2DG2A

Crystal structure of mouse apolipoprotein a-i binding protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I binding protein
publication title Biochemical and structural characterization of apolipoprotein A-I binding protein, a novel phosphoprotein with a potential role in sperm capacitation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 71
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2dg2A00
3ROXA 3RNOA 3RT9A 3D3KA 3RREA 3RSGA 3RSFA 2AX3A 3RTDA 1JZTA 3RU3A 3RTBA 3ROZA 3RO7A 3RTAA 3D3JA 2DG2A 3RS9A 3RTGA 3RS8A 3RTCA 3ROEA 3RRJA 3RSSA 3RRBA 3RRFA 3RT7A 3RTEA 3RU2A 3ROGA 3K5WA 3RSQA 2O8NA
chains in the Genus database with same CATH superfamily
5ADWA 1ECCA 1UKEA 2OBYA 2OGSA 3TAXA 4N4AA 2HN9A 1PT9A 5KOIA 5CDGA 2WTEA 4UHDA 3EZYA 2H7CA 2X3YA 1TIPA 3NBAA 3K8OE 4UNRA 3OG9A 2ATVA 2ON6A 3TIXB 4Y98A 2PGIA 3CURA 2ZBEA 1SK8A 1ZUNB 3F9RA 4ON9A 2V74B 1DQPA 3J80A 1XU9A 2VTEA 1R6DA 2W93A 3L8YA 2YS6A 3TZBA 4GZLA 4DMCA 4QC2A 3H0EA 4HJRA 4B2YA 1PWXA 1J07A 4MYRA 4NE7A 2MIIA 2PKCA 3IALA 4R51A 3EFEA 2BEVB 3JQBA 4CKCB 2WJIA 3T34A 3ZCTA 2J8ZA 1RLMA 4KLRA 4GR4A 3IIEA 1ENZA 5FD8A 3IQXA 3DV0B 2POQX 3THXB 4MA4A 1NUAA 2QLBA 5D51S 1NM5C 5AUNB 3IV6A 2Q4OA 2GZAA 5CFQA 1L8AA 2DWPA 3I5AA 2R6ZA 4AJ2A 1F48A 2WAAA 1OXTA 3KD2A 3DZHA 4IH9A 3W79A 3ZD9A 3TOSA 2PGJA 3QG1A 1W1IA 4LQCA 1WV0A 3NHAA 3I83A 3TGWA 4WNAB 3DLCA 4C2TA 1NX6A 1OJLA 3UYLA 4KR2A 3H6KA 4DTIA 1UMKA 3R4VA 5BYJA 3PUJA 1ZUWA 3F7TA 1EFTA 1HZJA 2GM3A 1Y37A 2QRGA 3PK0A 4N5HX 3FPKA 5FA6A 5K8JB 2XUFA 5J63A 1YFJA 1FLAA 3H9UA 4C2UA 2FF5A 3O2NA 1V71A 4IIYA 3PKJA 4LF4B 4YMHA 3PUZA 4TYNA 1JB1A 1ESMA 1DG1G 2QWXA 4M89A 5D1NA 1V95A 2VS1A 2M6SA 2Q46A 1CHDA 2Z57A 4PLGA 2ZTSA 3C3EA 2YV3A 3SZMA 2PX5A 2XUDA 4O4JF 2D54A 3A1VA 4PG7A 5ALUA 4DARA 3IMKA 1SUPA 2JEYA 2X1VA 2IS6A 2GPTA 3G5TA 2W4QA 4XUEA 1IBKB 3OIYA 1IY8A 1ZD8A 4Z9BA 3B2NA 3WJ1A 5JD4A 3P4XA 2OAP1 2FLWA 4M8LA 1CRPA 3CSUA 2ZJYA 3IDSA 3EWNA 1FX0B 2CVHA 5NULA 4RFVA 4GH5A 1ZNXA 3R3WA 2YMQA 3DNFA 3TLGA 1OH6A 3G8BA 1JFVA 3EWIA 2G1AA 4ZN6A 1CS0B 1S7CA 4L9RA 2WHXA 5E4YA 1BWQA 1RMQA 2HNKA 3EXHA 4Q93A 2XSZD 4WN9B 5FKJA 5K1ZA 2CD9A 3CB4A 1JF8A 4NYJQ 1XE3A 5IEBA 3W9BA 4DPMA 1C7ZA 1F0YA 3F6SA 4OK5A 1QXSA 3DO8A 3KV3O 1Z33A 5EMLA 1VPVA 5IJXA 4WK4B 1A7UA 4J76A 2VJKA 4G09A 3EUWA 2M1XA 2HCRA 4BNLA 2O8CB 2V54A 4CHGA 1JEAA 4WECA 1YE5A 3RU3A 5J2UF 2FETA 3UBMA 3L0YA 2PN1A 3KWLA 2VT3A 3ONFA 2CNOA 3OZAA 2C5BA 4RMJA 5SYNA 3ZEIA 1WR8A 1DCKA 1P4HA 5JDIC 2GETA 3UHJA 3HS3A 3HUEA 2OCYC 4YRMA 2FEMA 3UY4A 4ZGBA 1EG2A 2H1RA 3FOEC 4QDXA 3RC1A 4DBLC 4OHFA 4A6EA 3D4OA 3KOOA 1E8NA 1W5EA 2DF8A 4ACBA 1OXKB 3G0IA 4X97A 2DX7A 3EHDA 4LBZA 2OKGA 1R64A 4OV6B 3ZQKA 3CVOA 3K1ZA 2HA6A 4KQHA 2OK8A 1X39A 1Z74A 1PF7E 4MEBA 1NJ1A 4RF3A 3L3BA 4DJEC 4J0KA 1SCIA 2PMFA 4F1KA 3LPMA 4PLVA 3BE8A 5HQTA 4R5HA 1YR6A 3PTAA 3QUQA 1LSOA 3ODPA 1K97A 3HJGA 4OQNA 3OA0A 1KH1A 2ERYA 3DHYA 1Q1QA 3CCCA 4KXLA 5FEUA 1W8IA 3A1CA 3F1KA 2H65A 2XLBA 1B43A 2QT1A 4A0QA 1M2KA 3IQFA 2IH2A 4LZNA 4GIBA 1EM8B 4LX8A 3P45A 4XGNA 4XSVA 4ZO9A 2OHFA 2OHXA 4YWHA 4C0KA 1Z62A 2X22A 4EVQA 1UZUA 2GKGA 1XWWA 1AGRA 4FEAA 4L4RA 1P73A 1UJCA 3OICA 3W4JA 4G81A 1U04A 4FUTA 2WZBA 4MS1A 1V8ZA 2ZI3A 1Z5WA 4HP8A 3FUTA 4J6EA 3MTEA 4JC4A 3HP4A 3V6MA 4BVHA 3V46A 4S04A 1E62A 1ACJA 2NXEA 2BYTA 1UJMA 4MV6A 4B80A 4CM4B 4I14A 4N5NA 4WZZA 5IK2A 4RZ3A 1FTWA 4EW6A 1SCQA 2ILTA 1IUKA 3ERCA 16PKA 3JQGB 1P2DA 1U8ZA 1AKYA 1REQB 2WUWE 4RPJA 1ZD1A 1ZSVA 5JD5A 2J9YB 3PIIA 4G5SA 2BEUA 2H85A 2NOAA 1ZIXA 3OHPA 4MUNA 5ECYA 3B1YA 1RACA 4X60A 4B8YA 2VK4A 4OJQA 4WSOA 1RYYA 3O3OB 4IFEA 1TPYA 1Q7BA 1QNLA 2G77B 2ZRGA 3F67A 4L6IA 2E85A 2PNFA 4YCMA 2JAQA 3ADPA 3KQUA 2ERXA 2HWYA 4IHJA 3S29A 3BXZA 3LXUX 5K01A 1P0PA 2VNJA 4MR7B 2ORWA 3IV7A 2DXIA 2R66A 2QLTA 3OQJA 3ZLTA 4JLAA 1PD1A 1LEHA 4I7EA 3F6RA 2QM8A 1UBSB 1EUQA 5L40A 2YZ7A 1PQYA 1L9XA 3DM9B 4S2UA 5HRUA 1SBNE 1JA0A 2QN2A 1T5TA 2PQMA 1GUBA 2QLFA 1O87A 1NW7A 1AC5A 3RIMA 3F74A 4J4BA 4N0QA 1JDUA 2WVAA 4NBVA 1HYEA 4ATNA 1YR7A 2VPXA 3NO4A 3IB6A 2RJOA 2NM0A 5ENVA 1YDFA 2ZU0C 1OAAA 2IXFA 3LZCA 4M1ZA 1FP6A 1BHSA 3E8SA 1XQVA 1OT3A 3IAM1 1EGVB 1EHIA 2JFOA 4LRYA 3UT0A 4MH0R 1PZHA 1SQFA 1I1HA 1K86A 1QPBA 1NXVA 1ZC3A 4LXQA 4ZK6A 3LO5A 2DCUA 1X2EA 1M5UA 2ZI5A 4MQFB 2RGWA 4D96A 5KWJA 2B20A 1IHOA 1M2NA 2XCTB 1KH2A 2YJ5A 4HZGA 5HIIA 4CLRB 2HU2A 4YV0A 3PGMA 4B6OA 1JU3A 3JRXA 4R83A 3UG7A 4E5KA 4G5HA 2IH4A 3KSRA 2QRQA 4RH1A 4M9CA 2C7VA 3C4QA 5TC4A 3FMOB 1GNTA 3JQCA 4HLUC 4X7MA 1XA3A 4ZT5A 5FYDA 5LIPA 3GAFA 5E7IA 2IW1A 1CYEA 3LT4A 3AIMA 1DKNA 3BERA 3PC4A 3FWPA 2VDKB 1ABEA 2BP7A 4KQWA 2ZZMA 1PL6A 3EZLA 1U0RA 1D2RA 2GX6A 3CFYA 3K15A 3PV0A 2QPAA 2IYEA 1U5CA 3E9CA 5FOXA 2R11A 3I1JA 4RH3A 1LRKA 1V9LA 2HDWA 2P9TA 1THZA 2JJMA 2Q9AA 4W5RA 2Q5CA 3IBCA 3K1YA 2ZITA 1E7MA 4XX1A 3REOA 4DRZA 1N6KA 1W49A 4LWOA 3U9TA 5BWOA 1AUOA 4PZDA 1S2NA 4WOBA 2AXQA 2XODA 2HU5A 4BUZA 2F67A 3RWOA 4F3RA 1APBA 1ZNYA 4Q7MB 1YASA 4Q9NA 2WU3A 5F3WB 4QX6A 5DVZA 2Q4RA 2ZAOA 3PNLA 8ABPA 1LK7A 4YCBA 5COBA 4MA0A 1EFDN 5TQ2A 4BGVA 2YRFA 4LMRA 1R6BX 1H0RA 4AJJA 5IM4F 5CT6A 