2DG2A

Crystal structure of mouse apolipoprotein a-i binding protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Apolipoprotein A-I binding protein
publication title Biochemical and structural characterization of apolipoprotein A-I binding protein, a novel phosphoprotein with a potential role in sperm capacitation.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2dg2A00
3RT9A 3RSQA 3RSFA 3RRFA 2DG2A 3RO7A 3ROZA 2AX3A 3RTGA 3RT7A 3K5WA 3RSSA 3RTEA 3RTCA 3RTBA 1JZTA 2O8NA 3RTAA 3ROEA 3RS9A 3RREA 3RRBA 3RSGA 3D3KA 3RRJA 3RNOA 3RU3A 3ROXA 3D3JA 3RS8A 3ROGA 3RU2A 3RTDA
chains in the Genus database with same CATH superfamily
1VB5A 1WF3A 1Z0FA 4GL4A 5CXXA 4OXRA 2J9RA 2CXPA 1XTZA 4NFSA 3PC7A 4CKXA 2V8OA 2WP8J 3DAYA 5I9MA 3A1CA 3HQ4O 4QOJA 3RSZA 4BX3A 2CB0A 2FG7C 2R86A 4HZGA 2IY7A 3IVCA 2IBTA 1NBMA 4WASA 3KRTA 5JLAA 1AQIA 2XPCA 3M4YA 5EMHA 1EG7A 1JHXA 2YTZA 5CB8A 1BHSA 3GOQA 3U13A 3SKVA 1TQ6A 2H29A 2UU9B 1RTTA 4RVSA 1Y33E 2J1LA 3WRYA 3QWAA 5ITZB 1N1GA 1QWSA 4BXOB 1BE0A 1UINA 2JGLA 2PSEA 1CQXA 3R09A 5E9JA 1KORA 5HQJA 3VDNB 5L4SA 4MRAA 3RWBA 2HA2A 1PGPA 2IDJA 4MRVA 5TGDA 3TW4A 3ZGXA 1H66A 2EARA 2PRZA 3FKSD 3OZXA 1JKXA 3IPXA 3KB8A 2QJRA 4GGMX 4LPSA 5CK5A 4DUGA 3DEFA 5BN3B 3THXA 1R6VA 3WJ1A 2YN2A 2GN6A 5IARA 2LUOA 2G1AA 1LTQA 1SOMA 2PAFA 3GVCA 4IS2A 4OI4A 4CBVA 3PICA 4IDNA 1WXEA 4IV0A 4BAGA 3TZKA 2V0GA 1YQ9A 3RVOA 2NAPA 1XRRA 2D54A 5DSTA 1A04A 1KFBB 2ICAA 2GPTA 1YZTA 3CE6A 1B00A 3C14C 3VNVA 3AM3A 4EFLA 1HLDA 2PRSA 5HM6A 3AESA 3GIDA 3AL3A 4GUAA 3X3HA 1Z9BA 4C2AA 4YCNA 3RVNA 2GJSA 4RZHA 1ITZA 1K08A 1DG1G 4LCEA 2WWHA 4UJ5A 4B6OA 1BQEA 3QEOA 3L7BA 3O4RA 2PZ8A 3PNKA 2R1TA 1W4LA 3QWBA 1YBAA 4JKOA 4PLFA 3UFXA 4O8ZA 3KT3A 3ZJYA 2GM5A 2WWTA 3KL2A 1V4NA 3L84A 4WN9B 4Z0PA 4EY8A 3AIMA 5H68A 2O8EB 4ND8B 4A2QA 1TTHA 2NO6A 4B6GA 3SXPA 4R7GA 2C4HA 1K0UA 4KRGA 4LBYA 4N76A 4RZXA 3FOFC 1YRQA 3JAWA 3L0ZA 3TD9A 5DGTA 3BORA 1WS6A 3MF4A 8AT1A 4LW8A 4FYHA 1GTSA 1LBQA 3OCWA 3RHTA 4R8VA 5F2KA 5CFOA 4RTRA 1JIQA 4QHTA 3ETHA 1CRQA 2BF4A 2PKQP 4M0KA 3KM0A 5M29A 3GLIE 2PUAA 2VJNA 4UASA 1QHFA 1SNYA 4OYYA 3HKDA 3ZDXB 3ZPXA 1SG9A 2V9ZA 1MENA 4QELA 1NW5A 4PZYA 3SN6A 3LH5A 4MWGA 1QHIA 3DGFC 4QXRA 4R2HA 3TBHA 3ZDRA 7REQB 2YJGA 2ZSAA 3D4BA 3GLRA 4WZBE 3GW8A 5DU2A 5LCXA 3UJCA 4A0RA 3TECE 3TGPA 1E5DA 4FFMA 1PJCA 1S1CA 5BVHB 2GM9A 4FYMA 5F9FA 1Z56C 3NWJA 1HPLA 2ZRGA 3BSFA 2FE4A 1DTEA 1JSXA 4TWRA 4ZCIA 1FE8A 1Q1AA 3BH0A 3C98A 3Q7SA 1WXQA 4OSOA 2C5FA 5EIBC 3TF5A 4OSPA 1F4LA 2HQSA 1N0VC 4DLKA 4HDQB 3TIGA 3KG2A 4Z49A 3O1JC 3ORHA 4A8TA 1PW7A 4WFQA 5LR6A 1BWPA 4F5WA 2P2SA 1IJKA 5HGXA 3NANA 4PM4A 5TS3A 1P8JA 1LI7A 3MRSA 3ISTA 2D7DA 4ZVRA 3RODA 1GZUA 3FOAA 4HGNA 4AY3A 2QRUA 1N6PA 3ED1A 3OOWA 5JC8A 4K6HA 1XRJA 3RF7A 2Y68A 3ES9A 1G8HA 2OEPA 2Z8YA 5TF0A 3FBTA 1E7WA 1TVMA 4BO0A 4Z0TA 2ID4A 1JKMA 3LZCA 4CU2A 4AJLA 1GPWB 4RTQA 4Q4DA 4TQUS 2C8JA 3LSTA 4RF5A 3HYSA 5GWXA 2A0FA 1F51E 2XQFA 3H2IA 4UE6A 5L53A 3ZJTA 3PEEA 4DMHA 3EA4A 2GBIA 4DR4B 1SWVA 2R7MA 5AHWA 1Q21A 1VMEA 1Y8CA 2FFHA 3A14A 4DLUA 4P3NA 2EJTA 5TT1A 4G8DA 1ZP6A 4ZWNA 3LX4A 3ZWNA 4CR8A 1T10A 2XMZA 4IUCS 3MWKA 4PG5A 5DGIA 3RJ9A 4M60A 1X94A 2WPDA 1E9BA 3CW2A 3EAQA 4L7QA 4UUPA 2FP4B 1DINA 4KAFA 4UVEA 3T1QA 1ZXXA 1XDGA 2HNBA 2IEDA 2R6JA 3EIOA 4W1SA 2IZ5A 3HKCB 3QLJA 4Q0MA 4DA0A 1V8BA 1CNMA 4B48A 3Q8LA 1ZD8A 5KYGA 4TTVA 3LXUX 5SZJA 5IFLA 1XEWX 4G89A 4FMPA 3FA2A 3O31A 4IHQA 4YPOA 4IGAA 3SOPA 1LPSA 1T25A 3GA0A 4Q3LA 1GT91 4U9HS 2FEKA 3UK2A 3ZWXA 4BO4A 3U5TA 5EOVA 4URYR 4F85A 1XA0A 1UFRA 5EG5A 5EIBD 4CRWB 5LOVA 3BMOA 3BTUA 2I6TA 5LKAA 5EXPA 1LZKA 4YP6A 2IP4A 2A4KA 3KETA 3W8DA 3BGWA 1QIIA 4RACA 4BC1A 2AYZA 4NMMA 1FVFA 5HDBB 4XWWA 4F84A 2NOAA 3FMVA 1L5NA 2JH3A 3BREA 3KXLA 1Z2PX 2Z1DA 3OLZA 3WRWA 1OFGA 3EFEA 3ZCUA 3A26A 3ORYA 3R24A 3LHSA 3RJTA 1NWCA 3KL4A 1XLWA 4XYGA 4W7SA 1ZQ9A 2G4CA 3UO8B 1DWQA 2CXSA 1U3GA 3FBWA 4PHHA 3DZDA 5M3BA 2CMGA 1RZUA 1MABB 3HDVA 1GL9B 4AO8A 1C0IA 5JDIA 2R44A 3PNMA 1UAYA 3Q9NA 1KC1A 2HX1A 3K4QA 3BIJA 4G1VA 4KVFA 4OMDA 4EHIA 4J0DA 3DHYA 4GE0A 3EZ9A 7MDHA 1F14A 3L6RA 2IYTA 1YXMA 1JHAA 3VMFA 4XVHA 3ZLVA 1CF2O 3KJZA 3SSNA 1W4ZA 3TOCA 2BH2A 4MCAA 1UC8A 4LXGA 5E8RA 5I7UA 2FPPB 4GZMA 2WNHA 5EMNA 2ZUCA 4CDNA 1X74A 3FYUA 1TMGE 1QIMA 3P20A 5L95A 3KC2A 2ZSUA 5H16A 3LPMA 4CLDA 2IITA 3ADCA 5DT2A 1QNLA 5AHXA 3WWPA 3H6HA 1H94A 1O95C 4IQGA 3NHAA 4I5IA 4EW2A 1LLUA 4A2WA 2CVHA 3HU3A 4D3SA 1Z5WA 3ZVRA 2RGAA 1MAAA 5HRAA 4KZKA 3CBQA 2DRIA 5JSZA 1FJXA 4AIRA 1ULAA 1W8IA 1YTLA 2QR2A 5HRUA 5HQTA 3DO8A 1HOTA 3F5SA 3L06A 1E4VA 4BO3A 1ZBDA 2F1HA 2WJ3A 2QT1A 3WLEA 1K4MA 1QLWA 5MFPA 2LCQA 2GYVA 1XXHA 1XZLA 1A4UA 4GI5A 1OBHA 2QRPA 1KDZA 1V37A 4U39A 3PV0A 3SZLA 2VT2A 1X3LA 4NBUA 3SR4A 3Q3VA 4BZZA 3EZYA 1H2FA 1I2BA 3ZR4B 3O4FA 2XCIA 5HHTA 4Z9BA 2FY8A 5DGCA 1Q14A 2JVIA 1GAQA 1JQAA 1X92A 2RHDA 3B53X 4V0ME 2ENUA 5B7NA 3O8CA 2TRSB 3IBTA 2Q2VA 3OTIA 4DT1A 2PT5A 4L5CA 3V4LA 4K6MA 3NIWA 3ZWCA 4KB5A 4WPGA 3ZEIA 3DLTA 2A92A 1NSFA 3ZKWA 4ECAA 1HTTA 1DEAA 3PUVA 2NO7A 4E08A 2QE7A 3LHKA 4KH0A 2X7JA 5DCUA 3KTAA 3VU8A 2X0FA 1M1NB 5GZ3A 