A 4W5RA 1E8MA 2CD9A 5GZ1A 2UVPB 4OI1A 4ZVKA 1QB8A 4J0FA 3U4QA 5BWCA 4XRRA 5LLSA 5TNXA 1P9RA 2BSAA 3TZEA 1WB4A 4PGHA 2VVTA 2MMGA 1T0HB 2JCBA 3O8QB 4OYRA 3OQ6A 3KSBC 2HJGA 4LBWA 5A62A 1X74A 2XCTB 4OOEA 3NHRA 4RX1A 2QA5A 1O6ZA 3VI4B 1YZVA 2PY6A 3EQ2A 4F3NA 2W6OA 1NBAA 1TJYA 2J30A 5D5QA 1EVEA 4MUJA 4GW3A 1CQIA 5T6MA 2G9ZA 5LMNB 4HAZA 4A0GA 1NXWA 5JBQA 2W6ID 1B0AA 1L7AA 4R8SA 4NOMA 1C29B 1CZOA 1Z6ZA 3QVWA 4GP7A 5CDHA 3T52A 4CM8A 4REQA 5FA6A 3MWDA 5FTNA 1JA1A 1HYGA 1Z47A 4XM0A 1CB0A 5DO9A 3KALA 5IH3A 3RGWS 2NIPA 1V8DA 2QTMA 4EW6A 5FWDA 4AO7A 4Q9HA 3MOSA 1GKYA 3VPXA 4ARAA 4H6WA 4KVAA 4ODIA 3RIYA 1JU9A 2EIXA 2XGOA 4CDRA 3AEKB 2XT9A 4JENA 1UJ4A 1N9KA 3W5UA 5JRZA 2Z6UA 5ALFA 2P3LA 1XPOA 1Z83A 1YOBA 3ZEIA 3KOOA 2Q50A 4JVNA 4HJRA 2V5VA 3ZQJA 3DOEA 3QNUA 5I9NA 5AKYA 5ALIA 5AK5A 2DUJA 4DNQA 3HO8A 5CA0F 4KH0A 1AHIA 1C9KA 4CTMA 1FRQA 2JAHA 3LNTA 2YBDA 1VTKA 1A2KC 2Z9BA 5G2OA 4AMYA 4QEDA 4N8SA 2CLSA 4B7ZA 3OZRA 4DQDA 5DSTA 2WVGA 3R44A 2AEJA 3PI6A 5E9QA 3WWOA 4YCBA 4EARA 2ZTLA 2D5IA 4E5UA 5DISB 5H8WA 3RGGA 2W4MA 2PG3A 4HXFB 3FX2A 3EJWA 1N0WA 1UBJS 5JI3E 4FE4A 2IHUA 1NONA 2XGGA 1DO2A 4KUHA 3KZVA 4L72A 3AW8A 2EVWX 3CGGA 1J24A 2Q3BA 3A4IA 1A76A 2PKRA 4UFNA 1ITZA 2X7JA 4KAFA 2Q07A 3I9OA 4WKGA 4WADA 1RHRA 3T3HA 1XB2A 4DSTA 3MJRA 4F45A 3BB4A 1SA0A 4XB6B 4MWSA 1XYGA 5B58T 2NZXA 4MQ4A 1H3FA 1BHJA 1E64A 3GZJA 2P27A 3RG8A 1VCOA 4CVNA 3QJYA 1CJCA 4I08A 4F91B 3V2GA 2A9JA 2LE0A 4OI4A 1ORTA 5BVHA 1G8AA 1VIMA 3F1KA 3GY0A 2IQ5A 3H4VA 3BHMA 2H18A 2PR7A 3DO5A 4OXKA 3T5DA 3AR2A 3O8DA 1G2QA 3KD2A 2PZFA 2Y8EA 2QAGA 3BH6A 3ET4A 3TVDA 4ND1A 3PHLA 4OGFA 1T4CB 2JFFA 3LT1A 3UF0A 4OSEA 3GZNB 1FFAA 1LI4A 1PZNA 1V4NA 2QRQA 3EA4A 4MI9A 4YR9A 2XYVA 5K8JB 1IZYA 1MO2A 1SVKA 2Q28A 5BWLA 4D81A 3HY6A 3OPYA 5DN6D 2F3QA 3FPBA 3ADKA 2R7MA 4EHJA 4CEJB 3EXAA 4PSVA 4L2IB 3GJTA 2IPXA 3ZDCA 3BL5A 3KYDA 4XDGA 4LTNA 4B5KA 2HBZA 1XMVA 1JUDA 4ZD6A 3TMAA 3U3MA 4F93B 1AV7A 1OIWA 2FEMA 2I7XA 2G80A 1J0EA 2J1LA 4JJFA 2VYVA 1T1RA 3NEJA 1EK6A 2AGVA 3A31A 3BSSA 1SKUA 1V8PA 3HNOA 2PH7A 4L5AA 5TF4A 5CLJA 5IN5A 4HLCA 4Z99A 4OV6B 3CG4A 3K9NA 4HYQA 4PCUA 2Y0PA 4PLYA 2OBMA 2C2HA 4MB6A 4N5IX 4YDSA 3MJSA 3SZUA 2PUJA 2UZ1A 4BO5A 3D0RA 2VTBA 1HL3A 3VPCA 2W0MA 3WZLA 1FRZA 4CU5A 