1PTKA

Studies on the inhibitory action of mercury upon proteinase k
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies on the inhibitory action of mercury upon proteinase K.
pubmed rcsb
source organism Engyodontium album
molecule tags Hydrolase(serine proteinase)
molecule keywords PROTEINASE K
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ptkA00
2ID8A 1DUIA 4HX2A 3GCXA 1AQNA 1OYOA 1Y34E 3DE3X 5ARDA 3VSBA 4HVLA 1R0RE 1SBTA 2Z2YA 2Z2ZA 2W2PA 3ZXYA 2QTWB 2Z30A 3DE1X 2PQ2A 1TM5E 2PWBA 1TK2A 3EDYA 1SIBE 1YJAA 3LPAA 1JEAA 1EGQA 1SUPA 3CNQS 2DQKA 4Z2AA 5JMOA 1GTL1 1AU9A 1SCBA 3AFGA 4K8RB 1BJRE 5ARCA 5JXHA 3CO0S 1S01A 1WMFA 2ST1A 2Z2XA 4NE7A 1SBIA 1SVNA 2DUJA 2PMWB 3VYVA 1SELA 2W2NA 3BPSA 3DW1X 3PTLA 3WQBA 1GNVA 3LXUX 1IC6A 4KB5A 2ZRQA 3VV3A 1SCNE 2HD4A 3D9QX 3OSZA 3TI7A 1V5IA 1WSDA 1Y3FE 3TECE 1LW6E 3SQOA 2IY9A 1NDUA 1Q5PA 5I9SA 1SH7A 3WHIA 3DDZX 2Z57A 1UBNA 1V6CA 3I34X 1BE6A 4H6WA 1Y33E 1S02A 1Y9ZA 1IAVA 3A3OA 3A3PA 3Q40A 1XF1A 3AJ8A 4OMDA 3H42B 5JXJA 1GTJ1 1PJ8A 1TO1E 1Y4AE 2G4VA 1SBHA 1GA6A 1PFGA 4C3UA 3A3NA 3BX1A 5ARBA 1TM4E 3F7MA 3TI9A 3VTAA 4I0WB 3WIVA 5K7SA 1ZVJA 3LPCA 5SICE 1P8JA 1KDZA 4JP8A 2SECE 3VV2A 1BH6A 1GT91 1AK9A 1MEEA 1WMDA 1EA7A 5AVJA 5FFNA 1T1IA 2PYZA 1Y3DE 1S2NA 1C3LA 3HJRA 1Y4DE 2ID4A 1ST2A 3QFHA 1C9NA 1GA1A 4ZOQI 3DW3X 1WMEA 3QMPA 1SCDA 2WWTA 1Y48E 1DBIA 2WUVA 3DWEX 2SBTA 3EE6A 4H6XA 4DZTA 5B1EA 2WUWE 1GA4A 3DVQX 1SIUA 4DJ5X 1SN7A 1KDVA 1TO2E 1YJCA 1Y3CE 3PRKE 1VSBA 1KE1A 4CFYA 1T1EA 1CSEE 2X8JA 4WOBA 3EIFA 4WOCA 1SUDA 4CFZA 4CG0A 2B6NA 3D43A 1OYVA 3DE6X 4ZARA 4YN3A 1KDYA 1KE2A 2Z56A 4NMXB 2PRKA 1C9MA 4LVNA 4OMCA 1P7WA 3GT3A 1Y1KE 5JXGA 4MZDA 3UNXA 4AKTA 1BFUA 4KPGA 1ZVKA 1A2QA 5JXIA 3F49S 1THMA 2V8BA 3L1KA 4RYDA 4KG7A 4M1ZA 3DVRX 4DWWA 1AVTA 2X8JB 4BWGA 2XTJA 1YJBA 1PTKA 3DYBA 1NLUA 2DP4E 2TECE 4FONA 3Q5GA 5AMXA 4GI3A 1BFKA 3I30X 1SUEA 2W2QA 1ST3A 1GCIA 1TM3E 5AQEA 4B5LA 1BE8A 2Z58A 1CNMA 1SUBA 1TM1E 2W2OA 4H6VA 4C3VA 3GCWA 1R64A 1SUCA 3T41A 4OV6B 5B1DA 2E1PA 3QTLA 2XRMA 3I2YX 1P7VA 2ZWOA 1HT3A 1WVMA 1SBCA 1SIOA 1AV7A 1SUAA 2PWAA 3F7OA 1T1GA 1NDQA 2HPZA 2WV7A 1YU6A 4J94A 1C9JA 5AVKA 3VHQA 1TECE 2SICE 3WIUA 4AKSA 2ZWPA 2P4EA 3DE7X 1SPBS 3DE5X 3SICE 1SBNE 1PEKE 3DE4X 3AJ9A 4NE9A 1AH2A 1TM7E 5FAXA 5FBZA 3BGOS 3GT4A 3LPDA 2IXTA 1MPTA 1GTG1 1R6VA 2SNIE 3DE2X 1OT5A 3I37X 1AF4A 1Y3BE 1SCJA 3DE0X 1GNSA 1TMGE 2GKOA 3P5BA 4LVOA 5CW1A 3ZXXA 2W2MA 3DVSX 2PKCA 1SCAA
chains in the Genus database with same CATH superfamily
2IEBA 1G16A 1F4PA 3DUFB 2P1RA 2WJGA 2XCLA 1LSSA 2JCGA 5H9VA 4ER5A 4W5RA 1A4UA 4IW3B 4GDFA 3NDBB 4CNQA 1UFRA 3GHYA 1ODFA 2JFWA 3JVUA 1XPOA 3NC0C 4QVGA 4UDXX 3R3YA 4RIHA 1GTMA 3M2TA 2IS4A 2BEUA 2A35A 3HLYA 1GKKA 1WZNA 4I5GA 2IVFA 2NZ8A 3AETA 3C85A 3LHKA 1VG0B 4MV5A 4QT0A 3ZDYB 3RUPA 4EGAA 1USKA 4KGDA 5IASA 5JAQA 5K8TA 10MHA 4OHVA 3ITEA 4ZVVA 3QF4B 4LDAA 2FF7A 2DOKA 1CZRA 2X3FA 5T6MA 1B8PA 3VV3A 3VYTB 5BR4A 2JAQA 4Q3LA 1WXWA 3CYFA 2GN2A 3WLNA 1RE0A 2AT1A 2VDVE 1DFIA 2JLSA 5SYMA 3SIPA 4CN9A 3PFHA 4JOBA 2O5VA 4O4JB 3E7FA 5L7YA 2RH9B 1T10A 2HPVA 3PR1A 4RGVA 2WE7A 3TQQA 2VJPA 3T0GA 2HQBA 6CHYA 1NM5C 5HMMA 5REQA 3GLIB 4FR5A 4OI1A 5FT9A 2C4HA 4CYMA 4FU0A 3CU5A 3T7SA 3ILHA 4BTVA 3K0HA 3RARA 4JKYA 3F7MA 4DJDC 2BAGA 4JR1A 1KDZA 4FYVA 1OSNA 3I2JA 3LL7A 3OPYB 4J9UE 5DASA 1LTHR 1LB1B 3VX3A 1TTQB 2GUWA 1T1IA 4KE9A 4CMIB 4E7OA 2GF2A 4LZOA 3VC1A 4AMUA 1E89A 1L7MA 5KJ6A 1Z6TA 2VOEA 1K3UB 1B23P 1QQTA 5DHUA 2F8TA 4M8SA 4X44A 3RRJA 1NQUA 4RPHA 4CT5A 1ILWA 1DINA 1ND6A 2Q6TA 5KUTA 5FL3A 3L5KA 1J00A 3RT1A 4DMLA 3BICA 3HBLA 4LC9A 4UTNA 3E05A 1X80B 3CLRC 3PRKE 2H2DA 2QRZA 3UTCA 5LA6A 1H1LB 1LBSA 1CDOA 3PITA 5I51A 4MLPA 2X76A 1N0IA 4Y30A 2QAJA 1MO5A 1G7TA 1D2GA 1XNRB 3LDFA 3ZJVA 1B6GA 5IAJA 5HKAA 4Y3UA 2IOFA 2P4SA 3GDHA 4OMCA 2Y67A 2R7KA 1E6EA 2G1KA 3ESYA 3OE1A 3E18A 3FWKA 1IM8A 4MSUA 2P6OA 1Z25A 5C35A 1RWKA 1D2EA 1PL0A 4O2LA 2JCXA 1E1CB 5ALNA 4ZTBA 1V3VA 1NG1A 2NP7A 4I2NA 4H7DA 5J4KA 4C4PA 2VF8A 5IVPA 4G1MB 4N4AA 2ZXFA 3V8QA 3QU5A 3OICA 4DCOA 4IVPA 2A5FA 4QQNA 5ANRB 1ZHFA 2EF0A 4X24A 1CUUA 4DNFA 4QDOA 2BV3A 3QA3E 4V0ME 5I7EA 5IH3A 1QHHB 3E70C 3TOZA 2DT5A 1DKPA 4N5MA 2NP6A 4MOWA 3AL2A 3G9XA 4TTJA 2QV7A 4E94A 3FVRA 3HXTA 3OQHA 1P1IA 1JLMA 5KTYA 1KO7A 2PAFA 2Z9DA 4UE6A 4II3A 4ZV9A 3WR5A 3KPYA 3CRZA 5KU1A 3F73A 1VMAA 1U7OA 3GA5A 1EDDA 1NSTA 3K31A 5FAXA 4Q82A 4D4GA 4JJ6A 4F5EA 4RMNA 4FB4A 2ZYWX 4P53A 3H2KA 4CKBA 4PU0A 3KKMA 1GL9B 1SO8A 2HH9A 3PHJA 5ARDA 5DGXA 1UC9A 2AFHA 3CT4A 4L5JA 3VZDA 3I0ZA 5ICCA 4AY5A 2G0AA 1DCFA 2RHHA 1X7WA 2ZVQX 2GAOA 3G17A 3P5SA 4KO2S 4CF6A 2A0WA 3TRIA 3HFJA 4BNHA 1XDZA 5ARCA 1FU8A 1ZGCA 3GGSA 4GQIA 3F3KA 2E0IA 1LQ2A 3NGMA 1OX4B 2QZZA 3UMGA 4NPCA 4WPGA 1XTTA 5KJFA 4JI0B 4I4TA 1S0UA 2FFQA 4YMTA 1AHIA 4KI0A 3HN7A 4C3ZA 1DZIA 1W5EA 2FJ0A 1IATA 1RJ9A 4ZAXA 1JMVA 2QTVA 3F9IA 3MCVA 4EUHA 4CM7A 2IEAA 3CW9A 2IYEA 3M6FA 5TQ2B 1E2UA 4DHWA 3DG9A 4UDNA 1T6NA 3H7IA 4WOPA 1P1CA 3LCUA 4OYRA 4GX0A 4WINA 1HEIA 4IVQA 5DWQA 1N2OA 5FFFA 3TIFA 3V8BA 1COWA 3DT8A 3R7AA 4FEGA 3R7LA 2ETXA 3LRXA 1M76A 2IU3A 