1PTKA

Studies on the inhibitory action of mercury upon proteinase k
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Studies on the inhibitory action of mercury upon proteinase K.
pubmed rcsb
source organism Engyodontium album
molecule tags Hydrolase(serine proteinase)
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ptkA00
1PFGA 3WIVA 4JP8A 1VSBA 1IAVA 2ID4A 1R0RE 3QFHA 2SECE 3LPAA 3Q40A 3DE2X 1WMFA 3DE4X 2Z56A 3VYVA 5ARBA 3DE5X 1TM7E 1YJCA 1TM5E 1SBHA 3EIFA 2E1PA 4FONA 3HJRA 1T1GA 1OT5A 3AFGA 3SQOA 2Z2XA 3WIUA 3PRKE 5JXJA 1BFUA 2Z2ZA 1Y34E 3T41A 2B6NA 1BE8A 2ID8A 3DYBA 3VSBA 1GNSA 3UNXA 3A3NA 1GA4A 5ARCA 4I0WB 1NDUA 1R6VA 1SVNA 1R64A 1P7VA 1WMEA 1TK2A 5FFNA 1SIUA 3GT3A 2W2QA 1SBTA 2PRKA 4H6XA 3F7MA 1TMGE 3QTLA 5SICE 3GT4A 1GA6A 1LW6E 1AK9A 3BPSA 2PMWB 1EGQA 1SPBS 1BE6A 3VV2A 4NMXB 4CG0A 1C3LA 1XF1A 1YJBA 1GNVA 1Y1KE 5CW1A 1SUDA 5B1EA 3VV3A 1T1IA 4KG7A 4KPGA 1PEKE 4AKSA 1GTG1 3A3OA 2PYZA 1KDVA 4NE9A 1ST2A 4M1ZA 1AV7A 3VHQA 4K8RB 1NLUA 2Z30A 2GKOA 3DVQX 1OYVA 3LPCA 1EA7A 1SUBA 1WSDA 1YU6A 2PKCA 4AKTA 1BFKA 2V8BA 4CFZA 3WQBA 1SUEA 1BH6A 1TO1E 4DWWA 2DUJA 5AMXA 2TECE 1IC6A 4BWGA 3SICE 3A3PA 3I37X 5FBZA 1GTL1 3F49S 3DWEX 4Z2AA 2IXTA 3AJ8A 4OV6B 2PWBA 3GCWA 4YN3A 1Y3BE 2SBTA 3Q5GA 5B1DA 3I2YX 1S2NA 3BGOS 1SUPA 4H6WA 4OMDA 4NE7A 1SUAA 3DE1X 3DDZX 4H6VA 4ZARA 3DW3X 3EE6A 3DW1X 4C3UA 1SELA 1T1EA 2SICE 3TECE 4ZOQI 1KE2A 1AH2A 2ZWPA 1KDYA 1SBCA 3ZXYA 1UBNA 1KE1A 1SCDA 5I9SA 1ZVKA 2ZWOA 2W2OA 1C9MA 1KDZA 1TM1E 1AQNA 4GI3A 3TI7A 1S01A 3D43A 4DZTA 3LPDA 1C9JA 3I30X 3CNQS 2W2PA 4KB5A 2Z2YA 1AF4A 2WUVA 3WHIA 1S02A 1MEEA 1SCNE 2DQKA 2SNIE 5JXHA 1A2QA 3LXUX 3I34X 4WOBA 2PQ2A 5JXIA 1ST3A 4LVNA 1SCAA 2WWTA 1SIBE 2Z58A 3OSZA 2ST1A 3CO0S 1SUCA 2W2MA 1ZVJA 3DVRX 1MPTA 3AJ9A 5JXGA 3H42B 1SBIA 4CFYA 1HT3A 2WUWE 4LVOA 3D9QX 2Z57A 1Y33E 3BX1A 1AVTA 1P8JA 3DE0X 5FAXA 4HVLA 3L1KA 5AVJA 1Y48E 4WOCA 1V5IA 1CNMA 2WV7A 3F7OA 1NDQA 3QMPA 1SN7A 3DVSX 1SBNE 2XTJA 5K7SA 2HPZA 1Q5PA 3P5BA 3VTAA 1Y3FE 1GA1A 5AQEA 2G4VA 1BJRE 1Y4AE 4OMCA 1AU9A 1TO2E 2DP4E 3GCXA 1JEAA 2QTWB 2X8JA 2W2NA 2XRMA 1SH7A 5ARDA 1Y3CE 1WVMA 3DE7X 1OYOA 4C3VA 1V6CA 3PTLA 1Y3DE 2PWAA 3ZXXA 4HX2A 1GTJ1 1TM4E 4J94A 1CSEE 3EDYA 1P7WA 1C9NA 1DUIA 1WMDA 1Y4DE 1Y9ZA 2P4EA 2ZRQA 4B5LA 2HD4A 4RYDA 1THMA 5AVKA 4MZDA 3TI9A 1PJ8A 2X8JB 1GCIA 5JMOA 2IY9A 1SCBA 3DE6X 3DE3X 1PTKA 1YJAA 4DJ5X 1GT91 1SIOA 1TECE 1TM3E 1DBIA 1SCJA
chains in the Genus database with same CATH superfamily
3FZEA 4HVTA 3UV7A 4NYIQ 3CWQA 4GMXA 1JG3A 3ZGNA 1IAVA 1KK3A 4YJ3F 1QZUA 1YQUA 4U9HS 1UMBB 4MS3A 3X43A 4CT0A 4DPLA 3CZ5A 1NQTA 3TQRA 3DV0A 4U1RA 3VJMA 2ZW9A 3WB1A 4D57A 2C4WA 5GIPE 4QQNA 1P1CA 2XNCA 4UHKA 5AD1A 5JWOA 1Q0PA 2BZ1A 3IAAA 1XC7A 1IU9A 1Z07A 2I55A 2VJMB 2XOXA 3IB3A 4JLSA 1Y6QA 4J75A 4L75A 5DHAA 5ARBA 3CRW1 1EXDA 3P0HA 1F38A 1WDWB 5FEMA 4UXIA 1M1NB 1RXCA 1W85B 1SUFA 3QU5A 1YDGA 1P6QA 2DUMA 1Q2XA 3X44A 1EVLA 4AXBA 3JS5A 5IEBA 2PD3A 4BJ1A 2R4UA 5DHQA 2XUJA 3ZZUA 2B7CA 3CRQA 1GWNA 3VFDA 1XZJA 1X8KA 3ZCXA 5EEHA 2GBGA 4YQZA 4AKEA 3PPXA 2UZ4A 2WHPA 1ND5A 4JUBA 3IIJA 4IYRA 4DMFA 4YJHA 2AEJA 4KQWA 3LK6A 3WLJA 1T2UA 4WCFB 1Q7BA 3AO0B 2VCYA 3RJMA 2ZB7A 3WWYA 3E8MA 2HZ7A 1M2OB 1N1EA 1XEWX 3DJYA 4PZEA 1JU9A 1E2LA 2JGFA 3GRFA 3JRNA 3LRXA 1L4GA 3DMTA 3G8CA 2Q1UA 3JQQA 2AG0A 4OKSA 4S2UA 5ALHA 5JNSA 4XGKA 5JNUA 3DM9B 3ZKAA 5CB0A 4MHTA 3LX4A 1EDOA 1BDBA 1XTQA 1X8LA 1C9EA 1MG0A 5D1HA 3WAKA 4D8XA 4ZHQB 3IE0A 1O94D 1KH1A 1Z5NA 5T4EA 4A03A 4GI7A 2A1TS 4CNQA 3AUFA 3GXOA 4HTFB 1R15A 1M2VB 1M72A 2A0WA 1EU1A 5BWCA 3PDHA 1WHSA 4IGEA 4ER7A 1XGKA 1GA4A 1J9GA 3W78A 1CWUA 4AUNA 3PDWA 5H1YA 4JVOA 4MVWA 1Y1TA 1KWKA 4L6CA 4WVFA 3K70B 2AEEA 2MIIA 4X7RA 4JP5A 1Z2PX 5K0GA 5LYJF 1U2EA 3DKPA 4FX2A 5TEWA 1Y6GA 3GT7A 1IN4A 3TLJA 3B38A 2EGHA 4IIHA 4FFVA 4X8LA 3VMFA 1Q1BA 1ZUD1 1RU3A 4RCYA 4Q7EA 2YJTD 4HGRA 4M0CA 4MDFA 3U3ZA 2ORWA 4MMYB 2IOYA 4M49A 3RIEA 2PRKA 4GW3A 5K8JB 1TK3A 2HHJA 2ODNA 2PCJA 3DOHA 2EF1A 3MC1A 5AK0A 2Y0EA 2PFKA 3MLBA 2AF3C 3NUGA 4Y0AA 4ETMA 5G40A 5BN4B 4GPBA 5C3UA 5FXMA 1MVOA 2AMVA 1RFLA 3D3NA 4RMJA 3Q5DA 4WPGA 3A05A 3AETA 3D1VA 4ZQGA 821PA 3KSBC 1BQ3A 2FETA 1SPBS 1BE6A 4AUMA 3B60A 4QYMA 1YR1A 4QUGA 2Y1EA 5ADHA 3VR4D 3ZDQA 4JBYA 1OFIA 4OU5A 2CVZA 1C3LA 2XCQA 2EU8A 2RD2A 4C5AA 3HFJA 4LZJA 4QPCA 3ZZ1A 1AB5A 2ZYSA 3HE3A 4ZCSA 1SQSA 2ZJZA 3JVUA 5CPFA 3ZOZA 4KUHA 3FOWA 2ZSHA 3ORFA 4PG5A 3GLUA 4OJQA 5IP5A 1YJBA 3SP1A 4NXNB 3QOXA 2C42A 5GONA 3W5IA 4ENTA 4MRVA 4ZYTA 2NV6A 3I4LA 4NXMB 4IVRA 3BM5A 3U4GA 1PZEA 1PT5A 2QRPA 1J6UA 2WABA 1WOYA 5LZ2A 5FQNA 2FN3A 2GJ8A 2VXYA 4P7FA 2JJ1D 4RS4A 2L17A 1JR3D 3U4AA 4QOGA 4O5AA 3VNUA 4PZAA 4UVGA 1EE1A 2DFKB 1BXRB 3FSRA 1MG5A 3I2KA 3R76A 2B99A 3V33A 5CDYA 5J4KA 1ZVVA 3AF3A 3DSRA 2FVXA 1IPHA 3EA0A 1X87A 2HJ9A 1JLMA 4GDFA 1YASA 3H1TA 3GG9A 4AJ9A 5ERGB 5EWLA 2O7NA 4WFIA 3ILYA 5JZBA 2X0RA 3FPEA 4L85A 4MEAA 4PXAA 1XFAA 4LJ9A 3NNNA 1HETA 4P7BA 4HUJA 1W4CA 3P2YA 4KRXA 2IPAB 4YCBA 3WMWA 5DX0A 1JF8A 2UV8A 3L7NA 2ZUWA 3LFHA 3FCEA 1P0PA 3ZG6A 1FXSA 4IDCA 3CX7A 4MVJH 4KGZA 2CLSA 4ZEXA 4DNOA 4ZRNA 