4FLFA 4IO1A 3B36A 4NCHA 2Q3DA 4OO3A 2X9NA 2B6NA 1G21E 2YOHA 3FPLA 3ZWVA 3NIBA 2VXBA 1C3LA 2LCQA 1I10A 4PG5A 4OHWA 4Q02A 3K3PA 3FW1A 3NBMA 1BE0A 2OB1A 3DNPA 1T3GA 1AQUA 4LFAB 3AG6A 1TUIA 5CT9A 3IE0A 1KZ1A 2PH7A 3NLLA 2QUZA 4L4ZA 4HZIA 4HKTA 4X6UA 2I2FA 3QFSA 4DCMA 4RK5A 2GN2A 4RESA 1CJTC 4ZI2A 1FTYA 3DKVA 8GPBA 2FVYA 2VTBA 1GM5A 4UBIA 3VI4B 1Y7LA 2VF5X 3K9NA 4GVPA 1L7AA 1H2RS 5ESRA 2DT5A 3ONDA 5INTA 4EHFA 1M0TA 4G0XA 2FR8A 4F2GA 3SN6A 1RI1A 3B3GA 5EJ9A 3VPCA 4DKJA 2FZWA 2HJHA 4HH1A 1K9SA 5KX5B 1JEYB 4R2MA 2ZJ8A 2E1RA 2HRBA 2FSGA 2VAMA 1AXEA 5IJWA 3KKZA 4LE0A 1Z5VA 3Q7RA 4BZZA 1RQNA 1YULA 4Z9XA 1XYGA 3VHXB 1E58A 1U3TA 2RGEA 4KE8A 4JT9A 4FD3A 2A0KA 4IY1A 1JHAA 4RELA 3NTRA 4Q6BA 2AFIA 1IEVA 4RYDA 5FXMA 1O6GA 3FTFA 4EA6A 5J2TA 1MF7A 3RS7A 1THGA 3KQSA 1U11A 3KZVA 3L1KA 3D8BA 3PVSA 4Q0MA 3WDLA 4ENPA 4S05A 4DV3B 4A82A 1JEQA 1VDZA 1VKZA 2OK7A 3I01A 3U7EB 2HNBA 3T9BA 2NU9B 2O4UX 2Q7DA 1HEYA 1Y33E 2I78A 2GH1A 2P2YA 2GHRA 3GIWA 4WAUA 2DFNA 4W1PA 3G02A 2M32A 1UIMA 4OKIA 2GBCA 5FPQA 2V6JA 2Z2YA 3BK7A 3HQ4O 3DSRA 5CVEA 3BMQA 2OCXA 3TMYA 1IRXA 4ZXFA 3MMNA 3T5GA 1GYPA 3BYZA 4JUFA 3WGZA 5JFOA 4KVAA 2QG6A 1IOZA 2DC1A 4O2BA 1D2MA 1XNRB 3DVLA 3I6MA 4GZ3A 3S2ZA 1PQWA 3HEBA 1ZNZA 4KP7A 3S5UA 1KQFA 1N6IA 4KLAA 4BFXA 5FPKA 1YNOA 5DK4A 3AK4A 3T3IA 1BO6A 3WGOA 1OWLA 3NHLA 3TZHA 2TMDA 4B8ZA 5CA1A 4N76A 3GA5A 4HNQA 1HUQA 1RFLA 1W19A 4I81A 1VG1A 1JILA 5F7JA 5D3MB 2Q4TA 5K3BA 1SVUA 3KU4A 1DQSA 2J4FA 2P5YA 4WBNB 1V3UA 3KJQA 1PU2A 2PZJA 4FGWA 4J2TA 5FAXA 3UMJA 4N0MA 4ZCRA 2ATIA 3JWEA 3KJGA 1PO7A 1QWSA 1UZAA 1Q16A 2GK6A 2QMOA 3PC8C 5E7JA 3E7FA 4DEVA 4Q4LA 4W1RA 2WE7A 1NI3A 3QGMA 1L4EA 3VUFA 1CETA 5BVGB 3QNMA 3T5AA 1HT0A 3ZX4A 1QNFA 1QHIA 2CLSA 5AI6A 3PRJA 4RPCA 2J41A 2Q0XA 4UVIA 5IAGA 3N2EA 3NW9A 1LJ8A 3E9NA 3WRXC 4BB5A 4B2LA 5CAEA 4JR1A 1IJEA 2D1FA 1K7XB 3LXXA 5EWLA 1DARA 2WQ7A 1L4GA 1YRBA 2OBXA 3AJRA 4OH7A 1JJAA 4TLLB 4RMNA 2XR1A 3O3MB 1ZN8A 1Q11A 3O5AA 4C6SA 1AHNA 1OHHA 4D3FA 3BSSA 1RWBA 2VF8A 4LUCA 1KJJA 3LY9A 4FOOA 4Y67A 1E3IA 2AFIE 1EWQA 3NBQA 1OD6A 4MRPA 3VSBA 2CV0A 1A8IA 4MZDA 3TJMA 1PZFA 3ZE9A 1MX1A 4IIJB 1ZH6A 3W5SA 2W98A 1JIKA 1MAWA 2CLHB 4AZ3A 2WSYB 1V41E 1H3EA 4I6EA 3I5YA 1E3LA 1CJCA 3LZDA 3NHYA 4G1VA 3OCWA 1ZGBA 4IDCA 2AJTA 2H2AA 2JRLA 3D3KA 3G59A 4QE3A 3ZD8A 1KO7A 4AKEA 3BD8A 3R9WA 1GGFA 5EMMA 4A9AA 4GRIA 1E1RD 2BM1A 4M1SA 1ICIA 4ZI5A 3ZCRA 4F4CA 2J3LA 2X5OA 2ISSD 1L1EA 4YXWA 2XT6A 4W7IA 1JX6A 2JHFA 4BWGA 4QWWA 1IOVA 2OXTA 3WGVA 4FFPA 1KIAA 2VQ3A 3E2MA 1E5LA 1DAIA 3KCNA 1E89A 4MMYB 3GFPA 4XM2A 3MCVA 4OGKA 5G3YA 3TX2A 2WYIA 1PN3A 3TNYA 4U1RA 1ZN7A 3RE1A 3WFZA 1QMPA 2ZQZA 1PUJA 3WYEA 3BPSA 1UBGA 5SY6A 2ATEA 3D2LA 4OEHA 4JR0A 2PBZA 2X4DA 2R8XA 2PL1A 3D31A 2P0YA 2XMQA 2LUOA 4BPBA 5I8WA 4FNOA 4I55B 4NS1A 3VTAA 2QSJA 5FORA 3TPCA 4AS2A 1L7MA 4LAFA 1IB0A 3R3HA 5BN5B 2PZMA 5TMDA 4BQEA 4F86A 5DM0A 4ZCPA 5DHSA 2BGWA 4QKQA 3QJGA 1CEYA 1Z6XA 2Q1TA 2W6MA 4CQMD 3KB6A 4DNQA 2YINC 3ZNQA 1ZKDA 3GUVA 1OFGA 1N3YA 2PK3A 3S70A 3OTQA 3QLUA 4OYYA 3ZH9B 4UZSA 1E3WA 1ZUHA 1SA0A 1GITA 4PYJA 1XZHA 4I1VA 4P3KA 1RXWA 1T2FA 1HE8B 2CYAA 2PL5A 3GYGA 3N2YA 3PI6A 3VU1A 4KK4A 2HHLA 2W58A 4K6FA 4CT0A 1TOAA 3TW0A 3IELA 1DBVO 4BQFA 5LP6B 1JG3A 3OQIB 2A2ZA 4G5YA 4CF6A 3MT8A 4NQZA 1T8TA 3GEEA 1PGNA 1RAFA 4R1UA 2AN5A 4C3VA 5DI9A 4MUKA 5COAA 3EGCA 1HBJA 4H0FA 4ITUA 3LKVA 3L6BA 3O2QB 1ANKA 4INPA 1QRRA 1TA4A 1VCHA 2P1DA 4OL0A 4YIKA 3PJGA 3HPQA 3R3VA 1XXHA 3SZRA 3ZZNA 4NYMR 2WIDA 4HAXA 3UW3A 5C3MA 1GGEA 3QE3A 2DHRA 2WU0A 4B2IA 3KTFA 1WUIS 5ES3A 1BMQA 1C8KA 5JI3E 2P78A 2EWMA 2O2HA 1U31A 3OJEA 5DHAA 1SH7A 2NO6A 3DUFB 1GRRA 2A88A 1IAVA 3WMXA 3F6EX 3GJ5A 1L5LA 5KVAA 1WXQA 3D7LA 1U0BB 1H85A 1Y89A 3L1UA 5K5EA 1U6KA 2VJCA 2C1EA 2C5EA 2EZ8A 3KVNA 3P32A 2A9JA 1QC5B 2WABA 2FR1A 1X7WA 1LDMA 1ZINA 4JLWA 5F1PA 3ZGNA 4BX9A 3B6EA 5GJBA 1XRJA 1SULA 1YA4A 2DM6A 5T8KA 3R2JA 3F3YA 2QE7A 4WK6A 3UJ7A 3HMQA 4DL9A 5LMCA 1C9EA 2G08A 4BO7A 5LOVA 1WNFA 3BBPA 3DC2A 3OPQA 4LNHA 1KAGA 4C3ZA 2RBKA 1NF8A 1YR2A 4CM5A 4CW7A 1RI5A 1CZOA 4I5IA 3DMRA 4ZHQB 4XI9A 5BWMA 4FWTA 1GV1A 2GBIA 1QFZA 5KX5F 1SU7A 1BU5A 2BWJA 3GQBB 3IMCA 5JRDS 1PJ2A 1J8VA 2ECKA 1SUIA 3FFBA 1WDLA 3T5MA 4XYBA 1WSAA 4DUGA 1RPAA 4M99A 2J9RA 5TGDA 3HY4A 2XKKA 4EL5A 1D7OA 2CK3D 1X7YB 3MINA 3PR3A 2YYSA 1H1LA 1GLGA 4E6EA 2DY0A 5DK6A 3TVDA 4E2XA 5AQEA 1SQ0A 1L5MA 3UB3A 1E6WA 1C4WA 1UKCA 4FWBA 4G85A 4P93A 3D2AA 5FWDA 2COEA 4DV5B 2X1MA 5CHEA 2HD4A 2YBDA 1XTJA 3A6DA 4Y7DA 3IDOA 1JHOA 3UPTA 3KSZO 1KEWA 1T6YA 2ODNA 3AUSA 3MAGA 4ZQGA 2JD1A 5CBPB 3I62A 3WKBA 1GGNA 1E9FA 2RH9B 3U3OA 3C14C 2GHTA 2G8LA 1YL6A 5CW2A 2XZTA 4PONA 3DAFA 3F90A 5KPDA 1FRFS 1XTQA 3OE7A 1XZPA 2KJQA 3C3KA 3RJTA 5KAMA 3JYPA 4MV7A 1AURA 4OLFA 4HQ0A 4FSHA 1NJSA 1AQJA 1XXHE 3FI9A 3MLAA 2ZOSA 5AM2A 1EE2A 1NLYA 4HZUA 4Q7KA 2OGTA 3OU7A 3HY6A 2AMYA 3PNKA 4J9VA 1EGAA 4ZFNA 4P4UA 1SQ5A 5P21A 4D80A 2RJ3A 4OXRA 2ZTUA 3DZJA 5FFFA 5LB4A 4ZKDA 4HDMB 2PJUA 3ZHQA 1IB6A 2YICA 5DWVA 4W5TA 1V35A 3HDGA 3QIVA 1NG9A 2GEFA 1J2YA 1VTKA 3DO6A 4ZWNA 4WBNF 1JMKC 5DM60 1F0NA 2GLXA 2LZ0A 4FMPA 2WWVD 3N6VA 2QN7A 