2OBXA

Lumazine synthase ribh2 from mesorhizobium loti (gene mll7281, swiss-prot entry q986n2) complexed with inhibitor 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
b'HKDYETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRFFFEHFTVKGKEAARACVEILAAREKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase 1
publication title Structural and kinetic properties of lumazine synthase isoenzymes in the order rhizobiales
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
total genus 51
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2obxA00
1KYYA 1C41A 1W19A 1KZ9A 3MK31 1ZISA 1RVV1 1XN1A 2C97A 3NQ41 1W29A 1EJBA 1KZ4A 4KQ6A 1T13A 2A58A 1KZ6A 1NQVA 1KZ1A 2VI5A 5IM5A 1DI0A 2C9BA 1NQUA 4J07A 2C9DA 2B99A 2C92A 2A57A 2JFBA 1HQKA 2A59A 1NQXA 2OBXA 1NQWA 1KYVA 2O6HA 5IM4A 2B98A 1KYXA 2I0FA 2C94A 2F59A 1C2YA
chains in the Genus database with same CATH superfamily
5FA5A 3LNTA 3T4PA 1II8A 5KS2A 1LLFA 1UOEA 2JRLA 4ZGGA 3D54D 2QG4A 1EGVB 1M2OB 1Q5PA 5FBLB 3R09A 3FI0A 4NC9A 4B76A 1VFNA 3E84A 2HB6A 1UKEA 2LBPA 2YBDA 4O02B 1J1ZA 2PKQP 5TPZA 4DADA 1IMOA 2R8OA 3F67A 1FTGA 4W5WA 1GNQA 3UH1A 3W3AH 4DSTA 3ZDCA 5JS2A 4HJRA 5LUAA 1U7TA 4JKIA 2WWXA 4YRAA 3RIYA 1XAJA 2H9YA 2X7JA 4Z7NB 3FG9A 2IZZA 3RS3A 1YONA 3LKVA 2CLDX 5FA6A 1MAHA 2VDOB 2NTEA 4XOUA 4JFAA 1NZJA 1NT4A 2XCUA 4UTVA 2FY8A 1TVMA 3IT1A 2JZNA 5JSZA 4P3PA 3C3MA 3V33A 1T2UA 1M1NB 3FYCA 4DR5B 2W5UA 2NUTA 4AC9A 3D6UA 2IE8A 2QTVB 4TL8A 3GMIA 4YJ3A 4X97A 1XXHA 1Z16A 2PANA 8ATCA 3TK1A 5G1OA 4KMSA 3D6AA 1OFHA 3RRJA 4XVRA 3D6MA 1G5RA 1PW7A 4TVOA 5GOTA 4DA8A 5LP1A 2GN9A 2IGBA 2Q9CA 2JGNA 3WGNA 4BFLA 2DAPA 2WTBA 2CXUA 4K1XA 4UAGA 5K0SA 1R4NA 3LRPA 4RGVA 3QLUC 3RUPA 4BIIA 1QG0A 1AHPA 3LHSA 5GONF 4DLXA 4PG8A 1QUFA 1RBMA 4HWOA 4KE8A 1L7NA 2JJ1D 3MTQA 4L76A 4MGEA 2FUKA 4PHCA 4D97A 4RLHA 2WE8A 3KT8A 3V8EA 1Z07A 1DX9A 1K92A 1I1QB 1KFEB 2WZQA 5CCBA 1JYEA 1OLSA 2WJIA 3CUSA 1XTQA 2R85A 3EHDA 2C2MA 1YK1A 4X54A 5DASA 3WHIA 3LH5A 2XIQA 4Z9FA 4C5AA 1G8GA 1ZUNA 4Q19A 4NV3A 4UQPA 2FSIA 5JZBA 1ZVMA 2EEPA 3AR7A 4ZEWA 1YGYA 4WL0A 3WLIA 4MW0A 4AKGA 2VP5A 2O7RA 5B4TA 1XZAA 3MGGA 2G3YA 3U37A 2WAMA 4QICA 2CKMA 2RAPA 3AFGA 2NPOA 1TGVA 1Y3HA 2A5FA 1IJFA 2Z2JA 2IK8A 3VOBA 2XITA 1IZ0A 1K98A 3IR5A 4FD3A 1X38A 3LUCA 4N39A 3RG2A 4AG3A 4IIBA 4EI8A 4LK2A 3PWSA 4LJRA 3GJ5A 1M72A 1QKJA 3HMKA 4Q9HA 4EHIA 1CULC 2VYVD 4P08A 4UOEA 2KYRA 2Q4OA 2HPHA 1UXOA 2WHXA 3FN4A 4MVWA 1V37A 2C9ZA 1DUSA 1I6LA 4BJ1A 1KMCA 2ZR9A 3BF7A 2MT9A 3EFEA 3OEED 5U1PA 3M6UA 3W3AD 3AVTA 3FHJA 4PU0A 3WYAA 2H31A 3PNOA 1WHSB 5KHAA 2JFPA 2XJ9A 3EY9A 3FUWA 1E32A 3G9XA 1BXZA 2G04A 5EE3A 5E7JA 4W5TA 4OHRA 2RHBA 1P2DA 2IEYA 1IFXA 1JBQA 3EYAA 4MQEB 4B2IA 3N6XA 1JA9A 1O94D 2FZ5A 3FPGA 5EJMA 3WGJA 2ZB8A 4O29A 5A3QA 2A59A 3RB8A 3Q8XB 5T8KA 4R05A 2K7ZA 3ZVRA 5IASA 5TGTA 4JV5B 4UU0A 5DSZA 1FUIA 2ZT7A 2PKWA 5LZ7A 2ASEA 3CZPA 4J75A 4Z0TA 2DPMA 1ZH4A 2FRDA 2WIBA 4AMGA 1H8HA 2YHSA 3K5PA 3MRXA 5JJLA 4C7XA 3HFGA 2XWBF 3PE6A 1RXUA 1Y5NA 4NOLA 2VHYA 4UHJA 4YMGA 2WTEA 2F3UA 2J6CA 2W58A 1S2LA 2E3JA 3WI7A 4YRPA 1E64A 1NBME 1ELOA 1ZL0A 2BP7B 3JZAA 2YVLA 3KSRA 1UQRA 2EDCA 4AQDA 3OM8A 1UUFA 4TYNA 3LCUA 4N7BA 1LD3A 1EK0A 1M3SA 5IYZF 1I2DA 5T41A 2R84A 3U3KA 2FSGA 4CKXA 3OIVA 1L7QA 3UHPA 1YA4A 4BO2A 4F96A 1A5BB 1NPDA 3Q41A 2OOSA 3HKBA 3IELA 3UBMA 4KDEA 5KDLA 3EDQA 1PSDA 3S44A 3CW8X 2OXEA 1APBA 4P6VF 1JQ3A 2FB9A 1ND5A 4D46A 2VXBA 1SCDA 3LL7A 1D2AA 1D4FA 1BO6A 4TWRA 3HZZA 3I42A 1QMGA 5AQ1A 4J91A 2QTAA 2F8TA 5IU6A 3WWYA 1RADA 4RMNA 1OW3B 1TLLA 3HI6A 2PYIA 3SSAA 1Q2UA 1PDVA 4BNNA 1F51E 2CZGA 2VAMA 3DP7A 3TW8B 5HKBA 121PA 1UL1X 1AC5A 3ELBA 3VPBA 4YAEA 5DRTA 1E92A 3E3LA 2DBVO 2VBFA 3MTGA 5AK6A 1ZDMA 1K97A 3OOJA 3G3EA 1Q20A 1KJIA 1Z3IX 3ER6A 4OGLA 2E4VA 1YQUA 1FNBA 3EVGA 1HE8B 4RAOA 2GF0A 3QFSA 5I51A 3TZEA 4WLUA 5JNVA 4K0KB 1DC6A 3D5TA 1A7AA 3HCOA 4GX2A 1WD5A 1X1QA 2FW1A 2P6UA 1EK6A 4MS3A 2RHOA 2EEZA 2L17A 3O4JA 3WXMA 2FEOA 2W0SA 5P8WA 1ONPA 1F06A 2GI4A 3WDLA 2GEFA 2HBRA 5H0IA 3DKVA 2HHCA 5SYMA 1JMVA 1DBSA 2ID4A 4OG2A 4DMRA 7GPBA 2H4WA 3M33A 3ETJA 4QNMA 2OO3A 2X13A 4YXWA 2NZ8A 4P5PA 1PNTA 2Y1WA 4CIVA 3H19A 5J40A 3ROQA 3IDZA 3RUIA 2NM0A 1NUAA 4FQ7A 4QFDA 1G2IA 1ZG3A 1S01A 1ABEA 2FRXA 2ZE7A 4ZA2A 2OOKA 2AGVA 5LA6B 2YZGA 4EPWA 1XRRA 4OXIA 4WADA 2ERXA 2HWKA 3QEBZ 3NHFA 2R751 1GT91 2E49A 2HEIA 2A7XA 1KHTA 3RV4A 3L8CA 2A1IA 3EEQA 3GU3A 2CLOB 2X2PA 1JQLB 5K3SA 4CR8A 3OQVA 5BR1A 4PGMA 3E3NA 1PHRA 4IJVA 3FROA 1HO3A 1C4OA 3BMNB 3QOXA 4REMA 4XVHA 1K0FA 4OKIA 3PRJA 5BWNA 3U5TA 1CRLA 5DHFA 3EGXB 3M9LA 1SB9A 1BVHA 1P3Y1 5AJXA 3CONA 2VKTA 2ZRBA 2JI8A 5BV7A 5BW4A 1NPYA 1XLTA 3FJ1A 3FNEA 2IYFA 5JXWA 3LW8A 1W36D 3DYVA 2KS6A 3IKVA 3EOBI 4ZEVA 1BQ4A 3ZDRA 1EJ6A 2FYTA 3LPNA 3NT2A 2G88A 5IJXA 3CZ4A 2P4SA 3IOEA 4FFSA 1JFFB 3TD6A 2GLUA 4LPSA 1GOTA 2Q8NA 3H9UA 3NAZA 2AW3A 2RHWA 3IR6A 4IX1A 4TYQA 3D0KA 3WGMA 3GJQA 4P86A 3TB6A 2AEEA 5ENDA 1UQTA 3BD9A 4AIIA 1WXEA 1NLUA 3BDIA 4RK7A 3T4UA 2MSWA 1DBVO 5KTYA 2IQ5A 3EZ7A 2O2YA 3OTOB 1F1JA 1AD2A 1KY3A 2ANBA 4FNAA 4IRMA 4YN3A 1YKGA 3GGSA 4AWBA 5C53B 3QUBA 4UCFA 3ZU5A 1YC5A 