2GASA 3D8BA 3IQGX 2GWRA 4HAIA 5BNWA 1J1UA 1U5BB 4V1CA 1GHTA 4RVSA 2DP4E 4OB8A 4DA4A 2Q4EA 2XTZA 4BJ6A 4YCMA 1N0UA 1V8FA 4DEYA 2YCLA 1VCMA 2PGLA 4XXHA 1SBZA 3ZOZA 3MCTA 4RPCA 1CY1A 1XJCA 4F9EA 2Q9BA 3ZI4A 5K6TA 2WW8A 5HX7A 1E2IA 2HZ7A 3HPRA 4L0DA 5JSFA 1TL7C 4S3MA 1DX6A 3V8MA 2APJA 3TNJA 4A1FA 4HXYA 1SUSA 3OCJA 4LTMA 4FOOA 3H65A 3T1YB 4DBVO 5CA1B 2O8EA 5C7LO 1M2VB 1E6KA 2IPLA 3C4QA 3FMVA 2C96A 1RZRD 1T2NA 2BGRA 3EZNA 4XX0B 4ACBA 5T4FA 2CNDA 5KNLA 2V45A 1KEZA 2Q8PA 4TUYF 1O5IA 2XNKA 2QX6A 2YXPX 1VI5A 4WCFB 3C5HA 4NDAA 3D54D 2GJ4A 3DEIA 3W79A 3F49S 3L4SO 3H3FA 4DAEA 4HPXB 1EINA 1MOZA 1SBIA 1OPXA 4JA0A 4RYLA 1GSOA 4ZOLF 5G02A 2VPQA 1LU9A 3PQFA 2XDQA 2Q46A 3WGVA 3IBCA 4GF5A 2L82A 3DWIA 4WW0A 4YWHA 2QVZX 1H9CA 4DW8A 1WY5A 4DA9A 1W36D 3X1XA 2PGXA 4E03A 5C1BA 3TMKA 3FCOA 3I6YA 3OZIA 4CF4A 4NK4A 3RSZA 1L5ZA 1DCTA 5KTOA 3WICA 5BMVA 5FTLA 3SEAA 4J4HA 4DG8A 2XUDA 2Z4SA 2DJ5A 5K09A 4G1EB 1NUPA 3CE6A 1TAGA 1QC5A 2GYYA 4CG3A 3EHEA 3LZ6A 3EXHC 3PKZA 5DNWA 1J5EB 4FN5A 3QE3A 2XQFA 4S0XA 2GCOB 3HCNA 4YJFB 1O94A 5TEVA 1L4FA 3TTVA 3VNBA 4G2TA 3NTQA 4YXWD 2V7BA 2FW9A 4DJDC 5LJLA 3F6YA 5JH7A 1J99A 2DLCX 1VL1A 1QX4A 1SOUA 3OLQA 1J09A 1PVVA 2CVQA 1SD1A 2VP2A 4RHEA 1JJIA 3A6ZA 1XCGB 2WSLA 3Q1LA 1SUDA 4GLFA 1MZVA 4G63A 5EYPB 5IDQA 4EBBA 3HU1A 3RTCA 3H2ZA 1GGKA 3L6BA 5HS4A 3GDGA 1YTUA 1LF0A 5AKHA 3ICPA 1JLMA 1GGVA 1CY7A 2BGNA 2EFYA 2BZ0A 1VKJA 1YBAA 2YJGA 5AW9A 2HYDA 3C85A 5FBQB 2GAOA 4DANA 3MWKA 2V7TA 2WIGA 3I83A 1SKYB 3H9CA 3M4ZA 5AK4A 4CR6A 4EVIA 1M73E 2C59A 1MO6A 4S2EA 4DYDA 2CXRA 2NUPA 2YL2A 5EJ8A 4M8KA 3I34X 1RXYA 1IE3A 3OM8A 3HRIA 2J32A 3KZXA 5AW2A 5J4LA 1X8LA 5AKEA 4N47A 1N25A 2OHGA 4XUCA 1TYEB 3KBOA 4MR9A 2IXTA 2RC5A 2FSSA 4N5NA 3ROEA 5C34B 3CNNA 5BNTA 1ENZA 3T9AA 3UN1A 3ZCTA 3MS2A 1NV9A 2I4MA 4Q1AA 5ALTA 2E55A 1U98A 4C7VA 4IV8A 1JHYA 5HNKA 1VBNA 3QHQA 1GPKA 3WQRA 2Q2OA 5IEBA 1S6YA 3N0VA 2PRJA 4D8WA 4U4AA 2HN9A 5F9FA 1T0JB 1TKRA 3OCUA 3PSHA 3G2OA 4RSGA 1BMFD 4BTLA 4GICA 5TSDA 1TADA 2V1UA 2E87A 2QYOA 2BEWA 4HPJB 3R6WA 4PQFA 2I6GA 2QI9C 4U2GA 4ZQCB 1UKBA 3VTKA 1P2SA 5IUKC 3L4JA 3UT5A 4KKXB 4J91A 1LUAA 1POWA 1FLVA 1NASA 4GM4A 7MHTA 1TIBA 2A5LA 5EZSA 1SVNA 2H48A 2F1RA 2ZSIA 5LQDA 1RJGA 3HFGA 1ZYUA 3W1EA 4MUIA 1Y7HA 