4GZ6A 1YE5A 4I6GA 3UKOA 3L82B 1L5SA 3M6MD 4COKA 5ALJA 4DIBA 1NNSA 4RSHA 2B8NA 3C0KA 3GPBA 3PA8A 3VC1A 5HWSA 4CVNA 5I7OA 2CNBA 5EMNA 2B0CA 2WPDA 5LKAA 4DZZA 3EXG1 1EXMA 4QECA 2GHIA 4TRMA 3DZIA 3LWBA 3MAGA 1U3CA 3BXEA 3FVRA 3LY8A 1SC9A 2QQ5A 1V1RB 1CK4A 4A2PA 5JCPA 4RO0A 1L5MA 1XRRA 2JIMA 4A5SA 1HZZC 3ILHA 1B0ZA 4QL3A 5DO9A 5C35A 4JSYA 5K6TA 4LUCA 3F98A 1QP7A 3NASA 4Y1GA 3FDZA 1BDIA 3DVAB 1QGOA 1YKFA 2EG5A 1X1SA 2I33A 4R8KA 5CMLA 3I37X 4I1UA 1BKDR 4RDIA 2Q8NA 1GRRA 2WJ3A 4J29A 4A0FA 4BO7A 1SA0A 1GTZA 4FINA 1K06A 1S7CA 1NT4A 2HK9A 2HMTA 3LLVA 5FPQA 4AW9A 1R50A 2VAMA 4F04A 2VJNA 1ZSVA 4PZPA 4V0RA 3TQQA 3A2NA 3G89A 1ONPA 4JROA 4YN3A 4BX2A 5KYNA 1MB4A 4JI8B 2ZIZA 1IBLB 3SHWA 2ZTMA 4TUYB 1G6HA 1NATA 4DXHA 1SXJA 1QBGA 2YZKA 3DZFA 5FDFA 1F2VA 3II6X 4N76A 3K4PA 4ZI7B 1CB0A 1CQJA 1W34A 1KKLA 1I0ZA 4H6WA 6Q21A 2GMWA 1ZXBA 1L4HA 1NFFA 4E88A 4GX2A 4XIGS 1L7AA 1LBTA 4KVZA 2PS0A 4ENUA 4D25A 3UJ9A 5TIIA 2Q0XA 4YJGA 2H07A 1SJ9A 2F4NA 1MO2A 2GJ9A 2OHOA 4TOIA 4B7XA 3FOEC 3R8XA 2HQ1A 4I50B 2F9MA 3E9NA 4RD4A 2BGLA 4K0RA 5DGTA 1W2HA 4OXYA 4AN4A 2EP7A 2F2TA 3M9XA 1CJCA 3ZHYA 5ALRA 3LX8A 3ZYZA 1ZI6A 4PZZA 4N0PA 3U3JA 4QBIA 1XO1A 3CW8X 3FRHA 4FWIB 3G59A 4L76A 3HSSA 1L5VA 4JB8A 4BNZA 3PQ7A 4GL2A 4YO8A 2PG3A 1T2NA 2Q5FA 2BEUA 5KCMA 1TC2A 1UBNA 2V0GA 3OCUA 3CW9A 2V1UA 2EFHB 3JD3A 3OZRA 1QG0A 1URPA 2I99A 1A4IA 1YQ9A 1ZVKA 3RTCA 1OX6A 4FSDA 4BX3A 4F91B 1NJ5A 5BR7A 2IGTA 3INRA 3H9GA 1XLUA 2BFDB 5AIAA 3S29A 3SX4A 3T8YA 4NL4H 3DEHA 1EFDN 2ZBDA 4HDNB 2WVHA 4H7EA 5D3MA 4DVJA 1U2ZA 3D43A 4MRPA 1ECPA 4MARA 4WW0A 1ZGGA 2YZ2A 4M60A 5A71A 1P45A 4DZTA 3RS9A 1L7XA 8OHMA 5IF9A 2UU9B 1RWQA 3CNQS 2XV1A 3KLPX 3NBXX 1MW9X 1ZD1A 2CFSA 2FI1A 4Q01A 4JAVC 5KNBH 3W5UA 4GLBA 4MWEA 2C7BA 4N7MA 1JIKA 1I3MA 3FOAA 2R1VB 1J70A 1ZESA 4PC1A 2WBLC 3PNLA 4IJWA 2QTAA 4JGGA 3AEUB 3ZE8A 1UBRS 5KKCA 4M98A 4TKUB 1O5OA 2OD7A 4QQKA 1L8LA 3B3JA 3GZNB 5BSUA 1QQAA 4L07A 4FIZA 4KH1A 3AERA 3L05A 4X95A 3HO1A 1WCWA 1C30B 4MVJE 4IWXA 4R0VA 2RC5A 4LSZA 4RFSB 4RU1A 5IARA 3RDPA 2Z4SA 5AK4A 3ZUGA 2D62A 4AMYA 3V8VA 4XVUA 1I2DA 1AIPA 1M76A 2DRIA 2XLCA 2X7HA 4R2WA 1JTFA 4HN2A 2ZAOA 1N6RA 4DLSA 4DLRA 2FR1A 4NU6A 4J0CA 5FHQA 4B7CA 2VQ6A 5KEIA 2OL4A 4JI3B 2JG3A 1B4DA 1AY0A 2HT6A 3MMXA 3R0QA 4P0QB 1BDMA 3FMFA 3H9UA 2PEZA 1U7PA 2OGSA 1U28C 4WOBA 3ZE0B 2WWWA 1MX9A 2HQSA 2V55B 5AUNB 1T8WA 3F5FA 1XRJA 3CT6A 4EM6A 1SOMA 4FSHA 4X20B 4XYBA 2C2OA 1H8EA 1QHYA 4YRQA 4XGNA 4DY6A 1WZCA 3VNSA 2VBFA 4X00A 5FOXA 5JR3A 3MRTA 2I1LA 3EA4A 5EE0A 4UOQA 4B2LA 5BWOA 3H3XA 3QEKA 3U9TA 3L6EA 4P2GA 4NYJQ 1CFZA 2WNHA 1Y8AA 1R5OA 3UAWA 1JB9A 2XUAA 5AQ1A 1LEHA 1HUQA 3GRPA 4O6VA 4R3NA 3HUTA 1H2YA 2WJAA 5G4LA 3RVPA 5BQ3A 2R4QA 1K7CA 3IUNA 1T15A 4EIWA 3V8BA 2BWJA 2W48A 1ETUA 1KEUA 1QFMA 1SK9A 1X39A 3JPWA 3MXOA 3TRKA 1K0FA 1MX1A 1N5LA 2VSYA 4IYJA 4KTTE 2P3OA 4W82A 1XD2B 4FFMA 3D81A 1I1QB 1P91A 4LFAB 3FIUA 1HT3A 5CPBA 2A58A 4WT7A 1FMJA 3E2MA 4Q9LA 4FK8A 3T0IA 2M98A 4DZRA 3D9QX 2Y27A 2W7TA 3BX1A 1WBDA 3AZOA 3G5LA 2PKQO 2RARA 1WETA 3QV2A 4OM8A 2XZTA 4O5OA 4HRYA 3SHVA 3PSHA 3K53A 5A5EA 5K20A 1UADA 2GZHA 4N3BA 3E9EA 4ENSA 5AK6A 1ZUHA 5KDDA 5JFTA 3O8NA 3LA6A 5FULA 2DT5A 2BVNA 4J3FA 2C96A 4G23A 2XNDD 2ERYA 4X0EA 4RNCA 5BNFA 2IIBA 3VPCA 2Q4BA 3DCNA 1SD2A 4YRAA 5IH7A 1UOPA 1C0LA 3IP3A 1SC4A 1DPFA 3IA2A 1AZWA 4PZ0A 3K1AB 3ZEIA 3M70A 3AVYA 1PLLA 3QPCA 4G89A 4H4EA 4F12A 4KUGA 1YS6A 4M9QA 4MKZA 1VCOA 3VHLB 2P2GA 3U4DA 5HNKA 1SN7A 1L4MA 3C1OA 4Y98A 3EVDA 2O59A 4MQ6A 1Z0JA 2R8BA 4U8HA 3VDRA 2XTZA 4OM7A 4ZPJA 3KWLA 1VCIA 4WHMA 4AZ3A 3VHRA 4JYZA 3KUXA 2PUHA 3FSEA 1FZTA 1Q3KA 5I9LA 1QIGA 3GLTA 4UMEA 3MELA 1QV9A 1Y82A 3GJSA 3O9VA 3KT0A 4V1CI 2AG8A 2YHSA 2YFYA 1PP4A 3Q12A 4ZQCB 4J16C 4EL5A 4O4IF 4S24A 3EZXA 2ZUFA 2BM1A 5DLPA 5TT0A 1D04A 4XDYA 3ON5A 3ITEA 1UWKA 3SFTA 3LJKA 3B1VA 2YWEA 3K96A 4YMSA 5JYCA 5FD8A 1J1UA 4I4TA 3O8RA 3GCXA 2E5LB 3THWA 3W7AA 1QVWA 2ORYA 2V7QA 3B36A 1X74A 3CNHA 4PGMA 4RJTA 3AF0A 2NVOA 4W9MC 2ZGVA 5C1DA 1OLUA 4ND8B 3I9V1 1COWA 2FPKA 2G7ZA 4PAQA 2O6LA 5FI5A 2C4UA 5FP0A 4ER5A 1UEXC 5EZYB 3RARA 2JVKA 1IVNA 2CDAA 1C50A 2D5CA 1XXLA 3EWAA 4NX2A 5AK5A 3SS9X 3WK4A 5IF3A 2GN4A 3HYTA 2HF8A 1IMJA 2PRZA 4DDHA 3CVVA 1LWOA 2VZ0A 1JSCA 1P7ZA 3L46A 1VPTA 3DHVA 3HHEA 1HF3A 1CEXA 3REOA 2CF5A 3BORA 4RJLA 1M6VB 1VLVA 3DDOA 1HH4A 1O54A 4XKJA 2ZTHA 2VR1A 1S89A 2VJPA 1D6MA 3BRSA 5EZYA 3AESA 4LY9A 4N65A 4AMGA 4B6RA 4BWFB 5FLXA 3AM1A 1KSHA 3HTXA 2FUG1 2HA3A 3RR2A 4I4IA 1TJ3A 2Q41A 4R2HA 2A94A 2WUGA 3EW7A 4YMTA 3TLXA 1H6AA 1QHHA 2G04A 2H1SA 2C4HA 2CSUA 3HP4A 3QXXA 4IDAA 4KQFA 1JZTA 1O3YA 4Q7KA 4US1R 2BN4A 3L7OA 5JY1A 3VKHA 3LIPA 5J23A 1WU8A 2P4EA 3A10A 2ZT8A 2ID9A 4LOKA 1AXRA 2ZAMA 1U65A 1SD1A 2QV0A 1DKNA 2APJA 5BPFA 4UTNA 1OZ0A 5ELMA 1IUNA 1SXQA 3SFZA 2W93A 2X8JB 2EDCA 2R1UA 2RH9B 1J22A 3JD4A 2D5AA 3PVSA 4MW2A 1I5RA 1U2SA 4NE2A 4BJHB 4BLPA 4DLVA 4R1LA 2ZTSA 4IRMA 4GI2A 4N7JA 2DG2A 3BHMA 3WGHA 1OFUX 3JU3A 1Y1SA 2AOUA 3A6KA 4OYLA 3GGDA 5ALTA 3OPXA 3V3KA 3V7WA 4YCSA 3EGVA 4YTEA 1U0LA 1OY1A 1U0NA 1Z8DA 3LY9A 1E9FA 2IHTA 2NUAB 3VR4H 4CG2A 1AGNA 4JLWA 