1X8JA 1GZ5A 4RCYA 1LC0A 1Q17A 1G2OA 2JAOA 3KCQA 4IQGA 4V0SA 5B5SA 2Q7DA 3A6PC 5FBKA 3CLRD 4JUDX 5DNVA 4MVJG 2VJOA 1YZKA 3ZCSA 3FOFC 1DIAA 4FLFA 3QMVA 3B7GA 1OI7A 2NO7A 5CLQA 2OHVA 5I9IA 1RJ9B 3LCCA 4R51A 2I1QA 3JZDA 1VBMA 3BREA 5SY6A 3MK31 1KZ9A 1PD0A 3DFUA 3K2EA 1T34A 2UAGA 4Q3CA 3PIRA 4C1BA 1YB7A 1I10A 2JK0A 2Q9AA 3DMPA 3H9CA 1Z38A 3O8NA 3UAOA 1VJDA 2MTBA 1X0VA 3AETA 2E4YA 1AQUA 4GP9A 4XARA 5FO0A 3WHPA 621PA 4RZIA 2AFHA 5D2CA 4D5EA 3I3SR 5BUZA 2ZI7A 3OLQA 4RHCA 3IMCA 4J3FA 5DLQC 4WOPA 2W2KB 4L1KA 4G65A 3LUKA 2HGSA 4LJYA 2G9ZA 3DVSX 4RMGA 3ZWNA 3ZHQA 3EXIB 3NM4A 3DV9A 1CX9B 2O5EA 5CEJA 2FLKA 1W85A 2IW1A 1WXIA 2CXOA 6YASA 4CEJB 2C2XA 4F6RB 3A6KA 3OBBA 2B8NA 2F43A 2GBCA 3QE2A 1P39A 2R7NA 2VPZA 2NSDA 2OG1A 3Q7EA 1XEWY 2X0JA 4MH0R 4GW3A 1H0RA 1PR9A 2H4XA 3GCXA 3OCYA 2PUHA 4B73A 2WJVA 3ZJTA 3EVTA 4OMDA 5K8CA 2OLJA 4CG3A 1OASA 3IP8A 4DE5A 2ZPAA 3NEAA 4HPJB 2ZSIA 4KK3A 4NBSA 1CF2O 3LYUA 3E9NA 1YNOA 2I1WA 3EC2A 4GSLA 1JHQA 1RRKA 4MJLA 3ZHRA 3C85A 1SC9A 3M6IA 3ZLJA 3TPZA 4I6GA 5F5NA 4JI0B 1HY3A 2P65A 4PYIA 5ES3A 4C07A 1QF7A 7MHTA 2CDNA 4F2GA 2WNHA 4KN8A 3KSDO 3N7TA 4NBRA 2QL7A 4INOA 2YH2A 4Q37A 3L6BA 1N6RA 5GJCA 3VMFA 2Q3LA 3DO6A 1P4RA 4QUKA 3VO2A 2GM5A 2BM8A 1BFKA 1BN7A 4DANA 4YJ2A 1DKPA 3HADA 2XWPA 3T61A 3C6MA 4RZ2A 1J9EA 3VJLA 3M6XA 5CVDA 1IEXA 4RE5A 1HDYA 4UATA 1SU7A 3OOYA 1NONA 4MROA 4HAIA 3PUWA 4KWIA 1F2DA 2HSEA 5EXTA 4TWJA 2FF7A 4K9RA 1R74A 1Q7EA 1S1CA 1X87A 1EU1A 2FWRA 4O2AF 4R2JA 1T91A 5D5PA 1L5LA 2CT8A 3E5NA 1VG9B 1HTTA 1SHTX 2RGAA 3NYQA 4OHUA 3HU5A 4AY5A 5DYTA 4IXMA 4ZJZA 2QUAA 1E3JA 3EEYA 4PQEA 3UZUA 2W22A 1V1RA 2YHIA 1PSZA 3L3BA 1NJ1A 2QQGA 4WRRA 3SX0A 1M2VB 5DJ5A 1T5HX 2B2XA 1Z4LA 4GR4A 1XMOB 1Z28A 3OKCA 4NEHB 4LXXA 3R75A 4WA7A 5ALNA 3RTEA 2K87A 4B43A 4B3HA 1YL7A 1FMLA 2DE0X 2EIXA 2V7WA 1A50B 4O4JA 5EE9A 2ZSKA 5K0EA 4M21A 1GU1A 2D0OB 3MC1A 4JITA 4QD3A 3UJDA 1ZNZA 4P81A 1V35A 4BVHA 3I23A 2V7PA 2IBMA 4EJ2A 1NMQA 2A5LA 5HPYB 4NMLA 4N47A 4FT2A 3NVKI 2VQSA 1JFLA 4QECA 3C8HA 3NHLA 3TMYA 3R1IA 4AZ3B 2CXSA 3OX4A 5B3KA 1Z15A 3ON5A 2W9XA 4XCVA 2ZJ3A 1JH9A 5HYVA 1E2NA 3BKXA 2OXRA 3FSEA 3PSAA 2VXCA 1VHJA 1TA0A 2IXFA 1QF9A 5ECDA 3I2YX 4U8GA 3PHCA 5K2MA 3D4BA 1KZHA 3RARA 2XSZD 3AUKA 3SJZA 2HJ9A 2ZKLA 3BSYA 3HU2A 2CBZA 5EHGA 4PN7A 1MFZA 2O0KA 3COVA 4LC9A 1W0JA 2VJQA 2XWJI 2DY1A 4CQNA 1V4NA 2O8DA 4YB8A 4ESOA 1CT9A 4Q9AA 1G6Q1 1TCUA 2CNDA 1MV5A 1Q1EA 3A4IA 3ZWCA 3A6LA 3ES9A 4IO1A 4TSFA 4FW8A 4PNEA 3FB1A 2GESA 1RJDA 3G2PA 3PT9A 1U0TA 2ZTUA 1CZNA 3FB4A 4F3RA 4F5WA 4R2LA 1NVAA 3CPJB 4HAOA 2HX1A 4BZQA 1TRKA 2EYUA 1D03A 1DUVG 2XUDA 4IVRA 1OT5A 5LCXA 1C81A 3HWWA 3NHBA 1EGQA 2OXIA 2F8LA 1QR6A 5D86A 3SJAA 2OHHA 3CV3A 5I8ZA 3WFIA 4HKTA 5FLKA 2P35A 2YV2A 1LNZA 2C31A 2ZI4A 5ALEA 4RJTA 3EX7C 3L0PA 5JFOA 2HYIC 4GZLA 1KRXA 4XR9A 3HCDA 4ZCRA 4RXMA 5DXAA 2D0IA 2WM9B 1HYGA 4LQ4A 4ZK6A 5P21A 3EOZA 4WXPA 4KVGA 3AVXA 3VZBA 2GJSA 5ES4B 1XRMA 3K9QO 2IEDA 5CIWA 5CDFE 5FNVB 2I2AA 2HY7A 3OEHD 4J1TC 4O4LB 1K2VN 2ZVQX 3GRUA 4LWPA 4EUKA 2CLEB 1DO8A 1XDGA 5LB2A 3FYDA 3M4ZA 1XA4A 3Q3GE 5FOWA 3U4QB 2AZTA 4H7EA 4KJZA 4MEAA 4E12A 1J0EA 1KI1A 3C5EA 3VR6D 3UMSA 1J9GA 3DZBA 5JD6A 4U2DA 3PTAA 3S5UA 1QQ5A 1VQ1A 3ZWYA 5FPSA 1SJ9A 3E9CA 3ZE2B 3QVGA 5HQ3A 1IBSA 1M0SA 3FBGA 4X20B 1IIRA 3DCJA 2JJYA 4I1UA 3IVRA 1C0LA 1OX4A 4K6MA 3IL2A 1I1HA 4ZHQF 3K5WA 4H7FA 2PA0A 3TSCA 3TXAA 1C0IA 4N7JA 5IBCA 1EM8B 2NXNA 1KS9A 4KMRA 3DS8A 3I37X 4QU9A 4TRMA 5I6DA 2XD4A 3MT0A 2YWGA 3ML1A 3AUFA 3AB7A 5DKFA 1L5QA 4PZPA 3A70A 4GE0A 1EE2A 2UZ3A 3TZLA 3GRAA 3FDXA 3TECE 4FCTA 5JS6A 1G5FA 1L5YA 2QXYA 5HTKA 3RI3A 2Z1DA 1BE1A 3EVBA 5DM70 4JODA 1G3MA 4JVSB 1VFPA 2WWGA 4ZGBA 4CMAA 1CY0A 2Y67A 4MW5A 4B2YA 2KSQA 1W0KD 2ZI5A 3GZ4A 4PY2A 4ZMBA 3KBBA 2GRAA 5FA8A 1NDUA 1ZOOA 5SZJA 2BZSA 3H75A 4AJJA 5TIIA 4QG7A 1U02A 4J3JA 3KKPA 4F56A 2DR2A 4ARZA 3W90A 1HOXA 4GPD1 4RORA 2HA5A 1L7XA 2B37A 2PUAA 3IDAA 4PZ0A 2VRCA 4G25A 3W8DA 1T9HA 4WQMA 5ICGA 1JLLA 4X8LA 4WECA 5FFMA 1CB0A 1CKEA 2JH9A 1SXJA 2LUOA 3CTMA 3DOHA 3B85A 4J7AA 1XRQA 2CMDA 4L4YA 4OJYA 2DCMA 3SBEA 1IXZA 3IVAA 5D3MB 1XEXB 1A7UA 2AJBA 3ZVNA 1NVGA 4BN0A 3HNPA 4K6FA 4BN5A 2WTAA 4IIJB 3X1YA 2VCEA 2YRXA 4DM7A 1KI6A 3BKWA 1VMIA 4OHBA 4GI5A 3Q9UA 4WBNB 4H3VA 1R0SA 3KOUA 1DAGA 1Z4PX 4W7IA 5AKIA 4AECA 8GPBA 3CVWA 3K4HA 1CDEA 4O4IA 2F4VB 4LK3A 3C3AA 3IAXA 3V4PB 2DWQA 1IYZA 3LC7O 2O8EB 1FSZA 4IQ0A 4CM1A 3LLSA 2FWNA 4L4ZA 4YH1A 2HF9A 1EP2B 4OHFA 1I3OA 5IXJA 3FKJA 2RAUA 1ACMA 1WEHA 5A6VA 1AO3A 2H1OA 4J4TA 1N1EA 3FHLA 1WMEA 1ICIA 1XALA 2X8BA 4U7GA 4LBVA 3A6EA 2O2EA 4W8GA 4YAOA 4UM7A 1K8QA 1DSSG 2QUKA 1RPTA 4Z9BA 3G8YA 4FNMA 3PU6A 5JQGB 4AS1A 4QXPA 1WZIA 3ICWA 2GN4A 2OCYC 2HK6A 4PQYA 5EKTA 2FEKA 2DFKB 2R25B 3EQ9A 3RGWS 3T3PB 5ITZB 2IA5A 5I4IA 2YYAA 1KWGA 4X7PA 1LDEA 3CNQS 4M98A 1Q44A 3LHFA 3CUWA 4QPPA 3ZJVA 2GM9A 3QG5A 4O4HA 4DWOA 2BM9A 5CTJA 2WPDD 1WUKS 4X62B 4OGKA 4FKZA 4HNSA 3NFRA 3RANA 2ET6A 2VPXA 4R6XA 4BGVA 3MOIA 5ALXA 1NBWB 3PNLA 1K6XA 4EA6A 3NDPA 1P8AA 1X6VA 4ARSA 2Q6VA 4G4GA 1C7EA 1P19A 2EZUA 2XCQA 4F06A 5JSZB 3PQ3A 1CERA 5AUOB 4KLZA 1TJ4A 3NJRA 3CIFA 2NUTB 1GTG1 3G13A 