2FEXA 2TECE 4QYMA 4NG5A 3KB1A 2O7SA 4QNRA 4DXHA 3H1AA 3VNRA 1GDTA 5BSTA 3UMYA 3KUCA 5AKJA 1WL8A 3OFVA 2GPAA 4MRAA 4MP6A 1Z38A 1EE9A 4F6RA 3BRWD 3HFJA 1SU8A 1HETA 3R40A 4DCNA 2I4NA 1XRPA 3MA0A 3C48A 1Q0LA 1TF2A 1X3SA 3FDIA 1SA0B 1TVKB 3SC4A 3M3PA 2DG2A 2FG7C 1ZRHA 2J5XA 4JI4B 1U94A 1H2RS 1CUIA 1BAPA 4TVSA 1TECE 1OYWA 1BEUB 1F8FA 2W2LA 2O5VA 3EBOA 4KXVA 4LYAA 2VUHB 2GSDA 2HNAA 4OXIA 4F9TA 3JQGA 2CL6X 4RVUA 4UNPA 5K01A 2O8DA 2HU2A 4Q9KA 4FFLA 5J2TF 1PJQA 4EUSA 3S8EA 1HWYA 1B15A 1I2AA 1LLUA 3S70A 2II6A 1F5NA 1UBFA 2WSSD 3WB1A 4EJ0A 3AFIA 1P0MA 4WNIA 4J9VA 1SCDA 1EWKA 2PWPA 4G9GA 1CV2A 2R5NA 2OV2A 3ZGZA 1RIFA 3WK9A 2JCYA 121PA 1ODJA 4RIFA 4CQMB 4HRXA 4J0EA 1IDN1 4PG4A 3T15A 4D4LA 1WMEA 3TTSA 1BXGB 1H93A 4X62B 1GNLA 5BR4A 1NY6A 4S12A 1FDSA 3VA7A 4EH1A 1ZNYA 1ZJJA 5G0VA 3PX3A 3IUYA 1BKDR 3SYKA 4TT3D 5BV8A 5CYGA 5K0ZA 4ALMA 3DOOA 3ZQ6A 1BWRA 3IOMA 1N7GA 4U9UA 1U2RA 2R8YA 3JYPA 4IQ4A 5C7IO 3OEEA 4IUBS 4OYYA 4FNOA 5H4HA 5B4UA 3QF4A 2LCFA 4RETA 5KIAA 3VR3D 1B0UA 3RV3A 4QARA 2W00A 4Q7LA 1HOXA 3WYGA 4K0KB 1AOXA 5LQJA 5EJAA 1ZNZA 1XMPA 3OZSA 1USWA 3K0AA 1VL6A 3DD1A 2JFGA 2JFBA 1QO0D 1QYXA 1VG9B 3K0KA 2UZ1B 3CJTA 3TG8A 1DXYA 3COYA 3A3PA 2GCPA 3GIWA 1OSNA 5K99A 2R1UA 1MD9A 1NBMD 1LK7A 1B6TA 3N2GB 3N6RA 3C7CB 4IUCS 1TIKA 1X80B 4LJ7A 4MV3A 4JFRA 1RBQA 2I1VB 1ML4A 3ZLBA 1T0IA 2ZJ4A 4G5OA 4V1CB 4OQXA 2J48A 1TJNA 5LBUA 3QIAA 4RHTA 3AP1A 3C4VA 5DOVA 1Y6GA 1TZJA 5FRDA 4FFNA 3J81A 5H83A 4ZEOA 5TMPA 1RP7A 5B7PA 1KAQA 1IJKA 3F6BX 2G7ZA 3IFSA 3M6XA 4LRUA 4J16C 1MHTA 1E2NA 2VF7A 1EWRA 2ZLBA 3AHHA 521PA 1QKIA 4W63A 4EHHA 3ISVA 2F90A 3H0CA 1A5TA 4P84A 1FNSA 1GZ5A 3DTTA 1KI3A 4PFSA 4F96A 5BN5A 4AW9A 1DWQA 1U6KA 2V9ZA 1XP5A 4L4SA 1LS6A 4O4IF 4PLHA 4HSEA 1JIXA 2RARA 2O3JA 5IMSA 3AIOA 1V39A 5BPFA 4MROA 3YASA 1V9CA 4E5VA 5BV7A 2IDMA 2DJIA 1EQUA 2X3YA 3C43A 4P4LA 4GKJB 3CW2A 4KODA 4F21A 2XDQB 4UU7A 5JCZA 3L8DA 4R0NA 5HMLA 4M54A 4KFCA 3CONA 1M6HA 1UWLA 1GLNA 1NTOA 1YJBA 4B85A 3V1MA 2ZI3A 1K7XB 5EY5B 4M1EA 1KFCB 3OF5A 2OCAA 3PRYA 2HA6A 3RHZA 3LG2A 5BMVB 4AYWA 2JIDA 1H2ZA 5E1OA 1L4MA 3AV3A 3IQZA 3K0CC 4ENSA 4EKEA 3FR7A 4D42A 1KWGA 2PUFA 2JJ2A 1SVSA 2QAIA 1PYDA 2YHUA 1Y1SA 4F2HA 1AQYA 1EXMA 1DBSA 1JEOA 2P11A 4O59O 4QDTA 4QECA 4AN0A 