3W2GA 3RTDA 2J3EA 4P5PA 5K05A 5AJYA 4GXQA 2B8TA 1GAJA 1LBSA 2KE5A 1EAYA 4WZAA 5JPDA 1SO8A 3AEZA 2MCFA 4EARA 1OKKA 2DSTA 1FLNA 2ZI9A 4E5UA 1PG5A 1LDEA 4PQFA 3DYBA 4FMBB 5IUJC 4ZQBA 2GYUA 3HRIA 2CLEB 1R7RA 1Q50A 2JIQA 5D3ZA 4EQ6A 1MQSA 3EH1A 4XFKA 2FWBA 4HGRA 4HQLA 4D3ZA 5KYVA 2ZIVB 3S2GA 3DUWA 1L5FA 4RKYA 3FKSA 1HLPA 1VMDA 3BJRA 3GPCA 2PZLA 4ZO8A 1XEXB 2FP4A 1Z6AA 3K30A 1KI6B 3L06A 1ND6A 4O59O 4FGLA 4PYMA 3SYMA 4CNQA 1GZ7A 1J2UA 3IIIA 2X9VA 2Z2JA 3DYIA 4GO1A 4OMUA 4RSHA 5E4TA 1VIDA 1RBYA 3O9VA 3PSHA 4E7OA 2GFQA 5IHPA 4IIJF 4J0DA 4X64B 4FEGA 4HYEA 3ZXYA 1BKYA 4UUBA 3B1KA 2DBYA 1XDSA 4IXNA 4REOA 3RVKA 1SELA 1LWNA 1XCPA 1B2RA 4WLOA 1X1BA 2XYHA 1X7DA 3ZY4A 5AUPB 1UAAA 4TT8A 4ZYUA 4ZYLA 4AIRA 1EDZA 1RJ9A 4RQAA 4RIHA 4KV9A 1EZZA 4DMMA 4BP1A 3Q8WA 1NBAA 4Z86A 1I7PA 4JIMA 4PZPA 2YVLA 3TVYA 5K0ZA 2WWIA 3PDIB 2GEKA 3EAQA 4E70A 2XOKA 4HWRA 3WJ2A 1IN8A 4JROA 1LBTA 2ENWA 5DE3A 5F5NA 1MD9A 5L3ZA 5KWIA 2Q6TA 4G41A 1FFWA 4TV9A 3ZXSA 1BXGA 4B4OA 2IYZA 1FSGA 5DJ5A 2VAWA 4HN2A 3OZEA 1R6AA 4C03A 2G9NA 6REQA 5JCZA 2P77A 4HEJA 2WTBA 3SJAA 4ZEWA 1VGRA 2QENA 5LQUA 4D02A 1OFUA 1SVIA 1VG0B 2F90A 2AFHB 4JVNA 4L2IA 4ZVUA 2BELA 1MO6A 4UNSA 1ZBQA 5HYVA 2GA9A 4YJ3B 5AUQA 5JEDA 3QUBA 4I55F 4CF4A 1G20A 1MA3A 2FYTA 3TZQA 3KAKA 4WZAE 1YK0A 2FA9A 4TTAA 4UCWA 2PJZA 3JU3A 4Y2TA 3FF4A 4AZWA 3EPKA 5E4FA 4IAOA 3VR5A 3EY9A 3KR2A 4ZGWA 2QSYA 5K0NA 3V3TA 4MUIA 1T4MA 4HUTA 1TUEA 1QGUA 1TD1A 1H2FA 1Z37A 3HVJA 2HUNA 2ZIEA 4I5DA 1EFPA 4KI7A 5AJUA 3R7WA 4BC1A 4CEHB 3CWCA 2HQBA 3IAUA 1NIPA 5DPMA 4KPEC 4WOPA 3ANXA 3G49A 4Y2VA 1AQIA 4LJYA 5LDHA 2G36A 2IZ5A 4N5DA 3LL4A 1NUSA 2IFTA 1EX9A 3LQRA 3LSYA 1SOUA 3QE0A 1L7BA 2BGKA 4JNCA 3ZY2A 4C4XA 1LUAA 5HVNA 5LP6F 4BVLA 4MAAA 1MC5A 2VJYA 2X0IA 1E79A 2C88A 4MW4A 4Q3BA 3RR2A 4P83A 4MSUA 3SC2A 4F38A 4H3HB 2DFPA 5BMVF 3GLGA 1VI2A 2PMCA 1RBQA 1U0JA 3DBOB 1XTBA 4BDSA 1P77A 4L8YA 4KU4A 3WKCA 2H06A 2XUPA 4D8WA 1L3BA 1JQ3A 1PJAA 5TT1A 4ARZA 1EFVB 3QFHA 5L3QB 2CBZA 3ZU6A 3GP5A 5ALRA 2JFFA 2BL4A 3VYWA 3ROMA 2HA5A 1GA4A 3T7SA 5FT9A 3A28A 2QW8A 3DE1X 2YUIA 3OZ7A 1JLSA 5AXDA 1UPBA 3ZYCA 2DOKA 3QELA 2G9VA 4C6TB 2HYIC 2RC6A 3PD1A 4NYIQ 3SQMA 1ORTA 3RUPA 1A50B 2B21A 1V1MB 4U6QA 1RSZA 3TAHA 3BVPA 1R5JA 4PIVA 1FNSA 1S3SA 2AT1A 4MVJF 3K0FB 4YJ2B 4HY3A 4CKXA 1KWGA 3Q5GA 1XVTA 4RY8A 1UMCA 1R9MA 2O48X 3P9XA 4OQQA 2AR7A 2ZU6A 2FMTA 4BO0A 1QH1A 2YZNA 1TFUA 3CKMA 4KO8A 1WEHA 1KXZA 1BVRA 2C0QA 2VT7A 2B1GA 3M6XA 2WJHA 5D5PA 3NASA 4HRXA 3BG5A 5FDFA 5L8VA 2C4UA 4Q4HA 2CCKA 2P3OA 1QGED 2OPBA 1E3QA 1Q77A 3SM3A 2JH9A 2FEPA 2IPLA 1QR2A 3HKDB 4ZHQF 1T5SA 2Y0EA 3OKCA 1ZOLA 3IV9A 4LG1A 2VQSA 3B3AA 4ALKA 1BDBA 3DFUA 3KVYA 3RS3A 5C8ZA 5FA5A 3IEMA 3A36A 3Q0IA 5CLHA 5H83A 4ZVVA 4MO9A 4XWAA 4HAZA 2OV4A 1BCSB 2GLTA 3PXXA 4UBLA 3GLFB 1IU9A 1R15A 1UADA 1D2EA 2C96A 3A05A 3AB3A 4GPTA 4IPTA 3UNXA 1ZRHA 3W9YA 3WFIA 4COOA 3QZUA 2IOFA 2QZPA 2R8RA 2H5IA 4R2HA 3RW9A 5JPIA 2BISA 2NU6A 4P7JA 2D2EA 4P3XA 5EERA 2P30A 3K70B 1QRAA 3BHIA 3I42A 1KETA 1ML4A 2CDCA 1KZ6A 1XZ8A 1Y8RA 1JEEA 4KFUA 5C37A 5KS2A 2XIJA 3I0MA 4UXJA 1N1MA 4RW0A 3A0RB 4DLUA 4E1BA 1E5VA 3C8HA 2YHIA 1PW5A 3OCUA 2D5LA 3IUNA 4HNVA 3R9IA 2FRVA 3N70A 3M83A 2GZ2A 3QYAA 4ESHA 3BT7A 3ENNA 1TW2A 1JHPA 2CWDA 2CXXA 2PGAA 2VDQB 3OU2A 4PO8A 3LH5A 1KSGA 1Y6FA 1G2PA 3CCFA 3ODGA 2MOKA 3A4VA 2HHAA 1C8LA 3KX2A 4KZPA 3ZE7A 4AJIA 1XK7A 2YX1A 1EUCA 4Z1MA 3EVZA 3NV9A 1G8KA 3HXMA 4QYWA 3P2YA 5D7BA 3FPSA 3FFAA 3HKCB 2FZVA 2A1UB 4J9UE 3OFKA 4QHYA 3USCS 1FYWA 3WFJA 4C21A 4QG3A 3I2HA 5JY1A 2XE7A 3KQLA 4CN9A 4N54A 4B7UA 1QV6A 3I0ZA 4HNTA 1CT9A 1X8JA 2QB5A 3G1TA 3LK7A 1BWRA 4QJ4A 1CQZA 5HF9A 3SX4A 1II9A 3GY0A 1BC5A 1Q21A 3PC7A 3V2HA 1U9IC 2P5UA 4YJGA 1ODKA 2PX8A 2B9VA 5B3JA 2HLDD 1XVAA 2PUWA 3ZDFA 1ACLA 4XOUA 1G2IA 2B35A 2IP2A 4WK2B 4KFCA 1NZFA 4Q05A 4V1CB 5BSRA 2MMGA 3QXHA 2UZIR 1ONSA 3OZIA 1QVZA 2OORA 4MS3A 4AJPA 4NNJA 5H8WA 3ZCUA 3NIWA 3KS9A 2IKSA 2RHMA 2LIVA 2O3RA 4O4HA 3LWZA 2CV2A 1GZHB 5IAJA 3KQPA 2JHPA 3L93A 1NSFA 1YI8A 4YVFA 1WOYA 3IBTA 4C7OA 3JSXA 3PEWA 5HCNA 5DOVA 2Z4SA 3R0VA 4RWZA 4WXYB 3AT1A 4PSCA 3WDKA 1E3TA 2FTKE 1TTQB 2CXRA 1MJFA 3GRAA 1AQLA 3UF0A 2GOYA 2FQQA 3WIVA 4MTLA 1BDMA 4P7BA 3MA0A 1MOZA 2QI9F 1Z25A 5HF5A 1LSSA 2JA2A 3DMFA 2ZWAA 5B1EA 3SVTA 3QXCA 4I2NA 4UE2A 1Y4DE 3HM2A 4A8JC 3JQPA 1VA4A 4LKOA 5CA0A 4RK0A 2GXQA 4OGFA 2UUAB 3NHMA 1MIOB 2B4AA 3IMFA 4CL0A 4I6JA 4OA8A 5JDCA 3E5MA 5BQXA 5JCXA 1I2CA 3KYCB 3HCCA 3C6QA 2GQ0A 3FMGA 4HPJB 4LZAA 4RH0A 2W2NA 1L7OA 4P7GA 2LKCA 3N5CA 2JATA 3PRHA 2YXDA 4BP8A 4QGAA 4W8GA 4XYMA 5AJTA 2G7ZA 2VXYA 1Y8QA 1AK2A 1NW6A 4BJ5A 2AK2A 5DASA 4BCBA 4PC6A 5H9WA 5LSAA 1GU0A 4RIFA 2AUNA 3N2IA 5B64A 4QPNA 1JAZA 4PHHA 3CVVA 1TO6A 1CUXA 2AFRA 5B3AA 2BFBA 5L9AA 1GTG1 4W7HA 5JSZA 3W2IA 3CUUA 4IJVA 3RG8A 1GAQA 5EIHA 3PYLA 5EKDA 4TKUA 1QZXA 4MLZA 5AVOA 4DWWA 3H7IA 1NLFA 1FW8A 2IHYA 3QWBA 3D3WB 2X7HA 3C3MA 7REQB 1VE6A 2J1LA 3NHPA 5M7EA 2AYZA 2PKQP 3IRVA 1F4LA 4JHXA 3VR4A 3PL1A 3MJFA 4BV9A 1NM5A 2VPZA 2UZAA 3DAYA 3AONB 3LLSA 2NO4A 4O4IA 1ORDA 1MU0A 2ZEJA 1YRQA 4DV4B 3SR0A 3R8CA 1H65A 3PUVA 3R5TA 1UJNA 3K0HA 