3H84A 1T4BA 3P45A 4KPYA 3QM1A 3I1YA 2JLAA 4XE5A 3FR7A 2Y99A 1GTZA 2G6BA 2JD0A 2QR3A 3I9V6 4NXMB 1F12A 3AIKA 4M3NA 2VN8A 3DMRA 3PNQA 3I4LA 5F4ZA 3THSA 3BMQA 4A91A 3SFZA 1WZ2A 4WVLA 2GSWA 3B53X 4ERNA 5CFOA 5B12A 3KQOA 6PFKA 4ND1A 2RGRA 4Y2GA 3E9DA 3RSOA 3I6BA 4Q16A 1JE1A 4MV7A 2JHGA 3TNFA 1KMIY 1SIUA 3WQSB 5LWQA 2H7CA 2RGGA 4G5GA 2IWHA 5TLSA 2DH6A 1M5RA 3BORA 3AVVA 1XZMA 4HDSA 1XO1A 2EP5A 2D4HA 4RUKA 2UYHA 1KU6A 1V8DA 2QTNA 3P0IA 4I8XA 4MVJE 4R81A 5K8IA 1XWFA 1Y3CE 2AN1A 4PLFA 1R6BX 2GEVA 4YRZA 1X39A 1P1RA 2A58A 5CHYA 3WICA 4A27A 3EZXA 4EF4A 3ZKAA 3CVOA 2HU5A 4URZR 2W70A 1A4IA 2DTXA 1GQQA 2DXIA 4ZO8A 3VI4B 1O3YA 4R69A 1F2UA 2HPAA 2FI1A 4FNGA 1JI3A 3JQ9A 3L4BA 2ROQA 2W6PA 4DMMA 2QNRA 4ZRNA 1SKQA 2B4TO 2WF7A 4J9UE 4DNQA 2NAFA 2OHGA 2Z8XA 1JAZA 1MAVA 3QPVA 4MAFA 2ZSBA 4A73A 5ALRA 5EIFA 3HLYA 2J3MA 5BSEA 4X0EA 2AUNA 4RIFA 3S40A 1A8UA 1HNXB 4XUEA 3OJXA 4OQMA 1FFCA 3B1XA 2RAFA 2WG1A 1JB9A 1L4YA 1NW6A 3IBTA 2AI1A 3GVCA 4G8CA 2YDXA 5FL7A 4EG3A 3VR0A 3U5ZB 4BL5A 5GGXA 3V3KA 3IVMA 3J7TA 1SELA 4H0CA 4HADA 1N57A 1LNQA 4US1R 5EPUA 1YQGA 4TLAA 4U7DA 1TUBA 2VZ0A 5ALFA 1W5TA 2BEVA 1T36B 2EL9A 4KCGA 4D4KA 3QVOA 4XLTA 3OM9A 1JAHA 4NFHA 4DCMA 4YCNA 1BZYA 1VJGA 3AUYA 4YQYA 1RWWA 5IJZA 3EQ2A 3GDWA 2R7KA 3H1FA 4MIYA 5BOSB 2UYCA 4UUOA 4JDPA 4L9AA 1EI9A 3TI7A 5D5QA 1FVXA 3S55A 3I9LA 4Q7QA 2F9MA 4N5HX 1SCUB 3CUTA 4MUMA 5LQMA 5MN4A 2RHLA 3UMRA 1E8MA 2D2XA 3KYDA 5L3VA 5HKOA 1SULA 2PTGA 1UODA 5BV8A 1E7SA 2RB4A 3WGOA 4JYBA 2Q0XA 4XX0B 3N59A 1R7RA 1XLVA 3AHFA 1FXUA 4HWKA 3UJ9A 3SHVA 4FIZA 3HO6A 1L7BA 4UDYX 3SXJA 3ICCA 1ZIXA 4Z7JA 1DG3A 1H1LA 4RDIA 4TKVA 2FGJA 1E1QD 2EWVA 1VJRA 3IHLA 1V4VA 2YXNA 2OZEA 1FDOA 5ESDA 3T99A 3T5CA 2QW1A 2CC2A 2GHTA 5GV7A 1R6VA 2XUJA 3LAWA 2ZIUB 3R2JA 4V3CA 3NHUA 3OU7A 2W2VA 4DCGA 2XCOA 1KYVA 2Q6IA 3BERA 1NHWA 4NK5A 1DDIA 1U7WA 4WIAA 5ER9A 3U7RA 5BYKA 1R1DA 2N46A 3HKBB 3LQ1A 5DM1A 5BSFA 3DMFA 3ELWA 3CJRA 3T4EA 4DJFC 1ZWKA 1SXHA 3KOYA 2BI7A 2I2DA 1L9KA 1P45A 1PYDA 1C8KA 1ZMXA 3WYGA 1RSZA 1BX3A 4KXNA 3PF8A 3CXRA 3ZTTA 4ETNA 3FPLA 4UUAA 3CW2A 1I9CA 3UJPA 1B6SA 4XQ9A 4EHKA 2LZ0A 2H5LA 4E7PA 3V1YA 3WMWA 1H0KA 1XHLA 3QNMA 3LYLA 4JDUA 4W7SA 4OXQA 3IVCA 4LRUA 3VBEA 1U3GA 3EOAI 3OCVA 5COAA 3SC4A 1G8FA 2CCJA 2EV9A 1HE5A 2ZIWB 4FFWA 3UK0A 4ZALA 1FMJA 2MWMA 4RA6A 3VAZA 1G4UR 3L7DA 4FEEA 3IEUA 4FFBB 4HAYA 4JJ7A 4AZ0A 1A9XB 2FSFA 5FTLA 4RVFA 4CLOB 2PNJA 4MGIR 1C7JA 1XK6A 4M1YA 3RRMA 4IINA 1JLRA 1K6MA 2HA0A 1NR1A 3O2NA 2JGMA 1XCLA 2W2NA 3MZ0A 1JPUA 4G9GA 2XUFA 4WGGA 1JGTA 1OREA 3SHQA 1I7NA 1QV7A 2ZT5A 2Q6TA 3H3FA 4G1CA 5CIYA 4AZTA 4BRWA 1N6OA 4DPMA 2NO5A 1L5WA 2P2YA 2V8BA 3CNNA 4HXGA 1ODFA 3LQKA 4U7FA 5TT1A 5JFGA 2G0NA 4ZWNA 1XZBA 5AVQA 3ZEIA 5IZCA 4ESVA 3IDOA 3UJ3X 2CXQA 2OO5A 2X0EA 5CLIA 3HZRA 1U5BB 4HFRA 4TYPA 5EJ2A 5GMOA 3VOAA 2XTAA 4R8LA 3LCJA 3ZWKA 1V7QA 4RYLA 3SJCA 3DWIA 1QKIA 3GUYA 2OB1A 2ZUWA 4I4TB 1MVNA 3SHFA 2NT3A 4ZOLB 3VZSA 4CCAA 2VK1A 3B51X 4CM7A 2V58A 3HE3A 1VE1A 4QJIA 4DNOA 5KX5A 1NVMB 1I4TD 1NN5A 2GD6A 4X1YA 2YWEA 2WQ7A 4HQ0A 1A8SA 2QN3A 2RAVA 4DA9A 5F1PA 4WMLA 1K86A 3SEZA 3FZEA 3OFND 4YCLA 4AI6A 4NH4A 2WU0A 3BHIA 5EWLB 1N2JA 3RSZA 2RCNA 4C6SA 2G40A 4Y98A 1VLVA 4B35A 2ZRGA 4OYYA 4QG3A 2C96A 2BY4A 4UPVA 1R4AA 1QHYA 3QELB 1JAYA 4N18A 2B21A 5FLYA 3JQ7A 5HDQA 5JNRA 4GICA 4KGDA 1SZCA 2PCJA 4PCLA 2OENG 3HG7A 5DM2A 1JU3A 2WKRA 3G1WA 3ND7A 4GNKA 3R9IA 1XRJA 2OCDA 2X41A 2V5UA 2UXBB 5CVTA 1GJRA 3ZHZA 4A1OA 5DYNA 5KVVA 4LRWA 3WNVA 2VF7A 4KSCA 1ARZA 3MMXA 1XL0A 1DKNA 4UPEA 1IUNA 2N0SA 3K1YA 2AOXA 3STTA 4GL2A 1G8MA 5UKDA 2BVNA 2P68A 4KVAA 2QRPA 5FBWB 2O2CA 1SB8A 1DMSA 2G9NA 4AMVA 3LK7A 3HN6A 1TQ8A 5C35A 2M2IA 1YS4A 5G0TA 4EKDA 3ENQA 2AV6A 4JKYA 1DHTA 1VHLA 4I4LA 1YU9A 4KLNA 1WM1A 2FDRA 3HDTA 3OZAA 2HU2A 1C29B 1VMDA 3E70C 1QRUA 3D3WB 4RWEA 5KQLA 4BQRA 3SICE 3B6MA 3M5DA 5BMVA 2A5YB 2R1TA 1Y7LA 3OFSA 1TKBA 4O3FA 1LSOA 1QGUB 3BEDA 3HEBA 1UDBA 2OXFA 2LRHA 2PX3A 1Z8NA 1B1CA 4OYHA 5FD8A 3VHXB 3ZWQA 5B3JC 3FVVA 3G8DA 4P2GA 2IT1A 3S81A 2C2BA 1C1YA 2D62A 3VZQA 1HTWA 3PD7A 4BMSA 4QJ3A 2QPLA 4U2GA 1TF7A 3ZLBA 4DM3A 3AZPA 3AYXB 4W5JA 2NUAB 4LNHA 2XE4A 2DSTA 3RYFA 4XYBA 3TFWA 1CBUA 3HDQA 1Z7BA 1SCBA 1UBOS 2I0FA 2CDCA 1ORRA 4N0DA 3O3OB 4PAOA 1W5FA 2DUNA 4GEKA 3RU9A 4CU2A 2DHCA 2WAYA 5DBHX 5HKKD 5TS2A 1MRZA 3ED5A 1WDWB 3Q3IA 4ALIA 2DQZA 3UJ6A 2C88A 1S2OA 1W85B 3GFRA 2QUHA 4WFJA 3MD9A 3D3EA 1U99A 4KXXA 3QOYA 3B1VA 4RH3A 2WSBA 4DIFA 5HX7A 1FSPA 2Z04A 3TPCA 2I2BA 2ZRDA 4BVBA 1J2UA 5AM1A 1Z0FA 3FOBA 1H2BA 3KEQA 2YWXA 3U61B 4OLHA 4XYLA 3DR5A 1NZDA 2IEAA 1ZXBA 3S6JA 1C5KA 2OXCA 4J0CA 3P2JA 3L7AA 1GUAA 3AG5A 4TXHA 2FTKE 4HFMA 3CEJA 1CHDA 2VHTA 1PI3A 3KFLA 1RZRA 1IBKB 2DFTA 2WTXA 3T06B 1KYQA 3WK6A 4CTNA 2CSXA 2NTNA 4DIOA 2Q3HA 4XVCA 1HM5A 3T7AA 1ZIYA 3O1LA 4JLAA 2EXXA 5CAEB 4D44A 1GNLA 4BC1A 4F86A 2WWYA 1FE8A 2CLCX 5DW3A 3FTDA 1AGRA 5IW8A 3O92A 5CM2Z 1KVRA 1GA1A 3V8RA 2OP0A 3IUNA 4DVGA 1QIKA 4R0VA 1BHJA 1GEGA 5KYXB 1NAIA 3HPQA 2DQKA 4KAJA 1EWKA 3EGDB 5FV7A 5BSVA 4C0BA 1T25A 2YNMA 2XTZA 1ATZA 3TBFA 4QYWA 1WW8A 3C16C 3K9HA 4CKEA 4YJDA 1Q7RA 2PFSA 4BZXA 1H9AA 3KXIA 3ZGVA 