4WXMA 2IH4A 1X7YA 1UMDA 1TTQB 1VHDA 1T9GS 3NV9A 1N1GA 2Z95A 4TS4A 4O2AB 4QGFA 1VLQA 5ICGA 3DKIA 3ADBA 3CX8A 2W70A 3KYDB 3FPHA 2H5EA 1LTHR 4QIHA 3CUYA 4HY3A 1RWMA 2WDZA 5DBGA 5C8YB 2P9HA 4BXOA 4QSHA 4ASUA 4ID9A 1KBOA 2GOYA 3O4VA 4FKBA 1VHLA 1V11B 2H4JA 3KT8A 1IAQA 1OREA 2ID4A 4DBLE 1E7MA 1LF5A 2PSJA 4BKMA 5K3BA 4RMNA 1KVQA 4PNZA 2QRGA 2QRVB 1T0IA 3QF7A 1A27A 3P8ZA 2IT1A 1CE8B 3GDFA 5AKLA 3PVZA 5DXAA 5BO5A 1ZHOA 3Q40A 3I3SR 1W2GA 3MB5A 4TPKA 1Q91A 3UJAA 3EFOB 2X13A 3DBLA 2Z9DA 4IPTA 2OUKA 3SI7A 2OO5C 2EJWA 5E2AA 5I01A 2HMAA 2R5FA 3A27A 2EW1A 3JWPA 4JR2A 4EJ6A 5L3SB 2FF7A 2RAPA 2AD1A 1T91A 3F6CA 3A1DA 1T8SA 2ORVA 3TM4A 4N0DA 5HGXA 2WJPA 1Z39A 2E0IA 4LGMA 5IAJA 1PR4A 3E3LA 5JZSA 4MPJA 1O97D 4D6XA 2F43B 3DZ8A 2FYTA 4R9NA 2HA5A 4R1SA 4MR9B 2FZGA 5EUQB 4RVCA 3PXUA 3TBFA 1IEXA 1IBCA 1ZGCA 3R0IA 5K8TA 2PA3A 1V7CA 2Q7XA 4N7BA 2UKDA 4EWLA 2QRZA 2Q7DA 3EZ2A 3ZQJA 3ZX5A 5ALGA 3QPWA 1XRMA 4TQGA 4XFKA 1IY8A 1KMHA 2H52A 3EA5A 3IHKA 3U49A 4ES6A 3EIWA 4CDRA 3K71B 2HV8A 2VZ9A 4J9UE 1YVDA 1OFTA 2QYTA 4HEA6 4KAFA 3CVUA 5FWXB 4EGCB 1E9SA 5IAGA 2E1RA 2HH9A 4UJ3A 4Z3KA 3MMPA 5B4UA 1SKUA 2COEA 1C9KA 1EAYA 2WJ4A 1AUOA 3DOUA 4L0CA 2O8EB 3L7KA 2O2XA 1AKEA 4V0NA 3WWDA 4EUFA 4UDNA 3LCJA 7MDHA 1QAOA 3L0CA 4MKRA 1LSJA 2OWEA 3DUFB 4P4UA 2IYZA 2PV7A 2JLBA 3PC7A 2QWXA 2ETVA 3RFUA 3SIRA 3TQSA 1O4VA 1VJ1A 1WTAA 1P81A 3NBQA 3A58B 1GAQA 3T9EA 2FK7A 3OF2A 1G5QA 1WUIS 1JXMA 3K6JA 4IGIA 3MYRA 4GAEA 3R9WA 2W6NA 3EVTA 1M6YA 3P94A 3SC2A 3YASA 3LZDA 4AK9A 1ODTC 1UXGA 1WKCA 3EZ6A 3B1JA 4C6TA 3D8SA 2I3BA 2WT8A 1UQTA 3A06A 5SYAA 1OGYA 1KP3A 1P1HA 2RGXA 5A3JA 4QM7A 3KWFA 5JQWA 2P40A 1N2EA 1E1CB 1RTKA 3N75A 2IELA 1C7RA 4Z9FA 4RADA 1C41A 2BKAA 3V7NA 4H6XA 4NQRA 1E8MA 4D9KA 4B75A 2CJYA 4QPJC 3NX4A 3OM8A 4DW8A 3GT4A 1GA6A 3FGNA 2JCXA 3SYKA 2JIZD 1W59A 1FRFS 2DLCX 4TLEA 2WAAA 5D1NA 4MP6A 2FZWA 4I1RA 3FNFA 4MR8B 2VT2A 1SO8A 1RLMA 1YQQA 5JCJD 2IHJA 1QIKA 2AW5A 2X86A 3F1LA 4L9WA 4A3SA 1JJ7A 5KYXA 4N3GA 1JR4A 1V8OA 2O2GA 1QO9A 4C3OB 3FIJA 2PUDA 3F4LA 2GFQA 3GL9A 1M5RA 1CQIB 2E82A 4M87A 3D8UA 4TV8B 3MEQA 3W5CA 3H1BA 3R0ZA 1K86A 2OLEA 1MRSA 2ODEA 1WXWA 3V4ZA 2GYUA 4KQ6A 4KPYA 1NQVA 3PQDA 1IQ0A 3QG5A 2PKEA 1QQ7A 1CIJA 4RWZA 2DBVO 1T1IA 5JY6A 3A0RB 2XUFA 5F5LA 1EFCA 4JJ8A 3UB2A 3VGPA 3UN1A 4CI0B 2ZJ0A 4A5OA 2JBHA 3H13A 3NQ41 2MT9A 3BWCA 1ZWKA 4H3VA 2AFIB 4NENA 4HB2A 4ZQHA 3ZTYA 4AKSA 2YC4C 2V98A 2BBWA 2I2WA 2H7VA 1EWQA 2VAPA 5CLFA 1ZM2A 2R6ZA 3IBGA 4XYMA 5AW0A 2CMDA 2RGNA 3NEYA 4DV5B 2NU8B 2W4QA 3FLAA 3NATA 2BJWA 4OH7A 4CKCA 1NX9A 4UPDA 3QU7A 1Q22A 2JD0A 2Q50A 3MJSA 5WRFA 3QQ5A 3LBFA 3VRHA 5AVUA 5IWAB 2G82A 3TZEA 3GIWA 1Q14A 4QHTA 2WWFA 1YIAA 1ODJA 4FX5A 3BL6A 4JJFA 2V5VA 3LYLA 1Z4QA 5DHUA 5A4KA 4KWTA 2ZANA 3IELA 3AY3A 2FSPA 4UU8A 1GL7A 4OI1A 4OL0A 1JALA 1RRGA 1PO7A 2JGDA 3I2JA 3QX8A 3TDNA 4URVR 1ZRHA 5COQA 2QU7A 4B8YA 1YDEA 2PVPA 2YKGA 2MINA 2PDAA 2VUHB 3FTQA 3TLZA 3FYHA 2Z2KA 4HDSB 4DCSA 4QOJA 1T8RA 4YAKA 5JLJA 4WESA 4MUBA 1ISGA 4YREA 5IFLA 2C8VA 2Z2JA 1ZN8A 5DM1A 5IVKA 3DT6A 3IBYA 4NNJA 1L7VC 4DLTA 3PNQA 1G20B 2PTHA 3DH0A 3L8MA 3QWHA 1JJBA 1BDJA 1X80A 3C3JA 3WGYA 1OVGA 2QB5A 2WD7B 4UAUA 1BRMA 3EASA 4QRIA 2D5LA 3N8DA 1JEQB 1PFWA 5DTQA 5L51A 5K0JA 1H93A 1R74A 2YV2A 4CMCA 2Z3ZA 2B5OA 3FCUB 3FKJA 3RS0A 4G1VA 3OZFA 1FU4A 3TPFA 2R60A 4Y6PA 4BBPA 5BMVB 2NQTA 3NBKA 3L02A 3NUZA 3MWDB 3VU3A 1C8BA 4N9WA 4M9RA 1EK1A 5LC1A 3L01A 4M3NA 5IYZA 4KN5A 1HI9A 3OFVA 4V3CA 5CA1B 2SCUA 1UEIA 2R96A 3NOXA 3GO4A 3O0TA 1GYQA 4KRGA 1J06A 4MVJP 3TIFA 4EBBA 2BBTA 2J9RA 3QKWA 4L5AA 5H70A 5C32A 4II3A 2FZEA 1SUAA 4QDZA 4Y1EA 4DRYA 1NUHA 2D0OB 1DV2A 2DZDA 4ZQEA 4D9JA 3SPXA 1JAZA 1CRPA 2BHNA 3CRMA 3OEYA 4HMOA 5E7QA 1X7WA 4ATNA 5IDYA 4EJSA 1NC3A 1XU9A 3DW1X 3R3UA 3SEQA 4NZNA 1POWA 4L02A 4TM8A 5DHSA 4IWNA 1EQUA 5EIOA 1QK4A 4TLDA 5REQB 2JEYA 4PX2A 4K6OA 4KAXA 5LZ7A 1PFVA 1UFKA 3RUCA 1KFKB 3C85A 3MTGA 4F8EA 4O2BB 4DUZB 1KQ3A 1N4DA 2RK3A 2AK2A 3GA5A 1DOAA 3QXCA 4LDRA 3OX2A 2VC2B 1YOVA 1MV8A 3PUYA 3ZXYA 3HA3A 4FPXA 1J49A 2Y0PA 3UG7A 2VDNB 1CB7A 2QS9A 4XA8A 2IK8A 3DEKA 4YQYA 1ZR4A 1O0CA 1ZNYA 1VJCA 5I9SA 4UATA 4XGRA 1TUBB 3K0AB 4TLCA 1UFOA 2JJ8A 3BMQA 3S5UA 2I2AA 1J56A 2PMKA 3TDMA 1GPUA 1X1CA 2ZG6A 2BFCA 2NXCA 3E9RA 1RDFA 1UK9A 5FB3A 3WJ1A 4E1VA 1MVNA 3T52A 5ITZA 3EZYA 2I03A 1KYVA 4HH1A 4OMFG 1Y0BA 2XWSA 4PYJA 3LPDA 3OFSA 1C9JA 2OYRA 3LXRA 3JSAA 1FB5A 4BC1A 3Q7TA 2UXBB 1DBPA 1GLNA 3FDJA 4K5QA 4ZKEA 1QHNA 3BS4A 4Z0TA 4ZVLA 1X13A 1PSWA 5BW5A 1QRRA 1IWBB 2A5GA 2D4HA 2RAUA 3H5VA 2BIFA 2ZIUB 3F5DA 1QCDA 2C1EA 2CHEA 4AMZA 4RGBA 3KOMA 1IFXA 2Y1KA 4K3UA 4ETWA 2VP3A 4OQQA 1R4NA 2Q3JA 4IOMA 3GLIA 2Q6LA 4UVDA 5AIBA 5HJEA 2V7GA 3LCRA 4QPNA 1I7LA 3THRA 1H2WA 4M86A 4YHBA 2PZFA 2WRZA 4ZAVA 4D2IA 4ZANA 1QV6A 2R7LA 4D6YA 4C7MA 3NDBB 4Z4EA 2XUOA 4B6PA 3DFUA 4C08A 5CNJA 3X1YA 5ILOA 2OZEA 2BKLA 1FLNA 1Q0UA 1JGTA 2Q1YA 2CLFB 4G1UC 4PCUA 4E31A 4NEGA 4PX3A 4DTCA 3QFFA 1VCNA 1E2UA 3SJBA 1P73A 4ZVPA 4Q39A 5AW4A 2GXAA 1JSZA 4TKVA 1USGA 4XQEA 3UPUA 1XJWA 3AKYA 3S3TA 2B21A 3ZIDA 1XNJA 2XCIA 3JARA 4RHYA 2M2IA 2AMFA 4B35A 2NZUG 