1PTKA

Studies on the inhibitory action of mercury upon proteinase k
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Studies on the inhibitory action of mercury upon proteinase K.
pubmed rcsb
source organism Engyodontium album
molecule tags Hydrolase(serine proteinase)
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ptkA00
2DUJA 2Z58A 4JP8A 5JXGA 5AMXA 3WHIA 1PEKE 4HX2A 1GA6A 4DWWA 3F7OA 1YJBA 1IC6A 1HT3A 4C3VA 2V8BA 5AVKA 1KDZA 2IY9A 1MPTA 3DE6X 1R0RE 2XTJA 1AK9A 1AVTA 5JMOA 1R64A 1MEEA 1Y3CE 4H6WA 2PWAA 3Q40A 3DVQX 3DE0X 3OSZA 2SICE 1BE8A 1SBNE 4OMCA 1GT91 5B1DA 2Z2YA 4KG7A 3BX1A 1TO1E 1TM7E 4FONA 5FBZA 1R6VA 2GKOA 1SIBE 1Y33E 1YJCA 1C9JA 1WMEA 1KDVA 3DVSX 1OT5A 5CW1A 3H42B 1DBIA 2P4EA 5JXHA 2DQKA 2Z30A 4WOCA 3WQBA 3F49S 5FFNA 3VHQA 4LVNA 1SUCA 3QTLA 1KE1A 4J94A 2DP4E 2W2NA 3A3OA 3PTLA 4YN3A 1SCAA 3DE1X 3F7MA 3AJ9A 1P8JA 1ST2A 2E1PA 3AJ8A 1VSBA 2W2OA 4WOBA 3DE2X 3HJRA 3P5BA 3EIFA 4C3UA 1GA4A 1Y4AE 1GNSA 2X8JA 5K7SA 1CNMA 1TECE 4LVOA 2Z2XA 4K8RB 2PRKA 3VSBA 1V5IA 3LPAA 1BJRE 3QFHA 1A2QA 1SUEA 1AF4A 1GTG1 3SICE 1TM4E 3UNXA 1BE6A 1THMA 2WUWE 1WVMA 3GT3A 3PRKE 1UBNA 5FAXA 2ZWOA 1AH2A 3TECE 1V6CA 1Q5PA 3D43A 4Z2AA 1SCBA 1SCNE 2TECE 1PJ8A 1NDQA 4H6VA 1NDUA 4NE9A 3I34X 3CNQS 3D9QX 1NLUA 3TI9A 1C9NA 3DW1X 1BFKA 1OYVA 1SIOA 1Y3DE 4ZOQI 1AV7A 2ZWPA 2G4VA 2PKCA 3VYVA 4M1ZA 5AQEA 1S01A 1OYOA 4CFZA 3DVRX 1SH7A 3L1KA 2W2PA 1BFUA 3I2YX 4B5LA 4MZDA 1SBIA 1S02A 2SNIE 1KDYA 3DYBA 1LW6E 1SELA 4OMDA 3ZXXA 2B6NA 1ST3A 3BPSA 3DE4X 1C3LA 1YJAA 4RYDA 1T1GA 2XRMA 2HPZA 5JXIA 1WMFA 1T1EA 1S2NA 1TO2E 2PQ2A 1WMDA 5JXJA 4ZARA 1YU6A 1KE2A 4HVLA 1SIUA 1TMGE 1SPBS 5AVJA 1SBHA 5B1EA 3BGOS 1AQNA 1SBTA 3AFGA 2ST1A 2PYZA 3DE7X 4OV6B 1SBCA 2WV7A 1PFGA 3DW3X 1SCDA 5I9SA 1GA1A 1AU9A 1Y4DE 5ARDA 1TK2A 3EE6A 3GCXA 1TM1E 1SCJA 1Y3FE 1GTJ1 2PWBA 1Y48E 1ZVJA 3ZXYA 5ARCA 1Y9ZA 2Z56A 2W2QA 1SVNA 2SECE 2Z2ZA 3DDZX 3GCWA 3LPCA 3LPDA 2ID8A 1TM5E 3VV3A 2X8JB 3VTAA 1DUIA 1T1IA 1Y3BE 1P7WA 3WIUA 4BWGA 2WWTA 4CG0A 4I0WB 1EA7A 3EDYA 4DZTA 5ARBA 3DE5X 1C9MA 1JEAA 2QTWB 3A3PA 3GT4A 3DWEX 1ZVKA 4CFYA 3Q5GA 3WIVA 1CSEE 3I37X 5SICE 4NE7A 2W2MA 2ID4A 1SN7A 4KB5A 1GCIA 4KPGA 4DJ5X 2WUVA 1WSDA 4GI3A 1SUDA 1Y1KE 1EGQA 3VV2A 2HD4A 3A3NA 2IXTA 4H6XA 1GTL1 1SUAA 1SUPA 3LXUX 1SUBA 3CO0S 3QMPA 1P7VA 1Y34E 4AKTA 2Z57A 1GNVA 3DE3X 3I30X 4AKSA 3SQOA 2ZRQA 1TM3E 1XF1A 4NMXB 3T41A 3TI7A 2SBTA 1IAVA 2PMWB 1BH6A 1PTKA
chains in the Genus database with same CATH superfamily
3B78A 4HPWA 3MWYW 1VMKA 4E2ZA 3P2OA 2OD2A 2WE8A 3JZFA 1E2UA 1OAKA 1USIA 4GP6A 3TLKA 4Q66C 3U39A 4BX0A 4G81A 2VRWA 1EUCA 1RWKA 5EI5A 2VYVD 4MQFB 7ADHA 5DNAA 3A4VA 2D00A 3THRA 2OLKA 1XEFA 2I6TA 5KNBH 2PX2A 5FL3A 2QRLA 4YJFB 3UM9A 5KIAA 4U7PB 3GRVA 2G07A 2I29A 5CRIA 4CCYB 3QX8A 2IOYA 3BGDA 3O26A 1DTEA 1PWXA 1RKBA 2ZSUA 4OI2A 1Z5UA 4LUCA 1ZHFA 5BNIA 1JKJA 1XTBA 4I7EA 4GECA 2I87A 4F5DA 2WAYA 5D2CA 4EYSA 1L5QA 3VSAA 5CA0B 1I2ZA 1GN8A 1TRKA 2R8YA 2IS1A 4H6PA 2ZGVA 4IIYA 5TY0A 4Q01A 5AM3A 3NXSA 1YXMA 1YFKA 4C08A 3FMFA 3KSMA 4OYRA 3MC1A 1CS0B 1R0RE 2O8EA 1AK9A 2HQ1A 2J7PD 3O1IC 1F0NA 3ES9A 2UUPA 4LCEA 3ZJ4A 3VQTA 5HS6A 3AIKA 3QBTA 1KEKA 4Y6GB 2QTVA 4YWJA 1P5ZB 3JD1A 5EPEA 2YKGA 1SAYA 2R8EA 4A15A 4KQWA 3W5AA 4ARCA 2IGBA 3QWFA 4DV2B 1SC9A 4RX1A 4YDSA 5EFZA 4MDEA 2AHRA 2QN6A 1P9OA 3PNPA 4YAUA 2UXBB 4F86A 4U7HA 3HJUA 4K9RA 2NP6A 3U80A 1ML3A 2B34A 3KQSA 3KV1A 4L5BA 2DU8A 4N8DA 4OHOA 1YBAA 2KLBA 2OCLA 3DZBA 3PFKA 4KTTE 2X0FA 2XMSA 4ZI7B 4YFVA 4UUNA 1XCOA 1KZ4A 4Y2UA 1QGUA 1ZP6A 1YI1A 5DX8A 2JFNA 3OMWA 1EXVA 1XTJA 1FEZA 1CR1A 2IF0A 2JGIA 3GQBA 4WLUA 2BELA 4CL8A 1XDUA 4GBJA 1M54A 1VHDA 3N74A 3OLWA 1F3LA 3HU2A 1QE0A 1TFUA 3BRSA 4M1OA 1TM7E 1G5TA 1HG1A 1PJTA 3T95A 1GUFA 3FF4A 3F6EX 2X2EA 4G07A 3TZ6A 4Z0PA 4A8PA 3RAGA 2MSKA 2QTAA 2QRGA 4JUCA 3QTBA 3SYRA 3OKCA 2NT3A 2JLRA 4BNHA 2OZVA 1XCPA 1VMAA 4LBYA 3U61B 5EIXA 3K9HA 4CR6A 5FX2A 1NNEA 5DBHX 4EF4A 1Z6ZA 3GMTA 3IDSA 4XQCA 2WF5A 1LLUA 2Z0MA 2PX5A 5IEBA 5J1TB 2NU9B 4LISA 4UMEA 5TPZA 1VSUA 4FINA 2P68A 5K2MA 2BGTA 2HJWA 3SLGA 3X1WA 1KWGA 4FS8A 3FUVA 4TTVA 4I4TA 3GEMA 4OA5A 3H1TA 2N47A 4MARA 3GV0A 5KREA 4BLVA 3OOEA 2ZRBA 3L6DA 2C61A 4EG3A 1ID1A 4Y18A 1ACMA 4V02A 4ESEA 1H0SA 4L7QA 1CUCA 1SUCA 5F77A 5EWMA 8OHMA 4J94A 2C92A 4AK9A 1TLLA 3E35A 1L5HA 2W2NA 2DF8A 4XOIA 3TKLA 1XI2A 2VJPA 1D5WA 1E79D 4MHTA 4O0MA 4JVLA 4UC0A 2O8FB 3VGJA 1UT8A 2CXXA 2O6LA 1OLUA 1ZCFA 2G4LA 3DE1X 2YR0A 3ZBUA 3L1UA 1KKLA 2ONKA 4H1UA 3KG2A 5E7QA 5KOJB 2NZXA 3AXSA 3WX0A 3F5QA 3BF8A 1S7CA 1VKJA 2E1PA 2ECQA 1DTWB 3TMAA 3UMGA 4E31A 3CZ9A 4M21A 3D7SA 1E9BA 2FQYA 5B2ZA 3R9WA 2WNHA 1IOVA 5AKGA 1P2UA 4KDCA 2VUSA 3X1ZA 4ZHSA 1BMQA 3ONVA 3PC2A 4MAAA 3ICOA 1AS3A 3N5KA 5JZVA 1BXZA 3FM9A 4FLMA 1DBSA 3R41A 1UANA 1RHMA 3KE9A 3W4JA 1EFKA 5AVVA 1WW3A 3N0RA 1DEKA 1E0KA 3SZRA 3FA2A 2BI7A 1PF7E 4NZPA 4Q1CA 1W6UA 3KM0A 5LQAA 4K40A 4C43A 2JGDB 4HJRA 1Z7WA 2IUTA 4U7JA 1J49A 3HP7A 2ECOA 2ZPUA 1L1EA 1T35A 2IVZA 3RS3A 1ULTA 3N87A 1UEXC 4Q1AA 5ENDA 3IP3A 1MENA 1MCZA 2OO5C 1OFTA 1M1ZA 2F8LA 1OFVA 1LBTA 2WPDD 3ZD8A 1FTNA 3FGOA 3DOIA 