3ZDFA 4DSZA 1GSOA 2HIGA 2QRLA 4HDRA 4HLUA 2CLSA 3KAJA 3PEUA 5E8RA 1OWNA 3C3PA 3I45A 4B81A 3PUIA 4DR7B 2WOJA 2YHIB 3TUZC 4GYYA 2P1ZA 3RFUA 4KP7A 4FFRA 4FHFA 4XTRA 5BSTA 4IGFA 4OHYA 4GRIA 3DHEA 1CDOA 3N2ZB 5J2TA 3LUHA 1EHIA 4S05A 4GXNA 4JT2A 1XJ0A 2GM4A 2Y1CA 5MGNA 4BFZA 2CUNA 3ENVA 3QX3A 5KVSA 1J4AA 1YQXA 5T4EA 5TJ9A 1X7ZB 3KB8A 4XVQA 3L6OO 4Z3KA 2NPIA 3GUVA 1TC2A 3EUFA 2EJVA 4AYWA 2D5LA 4U63A 4QE3A 2JFNA 2YS7A 3ASVA 4U7TB 3W1VA 2OYSA 2SHKA 3IIKA 2F1RA 4MQBA 5DT9A 1H8EA 1F8XA 5DWDA 10MHA 1ZUWA 1PJ4A 1W2WB 2ZBUA 3GAMA 4I2NA 2Z6AA 2ZOSA 1DV1A 2RC6A 2V6JA 3BH7A 2PZGA 5TQVA 2CNNA 4Q34A 1H4TA 3TD9A 1L3BA 2NTYC 5DGXA 3SFTA 1WXWA 4FGKA 1NN3A 1ZL2A 3KOWA 3M4JA 3KLMX 3AQ4A 2GDZA 4MJ3A 2WKSA 3AFNA 5H5JA 2CFTA 1OAKA 3TUIC 1RLUA 4GS5A 4V38A 3WGTA 3GMSA 4BWYA 4ZXFA 2AF4C 1L5KA 5JHHB 2Q1XA 1M76A 1PJQA 4D42A 2YMLA 1PLKA 5CA0B 1RBQA 2X4LA 5I7FA 3HUUA 2O8DB 3DE6X 1UKAA 3MWKA 4Y6SA 2ZYHA 1RZUA 2B7BA 2XI4A 2X7HA 4URXR 1R5OA 4LRSB 1RR6A 3W8FA 1V6CA 1IXYA 2GN8A 4X6YA 1RWQA 1DKMA 1HNWB 3NTQA 1KOJA 1NV8A 1UBJS 1T6YA 2JFYA 3GZNA 4GR5A 5DH9A 4CDNA 3D59A 3TAXA 3NRCA 1XDUA 2WUGA 3N2EA 5EUMA 2B5WA 3EIEA 1SUSA 1USVA 2N9UA 1WCYA 1XZDA 1AX9A 2JKZA 1OU4A 3O3MB 4GMKA 2WHQA 3NB0A 1P1IA 2WMNB 1UC5B 4GU5A 1Q83A 3IGFA 3M89A 3V2IA 4BGUA 1KZ1A 1ZU4A 4M37A 2XCLA 3N86A 4OM7A 4OHPA 4ANFA 1H2WA 1YC2A 2RSLA 2X4DA 2IOFA 3EZLA 2BCEA 3GJSA 3K6RA 3LIPA 2BM1A 1J8DA 3NVMB 1C8VB 2GPWA 2W8ZA 4HNQA 4UDXX 4XDGA 4KI0A 2CL7X 3PFHA 4MV1A 1SHKA 1FDIA 2P9ZA 2HRDA 4BO8A 5LQNA 4L74A 4IGIA 4EUHA 4DA7A 3K92A 4IV8A 4U39A 4LYAA 2B20A 1X7WA 5GADl 4IH4A 3DVLA 2IPAB 1OGYA 1A9SA 1GGVA 2IUFA 4KFTA 4JGGA 4EY7A 1DDOA 4IIYA 5C9ZA 3TLEA 1SK9A 1C8BA 4ZQGA 1Z5GA 4KDRA 2QA5A 3AY7A 3HPRA 1EBUA 3WLHA 1M34B 1IZZA 2H0QA 5F7ZA 1BE6A 4GT1A 4LJ8A 4AICA 3UXEA 2BHLA 2NYAA 1G7TA 2JAXA 2QQFA 5B7GA 3KQLA 3X2EA 3VKGA 3P9KA 4MQ4A 1XPRA 5TX7A 5LLDA 1GSAA 1UPUA 1QNLA 3DOUA 4XPIA 3OLYA 2XHEA 3MAJA 1MG5A 2BJWA 2QX9A 3JATA 3QVGB 1AA9A 1VCMA 3TM5A 4OKNA 2B2CA 1LJ8A 4XIYA 4OL0A 4RELA 1LK5A 1OX4B 1J0CA 1B41A 1JEDA 2RJNA 3JQDA 4JT8A 1AHHA 2W6IA 3SC2B 2WP0A 1DARA 1RLTA 1TMGE 2REOA 3KZXA 4RVSA 2OO7A 2GUGA 3QK7A 3IAS6 1KXZA 2MYTA 1F14A 4ZYVA 1OXKB 1IOVA 3OFKA 1PQYA 1GPMA 3RS4A 3PP8A 1BVYF 2UZ0A 5H59A 2J48A 4PFJA 3FTNA 2YASA 1WSWA 1T3HA 1ZNXA 3STUA 4IILA 5FPTA 1BG6A 2PLRA 4NR0A 3BJIC 1BXRA 1U8EA 5CA1B 1VIMA 3BOSA 3BGWA 3QMWA 1ORWA 1S02A 2XBUA 3NJ4A 1BEEA 2P2LA 3TL3A 4DMLA 4NI5A 1QTQA 2QTFA 3RRNA 5KEIA 2JVKA 2C7QA 2XRMA 4MCHA 3I73A 2RKOA 1BXGA 2GWRA 4MV9A 4LTDA 1UBUS 3C5WP 4Q3EA 4HVTA 1EGHA 2CNKA 2IYUA 4TUYA 2OPBA 4RIIA 3V8BA 5K05A 1CG6A 2IVFA 4F5EA 1TD1A 3K32A 1DFGA 1WOYA 2R68A 3LTNC 1B8UA 1E9EA 3CF4A 3DCIA 3CMMA 4DQKA 4WLOA 1RQLA 1QM5A 2K2QB 3ZZMA 1Z37A 3CRZA 3Q6IA 4KAAA 5IDWA 5I9SA 4NLLA 1QK4A 4Z86A 2YIDA 3ILYA 3PDWA 3BXGA 4IVPA 3N2GB 2ZXUA 3F8SA 4ZT3A 2O0MA 4MLCA 5HIMA 1BEZA 3THWA 3KC2A 1KJWA 1MH9A 3VDQA 3ZD8A 5C34B 4FXPA 1ZY2A 3X1MA 4A8HA 1BOOA 2PDAA 3AY3A 5AOCA 3NYRA 1GZSA 2PX4A 5DO9A 1N75A 3G82C 2WUDA 4KGVA 3WJAA 4B8WA 1EBFA 1TVKA 5HUQA 4KR3A 4RHTA 2RG7A 1QLHA 1SXPA 1IUOA 5JNLA 4F8JA 5D85A 3SF8A 3R9KA 3FOCA 5BURA 4Q47A 1HDOA 1SZJG 2ACEA 3QU2A 4CT0A 5J1SB 2F3TA 2B0JA 3K7EA 5JR3A 1ZYUA 4UBIA 4FDVA 2HBZA 3NTRA 1WVGA 4RHXA 5LC1A 3TOVA 1MDFA 4OB6A 2O59A 4D9NA 2BJHA 3U3OA 3N0WA 2Y1GA 2R8RA 1QQ6A 3N87A 1GARA 1T4DA 2KBFA 4LVNA 3ZNOA 1Z47A 4PPFA 5LD2B 3L46A 3L93A 1P6QA 4RJLA 1TEVA 2RHJA 3HGQA 4DR3B 1ZA1A 2R66A 4WJZA 1DUIA 4AJIA 1W4ZA 1WDMA 3SC6A 5KTOA 3SE0A 1UDCA 3MWJA 4F5YA 1E4EB 2FMUA 1ORTA 1WX1A 1O94C 1TB4A 1PL8A 2CCKA 4Y2TA 2CNBA 1A04A 1MENA 2AWNA 2VT6A 3D4PA 3MBOA 4M9QA 1Q22A 2HW8A 2IDMA 2R6JA 3CJTA 2WIKA 3ZS9A 5BNFA 1WUIS 1G21B 2W00A 3K73O 2PGAA 3LXRA 5JJIA 2A35A 3PKZA 5F7JA 3BMQB 4YMLA 1YI1A 1QGOA 2Q6KA 1K27A 4JBHA 3TF5A 3N0VA 3LO5A 4R1PA 1N2OA 5KOHB 1KR2A 1KZYC 4YUZA 3VPHA 4FP9A 4ALJA 4AQYB 4A82A 2QLNA 3E6AA 4BMXA 1MFPA 4I8DA 4X1KA 3T1OA 4DRXB 1E6LA 3D6VA 4HDSB 2FN3A 1TVEA 1TZ2A 3HWRA 3W5SA 1RHRA 3BXXA 4HNAB 4N01A 5KIAA 3L4SO 1E6EA 1XI2A 5DIFA 1YS7A 1WG8A 3HKCB 1EXWA 5KNDA 2J0UA 1FXWF 2I2CA 4JJ6A 4IQ4A 4K0RA 4V03A 1CUHA 5KDOA 2ZUTA 3I9JA 2POQX 1RM4A 3BMCA 2H1RA 2HDOA 2I7XA 3L79A 1F2UB 2YWJA 4MVJF 4DDVA 2IXTA 3P9RA 3ZJ4A 4B3RB 2JFBA 1DT3A 3EGIA 4ILEA 3NHMA 5C7OO 2JBAA 1YTLA 2H54A 3HVJA 1JQAA 3GEDA 2D5BA 1M5UA 3W5HA 4AO8A 4AJOA 5IYZB 2V9CA 4H4DA 4N6NA 1EVKA 1N25A 4R84A 5M3BA 1FFGA 1L4EA 3FTFA 1ZZGA 4KTVE 3D6JA 2H8GA 1W9MA 4YXFA 3HB0A 2FF5A 1J5EB 4I9GA 2PS0A 4DEYA 4CL3A 4OA8A 4L9SA 4B74A 1T0HB 2A88A 2FN4A 4DWVA 2YV5A 4HWRA 1A5SB 3EXEA 2IEIA 1O6FA 1V3TA 2GJ9A 5E1OA 4MQLA 4QAQA 4YRGA 2ZZKA 1QHXA 1Z0IA 3KXLA 3OICA 2DLNA 3AESA 5JAZA 1WR8A 3JWEA 4YJGA 2GZAA 3FRJA 3TUJC 4DQDA 2BPOA 3BQ9A 1CQIB 3FYTA 1ECCA 2IS4A 4JWTA 1JQDA 4KSBA 3A0RB 1D07A 1LQUA 1V26A 4KQMA 1GU0A 4A8JA 2UVQA 3V7WA 3DL0A 2W83A 3FFTA 2E6UX 1Z6AA 2FH5B 1OBFO 3U3JA 1POWA 4BO3A 4E2XA 1T0UA 2J30A 1Z2EA 2RI0A 3A8TA 1QPZA 5B64A 2PKCA 4PPNA 3S8YA 1TVCA 4MW9A 4BU1A 2RBEA 1MHTA 2C4VA 3IVXA 1GITA 2J41A 3B38A 4N3CA 4TTAA 1DKOA 3HCAA 4WZAE 4K9QA 5EXDA 5KCMA 5AW9A 4BE7B 2XB9A 1ISPA 