3EZXA 2I8AA 2YVQA 2OFOA 4DV7B 4GPD1 4KFTA 4FMDB 4EY5A 4N01A 2C95A 2ZCVA 3NTVA 3PHBE 1LNZA 2BY4A 3FPBA 3ZR4B 1Q14A 1ECGA 4J7CA 1XNQB 3PNQA 2QT0A 2PUFA 2W4QA 3PGLA 5D6OA 1F9EA 5EJ9A 1P6XA 2JLYA 4L6AA 1SRQA 1JU9A 3NRBA 4ND3A 3PXGA 2ZVDA 2R5NA 2X5OA 4HQKA 2OHVA 2WUWE 3JQ7A 1EK2A 3V32A 4O02B 3VC2A 3K0AB 3KK0A 4P5PA 1GIAA 3T7EA 5KYNA 2E37A 2R62A 1F2UA 2REQB 3CM0A 3NNDA 4IQFA 1P9LA 3C15C 4NAUA 1XWFA 4F3CA 4BYGA 1MPXA 3U4CA 3BF7A 5JBQA 4L4XA 5E9JA 1IJEA 1CULC 3AHDA 5EJ4A 4I2VA 3MGAA 5CA0B 4RO0A 2B1RA 2FW9A 4ZOLF 3S99A 2PZMA 3N07A 1IK6A 2AXNA 2HZBA 3UMCA 3EOZA 3IVRA 4HEHA 2O5CA 2RB4A 3BGSA 3I2KA 3EXFA 4XSHA 5TMPA 5IABA 4QJ3A 3AHGA 3UENA 5BN5B 3ZXSA 5E6RA 1EFVA 3AHCA 1EVEA 2ZSFA 3OIYA 3UB2A 2WB2A 2VAMA 2YC2C 4FFMA 5COBA 4BLQA 3V55A 1H3FA 1IWOA 4BDSA 3EG9B 5C37A 3RJMA 1XDGA 1MDFA 3GRAA 1V1MA 2D7CA 4ZAWA 2NV6A 5IUKC 4XJVA 2CUZA 1KZ1A 1TKBA 2ZTVA 1TCVA 1ZN7A 4IQ8A 4O2AB 4PC6A 1H0SA 2CHGA 3D8SA 4IWYA 4BNFA 3L02A 3PUZA 4ZICA 5HXAA 3WAKA 4OHCA 4D46A 3CJRA 3PD0A 3CV3A 1CY0A 2BBTA 1C9KA 4EI2A 3AZOA 3U16A 3DV0A 3HPRA 4LSGA 4N8DA 4R8RA 3S2GA 2BUAA 5DM2A 4QARA 4REQB 2EIXA 2G1UA 2NNLD 3W5HA 3PX3A 2QRHA 4CKCB 1PV2A 2GZHA 2WF9A 3A11A 3Q7IA 4B4DA 3P2JA 3OQJA 2B78A 1BFDA 1QYVA 3TXAA 2IUFA 3ZE7A 1PFUA 1QKIA 4G86A 2WABA 4U2FA 2UYQA 4WA7A 2C9DA 1ECFA 4RJTA 2YXEA 2FR0A 1PSDA 3PXUA 3SOPA 3ESCA 5B4UA 3OAAA 5ISMA 2ZKLA 3MWYW 1SOVA 4XWTA 5CLHA 1KMIY 2P68A 1HNNA 1HQDA 1QCZA 2EBWA 2Z2XA 5JS2A 4F3YA 3QNWA 4MVJH 2E4AA 4IGKA 3RJ9A 1FJHA 3G7UA 5IZCA 4HUJA 4I50F 4RTKA 3OM0A 4WUTA 3KIPA 4U4AA 3SU8A 5G53C 5IT9A 3ZZMA 4CKCA 3EZYA 1QPZA 1P45A 2XDYA 5EIAA 3KO8A 1LEHA 1CYDA 3W8FA 1WHTA 3RUEA 1YB2A 4G2NA 5TPWA 4EB6B 2YYAA 1NLFA 3R7WB 4MK4A 5KNLA 1J2EA 2RHTA 3FNQA 4MVJI 1C1HA 2X6TA 1GQFA 5CK5A 5JNTA 3H2SA 5B3AA 1HDEA 3WB2A 3NH6A 1KP9A 2VT6A 4K9LA 2EHDA 4JJKA 3SIWA 3D8BA 2ETVA 3DEKA 2C61A 4DG9A 4UNSA 3SC2A 1GKIA 2Q4OA 4JL6A 2DWPA 2WTMA 3CB4A 4JLWA 3ON5A 1CG6A 3KJIA 1MZPA 3BDVA 4RPIA 1QQAA 3CH5A 4RH0A 4CF7A 2GGSA 2FY8A 4EMTA 3B1WA 4DRZA 5IMBA 4J0KA 4GW3A 1NVDA 3O5AA 1TW2A 4WFJA 1YJCA 3HJGA 1Q74A 3NTLA 4L15A 3GEDA 5JCZA 1J49A 1LLFA 2BF4A 2WWIA 2YYYA 4XRGA 2J6BA 3A10A 1NDHA 3DWFA 4QDUA 4AQDA 4LCEA 1WKVA 3G2OA 3TUJC 1YH3A 1J90A 3EGEA 4FXPA 4IZ6A 3QWIA 1F20A 1QHGA 3D3WB 4LDRA 4XM0A 3T34A 5KWJA 1THMA 2MSKA 4B32A 4WLNA 4BLRA 1MVNA 1O6ZA 3BXGA 3CR3C 1Z62A 2CVQA 3HGQA 1Y6JA 1Q84A 2F17A 2ID9A 3CNNA 4IQ0A 5AP9A 4YV1A 4MQ5A 1Y9AA 4LQCA 4CW7A 3EG5A 1W48A 5TMDA 4F2DA 1X86B 6GPBA 3VR1A 1NJGA 1J07A 4N6OA 2JIMA 2PPLA 3EMDA 2B5WA 2QA5A 3HABA 3NUZA 3IH5A 4O2BA 3P2KA 1D2NA 1BHJA 2R751 5BMVF 2EL9A 4OXKA 3SC4A 4O63O 2WV7A 4EZEA 3P4YA 2NUTA 4J7AA 4I1PA 2Q1XA 3HEBA 2XUDA 5B58C 4GFDA 2VP3A 4JC8A 2VJNA 2ZJ4A 3AFOA 1IQUA 3B6KA 4MGYR 4S35A 5JADA 1NF3A 1RZRA 5FTMA 4FBMA 4HLQB 4NZZA 4DT1A 5JD3A 4AF6A 3ZYCA 4XX0A 4JMPA 3DE2X 4K40A 3JALA 3G2HA 3NHBA 4XIGS 3IIKA 4D9HA 2XKBA 5C8YB 3PKZA 4MKXA 1G0OA 3C3WA 3U5ZB 2IKQA 1L4GA 4ETIA 5KREA 2DECA 3RAGA 1ZCFA 3KT0A 3NUQA 3L4JA 4Y0VA 5DXAA 2C77A 1XJ0A 1PR0A 4G8CA 3RGGA 5KTKA 5P21A 2I7TA 4RA9B 2Q7DA 2H0AA 2ZT7A 4AULA 1KXJA 1N2SA 4XWAA 1Q21A 4M0CA 3DHNA 1AE1A 2CB9A 3KQMA 3UBMA 1SCKA 2CMKA 1ODTC 3SZMA 1ZY2A 5BYKA 1RE1A 1II0A 4P2BA 5GV7A 3CZ9A 3H2YA 2YWRA 3NBQA 1KI4A 5CM9C 5IEBA 3O8OB 1F0KA 1DIOB 2FPMA 5LBTA 2Q1YA 1H6AA 3DLPX 4AKEA 4YP5A 2QDKA 2QIPA 4FSDA 4IUDS 1XMPA 3BKWA 1FDRA 5GJBA 3NTOA 1PZGA 1F6DA 1FU7A 4FYWA 4MWTA 4A16A 3TGPA 1RWPA 4XR9A 3QE2A 4RMGA 2RH5A 3QVXA 4F97A 3AJ8A 1T8SA 1A7JA 3QWBA 1HKUA 1TYAE 1ZD1A 3GZJA 1A5ZA 1J33A 2GXSA 3URKA 4IICA 3V8NA 5HK9A 5K6AA 2I80A 3BX1A 3FHCB 3MD0A 2A3NA 1EU1A 2JGIA 4L1KA 1ISFA 3GEEA 1US8A 3EQ2A 1WKBA 4RM2A 1PZFA 2VH5R 3L6CA 4ND8A 1FIUA 1WMDA 4P0QB 4KUHA 1MIOB 2CLHB 2BFBB 2Y0PA 3LC0A 3BXFA 4IIYA 4QUJA 3AEQA 1E2NA 1PEYA 1A71A 3AI3A 1GZ7A 3P45A 2PRSA 2BKAA 5GONF 4B76A 4B3DA 1O6CA 3KKZA 2BGMA 4PLFA 1QP4A 3E9YA 3ZU5A 3SD7A 3WWCA 1SPXA 3HY4A 3JQAB 2UVPB 4S12A 4PTZA 5IKEA 1SJ9A 4C14A 5A6VA 1GU7A 2GUGA 1U7ZA 4BP9A 3VX4A 1FFGA 3JATA 1I4OA 2NZYA 2PS3A 2FK8A 4KXUA 3KFVA 5ADVA 2NO0A 4TM7A 5TC4A 1IDN1 3UCXA 1JJAA 2HCRA 1XCGB 3HBMA 5LJIA 1OASA 2QN7A 3GFBA 3K09C 2QZJA 3FJ1A 4RL6A 5JCJA 2Q5HA 4BLPA 5AM3A 3I52A 3O73A 1NI4B 4DG5A 1OZHA 4KACA 1JNXX 4MCAA 1G17A 3S2FA 3EA5A 1PJLA 1A8QA 1ZCAA 2DFTA 1QS0B 1GPKA 4RDCA 1L5GB 4I3HA 5CB6A 2GZRA 3EVNA 4N65A 4BGUA 3MK31 3OFND 5E6UB 2P65A 4YFYA 3GGPA 3KOOA 1CNEA 4G6ZA 1FDOA 2C3MA 3AHEA 4B79A 2QR5A 1JR3A 2JI6A 5A1JA 1ODSA 2MR6A 4DANA 1QAOA 2AKAB 2NSDA 4RZ3A 2IRWA 4HXYA 4OHBA 2IIQA 1EDZA 3K8ZA 4PRYA 5LXTA 5BNZA 5D87A 3UJ6A 2Y1EA 4QHYA 4L8WB 1I13A 4FMBB 2WZDA 1PJ4A 3WFJA 4G0ZA 3FVTA 4I9FA 4XQGA 1UEIA 2ZAMA 4F5WA 3G2NA 4RCYA 3D7KA 2SNIE 1G4HA 4EHAA 1PO7A 4RXUA 1L5KA 5C8DA 4DQKA 3LCVB 4FP9A 5E2BA 1NXPA 4QNMA 1HDOA 1UJNA 1Z22A 1SG6A 2JKYA 1LKZA 5AM2A 3QU2A 3MXOA 2CFTA 3MINB 2IYXA 3WGVA 4D8YA 4D6PA 4FGZA 5GONA 4QU5A 5B30A 4KPUA 1BVYF 3HB1A 1Q16A 3G8YA 1IMJA 1QGOA 2XKKA 2PR7A 3QUQA 2FNAA 4MAAA 2APJA 1B8UA 5FPPA 4MQEB 1NUQA 4G8JA 1KAEA 1N8NA 1K75A 2ZUEA 1NRJB 4OU4A 4IBOA 4ZDIA 1AZTA 1IC6A 2YIJA 