2ZYVX 1XK6A 3D6HA 1N3LA 3COYA 4FFWA 4RV5A 2ZP1A 4RZ3A 3ISVA 4PGGA 3M3HA 5AVKA 2ZXUA 4CEIA 1SU4A 1WX1A 1XFAA 3THYB 1TIPA 1EA5A 3IE0A 1F8YA 4HY3A 4QFBA 4BJ3A 1XR3A 3DVSX 3B2NA 1YZQA 3EUWA 3JQAA 3KELA 5GV8A 4FWIB 3X2EA 4HUTA 3KXDA 3HU2A 4CV2A 1NDHA 1FNDA 3T9BA 3OQMA 4MB0A 4KN9S 3ZE8A 5GINE 3OI7A 4HEHA 4JMLA 1S8FA 2VUHB 1O95D 3ODGA 1G8YA 3PVZA 4KYIB 4II2A 3RV4A 4CM9D 2FSVA 5B12A 3O0DA 5IKPA 2AZTA 2MINB 2XUOA 3TLXA 1JAYA 3G02A 4Z1MD 1KTIA 5EWJA 4BQOA 4UTRA 1O5OA 1ISHA 4J4TA 1XYYA 3M6IA 2D62A 3OIFA 1SMKA 4KOAA 5JD3A 2R68A 1P1KA 1XVUA 3NHFA 4I19A 3JSAA 1KKUA 1S2OA 2CBXA 4ZT3A 2OK8A 4RS4A 3ZU3A 2BFEA 1LUAA 2CL5A 2ZJFA 4OAOA 2V9PA 3QYFA 3H2YA 3GMIA 2QNBA 3QYPA 5IVIA 2JH8A 3HY3A 4TLAA 1ADJA 4YRTA 3C3KA 1MFZA 1LZLA 5CJJA 1EE2A 1WETA 1NN5A 3P7MA 4JBNA 5IYZB 4ZOLA 1P75A 1GPDG 1YOVA 3LC2O 5EPOA 5GV7A 3J81A 2QXYA 1T9HA 4JC0A 2I7XA 1TEHA 3EG9B 3UMCA 2RAFA 1T1JA 2W6ZA 4FINA 3PEWA 1C9EA 4B84A 3TL6A 4M0FA 2QIPA 2ZJ2A 4PPQA 5A6SB 1TA9A 4NJOA 4N39A 2Q1YA 4UHEA 1KWGA 4K0KB 2PZEA 4L5BA 1LLDA 3R6DA 3WL3A 1QORA 5JMPA 3L1IA 2O2CA 4EM6A 1LFDB 4MVJD 3JQQA 3L77A 1O08A 1GAEO 1W0KA 2X6RA 1X87A 3NORA 1IBLB 2BGMA 3L7YA 4DHWA 9ATCA 3DE5X 3TW0A 4D80A 2OTCA 1TRKA 1YR3A 3GFTA 3WGGA 4HWSA 3T41A 4ZCRA 2V7QD 3EHDA 4WOBA 4X6LA 5CM8B 1LV7A 2Q50A 4QBKA 2WHPB 2NV6A 4FX2A 4L57A 3SQMA 3VR5A 4EUEA 1E9CA 1OXTA 1N5OX 3PJEA 1QPBA 3DMFA 2DFTA 5ESRA 1X6VA 2R4UA 1Z5OA 5T6BA 4BBPA 1GXSA 3KBBA 3NKLA 3WGKA 3RW9A 4FE3A 4LWPA 1MO4A 1I2CA 1TQ2A 2OY0A 3MBIA 5T4FA 3K9FC 1F2VA 1E96A 3RBXA 1P4AA 1PJQA 5E6RA 3RUFA 1H0SA 4X92A 2X23A 1E2DA 2DKFA 3EXG2 3HM2A 3I1YA 1YZLA 2XXBA 3L0YA 1LDNA 1N6NA 4FEAA 1E92A 2OHVA 3DNFA 2NACA 3AR9A 3DL2A 2Q0QA 2C0QA 2YJNA 1MO6A 3A1WA 3L0OA 4GI2A 3A9SA 2ZCUA 2VSOA 2O19A 2A9JA 3QKUA 4HEJA 1UJ2A 3VKWA 4R1MA 3OQIB 5IZ4A 4N0MA 3ZY5A 5JWRA 1ZJ5A 1T9CA 1PJ2A 1AKEA 3U80A 3ZQ6A 1AHNA 4AK9A 1BYUA 2WWIA 5HWSA 2QZ9A 1HURA 1M8PA 2V7BA 1XKXA 2GN0A 3IPRA 4GMHA 3QBDA 2OK7A 4AI6A 1PEAA 2RGNA 2NT3A 3W9YA 1DFIA 4DDKA 4DDMA 1DJPA 1ZLXA 1AGNA 4WW0A 4Y0VA 5EP1A 2FW9A 2JK0A 3B8EA 1AUQA 2FU5C 2LE0A 3SICE 1AUOA 4F3RA 4JKIA 1XDBA 4F9TA 5B7QA 1R16A 4H4CA 2YZKA 1PJ3A 2HU8A 1RWXA 3ZNQA 1DRVA 2AXEA 3ECAA 3ZHOA 1ENPA 4BMSA 3HUTA 3HNOA 4RXTA 1EXMA 1TO2E 4RHFA 1PT9A 4C0LA 3W5DA 3A9VA 3GFVA 4HC4A 3VYTB 2GZ1A 5KNBA 1ZJ6A 5FTMA 1FRQA 3E23A 1D2AA 3QKTA 4IJQA 4FYVA 3WGTA 4BHTA 2C77A 4KXXA 5JR3A 1NN1A 2J4DA 2N75A 2EBUA 2PN1A 5EIEA 4DLLA 2HBZA 2ZE8A 2J3KA 3VSCA 3F6BX 3TZCA 4CM5A 1RM4A 4GBJA 3FMIA 1VCIA 1SJ9A 2OO5A 2R7LA 2GNPA 4F6LA 3RHSA 1S89A 1RC1A 3CGWA 2B82A 4OGLA 2X4LA 1QZUA 5CCEA 5I9SA 1FQWA 3NEAA 1K66A 2Q2WA 2QJOA 4F4JA 4R1SA 3REGA 2Z3VA 1J8YF 3HR8A 3L4BA 2JGDB 1SGWA 2WD7B 1UDRA 4E5KA 1UQUA 3FSJX 2EJUA 3W6ZA 3NHYA 4D6PA 3IP1A 4E22A 2VLIA 4FFLA 4K9MA 4P35A 1YUBA 4DA9A 2Z6QA 4ZDKA 1BWSA 4ZAGA 3I6ZA 4NATA 3CEPB 1GPMA 2OV2A 1P74A 1YTUA 1K7EB 5BOVA 5L7WA 4W5QA 4MQ5A 4WERA 3GP5A 3UZUA 2GR9A 2BT4A 1E6UA 3LS2A 3ADBA 3S7ZA 2UUAB 1IZ8A 2FSGA 3TNFA 3NPMA 3CKMA 4MRMA 1VPEA 1E5VA 2FSUA 1W4AA 2QL9A 5MN4A 3T7TA 1AV6A 4DPKA 5KIAA 1NYTA 1XTVA 3DZIA 3V1NA 3HBFA 2I33A 2PWPA 4GKBA 3K1AA 3DS8A 1V71A 2UVPA 3LP8A 3R3JA 2BR3A 4ESOA 5K0CA 3GT4A 2O05A 1TB4A 1KVSA 2I7TA 3SXUA 4QYIA 5AH0A 3U81A 1R4AA 4WY2A 1JJIA 1XD2A 2R47A 3DE0X 3P9QA 3V48A 2R62A 1RM0A 2OG1A 5HQ3A 4RHUA 3B1WA 3GZ4A 2VZ9A 5HUQA 1N25A 1TUBB 4RY8A 3G23A 3P0IA 4BU0A 2AC7A 2PXCA 3OZFA 3S8EA 1ZJYA 3RWOA 2P2ZA 2XGGA 3PQ5A 3UWSA 4JUDX 4AYXA 4D4IA 3OTWA 4WVLA 3IP7A 3MXOA 1CIVA 2FOXA 4X1IA 1E63A 2WU4A 2Q2QA 1L7NA 2VYVD 5T7BA 1A9XA 1OIWA 3EW7A 2OHXA 4CIXA 2I4MA 1NUPA 5P8WA 2G4VA 4NK4A 1PD0A 1Z36A 4NZYA 2O7SA 4H7JA 4Q7LA 5JW6A 4B3IA 2QNIA 2DSNA 3GFGA 2LXNA 5AOCA 3VSAA 4A5OA 4L4UA 4BQIA 3BB4A 1CR6A 1E9SA 3SC2B 1W5SA 2ZTSA 2JFQA 1F8FA 2RK3A 1ML3A 3T1VA 2VWPA 4I50B 3EG5A 4Q4JB 1PTJC 3M1IA 2CL0X 3RS5A 3VR0A 4ESVA 1BX1A 2ID8A 4W99A 2GT1A 2LZ0A 5EKXA 3RAFC 1E2BA 3EIWA 2BVNA 1WG8A 3RREA 5BYAA 2HBQA 2FZGA 3NFYA 2ZK7A 1MQSA 3DE2X 5LIRA 1C1DB 2REQB 3ZHVA 4D9BA 2JLZA 1EI9A 3L6UA 3WDKA 2Q3JA 1WOYA 2RK4A 3PWZA 1JLLA 3NM6B 1PV1A 1RP7A 3SJBA 1AA6A 3PX7A 4IJMA 2YNMA 2K87A 1WPXA 1YRHA 2JATA 2XMPA 3AQIA 5ER6A 4DLBA 2VTBB 4Q02A 5FX2A 1I9CA 3MFQA 4PG6A 3VH4A 1ABEA 5JT1A 3WK6A 2HCJB 3EVFA 1SZPA 4YMSA 3R7AA 4CEHA 4ZHQF 3I64A 1AH2A 3C6QA 2FPSA 3TJMA 3TMAA 3ID6C 3HA5A 2BKAA 1EXDA 2I1WA 1KJNA 4WLFA 5FA5A 1XD8A 1FU4A 5IS2A 1PZGA 2V3VA 4I9NA 1YJ8A 1D7OA 1XZIA 2W2QA 3K09C 1HSZA 3O6VA 4IIHA 4YCAA 1QE0A 1H2YA 2H54A 4FDMA 3LY5A 4IW3B 2JJ2A 2B99A 1XJCA 1XQ9A 3S1AA 4BGEA 4B3JA 5AIBA 1NXSA 4TV8F 3JVUA 1CR1A 2PKQO 4FZ5A 2A5LA 5TJHA 2PK3A 4KQCA 4RTPA 4KRFA 3BZUA 1U8UA 1EE1A 3AOEA 2W71A 3W5VA 5A7GA 3WIOA 1IZZA 4H15A 5H5JA 2JRLA 2UYCA 2VKTA 4HGOA 1J8QA 3V4PB 1V6SA 4IG9A 2B7LA 2VCEA 2ZIUB 4KO1S 3JRNA 1U04A 2JFHA 4J2HA 1E1KA 2VHVA 2FVXA 4W6ZA 1GQRA 2D0PB 5KZMB 1KI7A 2AXNA 2BMFA 3UQZA 4DS3A 4ZQEA 5CDYA 3VOTA 1P0QA 2OBXA 1H1DA 3OY2A 3W9UA 4EELA 1L5YA 2RH8A 5HF8A 1W29A 2WIFA 1QDEA 4XUCA 5AK5A 3R7FA 4GBED 1IHOA 2HGZA 4P0QB 1SVSA 4Q15A 4DCJA 1Z0SA 2GKGA 2TECE 1XDZA 5IVPA 5BSMA 2GX6A 4BFXA 