4W1PA 4ZQFA 4OIFA 5HILA 3BGSA 4D8VA 1WE2A 2HJVA 3VYVA 4ZDKA 4O1HA 2B1GA 4ARIA 3LBAA 4QL3A 4NVRA 1N1DA 4QFMA 1UZUA 4TQUS 2PWBA 2R6HA 1U7HA 1FBNA 2WAXA 1SR8A 3ETCA 4AWAA 5AR1A 1HFEL 1CXZA 1ZSNA 3GOQA 4JXZA 4QYIA 5JSUA 4FMCB 1ATIA 3CUKA 1G7CA 1BH6A 5F9FA 2PSJA 4RKYA 1QIIA 1J2RA 1DELA 1YB2A 1Q16A 4PICA 4CKWA 3FDFA 2C5FA 1Y82A 2VA9A 4X92A 1KP9A 2AJTA 4ESHA 3WKEA 2C97A 1LK0A 1O1YA 2ZJ4A 3ESXA 3NXSA 2BBWA 2IOYA 3TJRA 3AY6A 2A1TS 1I0ZA 5AYVA 2FUEA 3WQBA 1JDUA 5HSGA 1YZNA 2HLPA 3KVNA 5IKPA 3THYA 4G8JA 5LM3A 3BS4A 1NJ5A 3MCVA 5B55A 1A97A 1A27A 4LQDA 1N5JA 1QMPA 2Q29A 1E4VA 3HY4A 4G09A 4NS4A 1W36C 4XUCA 4M76B 3D8HA 3ZWVA 1WBBA 4YLEA 3CX4A 2PH7A 2VAWA 2R1VB 2NV0A 3BT7A 3BDAA 2X9VA 4M49A 3GVHA 5TV2A 5KAMA 1EFUA 1RYYA 1GQSA 1YSCA 2RGDA 1DTEA 4LYHA 3U16A 1JB1A 3CUUA 3DQPA 2QV0A 2FG7C 4MVJP 3LU1A 1VHQA 4QXQA 4XOIA 3EC1A 3VU8A 3E22A 3MYYA 4ZVKA 3GUHA 3CB4A 4BCDA 4H9GA 3WIVA 3BL8A 2YR0A 3BN3A 1Q84A 4LQLA 1QVAA 3DOOA 2IEGA 2BL4A 1IM2A 3P0HA 4LG1A 1GV1A 1HURA 2ZAYA 3AR8A 3CLRC 1WNTA 2ZXEA 4QJ4A 3ZDXB 3K9CA 2OHJA 4L8WB 3NAGA 5IARA 4XJTA 9GPBA 4E13A 4OFBA 1E1DA 4EJSC 4MKHA 2GR9A 3Q8KA 2GJKA 3MBKA 3K6SA 4DLRA 2YXPX 1EDBA 1DNPA 1P1KA 2FSUA 5CVJA 2FE1A 3TZ6A 1FW8A 1RKXA 1N9KA 2ANCA 3FMGA 3DEAA 1U0BB 2P9CA 4BWFB 1CEEA 5JYBA 1JEEA 3IFSA 3GLHE 2HHLA 3HB1A 4NOMA 5DOVA 1KOFA 2VJMB 1CFJA 1PJSA 1P17A 1VYUA 4IS2A 1H9BA 1L7VC 5BP7A 4XIGS 5A05A 1FLAA 5D01A 4XXHA 2QMHA 1SUAA 3BHMA 2AT1A 3KKMA 2HIHA 2GWHA 5HVNA 4AKHA 2C07A 1ISMA 1MB3A 5E9AA 4TYWA 1DRWA 1BD3A 2QLJA 4LV8B 5DB4A 2J3HA 3SN6A 1KDPA 1PCXA 1D0VA 4RADA 2P3SA 3E9QA 3KRTA 4G37A 5AKYA 1O7JA 3EWIA 1YFLA 1AJEA 1SUFA 3OVMA 3UC9A 2VLIA 3PR2B 4FFVA 2JDIA 4PZUA 1ZVVA 1QBKC 1XZGA 3H9QA 1QO0D 2I76A 3JQ7B 3DUFA 4QSMA 1QE5A 5KNDH 3VSDA 3HYCA 1QO7A 5J5CA 1AK2A 1YBVA 4AROA 1FVHA 2FPGA 3IMGA 3EEOA 5ALUA 4PC7A 1DLJA 2A7QA 2HXYA 1MEJA 3KSMA 3Q15C 4Q21A 4MYCA 1AF4A 3UW1A 1CY6A 1IATA 1UP7A 1PR0A 1Z6TA 1X92A 5KOJB 4OP2A 1SA0A 1OWOA 1G41A 2B3DA 3COJA 5KKAA 4F6CA 2IPMA 4K6CA 1OTHA 1UM9A 1QIEA 2QRVB 5HE8A 3TMAA 2DGDA 1H05A 3GG2A 1TLTA 1W1IA 3FNQA 3K35A 2GYYA 3DVQX 1E5LA 3BFKA 3JW8A 1MABB 5KO2A 1N0UA 3E5MA 1AZLA 1JKJB 3DTVA 4R31A 4Y3UA 5AKXA 1NM5A 1JQKA 2EGHA 1R8SA 3FMOB 4J03A 3R76A 4KUHA 4PZDA 2H4HA 5C7YA 1B3RA 2A1TR 1PZHA 1WHTB 2PGIA 5BO5A 1R8XA 4WASA 3BAZA 3GEHA 4K40A 3Q85A 1QHHA 3VR1A 1VPLA 4HZUB 4OIMA 4MKZA 1Z5OA 1YBHA 2B92A 4C2TA 3VR4A 2WC1A 4CTKA 1J2JA 2LTAA 3G2HA 3N5KA 3CLUD 2QW8A 4KRGA 2YZMA 2CXNA 3TQIA 1XJ5A 2XGGA 5FI1B 1R6XA 5K0NA 5LLTA 3OHMA 1YTUA 1GGJA 3WAKA 1ULTA 1R6DA 4M89A 2BRUA 1Q0ZA 2WTMA 1NL3A 2VF4X 3B2NA 4XJXA 1ZK4A 1VIYA 3G5MA 2P1DA 1V7PC 1U7PA 4G2NA 3S68A 4D7AA 4PS0A 5A4KA 4QUIA 4C22A 2P5YA 3B3AA 3WB0A 4Q9KA 4FEGA 1PR5A 5KC8A 2AMLA 3F49S 1ZVQA 4WERA 1PV2A 1P8JA 1QOZA 3FWZA 1RRPA 3MBIA 1EVYA 3QMPA 5IVHA 3KLOA 2AG0A 4EZEA 2YXDA 1SC3A 1UINA 4OQLA 5B58C 3EEFA 3B9PA 3D3KA 1LPMA 1O89A 2X0NA 4E31A 1S5PA 2VWHA 2G06A 1K8XB 3H2GA 4RZQA 2O2HA 3ZZNA 2HN9A 3SVZA 3R7WA 5HRCA 1RACA 4ENWA 1W25A 2IWRA 3RJMA 2I71A 3KJZA 5DVZA 1ZITA 3ZUGA 5K3AA 3DMDA 1RMYA 2ZIXA 3AHIA 1RWVA 1Y4AE 1N3BA 5DNUA 4HF7A 2FW7A 3SAJA 3RC9A 3SJBA 1V4BA 3AG6A 3NEJA 1LLDA 1HFWA 1HBJA 2R2AA 3MSCA 4BNDB 4GOOD 2JIRA 3DF7A 4YBRA 5CK5A 2E4UA 4HXEB 4OSOA 1J2YA 3VTAA 5JT1A 2OZLB 1R3DA 4G5XA 1FFBA 1HDXA 1JV2B 5ALKA 4DDKA 1OY1A 1W4RA 4DN6A 2OSVA 4HPXB 4DPLA 1H4VB 4E08A 3W5CA 4G56A 4JI1B 2CL6X 1L7EA 2ZIZA 3ZY2A 1RXIA 4AY3A 1M2EA 1NW4A 2QX8A 3D4LA 1Z7GA 2FK7A 3NJ8A 4NECA 1KVQA 3WRYA 1B23P 2PD3A 3W5DA 3GZTB 1B42A 4YFVA 4AZWA 1XJWA 4XLLA 2OKCA 2Y6VA 3URMA 4CFZA 1U0OC 2J4CA 1Z4OA 1N2ZA 1XP8A 4TXMA 1KDOA 3RWMB 5KVAA 3NCTA 1KF0A 3GLIE 1MDBA 4YP7A 5FR1A 3SU8A 3CCCA 3DZKA 3SD7A 1D1PA 1G42A 3G7UA 4UE2A 3V2UA 3LZCA 1FSGA 5KJ6A 2ZM5A 1G5IA 1GZDA 2QTLA 1B0ZA 1N9ZA 2GXQA 1TMYA 3O4IA 2BTQB 3EPJA 1GV0A 3AJ8A 4LDAA 1F4VA 2D2EA 1P1BA 2GN0A 4GZ6A 4LRXA 1IMJA 3SZMA 3KQKA 1QCCA 4MW7A 2DH5A 2R60A 3HY3A 1V1JA 3QYPA 5BWMA 2PUFA 2APJA 5SICE 4H4CA 3LP6A 1KC1A 5GV8A 3WLOA 1P6UA 1CR4A 2AX4A 2OTCA 4AMUA 2I5PO 2ZW9A 4X60A 1S4QA 3RM3A 4R3WA 3T3IA 2WVJA 3B3QA 2G1AA 1BHQ1 3UWMA 2VP4A 1VG1A 5JAHA 2L18A 4JI6B 3NDRA 3HYTA 5J1TB 3JSAA 2REBA 1HX7A 4JR1A 1GTL1 3CUVA 1R27A 3EARA 5TQ0B 3W6PA 5T67A 3TQQA 4E30A 2O52A 2Z08A 3KQYA 2WYUA 2DPGA 3MAAC 5DPMA 3WNBA 3PGKA 3RIHA 3I09A 3ZQ6A 3UGJA 4MHOA 3ZIAA 4CV1A 1R9JA 1ZJWA 1UXIA 3A2KA 2BE7A 4L8FA 4IMRA 1U8TA 1LPAB 4EJFA 4BTEA 4RD3A 2PNFA 3I2HA 1O96A 5LJLA 4RENA 1BE0A 2BGLA 2FP4B 3A37A 3F5SA 3Q5GA 1MB4A 3AEZA 1U7DA 2QLTA 1LJUA 3ZLVA 3LMKA 4QGGA 1CEQA 1JZQA 2C1XA 3FA2A 4O25A 4NDZA 1FP2A 1Q0PA 5KNBD 5MHTA 4IOJA 2IYQA 1TTQB 4LFBB 4H27A 1GYRA 2J67A 3GZNB 2XUZA 2YV3A 1P9LA 3BK7A 2ATEA 2ZLBA 1A2KC 4PEVA 3MTIA 1E2UA 3MWLA 1OX5A 4PRZA 2J31A 5E2IA 3V97A 4ZHQB 3RF6A 2XQJA 4U7JA 3GH3A 3GBPA 4YY3B 2DRIA 3BD6A 3DR3A 2E5FA 3PYXA 4F1KA 1NQVA 5C32A 3PJGA 4MV5A 3M6WA 1QANA 1W59A 2WSSA 2ZXFA 5JW6A 1DWUA 2OVBA 4U5QA 3VO9A 1O4VA 5CYFA 4CLEA 5IDXA 2ZUFA 5AVXA 2IH4A 4NFLA 1IBCA 2VT3A 1JILA 3P4XA 4RMJA 1PF7E 1XD9A 1AVTA 4ZHSA 1CNFA 1GGKA 2E2WA 4AYXA 5U4XA 2E9SA 3ABIA 4ZCQA 2Q99A 5JCOC 