2VZLA 3MQ2A 4RQAA 1KK0A 3AC0A 1U80A 1WSDA 1JHYA 4C43A 2FSPA 3L0IB 3WXBA 2LV8A 1QH8B 3AF1A 2D5AA 5TDHA 1V4VA 3WX0A 1AKYA 5L3VA 3Q3IA 5TQ0A 1U7WA 2Z8YM 2BFFB 3UWDA 1VSQA 3LTNC 1Q95A 4IVNA 4JJ7A 1TAHA 5LQSA 4BX2A 4NG4A 1M7BA 4MRVA 2Z5VA 1RIFA 1ZH0A 3W6OA 1OXKB 3E61A 1YC2A 5I7SA 4GI7A 4UHDA 4MH0R 5ALYA 5K7SA 3OOEA 4YRSA 1ZMTA 3EARA 2C84A 4NENA 5EMNA 3D2BA 3Q10A 3OJLA 4P0TA 4O08A 1G7RA 1OW3B 5E9AA 1ZQ1A 3TD2A 3UMSA 2WB4A 4DZRA 4KODA 5FO1A 1E9EA 1PW7A 4MWDA 2WG1A 4KR0A 4QHTA 4QPJC 3VPBA 3DW3X 3ZHXA 2ABWA 2XTZA 3GCZA 5B1SA 4ZO9A 1AK1A 1W8IA 2GN0A 3BXHA 4LRXA 4MQLA 1WOMA 3VR5A 3R0QA 4ZJPA 3L8MA 4PEVA 1DJQA 3MWJA 2GZSA 5DB4A 1L7XA 4BE4A 4JJIA 5AESA 1Z2EA 4FWTA 1J8FA 1HL3A 3FVWA 1QLHA 4GPZA 2JFZA 3C6QA 3UAXA 3OTIA 3EMKA 4G4SP 4DLLA 1MUUA 1CTQA 2IYUA 1G64A 3OX4A 4QC2A 4WIAA 3STHA 1TQHA 4W6QA 1V16A 2J6IA 2Q1WA 1A2QA 1Z0AA 4PHFA 5JAPA 1YI1A 1KFJB 1EFHA 1QQ5A 2WC1A 3GZTB 3O1JC 3QUCA 4HRYA 4XPIA 5LP6C 4DWWA 4Z51A 1FQWA 1O6GA 3MS2A 5LIPA 1TT7A 1D7OA 1GZDA 2I4NA 4B17A 3NBFA 1OZFA 2OOSA 5TY0A 5KYTA 2DH6A 3X44A 2PT9A 1E1KA 2BKXA 3WB9A 4JI4B 5KVVA 1GZ3A 4KDRA 1G7CA 1V4NA 4TZKA 4GGPA 1GWNA 1GZSA 2GCOB 3C7TA 3EEYA 3KZXA 3EPPA 3GMSA 4IIHA 1ZI8A 2FK7A 3C7DB 2F43B 4U2EA 1E8NA 4C08A 1GSOA 3JXEA 5KU7A 4CEJA 1MP0A 2QQEA 1IU9A 1D09A 3U49A 3VH3A 5CFPA 2FE4A 4KHPB 3PDIB 4BU0A 1SPBS 3KHTA 4C07A 2D2VA 2CXSA 3AJ9A 3STWA 4BNDB 3H04A 2ODEA 2JHCA 4YIHA 1MEOA 3ND8A 3VFDA 1FNMA 3Q15C 5BRJA 5DP1A 1EJ2A 2GOYA 3O6VA 2KE5A 1XEXB 1Z74A 4UUAA 2H52A 3NR2A 4MUBA 4GP7A 5B2EA 3ONDA 4EKYA 2CHEA 3M5CA 4XB1A 4KNYA 1HBJA 4H1HA 4UARA 2WBLC 3OT4A 2BZSA 2C1ZA 3QY9A 1CLEA 3MAAC 4DHEA 3TL3A 1U0GA 1ZU5A 4OX9B 2ZW9A 2HWKA 4WESB 5AVOA 4DMMA 5HZGA 2C96A 1Z9BA 2Q45A 2ZPUA 5GONB 3DCNA 4CM4B 3KOUA 2P3LA 2WUFA 4UCXA 2RBEA 4CV3A 3RFFA 4RVSA 4RTQA 1GL7A 3E03A 1HO3A 3CXUA 3IUBA 1GG2A 4I55A 1KO1A 5I9MA 1TLTA 1Y42X 3PIRA 4FFLA 2ZE8A 1JHPA 1NIJA 2P3OA 4N3CA 1PU2A 4FT4A 3UMYA 5BWNA 2GH1A 2LPMA 3B2QA 3KUUA 5BUSA 2CMGA 1A1VA 1BE6A 2HO5A 5DBHX 5DN6A 4DNXA 3TLZA 3PUHA 4ZVSA 1M34B 4EQ6B 4JBIA 4KVFA 3S68A 1K3TA 3FKJA 4WNYA 3HMKA 3SY8A 1W7AA 1W52X 3W79A 1SUIA 2KMLA 1ZWLA 4CM5A 5C53B 2QJOA 2Q3DA 3WV5A 4A23A 1QAQA 2MJLA 3M5PA 3UWMA 1A5BB 1QJCA 2VRBA 1TB4A 2OC4A 2OSBA 3I45A 4U3JA 4XB2A 1E63A 1JSZA 4EHDA 1SUSA 2F9LA 3I5YA 1CF4A 3PICA 3DV9A 2FUNB 4J8PA 2RHJA 2R7LA 3HNOA 3ZJ5A 5EJEA 5IPFA 3EVTA 3N0XA 1LBEA 1PVDA 3M1AA 3OMXA 4FN4A 4DSZA 2IOHA 821PA 5KOIA 1KAQA 5KYWA 4B43A 2XUGA 5BPFA 1XMOB 1YA4A 5IBPA 4RTLA 1HSOA 3UK1A 1R8QA 4R7GA 2FUEA 1QFMA 1W29A 2X4LA 3DH0A 1GCGA 4JJFA 2JLWA 3QPCA 5LMNB 2WKWA 1JBEA 2IYTA 3IQFA 1E69A 4QWWA 5GOZA 3A1VA 1NMEA 3CZCA 3Q12A 3D5EA 3F1LA 3OZTA 4GH5A 3Q0IA 3WYFA 1QQBA 2R87A 5HRAA 1JVSA 1K92A 1OHHA 3W5JA 3F5FA 1V26A 4E31A 3S29A 4F85A 4GOMD 1PTKA 2A4KA 1EI9A 1ORDA 4DBVO 4OYHA 1XE3A 5DI3A 3RIEA 4C7OB 4M1KA 4ZO8A 4ACAA 2E82A 1II8A 2X1HA 1HDGO 3L1UA 2ZVPX 3NANA 4IY1A 1S6YA 5CH8A 1ZHHA 5BURA 3DMTA 3BD6A 1IOZA 1DWPA 3SC2B 4CBVA 2A5YB 2HCFA 3DZKA 2PMDA 1JFRA 3P9NA 4HEA6 2HK6A 1OVMA 4UM9D 4WV3A 4HH0A 4QBKA 4CKWA 4WAUA 4WNCA 5A2QA 1HYEA 1A9PA 2AG5A 4G0YA 2ID7A 1TCCA 1P19A 3C5HA 4LRYA 1JSLA 1I3KA 1HG1A 1YOBA 3GFTA 2ATXA 2J7KA 1KFEB 3GN2A 3Q2KA 4MRRA 5J5AA 3WIUA 4B3GA 4M9CA 1IVYA 5CLGA 3S44A 2GTPA 4CUZA 2CT8A 2K2QB 2WD7A 3ZHRA 3F8TA 2WLSA 3WAGA 3E5HA 2VTVA 2V9ZA 3K09A 5DWVA 1JLLB 3G2MA 2BL4A 3H1FA 3OCJA 3DE0X 4OHUA 4RK6A 4F71A 1N33B 1Z2AA 1LK5A 1EX7A 1XXHE 3V2HA 1Z5PA 2JFHA 4JP2A 2REOA 3L4KA 1NMZA 2I6XA 4BV8A 4JBLA 2GK6A 1H8ED 2H11A 4WA8A 4PAQA 3DE1X 4LF5B 2QY6A 1KAHA 5CA1A 3LBAA 1L6RA 1U5BB 3NDPA 1JEQB 2B5VA 2WT9A 3C7KA 4RJJA 2F1IA 5KJEA 1KETA 1NVEA 4Z9FA 4JHLA 5KJCA 5F12A 2G40A 2O3JA 3B8HA 1PG5A 1ZESA 2PKXA 5J63A 1DBRA 4A2WA 4RIFA 2WA2A 1J9GA 2DFPA 4Q24A 4HDKB 4NG5A 4PLWA 5HILA 2DWUA 4HOYA 4AFNA 2Z5GA 4FOTA 4QJ4A 4OLBA 5FRDA 1P7CA 5TEWA 2FW1A 3PNLA 3VR6H 1XN1A 5A9RA 1Q57A 1SRRA 2VN8A 1OC2A 3B9PA 3H42B 2J0QA 2H92A 1R4NA 4OKNA 1I2AA 2EZ8A 4D2IA 3ZK7A 1XCJA 4HUQA 4TMZA 2IFTA 2I6QA 2ZANA 2QX8A 4P83A 1HQCA 3ND9A 4ZZ0A 2YZGA 4ZVQA 2OHIA 2VPIA 3KCQA 4FHCA 4QOSA 2BHTA 1L5MA 3OEWA 2WJ4A 3K8YA 4GICA 5EWLA 3X3HA 4XDHA 3I01M 4KWCA 3FPSA 1J6UA 3ZNNA 4M54A 1DKQA 2WTUA 3BL5A 3DCJA 5AI0A 1A9SA 1PZXA 4G9GA 3WYNA 5EE1A 1RAGA 5M5BA 1YE8A 3KQOA 4TQUS 5JSUA 4RVUA 2XKJE 1BROA 2FB9A 2GVZC 2PN1A 2RIPA 3I6QA 4WXHA 3WYGA 4EPYA 4DR4B 1FUIA 5IAGA 1VSBA 5MGNA 3U37A 1U9YA 3EFOA 1T9HA 1GUAA 4PX3A 1MX5A 1NFFA 1PGNA 3GOHA 2AI2A 3KUXA 3OZVA 2AK3A 1TFRA 3JD3A 2RKOA 4KPUB 3OZ7A 3QJ5A 3NWJA 3MINA 4KPGA 1M66A 4MO9A 3J81A 2FWNA 3FSGA 1BEUB 3SKYA 1VLMA 3P9YA 1G2QA 1IG0A 4GOND 1ZGGA 1LGYA 3DVRX 3NJ8A 4IIBA 4AJ2A 5IN4A 3ROFA 3AVUA 2OILA 1ZHOA 1DUVG 3LC1O 2FEMA 5AMXA 3MMNA 2VYND 3UV6A 1CJSA 1SHJA 3HA3A 1GJRA 2VTDA 2AFVA 4ASUA 5KX5B 2D5LA 1YZLA 4H7KA 1E7WA 4CI9A 5BORA 4JEHA 2XWBF 2Y99A 1NVVQ 5B1DA 4CIVA 2BMAA 3N5KA 4N0EA 3D2CA 1S3GA 4MHOA 4BTLA 1ZWKA 3WP1B 1Z8NA 1PFQA 1IPHA 4WGFA 1J20A 1D2MA 4M9XA 4FD2A 4D80A 1FZTA 4L0QA 1HYGA 4NFLA 1ZJZA 1VLHA 1L5SA 3G5LA 5FR2A 4P0PB 3IC5A 1JQKA 2FPUA 3FH0A 4FCCA 2H1FA 4XIIA 3EFEA 3G7NA 