1WL8A 3Q7IA 2PZLA 4FOLA 2QRHA 5HF6A 4UHEA 3U7QA 1JHMA 4KOEC 1FYWA 5IKOA 1YE3A 4BKPA 4XTCS 3AY7A 2J5RA 2VZ8A 2QX4A 1JDVA 1HDCA 2LCFA 1Q1AA 2XGMA 1AQUA 3HGTA 4K03A 1W1IA 3M82A 4L9RA 1Y9AA 2XGGA 3IA7A 3IAXA 4IXTA 4Y0VA 3BJEA 2D2VA 4O4JF 5K0CA 4DV3B 3EZGA 2BGJA 3N0RA 3SS7X 3AU8A 3WLRA 4CFYA 1E6LA 4F5DA 4UNRA 2BEWA 1LA2A 2WUWE 5SYMA 3DKRA 1WU7A 1KAHA 4HN9A 4HGQA 4HJRA 4LHEA 1NJ8A 3P9YA 1J8MF 3CXUA 2O4CA 3R44A 4EVRA 2ZRKA 2RBEA 4N82A 5COBA 1GFWA 2YJ3A 2VYVD 3KLBA 1K6MA 5BV2P 1Q95A 4JOCA 4OHYA 3IDOA 1UBJS 5CYFA 2YQ4A 1W2WB 4M22A 5G4KB 4A6EA 4MDEA 4I99A 3RRXA 1NVXQ 1P9WA 1NJ6A 1N2CE 1MO4A 3SE0A 1T43A 2X0FA 1C2YA 3L79A 3WLHA 1AK1A 4WY5A 4YV7A 3TQIA 1K66A 3L9XA 1YRAA 4AJIA 3PX3A 4XSHA 3P0EA 3RS7A 3GEEA 1N75A 1W4RA 1HDXA 4UUBA 1GQQA 3LQRA 4XB6B 2EEPA 3DDNA 2DY1A 2PZ8A 2WF8A 2WFMA 3QLVA 4PO8A 1NDQA 1G20E 1RYEA 2C9ZA 5DMXA 3EXEB 5HKAA 1XWWA 5ILQA 4TTPA 2FZVA 4QQFA 3IP8A 1GZSA 3LM8A 4QDXA 1HDOA 5EC8A 3FYUA 1FRNA 1T9ZA 2R1ZA 4C03A 2GETA 5E4JA 3HCFA 4PLVA 4RQAA 3R75A 1J07A 5IXYA 1U0TA 3BSSA 2HUNA 2P77A 1DIOB 2FZ5A 2RMKA 3FFXA 2CXPA 1LBHA 4ML3A 4EITA 3PP8A 4BVBA 5IDWA 5KNCD 3U6KA 4JI0B 1SR8A 1KY5A 1GGFA 2PUJA 5KIAA 6LDHA 3B20A 5AW3A 4ARUA 3TW0A 4D9MA 1EBUA 4HDMA 4PN7A 1UJBA 5KVCA 1QQBA 2GO7A 2PMDA 1M1XB 4LBWA 2YV1A 2ZRFA 5B1HA 2Z6QA 5BQ5A 3BWMA 3GEDA 4BZPA 1KQFA 4Q21A 1OLXA 2A33A 3ZIUA 1B73A 1PLJA 4BYGA 4Q9AA 1JDZA 5ALWA 2XXBA 2FKNA 3GGOA 2EBWA 3PIDA 1F6WA 4HUQB 3BYZA 1Z12A 3AB3A 4Q6WA 4X65B 2IEBA 3TXAA 1Z16A 4UOZA 1JKXA 3W2FA 1YS4A 4YDRA 2HU5A 1NLYA 2Q3DA 3MGAA 2XD4A 4UUQA 3LXXA 3AGQA 2C9BA 3EAQA 4CIVA 4F6CA 1D03A 1ULHA 1G5FA 2HSJA 4HNAB 4O29A 4RAOA 1KK2A 3AQIA 1KZ9A 2J59A 1QRDA 2RAVA 2VDWB 2VHTA 1U8TA 3BREA 4IGAA 4IV8A 3RABA 3HCCA 2HHCA 2QA5A 2RI1A 3HXKA 3JRWA 1REQB 4ONEA 3TS1A 2LXNA 2XDAA 3RPEA 1S3GA 1RSZA 4IGKA 2QRQA 2V7UA 3PJDA 5LZ8A 5M29A 4B4DA 3U7GA 2FSHA 4H16A 2FW0A 3P7MA 3JALB 4ED9A 4G0WA 3MT7A 3NIGB 4QDUA 2QQFA 3S2EA 1M1ZA 1ZL2A 3R3VA 1FSGA 1JVBA 1UQUA 4IAOA 5D6NA 2NPFA 2P5SA 1ZCAA 2XRYA 3WYFA 3NWEA 4KPUB 3B1XA 3T35A 4G85A 4KOAA 2Y77A 4B5KA 4P35A 1ESNA 1PK9A 1PUJA 1S2LA 1KNQA 1VRVA 1Y9ZA 1WS6A 1GT6A 2XVYA 2QG4A 2XUPA 3GUYA 1JKIA 1E0DA 1FDTA 1KH3A 2FP4A 3OEED 1BS9A 5GZ6A 5DGHA 4IXMA 2QNBA 5I9BA 3W90A 5BUSA 4BN5A 1G2PA 1LD3A 1G16A 1XK6A 3DAFA 3HA2A 1ZLYA 3K1JA 3J7TA 4G4IA 1TMOA 4UPVA 4ENRA 1OA1A 3UM9A 1P19A 3EVCA 3EC7A 3BFPA 4GKVA 4M46A 2O0HA 2OAEA 4JZYA 1WW8A 2I3ZA 4PINA 1M0EA 5LWQA 4GHWA 3N2GB 4AY4A 3TF5A 2VNKA 2JA2A 3BT7A 3NC0C 3QUSA 4WBXC 1E5VA 2Z9BA 1G17A 2C4MA 2DUUA 2WKPA 2ZP1A 3IOBA 3TJMA 3VR6D 5CA0B 4B84A 1YJAA 3OESA 2BEVB 1R16A 4WZAE 3B6EA 4K86A 2FW9A 1JG1A 4INZA 1RFGE 1UKEA 3WGJA 4HWSA 5ELXA 4IX9A 5HKKA 1OASA 5HEKA 1JECA 2PVSA 2XMSA 2MSWA 3AHFA 4G6ZA 5BMOA 3U5TA 3ZY3A 2JLYA 1ZJWA 2F00A 5IASA 5JAPA 4Z8XA 1NP7A 4M1WA 3KQOA 3PQCA 1UZUA 1M33A 5CFNA 5EVCA 1HEYA 1W5TA 3NOQA 3NH6A 4QXAA 3RLIA 4GOJA 1OWOA 3WIVA 2FW8A 1XN4A 3IODA 3ZWVA 3AYZB 4ZAYA 3G0OA 5CFOA 3IQZA 1YZFA 3MJVA 3RV3A 1ZMXA 3ZD6A 3GI1A 4BTVA 1WF6A 1DARA 4OI2A 1ZS9A 1XCGB 2C2HA 1OZGA 4TSKA 3K94A 3ZLUA 3AHHA 3O8QB 4KVGA 4QJ4A 3ZWQA 4BNDB 1E7YA 1IG0A 4MKXA 5C1IA 1TZ2A 3ED1A 1YR3A 4BVJA 3S81A 4H17A 3D6JA 4RIHA 4ZAZA 4OXXA 2C5LA 1MP0A 5C5DA 4MQ4A 4W6ZA 3D0KA 1AMNA 3VISA 1DJPA 1YI1A 3V97A 4YI5A 2H0QA 3ZXSA 2AHOA 5IG2A 1DOHA 1N2SA 3EIEA 4QOEA 1V2GA 4CIYA 1H2AS 3D4NA 2XIQA 4PG7A 2QVLA 3QMWA 4KV7A 4EPWA 3EZ7A 5A4FS 1Y98A 5AW2A 1VE1A 2VWHA 4Y6SA 3K6SB 1NT2A 2P9ZA 1TKCA 5FWNA 4EW6A 2RDMA 1W581 3C1AA 4UBLA 1UP6A 4IH9A 2O7SA 2JAHA 3B12A 4LC9A 3R5TA 3KU4A 3O75A 2XXAA 4RA6A 2C2YA 5B58C 5DEIA 1SG6A 4CKBA 4OK6A 5EJ5A 4ZGBA 2WSMA 4C0JA 3S7ZA 3EVAA 1Q20A 2ZUDA 4WXPA 3OWXA 5FI3A 3L8HA 3PC6A 2R44A 3RUHA 4F11A 3OKAA 4WFQA 5JATA 1TJNA 1V41E 4W63A 3GK3A 3FR8A 4XYEA 4XJXA 3TBHA 2R00C 1QGZA 2FLKA 3LT0A 3TOXA 4D41A 4YCMA 5B6JA 4K28A 4AZTA 3W8RA 1BWQA 1T0BA 1JBQA 5KOHB 4EVIA 1EJ6A 1FFYA 2P7HA 3LO8A 4ZMRA 2FXIA 5K3EA 2MSDB 3FNGA 3TW8B 3HM9A 3W9SA 1MAAA 2UZ1B 1SVNA 3QYJA 3T3MB 1ZN7A 3VYTB 5IZ4A 1R18A 5NULA 4RY9A 2HGSA 1YB1A 1BKSB 5FBHA 3IE1A 1TGVA 1F0NA 1TK2A 2BCGY 2O50A 3D8NA 4Y0NA 3UCFA 1XPUA 2R6AA 2WHRA 4IHJA 3K70C 4FDTA 1XZHA 3AG5A 1MT0A 1XA4A 3MS2A 3QRWA 1XVVA 3G13A 4GPZA 5CGQB 5T4FA 3RADC 3KE9A 4X1IA 1H42A 4K3VA 5IMSA 3SE7A 3D6AA 4FHZA 3IUPA 5GONF 2D1TA 4BZQA 3G7NA 4ISBA 3FZQA 2VDMB 1PU2A 2P27A 2XMGA 2ZTUA 3E27A 4OMUA 3ZBTA 1WTCA 1K8RA 4BVKA 3SQLA 1N7JA 3IAFA 5EKDA 3T1OA 3NKVA 3U13A 3FUTA 3JQGA 2B4AA 1RWNA 2AFHA 1KI6B 5HCIA 5I9MA 5HRCA 3F1KA 1Y9EA 3OG9A 4MKGA 1E1KA 3TIIA 1B1AA 1M8JA 3KYIB 2UVQA 3PZBA 5K0EA 1HMPA 4I1VA 3OZEA 4Q4DA 3LQFA 3T34A 1YDFA 2B7LA 2EHJA 1C1DB 1I2CA 2NZYA 2ARKA 3K8YA 3FCYA 1HG0A 3KBBA 2D0DA 4ZI5A 2P6RA 5AXBA 3VU8A 1HSOA 1BCRA 3L4EA 2A92A 4AJJA 3CYFA 3DNPA 3Q3CA 1OWPA 3NT2A 4BNJA 4M8KA 4CKEA 1KF0A 1XMJA 3UMRA 5EY5B 2DOKA 3URKA 4ZV4A 3UYLA 2Z4RA 1I7SB 3PQ3A 5FOVA 3QE0A 1H0KA 2NV0A 2QI9C 1KEVA 3OY2A 3R2JA 4IIJB 4F1KA 1NDHA 1LPBB 3TZ6A 1U2DA 1XOIA 3OU7A 5CFLA 4MVYA 3R6TA 1UWVA 1GHTA 1SOUA 2PJRA 1V1JA 1KI4A 2OHVA 4MK4A 4II2A 2PT6A 9ABPA 1QB7A 1FIUA 2V6JA 