3SX2A 2AUMA 5E4JA 3IBYA 1ADFA 1J2TA 1P80A 4GP7A 4R9SA 4GOND 3K0BA 1S0UA 1T5SA 3GXBA 5A5EA 5AVRA 2AD5A 1MT0A 1MAAA 1BGVA 1X7WB 2A0WA 4Y2RA 3MGCA 4CV0A 4D9EA 3UNXA 3C3DA 2YV4A 2OCBA 3MXTA 3ABOB 1CRPA 1PEDA 4AKTA 4PLWA 1P75A 4BLSA 4PX9A 3V32A 4YAGA 3F6CA 2H2IA 2Y77A 3VR4H 1TA4A 1BQ3A 1A1SA 5A03A 3AGQA 2D5IA 1PKEA 2ISCA 3E5RA 1L4GA 1N5OX 5DHTA 3DDHA 3HBFA 3PD1A 3RU3A 5I01A 4IQFA 3L4JA 2C5AA 4FNOA 3TRKA 1D6MA 2QPAA 1JX6A 4X7BA 1WB4A 2A8YA 1D6JA 2C7VA 3TKLA 3WWEA 2R86A 1KO4A 3TNDA 1C3JA 1S2MA 4M1OA 4NWIA 4UE3S 1E3WA 3EG9A 1JSRA 1VP3A 1BW9B 1VRVA 4A6PA 2O8VA 5AM5A 5IH3A 2XODA 2IH2A 5JTUA 4FKMA 4S2UA 5IP5A 1XJQA 221PA 3LX8A 1Q0RA 1YS9A 4XJSA 4FYIA 5F23A 3JR7A 5ERXA 4F4JA 3CO5A 2JLRA 3S2EA 4HEJA 3NTLA 2EOAA 2P9TA 4WN9B 5IF3A 3VVMA 4Y6LA 2Q1UA 1RXSA 5AOVA 5I4KA 4MRNA 4C0SA 4UDOA 4DIBA 3IIMA 4D4IA 1JLHA 3UH0A 4RPHA 4UBMA 5KQGA 5THQA 5DGTA 1YU6A 5LDGA 4RTNA 1OR8A 5L3SA 3KKOA 4QU5A 3E4DA 1M0WA 1YUMA 4P54A 3BCRA 3GJYA 1N8SA 2W8BB 1QPGA 4N54A 1XQ1A 5FTJA 4OAQA 1JH8A 1QYDA 1I14A 3RYCA 1BWQA 2JHAA 1KEVA 5K7SA 3LSYA 4NOKA 5FBQB 1KJYA 2R7LA 2RIPA 4HSEA 2ZYAA 1KZ4A 5CFPA 4KX5A 4M8IA 4D3XA 1SKBA 1I32A 2OCIA 2QDXA 2ZRMA 3KLPX 1V9CA 4G36A 4YEDA 5TJHA 4EFLA 1B4DA 4AUKA 3P0EA 4OPMA 4B3SB 4Q7EA 2EGGA 3A26A 1EFRA 2IHBA 3MTDA 1RABA 1PYGA 2Y0DA 1UAGA 2FQQA 1Y3AA 2OC4A 4FVTA 4QGBA 5REQB 2IEBA 4YT4A 4Q03A 4Q1DA 2QLBA 5TGDA 3VSBA 3W4KA 2OZPA 3MFYA 1P3JA 3PKJA 4L4UA 5BXYA 3IC5A 2ACWA 2WT9A 1TPZA 2TRSB 3I9NA 2DC1A 1ZC4A 1TFUA 3KQWA 4I50F 3GMDA 1KO1A 4YRQA 4YJHA 4H6XA 1KI4A 1QC5A 2ODAA 2QTMA 1UXKA 2GZMA 4BASA 4M1WA 4Q4HB 1Y6ZA 3L0DA 3THWB 1TYBE 1TTHA 2V7BA 2PUVA 2B69A 2OQRA 3CURA 3GJ6A 4QO8A 1UBRS 5EWJA 1PWXA 3VH1A 4R5MA 4NMHA 3PC8A 3R7BA 2XBLA 3ULKA 2AUTA 1N5KA 1WCXA 2ATXA 3FHTA 4EUSA 3LDUA 1WQ1R 1TVKB 3RVOA 3BYZA 3IVGA 5FLXA 4U2BA 2VYFA 1Q11A 4YCDA 1LS6A 2AFIA 2E37A 3A1SA 3EBOA 5E4TA 4NYMQ 2BMWA 1UT8A 3A1WA 2I7DA 4PE5B 4H08A 4EYGA 1U3TA 1YZVA 4GDMA 5EFZA 3TQFA 3T54A 3WHLA 1YVPA 2CVQA 3NP7A 5CYOA 1NNLA 1T5TA 4P3OA 5D8DA 1H8HD 2BGIA 4DRZA 5CVEA 4MR8A 4CKBA 3L18A 2VUSA 4DCCA 3CM0A 1Q7GA 5A02A 4EJ6A 3OPVA 1XB2A 3HV2A 4C4RA 4K7JA 4B6PA 4EQ6A 5JQWA 2GS9A 2Q1WA 5DSXA 2BISA 2VJKA 1U0RA 1CZLA 2GD2A 2YHBA 1PDOA 2X4GA 3PHJA 2ZI9A 3Q0TA 3QF4A 4G4SO 2AW5A 2LCQA 3F2VA 4B3XA 3DPUA 4RKFA 3SXUB 1KXJA 4EW6A 1Q91A 5B6JA 1XEAA 4JFRA 3AOEC 4KRXA 4FJ2A 4MYRA 5J4LA 1G6KA 2WF8A 4CCWA 3EEBA 4D9HA 3EK2A 4B7XA 1E0SA 3U1VA 4FBLA 1W76A 1X14A 5CTAA 4AJ4A 4FCWA 5MDHA 3KSBC 5K3DA 3WV5A 1IEQA 3NDIA 2HJSA 1E6CA 4JD5A 2XZOA 2PS1A 3EXFB 1GNSA 1E5DA 5F33A 5F35A 1H2XA 3IKTA 4EPRA 4C7JA 3DHNA 3T94A 4ECAA 5LP6C 3HL4A 3SMQA 1SU8A 5CX4A 1U6KA 3HBAA 5CLJA 3HJAA 1RP1A 1T2EA 1JJBA 2O3TA 4KYVA 3MIZA 4LOKA 4PNZA 4Y1RA 5D3QA 3VKWA 5ICCA 2CHEA 4LCBA 2VNKA 2O1WA 1Z82A 1E1CB 4DQ0A 2G5GX 2NUPB 4FR2A 3RTAA 3SYNA 3T1HB 4IPTA 3KVOA 3U44B 4BP3A 5K8VA 3ND6A 3GJ7A 3A14A 4YYEA 2MSDB 3MNFA 2LVBA 1VJTA 3KZ1E 1E69A 5ARCA 3D7NA 2V7UA 2UV8A 3VC1A 3ETDA 3JD3A 1BYIA 3JVIA 4KRFA 3V9AA 1YDGA 1EX6A 1EZ1A 1KJ8A 2W2LD 1DU4A 3BMCB 5JU6A 2HLHA 3N9IA 1Z73A 3DEHA 3LUAA 1SQSA 1LVUA 5BPHA 2QTHA 3AWIA 5KQMA 2JBAB 2XYHA 4M88A 3WGUA 3U3DA 1IDN1 2CY0A 5KQRA 1RD4A 1K6EA 3WGIA 1M54A 1FTNA 4JNCA 3U4CA 4MYTA 4H0NA 3C3XA 3HVIA 1B3BA 2CEKA 5AHXA 4R41A 4CMCA 4RH0A 4ZVUA 1H93A 3RUFA 1XP5A 1AK9A 1R9MA 4KFSA 4LVOA 1GIAA 4D74A 1JZSA 1EFKA 4R1TA 4YP9A 1BJRE 3AF4A 4KE6A 4UOQA 4NBWA 5LMZA 2AS0A 3HEAA 1ENOA 3IP3A 3F8TA 1KYTA 1U9YA 2QJFA 1PJLA 3QVXA 3RQSA 3JZFA 3K8YA 2P6NA 3AR4A 4H2DA 1B73A 4DGSA 1N2GA 1X19A 1ZR4A 1M1YA 4W9MC 2A3NA 1XCBA 1EH5A 1SOAA 5K6AC 1ESZA 4A8JB 3AMVA 3JQAA 4XWGA 5IBQA 3KYCB 2H63A 5ED0A 1YB6A 5JNTA 1EE9A 1FYDA 5DTMA 1R5BA 2XZPA 2RH8A 3MRTA 4J2TA 4JWKA 3O6VA 2QVCA 3MWFA 3NHKA 3VOSA 5JH7F 2WU4A 2BHTA 4E2WA 1XMSA 2QMEA 4G9BA 4ED9A 4PC1A 3ZWWA 4MCIA 4CV2A 4DQXA 2HIMA 4UC0A 5IVDA 3ZKWB 1DJNA 1DIGA 3BQNB 5E2BA 2O7VA 5K45A 1VI2A 4Q7KA 3ANXA 5HFAA 1RXEA 4QDJA 2HCJB 1XF1A 4FYWA 5AW7A 3AUAA 4HX2A 1M1UA 2OV1A 1DL5A 2HZ7A 3A9RA 3DVAA 3MJVA 2XIJA 4GOJA 4JP1A 1XELA 3WZLA 4P31A 1JT9A 3AV3A 3DE3X 2FN8A 4FEYA 4OKSA 2D2IA 4AUMA 4MW4A 1BH2A 3FF1A 3BF8A 3PC2A 2G4VA 4I66A 4MP3A 4XSHA 3ROFA 2ABWA 3SGLA 3TL6A 4IOMA 1UR5A 2JK1A 4JYCA 4H7JA 3SM3A 4DA6A 4PXYA 1K5DA 1M7HA 3ND5A 4WINA 1U28C 2CSUA 2ZRFA 3TAUA 2PX6A 2CV1A 4MZXA 5ITVA 2C8KA 1JDTA 4RY8A 5DHSA 1Q12A 3H6HA 3L8DA 1PTJA 2EARA 3SI7A 4DZRA 5KWEA 1E58A 2W4QA 1OFUX 1B14A 5CGZA 4RS3A 1NVUQ 1J0DA 1GL6A 2O3JA 4EUEA 1UPFA 3GT0A 4HYEA 4KXVA 4P3YA 5EQTA 4ZIRA 1ECGA 4NU8X 5GONA 4HXFB 1GFSA 2NVBA 1K8ZB 3DUWA 2DQ4A 3E8SA 2WBLC 3E22B 4YMVA 4WNIA 4CL0A 4GLFA 1TZMA 2XYRA 3ZDAA 3M3PA 3KJXA 3B48A 4EM6A 1F60A 3WMGA 2CVZA 3ADPA 4NJMB 5L45A 1VMAA 1IK4A 3F4BA 4JN6B 5G1PA 2WD7A 4DAEA 3I62A 2F62A 2NQTA 2VQ6A 3RGGA 1XUOA 2FR8C 3MB8A 4DARA 4YT5A 1HZZA 3E3AA 2A14A 2NU6A 1E61A 2VDJA 4Q48A 1WDLA 3R5KA 1M0EA 3PJRA 1UXHA 4IDNA 5A0FA 3COWA 2ERYA 1A4RA 2PBZA 4PBSA 2UDPA 3CE9A 4A6DA 1ZN9A 3DDCA 3PQ5A 1Z0AA 1P0IA 1T0PA 1XKQA 4S1VA 3UG7A 4I4CA 1K7CA 3C7AA 2V4MA 4WK6A 4Z4QA 3IT0A 5JAQA 1ICEA 2DBQA 3EDCA 4MB2A 2M6KA 3WLAA 2HBQA 5AKGA 3MRSA 