5FBZA 4EECA 2E9SA 3LG2A 1CJKC 1LPBB 1LX6A 1WIWA 4ZHQF 5GGXA 3K0CC 4M1SA 3MTAA 1EMDA 3I05A 1EUDB 5AWFC 3LYLA 4P33A 1BHQ1 1IBSA 4ZGBA 4DA4A 1X7ZB 5B37A 4DKJA 3TKAA 3S2ZA 2GZ3A 3AWIA 3W2IA 2PBFA 5GY7A 1T5LA 2WSIA 1G21E 3T1NA 3KKOA 3LLCA 1NFRA 5CD1A 2AFHE 3NYWA 2Z09A 3PT5A 3HBAA 3VKGA 3B2EA 2RBKA 2HC9A 1QMGA 3L04A 4EA6A 1V5FA 3DBVO 5IKOA 1QPGA 2IT1A 3AFGA 3U7GA 1V8ZA 1QG6A 4H7JA 3KUDA 5A05A 1GT6A 4HPJB 5FOWA 5K09A 2H1OA 1HFJA 1F8GA 3KP1A 4Z0TA 3V9AA 4OPMA 4YV0A 3F46A 5BYBA 3EEFA 2HYDA 4PZDA 3W0LB 3AF2A 2C8LA 4RFSB 1TIKA 3UJCA 3GIWA 1FEZA 3AQIA 4R84A 1RCFA 4PSUA 3F8SA 4LIPD 4X3OA 3L79A 2JLQA 3OPXA 1JKFA 3MHTA 3ORRA 1XZNA 3ORHA 5C3UA 3ZIUA 4F3RA 1XRNA 4MDHA 2B4YA 5JXJA 3TTVA 1I3CA 2IEYA 1I5RA 2V96A 2ZRDA 3DDNA 5FOVA 1KZHA 3K20A 4CIYA 1OV6A 3RF7A 2VDWA 3N53A 3UFXA 3T3OA 2JCVA 4C04A 3UCFA 1LPOA 1TQ2A 3UGJA 4GR5A 1F0NA 3QJYA 4YRGA 1T8PA 3K5IA 3MJFA 5JY6A 4ZJZA 1JIUA 4OU5A 4BFZA 3HO1A 1UMDA 1BXGB 3FPCA 1APBA 4EW2A 2YV1A 5CX1A 4ENQA 1L7QA 2HXGA 2OZLB 3IAM6 4ND1A 3CNHA 5EZYA 4BJ1A 1WMEA 1JDVA 4H27A 4Y1GA 2IA5A 4CV2A 1PR5A 1I2CA 1UXKA 4O4HB 4BB5A 2E4XA 1V7PC 4LYAA 1AMOA 5HP4A 1IDOA 1KEWA 5DNCA 3I09A 1AS0A 4OSOA 1X13A 1Y0BA 3WIEA 2ADFA 2GB4A 2JBHA 5A1TA 3DEJA 4LWPA 4LOKA 1W2WB 3IUMA 4Q9DA 1U98A 1O95C 3DJYA 1YUNA 2JFFA 1CR4A 4NJEB 5L4NA 1U8XX 3HA7A 3CLKA 4A0GA 4NMXB 4Q4AB 4LOAA 4CTNA 5IXJA 4BZWA 1KO4A 3ZY2A 2WYIA 2OCAA 1X7ZA 1F51E 2POQX 5E1DA 3PT9A 4BXOA 3P0RA 1VZ3A 2I7DA 4J03A 3KBOA 4FBLA 4RXMA 4ZP1A 2ZB3A 4KOEC 3REGA 1FL9A 5IYZF 4HWGA 4QYIA 3RM3A 1HTBA 1AQLA 2W2LD 1ZH4A 2X2EA 3CPEA 4XA8A 4X95A 3L4BC 2HN9A 5D85A 2H63A 4EKIA 4KVZA 4EWLA 1V96A 5EP2A 3FVQA 4W99A 2K4MA 3C6BA 4L76A 1W25A 2DGDA 3RVDA 1I36A 4LE0A 1XL1A 1E60A 4FX5A 1ZA2A 5J4VA 2ADMA 5BV7A 1PT7A 1DDGA 1CZNA 1XK7A 2JGJA 5ALXA 3IXLA 5FUWA 5I7AA 2J0SA 2OBBA 1X1RA 3KPUA 1GYPA 2PUEA 3HYSA 2J5QA 4HMQA 5CFZA 4PRKA 4BUZA 1Q7EA 3CKYA 4Q9KA 4AAYA 1FVHA 1PQWA 4RA6A 5L3SA 5IBCA 1N6IA 2NQTA 1TZKA 5CXXA 5F23A 4A3SA 3R6GA 5I48A 3R74A 2YJ6A 3VR0A 4L2IB 4E6EA 3MLBA 3IDFA 5DBOA 2O2HA 1WY5A 2YHAA 4RETA 2ZJYA 3CPJB 2YW9A 3LFTA 4DPLA 2OAGA 4TZ0A 2REBA 3PF8A 4E7PA 6AT1A 4W5HA 5AOAA 4ZEWA 3AG5A 1Y7LA 4KITB 4D02A 2VNIA 4DLWA 4B2LA 1V1RA 2BHSA 2FPKA 3KNZA 3PWKA 1TK2A 1SIBE 4IILA 2VNAA 1H8HD 1AM4D 4BNJA 1MC5A 1R0SA 4JP5A 1DC7A 3ZCVA 1J21A 2B8EA 4IHJB 4WVFA 4DEXA 1TC1A 2H06A 2ST1A 2GPNA 4AECA 5CRIA 5C4GB 1FRNA 4IOMA 4ZVUA 3A06A 5H3HA 3REOA 4DIUA 1VPWA 1VXOA 3IMGA 4QASA 5BT9A 3M49A 4RTJA 1JLSA 1KARA 4B4WA 2SKDA 3R0JA 4BMYA 2ZJBA 2IY9A 5AVVA 3M4ZA 4TSFD 1JR3D 2O3SA 3TH5A 4ED9A 3RJZA 4X60A 5LQCA 4ZU3A 2F3PA 4PAOA 1RNLA 1S02A 1KE2A 4QXOA 3SE0A 1F5SA 5JMWA 4FD3A 5FKJA 1YQ9A 4TLBA 5L7WA 4XD2A 3TR5A 3FOAA 1SVIA 3MCAA 5D3MA 3CG4A 4QZVA 1GAEO 4G37A 3BM5A 5E1BA 1I4WA 4GC5A 4PZZA 3ZBPA 3ETEA 1NN1A 4X20B 5I7HA 5LPNA 2YJTD 1NP6A 2PBRA 3O94A 5CFQA 3K9CA 2X9VA 1B7GO 1J56A 1E0JA 2MHCA 1EA7A 5DYNA 1IRIA 4HUQB 3WGQA 4EI8A 5C8ZA 5HWSA 1IXRC 3W5DA 1AA9A 2IE8A 3ONVA 4FINA 5KIAA 2X1LA 4UW9A 1OJLA 4HS4A 1HPLA 4UU8A 4Y6LA 4IV8A 1ENOA 2QTLA 1GA4A 1KJ8A 4NU0A 2PKWA 1P6UA 2WW8A 4K88A 3ZGXA 1O4WA 2O1SA 1E79D 2ASEA 3HSSA 3VPHA 4A8HA 1SC1A 4DQUA 2NUPB 4F4UA 2BP7B 4CZ2A 1TA0A 2J7PD 4PGHA 2P9EA 4X6LA 2EQBA 2J9YB 3D4NA 4PONA 4G5QA 1P2BA 3WLSA 3LGSA 5B7PA 1QBGA 3IIIA 5F3WB 2VH2A 2PJDA 1R6XA 4RMHA 2OBFA 2NU7A 4M46A 2X8JB 4EJ6A 1P7PA 1NBEA 2XX3A 1UEJA 4RHXA 3DMTC 2HHLA 2VSYA 4ROSA 4HLDA 2O06A 2VJDA 2G9NA 2Z2JA 3FI0A 4HSGA 1AQYA 2VP4A 2B4QA 5LDDC 1KSJA 3F47A 3MM4A 4PPQA 3N2YA 4I1SA 2MYTA 4A8JA 2FTKE 1TJPB 1JGTA 2GXUA 2Z6QA 2QMEA 3TMYA 4XLLA 2W2TA 3GAAA 4QX6A 3ZH9B 1JFFA 5LU8A 2A0YA 4G5RA 4TVBA 3O1LA 2GYYA 1PR1A 2D4HA 2WM3A 1W0KA 4RX1A 1H69A 1ONBA 2AEFA 2HCBA 1YDHA 3VHQA 2PTHA 4RHYA 1KMNA 4G8BA 1O94A 2WD9A 3PEFA 2B6HA 2GD2A 1E5DA 3I39X 4U5QA 3NOXA 4Q1CA 3BGOS 1F1BA 5SY4A 4CUKA 3O95A 3ADDA 4A1FA 2AJLI 3T52A 4PZ0A 2Z9CA 4XTRA 5AW5A 2WSSD 3DFZA 4QDZA 2CYBA 1EWKA 4QD3A 3DVSX 5E4FA 4DRXB 3F0TA 16PKA 3T3HA 5KJ1A 1P9RA 3MOIA 4G1FA 2OYCA 1E3QA 1Q7TA 2GK4A 1KK2A 2PXAA 1RJFA 4M89A 1TX4B 2WSSA 3PEWA 1DMRA 1YZVA 2BEUB 3CLRD 5IRCD 2GXQA 2Z5FA 5CFMA 3ETNA 1U11A 1XMIA 4TTVA 4WH0A 5K3SA 3TGWA 3ZQJA 1Q12A 1VDMA 3KVNA 3IKLA 3LWNA 3TLKA 4I08A 5EGNA 3T9AA 2O8BB 3HU5A 4QUGA 5CXQA 2B21A 3RYFA 1KRHA 3CB2A 3H17A 3ICOA 4FCWA 4M9QA 2CJYA 2OYRA 1K06A 1QCYA 2CWWA 2FU5C 2HM7A 3TI7A 4KR2A 3JQ7B 4W63A 4HK4A 3DLBA 3NGXA 2LCIA 3VAYA 2IE0A 2Z57A 3CKLA 4OG2A 2FP3A 3TSZA 4K2HA 1EFPB 2M98A 4ZEVA 1LX7A 4OMDA 4E2YA 2QPLA 3NYIA 3PIIA 1OKKD 2QB5A 3A3YA 2VRCA 4MUXA 1NV9A 2OMKA 2BTQB 1PFGA 2P30A 4LOIA 4Y6SA 3B6IA 5ITZB 2PVPA 3MSXA 4W9NC 1RZVA 1QOPB 5AHKA 3BORA 1HDIA 4HRAA 4BNGA 3PDJA 5ALMA 2HDNB 3ZW9A 3U60B 1C81A 3E7PA 3GJ8A 4EEZA 2XQVA 1B0PA 1V6AA 2EJWA 2ACEA 1ISPA 3GRUA 3IURA 2CNLA 3QXSA 3TOVA 4AD8A 4PLHA 4FGKA 1JXOA 3R9KA 1DJOA 1JG1A 3L18A 4LHVA 4ZVLA 4ENRA 2I54A 5E9QA 4B2YA 2AG0A 3I32A 3EVFA 3K94A 2ZYVX 3TOXA 4ZYUA 3FPHA 4YT2A 4JODA 4LYEA 4CTKA 1UCFA 1K27A 3G8CA 1U0RA 4I19A 3ZHVA 3BTVA 2Q8QA 2DRIA 3BXEA 4R16A 3HB0A 4X97A 3STYA 4ZCIA 3K1JA 2R8BA 5IAAA 4DV0B 1ZNZA 