3E9RA 3HO8A 4UM8B 3ENZA 3AR8A 4D3YA 3A4LA 2B83A 4JP1A 3UMFA 1GO2A 4ZHQA 4GOJA 1NT2A 1Y7TA 2BFMA 4GX1A 5AUPB 1AM4D 4QRDA 4IVQA 4TLDA 3RIEA 5T4HA 3HCNA 2NSDA 4DQXA 3IR6A 2YHIA 4KKVA 1XZDA 1RWKA 3OLVA 4XCQA 1EUCA 5BUZA 5HA5A 1UPCA 2YH2A 2WQ6A 2ZG6A 3EXG1 1DMRA 5B3KA 1KK1A 1UXHA 1U2GC 3D2BA 3KJEA 5AKKA 4UFPA 4RVFA 4J16C 3G2HA 4TQAA 4TV8A 1B4DA 4BS9A 4BVBA 2CBZA 3A28A 4GAEA 4ZTBA 1JKIA 1LBIA 4GL2A 1DQZA 1XZNA 1YE3A 4BFCA 2GEJA 3EZFA 5DWQA 4OLAA 2Z3ZA 3K9LA 3LJKA 1YS1X 1R0RE 3FKSA 3UAXA 1C30B 3GLFB 3OEWA 4NK5A 1FIUA 4Y2XA 1MA3A 4MQ4A 4ZV7A 3ROZA 4AY6A 1EFVB 3UMBA 2NXEA 2P4QA 1Z3CA 4U2GA 2C8KA 2ZPTX 3NTXA 3JWHA 4K9KA 4D2IA 3QPWA 1Q11A 1N8NA 3WY9A 2P4SA 3IMFA 4MR9A 3GRUA 1GDTA 4RPJA 2ST1A 3O94A 1FUYB 1K6XA 3VV2A 3Q3GE 1YFZA 1AG9A 1M6VB 1Y34E 3LU1A 4JLBA 2WV7A 5EVCA 3IP9A 4AY4A 1M5UA 4EB6A 1J4AA 1UPAA 9GPBA 4N9WA 2FETA 1PU2A 5ALRA 1PS9A 2ODPA 3EPLA 1KQ3A 3R3UA 2RC5A 3PFIA 4H3KB 1I33A 1IRXA 4L5JA 3SLGA 4LGVA 1KMNA 3ZVLA 1YS4A 2OSVA 1Z4JA 3KT8A 2HNAA 5E9QA 1PX2A 1GZSA 4JHLA 1A5TA 1CZKA 3GT0A 3PE6A 5ESWA 3KWFA 4OYHA 2GCPA 1CRLA 3VH2A 3KLPX 2ZBEA 2WHYA 1NKSA 1KY5A 3DQZA 3GEHA 1DAPA 1NATA 4KTVE 2WQ7A 3PGLA 3VHRA 3DTNA 2ZYWX 4Y6LA 4G09A 5K01A 1YR8A 2PA3A 1VG9B 2PTGA 5EUCA 1UC9A 2FB9A 2XHZA 4QO8A 4ZYYA 3GDHA 4B80A 3MJSA 3OY7A 1G2PA 1H0HA 2WPNA 4YP9A 4BMNA 3CUWA 2OAGA 4X1KB 5BWOA 2XODA 3G49A 4Q3KA 3RF6A 3FCXA 1QZ3A 1UBHS 2I6XA 3AWIA 1KETA 3HUFA 4KO2S 2B8TA 5JXHA 4U7GA 1VMAA 1M75A 1NIJA 1RC0A 2I7CA 5ITVA 2C2KA 3FNHA 4GX2A 3WQHA 1ODCA 3AILA 1W1WA 1WULS 5AKHA 4PHTA 1JR3D 2IZ7A 3ZIAD 1I7DA 2PKWA 2Q9AA 5HS4A 3UIEA 2Q3BA 2ZRCA 4BAUA 1OX4A 1EFRD 1V7PC 4IILA 2OM2A 2W11A 1H05A 1YZKA 4ZVQA 2ZOSA 2C20A 2I78A 1FFXB 1UM8A 3P9PA 5FJIA 2WAAA 1ZGAA 1JEJA 3GEMA 3MN1A 4JLUA 1IH8A 4RM3A 3UH1A 1G1AA 3ZWPA 2XMCA 3WOVA 3N2EA 1H69A 5HXAA 5LJIA 2H0AA 3L8MA 4WKCA 1Z26A 1GUDA 1MB4A 2ZB4A 1G64A 1LV8A 3VUEA 4KR2A 4XSVA 3PNYA 1LPNA 5FOWA 4AKGA 4XTCS 2O9JA 1ML4A 3HKEA 3CKKA 1PNTA 1F8XA 2FRDA 3IDSA 4KL8S 1EIZA 3K0CA 1A76A 3G89A 2C8VA 4V0KA 1EQAA 1T0UA 4FYPA 2P68A 3STWA 5LBIA 3CNBA 4QAJA 1F9EA 2DLCX 3D7RA 1YVDA 1L4UA 4NNJA 1XMJA 2QW0X 3Q1KA 3ZZUA 4TPKA 5DI9A 2JLWA 2L17A 6Q21A 4GP6A 3WLLA 3ZY6A 1MR3F 4MV1A 2G70A 2IHVA 2CVOA 5TVKA 3SHFA 3KHKA 1JLMA 1VCHA 4OHFA 1I1HA 1K9SA 2BC9A 3JARB 5GGYA 3UK7A 3GP3A 3IT0A 3G9XA 2VK8A 2X4IA 1NZDA 5LMCA 1EFHA 3KYBA 4Q24A 4YJ2F 3PEYA 2ZUBA 4K1LA 2KI5A 4R81A 1CHDA 4QXAA 4AL4A 2R8EA 3KPJA 4H16A 3JD4A 3EYAA 2AOXA 1KR2A 1ZZEA 1XZJA 3BFPA 1JHRA 1QIHA 3OBIA 4EVSA 3AY0A 3IT1A 4QYMA 5EHIA 1IK4A 2XADA 1PJRA 2GILA 4FD2A 4DZZA 4RVOA 3N53A 4RKRA 3ZE0B 1W5AA 4ZAWA 5CH8A 1P91A 1Z12A 2X58A 3H65A 4XOUA 1OI7A 2NU6B 3A31A 1GRVA 1SHLA 4IYJA 3Q9SA 3RYHA 2NO9A 2NPOA 2XIJA 4BMYA 4QT4A 1NXVA 5HJEA 2ZXFA 5TF4A 4FDUA 2DPLA 3UWOA 1X38A 4PVDA 3UKOA 4BMXA 5G1NA 1JFVA 1L4GA 5FUWA 3OQNA 1FMTA 3MINB 1AGPA 1PT8A 1IUPA 1KEEB 2CBGA 5FOSA 4ADSG 1P72A 1YAJA 1WKBA 2AKYA 2I1LA 1DUVG 3MQ2A 5ALGA 3MB5A 2AT1A 1RPJA 3UW1A 1ZKMA 2TMGA 5KO2A 4BNLA 3Q8KA 3ROMA 4HUJA 2SECE 3HKBB 4WACA 4EVRA 3Q6MA 4XFKA 5DBGA 5FLYA 2DQKA 3QNMA 1EIWA 1KZ6A 3ZY4A 2R6FA 5C8DA 4QU5A 1T1EA 3NEPX 1FYVA 4HNSA 2AN4A 5ULLA 3W2HA 2PJDA 2V96A 3HDJA 2J6CA 3PSAA 1SCNE 3PYXA 4FIZA 1Y1LA 3HL4A 3OTQA 3L1UA 4Z3DA 5JVDF 4IXDA 1RQ2A 3P0JA 2HSDA 3ORQA 1NVGA 1IOLA 3D6JA 4YJ2A 3D8UA 1EM8B 1DEKA 1Z6XA 3A6LA 4Q47A 4LYYA 2GPJA 2CNOA 4Y9RA 2V3CC 1N4DA 1CLUA 5DMXA 3HTXA 2HRRA 3EE6A 1TK9A 2OV1A 1CJCA 3WGOA 2PJUA 3PIRA 4U9UA 1KFKB 2HV8A 2OZVA 1DC8A 2FUEA 1IOWA 1P6UA 3DDOA 2QTNA 3I12A 3P0RA 1E6KA 2H7XA 1GPNA 4RZIA 3VKFA 1WB9A 3COWA 5BR1A 2PUFA 1E2NA 1VRVA 3V4FA 4FTWA 1M2VA 2EG5A 2QPOA 4PQEA 4LFBB 1HWYA 4J07A 1NMQA 5FV7A 3P0HA 3RVPA 3UENA 1RACA 3JATB 3VI4B 3ZE2B 5LDHA 1KQFA 1GILA 3CPHA 3LKZA 3C3XA 1O6ZA 1DBSA 3EQ2A 3TKAA 1YC5A 4K9PA 4CV1A 5LM3A 1SVWA 4FFDA 3HI6A 4OP2A 1FF9A 2Y1CA 2Y1LA 1LCIA 4IVPA 3PQFA 3RR2A 3SKYA 3WB9A 1DEXA 1PWYE 3HG7A 3M0EA 4KPGA 5J40A 1HTBA 2Q0SA 4GM1A 4U5XA 1Z2AA 1PO7A 1P2UA 2VJMA 3IILA 1M72A 1HF3A 2B25A 3OFVA 4OQLA 3RH0A 1XQVA 4B7AA 4E07A 221PA 2BE9A 5TB5A 1NPDA 1VI2A 4ZPJA 3CF2A 3W34A 5AHRA 3IGFA 4KVAA 4REOA 4YY3B 2FX2A 1G2IA 1PEKE 4R1LA 3QA3E 3R74A 1O1YA 1X8XA 1NW6A 2D1RA 3VSBA 3ADPA 1KU0A 2Y05A 3LC0A 1DX9A 3KPVA 3F9RA 5D3QA 3CKLA 3W6UA 1B2LA 4YRNA 1F0KA 4FCWA 4FFBA 4JX9A 4OQQA 1H23A 3VYRB 3QEMA 2YZMA 1U1FA 3FE2A 3NHLA 3AVXA 2EWWA 3VR2D 2E4YA 3STVA 3EMVA 4FDLA 2PX8A 4LC0A 4YLEA 5JD6A 5JYDA 3L4KA 4BE4A 2QY6A 3C87A 4G65A 3DVQX 1IONA 4MVJF 3RS9A 1C50A 1IPHA 2QUKA 1R6UA 3X44A 2QKYA 5J59A 4EHNA 3NALA 2YWEA 1MO5A 4MDYA 1Q74A 3BXOA 1MB2A 4N8DA 3HCPA 1GG2A 2HCFA 2XLCA 1L5SA 4R3WA 1GPYA 3LRPA 1PYGA 3M9LA 5ENDA 5F9MA 5IN4A 1C8BA 2GERA 2F1JA 1O95A 3CZMA 9MHTA 3SFZA 3KJNA 2FE1A 1JHQA 2CNBA 1DKOA 1BD3A 1DVRA 1AN9A 5LYJB 3GU3A 3JYQA 1NURA 4NJMB 4IRXA 3P9XA 3NHZA 4B3BA 1R0CA 1EK0A 4ZJZA 2J3IA 1UCFA 3FLBA 1YV9A 4PR3A 2AIRA 4HDSB 5DTIA 3JYOA 3M9WA 4PLGA 3GUHA 4ARVA 5LP6B 3AL0C 2BGTA 1MVNA 3OOHA 1ADCA 1C3JA 4C7OB 2ZBFA 1A7KA 5LD2B 3DCIA 3R1IA 4ND1A 2X2OA 3V1KA 2F48A 3GLHA 2AG8A 2QQ0A 4J76A 2X22A 4Y2QA 1NM5A 4PLZA 