4OJTA 1TC2A 4AZWA 1TAGA 5LL6P 4PC7A 4R9NA 2HKIA 2NP7A 1NJ1A 4Q7JB 4H18A 2BE7A 4OKIA 3ZLBA 4N54A 4AWBA 3HXPA 4HEJA 4RGVA 5FPQA 4B2IA 3HBMA 3GVCA 3K9LA 4M83A 2M6SA 1L5LA 4Q4JA 3ZHSA 2JI4A 1XD2A 3GVHA 3OCJA 4ZYUA 3GRUA 4LXIA 4TOIA 5JARA 1CUJA 1QH1A 3AF3A 1CU1A 3QKTA 4N5IX 5D6OA 3PRKE 5AUQA 3RC7A 3WNCA 5AOCA 3FTFA 2B0CA 4X64B 1BDHA 4JIGA 1MQ9A 3WMGA 2JBHA 2AQKA 5KYXB 1LEHA 2DC1A 3KLMX 3MGKA 3VKUA 1JFRA 5K05A 3LOUA 1NUPA 3AHGA 3NJ8A 1ZVVA 5LXTB 3DFZA 4O4LF 4J7XA 4ZRMA 3V1UA 5CFRA 1SCNE 1ZMOA 4PONA 3ZR4B 1Y9EA 2A9PA 1RI1A 1Z0FA 4KWHA 2HHHB 2EX0A 1VOTA 1T5SA 4LHWA 4BLQA 1NW5A 1U8ZA 4WASA 1FW6A 2AR9A 4DXAA 4G0ZA 5FB3A 2WHQA 3CRMA 3BDAA 3SIXA 5EUBA 4BNGA 1KDTA 1P62B 1BMTA 1I33A 4CIYA 5FL7A 3Q3VA 3RFCA 2GSDA 3LCMA 2AFIE 3TI9A 1ZJ6A 2ODPA 5KYWA 4GT1A 4D3ZA 2J07A 2X41A 1ZH8A 3AEXA 3KV3O 1N1GA 3PDJA 4EW6A 4KR6A 3UUFA 2QQ5A 5IVIA 4GR4A 1ZIYA 4XB2A 1AX9A 4BKOA 2ZS7A 1YR6A 3W8EA 3QPWA 2P0AA 3C3KA 1W7AA 2R6DA 2ZUVA 3DC2A 1RHRA 3DMHA 4X84A 3AYXB 4DLYA 9ABPA 3AESB 4TMYA 4E22A 2HSEA 4RKFA 5EA2A 2PFKA 4J3JA 5FBQB 1NQAO 2I8AA 1M7HA 3HY4A 4H7IA 1KETA 1QLHA 3LQKA 4TYPA 5J5VA 4AAYA 3ONEA 3Q2IA 5LOVF 1MUUA 3CA8A 3LY8A 3Q7TA 3UJ9A 3F9IA 2QAJA 3OOYA 4J49A 1MT3A 1O4VA 1JAIA 2ZRJA 3EEOA 3HPQA 4JP1A 4M37A 2C7GA 3EPHA 2B4QA 3SXUB 1ZK0A 3UAYA 2Z1NA 1TA4A 2G6TA 4RPHA 3BXFA 2HBZA 4MV3A 1YB7A 1NUHA 1TYDE 3ENVA 2PU5A 4WD3A 1XJCA 1A9PA 1GAEO 1HNNA 1I2CA 2B5VA 4JLMA 1AKWA 4LJAA 5HRAA 5JROA 1YZLA 1JHDA 4GS5A 1ZIOA 4FLEA 4FZ3A 4Q16A 1N0IA 5DGCA 1W5BA 2G28A 2VT2A 4XZ3A 4A10A 4C03A 4R2LA 3R0QA 1TU3A 3AP2A 2E6KA 4BP9A 3AHFA 4MDFA 3WL5A 4ME6A 3KSBC 2G9NA 4HQKA 4C5BA 2JW5A 4BEWA 2LDBA 5DNDA 3KT3A 1Z13A 5ERGB 2IUYA 2A84A 4W7HA 2OQRA 3DBLB 2NPIA 2YZMA 1J25A 2WI8A 1OI7A 2RAPA 3O91A 4MKRA 4EHLA 2P2ZA 2DQ4A 2SNIE 4EW2A 2AJ8A 4WK2B 3MB5A 4YUXA 4MR7B 3AWIA 3CEHA 3DBVO 1ADCA 2QVGA 3R3ZA 3HVHA 4IBOA 3WV4A 1ZU4A 1O9HA 3EGDB 3WZMA 4B35A 1TA0A 1N2HA 4ALJA 3GLFA 3G68A 4XXHA 3UMSA 4I14A 1FFWA 1FP4A 4EQ6A 5IANA 2DWOA 4YP7A 2VNJA 4YT8A 3HXOA 4UBIA 1J39A 4LMAA 2IZOA 4ZT6A 2OBFA 5EVJA 1T8RA 2JLBA 3D4LA 5KNLA 4XIYA 4C05A 2AE2A 2P9ZA 4K6KA 3V33A 5ICSA 5CIYA 1I1OA 2K5UA 2HFJA 2ZB8A 3KRTA 1NKTA 3OP4A 2OYRA 1ZC4A 3ADPA 4AY3A 1EFVA 3ANLA 5AI0A 3V34A 4EF6A 1DBWA 3BQ9A 3CF2A 3KOXA 5LA6F 1SXJA 4HVLA 5HKBA 3OZ7A 5KPDA 1OWPA 2BYTA 4XD7A 2Y71A 3ITNA 3KVRA 5DSTA 1TK3A 3V5NA 3ZE0B 1R9MA 1PW5A 2Y0BA 4RMJA 2XOKA 4PY2A 1V1RB 3B2QA 1A71A 1IN5A 1X77A 4MW5A 3BZWA 3VO2A 1WU8A 5A9TA 3O47A 1PR3A 2GD2A 1QZTA 3I39X 4G9EA 3S2YA 2VHTA 1W73A 3LQRA 4RJTA 2HCTA 3TUZC 2EWMA 5K8LA 1DIGA 1REQA 1NI5A 4FR2A 4LVUA 4PX3A 3RUAA 2FP4A 4LBVA 5I7SA 1TF7A 2PWYA 1R6BX 3AUXA 3EQZA 1J24A 4WKOA 3ZCUA 1R7RA 4IG4A 3OQ1A 1ANKA 3DAPA 4BVHA 5H9VA 1XZPA 2XB8A 5G0TA 2I1WA 2PUEA 4TZ0A 4FD2A 2CV0A 1FUIA 1WOYA 2PSFA 1F4VA 1ZM2A 3AHDA 4KMRA 1G9SA 1OW3B 3VH2A 3O1HB 2JFFA 1MJGA 1QONA 1TA9A 1XN4A 2PH7A 2VF7A 3IKMB 3R5FA 5EIEA 1UPBA 2J09A 1W6RA 2YWFA 4KMSA 2FOIA 2H0RA 3HLYA 3BQMB 3OMXA 2JLXA 2IJGX 2B92A 1YMVA 1JVNA 2WG1A 1PDVA 1TD1A 1TKCA 3A1CA 1XGKA 4ND3A 3TRFA 2PVSA 4KWEA 5THQA 1E6LA 4O2RA 2Z98A 4P33A 1NR1A 4CM4A 5EP1A 4DLVA 3VOTA 4QXMA 3PRJA 3O75A 4JJ4A 2FCAA 5CM2Z 3RIXA 4ZYVA 2JCSA 3O4VA 3W3ZB 1CT9A 2BP7B 5FLEX 1DPFA 2Q1XA 1GAQA 4JBIA 1G64A 4LY0A 3G8BA 4GC9A 5EZQA 2RG7A 2SECE 1DQPA 3NBKA 5LQMA 1ZRNA 4QDOA 4RV4A 3WAGA 2QQGA 4HQ6A 5C53B 5ADUS 1WPRA 4K1XA 1NFQA 1KZGB 3KQTA 1QCZA 2HEGA 2QZPA 1M76A 1JDUA 1WY5A 5DM4A 1FTWA 5JD3A 3ODGA 2C82A 5F2OA 3F3KA 1Z4QA 2C8LA 1V4BA 4EUSA 3WY9A 4KE8A 1RJ9A 3EGOA 1O4WA 2QSZA 4FKMA 4JLOA 5AVRA 4H7EA 3CVVA 1ULZA 5DNWA 1NLMA 3IA2A 1L9KA 1M2OA 4N18A 1LFDB 5KKCA 1IL0A 2LWIA 4ID9A 1PD1A 2PEYA 4LMPA 3DP7A 1XZIA 1G21E 3QVWA 4LECA 2N42A 2IPLA 3AU8A 5UKDA 3TRKA 2VYCA 1RI2A 1D2RA 2XCLA 4MUXA 2O52A 1ECFA 2O2YA 4WVLA 1DG3A 3U3DA 1W46A 3ZH9B 1ZJWA 2Z6AA 2WU1A 3RRZA 1OYWA 1BE0A 3LDUA 3UMFA 4DJDC 1LC0A 4Y2JA 4F3RA 1F14A 1L7DA 2VHUA 3HP1A 3WKCA 4D0RA 2HDHA 1II0A 3II6X 3OFSA 4MMYB 4M89A 4CKYA 3E53A 4D8XA 2JLWA 3CTPA 2P1ZA 5JTUA 2D0OB 4MP3A 1XFAA 1VPVA 3MF4A 1B0UA 3GT4A 4JI6B 5FI3A 1XFDA 4C1BA 1MZPA 3PEFA 1IEXA 1P44A 4K1LA 2B99A 3DR3A 2F3RA 2VJQA 4EB3A 2IHZA 1DV1A 5F73A 4G0XA 3TK1A 1VJGA 2NACA 4ZAVA 4D9IA 3CT4A 3LHSA 1MOZA 1GN9A 1CB7A 4JYPA 5LP6B 4XM0A 4Y2PA 4C4AA 3DYVA 1RKVA 1YHZA 2C88A 3IUEA 2EGGA 4GO1A 5AVTA 4JFAA 1PZHA 3JQAD 3BRWA 3U4IA 3I52A 5AYVA 3V55A 1NKVA 2CVOA 4BB0A 3JYPA 5LD2B 1UDXA 1U3FA 3K0KA 1ZK1A 5JS1A 2X77A 3AINA 1JAZA 1MORA 2AD1A 2WUVA 3EGWA 2J3EA 3IP5A 5DM0A 4AP9A 3M83A 2HNBA 1QK5A 5KYKA 1G3IA 2AZ4A 2EGUA 3HFGA 3R6GA 4NBLA 5BW6B 3G59A 5BR7A 1ZUNA 1B74A 1AM4D 1YJ5A 1E2DA 3LO8A 3ONDA 4HGQA 1O08A 1VBFA 3CF6R 1WCIA 3PXAA 1LW7A 2BZGA 5IJAA 4XA8A 1IY2A 3PJEA 3T7SA 2QRMA 5FPYA 3OTIA 1G3UA 1IHPA 3C3EA 1B73A 2FSVA 4KHZA 4E5PA 3SJ7A 2FSUA 4DM3A 2P79A 4RIIA 3B51X 3LY7A 4R0VA 1YFLA 3BE8A 2SHKA 2FEMA 3OEHD 4J2TA 1F60A 1CJBA 4G1FA 3L4KA 4D8YA 3ELWA 1E1NA 3U9TA 3GUHA 4YGYA 5FI1B 4AO7A 4G5GA 3S2EA 2J8ZA 1R9GA 1XQ1A 1XMJA 2QAIA 2G70A 3E9ZA 1ZBDA 3P0JA 4BEVA 1E3LA 2H9AA 4UD2A 3NEJA 3O8DA 2FJPA 2ZIAA 3M6UA 5ALKA 