3L43A 2OBMA 3NDJA 5JARA 4ZC8A 5A4JA 1E4VA 3ISVA 9GPBA 4LJ5A 1E32A 3AL3A 3PXXA 4WESA 5LZ4A 4Q1BA 1UBCA 2NO6A 4KAJA 1UMBA 1FU4A 1AHHA 1HI9A 2WAMA 3B78A 1QMPA 1YRLA 3GT3A 3R0IA 4F06A 1J25A 4ZYTA 2IP1A 2AFHB 3HDJA 3R1IA 3W6NA 5ALJA 1P3DA 3OZCA 1WX1A 4H4EA 2ASVA 2PLNA 3RC8A 5KNCH 1ESNA 5DNEA 1NXQA 1QLWA 3QFRA 4PQGA 2ZIFA 1IN7A 4IH9A 4UZSA 4CKBB 4S1WA 5F4BA 1VRCA 2BBSA 2FW8A 3HACA 2JKVA 3M34A 3SSNA 1L1RA 5INTA 4M53A 4N9QA 1MA0A 3P0EA 3MUFA 3OTQA 4V0LA 3PDIA 4D8UA 4EMUA 1QH0A 3IERA 1EK0A 4JA0A 3QUAA 2ZIVB 1NVFA 2OG2A 2CLIB 1VJGA 3HDHA 5EWLB 1GQ2A 3NI2A 3OZDA 4AG6A 1BH2A 3KR9A 3OT5A 4ZWNA 3L7YA 2AMYA 3ICWA 3ROMA 2W22A 3QEJA 4HNAA 1YU6A 2I65A 1XQ9A 3PCTA 3TW6A 4RTMA 3IKTA 4JX9A 2A9JA 1DAIA 5KVCA 5A71A 2FPPB 2OAP1 3AYZB 3T3MB 1DRWA 2JBAA 2PBLA 1RXWA 4X3PA 1QIIA 4Y6PA 4BRSA 4EABA 3Q3HA 4YVFA 3FHTA 5EIHA 1IOWA 1IAQA 2J45A 1EVQA 2Q0XA 3EMBA 4JB3A 2CKMA 2R00C 3AX6A 3K1AB 4RV9A 4TSKA 4OQ4A 5IXSA 5FJIA 2PJRA 3DNPA 3N2IA 4X91A 3O8DA 1KMMA 3MJDA 1ZJYA 3WL5A 3TQTA 1RAEA 1M83A 2ZSAA 3QI7A 1U7UA 1E96A 2CV2A 3KRTA 3U1TA 3GJ7A 1QANA 1BJTA 5EAIA 3Q11A 1HURA 3WGJA 1XRRA 4A9AA 1H2HA 5F3DA 4EI9A 3H9UA 4R54A 1KAGA 4FI3C 1GLGA 2G9VA 2IPAB 5GGYA 1ECJA 2Q1UA 2H5LA 3T4EA 2EV9A 5JU6A 1Q0TA 3PI6A 4UQLA 1RBMA 4G4GA 1JB9A 3RV3A 3PR2B 1U3FA 1XALA 5D3ZA 3M3HA 1E4YA 1IZ9A 5B4VA 4CEHB 1XUOA 4K6OA 4JB0A 1SH7A 4LZLA 1ZBDA 3EGCA 1BG6A 4PC1A 4MIOA 3W7VA 3GD7A 5FWXA 3AXSA 4REQA 9LDBA 2A59A 4ZOEA 1WB9A 4QELA 3H4MA 2HUPA 2PIAA 4XOIA 2G4VA 1YQWA 1OFUX 2Y93A 5AVRA 3UW1A 3W34A 2Q9BA 1W0JA 4N8SA 5AJUA 3W6PA 4MLCA 4J0QA 1AB5A 3KTFA 1K7SN 1XKLA 4WEOA 4QKQA 4IYRA 5REQB 1YZNA 3VV2A 3GLIA 4M1EA 4P34A 5E4TA 3ZV6A 3VH1A 3QFCA 3DFKA 1NWHA 1XZCA 2PYZA 3RUCA 3ZD9A 2NU8A 1V8DA 4GF5A 3ZS8A 4JBXA 1EWTA 2XMQA 5K0TA 4S1OA 3LTEA 5J58A 2O2JA 5JAIA 4TWZA 1KJNA 4II7A 2OHJA 3GMDA 3H1BA 3A6EA 2AFIA 4GMHA 5FLYA 5NLLA 5TJ9A 3RKUA 1XAIA 1E92A 4ARZB 4NEHB 3PUKA 4AO6A 1KXZA 2Y3IA 2HW8A 1QHXA 1WBJB 2ONZA 3GJ5A 4F2GA 4H15A 2RB5A 2NIPA 4BQSA 4J75A 3ZX4A 4YUAA 1SCUA 2JH8A 3JTEA 1L3BA 4BO4A 3O4IA 2IXDA 4O4JF 2CZGA 3DR3A 3SHQA 5KVSA 1OFHA 2GHQA 2NVUA 5JLJA 4AG5A 5YASA 5IKXA 4MUNA 3TEFA 4TN5A 1S5PA 1K7EB 1T43A 3I92A 1P7YA 4Q00A 5LQJA 3G8AA 2DE0X 2H85A 3OFKA 3RYIA 1K1EA 2Y1LA 2IVZA 5SYAA 5F33A 3SDBA 2NM0A 3KAQA 4COOA 2OD2A 2VHUA 5IT0A 1BWRA 3LKBA 4DR3B 4LS3A 3H5RA 2PD6A 5IVKA 4NIMA 2M6RA 1ENPA 5AT1A 1KKUA 4PS0A 1X1BA 4RDXA 1CZOA 1N2CB 1ZAKA 5FPYA 3MWFA 3MVEA 1ZJWA 2OTCA 2VZ9A 4J2OA 5KDDA 3WYDA 2CWDA 1JZSA 1IVNA 1GARA 2QL5A 2AZMA 2YFQA 3PZBA 4RMIA 2EQ5A 4LHYA 4R8SA 4REMA 4U6QA 2PUAA 1WHTB 2XITA 2QHXA 3H5LA 4R2LA 5JBNA 1QTIA 3V1NA 4LDZA 4OMFG 5E6UA 2AEEA 4YT4A 1GNSA 3DGFC 5EPUA 3IV9A 4B83A 5CDFA 3DEYX 1SKUA 2PWYA 1OOEA 2DM6A 1Y1SA 4F0JA 5GIPE 4KKXB 2V5VA 4FFSA 4O2BF 4QVKA 3SR3A 1ZIPA 2P9CA 3UB3A 4L02A 4DSOA 5BN3B 4KDCA 1T13A 1SCIA 1UPUA 4RHUA 2J3KA 1G42A 3LY8A 4W8HA 1S3SA 3CW8X 1Z33A 1IN6A 2YRXA 2OXRA 3M33A 1CXZA 3QLTA 5BOVA 4B6OA 4C7KA 1DG3A 5GV8A 4EL5A 4NJEA 3FNFA 1Z26A 4M88A 4BU1A 3A6LA 4NS4A 3PXCX 1EAYA 3KR2A 4RTRA 1U7HA 2YMPA 2QRJA 2BKEA 3D54D 4XWWA 1YDFA 1RKXA 2RAVA 1KAMA 4I6JA 5IFKA 3JASA 4IKPA 4TXHA 3SEFA 1VYHA 2VUHB 2WFLA 2XXJA 3UKDA 4QJIA 3WMEA 1E20A 4TLMB 4JROA 1KRWA 2YWXA 2VP0A 2ZRKA 1DHRA 1RWNA 5FI5A 4IGEA 2AXPA 3ZY3A 1G3UA 1FTWA 4G0OA 1V37A 3V48A 4HGNA 2XMBA 3L93A 3G0GA 4LGMA 3UJPA 4Y0NA 1XCMA 2EW2A 3FA2A 5EXTA 1H3EA 2GDZA 2ZBFA 1V1MB 4UHJA 2TSYB 2J6HA 1LCIA 3IBTA 3GDWA 4OXIA 2HXSA 4YLEA 4PCUA 5EKSA 2D13A 8AT1A 2AW5A 4QSHA 4DV3B 2QKYA 2IUYA 3AKZA 2GCOA 5A5VA 1P9WA 2XT0A 4HEA1 4NESA 1QIGA 1G20A 2O2CA 4MGEA 3D6AA 1OBHA 3TVTA 1NC3A 1S2LA 1Y5LA 3PE4A 4ARVA 5I6DA 5KQSA 3F6SA 2W11A 1IN1A 4MHSA 1OXTA 3AF5A 1EFDN 1G9SA 1O2DA 1I30A 3K9WA 2XZLA 1O97D 5FI1B 4GXTA 4B09A 1UDAA 5K6RA 1Q0QA 1ETUA 4QXQA 1ATIA 4UAJA 4YRBA 3I9V1 3LP5A 1TE2A 1XTSA 3QP9A 4EATA 1UMCA 4J4TA 2HOQA 3KC2A 5D3QA 1YZTA 4WRRA 3USES 1FFXA 4WW0A 2RH8A 4MZDA 2ZIXB 3QV2A 4R1QA 1E0KA 3PYMA 5JXIA 2K7FA 1UK7A 2HV8A 4YBRA 4OQPA 5JG7A 2Q28A 4BVKA 2GYWA 4N47A 3W78A 3QFTA 3LQKA 4WN9B 4EGSA 5IZ4A 1M1YE 1X3SA 2O59A 3CIOA 3T7KA 1FBTA 4GI3A 4MKHA 5DOVA 1WVGA 4BFVA 4URXR 3OJEA 3EWIA 4D74A 2GBGA 2R1TA 4AJ9A 4CM1A 3AGQA 2FZKA 3TW0A 3X1WA 2QG4A 5HX7A 3O83A 3O4HA 1KDOA 2XW6A 3I2YX 1PWEA 3NM4A 2JANA 2EKQA 1UXHA 3I3OA 4ASUD 2FA9A 1BDBA 4CU2A 1ZSVA 1Z7GA 1IQPA 1KI3A 1X42A 2FWPA 4FGLA 2C4WA 4GPBA 4C0JA 4YDRA 2A5JA 1UBGA 2BFOA 4M87A 2QU7A 2WWFA 1F17A 2EGUA 1Z4MA 2PHZA 3DA8A 1C4KA 2A1TS 1S4MA 4YRQA 5GJWC 3L7KA 1RYHA 2IITA 3QNMA 2EX4A 2YRWA 3JQFC 1HMPA 3OUZA 1NOIA 1C30A 1Q92A 5EYPB 1E1QA 1DC3A 1HFKA 3TOCA 4E07A 5F2KA 4LJKA 1P5FA 3UXEA 3ZHTA 3HBFA 3VBCA 2D3WA 4OHMA 3SOZA 2BZ1A 5JVDF 3OWXA 2TYSB 5FBWB 1E59A 4J0IA 3BCHA 4G09A 4HI0E 1SU8A 4RIIA 1L6IA 3NOVA 4MV8A 3HP1A 4UMFA 1BWQA 4QXAA 5C18A 2PV0A 3WMXA 1MJFA 1CQZA 3IODA 2RAPA 2EX0A 4MYTA 3GUZA 4JSTA 3T4UA 3ZY4A 1SBIA 3QLVA 4UATA 1MC8A 1U1FA 1XCBA 1Y4SA 3ESQA 4MNTA 5T8KA 4DV6B 3OCYA 2VXYA 1KL7A 1UXIA 1M1YA 4RFVA 1GPNA 1MF7A 3OSZA 4J1QA 5TGDA 4CT4B 1E98A 3LGAA 3R9XB 1DXYA 1PDVA 1SHZA 3GP8A 3H8VA 4NXNB 4X8OA 