2CDCA 3C1UA 1FDIA 2WSLA 2COKA 1RXSA 5B36A 1QE5A 3EPHA 1XQXA 1PRYA 3BWXA 1U9IC 4KQJA 4Q05A 2XZPA 4YB8A 4HSGA 5ELLA 4AY2A 1ZIXA 3X1DA 3ZS8A 5JRDS 3DVQX 4ZEMA 3PHIA 3ESAA 5AXCA 3LZCA 5JSZA 4NYMQ 2YBDA 1P2DA 2GZ2A 4Y6OA 2R6CA 1TT5B 2EGUA 1G6KA 1SUBA 2Y1FA 1E3WB 3JV7A 4S1TA 5DHTA 1Z5WA 2IIVA 4OLAA 1TAGA 4QBFA 1S8FA 2R85A 3O93A 3B52X 3ZY6A 5LVAA 5H8WA 3CLSC 3MVEA 1N5RA 4RZHA 2ZB8A 4OHOA 2CJFA 2V8BA 3TNLA 1VIMA 5FPSA 5A9SB 1UDRA 1PJ2A 1TTPB 4R2KA 3LP6A 1SZPA 5JMWA 2J5KA 4ZP1A 3HCOA 3QW4B 5JMPA 4D4MA 2B8TA 1DWPA 4JP3A 1DQRA 4MB2A 1NXPA 1TPYA 1PX2A 5IU6A 1L1FA 4YP6A 3TKAA 1H85A 4DCJA 1XNQB 3WNBA 3L7IA 4G5SA 1P2GA 4YRSA 4HDAA 4IV5A 2YQ5A 3LU1A 3ISTA 3EEFA 4HAXA 4IUCS 4BWGA 5I7SA 4BQRA 3U5ZB 1UPXA 1YUNA 1CDZA 2ZRNA 2EBFX 1RXEA 3L5OA 4EPYA 3AUYA 2GJAA 3C5WP 3G68A 3V4VB 1ZM4A 1LRKA 2OSBA 2J3DA 1TK9A 3BERA 1EJ0A 4OFXA 4Q5IA 1E7QA 3GDGA 4U7HA 3QITA 2L19A 3A11A 3W7VA 5KSOA 2Q2WA 3B5EA 3GCWA 5CLHA 3R6LA 3PD7A 2GM3A 4MUGA 5IN5A 1PJLA 4R8RA 2A0KA 4OIFA 3KZ1E 1KEWA 2VSQA 2OFWA 2HFJA 4BO5A 4GL4A 3DGFC 4XWKA 4AM8A 2CBGA 2ZVDA 1S8AA 2C2WA 2GAJA 2V7WA 3KFVA 3KHUA 4FOTA 4CL8A 3QJ5A 4EYSA 4HQRA 3ENZA 1YDWA 1ZNZA 3UJ3X 3UAGA 3R3YA 1NBMD 4QD3A 1WXQA 1UKVY 3DW3X 1GSOA 3OKPA 1EQAA 2RHCA 3EE6A 2VWGA 3AIOA 4M0FA 4UD2A 3GDWA 3WKAA 1XU4A 2BONA 2J3HA 1RM3A 1GGNA 3PHGA 1TF2A 1RBZA 2DJIA 2VYND 2JJ2D 5AW9A 1E2HA 1US8B 3X1WA 3DTYA 1A97A 4FMDB 1KE2A 2JD2A 2JJYA 4QNRA 1KSGA 1LPMA 1NJ2A 1XT6A 2QMEA 2ZWPA 2CWDA 3EGDA 2ZJFA 3GVHA 5C7YA 2XCSB 1P3DA 1XVLA 2H18A 2P2YA 1C81A 1SVSA 4L1KA 4J0KA 1LV7A 2QBYA 5JNWA 1QZ3A 5CYPA 4CEJB 1RTTA 2Q21A 2WIFA 3CSUA 2IZZA 2J7PA 4R3WA 4ZV9A 4DF3A 2GZMA 3K0FA 3B2QA 1RHJA 4YCAA 3W05A 2HRRA 5LU8A 4AJ4A 4MLZA 1AQNA 1SOVA 4C0KA 1ZEJA 4GMHA 2J33A 1U90A 2Q07A 3GRYA 1FP4B 4FFNA 2IX3A 1YFLA 3T3GA 1CF2O 4XLTA 1L4EA 3RJZA 2O07A 3D3WB 2QAGA 1OBCA 4XGIA 4YBRA 1CDDA 5AUQA 3UMGA 5KNCH 3ROFA 2GM9A 3A2KA 3BDVA 1RYBA 4Y2GA 4JJGA 4JGIA 1ECFA 4MULA 5T57A 5JMTA 2NAFA 1K89A 4WOPA 2OR3A 3PG5A 3F0TA 4QXMA 1L7EA 2WHXA 2J07A 1ESEA 1U02A 2GZSA 3OP4A 3IP1A 4RM2A 4AUKA 3KB2A 3ZGZA 3E3MA 2F55A 3U1TA 1Q7GA 3A6ZA 1W88A 4PXSA 4HRVA 1QH1A 3OE7A 1KO5A 4YCLA 1T6YA 1PS9A 3JQFC 3WK8A 1E3IA 4D3YA 2EFDB 2QR5A 4WKGA 3EEBA 1RI5A 3CZQA 3N2KB 3OBBA 1YF3A 5TY0A 5AHKA 1T4GA 1KWGA 1LK0A 1T0PA 2X0JA 4NDAA 5CFRA 2WWGA 2A0XA 2W83A 2WZCA 3GH1A 4RUKA 5DM60 1KY3A 1SG9A 3V2GA 1P7PA 1U2QA 4ITUA 2GWRA 3EGCA 1KYZA 2FGJA 4A0QA 4DBZA 1E4YA 4Z4QA 1EP3B 1E6MA 1IHXA 3CWCA 4Y9UA 1A04A 4DLBA 4C2TA 4HFNA 4U2BA 5KJ6A 4E2FA 1QF6A 1N9GB 1M6WA 5PNTA 4PU0A 2A0UA 1XEXB 2MYPA 4UC0A 4DG8A 5JNTA 5FO1A 4PR0A 4TROA 4DQXA 3QPUA 2FXVA 1TL7C 4G67A 4NBWA 1N8NA 3GEMA 3PKIA 4EY5A 2VH5R 2UXDB 4LN1A 3QFSA 4NFHA 2A5YB 2YH2A 5JADA 3EDMA 3HL0A 1I2ZA 1CVLA 3L7CA 1WNFA 5MFZA 7MHTA 4F5EA 3RANA 4LEIA 5C34B 1FFHA 1ZN2A 2NO4A 2BBSA 3MWGA 3Q85A 3OVMA 4BX8A 4LWOA 3IMCA 3GPIA 1CUDA 4DCMA 2J6HA 1XL0A 3NYWA 1J0XO 2C77A 2YOGA 1Z2DA 1JDJA 5EZ6B 4JNKA 5GTDA 4A8JA 1RLIA 2VAXA 3M2TA 4I46A 1JNXX 5GOZA 3D6NB 4G4SP 1JJVA 1O6BA 4BTEA 3X1KA 4AJ1A 2Q27A 3SG0A 3AOEC 1RHQA 1EP1B 4JA0A 2AXPA 4WZBE 3O3NB 3ZU5A 4D26A 1R9NA 2EKPA 2FQYA 2XAAA 3MTJA 1BSVA 3QLEA 4W4TA 2IF2A 3GLVA 3VR6H 1ZOSA 1ZR2A 2XUQA 1AZLA 5FBQB 4LHSA 1BD4A 3RNLA 1YJQA 4X3PA 4A1FA 5KTMA 1Q50A 1GAWA 4GSKA 1E9VA 4HDRB 1KVSA 3KSZO 3L2OB 3BFKA 1TD9A 4GUDA 3C5EA 1KAMA 2PUVA 4R9UC 2IP1A 3W1VA 1OBHA 2OFOA 3TB4A 1JAXA 3ZHSA 1TXGA 1YUMA 2GEVA 1JFVA 2AOXA 2HY7A 1XMIA 1NQAO 4I4TF 3FGOA 4TMTA 3AUXA 4CMKA 3QX3A 1M66A 5KTYA 3H6GA 2WIBA 3IT2A 1YRYE 2TMYA 1BEUB 1JVSA 1JU4A 3KQQA 4FLEA 3VJKA 3HBAA 2X58A 1Q5PA 5GP1A 3ZWKA 2GPSA 3B53X 4ZEOA 4R01A 3U09A 2G0NA 4DV7B 4NMHA 4NZMA 4EGSA 3GVPA 4PFJA 5FFFA 5A6SB 5JBIA 3TX6A 2H11A 3VVLA 1FNBA 4FDVA 3AF2A 4H7HA 3DS8A 2X0NA 3ZH2A 4OXRA 3ESZA 2ZZNA 2X8WA 1EX6A 5CK4A 1W4LA 3KHSA 1RQ2A 3AFIA 4BDSA 1M6EX 1SVMA 4DA9A 2QNRA 3JZMA 5IYZF 2WYIA 3N70A 3EQ9A 7ADHA 2VDQB 1Y3AA 5JQGB 4Z5XA 1WCYA 4JLOA 1AQYA 1WWKA 2PX2A 2JF0A 2YJ6A 1ODCA 3GDOA 1QHEA 3PK0A 3R24A 5GVRA 1QRTA 3NMUF 2C9DA 1QZTA 3F6RA 4QSMA 1U8FO 2CY0A 2E4WA 2QVBA 3TLCA 1T2CA 2WKRA 4Y6GB 4GBED 2A0FA 1DC4A 1V43A 1Z6ZA 1AGPA 1DAIA 3HVJA 1QFZA 4WEOA 3BD7A 1FJHA 1YS2X 1Z7YA 2NYRA 3GLGE 2IWRA 3DCIA 4BCDA 2AJTA 4KITB 3JRXA 2XWBF 2C07A 4DA6A 4TRJA 5CIYA 2QD4A 1U0EA 4X1YB 1H1DA 3ODPA 3GJYA 3L7BA 2X9GA 4FR0A 4YDQA 4FMPA 4NZ9A 3IAS6 1AKTA 5HXAA 3GRAA 2NT4A 2X77A 5GAJA 1CZHA 1KAEA 1TX4B 2DPYA 3EQ8A 5JSUA 1VP3A 2VDPB 3A6LA 5HIJA 1JHQA 2QYOA 5FBKA 3OHPA 2CLIB 4Q4CA 3A9UA 5IT9A 2WLSA 3H3JA 1DEHA 3PE3A 3U4CA 4D4JA 1NXSA 3KETA 3GLFA 1PBNA 4C0XA 4PSUA 3NDPA 1IQRA 3S8MA 4J7AA 2GN9A 2C7PA 3UENA 3WLSA 5KQPA 2HD4A 3FSGA 3MM4A 5EJFA 1JAHA 3HNRA 5EXEA 4NRDA 4YRMA 4UZFA 1RXUA 5EIWA 3C41J 3NORA 2ZE8A 3UJ7A 1CQXA 2I8CA 1MR3F 2WTBA 4X1KB 5DLDA 4K9LA 3TOVA 1HFJA 1U6KA 2FSGA 1L8AA 2I7VA 3W04A 5TGDA 3BB4A 2VP5A 4YAEA 3H04A 3L7MA 2IY9A 5BYAA 1MOZA 3MAAC 1LS1A 1ZISA 3D6UA 4KRFA 1GZ3A 1UEJA 1P4HA 2KMLA 2NSLA 2YNMD 1M6HA 2Z8ZA 1GRQA 3JZAA 2EARA 3HJGA 1RPJA 2Z5VA 3JWEA 5I5EA 3H11A 1E96A 4I6JA 3WGMA 1LPPA 1DO2A 3C16C 3Q6IA 2VDKB 