4BV2A 4JI0B 1WDWB 1NXVA 5HUJA 5K4GA 1F7VA 1KK1A 2Z43A 2MT9A 2VRCD 1XHEA 2CFRA 2ZE5A 5IAJA 4BO4A 4H0NA 1J56A 3GIDA 2C0PA 3KR0A 1A04A 2FPGB 2HWWA 2JFUA 4FSDA 2G4LA 4Q24A 5HDQA 4Z1MA 3F67A 4C07A 4TMYA 1I7QB 2ID4A 3TF5A 3RRNA 4TLCA 3GLGE 2WWWA 4V03A 4MV8A 4R1SA 2FW0A 1X7DA 5L3SA 2P9EA 3OF2A 3MC1A 1IB0A 3JASA 1YRAA 3P0FA 5L45A 3ZBPA 3ZWKA 4I7EA 3DLPX 1SUBA 5JJBA 1CUYA 4Y9RA 1E61A 3VZQA 1PEKE 3AJAA 3SZ3A 4RLFA 3ENQA 4QEKA 1BHSA 4WOBA 2J8ZA 3FUTA 1GITA 3WGGA 4DMGA 3JQAD 3BRCA 4Q9LA 4QTXA 4V0SA 1QIDA 1RACA 3CRW1 4MWTA 1R50A 2E5FA 4DG5A 1WMAA 3TZBA 1P91A 3VZPA 4UVGA 2P9YA 5I3ZA 1YVDA 4UCXA 4Z6KA 3OZ7A 2ZR9A 5KYNA 1DI0A 1P6QA 3HWSA 4LV5B 3O82A 3TLBA 5C1OA 2GPTA 1H85A 5EP3A 3ZWAA 1NJ6A 1Q21A 3L9XA 4KFTA 2BI7A 2RHOA 4UBNA 5ENZA 4CYMA 3G2NA 5E9JA 2G5CA 3QP9A 4CCWA 4P33A 1NN0A 1TAHA 4XGNA 4UDYX 3P4UA 2BM8A 3FTPA 4J4TA 4IQ0A 3FCEA 3QPDA 5EE0A 5KQPA 5KYWA 1ZGCA 4IFEA 4J0KA 2I99A 3RS3A 4BKUA 1WNTA 1UBRS 3EVTA 1NXQA 1J1IA 2P6PA 5IKEA 4AM8A 2AOTA 1W73A 2XMPA 4EY8A 1EEHA 2Q0QA 1KEPA 2DR2A 4ZAGA 1KMMA 1XXHA 4NRDA 1QUEA 2R7KA 2G04A 2KWIA 2R96A 3CW8X 2WTUA 1N6OA 2PZAA 3A1SA 4D79A 1T9ZA 4IS3A 1CUXA 1MV8A 5I9MA 1U11A 2CWWA 3R3UA 3B1XA 1MU0A 1ZEMA 1RTKA 3A10A 4OBWA 2OXTA 4WSOA 1TEZA 1E2GA 2ZUWA 3BIWA 1QFXA 1Z0FA 1R3UA 3NVDA 2G17A 2XYRA 4OAQA 3JW8A 1U4SA 2C83A 1PJCA 3TRKA 4RVDA 1P0IA 2ONCA 1DAFA 2HV9A 3OQ1A 1Z88A 4OGKA 4OCZA 4WOPA 1YKSA 1Z25A 2X6TA 5I5GA 3IC5A 2UZ3A 5E38A 3ROXA 2E4VA 4IKOA 3UB2A 1UBLS 2GSWA 1XZEA 2ZBQA 4M9UA 4A8JA 5JXIA 2O8DB 2GCGA 4JUAA 1ECBA 2YC4C 2XT6A 5E9AA 5BP7A 1JKMA 5K05A 1TZKA 4I4TA 3V8RA 4ENPA 4Z7OB 2EERA 2GFQA 4TS9A 4UMVA 1VL2A 4UPDA 5DRYA 4EQ6B 5C53B 4YR7A 1Q74A 2C0QA 1NU8A 2E4XA 1QNFA 2FMKA 2AT1A 2Q0XA 3CUYA 4UTOA 1JTFA 2GLXA 3PNSA 4HNTA 1NBIA 1SOMA 2PCLA 4QIHA 1PBTA 3RJZA 1EB8A 4HDKA 1NI3A 1UT5A 3NH9A 5K6RA 3AKEA 5A9TA 5JSHA 1JSLA 3R3XA 1CR6A 2JZOA 2QD3A 2VPPA 3NQ41 1D5CA 5JJIA 2ATEA 4YN3A 1U81A 2PRIA 1CRZA 2YTZA 2HWXA 2A78A 1XDZA 3GFBA 2XMGA 4AZ0B 4EB8A 7ABPA 2VUIB 3ICEA 5IFLA 1U04A 1ZOSA 1CKEA 4LMAA 3ZHQA 1COWA 4BN0A 1XLVA 2F9MA 3EF1A 3ZHUA 1UOOA 3RVSA 4GPD1 4BMYA 4ZYZA 2B36A 2WWRA 3O8LA 4GSYA 1GNTA 1OV6A 2A9FA 4IX1A 3VH1A 3VVLA 4RL4A 5DWVA 1W36B 2FZCA 1SHKA 1UFKA 1XKXA 2CKDA 3KQQA 3RUDA 