1DG9A 1MHPA 3COJA 3LGXA 3ZWNA 1QCDA 2PZEA 1JHPA 3HB7A 3CX3A 1BCSB 1EVKA 3F97A 1MJHA 3PK0A 4AMGA 1OE0A 4ACAA 5C46F 3CVYA 2YDXA 3C6QA 3FAKA 4FEGA 5HTOA 1JTFA 2L82A 1M7GA 2VSQA 4HBGA 3S44A 2Q62A 821PA 10MHA 4XLLA 5BW5A 3GJ3A 3LW7A 5EHQA 1W5FA 2QTTA 3UOAB 4G4SP 5AI5A 3WHIA 1W2WB 5TQJA 2B1IA 5BRNA 4O5OA 3FVVA 2PX0A 3M4ZA 5C8YA 1YZKA 3E7DA 1EG2A 1UUFA 3GPBA 2PX4A 2NO6A 3PRYA 3F0TA 1ZNZA 3LC2O 3FLMA 4CN8A 1JQLB 1QKKA 2GXUA 2XVAA 4MS4B 6NULA 1GYRA 4W7SA 2UUBB 1QNFA 1XVAA 4Q3OA 3TH5A 4BFUA 5CW2A 3DDNA 4GX5A 4QDUA 2QQEA 1XMPA 3QKSB 4NJEB 1EDOA 1S4QA 2B4RO 1T4CA 4ISCA 3SWWA 1LTKA 1N36B 4MMXB 3MYYA 1J0DA 4C4PA 4C0JA 5CLGA 2XQJA 3DMYA 3ND6A 1U7PA 3WNQA 4B2LA 1V8PA 2ZIFA 4Q82A 4DMUB 2BH9A 3Q3HA 4F3YA 4HN4B 5A6SA 4I50A 5BSUA 4ER7A 5BSGA 5CAEB 3GLGB 1JJBA 1BROA 2P0YA 2ZI7A 3GJXC 5IC5A 5DM70 2AI2A 4UW9A 3I83A 4XCXA 4CL0A 5JFTA 4AY5A 1XVIA 2IEGA 4TTSA 1QOQB 1SCUB 1M1YE 4GGPA 4TMXA 5EJ5A 1IIRA 5JEDA 4TVBA 5U4QA 5JNVA 4RMNA 2APJA 5FWYA 2O0JA 2DUWA 1BE8A 4MHOA 1QS0B 3EGCA 3LC0A 1AZSC 3EPPA 2I78A 3M2TA 4KNWA 4HSGA 2QBYB 4PVCA 2ZG6A 3ZGZA 3AQIA 3AEQB 4HTAA 4OMCA 4JOSA 1MGOA 1EXNA 5M3BA 5EZ6B 5KU1A 4ZREA 1V25A 2LV8A 1UBLS 2VHEA 4GWGA 3BWEA 3ZJYA 1OWOA 3UQZA 1R0XA 2ECKA 2I3GA 3H0CA 4G5SA 4UE6A 1K7EB 4AYWA 4WZ6A 4DUZB 5ECWA 3IAAA 2XXAA 4ZU6X 3ZCPA 1L5FA 5DT2A 1QAQA 3CC8A 5JSZA 2XVYA 5E2AA 2JLAA 3T5CA 4ODIA 2WVAA 2YYYA 1U1GA 3ZJVA 1WPQA 1Q3TA 3DDUA 4TKUB 3OZFA 2BEKA 2ZI5A 3OIFA 4NCXA 5AM1A 2O54A 1UM9B 1Y89A 3F6CA 2QUAA 1MJNA 4O4IA 5DGHA 3T7JA 3WL4A 4XVRA 5FBWB 3LDFA 2VBIA 5FKJA 3SKXA 1OFUX 4FFSA 4QDXA 3DL0A 5JS8A 2G08A 4PU0A 3PQ2A 4K9MA 5JXHA 2QRVB 1ZH2A 4UFNA 1AO0A 1DO2A 3WLOA 5HG0A 2XD4A 3EXG1 2I2DA 5K3SA 1LRJA 2D2FA 2XUQA 4W1RA 1Q7EA 3S55A 3MYRA 2G5PA 3OT1B 3T3HA 4WA7A 1U0EA 1QB8A 1QKIA 1SOWA 3KOUA 3MS4A 3HK2A 4P80A 4K9LA 4KI0A 2EIXA 3IEXA 1NVMB 4MPTA 4RAOA 3RSGA 3VHQA 1WP4A 4EFDA 2CLDX 1LH0A 2RE8A 3BMQB 1RPTA 3GMIA 2HRDA 1KFJB 2COUA 4IOLA 3ZCRA 1ZI8A 4YPFA 1UT6A 1II8A 1YBFA 2IYVA 3AYZB 1N2BA 2FE4A 2LPMA 3AOEA 3QV2A 4RTOA 1YRWA 1B14A 5G53C 1VXRA 3L06A 2FZLA 2QU7A 3FD8A 3KPWA 3D7LA 1U2EA 3MLBA 4MWEA 1AXEA 3M49A 4JL8A 2EF0A 4FOTA 1EK6A 4LI3X 3UJ7A 1Q92A 3KXIA 4IYRA 1CRWG 3F46A 4MVJM 1O2DA 3OP1A 5C81A 1DL5A 3EIXA 1XKTA 1URPA 3N2EA 5AW4A 1P8JA 2PXAA 3CEAA 4HEA1 4QOJA 4NI5A 4QDKA 1V2GA 4QYIA 3JALA 3SR4A 1YBVA 3ZS9A 5AM5A 5KKNB 3GL9A 5ISMA 2NUAB 4AMBA 2SKDA 5FO0A 2A9QA 1TQ6A 3DV2A 5BURA 3RC8A 1W4AA 4Z3OA 3AOGA 3PFHA 2DBQA 3T3DA 1M83A 3V7UA 1XAGA 1GKUB 2CZGA 4GPAA 1OH6A 2P40A 1OPRA 3BIOA 4NV0A 1YE5A 3FYSA 3GEDA 1WEKA 2UUOA 4NRDA 1HLFA 4QG3A 2XDWA 4C7OA 1AKNA 1GRQA 3UB2A 1Y42X 3ZTWA 2XAUA 4IMJB 4RTKA 1N6HA 1PT5A 3N3BC 4FOPA 4KQFA 1HH4A 3GYGA 5BSRA 3STXA 4ZMBA 4R6XA 1A88A 1O7JA 1DKRA 1P0CA 3OHSX 4HH0A 2IU6A 2EVWX 3HU5A 3TN7A 1JHAA 4JKYA 5C80A 1LDNA 4B09A 1WP9A 5IZCA 4JEHA 3OM8A 4E1AA 4YRCA 3GEGA 2BFEA 2NU6B 2F2TA 1KR5A 1L7PA 3DCNA 1FFDA 1T3LA 3BZBA 4PBSA 3SJAA 5ES4B 1CHNA 3SVTA 4DV4B 1RXIA 4JY7A 4NG4A 3ZC3A 5J2UF 3WS7A 2F6RA 5AXDA 4F1JA 5TMPA 3TBKA 1F8XA 3RYIA 4O2BB 5DSZA 4URFA 1OZAA 2I9PA 3O73A 4YT4A 3IE1A 2OY0A 3N53A 1PR9A 3EXAA 2JLSA 2YJ3A 3P32A 1NLZA 1A2OA 1Z2NX 2QT0A 3UNXA 4TKVA 5C1IA 2O5CA 4QFDA 3VXKA 1BA3A 4LFBB 3TM4A 2XT6A 3RRFA 4IX9A 4W6ZA 2C07A 4JI2B 5DRTA 2IP1A 4UOZA 3CB4A 2HV8A 2C5FA 2QHXA 1SKBA 3UH0A 4TTPA 1GGEA 1LLFA 221PA 2I2CA 4CBVA 4E7PA 1XD8A 4PLHA 4URUR 2GI4A 4YX9A 2V6MA 2A8YA 5F4ZA 4MUKA 4CJXA 4G6ZA 2I3DA 4RC9A 4EYQA 7MHTA 1W30A 3F47A 1C7FA 4CV2A 3B5EA 1I14A 3DB2A 4MIYA 4JC5A 1US8A 2OENG 4KXXA 4JGIA 1K1EA 3E8MA 2GLTA 1NLUA 3TNJA 5DASA 1YH3A 1XRLA 3E1KA 3NHZA 4P5PA 4RJLA 5E9QA 3SP1A 1GPUA 3E7PA 2HV9A 1ZKMA 4NFYA 4TSFD 3MMXA 1YB5A 2OBMA 3N7TA 2PKRA 3QLJA 4BNNA 3NDPA 2IKQA 2B3DA 1XQYA 3AC0A 4YUZA 5LFAA 1M1XB 2AFIA 3GWGA 1KMQA 1O95A 721PA 1H5NA 4BVLA 4MV5A 2G4VA 2BDTA 4C0LA 1R6UA 3MCAA 3ROKA 1K88A 4P34A 2OGTA 2FRVA 1CJSA 2QPAA 5IAGA 4WXEA 4CEJB 4R0MA 3GNTA 4DLWA 4XCQA 5JAQA 1X0VA 3HG7A 2QD5A 3KDAA 4P2GA 4U0JA 1EA5A 4BKRA 1G20A 5JH7F 3G5MA 3RIYA 3U7RA 3N9IA 4AUMA 5HZHA 1M5UA 5BW4A 1E1DA 3CUKA 2ZYWX 3PF8A 3WK7A 4JBWA 4ZZ1A 1AJEA 3K32A 3L7JA 4BVAA 2X76A 4JGGA 3RIMA 3GGDA 5EJ8A 1JA0A 2FX2A 4A7PA 1TW2A 2Q5OA 2ZITA 2XVXA 3OH8A 1NSTA 4TYMA 2BGJA 3G0GA 1RD4A 3PHHA 3IMEA 4KSYA 4BBAA 3NC1C 2FQXA 2ATCA 3LUGA 4UBMA 2NUBA 4X24A 1YJQA 3NONA 4KLRA 1SVKA 3X2EA 4Y30A 4MVJP 1Y81A 4Q1EA 4PO8A 3SXPA 4UEWA 3DMPA 1W0KD 1KI7A 3CNEA 4LMRA 4NG5A 1DVRA 3EXFB 4GI1A 1FVFA 2IOHA 3I2YX 1ZNYA 1MQSA 4MCAA 3CLSD 4S1TA 1J42A 3TKYA 1R5JA 2C04A 3N0VA 4WY5A 4L5IA 1YQGA 1BQ4A 3KB1A 1IDOA 2Q5FA 2RHOA 1TTHA 4PSAA 5E3JA 3QX3A 4KW7A 2O8DB 1I2MA 2WJVA 4UCFA 1KRHA 2YC4C 2G63A 1EEHA 4OAQA 3VMFA 1USVA 1WG8A 3L5OA 2OV6A 3WRXC 3ZU5A 4TT3D 2C97A 4DXHA 5AW6A 3L8CA 3UV7A 3RK4A 1JYEA 3ZXXA 4UDXX 4BO5A 1A4UA 3ZZTA 3CEJA 2DHRA 1QVZA 5AW0A 4C2BA 4L02A 5H02A 2EEZA 4HG2A 5DCUA 4P0TA 1ISFA 4FJ0A 5CDGA 1RLOA 3N5CA 1O9BA 1IXSB 1OBVA 1KARA 1OH5A 1M73E 4BN4A 1FYFA 1XC7A 3LUCA 1XJ5A 4UARA 1CZOA 2ADFA 1RQNA 1NLYA 5AVXA 1SBHA 4FZJA 1DC5A 4OXKA 2DE0X 2Q28A 4FNMA 1J8YF 3L0IB 4N4AA 