2PWBA 4N7RA 4WE3A 2L18A 1T5OA 3T3HA 5K0SA 4PPNA 4WNIA 5E0KB 2GXAA 1RHMA 1XMXA 3D6NB 1G0NA 1DIAA 3I52A 4ZCLA 5LQAA 6ABPA 1LGYA 4I1UA 1MO2A 1KXJA 1Q5PA 4WESB 1UXKA 1H8HA 5ALEA 3EN0A 3THRA 2W6CX 1XTPA 3QQ5A 4QXMA 1SXQA 3WWCA 4UHJA 4KR0A 2GWRA 3AF1A 5EHQA 2JH8A 5HFAA 2CNWD 1N0VC 1JP7A 3AY6A 1NBEA 5TDHA 4FN5A 5B2EA 3RVSA 4V0RA 5C4GB 3AR2A 3ENZA 3N7TA 3OTWA 4QUEA 2PRKA 2FMXA 1PZEA 2CJWB 5DYWA 1QOQB 1VLMA 1HI9A 4QQFA 4AY6A 4BZQA 3U7RA 2IWHA 5DBHX 3FOBA 4CEJA 2LDBA 3AW8A 3JVIA 4EBBA 4HB3A 4QBTA 1QO9A 3PFBA 3PNBA 4NDNE 4QREA 2Z9DA 1RWVA 3I76A 4H15A 3ZIDA 4RF4A 4ZQCB 3E48A 4YRSA 3MBOA 4OM7A 4DS3A 2WZCA 1PDWA 3W06A 2UYGA 3M1YA 1I2BA 4W63A 1N34B 5HK9A 2ZI6A 1E60A 2E5WA 4LV6A 4BXOA 1U8FO 3FFTA 4R1PA 1L7DA 1DUIA 1PV1A 2Q62A 3A4YA 3TQFA 3VHLB 4D4MA 4R68A 4EUKA 3GJ6A 1CDDA 2LWIA 5BUZA 3NATA 1QIGA 2RHJA 4WL0A 3VU8A 3ZGOA 1N77A 1XZIA 3WGLA 1K4KA 1LC3A 4FOTA 4QHTA 3I45A 4YYZA 1GADO 4X24A 4DMGA 4ZTZB 2Z3WA 5IDQA 3T1TA 1YO6A 2OZKA 3QNUA 4Q7QA 1BW9B 1M2FA 1LLDA 4YP1A 1DOHA 1QYDA 2EJUA 1YC2A 4KI0A 5C53B 3O2JA 3OBBA 5JDIA 2ZBFA 4OI2A 5BSVA 1HRDA 2ZQYA 1YI0A 4DHWA 3P9YA 4B6SA 2A14A 3LUAA 4PCAA 1PG0A 2ZB7A 3QI2A 3H1AA 4JY7A 2ZJZA 2V45A 3WLIA 2HZBA 1FFEA 4F0JA 1JSZA 3BE5A 2LNDA 3ZKAA 2VK2A 4Z3DA 2GVZC 3W9SA 1RWXA 4FDMA 2NUAB 3RQSA 3ZZUA 3N0RA 2NUPB 2B7LA 4D0GA 1NURA 3EF1A 3EOBI 3WHIA 4MUGA 1GQFA 1MAHA 2IJGX 3F6BX 4PYLA 2YWEA 3QMPA 5JJBA 3E3MA 1U1GA 2HV8A 5CDHA 1KL7A 2YUTA 2GF0A 1ADGA 1DEHA 3AZOA 3EVTA 1XLUA 3KL4A 8MHTA 2C20A 4A0RA 5HKKD 3Q5DA 5CLGA 4OB6A 3MYRA 4MCAA 3HYRA 1H0HA 3OLWA 4KPFC 1WZEA 5FOTA 4BKRA 4CGYA 3ZVKA 3L49A 4C4AA 3GJYA 2Z2IA 4N49A 4DQDA 1Q6ZA 2W2KB 2FAXA 4MW6A 2R2AA 3KQOA 4NG4A 1LF0A 3F3MA 4YS6A 4BAUA 1MJGM 4ZPJA 2XSZA 2FPLA 3EWSA 1DQRA 1ZMXA 3HA2A 4E7PA 3H4MA 3KUUA 4JLNA 3AMVA 4GX2A 4MQ4A 1L4HA 2ZS9A 1MZPA 2XTZA 4CV1A 3S1AB 1GRNA 2ZYGA 3KSMA 2JB9A 3IX7A 4PHTA 3TRIA 4B43A 1V3VA 2HDOA 1E3SA 4E4RA 3DBRB 2FFRA 1K3UB 1CEEA 4G8JA 1FU8A 3BSYA 5EXPA 1OTXA 3RT7A 2AUMA 1PJTA 1SIBE 4HD8A 4US0R 2C3PA 4L50A 3ZHSA 1J6UA 1P2SA 3CW2A 4EUFA 2YL2A 1R66A 3DDNA 3FPHA 1BVHA 5HTOA 4YP0A 3T94A 3I04M 5TY0A 2G0AA 1KAHA 2IXDA 3JWPA 3PQFA 1ELOA 1FBNA 4PTYA 4ZQIA 4F5YA 5KAPA 4L7VA 2NXCA 1QFJA 4MO2A 4DDHA 4EELA 4EUSA 5KREA 3H86A 3Q5EA 1GO2A 3ZDRA 4JS0A 2VJNA 4GYWA 4FMCB 4UEOA 1AGNA 1KJ9A 2PDAA 3BK2A 2GK3A 3PFCA 2CV1A 5AI0A 2VF2A 4FZJA 4DBLE 4L3VA 4R71A 2AK3A 1Z0ZA 2WE8A 1Z6PA 3MGKA 4AK9A 2D4HA 1QIEA 1QGAA 4R9RA 2JFYA 2VP3A 2GA8A 4WCVA 4RD0A 1X1EA 1DJNA 3MN1A 4XGQA 4MB2A 3L01A 3SOZA 4YRBA 4HGYA 4NECA 2KSQA 3QF4B 4X93A 1W4BA 1O0SA 4I1RA 5IC6A 5BO5A 4HQFA 2PU7A 3LIIA 5A3QA 2JASA 1QRTA 4Y6PA 1I4DD 3GJ3A 1JLLA 1IXZA 3ZBTA 3OZSA 4J0CA 2JLYA 2V6MA 3RYHA 1L7VC 4KEAA 1UMDA 3Q3VA 1XRLA 3ZWQA 3ESCA 1LV7A 4V0LA 2VSQA 3F4LA 3M6MD 3HCEA 3TMAA 4OBXA 1FP4A 1Q0TA 1HLGA 1EM6A 3QEKA 5EJ5A 4QZVA 3A2KA 3OUTA 4LC0A 4UEKA 4PLZA 4HLUA 3WB1A 2Q50A 2NZ2A 1PR1A 1B16A 2RAFA 3R9KA 3B6KA 4ZCTA 4LHSA 3CUKA 5BRJA 1ZXBA 3AHCA 3O1HB 1JA9A 1DBRA 3SQNA 2ZRKA 3GF4A 3ZXXA 5IBRA 4DAEA 3RSHA 3U3KA 1GNLA 2IHBA 2GYWA 4EENA 2HMVA 4X3CA 2BGLA 4H3VA 3FYTA 4F5DA 5CFRA 3SMVA 3EFHA 2YXEA 1A76A 3S27A 4TKLA 3ZPXA 2VJDA 3H5AA 2HWXA 1GPNA 3AR3A 2YVKA 3II6X 1W25A 1E66A 4RTOA 2PX3A 1FC0A 2V1XA 2GI4A 5AW4A 2R62A 1A4RA 4RK1A 3WNZA 4U6NA 5CJJA 4ZO7A 5HZKA 1G0OA 2F48A 1P1RA 2X4IA 4K81B 5IZ4A 1W44A 3IYLW 3K72B 4O1IA 3N8KA 4I1OA 4KNYA 1V4NA 1M2HA 4X9XA 4PAQA 2NUBA 2WWYA 4R31A 4TVBA 4GKBA 1S2OA 3NUGA 4QELA 5LBIA 3V1TC 1Y3HA 2C2ZA 2FSUA 4QDZA 4RMIA 4BJ1A 4OHKA 2F8LA 5KYNA 1H22A 3L0BA 3A6PC 1LVUA 2ZIGA 2C2BA 2Z1DA 1N6RA 2O52A 2W4IA 3CNHA 3H9JA 3KT0A 4Q1DA 2F4NA 2YY5A 4MWCA 4MNTA 5KQGA 1HMYA 4FKZA 2QL9A 4WXMA 4HDKB 5AP9A 1USIA 3U17A 4P33A 3H6GA 1IATA 1FDOA 1D04A 1OPRA 1SHJA 2CFCA 3WOVA 4UFPA 2ZDHA 5F52A 5JZ9A 1UQTA 1WVIA 3O9ZA 3KDPA 1TF7A 4YRKA 3UC9A 1J8DA 3TS1A 1TUGA 3RFUA 4BLPA 4NU5A 3HCFA 4Q7JB 3TDKA 3L9XA 2F3PA 1SVWA 5DHUA 4ZVPA 3F8TA 1XC7A 2HRQA 3OZTA 3H8WA 4IDGA 2EW2A 2ZWPA 1ECPA 3NYIA 4UD2A 1H05A 4DLBA 4ZVSA 2ODBA 2OECA 2NTNA 2JFXA 4YQFA 3DE4X 3ZJUA 1DADA 1M6VA 3ZC3A 1BX1A 4F2DA 2ZJ0A 3QRWA 3GJQA 1SKYE 1BH6A 1B6SA 3QLEA 3FKJA 3NBYC 2IYWA 1MGOA 4ZANA 3MCUA 3HLTA 3KDAA 2BGIA 4NDZA 4RHCA 4IDFA 1XNHA 1L8LA 3GARA 2PT6A 3IP7A 3T35A 3QYJA 4HUJA 3UVEA 3ZWBA 5G0TA 5E6SA 2JG3A 4YRJA 1T9AA 3F8SA 3GLRA 4WKBA 3SIRA 4GOLD 4JU8A 2ZR8A 4MROA 2DKFA 2AWNA 3COSA 1JA1A 2HIHA 3GGGA 4JOQA 2R7LA 2ZUDA 4ONEA 5BNFA 1K3TA 2SKCA 5EXEA 2Y99A 2ZIXA 5FOVA 3K0BA 5ES4B 5K99A 2XZOA 3DMYA 1AXRA 3PX7A 2RGNC 2EBWA 2ZYHA 3VYUB 3WWPA 1OH7A 4IF4A 2BONA 2HX1A 1CDEA 1S2IA 2ZIUB 1W46A 4LOJA 4MVJD 5HCUA 2O0LA 5DMHA 3T9FA 2OENG 5I9BA 3TSOA 1VMEA 3IQDB 1V8PA 3CRVA 5FNVB 1PR9A 1KEEA 1GRQA 3EZGA 3GAZA 1WJGA 2W2LA 4M3NA 4DVJA 3HN6A 5JW6A 1FLVA 1D9ZA 5EPUA 4EHHA 1F5NA 8AT1A 5A4DA 1RJFA 1BEUB 3CONA 4L02A 2CVOA 3IBYA 3FCOA 2C98A 4UJ5A 3ZG6A 1Q7RA 4KSYA 2TRSB 2AW3A 4LRXA 1U8CB 1GL6A 3AVPA 3UMCA 1BHJA 1GEEA 2FRDC 2DUNA 3G6WA 2AFVA 2X0JA 3DHNA 5KNDD 1VXOA 2DHEA 4UNPA 1ZH4A 2FVXA 1BCRB 3DPIA 3ZI7A 5HKLA 1NF2A 2ONKA 4U8GA 2IUUA 5HIAA 4F5WA 2NXJA 1H2XA 2WINI 