4JC8A 4Q82A 2WA2A 1LPOA 3WNZA 4Y1EA 4URWR 3EVDA 3BGOS 3OFND 3VNQA 1TGYA 1YQUA 2JFOA 2YS6A 3QZUA 4MUGA 4C4RA 4DVGA 1O0SA 1XVVA 1QDLB 1OT3A 3CPEA 5KMGA 3LUJA 4G5RA 2QX8A 5LNK1 1SOVA 4KXLA 4R3NA 1UOEA 2C42A 2M98A 2W2PA 4ZAWA 3CX8A 1NVXQ 1XQ6A 5I7HA 2VKQA 2ERCA 4IGEA 1G0OA 4D2IA 4LC1A 2L0XA 3EW9A 4I5EA 1TB4A 2V58A 5A4MS 2H08A 1F2UB 1TVCA 1HL7A 3O9MA 4GU5A 4I9FA 4K6OA 4O8CA 4P9NA 1UP7A 1XO1A 5PGMA 3D6JA 3DAOA 4OMDA 1TAUA 3B5JA 1JIQA 1GKLA 1Y5IA 2QGZA 2VCEA 3GDOA 3O1LA 2FPWA 1ECFA 4KJXA 4M36A 4UTZA 2N0SA 1QVAA 3A37A 2FN3A 4UAUA 1C9EA 1MB4A 5MGNA 3DZIA 4U02A 3TQRA 1ZY2A 2I3DA 2YICA 4RZ3A 4TV8A 3VTZA 5I9LA 2QXTA 3DEAA 4L3VA 4AT1A 3ESXA 5IK2D 1FYDA 4QTUB 3WISA 3HKEA 1NRWA 3D8SA 2FYTA 1X9GA 3E7FA 3IPRA 2DUUA 3ENZA 1WQ1R 4DLBA 4F72A 2ZREA 3B9QA 3CNHA 3U9SA 2QUAA 3A6GA 2QLLA 4NU6A 3G7NA 4H1HA 3AF0A 2C3UA 5FCDA 1KZGB 3CNQS 4MEBA 4G0PA 5B1HA 3O73A 5M3BA 2X2FA 2O2YA 3L1KA 4P53A 4Y1RB 1Y3IA 4RABA 4D8TA 3UQZA 2QMHA 4G1MB 4GKKB 1C41A 3WXBA 2ZE6A 3G5LA 1MPXA 4ZI7A 2GN8A 1D7OA 2UU9B 1OA0A 4BO0A 4FKBA 4FNAA 4FNGA 1D2GA 4UCFA 5J43A 1QIIA 1H3NA 4DV5B 3WQQA 1IK4A 1NRIA 2IX3A 2VTVA 4N8EA 1P1IA 3HEMA 1E6WA 4Q16A 4D9EA 1XU9A 1E9AA 4V24A 5JD6A 1QCDA 1V37A 1AN9A 3AL3A 4PVDA 2JNWA 2CLFB 4EG0A 1UJMA 1W8IA 3LCCA 4QGBA 1OC2A 1QIGA 5FKJA 3GRVA 5JXGA 1YA6A 1I01A 1SUPA 4M1KA 4S1VA 3U3OA 1P29A 2BI8A 2X0NA 2I2XB 1XRRA 4X8OA 4WXMA 2DYKA 3C41J 1KI4A 3GLRA 4S1OA 5F1YA 4B6EA 3HXMA 1HTBA 1QUFA 1GDHA 1PVDA 2XZDA 3LBAA 2R8BA 3M4NA 3IODA 1O9BA 3P27A 2QTNA 3DXZA 4ADSG 3C7DB 3F90A 4BNHA 1U2QA 4DEXA 1CQPA 2B35A 2WHPA 1O0BA 4KZPA 1PYGA 3OX4A 1TUBA 3TLJA 4P6VF 4LFBB 2CB9A 5LU9A 2Y76A 4IO0A 3UGQA 2I65A 4D9CA 2J0UA 2J4CA 2FZKA 3VH2A 3CKLA 3PIIA 2YBEA 2X19A 1KY4A 3M70A 4BRWA 2RHTA 4FR2A 2QLBA 4MS1A 1W85B 4E4YA 1JBKA 1GCGA 1PS8A 2EOAA 2KX7A 5KYUB 2ZVQX 1AKYA 4M46A 3RWBA 3AW9A 2L69A 1WW3A 4MKHA 5LD2B 4LECA 1NR5A 4MVJA 1MJHA 2QAGC 1HZZA 4NPAA 4IDNA 1RR6A 3PK0A 4ZV4A 4TRNA 2PWYA 3QLUA 1CUEA 4QOSA 4DZRA 3U7FB 1QP7A 4Q7KA 3C8DA 3TMYA 5B1IA 4KWCA 5HA5A 2FV8A 3EC2A 4E21A 5AD1A 4US2R 1O03A 4KSCA 3CX7A 1GCIA 1T5TA 1EVKA 1K6IA 2PQMA 4KOEC 1F14A 3EVAA 2JIBA 5DCLA 3UK1A 1U0LA 4IXNA 4BCBA 4D6YA 3CEMA 3ESDA 5HZKA 2GBFA 1C2YA 2BDUA 3LP6A 1UC5B 4U2DA 3W8EA 5C4GB 