5EXTA 3VNBA 3CLHA 2XKKA 2G8LA 3R0ZA 2WJ4A 1RMYA 4XWYA 3Q8KA 4O8ZA 1AGRA 3H9EO 5ETJA 3GRZA 1X1EA 4WCFA 3HLTA 3V7FA 2ZYAA 3UCXA 2PWPA 4PQRA 4EKDA 1VIYA 2L19A 1EWTA 3HFJA 2YWRA 4HVAA 521PA 3JXEA 5JLJA 1AUPA 1VMEA 2OQVA 1LLCA 1SCDA 5DI3A 2BGUA 2XNDD 4H17A 4X1YB 2I2FA 2FXIA 2SCUB 3UJ8A 2BKXA 2VRNA 1TU4A 1RJGA 2P65A 3BIXA 3Q6MA 3QM1A 4LHYA 4LV6A 3ZWMA 1ZRMA 4EHHA 4ER0A 2DB3A 3LHKA 3UBTA 1SNYA 2AG5A 1R8SA 3U49A 3EE6A 2C77A 3A1EA 2YWDA 4JBYA 4LRYA 4DREA 3MWKA 2LD4A 3JQBA 3K4PA 3PNVA 4R8MA 5CFQA 1CLUA 5CCXA 3K7EA 3KOMA 3PFGA 5HX7A 2A5GA 4OGFA 3QVLA 3T9CA 1G59A 4MVJI 1Y8RA 3TTSA 2Y1DA 4EA6A 2BGKA 2HRRA 1KFBB 1SCJA 1HMYA 1T36A 4MULA 1NYLA 2WD7B 4YCBA 5EJ7A 4UAGA 4V2IA 5K0BA 1L4YA 1XOIA 4DV5B 4N5NA 3S1AA 4B3CA 4ZHQF 5EKUA 3DM9B 1YFJA 4OL9A 2PFSA 1TL7C 3GH1A 2Z56A 3OU6A 4MUIA 3UT5A 1CUYA 2EV9A 1POXA 1BDBA 1HURA 4MGYR 3RDPA 4JJEA 1AHPA 1YR9A 3ND8A 5DULA 4OQFA 3QWAA 4C6RA 2PGIA 4M3NA 2PL9A 4ZMSA 4BMCA 4E2WA 4RVSA 4UHJA 3ESQA 4C4OA 5LB4A 5JMTA 4PFJA 1N2IA 3CBQA 4QASA 2HYDA 3B60A 2FQWA 4FCWA 1EFPB 3GJRA 3SX0A 3O8OB 4ROTA 1I4OA 3ZGOA 3VPBA 1UXIA 4FQ8A 1E7RA 4IIEA 2WJWA 5CVUA 2W00A 3K0SA 1LK5A 1GNQA 2IBTA 3CX7A 3SD7A 1JV2B 3IX7A 4DOMA 2JEOA 1AE1A 1PEAA 3EVDA 2H16A 3IQDB 5IP5A 4B3DA 4HXYA 2QVLA 3IELA 2MSDB 2OECA 5JAHA 2EDAA 4S05A 1K98A 5JYEA 1MO4A 3DLHA 2Q6IA 1DO0A 3LW8A 2EOAA 2X19A 4MS3B 3ZLUA 3EEFA 1U9IA 4PEVA 1G21A 3R77A 3AVTA 2WF9A 1VJ1A 4I66A 2ZWVA 4GUDA 4MPRA 1Z4MA 3LL4A 4J0KA 3B3GA 5FIUA 4PSKA 3VX4A 4PG7A 1JHVA 3RQIA 1TLFA 1JBKA 4J07A 1UBTS 3GW8A 3A4YA 5GZ6A 4Q7QA 1BKDR 3BD9A 4ILEA 2WTEA 5FA8A 1KBZA 1HYGA 2C94A 5TARA 3E9QA 5U9CA 5JU6A 1L5YA 1ZLYA 4BLWA 2G71A 2XUJA 3DOCA 3SIPA 1JIVA 2OL4A 3CN7A 1PT6A 5HGXA 4G85A 2XMRA 2OYCA 1ZS9A 3WGYA 1E9SA 1OTYA 2YOGA 4JSRA 1EGVB 3PFCA 4ZVPA 3TNLA 2DG2A 5BT8A 4QJIA 1VLMA 5SICE 4IKOA 2Q2VA 3LO5A 3H2KA 4EJ6A 5CA1F 1PT9A 3LFTA 4NSNA 4DT1B 5A9SA 3KKLA 3QVMA 3WGKA 3MM4A 2PL5A 4XTRA 2OO7A 5LPNA 1RIIA 2D1SA 1IONA 3FI0A 1VYTA 4L0DA 4HAIA 5JDCA 5FFFA 1VYVA 2OUIA 3H1EA 3BCSA 1M0TA 5KJFA 3QVOA 3CU5A 3OQJA 4CEIA 1T13A 2ODEA 3U19A 3DDCA 3IMGA 4RFVA 5L3RA 1VCIA 2JFGA 1H4TA 2VJDA 1B2LA 2GFQA 4B7UA 3PX2A 3WKDA 2QPLA 4C88A 3CO0S 4Y0VA 3VDQA 4M0EA 4B40A 5DLEA 2JAWA 1SUIA 2J87A 1SOMA 1FOEB 1U2GC 1YGPA 2KBEA 3MRXA 1TDJA 4TQUS 4V0KA 2VHXA 4WINA 1Y34E 4ZT4A 4EX7A 1HL3A 5KJ6A 2V5UA 5I51A 2HDOA 1JSZA 3RSCA 2Q7XA 5E2IA 1G8JA 5HCIA 3I6QA 5GONF 5LZ9A 4F06A 1XWFA 2IPXA 1Q84A 2W8ZA 3QLTA 3EDCA 2VHCA 3LZDA 1TC1A 3SSOA 2R2GA 3VPSA 4DA7A 1GQSA 3HB0A 3H4IA 1G6Q1 4FLFA 4O1MA 3URMA 4LDRA 1Q20A 1Q0PA 4PSUA 3KSDO 5LUAA 1CY2A 2H1RA 1TCVA 1GZ5A 2WJAA 4HRAA 1B8UA 2SBTA 2QZZA 3V7YA 2AC7A 1A98A 1BXGB 3F8WA 3H5TA 4BP1A 3S5UA 4LJKA 2NXWA 1H6DA 3FOAA 1JLRA 1UF9A 3R3HA 3HNPA 2WSIA 4OM8A 1B23P 5EHZA 1N78A 2JI9A 2MWMA 1IQ0A 2ZUWA 4JR2A 3LUHA 5GOZA 3RUHA 1PFUA 2CVQA 2RGXA 2XB6A 4FMPA 4H1VA 2IZ6A 4OP3A 2A30A 1BGWA 3HCBA 1WLYA 3NHPA 2Z1MA 1HTWA 1Y7LA 2FMXA 2PH1A 4HTFB 1N2EA 3SM3A 2I22A 3UB4A 1EZ1A 4DC0A 1XKQA 3DBRB 3H2SA 3CYFA 2P1RA 3GMSA 3AF1A 2VEDA 5KYYA 4NXNB 5KX5F 1NI4A 2DLDA 4IV8A 4D9JA 2RD2A 4RSHA 1Y8CA 4HNTA 2OGSA 3PC3A 5HIIA 1A9TA 3EF0A 1KDZA 2OZPA 5A5DA 3OOHA 2ZYGA 5CFNA 2Q4BA 1ZD9A 1U8XX 2OXIA 3RVDA 2Q9CA 1ARZA 1O97C 1T0BA 3K0CC 3HDTA 4MH0R 1Z74A 1EP9A 3RUDA 4D82A 1NZFA 4D0LB 1PZEA 1DRKA 1PTJA 4P4GA 4CF5A 2C7OA 4CEHA 4WH0A 4WXPA 3PD7A 5KNDD 3CLTD 3P4XA 1KJ9A 2P5YA 3O5AA 5EE1A 5B2EA 1P4RA 1WA5A 4NBVA 2FPKA 3PXGA 2QLNA 4Y7DA 1UBGA 2YCBA 1TUGA 4GSLA 4F72A 1V3VA 3CJTA 5A71A 2R85A 2FR8C 5K99A 5JTTA 2ZU6A 1QM5A 2D1RA 1V9CA 1FE8A 3O8CA 1M1YA 1JTVA 3NPAA 4DYHA 1TVEA 2X0EA 4TTRA 1G7TA 5KOHB 4NK5A 3JQRA 5BN4B 1XZBA 3UUWA 3H9GA 5AUNB 4Q3AA 2VHQA 1AQLA 3G6WA 4L4XA 4Y0AA 1EUDB 3ZY2A 4L51A 1G6KA 4LWPA 4RU1A 3G2JA 5COQA 3VH3A 3HWRA 1ETHA 1CQWA 3AT1A 5K6RA 1XRPA 4GR5A 3DA8A 5IT9A 2AC2A 4ZOBA 3M7IA 3PQ4A 1N2JA 2WM8A 4B7XA 3JAMA 4KR9A 2FJ0A 2FRXA 3GGGA 1PR2A 3FE2A 4JJ8A 4RIEA 1XELA 3ZPXA 4E5VA 1C41A 1ZAKA 4OQDA 4LHXA 3R3XA 4QT0A 4YQFA 1DBIA 1F4LA 3EEBA 1P1BA 3FGPA 2VK1A 4FFDA 4RA6A 2DQKA 3TLJA 3R5HA 2CNDA 2WSYB 2X0JA 2A94A 1DAOA 2P9BA 3B1ZA 4RV5A 4I99A 4IQ4A 2WJ3A 4LHEA 1G8MA 5E8JA 4ISBA 2OZKA 4DWOA 3NHWA 2PMFA 2RI1A 3GPDG 4NS1A 4CQJA 1HI9A 4H0NA 5JISA 3KC2A 2PVCA 2O2SA 4P58A 3DXXA 1A9OA 3K0FA 4ZQBA 4JI7B 2V74B 4PLWA 2WJHA 3DKRA 3ZWAA 3O3OB 3B52X 2ZIUB 1RCTE 1SU6A 2CXTA 3KYCB 1MZVA 4RJ2A 4AMZA 4DR7B 4DNXA 1D2CA 4RM3A 3WSTA 1HG0A 3FR8A 3IHTA 1OPXA 1PJZA 2VDVE 1SCAA 1IZZA 5AI8A 1N6PA 1JFVA 1H0RA 3PUHA 3WISA 2PMCA 1E1RD 2LCFA 3WLLA 5LN1A 4GWKA 2W43A 4GMKA 3KEMA 4MPPA 1PJRA 2J32A 3LBIA 4HMPA 3RV3A 3D4PA 3NV9A 1E1KA 4OBBA 4EJSC 5GPBA 1K7CA 4E6EA 4DV1B 2ECFA 2VYVA 3GG2A 1FNMA 3B36A 3AZOA 3OTWA 3OETA 2VR1A 2XBUA 2J3IA 4IDGA 2BRUC 1ACLA 3AHEA 5EN4A 2C4HA 4O4HF 5I47A 1G0NA 1JR3D 2W7TA 3G7SA 4EECA 3HCFA 3M6IA 5E1OA 5TF0A 4BO6A 1VJDA 2JK0A 3K4HA 3BJEA 1L1RA 3LCCA 4WLFA 2Y1KA 4ZDIA 5K7SA 3WLHA 3WLEA 4IDAA 1YOVB 2R8ZA 3Q3JB 2BGWA 2W0MA 4HPJB 1N5DA 3EULA 2D54A 5D00A 4EUNA 3RNLA 1G7CA 3I9KA 3X43A 4RELA 2ZBVA 5DHRA 3T5AA 3VZSA 1VP3A 2GBLA 1B41A 1F48A 3LFUA 