5KAMA 1KFCB 2BZ0A 4BNDA 1XRPA 1Z0JA 3CRRA 4LFAB 3IHTA 3WWDA 4WFKA 4K9LA 2PBFA 4EGSA 3DCYA 1VCNA 3EIEA 2ZS7A 3RVRA 5EQJB 4YUYA 2C98A 4OJMX 3N76A 3L92A 4PN3A 4TTSA 5DWDA 3PR1A 4F86A 3W5UA 3TRFA 3EFBA 2QV0A 1M6HA 3VH1A 5B3LA 2BSQA 1ANKA 2X5NA 2ZFUA 2C2GA 2CJYA 2DLNA 1WTCA 4MVJA 3WYDA 1Q17A 1U7UA 2JDID 4TV9B 3EGDB 4F2PA 1IQPA 2HSGA 4JLJA 3UHJA 4HLUC 1DOHA 4UFNA 2XAAA 4S1NA 2V7QA 4RELA 3W1EA 2ZUUA 4LSMA 5DYWA 2FUKA 3ZOKA 1WA5A 4X3CA 4Y0AA 4O63O 3G8BA 2FWBA 3ELUA 2IWRA 5I3CA 1E4EA 1HNNA 4D97A 5JQGF 4MIOA 4D9FA 3FWKA 4GICA 1THTA 2XUDA 3ZBPA 3HSKA 1L1RA 2BRUC 5IAKA 3HGQA 1NUUA 4NE9A 3GEDA 2H57A 3I05A 3B48A 1WSAA 2HJVA 4JP8A 2VOEA 1FBNA 1QVAA 1PL0A 2GZRA 2FEOA 4JI8B 3FMPB 3CE9A 4RK0A 6LDHA 3TTTA 2EQ5A 3CISA 1DKRA 4V24A 1XPOA 3OOJA 5AKLA 1WXFA 2HDNB 5TXGA 3LCCA 1QO7A 3EF3A 4GKKB 2XOKD 1J39A 3QX7A 1QHNA 3DYBA 4PNPA 2JLSA 5KWIA 2O2JA 1KXJA 2ZU6A 3RT1A 1U0EA 2AEEA 2ATXA 2OAEA 3FOCA 2ZSEA 3OQ6A 3EIXA 4TSRA 1ILWA 4Z2YA 3VZCA 4OGKA 3Q5GA 3IELA 4JL5A 2XWJI 2H2AA 3G2NA 3O4HA 1XTJA 2AC2A 1NY6A 1J70A 1XTIA 4LYGA 1NASA 1Q1ZA 2COKA 5B58T 1L1FA 4C78A 1UL1X 4DNPA 5JMOA 1SQFA 2V6IA 3DMDA 5TPZD 1PZEA 4XWOA 1N2CE 2PT9A 3QLTA 4Q6WA 1FP4A 3RPEA 3V7YA 1VA4A 1WCXA 2BBSA 3CLTC 2YBDA 3AC0A 1QG6A 2HJ9A 1LU9A 2PUWA 3LYUA 1AQ6A 3UMSA 3QBEA 3D2LA 3MWEB 5DISB 2ONJA 3RC2A 4M6WB 5JAIA 2ASVA 2WJHA 5KYTA 1E2GA 2PANA 3B36A 1YJBA 2C3UA 3LVBA 3KFLA 4KE8A 4MARA 4JXXA 2A1UB 1MDBA 3IDZA 2XT0A 5CLHA 2IHNA 3LYHA 5FBWB 1II0A 2I34A 4G8CA 1EU1A 4PC1A 4AX8A 3UMVA 4CQMB 1OX5A 3ONNA 4DR5B 3KAKA 3QHPA 2NZUG 3HUEA 1CB7A 3GZTB 1SC6A 4H7FA 4YX9A 4ZAYA 2WSLA 5A9SB 1ECFA 1L4HA 1CIJA 5D00A 5E2BA 4X60A 3PQEA 5DWVA 3THOA 3O47A 4BJHB 2PBRA 3UT5B 1NMSA 1N7IA 4QUKA 3PVSA 5BYKA 3K9GA 3N0XA 2BKXA 1VC2A 4QOSA 4QDZA 5T5QA 3X0DA 4BVAA 2IH5A 3GUYA 2CLMB 4IZHA 2VHTA 1P7ZA 1T6NA 1V5FA 4LZWA 4ZO6A 1FVXA 3VR4D 4R8KA 4UUMA 1L4BA 2VEOA 3PFGA 3T7RA 3NDBB 4JROA 4YT8A 4G56A 1GU7A 1NL3A 5IW8A 3LUHA 1DJOA 1VHTA 2GK4A 3FNEA 1HBJA 1HE1C 3T7IA 1IFXA 3HXMA 1QS0B 3TEFA 2SCUA 1OH6A 1K6IA 3HP1A 5EMLA 5A62A 2JLRA 1Y3FE 2BGLA 4RE5A 4AS2A 1ZZGA 2QLMA 2Q27A 4LWOA 2LGJA 2QGZA 5TS2A 2DXIA 4W8OA 1JYSA 1RIIA 1M2OA 4TUYA 1WIWA 3ZHUA 1WMDA 4R8RA 1I7QB 4YRIA 1DJNA 1EXVA 3KQLA 4M0DA 3C1TA 1SRRA 2RH9B 3CLTD 1IZYA 2LKDA 1SCKA 2HM7A 4H6XA 3TQSA 5DX8A 3E3AA 5ERXA 3HBLA 1XKTA 4GSLA 1PQPA 3DULA 3RO7A 5EEHA 4HAWA 4IFBA 4O4LA 1DGQA 1LBSA 1ZEJA 4GG1A 4OUDB 6GPBA 5ICSA 2O8FB 3OP1A 2OFXA 2GCEA 4HLNA 2QMQA 5CYGA 2FKNA 2ZBQA 3RVLA 4JI0B 4DR3B 3KLMX 4HV4A 4C7XA 2VYVA 3T3NA 4CMIA 4L4SA 3S2UA 4BCCA 3X1DA 3MPOA 1OJ7A 5JV5A 1VM6A 2DHCA 1UR5A 2BTQB 4E88A 2Z4TA 3SYMA 3UHAA 4I4NA 3WIDA 3T5TA 3DMRA 3TW6A 5HILA 3EH2A 4UMFA 4DV4B 2EJVA 1U3VA 1Y4UA 3M49A 5FLKA 5KVQA 3ADDA 3D4NA 3L7OA 5HPYB 4IAOA 5HTOA 2HJGA 4XA8A 3GEBA 1ZGHA 2ZSKA 3BEDA 5I47A 2GPBA 1MBZA 2PZMA 4G4JA 1G9SA 1ICEA 1X9HA 2J48A 2P67A 2CVPA 4S1OA 4WKGA 3SBOA 3KOMA 2FVYA 2AYYA 4LE1A 2RBEA 1A8SA 1J9GA 2ZIGA 1V0JA 2W2KA 3OA0A 4KX5A 3IJRA 3V1LA 2ZI4A 1M2KA 1WLSA 3X1WA 4CTOA 1TJNA 4MWSA 1CZRA 2CXQA 2FPMA 3HFSA 4K2AA 3S2EA 1AQUA 2V6JA 4ZO8A 5JBNA 2AJDA 2XUJA 4TLEA 3HN6A 3IAM1 3QE0A 4R0MA 2YN0A 1OLSB 1JEYB 4K6GA 2BH9A 3NDIA 4OL0A 4GLLA 3CRW1 2RDMA 3VR5H 2GARA 1ZNZA 3B70A 4BEWA 5B55A 2DP4E 2IYAA 5E7JA 3PC4A 3GGOA 1YVRA 4FN5A 1LDBA 3NT2A 2VBGA 4B3MB 4BKOA 2VHZA 3M5PA 2Q4BA 4RW0A 3H2BA 3T4XA 5EJFA 3QG5A 3WTCA 5IWCA 3LOQA 1KI8A 1ZRHA 1O58A 5FPTA 2I8LA 2ZSIA 3D2CA 2PQ6A 4F11A 5JH7A 2BFCA 4PFKA 1NBOA 3C5WP 3GVPA 3HZRA 1MX9A 1J0AA 1TVEA 2IF0A 4QOHA 1C2YA 4OHRA 1FU7A 4G0ZA 3E4CA 3I6MA 2WILA 3DM5A 3PDJA 1ID1A 4D6XA 1OXXK 2YXBA 4HDKA 3RYFB 4PSDA 4MHTA 2YX1A 3CCFA 4HAXA 2IT1A 1RZRD 4ARZA 2NV0A 1GOTA 2P40A 3F7OA 4LAFA 3FYSA 1C3LA 4ZZ3A 4X93A 3DC2A 2W22A 4OI2A 1W4RA 1XCJA 4WCFC 5GAJA 3LRTA 1VL2A 3NQ41 1XMSA 4I4TB 1E2FA 3ROEA 5I51A 3KZ1E 1E8DA 3BQ9A 3CT4A 2X5XA 1VPLA 3L7IA 2XJ9A 4JELA 2IZOA 1T34A 4TLLB 1XXLA 3S0JA 4D57A 4UU8A 1PT7A 4WNAB 4E1BA 3B12A 1CYDA 4RH3A 2W42A 1SKYB 1TEVA 3LUFA 2NU8A 1ZD2P 3BEOA 4WN3A 4PZDA 1DFHA 1Q84A 3M3PA 3PPXA 5JCXA 4ONEA 3DZ8A 3W79A 1RNLA 3OU6A 5KNBH 1Q83A 1N0IA 1E6CA 2XDQB 2MYNA 2HCBA 4MWCA 4Q3NA 1KE1A 3SQNA 3K32A 1FJHA 4HOYA 3WKEA 4HFNA 1RD4A 2GEKA 4BGIA 5L4NA 1N5JA 2HJRA 1KY3A 3IL2A 1ZQ1A 3L7NA 1Y4DE 2DTEA 1ULSA 2BISA 3R3YA 2HYIC 2TMDA 2ZPAA 1SO8A 1I2DA 5G1OA 5IMBA 4IVRA 3K09A 2OYRA 1HYGA 2B0JA 5EHZA 1DKMA 2I1VB 1R0ZA 2WHEA 3NBFA 4JJZA 4ARAA 3UAOA 3A04A 4UCQA 1SXHA 1K7YA 2LBPA 5LC1A 1Y7PA 4BRZA 4Y6RA 3QFHA 3ZCQA 2CY0A 1NF2A 4RK5A 3VC7A 4Q7MB 2FN7A 2J9FA 4HQOA 2I3AA 3FJOA 1ULBA 5H4GA 4Q4HA 2RJNA 1K75A 1FVHA 1LPPA 4PS1A 4IDEA 1JJAA 1QDUA 3ZI0A 2ZBPA 2P6MA 3IQEA 2I99A 4MOWA 1KQPA 5BYBA 4FW9A 1RVV1 1E8NA 2ZUSA 3DBHA 1JSZA 1IAVA 2KPOA 2YIMA 4HPXB 1G5FA 4J0FA 1W76A 5C31A 1TADA 1JFLA 1GGKA 4J3JA 4X3OA 3ITDA 3A0RB 2X1LA 4M1KA 3KKLA 2QVXX 5ECGC 1JQ5A 1E3WB 4M54A 5BYJA 2IU6A 3T3EA 3AGQA 1JL3A 5A5DA 3PDCA 4LWZA 4RTNA 1CY7A 1FP2A 1ZMBA 4FMCB 4MUNA 5CLQA 4A4DA 4B6EA 3THWB 3DLCA 4RCZA 3TLGA 3WYFA 1VIDA 4PX2A 3R9XA 4TN1A 1C81A 1U4OA 5E6UA 3A8TA 1QB7A 2E49A 4US2R 4KNVA 5G53C 