3ZWCA 1ORVA 2HLDA 2W22A 2AOTB 5HFJA 2FEPA 4HL6A 4UXJA 4CM9D 3QUSA 2I76A 3AEYA 4F6LA 4CF6A 1I13A 4XIGS 1OR8A 2D3TA 2O0JA 3EQ6A 3MT8A 1YC5A 3Q7PA 4H7KA 3PPYA 1G20E 2VZ0A 4YROA 2H5JA 1RLMA 1FTQA 2WMDA 3LCVB 1TQ6A 4GQBA 4KU4A 2XYPA 1ULUA 2H4XA 3MRXA 4WT7A 3ZWBA 4BNJA 4IQFA 3W5HA 5FOWA 4C08A 2NU9A 5LIPA 3PVZA 3TRFA 3B2QA 1RM0A 1ZJ5A 2GEKA 3MT0A 3QBTA 4EHAA 1M2OB 5JUWA 3VKHA 2O8VA 1RHKA 2HF2A 3C5VA 3O9ZA 4RPKA 5ALJA 4A2WA 5JSUA 1KF0A 2OO3A 4UM9B 4AYTA 4JJGA 3ZY6A 4N3AA 1OTYA 1DAIA 1OZGA 1DBPA 2WD9A 3LQQA 2PIDA 1PG0A 4QATA 5FBWB 4GSKA 3OOWA 2K6GA 5BQXA 5CVVA 1OFUA 1YBHA 1XDWA 2VSXA 1XALA 3RS7A 1NE7A 3Q0EA 5KTYA 1D5WA 1R10A 4HJXA 2J3MA 3OLCX 5ICMA 2OK8A 1LQTA 1R6DA 5KYTA 3QVSA 4N0EA 1UK6A 2FOLA 4N0MA 2MYTA 4I4TB 5E1BA 4HV4A 2GRUA 2QBYB 3CKMA 3R8CA 1NBHA 1GT91 3AJ9A 5ARDA 2WHRA 5A3JA 2VJAA 1WOMA 3SHWA 2AR0A 2XIQA 1ZGJA 2Q3EA 2WRZA 3EUWA 4ZHQF 4OL9A 5DNYB 1QVRA 3FSGA 4KR7A 2CHEA 3DXYA 3ISTA 1EPUA 1WUYA 5CYPA 3GLGA 4FFSA 1Y8QB 1J0AA 2Y1CA 3L2OB 5JCJD 3NI2A 1EKXA 2DPMA 4NCIA 2P6UA 2BKXA 1XRJA 2AN9A 4DC0A 1JEYA 3AZOA 3LSYA 4RDXA 4CIYA 3IKMB 4W8HA 5TIIA 5HRCA 3ZZNA 4MYCA 3IOCA 4V0KA 4UE2A 5DMXA 3LY8A 4QXOA 3O8OB 3OPXA 3WGHA 4CQLA 1XMJA 1RPAA 2I7CA 2C5LA 4UMFA 4ZVNA 1YUMA 4DCUA 4EB0A 4HCJA 2C2BA 2LPMA 4N3BA 5ARCA 1K5PA 5AWFC 1OFHA 4URZR 5G4LA 5HTOA 1YMVA 3GT4A 3DBLB 5I7FA 1RYHA 3LXUX 4RS3A 1WZIA 4AY5A 4IWNA 3ZS8A 4IGKA 1M33A 3FR8A 4RQAA 4FZ3A 3PQ8A 1HKHA 5KWSA 2FR1A 2PFSA 4OIMA 1KEKA 4RY0A 2XOKA 1ORDA 2ZAIA 4BTEA 5KJ6A 5EMLA 4JJEA 4RCZA 1PUJA 3G0CA 4Y2UA 4NTZA 2ZJ3A 5FNVA 4MUBA 1L7MA 1O94C 3P2JA 2NO5A 2C3OA 3CRRA 1INLA 1I7LA 2H0QA 3RSFA 5GOTA 2GAJA 1KS2A 1OTXA 3VU1A 4B3FX 1DJMA 4KPGA 1JTVA 1USVA 1NIJA 4K9SA 3PQ3A 4AP6A 1X7YA 1IUKA 1P4GA 3IO5A 3R5FA 1X1CA 1WXHA 2RIPA 5B3KA 3IKJA 1RWXA 1XHLA 4CNQA 1R9MA 3F98A 2RE8A 3I28A 3K2EA 3ZGNA 3EIQA 3P20A 2Y66A 2B4QA 4I6GA 4BQQA 3TKAA 1OMOA 5I4KA 4BKMA 1P1CA 1CY6A 3SF8B 1OCEA 2Z8XA 3L01A 5E6RA 4IBOA 1DX9A 1XVAA 4RTMA 3OOSA 3UIEA 3E4DA 1U3GA 2HQBA 3IJRA 1M2HA 1PJBA 1QF9A 4M3NA 3ZW7A 4B4OA 4BBAA 5BQ3A 2ZUSA 4EECA 2H1WA 4ESEA 5SYAA 1SVLA 4X95A 1G291 3ED5A 3I2GA 3JQAB 3THYA 1PX0A 2AV6A 2OHHA 2PSEA 1ZAYA 1G9SA 1CY4A 1P61B 4BRUA 3IDFA 3TLYA 4ZU6X 3R7FA 2HJRA 1VHDA 5AM0A 1YJCA 2RFLA 