5H3HA 5MFZA 1XDBA 2J9ZB 3B89A 2F3QA 3DULA 4KDFA 1VXRA 3W6NA 5FH9A 3HZHA 1F4PA 5JISA 1CB7A 3O93A 4TVBA 3ZQJA 4FGJA 2FPIA 3AKEA 2OWDA 3JRXA 1GZUA 2H1LA 3E23A 4DREA 1I7SB 4C0LA 1U3UA 1JIJA 5PNTA 1U0JA 1HLPA 3H11B 2QXTA 3G7NA 4IKEA 4YCJA 3HUFA 3AEQB 2OT3B 2IPLA 1LH0A 3IP5A 1JVBA 1NX6A 4DL9A 1DCTA 4XKJA 3I6MA 2PRJA 4TRRA 2GXAA 2FFRA 2B83A 3MLEA 2COEA 2CYCA 3CGGA 4MO9A 1I36A 3U9TA 3PPIA 4V0LA 3T41A 3WP0A 4U9HS 1AY0A 4O63O 2JEOA 3R0VA 3OTGA 3DT6A 5IJAA 3VSCA 3W6UA 1Z0DA 2CXHA 1PBNA 2B36A 2O2XA 3OPYA 5LP6F 3ZW7A 3SE7A 2F7SA 3DUFB 1IHDA 4Q7JB 2FPGB 3C6QA 3OE7A 2HA2A 2FW0A 3CR7A 3Q7QA 2XRFA 2BR4A 4QASA 1BMFD 5I8WA 1P4HA 1SA0B 1B74A 3DEZA 3BHJA 3MILA 1J00A 1WVMA 3QEMB 2XE8A 4RSMA 1XV5A 1ZSVA 2CN1A 3X43A 1YAJA 2GETA 1UM9B 3H5NA 4LZWA 4GX1A 2YVUA 2ZDGA 2JAHA 4C43A 2VJCA 3RJZA 3LUFA 5IUJC 5DT2A 1H22A 2Q5CA 3H05A 4ZJUA 4LYEA 5EHZA 5KJCA 1N7HA 1QS0A 4NU0A 5L7YA 2QJOA 3MERA 4UVDA 2X58A 4POOA 1WXHA 1QJ4A 3DZ8A 3MHPA 1OV4A 4OHMA 1DEOA 2HRQA 5B1HA 3SOZA 2C2WA 3UCFA 1L7PA 2WJ3A 3EPRA 1P7PA 5EJGA 5EP2A 1VHTA 1CR2A 1IN5A 1SVLA 3PNBA 4NZPA 2Q2QA 5ALSA 3CSSA 3GLGA 1E3LA 1V3VA 3GVPA 4P9NA 2WYOA 4JHXA 4EHHA 3PDJA 4PM4A 4LFAB 1PGQA 4ZCIA 5A2QA 4LS3A 3OEWA 4GYWA 4W5QA 5EN4A 3KOOA 1Y8CA 1RRFA 4WY5A 4MDHA 4XA8A 3A3KA 4ZVLA 1P7WA 3T9DA 2PL3A 4GNRA 4HDMB 4K9KA 2X86A 4OQNA 1CIVA 3ASYA 3NBFA 3LP8A 4F4DA 1TQ6A 1CUSA 1NNI1 4G0ZA 4FZVA 2C9CA 4G5HA 4BBJA 3X1KA 4B6RA 1UDXA 3T9BA 5FIUA 4BVLA 3AVYA 1Q1GA 3P97A 4M9SA 3CLTD 1V39A 2XUOA 4GKVA 3BFVA 2EG9A 3CG4A 4OM8A 2QJTA 5PGMA 4UKDA 5F7OA 5ALGA 4MAMA 3UMCA 1PYOA 1I13A 1ZW1A 2RI6A 4UCQA 3X1DA 2EZ8A 4GX0A 4P4SA 2Y0EA 4OSPA 3VGPA 5THKA 1JTVA 3QBTA 1G5TA 3A6DA 1ML3A 3GIWA 3QX7A 2VSQA 1KNXA 3U6KA 5TMBA 1LPSA 4DY4A 3GA5A 1GSHA 3H9GA 3KKEA 3LD9A 1OBVA 4FD2A 1W34A 1KO8A 3RS0A 3D7SA 3EDRA 4OBWA 4AZVA 3H5WA 3PFCA 3RLIA 2PEZA 3D2BA 1EFLA 3K05A 3ZXUB 2JJ8A 2QY9A 3B7WA 2IYLD 2LWIA 4C08A 5JNUA 2AOWA 3UJNA 1EFVB 4U7WA 2Z5GA 2IZOA 3EF3A 3QA9A 3DCNA 3QEAZ 4FHEA 4HX5A 1PE0A 2GD1O 3LPCA 3HB7A 3M1AA 2HI0A 3AB3A 4HDNB 5HBRA 1CQZA 3UT0A 1XPUA 3EZFA 3HFRA 4G4JA 1SUDA 4OI1A 3THXB 2IBTA 3DE7X 4P34A 4W99A 5BN5A 2Q62A 2VEOA 1JSZA 1GUDA 2DECA 5B58T 2GJ8A 1W4BA 4OD0A 4H7DA 3W0LB 3PA8A 5AJYA 1LWOA 2PGXA 4KREA 4BYMA 1AMOA 1E1LA 1L5VA 1NXXA 2AB0A 1ZI6A 3K9NA 3VHLB 5TC4A 5J58A 4TT3A 2XAUA 1QTNA 3ABZA 4EYOA 3QLUA 3KQPA 2AX3A 4XLZA 4DCJA 3B3JA 2PGOA 1WW2A 2FNAA 3I6QA 1F2VA 4DCSA 4BU0A 1GPYA 2SCUB 3KQTA 4HQNA 1G7RA 1Z35A 4P32A 4Q00A 3KU4A 1E63A 4TLCA 3U4GA 2FMTA 2ZRPA 1V41E 3VDMA 2RGUA 2VK2A 4LWQA 1PEKE 1EXMA 2ATCA 3HUTA 4QYMA 1A71A 1OOEA 2DFVA 1JXAA 4IV5A 1LI5A 3I4CA 5H80A 3K2IA 1M2GA 1P0CA 4PX3A 2V4UA 1U0EA 2PJUA 2Q3FA 3O03A 4YGYA 3R0XA 2PZKA 4H6PA 4WLNA 5AI4A 5LKRA 1E8NA 2NU9A 4TTTS 1ZRNA 1W4CA 1IM8A 2JHPA 1GQOA 3P27A 1EUZA 5HCUA 3KJIA 4RKEA 3UHJA 3QLTA 4HEHA 4LGCA 5AJWA 1XZPA 3OKAA 4X5OA 1LLQA 4FDMA 1E4YA 4G1BA 1JAIA 3DHVA 3Q9LA 4JB2A 3MINB 3A1CA 3ZE1B 1ESNA 2WVHA 2YCLA 5GJBA 3O3CA 4KIWA 4AL4A 2VRCD 1ZP6A 2XQFA 4WNAA 1IZ8A 1G0OA 4WLVA 1SO8A 1J8FA 2R97A 4M86A 3C6XA 3N2YA 4R40A 1GD1O 5T3YA 3TDKA 3OLXA 4AIRA 3AX6A 1OYVA 1G5PA 2H16A 2ONJA 4U0KA 1SXQA 3NBXX 4IIVA 1DQPA 1DTWA 1KERA 1T1JA 2W6ZA 3QV1A 4OXXA 2Q0SA 1M8PA 5ILQA 4ZGWA 3KZVA 2JRCA 1T2DA 3HVUA 3E5HA 5JZMA 1FS4A 5C8XA 2RH9B 1XRLA 2JIZD 3IHKA 3IOBA 4LKRA 2N47A 2IXEA 2H4JA 2C5EA 3LWBA 1GDTA 2B61A 4ADSG 1XSEA 1BMQA 4FYMA 3ZBUA 3PICA 4KMOA 3VR5D 1GPJA 2HQOA 1QIGA 2LV8A 4XFJA 5FF9A 3OZBA 4GGMX 4QU8A 3KXDA 2DTEA 2R5NA 2O20A 4JL8A 4KXQA 4KE7A 4UTXA 4EFNA 4M1EA 3VO1A 4QGSA 1KR5A 4KV7A 1ZGJA 4Y18A 3KSUA 2J7KA 4YK7A 5DWVA 3I6YA 3B6JA 3DAFA 4FONA 4Q0MA 1R8YA 3SZGA 3MN1A 1S4MA 1RDFA 4GVXA 1T2VA 1X13A 3MJTA 5SZIA 1NVBA 2JIBA 2NYRA 4TZKA 4YUVA 1TM7E 1U2PA 2BKEA 4NHOA 3L7NA 1UJ4A 2JFZA 3M3DA 1I6MA 2BE9A 3OZVA 1EEHA 1E4OA 5AHRA 4P98A 2PZBA 2ZJOA 4QHYA 1Z75A 2CFOA 3M5CA 2BFWA 2G36A 4IICA 4P3NA 3HBLA 4MGKR 1AGNA 1L5RA 1PZNA 2II6A 5G0VA 1ISIA 3ZGYA 1AO0A 3X3HA 4BNIA 4CNQA 1H0SA 1V16B 3QPCA 2B94A 3LI2A 5JVDF 3KPUA 1D04A 1PZEA 1S8FA 3ZDQA 1UPBA 3SIXA 5IJ0B 2FN7A 5FOTA 4LCEA 4YFYA 3DTNA 4BJ5A 1OFVA 3CO0S 2WF9A 2IHKA 4IIHA 3VGJA 4BB5A 4B83A 1WZCA 1IN7A 5DNCA 1JPJA 1PLLA 1QZTA 2RHHA 3BWXA 3R41A 1X8XA 3QG1A 4J6EA 4KJXA 5G1NA 5IN4A 5E7IA 4O8CA 1YRLA 2C2YA 2K6GA 4WFKA 5IM5A 2G09A 1UIMA 1Y8QB 3U9LA 1J21A 3H6KA 2XEDA 1VGRA 4OBEA 1QIDA 5LQAA 1Z26A 4LYGA 3WXBA 1YFJA 2BFBA 3ENZA 3W5AA 3N6RA 3LUBA 1G8KA 1JHYA 1GAWA 1RHKA 4L5JA 1ZIDA 4RK4A 5HK8A 5HMMA 3WWCA 4JI7B 1DDGA 1MH1A 4PZLA 2Q5IA 1LPNA 3NWBA 3GL9A 4FR5A 3LDAA 4GLOA 3M82A 2OCKA 5C1BA 3RFTA 3UTCA 3PWZA 5EZSA 1X9IA 1HRKA 2LE0A 4RF2A 5AP9A 4RZ3A 3WYNA 2QE7A 1DJMA 3E2PA 4CDGA 3C4JA 5GVRA 2XTNA 1LLCA 4X3PA 4XPZA 3TEJA 4I1SA 1XFAA 3KQVA 2NZ2A 1MGPA 1CUYA 5KTTA 5BQFA 1VKRA 3L1VA 4IIUA 2OV3A 1UAYA 5TY0A 4TGLA 4QYXA 4YJHB 1ENPA 2V7XA 4K6GA 2I65A 1C7IA 3FDJA 1F5NA 2HXGA 3NETA 1HYQA 3ZWAA 3RREA 3JU3A 1EBBA 3AERA 4RHUA 3HYRA 3PPWA 3KPWA 5CH5A 4ZICA 5A9SB 4IDOA 1XRNA 3ISTA 4G07A 3CH6A 2QPOA 2J9FB 3NEYA 5CM9C 3GP3A 4L07A 1L9XA 1GPDG 1WUTA 1YCFA 3CNBA 2ZPUA 4I1PA 1CQJA 2UYQA 2UUPA 2F64A 1V95A 