3S2IA 4BMCA 3U2QA 2XJ4A 2NNWB 1JBKA 4NMHA 4AJNA 4Y18A 1CEXA 3VR6D 3DEZA 1Y8QB 2GK7A 4QFCA 4RJ2A 2YWGA 3A1UA 4EHHA 3ZDEA 3MBIA 2ZJ3A 3BZBA 4N5IX 2ODWA 4OB8A 1KZ9A 5KTTA 2ZTLA 3ELDA 4K9NA 4Y2TA 3QKRB 4HQ6A 3R7WA 3R5HA 4DLYA 3DDWA 4PC2A 1PL6A 4B7CA 3QXHA 1TAUA 2KS6A 2HX1A 3MRVA 2UKDA 2GNOA 3GGJA 3IKMB 3Q0TA 3EDQA 3L92A 4J0JA 1NF2A 4RWZA 1AURA 2R6JA 2W0MA 4MKIA 1RLTA 3RNOA 2VHTA 4Q3OA 2GPAA 2NLOA 2R1TB 4NABA 2RHOA 5F7JA 3ST7A 4BBPA 4HPWA 1F8UA 1SVMA 3TSWA 1A96A 1SG9A 3CF0A 1O9HA 3PNBA 3PNSA 2YHIA 4KAXA 1ZUNB 1TO2E 1X15A 4WZ6A 3UTDA 4ZGGA 2V1UA 1F1JA 3H9JA 4S04A 1XMVA 3ZCQA 3JQ8B 3UMVA 1GTRA 2H65A 1MQAA 2VPQA 1L4NA 4GI2A 4PVCA 4AWAA 2YNMD 5FD8A 2Q9CA 2DWCA 2B25A 4OAOA 3AGPA 5IDYA 3ECCA 5K2MA 4MICA 4FC7A 5G4LA 5KNCA 4JEIA 2DQSA 4EZBA 2W90A 2JLXA 4OO3A 2IYVA 4LWQA 4GO1A 4MO2A 1F7UA 3AHIA 4OXXA 1SQ5A 2G07A 1NKTA 1N9KA 1JEYB 1G3RA 1K6JA 1IXZA 4CR7A 5KNCD 5KOJA 2ZOSA 1YNSA 3G2KA 1K63A 2CL7X 4BJHB 3KQLA 3Q41A 1ZXBA 1P0QA 3N74A 5EZYB 3FAKA 4AMYA 3IHLA 1KIMA 3VHXA 1BRMA 1LJLA 1V8FA 5DNUA 2X6RA 3ZCSA 5HCIA 3WBFA 1NBMD 3U17A 4R9NA 1RHMA 3C5WP 5CEJA 1T0JB 5FYDA 1JKXA 1LWOA 3PDCA 1I4TD 3SF8B 3G6KA 1F0PA 3D4PA 4OTZA 2RDMA 4YPVA 2RHLA 4GLFA 1XQYA 2C4VA 5G4KA 3WFIA 4UMDA 2XDQB 1WHSA 4GR9A 3A1TA 4LNAA 3T7RA 4TVSA 3GEMA 3JVDA 5DI3B 4ACBA 6REQA 1C3OA 1EBBA 2Y05A 2Z08A 2W2KA 2ZT6A 2IYSA 4K9RA 1XJ5A 4Y9RA 4AP9A 5KNBH 2W37A 1UBMS 3DOCA 4ZDJA 2P41A 3BRWD 2PGJA 4NCXA 1TC2A 3B5JA 3MCTA 1PX2A 1U9IC 1ZGHA 5CM2Z 2XXAB 1P1KA 3MB8A 3RC1A 4DTIA 1EJ6A 2DJIA 4A1OA 1T2NA 5FDFA 2AKEA 5CVJA 1IHDA 1PGQA 2A9QA 2GAAA 3B3JA 2V03A 4JQCA 1D1PA 4CCYA 2WG0A 1RADA 1N2XA 3A6HA 1TVCA 4PXAA 4EG6A 2H1IA 1SCBA 1WD5A 2R66A 2XMGA 3G5TA 3LK7A 4KU4A 5GM2A 3K8QA 1X7HA 3IO5A 3NIBA 3FZQA 2G76A 2YXNA 3VDQA 3E22A 3LQYA 2FFJA 1FTNA 1L7AA 2HJRA 3EXG1 3H9CA 1VYTA 2I4LA 3GRYA 3V6LA 8ABPA 4XAQA 5AVZA 5FP0A 3GFFA 3LX8A 3PPYA 3QW2A 4LBVA 1ECBA 4Q9IA 5I4KA 3K53A 5EERA 3ROKA 3WHIA 1MOSA 2J8ZA 4PAGA 2XNDD 3GEBA 3TINA 2XYPA 1XMQB 4RPKA 4ENWA 3ESZA 3OPNA 3UATA 4YT5A 2N46A 4K1LA 2ZI4A 3EXIB 3I42A 2Q2QA 4NSNA 1SEVA 3NT4A 3P20A 1R3DA 4MV3A 2ONJA 2D6FA 1KP3A 3ETHA 4G5XA 2JJ2A 2GO7A 2PZGA 4DMKA 5CDSA 3E58A 5JMPA 1XZDA 3QYPA 2ODTX 1C3VA 3C3CA 3ZN2A 4DSUA 1RMQA 2A78A 2UAGA 3WHPA 2Q6OA 3ZV4A 1RACA 5EZ6B 3E2PA 1FX0B 4TKZA 4NZNA 5JZVA 3OC0A 4F8JA 4RD6A 3SQDA 3WQSB 3ISJA 5H3LA 4B4KA 2RD2A 4DUGD 1M10A 2CL6X 2VBFA 2ERYA 3D5QA 4BKRA 4C21A 2G28A 1A7UA 5DEIA 4F93B 4R8VA 2HT1A 3OLVA 4CLRB 2GCEA 4RJIA 2BGUA 1W73A 1CUBA 1YA8A 3ILVA 4GWGA 2QT9A 2A6PA 4RELA 3TG8A 2A0KA 3PVZA 4KYUA 4LSWA 2FUG1 3GVPA 1E6KA 4IO1A 3UJBA 5GVSA 5ESDA 3VNBA 2F4VB 1PS8A 3RYHA 4ZYLA 4EFKA 4Q4JA 1HY3A 2WKRA 1LNQA 2QLNA 1QYIA 3RBXA 3WA6A 2QRPA 4GVPA 2PT7A 2XWSA 2HDOA 4FCTA 3ZI0A 3JD0A 3OLZA 4YLYA 4Q16A 1R0BA 4MQ4A 3U26A 2D7DA 1CYEA 1IJBA 3GVCA 4C0HA 4M0KA 2GK3A 2C7BA 3ZCPA 5LQMA 4G07A 4KL8S 3KOXA 4AIRA 3IDOA 1JDZA 1SUBA 3BUSA 3D3EA 2QEQA 4YBZA 1PFYA 3ZZUA 3IE2A 1EUZA 3PNPA 2HSZA 1US8B 3IQDB 4PSAA 4AMGA 2BGJA 2XXBA 1B2LA 3FNHA 3NHRA 4CEJB 3ILXA 2R00A 1HDYA 2Q4DA 5ILQA 3FMIA 4GRIA 3QEOA 1T3GA 1T1GA 1A7KA 3OTHA 3CEJA 4CF5A 3JWJA 4N48A 2VHZA 3B7PA 1M73E 2OCYC 3KXPA 4PX2A 2ET6A 3KQHA 4U7GA 1Y9EA 4GD3Q 4URUR 1AH2A 2PSEA 1O94D 3EZ2A 2UZ1A 3OBIA 4V0KA 3D0KA 1DRJA 4RY9A 3WY9A 4ZMSA 4KB5A 5LP6F 5IF3A 3ILSA 3A25A 3BRCA 3MA0A 1XDBA 3OJCA 4XM2A 3HVHA 2P0EA 4BHTA 3UOGA 4IZIA 1K8RA 2B94A 2C9YA 4P4LA 4ZCLA 2IPNA 1LC3A 4F72A 1XYGA 4AN0A 4I8XA 3VPFA 1MJNA 3WLEA 1KIAA 5EJ6A 2EJVA 5AK4A 3SFTA 1YL6A 4OHZA 4FHZA 5ED0A 1YQDA 4AP6A 3TNDA 2L82A 4J3NA 1U1EA 4KXLA 1ECCA 1S01A 1V25A 2FZLA 1Z34A 2FX2A 3C3KA 1D2CA 3HDYA 5FA6A 2N9UA 2C98A 2XNHA 2FRVA 2QSJA 3C41J 5IJWA 4HDSA 1E0SA 3AR6A 4DV1B 1L7PA 4B3FX 1WQ4A 1ZM2A 3DTNA 4CLHA 2B3DA 3ENZA 5KVAA 2Q3FA 2P6NA 2JFUA 3SQOA 2YQ5A 1R0YA 4HGPA 4DT1B 1OX6A 4FDTA 1GKUB 3OLYA 1U1DA 3NZEA 3EGDB 2CF6A 1R37A 2ZIGA 4EUKA 3MMSA 4PCVA 5FPSA 4HAIA 2O8FA 3Q98A 3I5AA 1MB0A 4HDNB 4FJ1A 5HKKA 3DCYA 4G01B 3OF5A 4G0VA 2AVNA 2UZAA 3BMOA 3D3KA 3A1FA 4JL8A 4RIGA 5THXA 3T5MA 3VAAA 2PE5A 2QAGB 1DAOA 1S3IA 2EBFX 2CXTA 2O9JA 4B8WA 2FPGB 4D9JA 4POAA 1RJEA 1OAAA 3BBLA 1NVWQ 5TQVA 2XVMA 3VPGA 4YJHA 3WXMA 1FUUA 3FHOA 3KJGA 1POWA 4TXJA 5AW7A 5U1PA 2ZJAA 4BO9A 4B3TB 4NOLA 4A26A 2QTNA 3N3AC 3IKJA 4DV4B 1MC1A 1JMYA 2BFDA 3R0ZA 4A5OA 5LZ9A 1E5TA 1QZTA 2Q5JA 4K3VA 3FDXA 1U3VA 3TJRA 1XZMA 2XYRA 2J4DA 2VHCA 3PRHA 4GSKA 3BMNA 4DPMA 4N5LA 4IINA 1OBCA 2FSGA 2ZI3A 3DEIA 5F3RA 4CMEC 5TT0A 1VPLA 4ZMRA 5I9LA 5CMLA 4C0WA 4DYVA 1TCUA 4DR6B 4PYJA 2J1LA 2OEPA 3CZMA 3IDSA 4NCAA 3KQSA 3JSXA 2F1HA 1HUQA 4QNNA 1XTPA 2JCSA 4KMMA 2WMNB 4E2ZA 3TRHA 5KTOA 2JAUA 2JDIA 1CUIA 1R9NA 3R4VA 3TL2A 1Z2DA 3PXAA 4J16C 1Q17A 1H2RS 4Z8YA 3TXYA 2XE6A 2QI9C 4F9FA 5K3EA 2TECE 2VVTA 3IDAA 4BRZA 1IY0A 4ECAA 1KC1A 3CTPA 3DPIA 1XAHA 3HFGA 4EPRA 1BAPA 2E5LB 2H4YA 2Z9BA 4TV8B 3UVEA 4A2CA 5I4CA 3VSAA 2Q0SA 3SJZA 1NW9B 1UIRA 2NQ8A 4U7PB 2RH4A 4JDUA 2RKBA 5DGCA 3U80A 3P2MA 1PL8A 1PZNA 4JIGA 3GN1A 1SXJA 5KNBD 1X1DA 3IILA 3ENQA 1TO6A 1YQUA 4OY3A 3S1SA 1VLZA 4KXVA 3VDNB 3LKDA 5H3CA 4V1CI 1DHTA 