1Y37A 2BMWA 1ATZA 2PWZA 1LS1A 3I6IA 4RKFA 4IIJB 1HDYA 3TBFA 4DDVA 3BSYA 1I30A 1EBBA 1Z0AA 1TCVA 3CBQA 3F4KA 1C1DA 2IHJA 3JPWA 3BHNA 3VHQA 4Q93A 1GXSA 1D1PA 1N5KA 1WVGA 2WJVA 4MWZA 4YPOA 4W5OA 4CIDA 2QUBA 1K4YA 3H6GA 2W2OA 4PS1A 2PPVA 1MX1A 4ZI7B 3W3AD 1JFSA 3P4XA 1C3LA 1CF9A 3S29A 3HL0A 1OWMA 2OXFA 3QVJA 3FNGA 5CDFA 5T4EA 3L84A 4JX8A 1XU7A 4MB2A 3ZUPA 3GU3A 3HCRA 2IDKA 3TCXB 3ZVKA 1EQ2A 3G7SA 4KQ6A 4U2KA 1R66A 4S1WA 1CUVA 3PEWA 5C7YA 4V38A 3DYBA 4XARA 5C8YB 1W94A 1H1TA 3H9UA 4JJ4A 3LFUA 4KDRA 1YZYA 2XVYA 3KCQA 5I45A 2CXTA 3KR1A 1S8FA 2QUKA 5K8CA 4Y6GB 1ZGHA 2H57A 4RYDA 3MFYA 1CUDA 2BKAA 3DB2A 3MD0A 2RHWA 4XJXA 1ZVKA 2P75A 3DE7X 1NW5A 2YWHA 1GZSA 2YHIA 2RBGA 3THOA 3PQDA 1FVFA 1OBFO 2C1XA 4HLUA 5AKGA 4PG7A 2VHTA 2WA1A 2BFCB 1G3IA 2AJCA 1SGWA 2CE7A 5CD9A 2AC2A 4YBRA 2F4NA 3KYCA 2B3DA 2C58A 2QN7A 1MGPA 3PLNA 5K2OA 3MMPA 3ZV4A 4MS1B 3WNQA 5BMOA 2WTXA 3V2HA 3LQ2A 1Z6PA 4XIIA 4ECAA 1VJ0A 1Z7BA 4B47A 4CM4B 5FULA 2V0CA 3MQ2A 2FLWA 2NTYC 5HILA 3U7JA 3QITA 5KINB 4GDFA 5FEUA 1BOOA 1QTNA 2FP4A 2ZOSA 4KACA 4MUXA 2G63A 2TMKA 4Q37A 4NPCA 4QOHA 5KQSA 5ER9A 2HBRA 3JTEA 5GIPE 1D8AA 3OA2A 4KAAA 4PX5A 4YJGA 5CAEB 3SEZA 4ENWA 4PX3A 5TS2A 1KYZA 2Q3HA 2M9MA 2NT3A 2PGAA 5JZ9A 2FZWA 4YQZA 4JUDX 2GJSA 3GFGA 4C4SA 1CG6A 2VCYA 1TC2A 1UKYA 2FZEA 3K94A 4MQFB 4XWYA 3DDSA 3ZXSA 4CLHA 3TEJA 3ZY4A 2ZAYA 1J42A 3L0YA 4NONA 4X45A 4OLBA 1I4LD 1AKVA 3LO5A 4DSUA 3ITEA 4MV4A 1ZUNA 1K7YA 4PBTA 3PWTA 1ZS9A 1GNVA 1XTPA 4L3WA 5ITZA 3BCUA 1DBWA 3KKKA 4P81A 5CVCA 2CBXA 1NF3A 1W4AA 3S8MA 5D84A 4C4OA 1RBMA 1WMBA 3IAS6 3LL7A 3ZQ4A 2ID8A 4KPEC 1W0KA 3IT2A 4HH0A 3JAWA 2HHHB 2V7VA 2RMKA 2V7QD 3W04A 2NU9B 2CLMB 2YWFA 2ZI5A 1PFQA 2WPDD 3V2UA 4D98A 3SVTA 5EEGA 4QUEA 4ARZB 1KMIY 3FNFA 2P6NA 5AI8A 3C3AA 2VUTA 4IW3B 1M6VB 1KIFA 1KHHA 4JJ6A 4WK0B 1E77A 2F1JA 3VZSA 4EG1A 5ADVA 1F8XA 1OOEA 1EX6A 3B8HA 1P8AA 1R18A 3IQHX 4UVEA 2G1AA 1XIVA 2Q9CA 2R7LA 4P08A 1LNZA 4JA2A 3WB0A 3REQA 4G41A 4KRXA 1KPGA 5DHFA 4G6ZA 4BMNA 2QRPA 5EE5B 5A02A 2PQ0A 2ZSEA 1W29A 2RAVA 2D59A 3WLQA 2ARKA 1K66A 3DQZA 1U8AA 2MR6A 1GTVA 3PTAA 5AHXA 4ZKDA 1XYYA 2VXBA 2VWQA 3LFHA 1GYQA 5EUCA 1F9AA 4OI2A 1G3QA 2Z56A 3MTGA 1Z15A 4I46A 5CVJA 3RC2A 3DYVA 3ZDFA 3EF0A 4O4LB 3EQ7A 1EJ2A 2Q4RA 3ABSB 