2PG3A 1R6AA 3JXEA 1YGPA 4DQVA 3VKGA 1EBFA 1G5RA 3NDPA 2AYXA 3MS4A 5JNUA 1NP6A 3DL0A 1X0VA 5BNFA 4H0FA 4EDHA 4NZ9A 2L2QA 4N6NA 1QVWA 4UTVA 5LQMA 1L5VA 3EJWA 3GT7A 3KVRA 3DBLA 3LT2A 1NX6A 1IY9A 4OGFA 4DSUA 1UXJA 4EG5A 3WAJA 3VZBA 2OWEA 4DABA 3BF8A 4NQZA 1JDPA 4KE6A 4D74A 5CGZA 4B73A 3D6MA 4OATA 3WZLA 1NMEA 4ZOAA 1MX5A 2Q4OA 1RLJA 4URVR 2EX4A 1FDRA 5J43A 5A03A 2LD4A 1QX3A 4GSKA 1U2GA 16PKA 3WBKA 2VPZA 1O4WA 3B6JA 4J16A 4JBIA 4UUQA 4KLAA 4F4UA 1XQ1A 2EBWA 3NTRA 1YE8A 3RYTC 5KSOA 5DLDA 2ZYHA 2Y6UA 3I9LA 5YASA 4JVOA 5DGHA 2DHEA 1JR3A 3ZIAA 3B1KA 3VX3A 1XOIA 2QMUA 3EMBA 3L02A 1TEXA 1KEVA 4EPVA 3FTEA 4CPDA 1QIEA 1S0UA 4TL7A 1EFRA 2HDHA 5DGDA 4FLEA 1ARZA 2VPYA 1AE1A 4J4BA 4BLRA 1LBHA 2X9LA 2IEBA 3MJFA 3RUAA 4BV2A 2GZ2A 4I4IA 4KQGA 3FWNA 4PAQA 1VXRA 1HDYA 3BMNA 4NMWA 2LTAA 5DLYA 2P4EA 4F8JA 1MJGM 5IXJA 5F12A 2COEA 3A9RA 1SHKA 2C31A 2EYUA 2W9XA 3IKMB 5D1NA 1D2RA 4C9BA 4UD6A 4ESHA 3TQRA 4EECA 1UMCA 3ERCA 3R4CA 4F45A 1F2DA 2H2HA 3F2VA 3K8ZA 3Q9UA 3TVTA 1O6FA 2ANBA 2Z58A 3NWEA 3TNLA 5B30A 5ABPA 3GJ0A 2WFLA 3V80A 3ZHYA 2PQMA 3ELYA 3L8GA 1TCAA 2HZBA 3KVOA 3AVTA 3FTPA 3VO2A 1W35A 2C1EA 3OHSX 2CE7A 3U1TA 5KTMA 2PYZA 2AKEA 2HPAA 2HQOA 3ONVA 4X3PA 4ZAXA 1Y6ZA 4GKAA 4NG5A 1NW3A 5ERGB 3WICA 4B4KA 1H1LB 4IIJF 2X0EA 3F6CA 1RPAA 5AW7A 2VZLA 3A6HA 2GCOA 3H5NA 3UUWA 1Y89A 2O50A 1Q1GA 5DNUA 4DPMA 2GTIA 2O14A 4K1XA 2B6HA 3QK7A 4JR1A 4H18A 1YC2A 3GWZA 3IBCA 5SY4A 5G41A 4R2WA 3A2KA 4P7BA 1RWMA 3MWYW 5BNIA 4LISA 4OQEA 5CMLA 1SBCA 3T7SA 1D2MA 1QHSA 4GQIA 1Y8RB 4WSOA 1U6IA 2NUPA 3GDFA 1EUZA 3QE4A 3EQ6A 3WFIA 1Q0ZA 3OZAA 4EARA 4EB8A 1ZI9A 2Z98A 3HXPA 2C7OA 3Q0TA 5ALKA 1BHJA 3HFJA 5LPNA 5DYTA 2Q28A 1GR1A 3T5PA 4LZZA 1Q0UA 4FGSA 3OUUA 4R8LA 5DDIP 4MYTA 4BP1A 2NX2A 2YY6A 2PJZA 2B3TA 2VNHA 3M82A 3QHAA 5LZ4A 2XKKA 1SOAA 3K0FB 2IH2A 4I8XA 2AMFA 1L7PA 2ZATA 3SS9X 2BKVA 4QUJA 3DOEA 1GYRA 4CKYA 3AR2A 2AK2A 3KR0A 1L3IA 3Q72A 4NBNA 1N4AA 5HCNA 3ER8A 1O0SA 4Q1CA 4UTZA 1YB6A 1R00A 3EZLA 4FSHA 5GQSA 3WDMA 4B6PA 4ZO4A 3VC2A 2QZPA 3AHGA 2DG2A 4C3OB 2XE8A 3UV7A 2PA0A 4BLTA 2L19A 2QAJA 3E2IA 2Q5HA 2H1SA 1UFQA 2DTDA 4UBJA 3HUDA 5CH5A 5JIBA 2FDXA 3ET4A 4XUEA 2GFIA 4GIBA 2CMFA 4B87A 1D2NA 5LQAA 3OHMA 4TMWA 4GKJB 4QXOA 1A4RA 1G5QA 5JTTA 1L7MA 4MWZA 4Q5IA 3I01M 4PZPA 1WMSA 2JA2A 5J1TB 1WBDA 2O6HA 2VAVA 2IZZA 4DA8A 2I65A 1ZIYA 4QYXA 3GAZA 5FNVA 1DCKA 3VPXA 1DAGA 1N2SA 4I5DA 3SPXA 4L4YA 3TTVA 2Q4EA 3ITEA 1R4NA 2FR0A 1T5TA 4E5VA 3O7MA 4F6RB 2C9OA 1K88A 3AU9A 4Q9AA 3W0LB 4OD0A 2C2ZA 4HH3C 1S4MA 1TA4A 3N6XA 3NB0A 1E0JA 4UAGA 4RGYA 1P39A 2AFVA 2PMWB 2KM1A 3OP4A 4OLFA 3BWEA 1Z4QA 2D4HA 1HRKA 4WZBB 5L7YA 1G7SA 1FCJA 2WEKA 2BGNA 3NOVA 3PLRA 3SZUA 4O8CA 4DSNA 2NSYA 4RADA 5IM5A 3VTFA 4MVJP 4TMYA 3LPCA 3S2SA 1XTRA 5AVVA 4LF7B 2ILVA 2QUZA 3HUUA 1EESA 2P1RA 1GSIA 4A8JB 1TVCA 2BSAA 2N1MA 4DA4A 4IHJB 1KGSA 1M2NA 1Y9DA 4MYRA 2I6QA 2MMGA 1T8PA 3O8NA 1H2HA 4PWYA 4LBVA 3COSA 3OTGA 2MSWA 4BB6A 2Q3MA 3VFDA 2NTEA 3UXMA 4D7AA 3KK0A 4J1QA 3C7DB 1IEVA 4G5SA 4KR9A 3VKVA 3LBFA 2WIBA 2HIHA 3LQ4A 1V1RA 4LI0A 4RA6B 1SHJA 1H8ED 1PGJA 1PDOA 2B1GA 1U7PA 3D4PA 3UMGA 3SMVA 2O57A 3EGXA 1FNBA 2LIPA 2HWYA 4ZCMA 3A6KA 4N6OA 4KI0A 2EL7A 5TR9A 1W8DA 4R5MA 4C7MA 3NT5A 2E21A 1ESDA 1VSTA 3JX9A 4MDHA 3CNQS 2E87A 2VC2B 2O7NA 4TZ6A 2FDRA 3UOWA 1RLMA 2GD1O 3BCHA 1G21A 2H1OA 2QPAA 3TAUA 1AS2A 4B4VA 4QQRA 4AUEA 2GPNA 3AEQB 4E5SA 2ONYA 4K03A 1X80B 1N0UA 1O03A 1AXRA 1Q15A 1V25A 1P77A 1ICIA 2E48A 3VR2A 5JCZA 2XWBF 1J97A 1ZU5A 3IBFA 3ME5A 3MTQA 4YIKA 3KLBA 2Q5IA 1YR6A 4RPCA 1H2EA 2GXUA 2YN4A 3DMGA 4L16A 5CVJA 5KKNB 4WZAB 2WD8A 2FPWA 4NENB 4YMGA 1Z8DA 3BDAA 3CX4A 3FPSA 3OJOA 1WCYA 2FQQA 4GPIB 4IDAA 3TK1A 3TUIC 1TYBE 3KOWA 3PKJA 1EDBA 2HHCA 3KQKA 3IB6A 3FNIA 3H9JA 4PGMA 2A7XA 4A0SA 1ZVKA 4MR8A 5CCDA 4DRXB 3IQFA 1EWTA 3QVWA 3ZGYA 4CN8A 4OHKA 3I9JA 3LUKA 5F1OA 3T7AA 2GSDA 2RHLA 3N2GB 4RD3A 2YVKA 4CCAA 3JTMA 1GQSA 1OW3B 1U5BA 4G0YA 3IQIX 2AJ8A 1WVGA 3TSWA 1PFUA 1C4KA 1UDBA 1PDVA 1ZUNA 2IOFA 2ZR9A 3DPUA 3JQPA 1ZL0A 5FL7D 1JBKA 3QPCA 1QVVA 2WAMA 1AS3A 3A4NA 3GG9A 4XX0A 3VNAA 2YXNA 3K9CA 5FQNA 1J6UA 2R60A 2HOQA 1AUPA 1OBFO 1ACLA 2GA9A 2ZM5A 5LQUA 2XYRA 3FCEA 5GZ6A 1BD4A 3TXYA 5CNJA 1YULA 4FDTA 1XZMA 1R3UA 2VK2A 5K51A 2O20A 3EDOA 1VMDA 4TZKA 1Z18A 4G81A 2C4KA 3KWMA 1Z37A 2ZXEA 1S7CA 4Q4AA 2VDNB 3QU2A 2GM3A 2G63A 3LX8A 3Q11A 4HQKA 2QAGB 3PQ7A 3VHXA 1E0SA 1XN4A 2BP7A 2Q8QA 4HF7A 4AO7A 1PJBA 2OZEA 3T7DA 2JDIA 1AMNA 4J0GA 2GAAA 2ZIZA 3OZDA 4UBKA 3ZHXA 4AQ7A 3K8OE 3ZGLA 5CXQA 1PVOA 1DHTA 3WGVA 2BGIA 2DY1A 3EVCA 4AWBA 3DWFA 3ILYA 4J2TA 1XAHA 4CQJA 3RFFA 1AK9A 1PSDA 1XRMA 2OHOA 1A4IA 2PGLA 4BTEA 3MS7A 3GD7A 3IH5A 5B58C 5KJEA 1NZJA 2GOYA 1O96A 2BMVA 2HMAA 2PEYA 3B7PA 2YV5A 4ZVVA 3FLMA 3QBJA 5J5AA 1DRKA 1OWNA 5HCUA 2RHTA 3TFWA 1GTG1 4KLNA 3O3MB 4TRNA 4AG5A 4E33A 1NFFA 4FCVA 2ZUVA 5NLLA 2ZWVA 3JSXA 5AVTA 3GGPA 3ANXA 2BD0A 3NOXA 3AYZB 5F98A 2HRDA 1V7ZA 4X9XA 4G4IA 4ABTA 3ZYZA 1WEKA 4K3UA 1REQB 2AZXA 5BWLA 4OFXA 2X9QA 2AQIA 2WAYA 4HGZA 4M7WA 4NHOA 3WRXC 5CIQA 2FJ0A 1D2GA 3AFNA 4KXVA 1ABBA 2VN8A 1SVNA 2AUNA 3GFPA 2ZSFA 3OD5A 2PFGA 1THGA 