5ALDA 4RUKA 2FX3A 3DV2A 4LWPA 3K5HA 5EZSA 3HSSA 2X4LA 3HXLA 1I2AA 5LP6C 3EZ9A 2CKMA 5CB4B 2H2IA 3RHZA 3H13A 3PC8A 4G0ZA 4YLEA 3U3JA 4NC9A 2F4VB 3PHCA 1P0QA 3IIMA 4Z7NB 1ZP6A 3A25A 4RACA 3WQHA 1TF2A 5TNXA 4D44A 1JB9A 4MEAA 1NVDA 4FW9A 4MVWA 1FS5A 4B35A 1C30A 2IHNA 4JJIA 3OEED 3WRXA 3G17A 1J97A 4DRYA 4ALLA 2PBRA 2O3UA 3C8UA 3HZRA 1P2TA 4J43A 2QMEA 3LBAA 2A1IA 4IS2A 3BCRA 5ALFA 4URZR 2ZWOA 1RCUA 3GMDA 2PR7A 2P9ZA 2CMFA 2R25B 2J9XB 3M7IA 3ND9A 5EKTA 3VZDA 1EGQA 4LZPA 1WDKA 1CUEA 1CBUA 1XCJA 2AS0A 2HSWA 2VOEA 2ZPUA 3OCZA 2ADMA 4L0QA 2BJWA 4ZI7B 3T7DA 4AM8A 5EHIA 2PMWB 2PY6A 1TYZA 4DF3A 1EFHA 2G71A 3QVJA 3TLXA 3W5CA 2GTHA 1PFQA 2R86A 4PLPA 4ETMA 3PQ4A 3LP5A 5CX4A 4WWHA 3TOCA 2P2NA 4KAXA 2VBGA 2AMLA 2VH1A 1XK6A 4ZOLB 3SDSA 4Z4IA 2Y6VA 3VNSA 3KR0A 1JG4A 5DGHA 4ZHSA 3KEFA 5AM5A 5I9MA 1PK8A 5A4IS 4UQPA 3QWFA 4H1HA 4ZQEA 2X8WA 3O8QB 1CFZA 2H2WA 1DJLA 3QKSB 4MICA 3STVA 1Z35A 4FFLA 5JZSA 1FDVA 3QYPA 1B1CA 1EGMB 2ZWIA 4FMCF 1VKNA 2JCXA 4X95A 1GL3A 1KH3A 2EFEB 5EL0A 4BMYA 4BRZA 5J4VA 1Z7WA 3HO6A 4DOMA 3GCXA 1CR0A 5B7GA 1LX7A 2V97A 3TW8A 4DY4A 2E48A 2PZKA 3N39C 5YASA 5AO9A 3ED1A 2EG5A 5H70A 4EG0A 3BCSA 2WG0A 5TJHA 1O6FA 2XNHA 3DE7X 2VLBA 1NJ6A 2ID4A 4ND3A 3MHTA 2O8DB 1CZRA 2XUZA 3R44A 2IV7A 1NIJA 1GZUA 3SYKA 1NW8A 4I50B 1NQOA 1Z7GA 1P8AA 2O7RA 3CX8A 4ZIRB 1N36B 2BSQA 3ORRA 5KQRA 4L8VA 1NMZA 3TI9A 2ODPA 1NUTA 4H7IA 1GG8A 2ZYUX 2HLNA 2OV6A 4G5GA 1Z73A 5JSYA 2PKWA 4G63A 4P58A 3UUFA 1XDUA 3OEHD 5EIFA 5BOSB 1YHYA 1N0IA 3EEBA 3WWEA 2DBVO 3B48A 2EGHA 4EM6A 3VDRA 1MR3F 1MC8A 2FY8A 1II8A 4XWYA 5EE0A 2AJ8A 3P9QA 1PUIA 4I08A 5GMOA 4BFYA 4A2CA 1N57A 1FIUA 2OXFA 4MR9A 4XSGA 2BHTA 5CFZA 4AO7A 4NX2A 3HYSA 1EDBA 2JGDA 4DQVA 1C3EA 2IZ0A 3K4PA 2PL3A 1ACMA 3B70A 2VUSA 2EP7A 5D3KA 2WIFA 5B2ZA 5JD3A 4CKBB 4B45A 2KBEA 3EVEA 2YZ2A 4AJ4A 2VJQA 1YZTA 2CE2X 3PT9A 2I91A 2LPMA 2XKJE 2WJJA 5JAUA 4XCQA 3TINA 2GHQA 1MQ8B 3D5QA 5DT9A 3IEVA 1Z38A 2DKNA 1GFIA 2BFFB 3FGOA 4JJEA 2ZRHA 2AOTB 2MYUA 4GOJA 4KACA 2D2IA 1Y9JA 3OMLA 1CUSA 4K26A 1ZVKA 1DRKA 2P6RA 3QOFA 3NUZA 3P0RA 3UHPA 1U4OA 2KI5A 3T5PA 2F8SA 2HA0A 2TS1A 2NU8A 4CLOA 4A5SA 4AX4A 2Q4DA 2P35A 4J1SA 3RQIA 5K51A 1NUPA 3RLIA 1E4VA 1L4FA 5J43A 1AKQA 1E1RA 2X40A 1Z4NA 4RIEA 5IVPA 5M34A 2VVTA 3AOGA 1WLYA 3AKDA 5ALIA 2D1TA 2IZZA 1AH2A 2XCUA 3CBQA 3UGKA 3CVWA 2XHEA 3PXDA 1XJQA 1VBFA 3KM0A 2FEOA 4C30A 5CD1A 3GOHA 3EF3A 3OPYB 3H1GA 4A36A 3PNQA 2AKEA 4CTNA 3FAZA 3W8RA 3EAGA 1JJFA 2Q6KA 5BN4B 1KJNA 2OAGA 5ESXA 4H60A 4QYTA 4P4NA 1DBWA 4JYAB 2Z04A 4JP3A 4BNFA 3TDMA 5JCJD 2A6PA 4RJ2A 3BFVA 1NN0A 3LQYA 4UMFA 1XZKA 1RRFA 2PSSA 3J7TA 4ZP1A 3RYFB 2IX3A 2F3SA 2OV1A 4NENA 2WSSD 1RLIA 2IYYA 3IR5A 5A9RA 5KVVA 2QI9C 1X0VA 2YWBA 3MMZA 2H2FA 3GMIA 2C82A 1DLIA 3PFKA 1LI5A 3P96A 1QORA 4YV7A 1PWHA 2FDRA 3EFOA 2G1JA 4LE1A 5FV4A 3DEZA 1YH3A 3ZXUB 3JQ7B 4MVJG 1ZD3A 1S2DA 2QPLA 4CQMA 1EJ6A 4IXMA 4PF1A 4WEQA 1ULUA 9ATCA 4I5EA 1F2TA 3WGJA 3TOZA 3NDJA 2ZT7A 3KU1A 1AKMA 1GZ6A 1NLMA 1H0KA 1TC1A 2H16A 4M7WA 3SI7A 1LXCA 2ZSHA 3IVCA 3NH6A 4I5GA 2AMFA 4IOJA 4QJ3A 1KMHA 5ADUS 2ILVA 1QG0A 3O21A 4C6RA 2XYQA 4IM7A 3JAWB 5BQ3A 3PE4A 1O95D 1F38A 1VPEA 3G9QA 1G9SA 5LLDA 5E9QA 2DGDA 3V3KA 3T5CA 1LFDB 1HE3A 1TZKA 4KO2S 4YO8A 4BQQA 3EVAA 1T2VA 3K94A 3WHLA 2XQVA 2AEMA 1SIOA 2X1HA 2P4UA 3EIHA 4N7JA 1VLJA 4C89A 5KQPA 4H77A 1G19A 2VK8A 2YYZA 3IUSA 4GI3A 3TVTA 3BL6A 5JCOA 5KWEA 3HTXA 4ER7A 1C3OA 3EXIA 2XMBA 2ONCA 4ICIA 4PQGA 4YCDA 3GA0A 5FNVF 2BFCB 1QB7A 3ND6A 4ZQFA 3VR0A 3WLQA 4DNFA 5DRTA 3N0TA 5FLYA 3VKHA 4TTRA 2XA2A 4J7AA 2I3BA 5JXIA 4OQPA 4RJLA 4OSEA 3FZGA 1JSCA 4EPRA 1P9NA 1C0EA 3BK1A 4L27A 4X54A 1YJAA 2IOYA 4LV5B 4M0FA 2FK8A 2W83A 3A9SA 4CEIB 1YE8A 4PPFA 2NW6A 2VJAA 5JZVA 1Q1BA 1OW3B 2DHQA 4AXBA 5DCUA 4X8LA 1T8YA 2QROA 4JBWA 4V0NA 2QY9A 4DR6B 4O2LA 1DCMA 1VLHA 3NZEA 1QFYA 2XQKA 3LX6A 4ER6A 4IDOA 1JI3A 2XNDD 2Z2ZA 5AK3A 4KMSA 1PSWA 3NETA 1HFKA 1R16A 5LVAA 4R0NA 2H2GA 2C9CA 4O4JA 2IEGA 4Y1EA 3ZU2A 1U3FA 1YF3A 4AI6A 2Q2QA 4KXWA 1FPMA 2IE0A 2Y1WA 4NF2A 3K70D 1T2UA 2FG6C 4OOEA 4WX2B 2WDPA 4WVLA 5EFOA 3ADDA 1DKUA 3GRKA 1DPFA 2QNBA 3GZJA 1MX9A 4LBVA 1JAXA 1E1KA 3VGJA 2G1KA 2QORA 4Q19A 2BUBA 1X80A 5HBGA 3WR5A 2CK3A 4X8OA 1NI5A 1JKIA 1O95C 3AF2A 2D1YA 5CCEA 3NXKA 1WIWA 1NMSA 4EB8A 1FUIA 4D5GA 1N5OX 1NUQA 4EGCB 3LRPA 3G2PA 1ZK0A 3R74A 2WP8J 5C7IO 5REQA 1QYRA 1RHJA 1PWYE 2FFBA 3HDHA 3QWAA 5CM9C 3UFBA 3SXUA 1UBOS 1H42A 4RTRA 2W2OA 4BTEA 2VBCA 3KG2A 1Z5NA 2UZ0A 1DL5A 4IDNA 3UMRA 3UANA 2DG2A 1TO1E 1M1YE 3DLPX 4ZOLF 4TKVA 1U1EA 3ETGA 1A97A 2ATXA 3DULA 2FN7A 2V58A 3NYQA 4BVJA 1EX7A 4RDXA 5F9HA 3WHKA 2AC2A 2WLTA 4XUCA 5J2UA 1GQYA 3R9XB 2V7PA 1DKPA 4S3MA 4HNAB 3MS2A 2YHUA 2A9KA 3RT9A 3N2LA 1E4EA 4C14A 1WS6A 3QQPA 2E3JA 4X3PA 3NDBB 1QG4A 3KFVA 1NVGA 4BWVA 1Z7EA 2Q41A 4GF5A 5L45A 1QFSA 4YK7A 3TTWA 1GPKA 4DLVA 1NW4A 2H0AA 3TZEA 4CMAA 1FFYA 1ITZA 3GLQA 2XBLA 4FBMA 4GOKA 5L4NA 1VCMA 3M6LA 5KYYA 2C9ZA 1BZYA 4S1NA 1QZUA 4TRMA 3U37A 3N2GA 1U7PA 4I50F 1Z22A 4GWGA 3ZJVA 4INJA 1I7LA 4KX5A 3E9QA 5CRIA 3K70C 2FSFA 2RI6A 4D9NA 2AJLI 4JZYA 4X20A 4BBJA 4GYYA 3CB2A 4MRAA 5AOVA 3CEMA 1T9GR 