3URKA 1H2XA 4A2QA 1M6NA 3MWJA 4QKQA 4R3UC 2IYZA 2FZGA 1Z2AA 4FYIA 5L7YA 2ODTX 1YI1A 1TU3A 3JALB 1L5RA 5B53A 5SZJA 4YRAA 2HCBA 4P0PB 4KXNA 4RC9A 4RESA 3K2BA 4K26A 5F7JA 2DAPA 5A3VA 4B87A 5B2ZA 5E3HA 4YK7A 3GLGB 1HYHA 3OIGA 1A4RA 5BSGA 4BGUA 2D00A 4NBSA 1JHRA 4AJOA 3PR2B 1G38A 4CFZA 4MRRA 4EATA 1BMQA 1JEYB 2Y1GA 2ZRKA 4IR7A 1FTWA 3VNSA 1FRVA 3WIDA 1ESMA 4NYIQ 1YS2X 2AR7A 3HDGA 1KH3A 1HE3A 3LKDA 4WECA 4AZWA 4YV1A 2VDQB 3HDHA 1XMIA 4B3IA 2PSJA 1GL9B 3II6X 4TTAA 3MAAC 3J80A 2JB9A 3FPFA 1P17A 3GLTA 4GXQA 2HHCA 2P67A 1EFAA 1DKLA 1X9HA 1EFRD 4ZO4A 3LHKA 5ALQA 2C2WA 2Z3ZA 3LF2A 1I9GA 4E4RA 2ZJ2A 4GFDA 2ZTSA 3A6LA 2JEYA 2QY9A 3VRHA 2VAWA 3EUEA 4JKYA 2V97A 4RK6A 1OWOA 4QYXA 3WTCA 4WZ6A 3PEUA 4UHFA 3WKCA 2TS1A 3KHSA 3V1KA 1XDDA 2XRYA 1L5VA 3EISA 3IQWA 1PEDA 3NWPA 4TVBA 1ICEA 1AVTA 3OQPA 4MO9A 2SHKA 4UQLA 3NGMA 4UU8A 3AVTA 3E22B 5I4CA 2HQOA 3VZBA 3PPIA 4Z4FA 2GBPA 4Q01A 5FHQA 1C4WA 2J9YB 4U00A 2YYZA 2VJBA 3PKIA 5ECYA 2GFIA 1DJNA 3U0BA 4GOMD 4UOZA 3HU3A 4I36A 5JAIA 3TRJA 1RC8A 3DLIA 4F5WA 9GPBA 1SQ5A 2I67A 4BLTA 1DOAA 3DPSA 2Q0SA 1KQ3A 2EGHA 5EZQA 5T67A 2V4ZA 3SJUA 4G0WA 4WLFA 1FX0A 4BDTA 3GBSA 3D3WA 3THYB 3VI3B 5GZ6A 3TLGA 1DV1A 3PE6A 2R60A 3GT3A 3F9RA 5FT9A 3C45A 3MCWA 1FMJA 3U1VA 1CUZA 3WNCA 4EG4A 3JYLA 1OREA 1SVOA 1KQOA 5GTDA 3AY3A 2N9UA 1REQA 2WHEA 3DNFA 3ENVA 4UKDA 3K9BA 1EP3B 4YAOA 3FFAA 3AKCA 5CB4B 3Q8XB 2IXFA 1RRMA 2VK2A 1UJ6A 1I14A 3HLKA 4K03A 1JEAA 5CEFA 1YIDA 2R0QC 1SC9A 2BJVA 2BM0A 3BJEA 2G07A 3OE5A 3TQHA 4YJDA 1HM5A 3UB3A 5JCXA 1AKQA 3LGSA 1GPAA 2PT5A 2F8MA 2QN2A 1T9DA 2CSXA 4HAWA 3U7RA 1BE6A 3UY4A 1OI4A 1E99A 3MYYA 3OY2A 3RAGA 1FYVA 4QG3A 1A8SA 5CFLA 3KT6A 2XMBA 2ZRFA 3A2MA 4AWAA 4NWIA 4UZEA 1PSWA 4ITRC 3KWMA 3VGPA 1JBQA 5L3RA 1PR5A 1Z39A 3B9BA 1NLZA 3KLPX 2R8PA 2GFHA 1CUSA 3F5QA 5JS1A 1EA7A 1U7ZA 2EFEB 2PQ6A 2RHRA 3ZWQA 5AW8A 3JPYA 3VBEA 2EYQA 5JSQA 4DMLA 3GYBA 3D6TB 3EYWA 1ONNA 3WWCA 2VJDA 1JVBA 3SR0A 2IYQA 4KZKA 3ABZA 3NORA 4YP1A 4U8HA 3TZ6A 5C4MA 4W5QA 4KE7A 1LPNA 1KERA 4ZT5A 4YRMA 1CJKC 5E2BA 3IIEA 3HUEA 3MGKA 5DCUA 3SFVA 1CW2B 1N5IA 2PSSA 1YIOA 2AI1A 3PFWO 3QYJA 1N2IA 4IH9A 2IDZA 4H7PA 3SPXA 4DR7B 1QHEA 3RIMA 2NU6A 4L4UA 2COUA 2NZVG 3KUKA 3KYCB 3W06A 4HR7A 3W78A 5JH7F 2FFAA 2OCYC 3NVMB