2JPDA 4BAZA 4EYOA 2VNJA 2XOKA 5A3SA 5BSGA 2BKUA 5HR5A 4PLTA 4WXPA 5B3JC 3NTVA 1G7CA 1NJ2A 5LZ7A 2AQKA 1JXAA 2C2OA 3JRWA 4TVBA 3PUXA 2J3QA 3LE8A 3JQ6A 4UBIA 3BUSA 4LTNA 4C7JA 1TCBA 3FBGA 3HABA 4LXHA 4ON9A 3RRZA 1OLUB 4I5FA 4RD2A 5DM60 5CEJA 3GJ4A 2N1BA 1XZAA 1DDGA 3RFCA 2LIVA 3LCVB 1PQUA 5IDYA 1GCUA 1JQKA 2B4YA 2QQEA 5TPZA 2OORC 1KAMA 2FR8C 2GFHA 2XI4A 3MOGA 3ICQB 2UYGA 3LDAA 3TLCA 2VNIA 3IESA 5C8YA 4PYLA 1ND5A 1Z63A 2FCRA 4Y9DA 4FUQA 2UZ1B 3TQOA 1FP6A 2OSBA 1UEJA 2GYYA 4HLUA 2YFKA 3D8BA 3UPUA 4FMDF 1ZM3A 4GOOD 4EJSC 3AKYA 4GBMA 4ZZ1A 1Q5PA 1Z4OA 4IQ4A 3UCFA 3ZE1B 2JIZD 3N05A 5CB6A 1AD2A 5KHOC 1NYQA 1SY7A 2O5RA 4HZUA 2BRUA 4HBZA 4N3NA 2YR0A 5A1TA 4COKA 5HEKA 1HDXA 1G16A 5ALTA 2X77A 5JSKA 1E66A 1RWPA 2EL9A 2VTEA 3D3QA 5HDQA 1U3UA 1HUQA 3HA7A 3G6KA 2IDMA 4MO2A 4YJ3B 1OT5A 5JSYA 4EFKA 5JALA 1JH9A 4GRDA 1AU9A 3LZ6A 5C35A 4N48A 3V8VA 1PN3A 4JXZA 1WP9A 3TZEA 1WQ3A 3PTZA 3QEBZ 2E2WA 4YRMA 5U4QA 3VR4A 3U4AA 1CUAA 2V0CA 4POAA 3O4GA 1I5EA 3PUJA 1WOMA 4PLHA 3I9V6 3WNVA 4CQLB 5J2UA 4L3WA 1PWEA 4LBZA 1XRQA 3UAYA 6NULA 3E22A 4MK4A 4LJKA 5HIMA 4FHDA 2FMUA 1HZZC 3FPCA 4CODB 5ADUS 5AVOA 1T8RA 5DP1A 5FUVA 1OJLA 1L5RA 5HZHA 2R6DA 3UN1A 2VSYA 2H2IA 1N6RA 3MSCA 1QOPB 2A9RA 4NAUA 3EASA 3H11B 3NC1C 5KOHB 2N46A 4OO3A 4QTZA 3SZMA 4ENUA 5IJ9B 1Q1NA 2CJPA 1RQRA 4UCXA 1OGYA 3EXFA 5K8LA 2HH9A 4IR7A 4ZT4A 4M76B 1QU2A 5JFOA 3WQRA 1NVDA 4HHEA 5C18A 2B8NA 5DYYA 1E7QA 3TRDA 1BWQA 3W6NA 3BE8A 3LPDA 4OQFA 4I1PA 1I6KA 2GEUA 1IVNA 3CIFA 3E4DA 1VLMA 3KTDA 3QBTA 4GXNA 3RUPA 4KAAA 1G3RA 3A1TA 3MFYA 3NYRA 4L73A 3EXHB 4LQLA 1SXJC 2AFHA 2VYCA 3DKRA 5AOBA 4DYVA 1PNVA 2PX5A 1W2HA 4WXRA 1X2BA 4F5YA 4CT0A 4LF8B 1FBTA 2IODA 3TAXA 2QRLA 3VXKA 2C04A 2BHRA 2VR1A 4CLHA 5K3EA 4AN1A 3NBMA 3W4KA 2QL5A 4TYNA 1SIWA 3IR7A 4TS3A 3TLAA 2CFSA 4GWKA 4P3YA 2BFDA 3BGOS 4H17A 1V47A 4FHZA 4CI0B 4CMIB 5JYBA 1LTHR 1T35A 4ALKA 3T9CA 2BSXA 1NUTA 3RNOA 1XNGA 2FHSA 5LXTB 1FMFA 1MF7A 4LK2A 2P8JA 2XD9A 4BVEA 2C7PA 2EG9A 4ZMBA 1DJMA 2GN2A 4G41A 1R0SA 3PC3A 2RGGA 4FYIA 1QGED 4X61A 3B6KA 3RQSA 1CP2A 4QTTB 2FGJA 3TGWA 3SQOA 4QA9A 6YASA 3ZK9A 1XJWA 4ZEVA 3ZHZA 4U7WA 4UHKA 1ZWLA 2O8CA 3O2JA 1DSSG 3CUYA 4NC9A 3QXJA 2VRBA 1DBPA 4UU1A 5C46F 5JJBA 1JU9A 4AJEA 2O7RA 3GLQA 3WLAA 5AJZA 4EHAA 4MVJH 3WVNA 1GTMA 1XRNA 2IXDA 1WU8A 2PX6A 1R0KA 3HYRA 3OE7D 3EVEA 3T5MA 1IY0A 3S2GA 4L74A 1DTWA 3RSCA 1H5UA 3I2HA 3F7MA 4DIKA 1N9KA 3PQ3A 4D4GA 5D84A 3ABRB 3S6JA 5LLDA 1IXYA 3JZFA 1TKRA 2D0OB 3C24A 3GNSA 3L82B 3DWIA 4C6SA 4HKTA 1SPXA 4PZEA 2PRIA 1MG5A 5DCWA 1XTUA 5BVGA 1QQ6A 3QTBA 2H1RA 1S3FA 4MI3A 4QUIA 4IGKA 3OZ7A 2GNAA 1AF4A 4WLVA 1Y1RA 2FMXA 3F49S 3V97A 2F55A 4EENA 2HL6A 3K6JA 4L4RA 4UAVA 3AG6A 5GY7A 3UNXA 2WJ4A 4Y9UA 1YZVA 3FNGA 3AV3A 1ABFA 2JFUA 4QLBA 2NU9A 2GHIA 5HFAA 3K6SB 3LUBA 3QF4B 5ICMA 4HP8A 4OREX 1T36B 1GKLA 5AJTA 4CG0A 1Z6YA 2B35A 3C85A 3F0TA 1N5DA 3F98A 4Q03A 5I7OA 1QQ5A 2ECFA 4JI2B 5E2IA 1FDSA 5CUQA 3QJ5A 2H31A 3H9QA 2X42A 1XYGA 4BNHA 3AEUA 5JATA 3ESBA 2W37A 4YBRA 5DI3A 1E9DA 1JKJA 3KPWA 4NMLA 4OAQA 3P8ZA 3JQ9C 4XPIA 5LYYA 3S68A 3HN7A 1J8MF 1V1MB 1ZPDA 3EB9A 5D3MB 4AB1A 4PGAA 5DNYB 5JCOC 5C7LO 4WNCA 3FJ1A 3WS7A 2FJUA 4W7HA 4ZK2A 1GG8A 3GUVA 3D5EA 4I4LA 3BE5A 3ZNOA 4HH0A 4JITA 4RV9A 1RZRA 4PS0A 1L4NA 2CHVA 1GZHB 3FTDA 3UMJA 5BV0A 1ZESA 3QELA 5ALUA 3KKMA 4DANA 4EHFA 5KDDA 1Y4AE 2G76A 4MQEB 4X1YA 5H83A 1PBTA 1ZI8A 3F71A 3N8IA 4H1HA 3PCRB 4KR3A 4CKEA 4DLAA 3N6RA 4ZHSA 3ZHCA 3T9EA 3F47A 4DEYA 1SCUB 3KEOA 1L4KA 1TT7A 3JRXA 3F9IA 2RAVA 1U1IA 2FW0A 4MVCA 1ZAYA 2QTVA 1Z8HA 4G5GA 2LKCA 4V0OA 3IT2A 3BWBA 5FBVB 3V00A 2PGDA 2VT6A 2F3TA 3WV5A 1RLOA 3I0MA 3P2MA 4ZVMA 1YZYA 4EHKA 4ZZ0A 4YJKA 3T3IA 4R0NA 2F90A 4K26A 5DTEA 2NTYC 1T0IA 2P7HA 4BYGA 1XVVA 1HLFA 2FXVA 4OTZA 1KQGA 3EQZA 1EVQA 1IULA 3MOSA 4GZLA 2E5FA 4UQOA 2FPGA 4YDHB 1ZIXA 3SBEA 2HXYA 3ZWOA 3HR7A 1EFAA 1D4AA 3R6TA 4JLOA 4JZKA 4P8RA 2F3SA 3MELA 3BSWA 2OFPA 3U7RA 4AUKA 1BE1A 4HWGA 2QROA 3R2JA 4ER3A 3IUYA 3HADA 4WECA 4BVKA 3RSHA 2A5JA 3B2QA 5AQEA 1W93A 2XVAA 2WOOA 1X1DA 1TAGA 3K72B 1EXWA 1MW9X 3CWQA 4NU6A 1B8UA 2AH5A 4I6JA 5G0UA 2IS1A 4YRQA 4Q9LA 1QKKA 2OFWA 4A26A 3UJPA 4P81A 4PICA 1JG3A 3RVMA 3QPUA 3DDHA 5BSUA 5AKXA 4GLBA 4MQLA 3MRTA 3RASA 4PHGA 3TRJA 2BLLA 4LQ4A 3EARA 1PAUA 3LCUA 3CY6A 3K96A 3QXGA 1K92A 2HA7A 2R6AA 1C29B 1WHTB 1KI4A 5CGQB 4ACAA 1Z4IA 5JS1A 1V9CA 3TQHA 3LQYA 2NMVA 1DBWA 4C30A 3Q7PA 5BV2P 4K46A 4ND4A 1J2RA 1QHGA 2E4UA 2C0CA 4WCFA 4X71A 4XWKA 4HDRA 4GYJA 3A6EA 5FPKA 1BCSB 4TL6A 2V59A 2VK1A 3FGNA 3GHYA 3RRXA 2P0YA 3B5IA 2YYYA 3HJRA 1KDRA 2FAXA 4D9KA 2E5LB 4BZXA 3D0KA 3UB4A 1NV9A 2O3RA 3PCXA 2GXQA 4KACA 3ZZMA 1IOZA 3EJ6A 2WYHA 5DM1A 1K97A 1UP7A 4GDMA 3RFXA 5KYNA 1C7ZA 3AR4A 4UZSA 1A7JA 4CETA 1A8QA 4AECA 3AVWA 2QL6A 4DV0B 3ICEA 4EA7A 2V7XA 3LT0A 2CYAA 3N8NA 2BGUA 3I2JA 4P54A 1WWKA 3ZDCA 2IF2A 1ST2A 4O4IA 3L5OA 3QVVA 4H7KA 2Q9UA 3HPRA 4OQNA 2EKBA 2YVQA 1YCGA 5ENZA 1RHUA 2E4XA 1KJYA 2GEBA 4MRNA 1JTVA 3FGPA 2DETA 3LPNA 1GV1A 1NW8A 3KYCB 4PF1A 2ZR0A 5JAZA 1WCIB 1JVSA 1MV8A 4D3DA 1YKGA 4P3PA 2HFJA 4HB4A 4O5OA 4DQKA 4DQUA 2QT9A 3WJ2A 2AQHA 