3OHSX 2HK7A 1QU3A 4F8EA 2WAOA 4NOKA 4EZIA 2COUA 1PKXA 4LHXA 2OO5A 4KGXA 4BNZA 3IS3A 3G8BA 5AW9A 1TJ5A 3GHHA 1OT5A 1Z8HA 4R51A 2GBPA 3EPRA 4YWHA 5A3SA 3NVMB 1E8DA 4QTZA 1BYIA 4PS1A 5AR1A 1EQAA 3TBFA 4UVDA 1W0CA 2JFXA 2RGWA 3HR7A 2VYQA 4HX2A 1N2GA 1NW6A 2YNMC 4TUYB 3CVXA 2BHNA 2CHVA 2ZIXA 2BJWA 2CYAA 3NTXA 4PNZA 3IO3A 3LRTA 4G5GA 5FBQB 2WSLA 4NAVA 1JEQA 2H9YA 3LUFA 3IUPA 4QQKA 1WDKA 1X3LA 1YASA 3LYUA 4AKIA 2PKRA 5JRZA 5C0OE 1WPQA 3QPDA 2XOKA 3O03A 4JENA 4CCYB 2P2SA 5KVQA 4E12A 2I4IA 5LBUA 1KA9H 5ELLA 4BFWA 4UBIA 2NZJA 3GFQA 3L77A 4FOSA 1IZ7A 5IJ9B 3VVMA 3EAFA 2FH5B 4GPIB 4JBHA 4DWVA 1OYYA 3I9V6 3E5RA 1I80A 2Z3WA 3CPHA 1JRLA 3CRVA 3ZS9A 2ZRQA 1EM8B 3C16C 3GWGA 2IKSA 2VHQA 3KWMA 4P4UA 4UMEA 2GSWA 4RV5A 3UO8B 1OXBB 3SZUA 4FILA 1N3LA 1O5IA 3MG9A 3JQRA 5KO2A 5FQNA 4B85A 4QNRA 1I3LA 3QVTA 4H6WA 4QAJA 3A3OA 4LXUA 3BA6A 1XF1A 1Z68A 1RWOA 3KQVA 1VKRA 2QM0A 1GQSA 1BC5A 1Z75A 2ZIEA 2HKIA 2QLBA 2BFNA 1JYFA 3FKQA 4HGOA 4OQXA 3BB1A 2ON6A 4XIFA 3A14A 4Q3EA 4GZ3A 3WSVA 4HZIA 1P8JA 4OOFA 1C4XA 1D4ZA 1W30A 2VQDA 3OO0A 3PV0A 4MITA 3WNQA 2HA6A 2B7CA 2VA9A 3BXOA 4BVHA 2ZYRA 4PLGA 2CFRA 1U04A 3JQ9A 4QDKA 2IHKA 5J5VA 4HNGA 4IRMA 4F4JA 2EQAA 3L0OA 3QHQA 1THGA 4CTMA 1CZHA 3QMPA 4LSMA 4JZKA 1MBZA 3KL4A 4W1PA 3R3ZA 1XSEA 3IMEA 3ACDA 1O54A 2FRXA 3O2NA 1WDMA 2D00A 4MUKA 3O8OA 2X8JA 4ZFNA 3H13A 4Z0NA 3PR3A 1UDBA 3CMCO 1YC5A 3FOBA 1ZL2A 1HE1C 4NU6A 2V7PA 3JRNA 4A10A 3F6BX 2VP2A 1KQOA 1R10A 1KO8A 4EUSA 521PA 2DPGA 4C2BA 4L4RA 1MH1A 1KMHA 2ZJZA 3BXZA 4G3XA 2X0FA 3MT0A 3FHLA 5A4DA 3TIXB 3G1WA 2FWRA 4L0DA 1U3GA 4HFRA 4DSAA 3SS7X 4DCVA 4CUJA 8OHMA 2B4AA 4IR7A 3CCFA 3R8CA 1OFGA 4IH4A 3RUHA 2DP4E 3R7FA 2DHDA 1QG4A 1RWXA 3EHEA 4WKOA 2IODA 1ODJA 2NSLA 3HH8A 1LDMA 4FMDF 2JH3A 4V39A 5A0TA 3R6TA 4ZYXA 5KSOA 1NX9A 3FR7A 4L73A 2NUTB 3T0IA 4KZPA 3KKQA 1FDIA 4JBYA 3GJXC 4P93A 4K86A 2QUHA 3Q4GA 2IX9A 2ADOA 3VTZA 3G49A 3NXKA 4U00A 4IXNA 3PHHA 2I2WA 5AVKA 4AY6A 3SN6A 2QSUA 1ONOA 4NBKA 4N41A 2XD4A 3SS9X 1ZH8A 3DKIA 1YZKA 3T7JA 3O93A 1ZNWA 5T4BA 5JJIA 3FW1A 1E2LA 3ZW7A 1PJAA 3D2LA 3CF4G 2QTVB 1DPFA 4WBXC 3M89A 2AR9A 2Y4NA 1IL0A 1X92A 4C29A 3QHAA 1NSYA 4LY6A 3E3LA 3H5WA 3P4XA 3P9XA 2FR8C 3R7DA 1Z29A 4YI5A 4JYMA 1Q0ZA 5JIBA 5B3LA 1UM9B 4IIJB 4LG1A 2DVMA 3JZIA 4KNVA 3HB7A 3B1XA 4GLBA 1JXQA 1TEHA 3DMPA 4GGMX 4D45A 3CX8A 3OPVA 3DBHA 4FZ5A 1GM5A 1AUQA 2OCKA 1QUFA 2P5UA 3AP3A 3CN7A 3X1ZA 5JFGA 1WUHS 4WFKA 3TTWA 1PQYA 2XMRA 4I1RA 5D7BA 2G72A 3PQEA 3ZI7A 4PG7A 1RAHA 4BOYA 3LUAA 1DDOA 1DG1G 1RLJA 3IDQA 2GWRA 2W8BB 3V7FA 3KPVA 4BL5A 3FLMA 1OYWA 3BZWA 4OGKA 3RRBA 3LUCA 3B2NA 4E2WA 1HLPA 4DDVA 4BZQA 4YX9A 3EX7C 1QONA 5CNMA 4ALIA 1U8CB 1KDPA 5EQTA 5DX1A 4I6GA 5KHAA 1UC8A 4I9HA 1QDLB 2PQMA 2ZJFA 2AJTA 3KJNA 4MVYA 2QAGA 3VPDA 4WZBA 5EIEA 1PJRA 2Q4BA 5TVKA 4RVNA 4Q05A 3N87A 8LDHA 3AHFA 3ROTA 1C80A 2Q41A 1AQIA 1XU7A 4B4VA 2Q3JA 2O2ZA 1K5HA 2Q9AA 3T5BA 2QJTA 2FEXA 1BQ3A 3CVJA 4NBWA 1M6WA 2ERCA 4D8XA 1B41A 1GDDA 1Y48E 2O1XA 1W59A 4CR8A 5ADWA 1KSFX 4Z3KA 4EYGA 3Q8LA 3QU9A 2O3TA 2X6QA 5EUMA 4H3HB 4DBLE 1GZ6A 4MCHA 3SR0A 3BH0A 4X6UA 4KE8A 4JFAA 4Z4IA 1N1DA 4GBMA 1JEEA 5L6LB 1HQYE 4H77A 1Z37A 2DC1A 4GZLA 3BH7A 1MO4A 3RSHA 2OFXA 5IJZA 3TFOA 3QVLA 4G5SA 1VIVA 4IH1A 2DSTA 2J30A 2YHSA 5PGMA 3T9CA 1H2XA 4G23A 2ATEA 4H3SA 4ENUA 2RAFA 2WF8A 2YCBA 1OIXA 2OYSA 2ZYUX 4BVAA 4LRSB 5DH9A 1OREA 4GECA 5DYIA 4MA0A 3W9SA 3W6ZA 2GN1A 4BBJA 1M33A 3ZIAA 4L95C 3L4EA 2WYHA 3LXXA 4U2DA 5TARA 1E94E 3TZKA 4JZYA 1L5WA 1MB2A 3W2GA 1W19A 4X64B 4LF8B 1RQNA 1RYEA 3ZE0B 5BW8A 3IEVA 3TBHA 3ZIAD 1AQJA 1TLFA 3NWPA 2ZIUB 1LTKA 1KVQA 4UUOA 1E5QA 2ODNA 1VGRA 3EQ8A 1DBWA 4IM7A 2PQ6A 2W2LA 4L5AA 4AUNA 5AVQA 2GJ9A 4YXWA 4QBFA 1RI4A 3IE1A 1Q1EA 2INGX 2YBDA 4H35A 2BTEA 2YJ4A 4K8OA 3THXA 3D1VA 2WU8A 3I72A 4JB8A 5EVCA 3WO1A 3F5MA 3ILYA 3LKZA 1W4RA 3IV7A 4X7MA 1QORA 1Z5WA 1U2RA 1GPH1 1R0CA 1XA0A 2D1YA 5AOVA 1UT8A 2L2QA 5ICFA 1KVTA 3IAEA 3P9PA 1U28C 2HEGA 2X15A 3PD1A 4KIJA 3EIUA 1EFVB 3WL6A 3AUXA 2QRVA 5EWMB 1L5VA 3TZLA 2HADA 2OY0A 4Z7QB 2D0PB 3PUXA 3BAFA 2GLUA 3PC6A 1VDZA 3M9XA 5B2ZA 1NBHA 2XZOA 1Q15A 2GZDA 2IXFA 3PC3A 1OA0A 3BGVA 1KZ6A 4QULA 4R6XA 1YR7A 3VC3A 5HRUA 3DZJA 2ZR9A 2AC7A 5FUVA 1Q19A 4DSNA 4PQFA 1UZNA 2I7VA 5JATA 4EHKA 1BHSA 3VYUB 2F8SA 4P4NA 1ZRHA 3HFSA 1EGHA 2QW8A 3HC7A 1VECA 2ZVJA 1OLXB 1YZFA 4JI5B 1GZHB 3RROA 1ELOA 3V4FA 4NE7A 2PEZA 5KX5F 4X0EA 3K0AA 4KUGA 5IM4F 3HSKA 3KALA 4HDAA 4DJFC 3MCUA 2J6CA 2A0XA 3LXUX 5B1EA 2JC3A 3UAOA 2H59A 2H5IA 3FY4A 1RQGA 5AM0A 4ERXA 5JECA 5K8CA 4LTNA 2UXDB 4P7JA 5DLPA 4BNLA 1B76A 4CQMD 5KEIA 4P38A 1M72A 3BE4A 1HOXA 4K9OA 1YUBA 7REQB 5F77A 1JHOA 1FPMA 5DJ5A 3T94A 4BWFB 5JJBA 4C20A 5TB5A 4IF6A 1Z4OA 3SYRA 4KYVA 1QPBA 4GMXA 2ZYGA 4EITA 2C83A 3IOCA 1IJKA 5F5XA 4ZPXA 1N75A 3S4YA 2DQYA 2Y1GA 3D31A 4JR0A 1P81A 2SECE 3R6WA 3P26A 4WZBE 4OSEA 4ESEA 3JWPA 1J2RA 3G9TA 4TUYF 2NU6B 1M75A 2KLBA 1LPSA 3D6NB 1LBQA 3FJOA 2ZUDA 1KOGA 4RD2A 1X74A 3WGNA 5K3FA 3RSLA 3FF1A 1KH1A 2VUSA 1N4DA 3PWSA 2WKQA 1FLVA 2P62A 2AF4C 2ZJ8A 1RAAA 4MR9B 3U48A 2PX5A 3IQEA 3JQBA 5FFMA 2C8VA 3O9VA 1PDOA 3B6JA 3RB8A 2BSQA 