4RVOA 5CDFE 1V7QA 5KSZA 2ZRKA 4YQEA 1E3DA 1AGPA 1CQIA 2FPPA 1AQ6A 4KEAA 1XA0A 1ZD8A 4YBRA 1S2DA 4I3HA 1TU0A 2J7PA 5LIPA 1LPAB 2P69A 2QRZA 4FR5A 4Q4DA 4Q7LA 3FPCA 2CDBA 3O21A 2AG1A 1UPTA 2EFHB 1UMKA 3H65A 2C3MA 3SR0A 2BBWA 4DMFA 4DLRA 2IELA 3LV8A 1KL7A 4PYNA 4RLQA 4N7MA 1L7NA 2FG5A 2XCIA 4U9IS 4UDYX 2IWRA 3LFHA 1X6VA 1YZHA 1N9GB 3TIFA 4BBPA 1DOZA 4FD3A 3HJNA 3P8ZA 4GRIA 3MQ2A 2QL6A 3N2ZB 1RWBA 4AX4A 1Q5PA 2IZ1A 1JILA 4YJHA 4CUZA 4CDNA 1Z0SA 2I3AA 2FUG6 2VDRB 3H2GA 2JAQA 3IVGA 3MSCA 2CLSA 1X1RA 1ZIPA 1QV7A 2YN4A 3GB9A 4C87A 2VZLA 2QRNA 4XWGA 5EWLA 2YVAA 3GCGA 2NO5A 3IAS1 3U1TA 2II6A 4QQKA 3HE3A 1N75A 2YRWA 1U8YA 4PS1A 2QN8A 4B9EA 3H2JA 4RJKA 3UMRA 2QTBA 2P67A 3IJEB 3QIAA 4BBJA 3EFOA 1K0FA 3EC1A 4HO1X 3UJ3X 3OESA 3HADA 2OBXA 3UT0A 1O6GA 2XB4A 3I45A 4PVDA 5F9MA 3S2SA 1U0BB 2P4UA 1OV4A 3C6BA 3E22A 4DS3A 1USWA 2CJPA 2XGJA 3EIQA 2YZ2A 4TZTA 4GX2A 1OBFO 2BGNA 2LP4Y 2PSHA 3BJIC 1SUSA 3IPXA 4RUKA 4DMRA 5K8IA 2RK6A 3TSWA 1OA0A 1J7JA 2QG4A 4KDFA 3RKSA 4IWNA 1VGQA 2CE7A 2VDWA 3CKMA 1U04A 5EZSA 3KVYA 4ARVA 3KETA 3K6SA 2P35A 4MV0A 4MB2A 2YHIA 1XAJA 1NIPA 1RAEA 1ULBA 4TL9A 3H87A 2O1EA 4H4CA 2D1QA 4N0QA 4OU4A 1QHHB 1T9AA 4RSRA 4RWZA 3A9VA 4DQLA 4FE3A 2X22A 1RPZA 1P7CA 2WWYA 1C5KA 3BIJA 3E03A 1FK8A 5CB8A 2PPLA 2R6CA 3MAJA 3UXYA 3KZXA 3TLEA 4DQVA 2OBNA 3D4NA 3ROFA 3WRYA 3EXEB 2V0NA 4HADA 5LIRA 4HB0A 4EPXA 4B48A 4KGZA 1PI3A 4JV5B 3BG5A 1P73A 5GP1A 3RHTA 3ILYA 4P4TA 3F5SA 2OCYC 4M0DA 4WCVA 2HAEA 3P2IA 2C99A 4V3CA 1E79A 5GY7A 3A32A 2R86A 2QJRA 1PLJA 2I71A 4H4EA 4KQKA 5FI0B 1V3UA 4LXTA 3EODA 4QUEA 2MINA 3MUOA 2XTAA 4PWYA 5F3WB 3SJZA 2VQDA 1Q6ZA 4Y1RA 3VZPA 1FQWA 5AVQA 3BXZA 1YB2A 2VNSA 4MRSA 5CLFA 3C5HA 2CDNA 4JQZA 2NVUA 1OSNA 2ZU0C 3RTCA 4IDNA 3KLBA 1GNRA 4LZZA 4TLAA 4MVYA 1MXFA 4RTQA 2NU8A 2UZ3A 2PKEA 3UMMA 2CFOA 2BSQA 4AI6A 1XRSB 1U8AA 3E3MA 4RACA 3JQ9A 1U3DA 4KE7A 3GQVA 5HBRA 2KS6A 1KI3A 3LP5A 1UWVA 1DOHA 3MILA 1MO5A 3DE4X 1Y9AA 5ESDA 3K0BA 5KBYA 1XCLA 4G41A 2GZDA 1O8BA 1I7QB 4X8MA 1ZITA 2D3WA 1U7UA 3N2KA 4QQFA 4KU4A 3RAPR 4AURA 3WSWA 2A6PA 4M7OA 3HHEA 1K4KA 1YGYA 1YHYA 3D6NB 4E4RA 5J2TB 1FZTA 2FOLA 1YMUA 2OV1A 2QAGC 3SYTA 2A9KA 3CPEA 2ONZA 4HFNA 1ORIA 4QBTA 1SPBS 1KMMA 3K0EA 1JF8A 1O03A 1NAIA 1LRKA 2WPDA 4JLJA 2IUFA 1NQXA 5C5EA 4FC6A 3C7DB 2FG7C 3WGQA 3JQ6A 3T3NA 4MA0A 3H19A 5JAIA 3VC2A 4A3SA 2ZE5A 3T0GA 2W2XA 5ALOA 1A95A 3CXUA 2M1ZA 3BSSA 4KO2S 4LOIA 3SBDA 1XNQB 1EVLA 1PEYA 1MRNA 4UNSA 4N48A 2ZFUA 4F4UA 2DSTA 5L3ZA 5K5EA 4P54A 4F56A 1JG2A 2WT4A 2Y4OA 1P74A 2AZMA 2BFNA 1GA1A 2UDPA 3GD7A 4WPGA 1K97A 1GPLA 3QKRB 1TVKA 1TK2A 1ZH4A 4FOOA 1RWWA 1ZONA 3MTQA 1J8MF 3MOIA 1M7BA 3IQEA 3K2EA 5TJ9A 3TMKA 4IJQA 4OQNA 3ZYCA 2MSLA 5H4HA 2VQEB 3ENQA 3PGVA 1ZD1A 4OIMA 2WZDA 3OLYA 5IFKA 5JCOA 3U0BA 3V4SA 2ZJ7A 4G0OA 5EZYA 2P3SA 4KOAA 3KJGA 1V5FA 4DPMA 2OPBA 3OPYI 3S3TA 1VLQA 3BGIA 4L8YA 4Z7QB 3W7AA 1N8KA 4FI3C 1MEJA 2HLDD 3H1PA 4NARA 4XJSA 5KAMA 3HJFA 5E6UB 3FUCA 4IZIA 3PBKA 2REQB 3KPYA 1L7AA 1C4WA 1VCNA 4N5LA 1T9GS 4UAUA 3SIWA 2FDCA 3A9TA 3WP1B 2XW6A 1ZR2A 4DJEC 4CIAA 1JA9A 1T2UA 2WZQA 4PICA 1I2DA 3WQQA 1Y63A 4BN0A 5M34A 2OOKA 4XX0A 1YKFA 3KPUA 1KMCA 3OPYA 3U7QB 1Q0RA 1Y3AA 3EZGA 2BFAA 3HO6A 1INLA 3PD1A 4YCDA 3RBAA 2UUCB 4I8IA 2VYNA 3CUYA 2DPYA 2BIFA 3PTAA 3GD5A 4HH4A 3LPCA 3RRNA 4GDFA 5JQGB 3LRXA 2HRBA 1T9KA 2YINC 3ZVRA 3PFNA 1JKFA 4OGWA 2YYSA 2X1HA 2ORVA 4M0PA 4QPCA 4X61A 1Y6GA 2F43B 1ZUWA 3ZDAA 3QWBA 3WK5A 4O3FA 5JZOA 1P1FA 2L2QA 3DAYA 4JKIA 4OK3A 3W2TA 4AJ1A 5LJLA 3KDPA 1ZOLA 4X6XA 4YNBA 3G0BA 3NKLA 4LTMA 4QUBA 1QRSA 1A8IA 4YMIA 4C4XA 3UMBA 3KT8A 4XQ9A 4WCFC 4U7GA 1E2GA 4ZVVA 1NC3A 4EA8A 3MLAA 1KQFA 3SDSA 1SXGA 2VPWA 3G7UA 1IIBA 4AROA 2NGRA 3FUWA 1VKRA 4D0NA 2VWPA 1PUIA 3MMPA 3BRCA 4CM7A 2YTZA 4Q02A 3GT7A 5M7EA 3S28A 1ZW1A 3ZZNA 2QY9A 3WRVA 5CXQA 1BZYA 4IR7A 4BWFB 2PPVA 2GLXA 2ZS8A 2ZTMA 4PF1A 1NP7A 3ULKA 1W5TA 2J5KA 2CVZA 1QWSA 3HP4A 3KSUA 2H48A 1MRSA 4KIWA 2VF8A 2GN1A 3GF4A 2C7BA 1OI3A 4IHQA 4MQFA 3NTOA 4BRUA 4HYEA 4CNQA 2Y27A 2EJBA 4H3VA 4IOJA 4ZRNA 4CHGA 3A04A 5GADl 4S3MA 3QLUC 3DUFB 3QU2A 5D87A 5T6BA 5KQLA 1F8GA 2PM8A 4OP2A 1OFGA 1Q57A 2QVCA 2GJAA 2R1VB 4Z86A 2AXNA 3DEFA 3RBXA 5JASA 4NFHA 3SF8B 3ZHZA 4DADA 3OF3A 3ETCA 3EX7C 1WAMA 3QE2A 5B6JA 2AEMA 1WSDA 4HDSB 3TEMA 3LE8A 5LLSA 1DAHA 3G85A 3HI4A 1HOTA 1NRWA 1IZ7A 1E58A 5EJ2A 1NONA 2BUAA 3KE8A 2PUFA 3G6KA 3NT5A 4IH4A 4JJKA 3ZWPA 2OVBA 1O6BA 1BH2A 3EBLA 1RTKA 1G19A 2IXTA 3DT6A 3DZGA 3LT5A 3PS9A 2XGSA 3V8MA 3J80A 1A8UA 5AKXA 4BNZA 1KEEB 3L9XA 2Z5GA 1L5VA 3HZOA 1JU3A 5TSDA 1EWYA 1XTPA 1KSFX 3FX2A 2DEUA 2EG9A 2ZZKA 3DLBA 4JXZA 4FR0A 2Q2NA 2K87A 5GWXA 1JQDA 5KYVA 5F5LA 4R8LA 1V45E 2VJLA 4MO9A 4N65A 2OAP1 4RETA 1XSEA 2NOAA 2OCKA 2ZJAA 1FRNA 3DMDA 3HA2A 4LE0A 2BDUA 4YJGA 5JS2A 2EQBA 2R7AA 4LRTB 5FPKA 5IT4A 3A58B 5F64A 1V11B 4PX9A 1QH8A 2UVDA 3VI4B 1C3OB 3QEMB 2E4UA 4G4GA 4IGIA 1CDOA 4MV1A 1U80A 3GX1A 4RKRA 4O29A 2IE0A 4KQMA 3DAHA 4MUGA 4J1TA 3VR5D 3ROMA 1RYHA 2VJNA 1B76A 4YMLA 4Y9SA 2UZ1B 3V32A 1IAQA 4F4DA 4NMXB 5CP8A 2PLFA 1H0KA 1T5TA 4N0DA 4IGEA 4JEIA 1USGA 2HSJA 3W7BA 2DUJA 1PGPA 5CPFA 