4CT5A 1KFCB 4CRWB 2CUNA 2FFBA 4BFZA 4JC4A 4RE5A 2WK1A 5DCWA 5JZMA 3V9AA 1D6SA 1O95D 2JFWA 1KARA 3VZCA 4IDNA 4KYTA 2H4ZA 3ADKA 4LQDA 5LXTB 1HYEA 2GS9A 3CLRC 4BVLA 1JEEA 3U0BA 5DLYA 5I7HA 3ETGA 2SECE 2R8RA 3OQPA 4J43A 4XD2A 1Y80A 5FWYA 2J0UA 3A31A 3RYHB 1Y8QB 1M1UA 1HTTA 1WMFA 2V8OA 3L0OA 4XR9A 1JQAA 3GUCA 4B6SA 2CGEA 1YRWA 3DE4X 4X97A 4MYCA 3FYTA 4F3CA 2XADA 3R5HA 1EP2B 4HBGA 4JQZA 4R1QA 4R1MA 3RVBA 4JGBA 4YACA 2DR0A 1YONA 3VZPA 4D8YA 3IALA 4E0BA 4F92B 3HGQA 1TM7E 2X41A 2UZAA 3JVVA 4IF4A 4JY7A 1P2FA 4JUFA 1UJ4A 4MXDA 1ZH4A 1J97A 1NF8A 3UFXB 3C3PA 3FFWA 3GC6A 3WLPA 1OB2A 4FONA 2Z5GA 3P4YA 3IIEA 2IU3A 5ITZB 2QTNA 1N33B 4ADSG 1TYEB 2ZI7A 2P9TA 5A4MS 5HJ7A 1EG7A 2AJBA 4CM1A 1DIBA 1L1QA 1WSBA 3R7WB 4PX5A 1VDMA 4RH1A 4YJ2F 2BEJA 4OSEA 4U7FA 3LHDA 4XQ0A 3VQTA 4US2R 3THYA 1Q6YA 2D59A 2O0JA 1J20A 4FGJA 1W0JD 1U9JA 2PS1A 4PPYA 4U7JA 5ALKA 4XQ9A 5MGBA 3C39A 1TAHA 1HYHA 4UU0A 5H9VA 3O2NA 3TINA 3P9ZA 4MJ7A 4A8JC 1A96A 4C88A 1DTWA 1V3TA 1RIIA 4QGGA 4QA9A 1CYDA 4KXLA 4M0EA 1QHSA 3LXMA 1OROA 4G8CA 1KYXA 2O7RA 1Q0SA 2WM9B 2ZIGA 4MAMA 4DUGA 4TTTS 4A0HA 1XN1A 4B3JA 1E3EA 1XE3A 4OHFA 1UT6A 4BLVA 1PDVA 3IKMB 1Y63A 5HZKA 3KTFA 3N59A 1FLAA 3GFSA 1L4UA 2X8AA 2AHRA 3IKVA 3KJEA 3KVVA 3LHSA 4CMIA 5LIPA 4I2NA 5CIQA 2HC9A 5EESA 2PFSA 1TF7A 3ZHZA 3DQQA 5SY4A 1P7VA 2X6RA 3HUDA 4U5QA 1WMEA 4GKAA 2Y92A 4NOMA 5D7BA 2OXFA 3TMYA 4FR2A 5J2TF 2VBIA 2X7JA 3O0DA 3MS7A 4IICA 4LY6A 4C3ZA 2WFAA 3RG8A 1H2ZA 1KDOA 1Z88A 2R47A 4PE5B 1SKYE 3IJPA 5BSRA 2FEXA 3ZQKA 3ZR4B 2OAP1 2JCSA 5FA6A 2ES4A 2V6IA 3PUKA 3KKNA 3FN4A 2FW1A 4PANA 4IZOA 5TT1A 2PGNA 2WUEA 1R8QA 2JK1A 3GPCA 5JUWA 1L8OA 2C7QA 1E3MA 3A2LA 2O3QA 4W9NA 1GPJA 3VV2A 1UMBA 1DB3A 3FMIA 2VH1A 1PGNA 3UC9A 5HOEA 1QPBA 4TXHA 2GZDA 4NNOA 5KQLA 1V8ZA 1FDOA 3NYIA 4F9FA 1YK0A 2W4MA 4I1SA 1RR6A 3DC2A 1Z25A 3HB5X 4LX0A 2NSHA 4DMRA 1NUUA 3H3FA 4Y2SA 5BRAA 4D45A 1KYIA 1MDFA 4QUBA 4ZTZB 1Z6YA 2PYDA 3T7CA 2YWHA 2PKYX 2VJMA 2HQBA 4KE6A 4GM1A 3FPAA 3AR6A 3H9JA 3PWSA 3COSA 1Z8NA 3BK7A 5JVDB 1MOPA 2BFMA 2FUKA 1EFLA 4KJXA 1Z26A 2ZYIA 5IJXA 1M1NA 1W85A 1ABEA 2HADA 3HU3A 4ER0A 5CD9A 4HQLA 2QE7A 2OOKA 4F4JA 2CLLB 5C8VA 3IUEA 1TKAA 5J9FA 5JDCA 2JLZA 2VJDA 4DJEC 1FS6A 1LBIA 4RFVA 2GCOB 1XVTA 2FP3A 1FFBA 4ZCTA 3A3OA 1Y6ZA 1KMNA 2JKVA 5FO0A 1NF9A 2QL7A 1CX9B 4GPAA 4RHCA 3RT9A 3ZDYB 5FL7D 3KT3A 3LDUA 2A14A 4Z3DA 4WCFA 3A32A 1XTKA 2EV9A 4YNBA 4HLCA 4K1LA 3Q9LA 4KNYA 2J5QA 1M2OA 2IDMA 2PKQP 3AUAA 2GUGA 3LDHA 2H8GA 5TX7A 1GR0A 3NB0A 1U8EA 3TCNA 2ZIVB 3KAPA 3QPAA 3QEJA 4NULA 3IVMA 4HF7A 4WSOA 4L08A 3TPCA 3OQOA 5SZJA 2WB2A 1GTRA 3HCBA 1SVLA 1DVRA 4PG6A 4HXYA 4MP8A 5LA6A 4ESEA 4ZHQA 2HLDA 1DKOA 5KS2A 4RKFA 1EGMB 4UFOA 4HTFA 2FVYA 2VZLA 2YINC 4NOJA 1M2VA 1N1DA 4BO8A 4RK6A 4ZYXA 1YU6A 2EDAA 2CFRA 2G1UA 1HE1C 2GGSA 621PA 1ZK3A 4CFZA 4JBHA 4X8MA 3GAAA 2C3YA 2NTEA 5DCLA 3WDKA 2ZYAA 4DTIA 3EWIA 4JX9A 4WNCA 2FPUA 4DSTA 4OIMA 3A1NA 2AIRA 1XHLA 4IZ6A 3DLTA 2Z5FA 1DC8A 1W0CA 2P11A 4CLRB 4FCCA 4NZYA 4G0MA 4JB0A 2WG1A 3L0IB 3WXBA 3FNRA 2HB6A 5EHGA 1M7BA 1PJCA 2JAPA 5K4GA 3M6AA 1EUCB 1JBEA 3RNOA 5FBLB 2DPGA 4EQZA 5BV8A 5CB4B 3NHSA 5HDBB 4DE5A 3SX2A 1E99A 4DLYA 4Q4AB 1ULUA 2G40A 1IM8A 2LUOA 4RS3A 1E9CA 4X1OA 3K05A 2LKCA 4DIEA 5BN4A 3UPTA 1SAYA 3W9BA 1VLZA 1IATA 3I8XA 4OHXA 3M6VA 4MVJA 4FCTA 1Z74A 4MHSA 2HA7A 4LZPA 3IV6A 4NABA 3AR2A 3FWPA 3ZC3A 5HIAA 2AG1A 1KK0A 5GADl 2OCGA 3Q8MA 2UUCB 1UWLA 2BGIA 3CNEA 1AUVA 1CG6A 3EGXB 4R31A 1O89A 5E7IA 1V5FA 1IOVA 3NVAA 2A1TR 3GFBA 1AS3A 1HXHA 2H9AA 3A25A 2LCQA 1KJYA 1U1CA 4QBHA 4RKWA 1UBLS 4Y2JA 1XZQA 2YHIB 4Y2XA 2CSXA 2I29A 2QRNA 4YEDA 2B37A 3B6JA 4CCYB 1I6WA 3C98A 3E15A 4LJ6A 3MPOA 4DDKA 1IXSB 2C95A 2PMFA 4L6IA 3NHMA 1NN5A 2I3DA 2J08A 3IH5A 5L4SA 3FTEA 2D5IA 1Z9BA 2WWRA 3G2KA 1S2MA 4N49A 1WKVA 4J8PA 2GEFA 3I6YA 3GMIA 2XCUA 5E4TA 2CXQA 3KXKA 4ARZB 1PS0A 1SD5A 2DWCA 3TECE 1ORTA 1O9HA 1Y9JA 2OCIA 2VHYA 4JB2A 2CC2A 1BXRA 2G9UA 2HJRA 2Q5LA 3LYHA 4B3GA 1HYQA 3JASB 2Q1WA 5KJEA 2O9JA 5BSTA 5DT2A 3THSA 3DTVD 1Y42X 1SKQA 3VVMA 1CUFA 1DJMA 1OAOA 1CU1A 2K7ZA 4MS1B 1JI3A 3TDKA 3NCTA 1J8QA 5IHPA 3EG9B 1WCIB 4G81A 2P41A 2CBZA 3G2MA 4BO1A 3I64A 1EDDA 3VR3D 3KOZA 1NF2A 1B7GO 1PT9A 4MB0A 4UE2A 2J45A 4TL9A 2W2OA 4A0RA 4Y6LA 2C2ZA 1FSSA 2A9RA 3QY9A 3WK6A 2GCEA 1GXSB 5B1YA 4C06A 1M34B 2IEYA 1AZSC 3GYGA 2XGOA 2OPHA 1GG2A 2B8WA 5KYGA 2KM1A 4FXPA 4JNCA 5F2KA 2BYTA 3WRWA 1PEAA 2BE7A 1P0FA 2QLBA 4D98A 1W1WA 2X0IA 3VR5D 2O54A 3EHDA 2BJHA 3JAKB 3N86A 2DERA 5G3YA 4LBVA 1M5UA 2EKZA 4MGIR 3J81A 1RLOA 3F6SA 1V1RA 3TG8A 2PANA 2Y0BA 2AL7A 1PKEA 4DLUA 3QBJA 1PGPA 5HP4A 3AVXA 3BGIA 3N8NA 3E9DA 3RUPA 2IYPA 3UJ8A 5JSYA 3V2UA 1JHYA 4KNVA 2AUNA 1VG0B 4BP8A 1N3YA 2DKFA 4QJIA 2HA2A 3N2ZB 2H2FA 3M1LA 4Q1BA 1DIAA 1JE1A 1SC6A 1YDMA 4NESA 5JWHA 4YFYA 3TSCA 4UUNA 4UHDA 1M2FA 1DDOA 3QX9A 1JKJB 1QIFA 2PQ2A 1KGSA 2C9YA 4WASA 4BNTA 5KX5A 4G5HA 4HYEA 1L5ZA 1V35A 4TUYA 5MFPA 3LUJA 4EB8A 3FTDA 4QDJA 1BZYA 3V8EA 4JOBA 2V54A 1NL3A 4K81B 4WJLA 4TLMB 1I51A 4ZI7A 2UZ0A 4PSKA 5KNBA 3OPYB 2HDOA 1DKLA 3EUAA 4XAQA 3GRCA 1FDVA 2II6A 2F1JA 5B7GA 3HB1A 3I39X 4PVDA 5D5QA 