3JQ8A 2ZS7A 2D0PB 4F3NA 1JR4A 2B94A 2NZYA 1TMOA 1F51E 4QJIA 4UU1A 1QCYA 3P4YA 4BJ6A 1N5DA 1U6IA 2OV2A 2MDTA 4ALNA 3FBGA 3KKOA 2HMTA 5A4JA 1LW7A 3W9UA 2ROQA 1CULC 1X87A 2WAXA 3ZEAA 3ZIUA 2F3TA 2I7DA 1XTZA 3OIFA 3U3ZA 4B6PA 1H4TA 5ADHA 3S8YA 5IVKA 3IE1A 1G60A 4IVRA 1EK5A 1KS9A 1JKJA 4YUZA 2Q7XA 3G2LA 4LY6A 1EESA 1DEOA 1N3IA 1ZWKA 2CEAA 2OM2A 2OXRA 3C74A 5FO0A 3R7LA 4QDTA 2GEDA 3DEHA 3QYFA 4CKWB 3HYNA 1D8AA 2ACKA 2Z9CA 4GX1A 4BQNA 1VSTA 1JKMA 3DCIA 3CKKA 2DTEA 3HVUA 3GLKA 3V1UA 3KIPA 4JYPA 4O63O 4M1WA 1AUXA 5EJAA 5CFPA 3AX6A 3MTJA 1HDCA 1SWWA 2C31A 4AKSA 5AVSA 3EIXA 1W88B 4JGGA 4UXHA 4N3AA 4YV2A 1W36D 1TO2E 2QX6A 1FYVA 1ZOOA 5HE9A 1NVMB 5EHGA 3VH2A 3SC3A 1OE0A 1Z45A 2XTMA 4CMHA 1XMVA 1BH2A 2BFMA 2JARA 4KXXA 4N82A 4YMUA 2C58A 2SICE 4Q9AA 3ZNPA 3TF5A 3GLHE 1TVCA 2REQB 1HL3A 2CXTA 2B2NA 2G3YA 1MHTA 2VQDA 2YFQA 3HBMA 4J4TA 2I6FA 4JJ4A 3VPBA 2X15A 4RK7A 1LPBB 3ZJYA 3FPAA 3G89A 1V5FA 1Y1LA 4R9NA 4L15A 2QUBA 4XYLA 2I4LA 4AG5A 4RVCA 5C8YB 1X9GA 3N7AA 1XR3A 1AJEA 3D1VA 3I5MA 1Q7TA 2HO4A 3SE0A 3D6HA 2HPAA 4G97A 1MUUA 3AHFA 4B73A 5JY6A 5SYAA 1Y1QA 1DHRA 2I55A 1S1CA 3NT2A 4G89A 4UTOA 1XRMA 4YRDA 3R0QA 2REXB 2QN6A 1L7QA 3HRHA 3LWDA 4AQDA 4F2WA 3ZBUA 4J16C 4B3MB 3OZRA 1WZUA 4EMBA 5BVHA 4JLPA 2V3VA 1E0JA 1F9AA 3F2VA 4UUMA 4ZRMA 2EKQA 4DLZA 3E27A 3RADC 3BSFA 5HF6A 1KYYA 1UBEA 3PXBA 2VUHB 5A7GA 5HCIA 2BH2A 3G0DA 3RIYA 1TT5B 1HYHA 2VP9A 4KCGA 4QDOA 3O73A 1UMBB 4GVXA 2EQBA 5LXTB 3EZXA 3D3NA 5H02A 1B6GA 3NIGB 1J2JA 1EI9A 1LA2A 1NAIA 3BIOA 3NV7A 4HJXA 3TLKA 1BRMA 1E2PA 5I9TA 1MX5A 1CEXA 1U3VA 1P9WA 2ZETA 4INOA 3RIHA 1W36C 1FEZA 1KEPA 3P2KA 4GP9A 4RD4A 4FINA 1ZUNA 1JKXA 5F35A 3U49A 4K0KB 1BGVA 3VO2A 4N3NA 4QYMA 3UUWA 4C08A 1V48A 3OX2A 4LEIA 1VZ3A 3BH6A 3HYCA 2BEVA 3A70A 4CKCA 3MMXA 1OLSB 1XJ0A 5KDDA 4PCLA 2Q0QA 1FVOA 3WGTA 3THXA 1U2GC 3DV0A 1ZEJA 3L6UA 5HFNA 2EERA 5TVGA 3SKVA 4LY3A 3WZLA 2HRRA 4FYMA 4D57A 4GS5A 3BB3A 1FDWA 1OX4B 2YWJA 3GFGA 3KOYA 3MB5A 1OFHA 2HB6A 5LLSA 2DLNA 4DIDA 5HIKA 1G21B 2Q4EA 3ZI4A 4LXTA 4MEJA 5ICSA 4DJTA 2I2XB 2ZE8A 1JQ5A 4UW9A 3KZNA 4WNAA 5FPHA 5IM4A 4HNGA 1K63A 5G3ZA 3JW8A 2OP0A 3VHQA 1DXYA 2X5JO 2Q9CA 3Q12A 4GICA 4UTPA 1TVMA 1TQ6A 5CFMA 1Q7GA 4LXIA 8LDHA 4EY4A 3BXXA 1KMIY 3FTNA 3RRZA 4B84A 4BMVA 5B3LA 1KQOA 1Z2NX 2WP0A 3DLTA 4XB6B 5EZYF 5F4ZA 4CU2A 1N0UA 3ADCA 3NOQA 3ONNA 1S0UA 1X94A 3P0EA 2HBZA 4EG3A 1Y5MA 3EQ6A 1O7JA 4Y18A 1U9IA 4K5QA 1TEZA 3U4MA 4KDFA 3ETEA 1B3RA 2Q8QA 4DIEA 3E61A 3HXQA 3UH1A 4CKEB 1LZKA 3JX9A 1IG3A 1XZBA 2AOVA 2J08A 4IIFA 2DT8A 1WNTA 2NU7B 2ZRQA 4OU5A 4AG6A 3Q3JB 1JDBB 4L5IA 3T61A 1H6DA 1QQ6A 3UOGA 4ML3A 1XGKA 3P8ZA 1IFXA 1YQUA 1PHPA 2PLRA 4KDRA 3WL8A 5LYJB 1Z6ZA 3URKA 3I8XA 1U28A 2DPXA 3LLCA 3QUAA 3X43A 4Q1EA 4UCFA 5H4GA 3R5KA 3EY4A 4MCIA 2UUPA 1A4UA 3GD7A 4PN3A 5JRZA 1YI1A 4MJXA 1FX0A 3ZCPA 2Z58A 4BJ3A 2QW0X 4C06A 1Y3AA 2WOJA 2XCIA 4JFRA 1VECA 3PWSA 2R7MA 1DG9A 1CS0A 1G8YA 3A3PA 2FEAA 2PA0A 5BMOA 4WN9A 4AECA 4M8KA 5J58A 3T1NA 1W9MA 2QGNA 4QT0A 4QXOA 4XPZA 1WP9A 1KMMA 2G80A 3ABZA 1J0DA 5A4FS 5BR8B 1W4RA 2F1OA 2WDZA 5L53A 1OBHA 4CYMA 3HB7A 4CM7A 1DJQA 4FHDA 4IQGA 2Y1CA 3NIDB 2C83A 3IQIX 2J7PD 3PHLA 4BQRA 1AS0A 2F8TA 4TYYA 4RJTA 5AESA 2OXIA 2GK7A 5H59A 5IN5A 4E5VA 3GZ4A 1NVEA 3UMGA 2OHIA 1GTJ1 4LJKA 5F3DA 1EQUA 1ADFA 2D1QA 3I30X 3DOEA 3N8HA 4QUIA 3ZCQA 3SAJA 4KSBA 1RPZA 4JSRA 3MLBA 2ZB8A 3SQXA 4YCJA 5KKCA 5CLFA 2XUHA 3JTEA 4WLNA 1C1HA 1WMBA 2ID9A 1J5EB 4I66A 5BV7A 2GDJA 2PCJA 1HOTA 3ND5A 2FZCA 5GM2A 4D4KA 3MS7A 3KR1A 4BNGA 1H1TA 1C3XA 4M88A 3O8OB 4R9SA 2I4OA 5MN4A 3FDIA 3GRVA 3HXPA 4LOLA 2HLDA 3GUZA 4NTZA 2DCMA 3QXJA 4HWOA 4XOIA 2CDRA 3CBGA 3VZPA 821PA 3F5SA 4LJAA 3PCTA 1PHRA 3D59A 2HZ7A 2UUOA 1RKUA 4ZJUA 1NAHA 2NMVA 4P86A 1PFKA 1MVLA 4HAIA 3OQMA 3TTSA 5JNWA 2J6BA 1MB2A 4CMCA 1EWKA 4TS1A 4ND8B 4HG2A 1B8VA 4QT4A 2JFQA 3MVEA 2R79A 4CM1A 4D8UA 3OCXA 1BWPA 4HEHA 2HF9A 3PPXA 4DZRA 4JA0A 5ALKA 1ZL0A 4EY8A 1XDWA 2VFAA 1TECE 2XTAA 3KO8A 4GOMD 2BW0A 1EM8A 2ZRJA 2CNBA 5KC9A 1MB3A 3QX7A 4BKOA 2IIVA 4ECEA 1OZAA 4KE7A 3FSEA 3D64A 3FI0A 3OJCA 3TW4A 4CZ2A 2PUGA 4UVEA 3THYB 4OATA 4TL6A 1FYEA 5EP1A 2WIGA 1Y7TA 3DV9A 3OJFA 4I19A 2ZJ2A 5EXSA 2HU7A 4CQJA 1L3IA 4KBGA 3EVBA 2O50A 1FXUA 1AB5A 1HE1C 2HNAA 2Y1FA 4GPAA 1T3TA 4CM4A 2QDKA 5H3LA 1Y6JA 3UT6A 2E5LB 4WZ6A 2JIPA 3O0DA 1L4MA 3JQGA 1AA6A 3RDPA 4X94A 4F92B 1REQA 3NEPX 1EBFA 3BGOS 2VYVD 4I4TB 3JWGA 2PLNA 2PKRA 2YFYA 3BILA 1OIVA 4RYLA 4DJJA 3FPEA 4DLTA 5BR7A 1U7DA 5I5EA 3EOAI 2ZRCA 3K2IA 4PSKA 4FOPA 4MPPA 4PCUA 3VYTB 2I66A 3DZIA 4P84A 4UU0A 4OHUA 2P41A 3RVOA 5A9TA 1CIPA 4HXGA 2H5LA 2MSDB 3CLKA 1OB2A 3R8XA 1DC7A 3V80A 3O4VA 5C35A 4MR7A 1UK7A 4AULA 2R4TA 2JLCA 2RKWA 4HDCA 2OFWA 4QYXA 1U7ZA 4XE5A 1R50A 4BNKA 2VK1A 4B3JA 1JIJA 4K9QA 4D4LA 5C8YF 1YB7A 1KVQA 1N8NA 4BN0A 4ME6A 1FYDA 1CLUA 4U9UA 1DVRA 1FJHA 1G18A 3QLTA 1RKQA 4YTEA 3LOQA 4HB4A 1YHNA 4B44A 3F47A 3NJ8A 4N5IX 2XYVA 2C03A 3LYUA 4Q3LA 1X1DA 2Q8PA 5TE9A 3MUFA 3WO1A 5JWOA 1HPLA 1K7EB 1LRLA 1S3FA 2ZRBA 2HCTA 3CV3A 3O03A 5C8XA 3AYXB 2GNPA 3IAS6 4DUPA 4YIHA 1JZQA 1AZSC 2HYDA 5BRNA 3BZBA 3M3HA 4D6PA 4F6RB 2YOGA 