1J8VA 3MERA 3MXTA 5J59A 4DY4A 1RP7A 4MRPA 2H2AA 3FKSD 1ZGAA 3PGJA 4XYBA 3ITDA 3DE6X 4HATA 2QQFA 2WHPA 4IWXA 5A3RA 3QE3A 2OA0A 5BWLA 3G0OA 5LOVF 4RSHA 1XKTA 4G5FA 4R7ZA 1N5MA 2GLXA 2W6QA 2Z6UA 5JY1A 1Y1KE 4MA4A 2C7RA 1X7GA 2FLWA 3RS5A 1YFLA 3FYSA 2EW8A 3T5AA 1YS9A 1IONA 3RFTA 1VIDA 1E79A 1QV6A 4JSYA 1OXVA 5EHZA 3FGPA 1Y8AA 2Q6IA 1HGXA 3SS8A 2GEBA 1C1XA 3L01A 4I1OA 4KQXA 1UODA 4YAUA 1TZJA 2D8MA 1QLJA 4L6IA 3O4GA 2JJ1A 3ITNA 3ENKA 4TQ9A 5C52B 2FX3A 3BRWA 4KQ2A 4N82A 1Z0DA 1EH5A 2NVWA 3NHPA 4JITA 5AICA 3SX0A 1CNMA 1IMOA 5AYVA 2FFHA 3DTTA 2I78A 2AZDA 3I6MA 4JKOA 3BWBA 4OK5A 2AEMA 2XRMA 3VR4H 2IS2A 3H6KA 4EEXA 1H8HA 1D5CA 1S8NA 1VFPA 3NJRA 1CB0A 1KBZA 3O3MB 3OZIA 4LNHA 1KYQA 4KR7A 4J94A 4JAVC 1DS6A 1E7QA 1U2TA 2B9EA 5ALPA 5GP1A 2YIMA 3LO5A 5B1YA 2ACWA 1IB6A 2HBRA 1PN3A 3MELA 2HU2A 3JASB 3ZC3A 4A6EA 4EA9A 2Q2WA 2YKGA 1F38A 1SBYA 4WLVA 4DPKA 2E4ZA 2NTEA 5DE3A 4L8VA 3C3JA 3EEOA 4EKDA 2NG1A 2PSJA 2A0UA 3V5NA 2PIDA 2F55A 5BVHB 3MJSA 3KAJA 1Y1RA 1G20E 2XNDA 4HWKA 4LF4B 4DGQA 5BQXA 4ESVA 2F1OA 3GB9A 1DEOA 3N2NA 4KAFA 4URHA 2JARA 5FUQA 1QE5A 1VLLA 3QH4A 4QPPA 4YJGA 3QA9A 5IHXA 4HFMA 4EG4A 2RG1A 3C3BA 4Q01A 4CKXA 1PNQA 3NW9A 1B0ZA 1TEVA 2BP7A 3N5CA 5JAUA 2OCXA 2LIVA 3K6RA 4LPKA 4RUKA 1QE3A 2PGIA 4I9GA 4WZAE 4YCSA 2RJNA 5CXUA 2JFPA 2XV1A 3F71A 3HJTA 1BDHA 4DLUA 1AKTA 4L5YA 5L4SA 2Z3ZA 1IUOA 2EFHB 2ZLBA 4HB2A 5AIAA 4RNCA 3TQSA 4G0MA 3WVNA 4UUBA 4G1EB 1E9BA 4XQCA 5LIRA 3A6PC 5H0IA 2BH9A 3HBNA 3OA0A 1DOZA 4OKSA 4CIXA 3QIVA 4MP3A 2DFLA 5DGHA 1Z35A 2NPOA 4D96A 1K0UA 2JF0A 3IIJA 4ZAVA 5I9BA 2WJYA 4MIYA 1ZVVA 2V3CC 1U3UA 4C89A 1A27A 4RMJA 4RS4A 3QKSA 3QVKA 5LP6A 3NHSA 1UPXA 5BSTA 1T4CB 3UUEA 2OV1A 4P35A 1ORWA 1QIFA 5IT4A 3C8DA 2Y76A 4M8KA 1M2KA 3RVNA 1CY7A 2H3HA 3ASVA 5AJYA 1V1JA 5CCEA 1C4OA 1AG9A 1B8VA 4X1YA 3WGTA 3D6TB 3H6GA 2XI4A 4Q66C 3KT3A 3OCCA 4JVLA 2J0UA 1XCPA 2OHGA 5CVDA 3EOBI 1FXWF 1XRLA 4BKMA 3H2IA 7ADHA 3Q6NA 3EF3A 4WOKA 4AYTA 5CA0F 1C7ZA 4RPJA 4V02A 1MJGA 4DCPA 3GAMA 5HE8A 2MSEB 3C3PA 1U1IA 2QTCA 3EIFA 1CJBA 3ZCXA 3HKCB 2MYNA 3NAMA 1OI4A 1OPRA 1T6ZA 1VSTA 4MUGA 1JWAB 3BSFA 4CLXA 1QK3A 4OHKA 1BW9B 4FYYA 1V4BA 1XMSA 4ONEA 1DQRA 4HAYA 1BFUA 2WHPB 1MORA 3HKDA 4YAGA 1VHTA 1OE0A 1GNLA 5I7WA 1WUYA 1ZKDA 3QOYA 3KEMA 3V4ZA 1YONA 3AP1A 2JRCA 2VUTA 3E8XA 3L6DA 3DQQA 4Y2SA 5AM5A 3L4SO 3B6MA 2C0QA 2HA4A 4OLFA 1GLNA 4P7GA 5FYQA 3E0QA 1KS2A 3EXHC 3VO1A 5KYUB 1QRAA 2XUIA 1SBQA 2QM7A 3L5OA 2BI4A 2BMJA 3NWEA 3TB6A 3NVKI 2V6JA 1JA0A 4LUCA 1NQWA 4EJMA 1NJ6A 3FGZA 2HY7A 1IZYA 5JTUA 2G8NA 3WIBA 2DLNA 1VI2A 2O8DA 4BZXA 1CR2A 1KERA 2AZ4A 2O5EA 2BPOA 2Y1FA 2AN5A 3ZDQA 3S2UA 1KDTA 2IF2A 2YL2A 5GZ1A 2PX8A 3RUAA 2YY7A 4I50A 2GZAA 4XSGA 1TI7A 3N8IA 2OVFA 3D81A 3H83A 1R7RA 2P2GA 3D8TA 4YDSA 2ZCJA 1HEYA 2MWMA 1GTG1 4I0WB 4ARUA 2OAQ1 1V8BA 2P6PA 3ANNA 4LJAA 1TMGE 4ZJUA 1KEZA 3DQZA 1IBKB 3TLAA 2YS7A 2PCJA 3AEZA 5GADl 3RS3A 1EE9A 3OMLA 4RCVA 1MV8A 2FJPA 3CLVA 2XVZA 2C5FA 4KLNA 4Q3DA 4HGQA 1JE0A 2BBOA 5CT4A 4DN6A 2QX7A 2XGGA 2OCBA 1WPRA 1KMCA 4I14A 1T34A 5EOVA 2QSZA 3JYLA 4F21A 4BB0A 2GD6A 3G3EA 3HXKA 2AYYA 4O1IA 3W3AA 4PN7A 5G0SA 1KVRA 3SG0A 2FRDC 1B8OA 1NLYA 1VCMA 4BFTA 1YNOA 1TPZA 3P19A 2ZWVA 3OPYI 2ZYAA 1EP3B 4R6WA 2BEWB 3U4DA 4BMPB 1LRKA 4Q1AA 1EUCB 4HQ0A 4CRWB 2YWCA 5CFLA 3ZE6A 3G9UA 3PJDA 4WLUA 3BFXA 3WYCA 1EFUA 4UTXA 2QAGC 1PJ3A 3VMMA 3IT1A 4K9QA 3R5FA 3WLTA 1RJWA 3RKRA 2WJ3A 2J3MA 3NPAA 5FTNA 5BNFA 4DLVA 1CUEA 3OZFA 5C1OA 4OXNA 5EG5A 1PJ8A 1Y4AE 2EFDB 3AB7A 3COSA 3MYRA 4AMZA 4BC1A 2OV4A 5IHPA 1PZHA 3EVZA 1T2FA 3A9VA 1AMUA 2R8XA 1O96B 1G18A 1J0EA 1PZMA 5DCUA 3DF7A 5GWXA 3QG5A 1OUMA 3TDKA 1HT2E 3ZQKA 5AUOB 1L8LA 2EARA 4OM8A 3CX6A 1K2WA 2GJKA 2PX4A 3I9MA 3L2OB 3TZQA 4R2MA 3U1VA 1HRKA 3KHKA 4BMOB 4EGFA 1XO1A 2FMFA 1JHDA 2X9NA 3KZMA 1A8PA 3GVXA 2VZ8A 4U7JA 2ZT5A 2FLVA 4EG5A 5ELXA 1K4MA 2O7VA 3FETA 5JLAA 1UBSB 2ZRHA 1NC1A 1R6UA 4LN1A 1EVIA 5ERYA 2XKAA 1DJLA 4DDTA 1ZLYA 1JHAA 4R41A 2EG5A 2NUAB 4G97A 2FSIA 4BFSA 1TUIA 4P32A 3BFVA 3L1JA 4KV7A 5DN6D 2QG9A 2H9AA 3OE7A 3N6VA 3NH9A 4DXDA 2JLUA 1FDVA 4Z3OA 1M0TA 2HF9A 3EGVA 1CE8A 4ND5A 1D2HA 4X8MA 3SFVA 4R9VA 3ED1A 6Q21A 4QUAA 1WB4A 2GS9A 2CL5A 2XE8A 1K5PA 1VHJA 3OE7D 3PQ8A 4GVXA 3WADA 3AERA 1P0FA 1MHPA 3CHYA 2AI3A 5D6NA 4AT1A 4LBWA 2P75A 3VKHA 1FFBA 4N1AA 4RHEA 1XPJA 2JA2A 3E4DA 4QBIA 4JC0A 1JQJC 1RYDA 1DEKA 3ICCA 4HWTA 4NCKA 2ZJ2A 4GNKA 2WTXA 5EP3A 1DV2A 2W6ID 5TS2A 3E7WA 3I6YA 3LZ6A 4P9NA 2VJLA 5DBIA 3IEMA 4KLRA 3GOQA 1OB5A 3A6JA 3AV0B 3F6EX 4PLVA 5DCLA 1PHRA 3CNLA 4RACA 5AXBA 1YQXA 5F2OA 1YIAA 5IM5A 2GAFA 3EH1A 4NBVA 2QIOA 2Q6KA 4MRAA 5D5PA 3W5SA 3FCOA 4PGMA 4P82A 1X8XA 3NNNA 2VYFA 2DPMA 2BE7A 3GV0A 3ZD6A 2K5UA 2C8KA 3MQFA 2MSNA 2HQRA 3NM6B 2BDEA 1RC1A 2XJ9A 1WPXA 2BC9A 1WLSA 3ENNA 4C7JA 5AKGA 1TTPB 3RLFA 1PT5A 2NGRA 1MFZA 3FSEA 3NTQA 3QELA 3WQHA 1RW4A 3PU6A 1XHLA 3S7ZA 2KSQA 3BJRA 3OCXA 1GUBA 3DOIA 5HF6A 1DMSA 3B3QA 4A6DA 3HL0A 5FL7A 3RYFB 4XUCA 5CT6A 1CQXA 3HB4X 4E2XA 3AINA 1CNFA 4QPDA 1CETA 1YJAA 5CG2A 1NMQA 1YRQA 2BLLA 2P11A 3TW4A 3AYXB 3ZLUA 1I2BA 2GEUA 5J2TB 3RIYA 3C6YA 1GNPA 4MINA 5E95A 4HY3A 4ARBA