3I4FA 4MUKA 2R48A 2NPIA 4TSFD 5C7OO 5K6AA 1KYZA 2CD9A 3ZH2A 3ML1A 2QW8A 2HBRA 2W8ZA 1W1IA 4MRRA 3LDFA 4AXBA 1ULZA 4D4LA 1NI4A 3ORFA 1W47A 4NDZA 1GQYA 5AKZA 1GQ2A 2XYQA 1P3Y1 4RIHA 1E4YA 4IO0A 1DJQA 3HZHA 2PZFA 3V1UA 2AGVA 2ZVPX 3O3OB 4R31A 4RORA 3K9QO 4DGQA 3L2OB 5F7XA 2B34A 4Y1FA 5KQGA 3BIOA 1QHHA 4HWRA 3PT5A 3Q3CA 4EF6A 3GEEA 1AKYA 2PSHA 1ZU4A 2QVZX 2VHYA 3RTGA 2KE5A 2CJWB 1L8LA 1NPTO 2IXGA 2QUHA 4D46A 1XF9A 4DSAA 3G3EA 1D03A 1IB6A 4S0ZA 1NUHA 1I2AA 4N01A 4EK9A 4RJKA 3PXUA 1FYFA 3RC8A 1J2YA 4MJLA 2QTLA 4F4CA 3FYHA 3VI3B 2WM3A 3G7UA 4BASA 4UUAA 4RJJA 5M34A 4L8VA 4YDSA 5EJ2A 2R00C 1YQDA 4G26A 3GMDA 1FUKA 3HKDB 1L8XA 2C9BA 1JPUA 1H1TA 4OUKX 4OI0A 1OIXA 5FFNA 1YDWA 1RABA 5AW1A 3K70D 1D3AA 1YA8A 3R3WA 5JI3E 4EITA 1OVMA 2J33A 4PRZA 2ZDGA 1JEQA 2FPIA 1WUTA 3Q15C 4HBGA 4IMJB 5IP5A 4C21A 1M8FA 3I2GA 4PSCA 4HX9A 3M6WA 3TYXA 1VCMA 1VDZA 5REQA 1MTOA 3G7SA 2EVWX 3GZNB 1TD9A 4IP0A 4HFMA 1R27A 3C6ZA 4ZVOA 4U8GA 3R7SA 4WDRA 1AK1A 4EJFA 2R0QC 3R6WA 4H1UA 1DOZA 1U7OA 2JFZA 3OLQA 4G0VA 4AZ0A 4P5PA 1UT6A 2YFYA 4FHEA 1E3JA 2RI6A 4M36A 5CA0B 1GNVA 4NU5A 3OC0A 2WF5A 1ZW6A 1FXUA 4FC7A 1DT5A 4CV3A 1CQPA 2CZCA 2IZ6A 4F6CA 1N7HA 5B6IA 5WRFA 2POCA 4L9SA 1E1RD 1YQEA 3BS4A 4JYBA 2G5CA 2JJYA 5K0JA 2ID7A 1G20E 3QA9A 3HEMA 2ORWA 3SYLA 3QXHA 1MCZA 4WOPA 3MRVA 1JA9A 2RIRA 4JVNA 3S44A 4GRIA 3DC7A 3WBFA 4DTCA 3GN1A 3HVUA 2UZAA 4MAAA 2Q7DA 3RI3A 2CEAA 4YCJA 5D1HA 4Y1RB 5T3YA 1R64A 3A6JA 3GLTA 3CINA 2P2CA 1NQ5A 4QYTA 1EXNA 2DY0A 2GBLC 2J0UA 4PPNA 3EWNA 5BSWA 1KH1A 3LM8A 1S2GA 3MGBA 2PUGA 4FEGA 3CFYA 4AROA 1P45A 4XJSA 1DG3A 2QTWB 3HXKA 2IUUA 3JQRA 4RL6A 2CLHB 4AZSA 5FI5A 4EKEA 4WK4B 1U2PA 4WV3A 1RRKA 3RC9A 1FUUA 1V6CA 1E9FA 4J75A 5HCIA 3T3GA 1WTAA 1YBHA 2GUWA 4DLNA 4YRZA 4HNHA 2HK6A 2OVFA 1GCAA 3KAPA 3TDKA 4LN1A 4XDGA 4XQEA 4P9NA 4C0JA 5HZMA 2XDYA 3E27A 5DASA 4NFHA 1PG2A 2J6HA 3O8OA 2ILTA 1K27A 3DPSA 4QUEA 4CNBA 1THMA 1II8A 3GJ3A 3AFMA 4WLOA 2MDTA 2CLOB 2DPGA 1SKMA 5F78A 4KP7A 5KC9A 1WRBA 5ISMA 3GPDG 3KJQA 1YJ5A 5CB4F 4HGRA 3BMOB 3PR2B 5FUQA 2H7VA 8LDHA 3FMFA 1UBUS 2WYOA 2DVMA 4DMRA 3T0IA 1KY2A 4N7MA 4UEOA 1NW7A 1XZBA 4I9UA 3H0EA 3CW8X 3JQDA 4G5YA 5AW8A 3NETA 3GLVA 4PZZA 1W44A 4X7MA 3M4ZA 1H8EA 1JZTA 2WSBA 1WDMA 3NZEA 2FRVA 1I4TD 2RE8A 3DXZA 4YXFA 1EP3B 2AN3A 1W6UA 4GOXA 4FE7A 4PE5B 5AYVA 1XN1A 4ZICA 3Q7EA 2Q2NA 1QSGA 3BK7A 4RCVA 1T9DA 4UMEA 3K2IA 1MO2A 3MQ4A 5JXWA 5KQSA 1W6RA 2LV8A 2XV1A 1RIFA 2YOFA 1BE6A 3LDUA 3M6MD 3L46A 4K9OA 2YC4C 3L8ZA 5DNWA 3QUQA 1XU7A 2JKZA 4LMAA 2HLPA 5BQFA 4MGIR 3MNFA 3EZNA 1A9YA 4JT9A 4UM7A 4RK6A 4HNVA 3U7QA 4S04A 1T4CB 2QLNA 4FNOA 3OPYA 4BJ5A 1AF7A 4MGYR 4CF5A 2VHJA 2ET6A 1JYEA 1NUAA 3SYRA 4EMBA 3KCQA 1LSOA 1H5NA 3P4UA 1G5PA 1HTWA 3GA7A 3VJRA 3H8WA 5ALLA 5AR1A 3FOBA 4RETA 2XW6A 1M34B 3NC4A 3TLEA 421PA 2H7CA 1XVIA 1A8UA 3IOCA 5JSZB 1ZR2A 2PUDA 4TL9A 2ZAYA 4LK3A 3SIWA 3FD8A 1B8PA 1CJBA 3GJSA 1B7GO 4ZXPA 3HXQA 3ZDBA 1GQOA 4ZVSA 4AG3A 1E1QA 3RUCA 5KTPA 1JX6A 4CG1A 1XXHB 5FL7A 5DLEA 1OXBB 3IV7A 3MAGA 4JNKA 5G4KA 5LJLA 2WHQA 3G6WA 3TWOA 1AMOA 2WAOA 3ZBTA 3DAFA 1NFQA 2G09A 5KPDA 4WUVA 1QF9A 1UKAA 1X7XA 2R6R1 1VL0A 2V7WA 3OOYA 4V0NA 1XP8A 1U0NA 1LTKA 4YAIA 1ECBA 4DT1B 1O0BA 4AY2A 1F38A 1HYQA 1C4XA 3ZKWB 1Z07A 1RRGA 4NCKA 1MX1A 2YMQA 4P7FA 4Q1VA 4RMGA 5E7QA 5H7XA 1AMUA 4KQFA 3FCYA 1KMHA 1TM4E 4RQTA 3TOZA 2WNSA 3LLMA 3KTAB 3UXYA 3DOJA 2FW8A 4GSYA 1RBZA 2V4UA 1UBLS 2YINC 5IJWA 4EW3A 4PG4A 4YECA 2YV2A 3R4VA 1S7GA 2LW7A 3MJEA 4LDAA 1DCTA 1FFAA 4IOLA 3WLTA 1U0LA 2H5JA 4BB0A 4CEIB 1J0CA 3IRVA 5ICCA 2O7VA 1LGYA 2BIFA 1VZ2A 2RBGA 2IE0A 3C1UA 4G84A 1MNAA 2JHPA 2ZSHA 1RCUA 3JQAB 1G6KA 3PJFA 4Q00A 1T5SA 4A0QA 3G2MA 4HWOA 4RTJA 3TSOA 5K6RA 2OV3A 2WFZA 4HATA 2EIXA 4P22A 5K3CA 1QK4A 2VI5A 3H3XA 3MJCA 3FPJA 1FFYA 1FQJA 1U3FA 2O0MA 4QAQA 4EMTA 2O23A 2CZQA 4RK4A 5DYIA 3GP8A 1H93A 3O75A 1AXGA 1Z6PA 4IWNA 4MUGA 2IPOA 2Q49A 4ACBA 2P9QA 2JFOA 1KPIA 3WR5A 4D99A 1CFJA 4LJ6A 1MT3A 3AIKA 1ZC4A 2AZMA 3D3WA 4EX7A 1WVIA 4CTNA 5M5BA 1XQ6A 4DILA 5EHNA 4F8YA 3MD0A 3M4NA 1VPVA 1GITA 1OY1A 4LYEA 4TLCA 4YRFA 4MDFA 1CVIA 1SHUX 2L0XA 2LRHA 3G59A 3RK1A 4ARSA 3FDIA 1WUKS 3HA3A 3TKLA 1I80A 5DO9A 3QFCA 3WLKX 4EY7A 3V2UA 1YOVB 5JNVA 3DD5A 3WKBA 3B1JA 3H42B 3T3MB 1JBEA 4YDRA 2XHEA 4RWZA 1NJSA 1DFGA 1L7RA 4M9ZA 1WMFA 1DIOB 4NJEA 4MI1A 3NC0C 4TWAA 2VDWA 4I3GA 5IANA 4IZIA 2HWXA 3NH9A 5TE9A 5A3JA 1TMKA 3LPAA 3P0FA 4HN9A 5DYNA 4BNZA 4J2OA 2PL3A 1N1EA 5UKDA 4CIYA 2GXSA 4X8OA 3K16A 5DXAA 3C48A 4GR9A 1Z5UA 1QWOA 1EK1A 2UYHA 1TT5B 3D59A 1PZMA 4LDNA 5A04A 4W4TA 3Q87B 1BHQ1 4XVRA 2AFHE 3KUCA 1RHQA 1E3QA 2VHXA 3CPJB 4EG3A 3WLMA 1E2IA 2QP9X 3B9BA 1Q7EA 2JFFA 2TMKA 2ZRNA 4CTJA 4IZ6A 4L0DA 3U4MA 1IN6A 4PGHA 5A2QA 2VHUA 3AEYA 1JYFA 3VDXA 4CMCA 1UUFA 2FW6A 1GGEA 2JIZA 3O2QB 3C97A 4ZA2A 4X65B 1ACJA 4FKBA 3COJA 1HL7A 4BLUA 3R0XA 5K0SA 1PCXA 5IM4F 1FDWA 3KHTA 1GXSB 3KT0A 4ZTZB 4OU4A 3IBGA 2IU4A 4CM4B 4AKTA 5AT1A 1HEUA 3PC6A 1AZWA 1TJ4A 2F9MA 5E6RB 5T8KC 5KWSA 2IOHA 4RTSA 3P32A 1UZNA 3WO0A 4OB7A 1Q0HA 1SB8A 2RKWA 5G0SA 4BO1A 3W5CA 1B15A 1DI0A 1TPZA 3WRXA 3DMHA 3OMXA 3EY9A 1PNRA 3CVOA 4I81A 