5DYNA 1WPRA 2J45A 1GG5A 1GT91 1SBCA 1TXGA 4ZQHA 4Z0NA 3T7EA 1WKCA 2QLMA 4NCJA 2H1CA 4TV8B 6YASA 1KI3A 4HH0A 3TKYA 3LY7A 4DUYB 1NNEA 2GN8A 4MQFA 5AOCA 4B71A 1N5IA 3EXG2 5C8DA 1U0SY 5LXTF 2BFPA 2NPIA 5KYWB 3ZW9A 1OLUB 5DNDA 1DZ3A 3T7CA 2I76A 6ADHA 3OSZA 4WVFA 4CHTA 1KJZA 1XPJA 2CDNA 4IUCS 1HT3A 1H69A 2IZ6A 4GXTA 2Z6QA 1FSSA 1RJGA 3WGYA 2E37A 1DDGA 1P9OA 2P67A 1OXXK 3WGKA 4UREA 3WK5A 3WLLA 2JCSA 2F1KA 1Y81A 2FW1A 1TAGA 1W5SA 2Q27A 2XXBA 5T6BA 4F71A 2H18A 2OLJA 4GNRA 2FWJA 4ZJPA 2OBMA 4Q9JA 1E3JA 3HCPA 4R16A 1BVYF 5DX8A 4B48A 2I8AA 3UMMA 1SN7A 2W6IA 4ENRA 3DTNA 5KQMA 4M4SA 2MSKA 2ZYDA 4AKTA 1J56A 2DBZA 3FROA 4QNMA 1T9DA 2G63A 1GSOA 3W3AD 3TEMA 4I4CA 4IIDA 2E18A 4IKOA 2QTVB 2Z9BA 4XSHA 1JXOA 1LJLA 1H2YA 1ULBA 3AHEA 4QUDA 2GRAA 3QMMA 3V4PB 5IDWA 3IEPA 1CQWA 2RJNA 4GBGA 2BSAA 2EQ5A 2Q5JA 2GB4A 5FOWA 1GA1A 3F7OA 1KOGA 1U2SA 3ETHA 4W9RA 2FKNA 4JVOA 1I6WA 1NHGA 1CUBA 3L7JA 4FHFA 4WADA 1TCCA 3DEFA 2AG6A 1YJ5A 3PVZA 1IQPA 3CUTA 1LLFA 2ZAIA 1FFAA 1QCCA 1RXVA 2ZBDA 1E1YA 4D9EA 1EVIA 2W2XA 2JL1A 3U5ZB 1HR0B 1IWOA 1PS8A 2F2TA 3S28A 5F2NA 1IY1A 3QVKA 5BSWA 1ZM3A 5G1OA 1XG5A 4B5LA 5EG5A 4BNIA 2BPOA 3ZV6A 1SUDA 3BDVA 4A26A 3FCUB 121PA 4RKFA 5BSHA 2B8JA 2V6BA 2XOXA 1NKTA 3COZA 2R97A 4NQRA 4K9LA 2ONJA 3ZQJA 4OJMX 4BLOA 1TZ2A 3P2IA 3N9IA 3OF3A 4V02A 1GG2A 5LYJF 1IZ0A 2WNIA 3CC8A 5DGIA 3UAVA 1FSFA 3W5BA 2MR5A 1E7YA 3CT6A 3E05A 1RRPA 3S68A 3DFIA 1RRCA 3M9WA 4OXXA 1H6AA 4GP6A 5FWAA 3VKUA 3VX4A 4XIIA 5KX5A 1JEYA 1IBLB 3H99A 1UAGA 4OIFA 1H5NA 3VA7A 1TTHA 4O5OA 1G3MA 5CIQA 3ZDXB 3VHXA 1GTMA 4X6YA 5IP5A 1CY2A 1SG9A 4GMKA 4LZOA 2AN9A 4X7RA 1OFUX 3BM5A 2FSPA 5ITVA 2HUPA 1CF2O 4K9SA 3L6CA 5KQSA 4KW7A 1ZA2A 3O95A 1D1TA 2W4MA 3ADKA 4C7JA 4L07A 4JELA 1J8QA 3ZDQA 1JQLB 1UKVY 2NU9A 4D9IA 1ZITA 4JMLA 1RAEA 2HKIA 4HGQA 5FJIA 2H4JA 1NR1A 4MRRA 4BN4A 1QHHB 1M7HA 5CP8A 3RKRA 4PHCA 3CNNA 1T1EA 1QVWA 3AHIA 1EINA 1UDXA 2RHBA 4W7SA 5C31A 1V8DA 3QV2A 1KQGA 3I73A 3BC1A 2NSDA 1TZMA 2A5FA 3G0BA 3AV0B 4JI7B 4M6WB 1CV2A 3OPXA 4FWIB 3GELA 4HQKA 5FNZA 4QU5A 3BRSA 3S7ZA 3VTZA 4H6XA 4RZUA 4WJKB 5ALSA 3TCNA 1MABB 1YB1A 2FGKA 5H1YA 5C1OA 3AHJA 5C1BA 5IASA 3N8NA 4CR8A 1VHJA 1T3HA 2N3ZA 3F49S 3V8PA 1K7SN 3DD1A 4IRUB 2V96A 1XHFA 4CMIB 1EB8A 3CRW1 3R5SA 2GNAA 4LY9A 5D3MA 4UBMA 3KXPA 4GW3A 1USGA 3IKLA 3C3PA 2GM9A 3BKXA 2NIPA 4RV4A 3UKDA 4WBNA 2K2WA 4PPQA 2CHUA 3K71B 1VBKA 3WGUA 3H42B 4Q3DA 2DLCX 2FWIA 1PT6A 3F71A 1AKVA 4K40A 4NU8X 4TM8A 3KKMA 4B9AA 2O5CA 3A32A 4AJ9A 1JFRA 1RYFA 1UBTS 2I6XA 1T6XA 4WT7A 3WLKX 1T0BA 1X42A 3G68A 4HBGA 4V0KA 4WPGA 5BVGA 4H1UA 3OU6A 3DQZA 4LCBA 5KNBH 4F5EA 3S81A 5CK4A 4QYSA 1GPLA 3EC7A 3CM0A 2BDTA 3ZVRA 3TFOA 4US1R 5ECWA 1IZZA 2ORVA 4KAJA 3L7OA 3GEMA 3EGIA 4EABA 5LA6B 2WMOB 2Z30A 4DG9A 4AF8A 2PQ0A 4DLLA 1M34B 1R4MB 3PRKE 1JMYA 3RFTA 4LF5B 3QA3E 3PNMA 5ALVA 1IPEA 3LUHA 3QOXA 4Z8YA 5FADA 4ZJYA 1Z0SA 4ZV9A 1U1CA 1E4OA 4NV1A 2QUIA 1Z6QA 3LC2O 2QD3A 1JG2A 2GCPA 3DWFA 2N75A 2UYYA 1FUYB 1J0BA 3BSWA 1N2GA 3KFXA 3O92A 1F0KA 3OD1A 4I4TF 4QLOA 4RDHA 4UEWA 4UNIA 2CBGA 4YFVA 3U7JA 4LXXA 3GR6A 1F12A 1OF1A 2J7KA 1A9XB 2WI8A 3AETB 3JALB 1NBMD 4IIJA 4LY0A 4DJDC 4AJKA 4F21A 1E1CB 2CFOA 2O7VA 2NV2B 5T64A 4D74A 1QYXA 1GTSA 4C0QC 1ADCA 3QUSA 4IOMA 2ZZKA 1HLDA 3GCWA 4LBWA 4M76B 3CO0S 5E9WA 3G2QA 3DOUA 5AW0A 3W2TA 2HU8A 1ZIDA 4BMSA 5KQLA 3LHKA 3I28A 4XVRA 1CCWA 2NVUB 3ICQB 4GFDA 3U4DA 1IIBA 1G66A 3VX3A 3JWHA 3QJ5A 4W6ZA 1IQ0A 1NR5A 3PC2A 4LGYA 5DEIA 4EHBA 2QYOA 1G42A 3IUMA 2AR0A 4U2EA 2JFZA 3LBHA 3T7KA 1R74A 3N6RA 1JLKA 1T1RA 1FJ2A 2Q0SA 3RHFA 3U81A 4MCJA 4BGEA 4RA6B 3UGJA 3OQNA 1ICEA 2QYTA 1VLLA 1WSDA 2C4VA 3NHFA 2R751 4ZVQA 1H9AA 3QG5A 3N75A 4L76A 4UAJA 3VC2A 2RGNA 1HYQA 5CDFE 2BFWA 2FX2A 2HMUA 3F5FA 1YZQA 3C3AA 5AVTA 1UBKS 4IR7A 2XMRA 1Q44A 4MWBA 3O26A 1MB4A 4TV8F 4CCAA 4I55A 2J9FB 1T8UA 1YQ9A 4YR7A 3M34A 5BN5A 3HCBA 3JATB 2O7QA 4J0GA 4LNUB 4XH9B 4FYHA 1V5WA 2B4YA 2V7TA 4Q9IA 4X90A 3BUSA 5HNKA 2AN4A 5BXQC 1NC1A 2AKYA 4IJUA 3QFRA 5C32A 1UJ5A 1QDUA 2IHVA 2FRDA 3DEAA 2J9ZB 2O8VA 3DEYX 1RQPA 2ZIWB 4AZ0B 3AUXA 1K6JA 1W0KD 2PU5A 2Y8EA 3MRSA 4HTFB 2GM5A 1DELA 3EB9A 4FYXA 5KCZA 4HWSA 4EUHA 4JJAA 1KZ7B 3G3EA 4MV0A 5DH9A 3CE9A 3TCXB 5I45A 3L7AA 3MSXA 1OX6A 5LP6A 1QQAA 1SD5A 1GGKA 3OQIA 4FZ3A 4R3UC 4N5MA 4EITA 2DFTA 1VKOA 1DKOA 2XA9A 3KHUA 5M2QA 1RRVA 1G291 1V8OA 5ERGB 3RM3A 2IUTA 3ROFA 3H4TA 2WD8A 4XWOA 5C7LO 3V7FA 5SZKB 3CEPB 2HCBA 3K0AB 4QNRA 4R41A 4TROA 1DT3A 4JBIA 1NSTA 4JI6B 1AN0A 3RRMA 1Z56C 1QVAA 1TM2A 3H5IA 3ZWMA 4UU7A 1J8YF 4DDMA 5KIAA 1R0ZA 2PX0A 2ZYIA 4ROTA 2ZT6A 3U44B 2AQHA 4IIEA 4RBNA 4JA2A 4KIFA 2GAJA 5LQNA 5A5GA 3TKLA 3H9GA 3MGAA 3AM1A 2ATCA 1NJ8A 2EEPA 4XGKA 5DGXA 1SVNA 1DSSG 1OTHA 4QL3A 4OI0A 1XTSA 3W0LB 5K0TA 4NK5A 2OM6A 1N4AA 2P2GA 2C00A 2DR2A 3MOGA 3Q4GA 2A5YB 4JR2A 4XW2A 5DBOA 2DE0X 5CLJA 1YK1A 2GARA 3DUFA 3OESA 3D7KA 4IXDA 4R2WA 3WAGA 4I1PA 1DQZA 5E38A 1W0JD 4MVJA 3BWCA 3UMSA 4EF5A 2JLBA 1SXHA 1V3TA 3FZNA 4LTMA 4RTQA 1QGOA 3AWDA 4KIUA 1M8PA 1NW9B 1XZCA 2XF8A 3I92A 4MLPA 4XYEA 1QC5A 3A1SA 2F9LA 4N9WA 4GMDA 2PWPA 2D13A 4M46A 1ZLYA 2E4XA 1MO5A 3R76A 3M1AA 