2AZTA 2YWGA 4JP8A 1NJFA 2VIIA 2VQFB 4B4OA 5DNVA 2YXDA 4EB6A 2H1SA 2Z2IA 3KR0A 4BIIA 1DJLA 2WUDA 2CUTA 1HRDA 3QGMA 3GBSA 4RMIA 5JMWA 3QUBA 3I1YA 1PEKE 1WDWB 1OUMA 4EK9A 3R76A 5AUOB 1PFWA 2PGJA 2PZKA 2ZM5A 5G41A 1JSLA 2VDQB 4UD6A 3B8EA 1CJMA 5IHPA 3PR1A 2YV2A 1MRZA 1XT6A 2J6IA 3W2FA 2NU9A 1DC3A 2UZ0A 1DELA 2NT4A 2Q7DA 3QJ5A 4MLCA 1NQVA 2P5SA 1L3CA 4MB6A 1U7ZA 5KWIA 2A1IA 4RQAA 1A50B 4MW9A 1YASA 2IV7A 3OIVA 2V8BA 4UVIA 5SZHB 3KKMA 4NV3A 2UYCA 2IT1A 3TQCA 2VVTA 4CMGA 5DN6D 2JHAA 4O4JB 2VNIA 4L78A 3BAFA 4YXWD 2FLWA 2D5BA 5C4GB 1YUMA 1E1MA 3UJDA 1FX1A 3EB9A 1MPTA 3L7CA 3CLKA 4LPKA 5CT9A 4BGVA 4NMMA 3AR9A 2AI1A 1PBTA 2EZUA 3X2SA 1NG9A 2ZSKA 4M60A 4I8XA 1BA2A 1M67A 4CR7A 3RKUA 1UJ2A 2HXYA 3I04A 3TL2A 1VJ0A 1BDJA 1OCEA 2OCXA 1LJUA 3EQ9A 3T1TA 4M49A 3I9OA 1D4OA 1OREA 3QE0A 1D6NA 1OXUA 5KHAA 5HKKA 3PUXA 3PNMA 1U0TA 5KOJA 3A6LA 3FB4A 3ORHA 3U4CA 4H35A 3CNNA 5AH0A 4KR7A 3TRDA 3V00A 4Z7NB 4IDEA 1I4LD 2ZAIA 3UAOA 3G2IA 2JFHA 3QG5A 3TUIC 5H7XA 5L45A 4H1TA 4KO4S 2XOEA 1KY3A 1X7GA 2WEKA 1KJWA 3DAOA 4QNMA 1L4KA 3OWXA 4CDGA 3SX2A 1P29A 3HGMA 4ZQFA 3TR0A 2OK7A 2HR1A 3NGXA 4K46A 2QV7A 3WGNA 2W6JD 5BWNA 3E9CA 3ELDA 1T91A 5ULLA 4UNQA 4URYR 4RVCA 4O33A 4YK7A 1I32A 1I7DA 3HUUA 2L69A 1H2FA 1CJTC 1WXDA 2FG6C 3JQAA 3PUWA 3VJKA 4G9BA 1YI8A 4MWGA 1M74A 4WNCA 3PYXA 5J58A 2IYYA 4QRDA 4XVCA 3E1GA 3CT6A 2JASA 2WF8A 5FRDA 3WL7A 3A0RB 3ZDXB 1W5SA 4DLNA 1NT4A 4V2UA 4OA8A 5C1BA 3DFFA 1FNDA 1E4OA 3NC0C 4IL5A 5FLKA 3I1IA 2J33A 1C2TA 1HNWB 1J07A 1S3GA 3GH3A 1L5MA 2I4TA 3K6JA 3LBNA 5BN5B 2BGMA 4BFCA 4ZEOA 1GHTA 3FKSD 3NTUA 3LQ4A 1AK1A 1VE9A 3Q41A 2NIPA 4JELA 4C78A 1PZNA 5L51A 1C3EA 4NE2A 2IEIA 4WOCA 5KWJA 4L8FA 4JCOA 4PZUA 2C58A 1L5NA 4RTRA 2BFFA 1L7BA 1E2BA 3B9RA 3AV3A 3MJTA 4ZCLA 4GNRA 5BOSB 3NUZA 3KPJA 1GG2A 5JNSA 4EJ2A 5DX1A 4RLHA 1RM4A 2BR3A 2GO1A 2RG1A 3I72A 4EKEA 3NP9A 4P0QB 3BJMA 1K8YB 2J9ZB 3OEHA 3LT1A 3VC1A 3SMVA 1PLLA 3SU8A 3BWBA 2JIDA 1JMVA 4G1UC 4LJ6A 4MI1A 1GADO 2YOHA 1IEQA 1L4UA 3MRSA 2GOYA 5KKAA 4EX6A 5JFOA 3TOSA 5IN5A 1ODCA 1TJ4A 3OAAD 4MRMA 1PDWA 4B4WA 2VBCA 4BE4A 4DLBA 3JD2A 2HF9A 4Y2TA 1LZKA 4YJ3F 8GPBA 5F21A 1I4WA 2Q3LA 4IJKA 1NMZA 1A2BA 1WTAA 5CBPA 4AW9A 2RGUA 1NUAA 4OHMA 3IV9A 4YI5A 1ZK3A 4CNBA 4WWHA 3L0YA 3L79A 1YJXA 3B1JA 2BWJA 3LY5A 3QF4B 4E12A 1P77A 2YYAA 3CW8X 1R18A 2M6RA 5BVGB 2FFRA 2RHHA 4E15A 1HLGA 3IV7A 3UJHA 3BWDD 2HY7A 2X2PA 3D3NA 3PQ7A 1J8VA 2EFYA 2IYEA 2W71A 3HJRA 5F1PA 4F0JA 4KCGA 2CK3A 2AW3A 1SA0A 4YP1A 4E4TA 1Z4IA 5FQOA 1RZRD 1NATA 3U4GA 5I4BA 1HDZA 3TEJA 3TSZA 1M8FA 1Y1QA 2XVZA 1ZGAA 1E20A 2WFZA 3DZ8A 5TS2A 2DHCA 4JLSA 4L22A 2EXXA 2BGLA 3HUFA 4RWEA 3LVRE 1K6JA 3HYSA 3TZKA 1IRXA 3K70C 1HA3A 1TECE 1DRVA 4MV9A 4QBHA 4K6OA 5E0KB 1T1RA 3TIIA 1OB2A 3QF7A 4RCVA 1U7TA 3SXUA 4I1OA 1FXSA 4QJ5A 4MGHA 3T7EA 4KQCA 4NBKA 5DP2A 5JZSA 4I9FA 3QFHA 4HNUA 1OIXA 1K7YA 2ZT6A 3NXKA 4FXOA 2R6AA 4DCVA 2O0HA 3P45A 2M2IA 5CIQA 4C7BA 3BMNB 3W8RA 4DAEA 3IHLA 1GAWA 3IQIX 4GM0A 2I5PO 4UJ3A 5IKMA 1G2OA 5E0OA 4LF7B 1FYEA 1VPTA 5CDFA 3IP7A 1QPGA 1NVBA 3E27A 2YQ4A 1VECA 5TF4A 3E9MA 4U5QA 2IBMA 2QR5A 2WM2A 1UBNA 3D2BA 3WWYA 2CZQA 1K7SN 3LUJA 1I7LA 3C7AA 2AJBA 1S0UA 4EO9A 1KOJA 2J9RA 3HVIA 2FWJA 4HWGA 1QZUA 2ZZMA 2WV9A 2YW9A 4QARA 4F4HA 3TECE 2PMBA 3KUDA 3D7NA 4HV4A 3IP8A 4J6FA 3DG9A 2O3QA 2O2ZA 3LAWA 1G5RA 2G1KA 4OGKA 3W4IA 3EGDA 4RVUA 2TECE 3PC8C 2Y9PB 4BB5A 4IIVA 2Q3MA 5H9WA 1WOMA 4OUDB 1QUEA 2WJZB 3KL4A 3QUSA 2ZTSA 4YRJA 4O4LA 3B7WA 1S1MA 4UTVA 3FB1A 4KFSA 2XNJA 4ZOAA 1DEOA 2GPJA 2ILTA 3WICA 4GEKA 1L5GB 1E5VA 2GBFA 1NW8A 4NYIR 1PG5A 2Z83A 4BQNA 2I3ZA 3BKXA 1GVNB 3BL8A 4EMBA 2HIAA 2GDZA 2TRSB 4GZ3A 2P78A 2QDKA 4RLFA 3UH1A 4LDJA 1FFAA 1YS9A 2W0SA 3C45A 2J6BA 3WGZA 3U5TA 1CUIA 1V1RA 2O20A 4E2FA 4PG6A 4BNWA 1ZUHA 1A76A 3CF4G 2XI4A 3RHSA 5I7VA 3PA6A 3C1OA 1A8PA 1SO8A 2IW3A 1J2YA 1MKYA 1G3QA 5FNVB 3OECA 3ECCA 3Q2KA 4NZYA 2YN2A 2G77B 2I4MA 3PDIB 4NOMA 1UFVA 4OXRA 4I5FA 1Z28A 2OSVA 4N7JA 2E3JA 3QFFA 1SKUA 2W6IA 4I6GA 4B2PA 4F8EA 2DQYA 2H00A 3IRVA 1ZJYA 1W48A 1W8DA 4JYCA 4Y67A 4BNVA 4H3HB 1JAXA 2Z2KA 4L8VA 3KVOA 5AD1A 3PZRA 1ZIXA 1QIJA 3EA0A 1QRAA 2CB9A 2JDID 2BD0A 2OXEA 1SVLA 1WB5A 1ISHA 2YVQA 4D3FA 3G9ZA 1N5KA 3ZCTA 4G5FA 2CXUA 1I94B 4HOYA 4LBZA 5IDVA 5K3DA 3ONNA 1V95A 3LJKA 1NQWA 2H31A 4U7DA 3V80A 2HDWA 5KOIA 5CM8B 3PJDA 2GCGA 5CFMA 4KFUA 1ZHOA 2Y1CA 1QYWA 3CISA 4AS3A 3W06A 4B33A 3OQHA 3NBYC 3MTEA 2Z4SA 3KS9A 1KMHB 5FTNA 3B8HA 4CU2A 3KYJB 5B55A 2CHEA 5CEFA 1B43A 1F1JA 2AT1A 2WSMA 3WK8A 1N34B 3TCKA 3GRRA 3Q3EA 4IX1A 4KMMA 2B94A 2CHFA 3O2JA 5TEVA 3ICEA 1XMXA 4CKXA 4DIKA 2BP7A 3FDZB 4HAOA 3W1WA 2ZUBA 1G5FA 4R71A 3IQZA 4HWRA 1U8CB 5IH3A 4Y2HA 1Z2EA 4FFOA 4RVNA 4R5HA 3FHJA 5TXGA 1STOA 2ZBDA 3KEGA 4UVDA 3FKQA 1NXVA 3I4FA 1QK3A 5BUCA 3H75A 4LF9B 3BA6A 2I91A 2HPZA 2IOFA 1GQRA 1GLVA 4MKGA 4UEQA 1F8FA 1MQ8B 1XRRA 1VB5A 3PNYA 3Q0IA 5EJIA 3TDKA 3SC6A 5DK4A 2HJSA 1H9CA 1G17A 1CIJA 4M1EA 2FEWB 4KIJA 1BQEA 4X20A 3L6CA 4GX0A 4RKQA 4E14A 3L0SA 1JR6A 4X00A 5D1HA 4I5EA 1HM5A 4HDMA 2JA2A 4YAWA 5LA6A 1WHSB 2GRJA 2ONYA 3A06A 3P9CA 5F4BA 3H6GA 4FDAA 5DW0A 1RRVA 4RSGA 