3RU7A 1EVJA 1VXRA 5CX4A 1PK7A 1T34A 3E82A 3RT1A 4D43A 5KKNB 1W29A 3L0BA 2PJDA 5FUBA 2IYSA 3VPAA 2QUIA 4AWXA 2RJ3A 4I50A 5LP6B 5BYKA 1MW8X 4D5EA 1MPTA 4EX7A 3CE6A 4NH0A 1JPUA 1SBIA 2MDTA 4PZUA 4E94A 1RE0A 4CQNA 1GL6A 1OXTA 3OZAA 4GMFA 4HDCA 4LVOA 4Z4HA 1HWYA 4M8IA 4KN6A 2AN9A 4YWJA 3VBEA 2B7BA 2WMYA 2PS3A 2J0SA 4R7TA 4JT9A 1XTVA 4NJOA 5B37A 1Z5PA 4NCAA 4BX0A 4CMEC 4O8ZA 3L0ZA 4QG3A 5IZCC 2ZSEA 1P1JA 5JZVA 4BMYA 1Z4PX 1JNYA 2A67A 5DIFA 2HCJB 1XJ5A 2YXDA 3P96A 3Q7PA 4C04A 2HMUA 2P65A 1WXXA 4K6MA 1SK8A 3ZHRA 1ADBA 1J21A 2BFDA 2Y2VA 2JIDA 3HUUA 4CV0A 2P3SA 3Q7QA 4HDNA 5TMBA 1Z33A 3T5BA 1NKVA 3THXB 4DEXA 3OLCX 2AZTA 3R40A 4D74A 3CH6A 1CW2B 1GL9B 4LW8A 2IDKA 3OX3A 5HW0A 1WBJB 1XTIA 4YASA 1IMOA 2WZDA 1RKVA 1BN7A 1DC3A 1EUDB 2ODBA 2P5YA 3MGGA 4YDHB 4LDZA 4AY5A 3NS7A 2FW6A 4F2WA 5A3RA 4H6PA 5T64A 5K99A 2ZZMA 2R1VA 2X4IA 2QPTA 4IOJA 4P08A 4RBNA 4QFMA 4HS4A 5DN9A 3W2GA 4TKUA 1JXOA 4TT3D 2VJAA 4YROA 3GZNA 5IH3A 1TNDA 1TE2A 4PQYA 1RAAA 4TL6A 1FU7A 2D1QA 1C30A 1WAMA 1NZJA 4RFSA 3GNQA 3M6FA 4IXWA 3VTAA 4AP6A 1FBNA 3JQPA 1GEGA 1PR9A 1ORWA 4RTSA 4M9ZA 5CU7A 3TSYA 3DAYA 3G2JA 1WY7A 3HJNA 4NZZA 4M7WA 1LLQA 1AXEA 4QLAA 3RFXA 1VYHA 4YRIA 2PUWA 4H1HA 4BRWA 1QAQA 2MYNA 3Q1LA 1G0NA 2JFPA 1DRKA 3K8OE 3IHLA 3FGZA 1MNAA 1YKGA 4NBKA 2O3SA 1MN6A 4X20A 5SY6A 3KXLA 3MWFA 3MZ0A 4XJTA 1TUEA 2I3AA 3PYMA 3EGEA 3PC4A 4ZIRB 2JI6A 2WF7A 3AQ4A 3RC1A 1WVMA 1JQKA 3STUA 4KXUA 1I01A 1GFIA 2J9FA 1U5BB 2QL6A 2Y1DA 3F74A 3GARA 4I4CA 4ZAWA 4EHJA 3ADDA 4U9UA 4B3RB 4C7VA 4B3IA 3OCCA 1M0TA 1U0JA 3BMOB 4R83A 2FOIA 1GU1A 1BH2A 4IH1A 1RI1A 3V4LA 3TRJA 5GVSA 1D2GA 3HLKA 2G5TA 3U9SA 5BN1A 2XOKD 4KIJA 2JFZA 2B20A 1Z56C 3PRJA 1SPXA 1XD2A 1JMVA 4JYMA 4YAJA 2WINI 3SLRA 3ABOB 2BMVA 3KEMA 1DKQA 3LBNA 4F2HA 3WI7A 4UCQA 1W5FA 1C3OB 1VSVA 2F64A 2YIDA 1MJHA 3DOEA 1O87A 3EDYA 5EZSA 2QTRA 2XGSA 4RENA 3BBPA 4RZ3A 1NMYA 4NDNE 4LSGA 5H5JA 1I2BA 1RBMA 4UUOA 1EJ2A 2X2FA 4PG4A 4ZC8A 2ZBEA 1D2RA 2C0QA 2FQWA 2ZRQA 1CZUA 3OLYA 1KY2A 3OLWA 1JG6A 3PFKA 4E1AA 1OAOC 5AESA 1C4XA 6CHYA 2ZQYA 4RYDA 3GUZA 4MYDA 4N8SA 3ESYA 2REQB 1L5HB 3KQPA 5BWNA 1Q3TA 4YQFA 1UPFA 3DL7A 1MENA 1G8YA 3GNLA 3HHPA 1FTYA 3IMGA 3HEBA 2GKSA 4ZODA 3VH3A 1IVSA 1Y4SA 5LP1A 2YMPA 3K15A 4B73A 3KR9A 3C3KA 1O94A 2CHGA 3BWVA 1GLVA 3K1AA 2H85A 2XJ4A 4DHWA 4Z4IA 2H1LA 3L18A 4LTNA 4PS1A 3MRSA 4OXQA 4QBGB 2BFEB 1Q7RA 2H1FA 2Q46A 3G1UA 2VPXA 2J32A 1HK7A 4UTOA 4DLAA 1W76A 4KEAA 3NUQA 1T4MA 3ORYA 3L0DA 3D1LA 4Q24A 1X2EA 3FUCA 2POCA 3O74A 3RS2A 2BM8A 4Q02A 3VZDA 3DZHA 4QPZA 2WSBA 3C3DA 1HRKA 1GO2A 1G5TA 3H2GA 4YS6A 1RXYA 3RH0A 4D6PA 4MUMA 3M4ZA 1E98A 4FBMA 1B0PA 2HSZA 3VTZA 1HOTA 4RC9A 1OI7A 4HDOB 2HHAA 2XJ9A 2ZSAA 3WR5A 1O0SA 1IDN1 5HR5A 1TZKA 4URFA 3RAGA 3WE7A 2GHTA 2QRUA 4LECA 2WUFA 5G02A 3HQ4O 5T6BA 1K5GA 1UMKA 3HLYA 1U0HC 3PE4A 4R2XA 2D1YA 2IS6A 2C7GA 1K6JA 3HDGA 4MV6A 4N7RA 4QVGA 5EWMB 3RCBA 2GAFA 3Q3IA 4UNQA 1AN0A 3FF4A 2HMYB 4M76B 3AWIA 3TOSA 4RSMA 5LSAA 4C7OB 4XRGA 4ND8A 1JIJA 1FQOA 2V6BA 1CEEA 1YXMA 1AHNA 1XMSA 4N5NA 4LZAA 2BPOA 4PNPA 1N8KA 4FGWA 2QLTA 4UBKA 3VR4A 3W79A 3WKCA 5E9WA 3GRRA 3PJEA 1E1QD 3A0UA 3FPCA 2QVZX 3IVAA 1VE5A 2OPBA 3RB8A 1NOKA 5ALEA 3A6PC 3WO1A 2WC1A 2WFLB 1ODSA 4J7XA 2GFHA 4UNIA 4CMHA 1LPAB 2JLUA 1VPEA 4E4YA 1M6VA 3QGMA 1JN0A 3OIWA 3SQOA 4F56A 2P67A 2C7VA 5BN3B 2HYIC 2I6FA 2BMJA 2CFTA 4HLQB 3D7RA 3R3XA 2JJ1A 3OI7A 2HEIA 1JR3A 2PS9A 1S5PA 2VTDA 5BOSB 1XAGA 2YVQA 4BNMA 5AW6A 4HLUA 3ZCQA 2D2FA 4IHJF 1UF9A 2HYDA 3PEFA 5F5XA 3DTVB 3PUZA 5AI5A 4NP6A 4UULA 3C8HA 4P80A 5EXTA 4O2RA 4KKXB 2KI5A 2W22A 5ECDA 4LC1A 2W9XA 1WOMA 1FJ2A 2VTEA 1DOZA 4JP1A 3AIIA 4MA5A 4EQ6B 1DBSA 2RHRA 4CQMD 5K4HA 2LV8A 4WQMA 1GQYA 5EJIA 4JCCA 2HUPA 5ER9A 1NA5A 2X2OA 5C4IA 1H2EA 2G72A 1SHTX 5C0OE 3TIVA 2I22A 3KZVA 4GX5A 4EG0A 1HDGO 3AK4A 5AVOA 2YRWA 3EWSA 2ET6A 2LP4Y 3ONFA 1EVIA 3ICCA 4N5HX 3I8SA 2NUAA 4G5OA 1WM1A 1VRWA 2VN8A 5F76A 3C4JA 4BC0A 4FLMA 1E0JA 1Z37A 3NOVA 3NANA 4O2AA 4EG3A 4H1UA 2ERXA 4RVGA 3WGGA 4BE4A 3M4XA 1RQRA 3GJ7A 3G6WA 3KYDA 1L5OA 3KRTA 2Y4OA 2AYXA 4PNEA 5BR4A 4KCGA 3CC8A 5C8YA 3U26A 5I45A 4E21A 4RPLA 1XLTC 4DC1A 2Q6IA 1V11A 2VHJA 2QW1A 2ZKLA 4B32A 4CG0A 3KDSE 2WAXA 1PUXA 3RFTA 4B2IA 4DABA 1UBGA 5LL6P 2QRVA 3WHLA 3IX7A 1H4VB 1CE8A 5KCZA 3EZFA 3VR1A 2IYNA 1YU9A 1ZHFA 4Y2VA 1ODFA 4WLOA 4ETNA 4HNQA 4QEZA 2FA9A 1P44A 4AF6A 2HL6A 4NBTA 1MAUA 1E6UA 1N8SA 3T7DA 4L9SA 4CJXA 4ZQIA 5L3SA 1L5GB 4E09A 3OTOB 3MGBA 5TR9A 2B3DA 3SF0A 3N0VA 4JODA 2OBBA 2O1EA 1UC9A 4GP6A 1RKQA 121PA 3BCHA 4IHAA 4DBLC 3G5MA 3EGIA 3IRVA 2ZVPX 5DJ5A 2XMQA 2VJCA 1RYNA 3HXTA 5HTOA 2OORC 2F43A 4RLQA 1SXJE 4ZTBA 1JHRA 3BL8A 2NZVG 4MR9A 5SYNA 2W2VA 2JEZA 3RUDA 2PO7A 2YW9A 1ZXXA 5FPHA 5EIXA 1TOAA 3K9LA 3DTTA 3R9XA 4FHGA 3M7IA 3K9HA 3UK7A 3AVTA 1C7EA 4OFWA 1A2BA 3PVCA 4PHCA 3WAJA 5B5SA 4KR2A 1WSWA 2QRMA 3KS9A 3O1IC 4K8RB 2Z30A 1W73A 3VR5H 3RRYA 5BSFA 3MWJA 4MV8A 5FBWB 2CMFA 4BE9A 2D3TA 1RJWA 1ORDA 3O4IA 3T5PA 3QV1A 4A0SA 4BB0A 1J23A 1XZIA 3SJAA 2V6GA 5HRAA 1PVOA 2Y1LA 5FWXA 2FEPA 3IE2A 3NTVA 4FEYA 4HPXB 3L43A 3VI3B 1E79D 4GE0A 2ZQ5A 4ILKA 3U0VA 4OXNA 4B45A 