1I1NA 4ER3A 5IAOA 3LLMA 5KBYA 4H7FA 1UOQA 5JE8A 3W2EA 4P82A 4XAQA 5JEEA 2I6UA 2DWQA 2GPWA 3O82A 4R8KA 1YUNA 2CNDA 3B12A 5DSZA 2BKEA 2VJOA 2XVYA 4ZHQA 5KNDA 3L6EA 4YUYA 1T24A 1NYRA 1SAYA 1GNRA 2DMRA 3CF2A 3GQBA 1NMQA 2OTCA 5SYMA 4Z4FA 9MHTA 2DTDA 2MYTA 1K98A 1KI9A 1UOOA 4D82A 1TYBE 1BXKA 3V1MA 4LQDA 1PR2A 3FWHA 4AMYA 3NHKA 3SQLA 4NHEA 4FIZA 3M3DA 1X7YA 4F60A 3RJMA 2G25A 5H7XA 2NGRA 3GX1A 2EJCA 3KOXA 3VR6D 3MAAC 3EGVA 2GPYA 2B2CA 1YDWA 3O1IC 5K3CA 3UAOA 4MYUA 5KJCA 2BY4A 1WCYA 4LV8B 4C4SA 3OEEA 4MUXA 2JIDA 5DV9A 1G7CA 3OJ0A 4PM4A 5FTNA 1PIWA 3STHA 3W7AA 5IKPA 5CBPA 3GL9A 3OLCX 5LZ7A 3PWKA 4LYHA 2C4MA 4C5AA 2GJSA 2BAGA 1M3SA 1NNSA 2AG1A 2CEKA 3K05A 1YBMA 3OIUA 4WRRA 5C46F 3H1PA 5K3EA 4KQEA 1B42A 3WJ7A 4TXLA 2A1TR 1EVKA 3X1JA 1E2FA 1WB6A 2CUNA 4KBYA 4B31A 1X86B 3ONEA 1P5FA 4BKPA 4BVAA 1KRWA 5BW8A 4D45A 3ZK7A 2WF5A 2CHEA 3DZDA 1M7GA 2EF0A 3NS7A 1IY0A 1H2HA 2IU4A 1UFRA 3R6DA 4L6AA 4YRRA 3DG9A 3GQVA 5JR3A 5F98A 4LZZA 3AERB 3NU1A 1ESNA 2QRMA 4HDMA 3DEKA 2OVFA 2HBYA 1RI2A 2FCRA 2VTVA 2GJAA 5F1KA 4TWRA 3V7NA 2LXNA 4QDUA 5EGSA 5CCDA 2PZEA 3CJQA 3IL2A 1FQOA 4AICA 4A92A 4DYVA 5TMPA 4LYAA 4G4SP 4UBKA 1UK8A 4CPDA 1FXSA 2GCNA 3KJNA 5K8CA 3Q6NA 4H7HA 1X7GA 1ZESA 2HA7A 5A5DA 4CDNA 2GYVA 1AQNA 1ZQ1A 3NWEA 4RVSA 1BE8A 1KARA 1U99A 1YTLA 3QPBA 4JYBA 4IF6A 4Z2YA 2D00A 3U6KA 1NJGA 1GCIA 1GN9A 2XWPA 3LHSA 4B76A 4K6HA 3E9RA 4JODA 4MP3A 3VC7A 2Y66A 3W5UA 5LA6F 2XVMA 3I23A 3WDMA 3THWB 1XAIA 4PEVA 5ALGA 1K27A 4A6XA 3RKUA 3UHAA 3SDBA 1VL8A 3C8MA 4J0EA 3U16A 1G5QA 4NYMQ 5I5GA 3ONWA 3KYBA 3PL5A 4GI2A 4LHWA 4QUAA 5CX1B 4DQKA 5HKAA 3IKVA 5IAAA 1MN6A 4K2HA 2CJFA 2BMWA 2PVSA 1XEXA 4JH0A 4P35A 4EMSA 5B4UA 1KI6A 2NSLA 3OEHA 3P2OA 5CEFA 1JPJA 1UWVA 3ILSA 1SU6A 3N87A 3PSAA 2HQSA 3QSGA 4FFNA 4U39A 4UBOA 5LNK6 5LIRA 2QSUA 2WWHA 3NWBA 3JVUA 4FXPA 1WU8A 2OOSA 1KY3A 3GFBA 4EVRA 1GOTA 3KQHA 2H5JA 4GC5A 1U8EA 4FDVA 3PX2A 2NUTB 3VPXA 3K32A 4GVLA 3ROXA 1IXRC 4MB6A 3KKPA 5EN4A 2QM7A 2OQIA 1WDTA 5JNRA 1Z68A 1CUJA 1K2WA 4HX5A 5B3KA 4C4YA 4RHEA 2NZWA 3FTCA 3OO1A 3AESB 2B61A 4LDJA 3SIWA 5AKEA 3JV7A 2X1LA 5KNCD 3M89A 5J4LA 3OPMA 1DAOA 3PDIA 4MDEA 1N6HA 4DVGA 4N47A 1A1VA 5GJVC 3H3XA 1AKTA 1YT5A 4DHEA 1V6CA 1LPSA 3VRHA 1U0EA 1Q0RA 1KZGB 4YY3B 1ML3A 1FDIA 2IF0A 2YC2C 4Q1AA 5JZOA 2C7RA 4ZOAA 3ZWXA 3U4HA 3Q7EA 1L7EA 1W85B 3ABSB 1K8YB 2JA1A 4BYGA 1N1GA 1JJVA 3K9BA 3NPMA 3P71T 1ONPA 2TMKA 3U3XA 1AT1A 2AFHA 4IMJB 1IK6A 1YSCA 3MELA 1Y98A 4YJ3A 1KO1A 2GPJA 5ALXA 1P1BA 4WERA 4DUZB 4F1WA 4Q9HA 3ZHCA 1BEEA 1F3OA 1NXPA 2J32A 3I2JA 3NTXA 2XCRB 1NW3A 1HNZB 4I1IA 3RO7A 1VBMA 4ZMRA 2DECA 1I3OA 2BTQB 4KIGA 3HJRA 2GO1A 3L4SO 3BF8A 2QBYB 5JCJA 3ZDEA 2GPNA 3HV0A 2J85A 1CRWG 5EIBD 2P27A 5EP4A 2YZKA 1BS9A 4LMBA 3JPWA 5AOBA 5BQOA 2WSSA 4PSAA 4CEHA 2ZYVX 1N2CE 1XL0A 4JBLA 3FRIA 2W71A 2OL4A 3ROPA 5J4KA 4DTCA 5I7HA 2FN8A 2YW2A 1ST2A 2DWUA 1JT2A 2PZ8A 3P9IA 4FJ2A 4RVHA 4EKGA 1LF5A 2PT5A 3SSMA 3QW4B 1EUDB 1YVRA 3DYVA 2IVFA 3SDZA 4DILA 3BN3A 3D4PA 1NR7A 3ITDA 1I4LD 3TPFA 3S0JA 3PQCA 1F9EA 1KU6A 1A77A 3LUGA 2RARA 3R5HA 2PD4A 5AHOA 2PUCA 4RNCA 4HBZA 2GWHA 1MP0A 3H2JA 2OEPA 3G2JA 3UMBA 4X92A 1ESEA 4IMPA 1ZK2A 1CUIA 1X7ZB 2VP5A 4GT1A 1SB8A 4QUKA 4EA9A 2WHYA 3L1IA 5TVKA 3E3LA 2WFMA 5DNVA 3O1LA 4J75A 4RETA 3TLMA 4URHA 1EFVA 5HEKA 5L3QA 3K0SA 5AK0A 1XELA 1F2UB 2X13A 3RWBA 1O95A 1Y63A 4N1AA 3OOHA 4JLKA 1E2GA 2EX1A 1SXPA 2J4DA 2J3IA 3H65A 3CLTC 4KVZA 2ZREA 4DMRA 3CUVA 3LA8A 2MSWA 4C6TA 1R4ZA 3B6ZA 1BD3A 3CSSA 3C1OA 4NU0A 3OX3A 3WXMA 1V1MA 5GV8A 3EMKA 2PHZA 2FE1A 3Q3CA 3QA9A 4MVJP 5CTJA 1GAXA 1FNCA 3W90A 3K0FA 5JSKA 2E0IA 4YJ2A 4L5CA 4X1IB 1WUJS 1JAYA 5GINE 4JP2A 3CZPA 3EGWA 2IZOA 5LC1A 1B8UA 1J49A 1V16B 1QTQA 5CH3A 1Z0KA 1IHDA 4JUDX 1M54A 5CXQA 1ZI8A 1RXSA 3LX5A 2BEWB 3V6LA 4RGVA 2FE4A 3IP8A 2YN0A 3G9ZA 1OZGA 1X1QA 4UCXA 5EIBC 1EVQA 4L5BA 3E1GA 1Z75A 3NTOA 3K16A 5KJFA 4JEUA 3HKDA 1QDEA 4QUHA 4CMGA 2P79A 3I53A 3L8CA 4BMOB 4D3SA 1YZ3A 3N0VA 4FCCA 5F77A 1L5RA 2L17A 1DKMA 3A1EA 3Q41A 1QPGA 3T7AA 3ER9A 2XNDA 1ID1A 2AD5A 2G4VA 1BCSA 2IYQA 2NTYC 1ZVJA 4TTQA 5EP3A 3HR7A 4YRPA 2R00C 4UTZA 4TYMA 5EFZA 4B6JA 3DWIA 4FE7A 2W6NA 4JJKA 4QQRA 1Q7CA 2V1UA 4BFSA 1WTCA 1DLJA 1OYWA 2C9YA 2V7WA 5FUVA 2YV2A 2XOEA 2PG3A 2AV6A 2WAMA 1UZLA 2NO5A 1F8FA 3BTSA 4HRYA 1SIUA 3T1OA 1NMYA 3ZGZA 1OZHA 1RM5A 4FHCA 1J1IA 1EE1A 4RPHA 1VIYA 2OB2A 1ZFNA 3D6UA 1P91A 3WDSA 2Q5IA 1LNZA 2B92A 2O2ZA 5C7YA 1KJYA 1B8PA 1UBCA 3D0RA 2DSNA 3NH9A 1M1XB 1QVVA 2C2GA 4FIDA 2X6TA 2ZJBA 3HSYA 3LF2A 3OKPA 4EHNA 3SG0A 1Q84A 5A2GA 3WLMA 1ISRA 1E94E 3DDZX 1BJTA 5HF8A 2ORYA 3KVVA 3NCHA 2OGZA 4MUJA 4XM0A 3QBTA 3LFHA 3MMSA 1THTA 4C0JA 1T1SA 2GRUA 1W30A 3LPLA 1RVV1 3OZXA 2DAPA 3NDPA 5K20A 1DUVG 4GLLA 4MW0A 4WW0A 1K08A 1QGYA 2XWBF 4D8YA 4U2BA 3ZWCA 5F78A 1I30A 1YWGO 3GH1A 2VDVE 3CLUD 2X2FA 5HMMA 2QHXA 2J09A 2A1UA 3HKCA 3L5KA 2X58A 4A23A 1QJ4A 1QAQA 3JPYA 4D0RA 4D42A 3OIWA 4P53A 3TM4A 4V3CA 1SPXA 5C4MA 1KQNA 1LKZA 1U94A 1MV5A 4GGOA 1IDOA 4TS3A 3V8EA 4A6PA 1LBEA 2QAIA 3GP8A 1LBIA 2QEQA 3BMOB 1BYIA 2XQGA 1M6NA 1AKUA 1OTYA 2ZAGA 4Y6QA 3OJXA 3RVLA 4ALMA 2RSLA 4FDTA 5EWMB 3C