2VPIA 5GJVC 4B3CA 3IIIA 4F4UA 3WG9A 1UP6A 1Z6YA 3OJWA 4BNWA 3RAGA 3F4LA 4X1IB 1NUSA 5LB4A 5CB4F 1Z6PA 1T5OA 4FFLA 4DLNA 3DB2A 3NLLA 3A1VA 4RMIA 5A5GA 4OAPA 5JJCA 2AVNA 2PCLA 3PFBA 4MR8B 2YHUA 2Y71A 2G9VA 5HMLA 2DYKA 1T0JB 1EGMB 1SOUA 3OZWA 3ZTYA 2XJ4A 3OECA 3WSVA 4PFKA 4QLOA 4EQ6B 1TM1E 2X3FA 3E3MA 3LOQA 3ZCRA 4B3BA 2NZVG 4B40A 2EQAA 1CEYA 1DKRA 1VLZA 1VZ3A 1S2IA 2QGZA 3IAHA 3IAS1 4RSRA 5TVKA 5EJEA 2OSBA 1XVUA 4RD6A 1XXHE 2BT4A 4EGSA 4YRKA 5C5DA 2WTUA 3EZ2A 3BTSA 4F5DA 3IKMB 3QENA 3UPDA 1H6CA 4MGZR 5KSOA 3D8SA 2E48A 2QXUA 3GFTA 3OIDA 1N7JA 3ZJYA 1Z29A 4CMEC 3P2IA 2YCBA 5CB6A 4KSYA 2VSNA 3BB1A 4BNUA 2O8FA 4AJPA 1S8OA 7REQA 3GHHA 4A03A 2Y1DA 3D2AA 1J39A 4LTMA 2HOQA 5G3ZA 4YRIA 4HS4A 1ORVA 5FFNA 2NV6A 3B1ZA 5HF5A 1H4QA 3U7FB 2FPKA 3QFTA 4LXYA 5B53A 1ZPDA 3L8YA 3L1JA 2H1HA 1D7AA 2VSFA 3U40A 2A5DA 1G55A 5F64A 3VPFA 3MLBA 4BJ3A 4OHXA 2Q07A 1RXYA 1O6GA 3E61A 4PAQA 2QNBA 2XKBA 3QIAA 3RJ5A 4C4ZA 4DC1A 4YCCA 3HKDB 2NP7A 4H3HB 4PHGA 2OV6A 4U02A 3PI6A 2Y27A 3A9SA 3UOGA 1RQPA 5L40A 4LSGA 2ZE5A 2KE5A 3FLBA 3NHJA 1I3MA 4LY0A 2P9YA 4PFQA 4B31A 4MMXB 2FHSA 2Z1MA 3TNJA 3K0FA 1IBLB 1TQDA 3GAFA 5E3JA 2GB4A 5AWFC 1D5CA 2A4MA 4BX8A 3J7AC 2RH5A 1YA8A 4KXYA 5BSUA 4YACA 3JX9A 2MSEB 4GKBA 4DDMA 1AH2A 4C6TA 4RGYA 3HU3A 2IP4A 2DETA 3WIOA 3O83A 5ARDA 1YQEA 2UZ1B 3BX1A 3FOAA 3HKEA 1GA6A 2J6BA 3PEYA 2IU4A 1JBKA 4M7OA 2YWBA 3QUQA 3Q5DA 4WI1A 2PGLA 4DRYA 2ZCVA 2DEUA 2CFSA 3TNLA 5TR9A 2W98A 4CW7A 2X8LA 4FDLA 4LJ6A 3RAFC 4GFDA 2J3EA 4MJXA 3IEXA 1RM0A 2BEJA 4O33A 1M1YB 1BE8A 1DIHA 3OCJA 2D1RA 2CMKA 3P9ZA 1TK9A 2JI9A 3B6KA 4Y0VA 2GJ4A 2BMJA 2Q5EA 5CXQA 2C7OA 1IUPA 2QD2A 1ZKMA 4JU9A 1VPWA 4GI3A 1NW7A 3MWEB 5K3FB 1KMHA 1Q1BA 1Y7HA 4B8YA 2PSFA 4CR7A 5IZ4A 3LC2O 2QI9F 3C6YA 3G7SA 2CDRA 4QQNA 4HP8A 1RW4A 5I45A 1FDVA 1OLXB 2A6PA 2Q50A 4ND2A 3KJGA 4PC2A 2ZDHA 3VDRA 5JD5A 3IRUA 4C7KA 2DPHA 1US8B 2FEXA 3CBQA 3STYA 4G0NA 2HV9A 3GW8A 3DPIA 4XW2A 1ENYA 1HE4A 4V3BA 1TYEB 1YJCA 4XDZA 4NQRA 1ISSA 1MV8A 3SR0A 2VNHA 3PHLA 1FSFA 3G2LA 3VM6A 3ITNA 5AM0A 1KPHA 1RC1A 4H4EA 3IQFA 1P2UA 3NIFB 4K9DA 2QAIA 5BW5A 1AUPA 2YXBA 3SDZA 2AOTB 2ZRAA 4ATNA 1SURA 4TPKA 1KY5A 3CRQA 2MOKA 3OIGA 5SYAA 3EIXA 4L2IB 3V4FA 3UHFA 4F93B 4DLTA 4J1QA 5IC5A 3F9CA 2Z3WA 4RPCA 2H6EA 5CVUA 1I0IA 4DCUA 3WWZA 3FWKA 1II0A 2VDUE 2VPYA 3H2YA 4WKGA 5KMGB 5BN3B 4CQJA 2B5VA 2FA9A 2ECKA 2OK8A 1UT5A 2PPLA 4RGBA 3O9VA 2VLBA 4JOQA 4MRMB 2V7QD 1GNPA 1U0HC 3CKLA 3HMQA 3G2IA 1E94E 4P0QB 5CITA 3DBLA 1WCIA 3NGLA 2ZZMA 1BAPA 4FU0A 1B16A 1CY4A 2XMCA 1GPWB 4Q6BA 2YOHA 2RE8A 2C42A 3QWBA 4HWTA 5C18A 1KYIA 1Y5LA 4JJEA 2VTEA 3DYBA 5ADHA 1B1AA 4R6WA 4XQ0A 1D2EA 4CF6A 2VDVE 4CQMB 5F73A 2C4HA 5LXTF 4S12A 2PY6A 4FN5A 4HXYA 1PJTA 2Q5FA 2WFMA 4NENB 5EE0A 4NCXA 4I3FA 2GUWA 5HK9A 4CI0B 3WDMA 3FPEA 1DAHA 1HSZA 3RKRA 2RG1A 1THTA 5JNSA 1P31A 1TM4E 3JAKA 3PDHA 4ZT4A 4ENQA 3K09C 5F76A 2NX2A 1W93A 2FPMA 2OBYA 1D2HA 2H2DA 2QWXA 3U56A 2AYXA 3P32A 1GWNA 1OHHD 3GG9A 4LOJA 4Q4AA 3WMFA 5IK2D 1JEYB 2QY6A 4DCPA 1EUQA 2M9MA 1XJCA 4LISA 2R00C 2O54A 4FIDA 5TPWA 2C82A 3CLUC 1IJEA 5BV1A 4KI7A 5LA6F 2CNWA 1E1YA 1DPGA 2DBRA 3AZOA 1R18A 2FPIB 3DGFC 1RZRD 1SNYA 2WZDA 4B84A 2PBFA 1FUEA 3WV4A 4L5YA 2ZSAA 3A3NA 5IAAA 3Q3EA 1NWCA 5TDHA 1T4GA 1HDEA 2FX5A 2FSHA 4EAQA 5KOYA 4TZ6A 2WHPB 3AVUA 2G7MC 3ZDDA 4GLBA 5LZ8A 2VDPB 2DERA 1YR1A 3D2CA 3NC1C 3EBLA 3LFTA 4LHZA 4QGHA 3MJRA 4JB0A 3GJ3A 4C06A 4E2YA 1UH5A 2YHAA 1E99A 5FPPA 2V0CA 3T3HA 1VYVA 3OAAD 3ZG6A 1G4HA 2CJFA 2IZ6A 1PHPA 3C1AA 3JWIA 5BW6B 3DDZX 2GNPA 2P3OA 1XZHA 3QUTA 3DXXA 4U2CA 3A7EA 5AJVB 1VYTA 1NVFA 4RM2A 4ZU3A 4ZAFA 1CYDA 2YFQA 4TV9F 3FIJA 2WIJA 1SOMA 1NMZA 4OU5A 1JWAB 4I19A 1XZIA 5ALTA 5K8TA 5C51B 4Q1VA 4I14A 5E6RB 2EHJA 2WUFA 5LYJA 2XMRA 3KDSE 2YRFA 3QUCA 2JIQA 3F90A 2X3UA 5ALZA 4B9AA 1JJFA 4O2BA 4TVSA 2WU1A 5K20A 4AF6A 3L4KA 4EB3A 4B1FA 3HXQA 1RFGE 3ZY3A 4RDHA 1TD9A 1O9GA 4FMDB 1LPBB 1Q1ZA 3BB4A 1QS0B 3D5EA 4C3UA 3PXBA 1UC9A 2HDWA 1ANKA 1HQDA 3PVZA 1R66A 4ND4A 3GN2A 3OQIB 3BE8A 3JQ8A 1EFHA 4QTTB 1YVEI 2O48X 5K3BA 2G67A 1JG1A 3LL4A 3OT5A 4BLVA 1H8ED 3NHAA 721PA 2E7ZA 3PUYA 4RFSA 1AKYA 3QE4A 1LSUA 4XUDA 5CH3A 3H9JA 1VSQA 2AFHE 4UVEA 1CJUC 3WQRA 2VQFB 3CLSD 4FSXA 1NQOA 4B3JA 3LX4A 3UKJA 4WOBA 4IWYA 5AVZA 4ZMSA 1I30A 1UJNA 4Z4IA 3QF7A 1ZCJA 5I7AA 1DX4A 4BMZA 4JA2A 4PXAA 5ESRA 4K26A 3W1EA 1HH4A 1K3UB 2HWYA 2P67A 3NWEA 5C7LO 5AICA 3R9XB 1JIKA 2UUBB 4RIEA 1PFWA 3D81A 1T2AA 1JXMA 3LLUA 1HPLA 4LXQA 4M0PA 4CIDA 3HO8A 3W06A 2HJGA 2G5CA 3N3BC 4RTKA 2G82A 5J47A 1SAYA 1N2HA 3R3VA 4UU1A 2Z2IA 4Z9XA 2XGJA 1SH7A 4D79A 1AGYA 2JLUA 1JLMA 1PG2A 4ICIA 2J7PA 2C8LA 4LKOA 3PHBE 4S24A 2R6ZA 4L0CA 4PYOA 3TTVA 3GP8A 1HDIA 2XMDA 4M4SA 2A9KA 4LBYA 3GBVA 4Q6WA 4R2HA 4AN4A 1I4OA 1SUEA 3MGAA 3F7OA 4MR9A 1LZLA 3GRZA 3VU1A 5ICEA 4CM4A 5F21A 3RSFA 3M9WA 4D4LA 4EJSB 1GL9B 4BP8A 2LNDA 2DU8A 2WD9A 1M8FA 3OESA 3KPJA 4LY9A 4ZI7A 3L1UA 4NYIQ 1PV1A 2I78A 4PLGA 5IM4F 1MQ8B 4XIJA 3BSFA 3K0CC 1E2HA 3UAWA 3UUWA 5DMHA 4C0XA 2GKGA 1L8AA 4XX1A 3GLFB 3T8YA 3DLBA 2NXJA 1U0GA 4RXTA 4UHFA 4NDAA 3M0EA 2QVYX 5FUMA 1E18A 3D31A 4XRRA 2GLTA 1NAHA 4QC2A 2Z8YM 5CLHA 3VPDA