2MSNA 3W8FA 4BFLA 3O91A 4RCVA 2O8EA 5GPBA 4YUAA 1FRZA 4R7GA 4GRAA 1EK0A 2FGKA 2O8CB 2QT1A 2VYFA 4YCDA 4CMJA 2HK7A 1ISMA 3DUFA 3M5PA 4EHLA 4QDTA 3AZQA 2FWJA 4MS4B 3FTFA 2WYOA 2C5AA 4OD0A 4DLKA 2KHZA 3GEIA 3IURA 4JXJA 1TIPA 3F9CA 2NVBA 1YV9A 4WK0B 2W5UA 3MD0A 3WGVA 4EHDA 2PH7A 3PFIA 3HN2A 1TT7A 4ZAGA 3JW8A 3MQ2A 1K3TA 1MC8A 3GWGA 5JG7A 1USVA 3KAKA 3KLNA 5SZHB 2OLKA 1JRLA 3FX2A 4FMCF 3VI4B 3KG2A 3DWGA 1JWAB 2GILA 1KQGA 1E1CA 3I9MA 2PWZA 4PWYA 5DLQC 1LDMA 2FSIA 1E1DA 4KDCA 4MW6A 5FL3A 2C78A 2OBMA 5F64A 2IYRA 3IT1A 1DRJA 3HMKA 4B3BA 4ZMSA 1JR2A 5K45A 5FA5A 2ZBUA 1Y5MA 3CVWA 4E11A 1Q2UA 3SZMA 1CUSA 3H2KA 4XLLA 3CR7A 4DIKA 3MJDA 1Y3BE 2SBTA 3LPLA 3NOOA 3X1JA 3IKLA 5F12A 1FFGA 3M6WA 2PRYA 3SHTA 3G2IA 4D9GA 5IJAA 2JGAA 4MR8A 3S70A 2FDRA 1XZLA 1NHWA 2VWPA 5K0LA 3CJQA 2VKQA 3HJUA 1QE0A 2VOEA 5KREA 3T7EA 4D9HA 3NDIA 3QUBA 2EBUA 2ENWA 2Z3VA 4WBNF 2DHQA 4G07A 1B16A 4XPIB 1CQIA 1RAGA 4TV8A 4HWTA 2QRJA 5KSZA 2ZXFA 1RBYA 4BGEA 2LDXA 3CRZA 4IEIA 5J3JA 1ISFA 1MH9A 4BFCA 3UKDA 1EZ4A 4B3XA 2B4YA 3QYAA 4MI9A 1VCHA 1U8CB 3FUWA 4CIXA 2J3QA 1EIWA 5JAIA 1MEJA 4HZUB 2H5IA 3O4HA 1O77A 3DC7A 2OOSA 3FWHA 2AFIA 2F62A 4LFBB 4HR7A 4OHCA 1T36B 1DBWA 4PTLA 3T5DA 5JDIA 4UU1A 1OXUA 2XWJI 2XUZA 1IN1A 4FE4A 4QUDA 4UEWA 1NBEA 4COOA 4LHWA 1OBFO 4EA9A 1NW5A 2NU8A 3CLUD 4G9EA 2B92A 4CGYA 4OO3A 4YT5A 4L4YA 2IH2A 3OFJA 3ET4A 3PD1A 4A8TA 4BZWA 3DKVA 4N12A 4GI3A 2IDZA 5EUBA 4QEKA 4ZXPA 4R8VA 2COUA 4N5IX 3E3OA 5LDGA 2OBLA 3WL7A 1T3SA 2VRCD 3DOIA 3KTOA 1BN6A 2VSOA 4HLUC 2C9MA 3ESDA 4Q16A 4TGLA 5ABPA 1EFUA 5CRIA 3H1AA 3K0SA 3TZHA 3Q9NA 1SMKA 4GLOA 1BVYF 3QLUC 2XCTB 2QM3A 2VCHA 1C0EA 1AZTA 1KQPA 3A9CA 3OZIA 4H15A 4DDVA 3R3HA 4Q66C 2JARA 4JT2A 4MV4A 5CM2Z 1G6Q1 1ONNA 2FR8C 2XNDA 4LBYA 3I62A 1DKRA 1SCNE 3ANNA 5CXXA 4HDSA 3EX7C 1ECLA 1L7NA 3BN3A 2GCIA 4FN4A 2RKWA 5TF4A 1RRFA 1JQJC 2Z09A 1QF9A 4QU9A 3FZYA 3RRBA 1AS2A 4P81A 4NMLA 3I8OA 3SYRA 1G20A 3EMVA 4EYQA 2WF9A 1SBZA 1QZXA 2BELA 2WD7A 4B3SB 3E5RA 1KMIY 1X1QA 2ECFA 3NPAA 3QPVA 5DBEX 3IV9A 1PSZA 5GJCA 4RK5A 1JEQA 2FB9A 4YRCA 3V8NA 1TLLA 3VAYA 5KWVA 2DKOA 4FGKA 4KO8A 3DMFA 3NC4A 1RJEA 3SVZA 2XWPA 1M2GA 2GEBA 3RIMA 3JZFA 5BMVA 2YUTA 3J81k 2WSIA 2ZULA 1XP8A 2FK8A 2ZOSA 1NVUQ 3KJQA 3LWZA 3MWDA 1RJGA 1NQOA 3PFCA 4NECA 3EXG2 4RY0A 3FFTA 4K0KB 3QEAZ 4IGFA 3EIQA 4JWTA 1FFSA 1WPRA 1MLDA 3VOAA 1TQDA 5E9AA 5CA1A 4ZALA 3VMMA 3AEXA 2EAUA 3DPSA 3EXHB 3OQ1A 1SKBA 3O3MB 1D1SA 1F8XA 3ZYCA 5IBCA 1ZOIA 2OHXA 4DDWA 5ENZA 1IZ9A 1QFXA 2KYRA 1QYRA 2ST1A 2NT3A 4JC8A 1QQTA 1I9CA 5IK2D 3ASUA 3S2SA 3HRKA 3WNCA 1GUYA 2NTNA 5JXGA 1U5CA 1XTSA 5IDVA 1ADJA 1IH8A 1NXWA 2B1IA 4YP0A 2ESRA 5REQA 2AA3A 1CDOA 1RC0A 1WVIA 1CUCA 3QFRA 3T9AA 4URUR 1BE1A 2QW0X 4FFWA 2EJCA 4Y6RA 2VZEA 2R6GA 4O2BA 1PZFA 3GMTA 3QJGA 1B43A 3P2OA 3W9YA 1W19A 3DZBA 4ZDJA 3DE0X 3QI7A 1SVIA 3QOFA 2I2XB 4L8FA 5FAXA 1DT5A 1YVRA 2HOQA 3IEUA 5B4TA 4NCIA 4B71A 3I4CA 1QMGA 4MVJI 4JWKA 4YRJA 5CDSA 3HB7A 1APBA 4OAPA 3TB6A 3WRVA 1XTTA 3QLJA 3JR3A 1TUBA 5FNZA 3SXJA 5KNDD 3K0AA 3SS8A 3TUJC 3WA6A 4M7RA 1NI3A 2I9PA 3K73O 4MH0R 3AR8A 4NK5A 4S35A 1GZ5A 2H4WA 3CKMA 4MWSA 1G291 2PSSA 3COVA 3E9ZA 1FNCA 3L0SA 2CXXA 1FFDA 3QU9A 4KMMA 5FAKA 2PKRA 2Q8PA 1UANA 2BCJQ 5FJIA 1PIWA 3VZBA 1AA6A 4AIRA 1L8QA 3KQUA 3ROZA 4A8HA 1GPYA 1N2JA 2R8ZA 2L0XA 3I2IA 1FUIA 2IOHA 4GXTA 4HRXA 1JBKA 3EK2A 2AX3A 2ZSBA 3PQEA 4CM9A 4YUWA 2WWYA 1JZSA 4B44A 2JHCA 3TE7A 3W6ZA 4WKOA 1DAHA 3U4QB 3AL3A 4JT8A 1VMKA 4L4RA 3KAJA 4FNOA 4KTVE 1PZGA 1FY2A 1CR0A 4WLFA 1IBKB 1M0WA 5K03A 3H1EA 1VJGA 4L27A 5B2EA 3KOUA 4LZNA 4RV5A 4DMCA 1ISIA 1IE3A 1U0OC 2WTNA 4U2KA 3UO8B 4HB4A 2B98A 4V38A 1YUBA 5FTKA 2G4VA 4D0SA 3WJ2A 1ZOOA 1J99A 1SUWA 2GAOA 3E05A 3MGKA 4H1WA 3X1MA 1D4AA 1EH5A 3IAEA 3HM2A 3I5UA 4PLHA 2H3HA 1F6BA 2PQ6A 5DNAA 4ZCPA 1OWMA 2QT9A 5BRJA 3AXSA 4YRNA 4DS3A 3IAM6 3FWYA 3K6RA 1Q84A 5EMMA 3T12A 5CB6A 4OGWA 3UOGA 4NBUA 4WVLA 5KYVA 4QUIA 2X4LA 4FI3C 4PLCA 1Z83A 5ARDA 4CLOB 1L9XA 3WC4A 1IXRC 5I7WA 4DIFA 1N2GA 3EVZA 5IJ0B 3AEZA 3B3GA 3D7MA 1EUYA 4XUDA 3GJ5A 3I6MA 4Y30A 3H7AA 3F7NA 1MNQA 5CHEA 4QELA 5G2OA 1J5PA 2XR1A 4DARA 3AYXB 2WU4A 2FX5A 3W5HA 1A1VA 4OJTA 3PEEA 4G9BA 5F7ZA 1XJCA 1JWBB 5E2BA 4DB4A 4DSZA 3AV0B 5FTMA 1P77A 1D4FA 2GF2A 1PVDA 3PFGA 1HR0B 2HO5A 4UUPA 2OENG 1P80A 4EAAA 2IV2X 4KLCA 3CUVA 5LLDA 4NYIR 3DOJA 3RFVA 2BF4A 4C78A 3NZEA 1FYDA 3AILA 4CG1A 1G64A 2WE8A 1DS6A 3I3OA 3IPYA 3ANSA 2CXHA 2PV0A 4F2DA 3IVCA 3M4NA 2WWHA 2WSSD 5FLYA 1ZJ5A 1YI8A 2G36A 2NO0A 1C3EA 2ZIEA 1M2EA 1ZINA 3M5DA 4TRRA 5F3RA 1XF9A 2BKXA 3LWNA 4UBNA 5AOBA 5JDIC 1JSLA 1G4AE 2QPLA 3TLAA 5G4KA 3UBMA 2CHVA 4ERXA 2IU6A 2VF7A 3ZJ5A 3NAMA 5AJUA 3DMNA 3TZLA 1NVAA 4MDHA 2QLMA 1JFFA 3OAAA 1C7JA 5AKHA 4DIMA 4CYMA 1JH8A 1KZHA 1ZI9A 1DPGA 1I6KA 1U2GC 1UODA 2DWUA 2OEPA 3O1JC 2FHSA 4RCZA 4FJ2A 8AT1A 4MI1A 1GCIA 1Z22A 4FOOA 3S2UA 4D82A 4NAHA 1A7KA 5ADWA 5F9HA 2OHGA 3JQDA 5JMOA 1SKMA 1NSYA 2DPMA 3UAZA 1U8YA 4HI0E 3MJCA 3FTNA 4XIFA 5CLGA 1GV0A 3ND6A 2OT3B 1FYFA 3ABRB 3EXEA 1T0HB 3AI2A 4C0SA 2RB5A 3C6ZA 2I2BA 1OD6A 1BDHA 3GFFA 2V7PA 1C1HA 3IERA 3H97A 2FU5C 4LG1A 5E1OA 1RP1A