4GMHA 5DIZA 3HPRA 1LNSA 1RBZA 2CXOA 2O23A 3KJXA 2B4TO 1G1MA 4Q21A 2IWHA 1M2VA 1A04A 3I3OA 1SVUA 4JUIA 5CLHA 3AEKB 4EHJA 4CF7A 2CV2A 2Z9DA 4H60A 1QTQA 1ISSA 4IMRA 3OZSA 5EIHA 2ASVA 1JWAB 2Q5EA 3GLIB 4BEJA 3WB1A 2UYYA 4GMXA 2LR0A 3M0EA 3FOWA 3B9PA 4QGGA 2XCTB 1J5EB 2VATA 4DIDA 1YVEI 1TMKA 5IRCD 4DIFA 4ENQA 2IXGA 4HI0E 3OM0A 1ZD2P 2CDCA 2F4NA 1IK4A 1N6NA 1ZRSA 2HLNA 3DO5A 3PGA1 2Y99A 4ZO6A 5EJ4A 1MA3A 4RIFA 4XQ0A 5AVZA 2XCUA 1YVUA 1RLMA 2ALJA 2B8WA 2GK3A 3Q7QA 1XJ0A 2HA5A 4U7WA 3RJMA 3DWFA 1Z68A 1ZL0A 3A36A 4QAQA 3F90A 3I5YA 3T9DA 3HKCB 3THOA 2O5VA 1CDDA 4OBEA 4BV9A 1G5PA 1NNSA 3BTVA 3LH5A 1W9HA 4QAJA 4FN4A 2W98A 2ERXA 3EZ6A 5IC6A 1Y9ZA 5TMEA 4XYLA 1KGDA 4Q19A 4DCPA 2OCGA 4PZEA 4YA6A 3JQPA 4UPDA 4W7IA 4AVYA 4F7WA 4YTEA 1AO3A 2Q6TA 2B8EA 1OB5A 4D9MA 3NEYA 1Y7TA 4D5GA 4TZKA 2O0LA 3OOSA 5AVOA 3VDXA 1WZCA 1RVV1 4G8DA 3JQGA 4JR1A 4GYJA 3VKGA 1H1DA 1JP7A 4PR3A 3WP0A 1DIRA 1R9JA 1NVFA 3E7WA 1ZXXA 4TMTA 2P77A 2QMEA 3ZE2B 5JNRA 1KYWA 3NASA 2X8JB 4X3OA 4EPTA 1S5PA 2WG0A 1P2FA 3IFSA 3WK4A 1Q1NA 1P7WA 2YWBA 4EQZA 2B1RA 4G0QA 1NVAA 5E4FA 1KSHA 2VS1A 3ONFA 2XGGA 3O3MB 5MDHA 2A9JA 3ZG6A 4K03A 2P2GA 2O7QA 4ATNA 3UN1A 5FWXB 4I0WB 2CUZA 1ZUD1 3L6OO 4US0R 4BO1A 121PA 3SZMA 3M5CA 4JQSA 3VPCA 3MOGA 2FKNA 4N0MA 1WMBA 3HA3A 1TPZA 1XRJA 3BXPA 1X38A 1BCSA 3I01M 1G8YA 1UJNA 2ES4A 3MELA 3NV7A 4L5YA 3SVZA 1CUSA 1BKSB 3MBKA 5HF8A 2GASA 1J6UA 3MXOA 3PEUA 4K86A 4LOKA 4CKWA 5LYJF 1B15A 3IPCA 1G3MA 4M98A 1KYTA 4O2AB 2PZLA 1XEXA 3OE1A 3O8LA 2RAUA 4LHSA 5AI4A 4KNYA 4TT3A 1EM8B 4P82A 5MGBA 3Q5GA 2CF5A 1T9GR 4E6PA 2EX1A 4LY3A 4CLDA 1ODTC 1H0HA 1YRLA 1PNRA 4BJ1A 2KM1A 4I6JA 3R3SA 4KRYA 5JVDB 3UUGA 4L5JA 5KTTA 2IY7A 4EKNB 4C0SA 4TMVA 4E1VA 3TW0A 1K06A 3WGTA 4X7RA 1VCOA 2G0AA 4EH1A 3WLQA 2OWEA 4G1BA 4MS4A 4DBLC 3AGPA 4C7JA 2BR5A 4MYRA 1QQ7A 3LBAA 2YX1A 1Y1KE 1D3AA 4C6HA 5EXSA 3RNOA 1C8BA 5CDUA 4CKBA 3QKSA 3IOYA 4EVSA 4TV9B 4BLUA 1HSOA 4IRMA 3DC7A 2P8SA 1MBZA 2FWBA 1GTSA 1GNTA 1T9BA 4DA0A 3L49A 4BFZA 1H9AA 3E70C 5DGDA 1OI2A 3P7MA 2GRAA 2ZQYA 2BF7A 1SUBA 2JLZA 1QIMA 1X19A 3RUFA 1K3TA 4UOQA 1ESMA 3NNNA 3RAJA 4EMSA 1DG1G 1X87A 1PEDA 4X1OA 3EWSA 1Z5OA 2VSXA 1RQPA 2OAQ1 4OJKA 1T0UA 2A1TR 2X42A 2YIDA 3B53X 4JUDX 1J0EA 2BBSA 3BMOA 5BW8A 4OHKA 2HWXA 1WDMA 4PO3X 5BN1A 1QSGA 1SCUA 2NQ2C 4OMUA 3WYFA 5C1DA 1TQ2A 2ZOSA 2H3HA 5A7GA 4OHZA 1R1DA 3E58A 1QS0A 2HT6A 4LZAA 3A11A 5KMGB 2QBYA 2VAMA 2PZAA 1DFHA 3PF9A 4H1HA 1TYCA 2V9ZA 3AEQA 2GCOB 3ETEA 4I4NA 2QRJA 4PAWA 4Q1VA 4WNYA 5HDBB 2RONA 3RFTA 3TUJC 5KVSA 4JC4A 3TLXA 3Q7PA 1CB0A 1XE3A 3T41A 4CCAA 2F9LA 3T9AA 1NJ8A 4JNCA 5JBQA 2DM6A 4G0NA 1Y6RA 4EY3A 3MT8A 4JR0A 4L76A 3MPOA 3EDOA 1RYNA 1KS9A 4KMOA 4KE9A 5ALUA 2A33A 3O8QB 3PHIA 5TS3A 4Z4EA 2HK9A 4E5DA 4DNFA 5HW0A 1S9HA 4JYBA 1GM5A 2VSNA 2BMEA 2C95A 1IDN1 5AJUA 4ZJZA 1YNSA 1JG1A 2PZ8A 1CJUC 2QIOA 1UM9A 3I73A 3F6YA 5HQJA 3WYNA 1NHWA 1GTMA 1U63A 1NQTA 3GEIA 1RHUA 3EY4A 3ZX5A 4P3OA 3ADKA 3IAEA 3CZQA 2QRVA 2POCA 2JD2A 1WKVA 3DV9A 1QJ4A 4PIVA 4BC0A 3A26A 2ZSBA 4L2IB 2BMWA 4P32A 1K3UB 1RQ7A 1WV0A 4DMKA 5ICMA 5ALFA 621PA 4NDNE 4GBED 4AC9A 4CDRA 4ITUA 3GEBA 4WBNB 1NF8A 1Z5ZA 4F6RA 5DGIA 2HHJA 3LVQE 4LXXA 2WLSA 5WRFA 3HO1A 2JGMA 4S2UA 5BMVB 1UIMA 3BMQA 2EP8A 3K96A 5ADHA 7AT1A 1RQGA 2OG1A 4P4LA 3RVKA 1YFZA 3H05A 1N7JA 4PYRA 4RE6A 3CLVA 1KZYC 2PBFA 3ETGA 1MNQA 3HS3A 1JJIA 3L6EA 4D6PA 4RTJA 1JEYA 2W11A 2W4QA 4I3GA 3EVEA 1RIFA 4DQUA 1KZ7B 3PA8A 3R6LA 5ADVA 5IYZB 3NOXA 3JVUA 4NWIA 2YZ7A 4RTPA 3NBMA 3SC2B 3TSYA 1TFRA 3KJEA 2FWAA 2WWWA 1E4EA 3NTXA 3K94A 3Q40A 3UV6A 5DXJA 2SICE 2GTHA 3AF0A 1RKXA 2J67A 2QN1A 3AY0A 4JASB 4IUDS 1ZCJA 4K6HA 4J1TC 2B1JA 1K75A 2B82A 4RY9A 4A5OA 1VA4A 3AEZA 2YL2A 3WDKA 3PHGA 4C07A 3SQWA 3AFHA 1J70A 4YAKA 1U6JA 2XODA 1T2VA 1W75A 2WSBA 4XPIB 3ELUA 2YMQA 1F0YA 3TR6A 4V1CI 3IH5A 4C7MA 1WZ2A 1BW9B 3QZUA 3QXCA 4KBFA 2F3QA 2AQ8A 3CM0A 4ZQHA 4G0VA 2WOOA 4QU5A 4Y6QA 4B5KA 2IOQA 1NN3A 1ZRHA 2DY1A 3BL6A 3P9NA 1SQ5A 2I80A 3Q7EA 2HQBA 1XL1A 4NTZA 4QLOA 4Y9DA 1K8ZB 3R8CA 3DVAA 1DDOA 1LBQA 4ZCRA 5AESA 3L1VA 2KB0A 3FROA 3L6RA 3W04A 4II3A 4L9RA 4RD1A 1NBWB 3STWA 4AO6A 2YJ5A 1GKLA 1CUWA 1R6TA 2BMAA 5L8VA 2OFXA 3DFIA 3FYUB 4FYIA 3T5DA 2XA9A 3ZX4A 3M3DA 1G8GA 2EZ8A 1NUUA 4L4RA 4Q3KA 5J63A 4AN1A 1P0QA 4URWR 4JU9A 1Q21A 3KYBA 3QVKA 4FKBA 4C4ZA 3OEWA 5I8PA 4OFZA 1CZRA 4JEMA 3AHCA 2Y1OA 3GFFA 3Q11A 2SKEA 5L95A 2IEZA 3ABOB 4LYFA 4XASA 1GZ4A 4QQ8A 5DW3A 5CNKA 4WDRA 3U40A 3MD0A 1E1LA 1R6DA 4FK8A 4KVAA 4E5SA 2Y4NA 4GX1A 4QRHA 4QPDA 2IUUA 3HJAA 4GOJA 3I6YA 4CL2A 1HX7A 3RC3A 3KBBA 1HE2A 3C6YA 5DPMA 1VBNA 1LUAA 1X7WB 4WOPA 4ON9A 4WV3A 4M76B 3RYTC 1EHCA 4PHHA 4V0QA 4W8GA 4HZIA 3TZLA 1A7AA 9LDTA 3NS7A 1RPAA 2X9LA 5G4KB 1XNJA 2I54A 5AVUA 3ZKWB 3GOHA 1E2EA 4TS1A 4ZVKA 2J3MA 2WHPB 5F2NA 4Q4LA 1ORDA 1YULA 2NO7A 1V26A 5HJ2A 4KPYA 1XDDA 3WHKA 1TYBE 3W9YA 3VZRA 2ZBUA 4JOBA 2DH5A 3AFNA 2C2ZA 3T3EA 1Y7IA 2GEJA 3HB5X 5T3YA 3TF5A 4WY8A 3P5BA 3K2IA 5HZKA 1GEEA 1JS1X 3EXIB 3P20A 2PRIA 3QJGA 4RABA 5DBFA 4EGJA 4ZZ0A 1BCRA 1GU0A 3BXHA 3C8HA 2BLNA 4CLOA 3M1LA 2H4WA 3MCVA 3HL0A 2AVDA 2HF2A 5LQDA 3EMDA 4KR0A 