2VDKB 1W25A 2W5UA 1C7QA 5B1DA 3WB0A 1CZHA 4U7DA 4S3MA 3MT9A 2OQIA 3G1UA 3K0EA 3PGVA 4D0NA 4B9AA 2Y92A 3PYMA 3WA6A 3ZWKA 5A1JA 2YBEA 2O8VA 3DD1A 3GGDA 1C3OB 4LA4A 5B3JA 5BN4B 3AERA 3REQB 4E5MA 1Y7HA 5GVSA 2Z2JA 3KB1A 2KS6A 2QRZA 4YALA 1X7DA 4G0UA 3KEFA 2HIGA 2VO1A 1E4OA 1RBMA 1R7RA 1MAUA 3BFXA 4X7BA 1PK7A 1GR0A 5I8ZA 1Y3AA 2CLEB 2UYOA 3UYKA 2NUAB 4ZI7F 1RYMA 2VKQA 1FLNA 4YRLA 4ZI2A 2OORA 4EKNB 1CU1A 1XROA 2FLVA 1VYVA 2FR8A 2Y77A 5FTJA 2ZIXB 2PPLA 5HKLA 3T3HA 4EB3A 1QP7A 4FYKA 3ER6A 3ZU4A 1JQJC 2EZTA 3I6BA 3D7LA 1LBTA 4AX4A 1RXIA 1FXWF 4MHOA 4ZN6A 3GA5A 4CLRB 1N2JA 1P0FA 3Q3EA 2I8CA 3CVWA 1W94A 3LMKA 5IM4A 3ABIA 3HBMA 4G5FA 3KQNA 3ANYB 1CPYA 3TSZA 2XQJA 4EJSA 5CDFE 1YR7A 1R4ZA 5ICGA 2E7ZA 3TPZA 3UKJA 2ONKA 1DAFA 1UZLA 1FP7A 3CLHA 1T3TA 1EFLA 4ZCLA 3WYGA 3BKXA 2P69A 5CXUA 4FM9A 1EFPA 2GKOA 3PQCA 1BOOA 3TQIA 1N8TA 4TTJA 1NXPA 5KYWB 2BHNA 1LQUA 3AVUA 2RARA 3LP5A 1RMQA 2EFYA 4PU0A 4TWBA 2W6MA 4QC2A 5ALJA 5FR1A 3ZD6A 1GFSA 5TGTA 1E8MA 3DT6A 5DX0A 2R9VA 1KJ8A 4QDUA 4B7ZA 5E7MA 4CF6A 2J5KA 4R1OA 3FCAA 3DWGA 3NXKA 3K05A 1ZD3A 4OAPA 4QU8A 4UVIA 1A5AB 1WMEA 2QPTA 4U02A 5KI6A 4FZ3A 3DZJA 3DONA 3TDMA 2ENWA 5TQJA 1OYWA 5DSZA 2PZJA 1I01A 3BXZA 1VSQA 2QDXA 5TQ2B 1HOXA 5P21A 4C1BA 1DZIA 2HA5A 3JQBC 1A2BA 3CZPA 3NHUA 5HE8A 4RQBA 1E5TA 3P5SA 4C08A 2XZPA 4BLSA 4MRMB 4YDQA 2NZ2A 3CM0A 4P4LA 4XR9A 3NNDA 1G4AE 4YFYA 1SRQA 1CFZA 3H4IA 5AW0A 1CEQA 1GARA 1T26A 2PX2A 3LQRA 3OE7A 1H3NA 1RI3A 4MINA 4XFDA 5F3RA 3SMQA 3K1AB 5I7EA 2WT9A 2UVPB 1PK9A 3TIXB 4TRJA 4KRXA 4W9RA 4R9NA 1C5KA 3IUMA 4YAJA 3K20A 5JJIA 4NARA 3V8PA 1O77A 1P7YA 1U5AA 4M99A 4QYIB 1FXWA 2W6ID 3NS7A 1XD2B 2WUFA 2AS0A 4LRUA 3GI1A 3UT6A 4EH1A 4PAWA 4HL6A 4C03A 2QP4A 3D64A 3HR4A 4BFZA 4EVQA 3VC3A 1LI5A 3HHPA 4ARCA 1M6EX 2PMCA 2FSSA 2HU7A 5K8IA 1Z33A 1QP8A 2D0IA 4XR4A 1SXJA 4RCYA 2YXDA 3PFCA 3EUAA 3R6LA 4IKOA 1PFVA 4O2LA 1NJFA 2FJPA 4AJNA 1JRLA 5I9IA 1THZA 3T3PB 2SICE 4WBNF 3GQBA 2XRFA 3DDUA 1NSTA 1ZIDA 3X2SA 4E5DA 1E7RA 4DXDA 3MS2A 4FB4A 3X1ZA 4NWIA 2RH5A 1QIFA 2HRQA 4HGPA 2FZVA 3CEMA 4MXDA 3WX0A 5KNLA 5BSRA 4P82A 2BI8A 1OV4A 1VBFA 3QP9A 2XWQA 3JASA 3K35A 2ANCA 4UNSA 1NDUA 2ZW9A 5LQKA 1HQYE 2WFMA 1U8CB 1XEXA 1C9DB 2OECA 4P6VF 3T7CA 5GJBA 2Y3IA 3D6VA 4O2AA 5GADl 1J2UA 3EUEA 4ZARA 3RRMA 3L05A 4HDNB 1NVTA 3HYTA 6ADHA 3ITNA 4PG8A 3HY6A 2PUHA 3TRKA 5HUHA 1ODJA 1JDNA 1OXUA 2XH8A 2H06A 3BIFA 3TNJA 3KJFA 2OILA 1UEIA 5HVNA 1JLLB 5LFAA 3BIWA 2PVCA 3HDYA 3MSXA 1UIMA 3MW8A 3V6LA 2NVOA 5MF6A 2ZIFA 1WEHA 2JBWA 4IQ8A 4KUHA 1G19A 1RYDA 2Y67A 4YJFA 3I32A 5D6OA 4BNTA 3ET5A 1FLAA 1OI4A 3EPKA 2RBKA 3L6EA 2P9EA 2DAPA 1G8SA 4BJ1A 3DZFA 4BKPA 2QLFA 3ILSA 4GX0A 5C1DA 5AFSA 2E4VA 4JEHA 5KTRA 1CLEA 1CQIB 1N1DA 4LKOA 4HEA6 4NICA 2IWHA 4DZTA 1PR3A 4KLRA 3OUTA 4I5GA 4J6FA 4MYCA 3TW8B 4WBNA 5DM70 3OEYA 3OMLA 2A0YA 1QPGA 4O6VA 1OOEA 3MIIA 1OAKA 1F6BA 2Q8NA 2O0HA 1LRLA 2DLDA 1P1CA 3ISJA 3MTBA 4AN4A 3QVUA 4F8EA 4XWYA 1G0OA 1H2XA 2Z2YA 3T1OA 3ANSA 3NYQA 2WWFA 5AKJA 4C4AA 1Z25A 1EZZA 1QYCA 1XALA 3HWX1 4V0RA 2DPYA 4B2IA 1NR1A 3OECA 3DFMA 2I2WA 3WZMA 1RHJA 1UK8A 1RAGA 3A1EA 3UAVA 3AR5A 3VR4H 1N2BA 2VJQA 4FHGA 4AY5A 2X8JA 2JARA 1GJRA 1E6EA 3OQOA 3JQ9A 2B69A 2HRBA 2V5UA 1L3CA 1UZUA 2XKJE 4QOEA 3DT8A 5JCOA 4FFPA 2IYXA 3MRXA 5FEUA 4ZC1A 1SG0A 3H2JA 3OZEA 3TINA 1P2SA 3HNPA 4C4OA 3CH7A 1H6DA 2IIBA 4YJHA 2GBCA 4RHXA 2DKOA 2OXRA 3WGZA 1YB7A 2PLWA 2L82A 4B3HA 3P45A 2OCYC 2XZDA 4OKSA 3AUAA 4OKIA 1BRMA 2QM0A 1TE2A 4OBBA 4LDPA 5FA6A 1UQRA 4M87A 5CA0F 4IDOA 4EWLA 2AOUB 1N6LA 4MPJA 1DC7A 4ZHQB 3SF0A 1LB1B 2F43A 1CZOA 2XIQA 4RF4A 4D4MA 2OBNA 4P7KA 1D4FA 1ESZA 2KSQA 3PZRA 4DN6A 2CKMA 2JIDA 1ZJZA 1SBQA 1D1TA 2YHIB 4KPFC 3U0BA 1NJ6A 2W0SA 4PYQA 3G17A 3NASA 1VE3A 4DJ5X 1QFZA 2GZ3A 1IEWA 1Z7BA 2ZSJA 5AIAA 5E1MA 4OEHA 2XUAA 4IIFA 4TV8B 2JL1A 5EPEA 5C1OA 1N78A 1KZGB 3IEVA 4AP5A 3EWAA 2OL4A 3I2KA 1N2EA 3I1IA 1OXMA 1Q3HA 3OZVA 4M4SA 3OPMA 4MWOA 1YAHA 1SOWA 3FVTA 4FVTA 4X00A 4NBVA 4PC2A 1RYEA 1B0ZA 2VF4X 5IRCD 1C3XA 4NBLA 2DWQA 3LX5A 4FGJA 3RKUA 4FOSA 4LZNA 4GX5A 2F59A 3NPAA 4II3A 3LHFA 4UKDA 4LZJA 1N7JA 3ZD9A 3ZCVA 4F1WA 4FN4A 3AY7A 3TVDA 4M7PA 1FXSA 1KS9A 4MR9B 4RFSB 3KJGA 2VVTA 4TSFA 4CIBA 5K4GA 1N9GA 2J3EA 2J87A 2ZRPA 4PZLA 3ZV6A 5K4AA 4JODA 4F91B 3F1LA 3INNA 1FDOA 1DEOA 2FWPA 3PXCX 2D3TA 1Q7RA 3SHQA 3AUXA 3SM9A 1GNPA 1W9MA 2BI7A 3G13A 3JYNA 5HBRA 2VT7A 2Q3FA 4HAOA 1AQNA 5JSFA 4MW4A 3L04A 1LJLA 3TZQA 4CGYA 4ENTA 5JPCA 4Q9KA 2RHOA 4DWJA 1DQSA 3A27A 1LJ8A 5AICA 3B82A 2VSNA 4PQFA 3HXLA 5DM2A 1SXQA 2GQ0A 1D2CA 4HQLA 3I76A 2XB4A 3L8DA 5IAAA 2IOYA 3L8YA 4YBZA 1S8AA 1G5HA 3F4BA 3Q4GA 2P6OA 1H3EA 3V34A 1MJGA 1JI3A 2RGUA 2XNJA 4BQQA 2G1KA 1WBJB 3BJRA 2HAEA 2JFNA 2RJ3A 3USES 1ID8A 1NNSA 3AFOA 3JU3A 2G9UA 2HO5A 3ASUA 2CLFB 1NQXA 2CXNA 2XMQA 5CT4A 5G2OA 5AXCA 2J32A 5DXJA 1N1MA 4ZQIA 1V11A 5JS2A 1JU3A 3WJAA 3ZQKA 3ABQB 1WQ4A 1Z38A 3LT4A 1HQKA 2HA6A 3BXHA 4GXTA 4JWTA 1CUZA 2QPLA 2EWVA 2ZRDA 5CIYA 1SKAA 1T5IA 2YMLA 2QTCA 2ZVDA 1Y48E 3GR6A 3TBFA 3PPWA 1G291 2OAQ1 2ADMA 3BBPA 4OOEA 3GRPA 4WLNA 1HC7A 1NA5A 3H5VA 1N3YA 2GD2A 1B76A 2RC6A 3I6QA 1I7PA