4CEJA 4H2DA 4ZVQA 3IIIA 3CBGA 3Q2OA 5A1TA 1ES9A 2V97A 1VB3A 2HA7A 4NPHA 1PJSA 4RGYA 3BWVA 4ENPA 4ND5A 4W9NC 4S1PA 5FOUA 2YW2A 4MLPA 9MHTA 4BQQA 3RO7A 4LZLA 1VE7A 3KB2A 1Z0DA 4OAPA 1JDNA 5C3MA 2PTHA 3WRWA 2GHRA 3OM9A 3L9WA 1TTQB 3CXRA 1YRAA 3DD1A 4FZVA 4MRNA 5CT4A 1QLJA 5IFLA 4JJIA 1EJBA 2ZKIA 3HZHA 4AO8A 2JF0A 2Z6UA 1GTG1 2J3JA 4B3HA 1A3CA 2C2YA 3GMDA 2QI9C 1EESA 3GRKA 5CIWA 5FHQA 3WGVA 1L8LA 3N75A 4HC4A 3WO1A 1TT7A 4LZPA 4MS1B 1B3BA 1THMA 1VPLA 2PSJA 5KNDA 2GRUA 1RT9A 3NVAA 3S27A 3EF1A 3TD2A 4BTLA 5DCYA 4LNUB 2G88A 3ROGA 1HORA 3M6VA 4QULA 3IERA 5HILA 5J23A 1EFDN 1KNQA 1OGJA 1RLIA 1U9CA 3VYRB 5HOQA 2E1RA 1NVVR 1PQUA 4WLEA 2V7WA 5GGYA 3LRTA 5EQTA 2XGOA 1PWEA 3RVPA 1P3DA 2XUZA 2ZE8A 4G36A 3UMJA 2ZZNA 1JHUA 4L16A 5LJIA 3ZI7A 5HF9A 3QHPA 5JNTA 5KYTA 1W35A 5ALVA 2AYYA 4PXYA 5EWJB 5IBRA 4QYMA 2EWVA 1E59A 2VHWA 3JWIA 3NTRA 1JG4A 5B5SA 4L8GA 2C7RA 3M1IA 3WMWA 5L6LB 3QV1A 2V1UA 2JL1A 3FMPB 1NVXQ 1P2DA 1I7NA 2DFDA 1BFKA 2G4CA 3HXTA 2Q49A 4M8SA 2QV0A 4FB5A 1DFGA 2R65A 5IJ9A 3K5HA 1X74A 1GUZA 3C1UA 2N3ZA 4IPTA 3TE7A 1GGHA 1M1NA 2ZVPX 4US1R 1F2TB 4YS6A 3CRQA 1E89A 1NM5C 1RYEA 2ZWPA 3E0XA 4ILKA 4JP5A 4L6IA 4MPDA 3D59A 2BEVB 2PKXA 4TLDA 1E62A 1KVUA 1T3GA 2DHDA 4ZC8A 4S1VA 2VUIB 4EDFA 1FU8A 1FTYA 5JSUA 4DR2B 1EBUA 2PLRA 4RVHA 3PEYA 4MW0A 1GV0A 3H9UA 1HDEA 4BIMA 1FDWA 2IP2A 4DRZA 5KC8A 1HR0B 3GARA 4PRZA 1UDWA 2PT7A 4RY2A 2HGSA 4R8KA 1A96A 1RE0A 2JNWA 5DWDA 1E1CA 3VYVA 1LY1A 5KHOC 1VDZA 3H4MA 3A6GA 3NT2A 5DN9A 2ZE6A 2BOVA 3TTUA 5JH7A 3VZBA 2J59A 4ZJPA 1DJPA 3A1WA 3IVXA 2AUNA 4NMLA 4RY0A 5GGXA 3TX2A 3TZEA 1IQRA 4X1YA 2QT9A 3WNVA 2SCUA 2GBPA 3N2IA 3O4GA 2CD9A 3CN9A 4MA4A 3RADC 4DUPA 13PKA 3V1MA 3G13A 2G76A 3NJ4A 3S81A 4LKOA 3L8GA 4Q34A 1DAKA 1X7DA 3A7DA 4B76A 4TTAA 4CZ2A 2W2PA 4FMDF 3NOVA 2C59A 6Q21A 1YHNA 4B83A 2DZDA 4I55B 1RI4A 3KOWA 5K6AC 3EMBA 3BYZA 4ZQIA 1E1RA 3D8TA 2HMVA 1Z7BA 1OLSB 2WFMA 3ZCSA 1XQXA 1LKZA 2YOFA 4NC9A 5EHNA 4ZAZA 3U7IA 3WNDA 1F9AA 3BORA 2RIRA 3Q9UA 5DM60 3W6ZA 3RYFA 4X45A 2WD7A 1ZYUA 1S8AA 1E9DA 1D03A 5KNDH 1L5ZA 4LXHA 1NU6A 4L5AA 4UHHA 5IMBA 1RFLA 2WG2A 4GHWA 1LW6E 2EWWA 4LJYA 2JH9A 3P9SA 2P5TB 1XRNA 1VG0B 1Z18A 1Z2AA 5GJVC 1QFXA 4MRPA 3BHJA 3FRIA 2WR8A 3ZQ6A 2X5KO 3F1KA 3Q15C 3W5SA 1C3LA 3FYHA 2A2ZA 5K3CA 4A8JB 5IXYA 3MTBA 4Z1MA 2FUG1 3A1NA 1A82A 3U62A 1IY0A 2WWXA 5GM2A 5JXIA 3B70A 2GCPA 2QTFA 3FTPA 5LKAA 1FBNA 3G0CA 2VPZA 2YMPA 1Q17A 3M4JA 1SVOA 4QO7A 1EAMA 5I7WA 1SUWA 1EFPA 4DSAA 5NLLA 6PFKA 3GJ4A 2Y67A 4N3GA 4WE3A 4DL9A 3MJ4A 2V7XA 1NZDA 1RKQA 4TXMA 3FMOB 2YS7A 2Q1WA 5FHRA 5CVTA 3RVLA 3L7MA 3NDRA 3OTOB 3HWX1 1VIDA 3ETHA 3Q9SA 2QLLA 5B37A 1OYYA 1ICEA 3MWJA 3DE7X 4GM1A 3UWMA 3W5UA 3X1JA 4BAGA 3V9AA 3BA1A 4RXTA 4CG2A 2XUAA 4ZYWA 1O3YA 1RWVA 1VLZA 1ZH6A 1KVTA 3QMVA 1KY2A 5G02A 4MS3A 3TW6A 1RYZA 1SVWA 1DC6A 4IVQA 4RJIA 1FNBA 1BIFA 3HV2A 1JUDA 2ZYIA 4P93A 3PKJA 3TNFA 2XRYA 4FGLA 4S1OA 5K0FA 4Y1EA 4CMEA 5C8YF 3A10A 1QGED 1MMFB 3ROEA 1PQ4A 2ONCA 2ZDQA 5IT5A 4YLGA 5D51S 2BM9A 4YAGA 1RE1A 1ZG3A 4F8JA 5EIFA 2MR6A 3NBQA 3DBHB 1HMPA 4HATA 4X7PA 4XYEA 4DCCA 1HYQA 5DFAA 4DIOA 3UBMA 4RD2A 1OAAA 1U6KA 3KXDA 1GAXA 4CQLB 3FPLA 4G01B 1WEHA 1YIOA 2OYSA 1OBOA 3K8OE 4AZ3B 4E94A 2GFIA 1W19A 3IT1A 1VZ2A 1PKXA 3T7IA 4NDAA 3OPXA 2YVLA 4DN6A 2ZRCA 1DT3A 1TEHA 3OIUA 4TWRA 2FVXA 5DLQC 2WJPA 2D2XA 2CXPA 3TQFA 3OQMA 3LUKA 4WOKA 2AB0A 2J85A 4C30A 1Y4UA 2XOXA 4AJIA 4RS4A 1NOJA 3EUWA 4I50F 3ITDA 1JN0A 5HK8A 1C9EA 3IBCA 1OH8A 4D9BA 3MWDB 1VLVA 2XEXA 4ESOA 4PZYA 1HFJA 2VJMA 4AZ0A 1KNXA 3VNRA 5JPDA 1ID8A 4IDOA 2PCJA 3UKJA 2LRHA 4J1NA 1I6LA 1COZA 2XZTA 4XSGA 5HUHA 2XZOA 4BKMA 4FHCA 4V3BA 3N76A 2EERA 3U1VA 4I4IA 1OVGA 4CTOA 1FDIA 3F5MA 5DJ5A 1QB7A 4ZD6A 4POAA 3R9KA 3LNCA 3OPMA 4C06A 1KI8A 2MSNA 2YY5A 5JJ5A 3PDUA 1U4NA 1L2TA 3G2QA 3JSAA 4W4TA 3OPNA 1HL7A 3NGLA 4IHKA 1U6IA 5G0VA 3L4BC 4KDEA 3RVBA 4DE5A 2FWMX 1QNLA 1MV5A 3G89A 2F3PA 4IVPA 4Q9AA 1XL0A 2Q5LA 2B61A 2PSSA 1MB9A 4GC5A 1QCYA 4AQ7A 4IIUA 4KKXB 3T38A 4MVJG 1DAPA 3OX1A 4YV1A 5HE8A 2AN5A 1JEJA 3U4MA 1JEAA 4WL0A 4ZCTA 2GWRA 2FZ4A 4TUYF 2PCLA 3WNZA 4JC8A 3PZBA 4MUJA 3U0VA 2F62A 1D5CA 1TQ4A 3MG9A 1YQQA 2V5AA 4NBWA 4AZSA 1GCAA 3OE4A 4HB3A 3QUCA 4Q9DA 4L7VA 4XVQA 2A0KA 3AVQA 3F9CA 2H8KA 5CCDA 5K8UA 4D99A 4YUYA 2BCGY 5FBKA 2O2HA 4GIBA 4M55A 1RRCA 2GM9A 3CZMA 1RXVA 3RVQA 2NTYC 2RB4A 3IUMA 5GAJA 5AKLA 3V8BA 1YRYE 2Q9AA 4BJHB 2ID4A 4ZZ3A 5HUQA 4PW0A 4YIHA 2JD1A 3WYAA 1SPXA 2G72A 1CULC 1T3TA 4HQRA 3V2IA 5LD2C 2PSEA 2VT7A 5LVAA 1EWQA 2UYOA 2HB6A 4ZI5A 3NX4A 4XLTA 1EZZA 2OCIA 4GRAA 4Y8VA 4DV0B 4DIEA 2QM0A 2R6R1 1C9DB 2XYVA 4DA9A 4NX2A 3U7HB 5CA1A 2YV3A 2HA6A 4NESA 2RHGB 4AS1A 2HL6A 3O3CA 4IJ5A 1U7OA 4PQYA 2AYZA 3ISJA 1LDMA 2DHEA 5BSWA 1A5ZA 5LUBA 1IVSA 3EOAI 1KKUA 2PHZA 3I58A 3YASA 1DNPA 3JR7A 2FLKA 3CNLA 3CRZA 3O7MA 3N2NA 3HJHA 4UMDA 3WLTA 4QTUB 1NJSA 1XZNA 1FDTA 1ZWKA 4YROA 5BSKA 5I7UA 1RYBA 2CLIB 1C1YA 1IK6A 3C8DA 4PSDA 4F85A 3PPVA 2AH5A 3EVFA 4JUAA 1S2LA 3EHDA 5PNTA 4A91A 1JE1A 1QJCA 1V7PC 2VZ0A 3GNSA 4TN1A 3M6LA 2C31A 3CUUA 4RZXA 3C4QA 4C6TB 1KK0A 5E4YA 3VAZA 3ZDZB 4OHRA 5GONA 3L7KA 5KOHA