3WMEA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
588
structure length
588
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAGAAQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein
molecule keywords ATP-binding cassette, sub-family B, member 1
total genus 214
structure length 588
sequence length 588
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmeA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmeA02
4RCZA 5FTKA 3U3RA 5CDFE 4NU0A 5BN4A 3IIMA 2R6AA 4Z8YA 4DLVA 3REGA 5FUWA 2RB4A 4DIDA 1Z08A 3I3SR 3EIEA 1H8HA 4B3BA 3L0IB 4OK6A 1GFIA 1SKQA 1YR8A 3NEYA 3FPAA 1KO8A 2V8OA 3MJHA 4DCSA 5JZVA 3RDPA 1GRNA 3IPYA 1LF5A 1GL9B 1KI1A 1OFIA 2FSHA 1GSIA 4PO1A 1OIVA 2ZYWX 4WZAE 3TVDA 3E1SA 5KU1A 1KMHB 3WHLA 1YJ5A 3UANA 2ZJBA 3EIHA 5JWOA 2Y8EA 3PFIA 1TU3A 1F60A 3TUZC 1SKYB 1LS6A 3TW8B 3I92A 5L3QA 5LB4A 2P3SA 1VIAA 4GT1A 3QSYA 4TMXA 2FN4A 5GVRA 2D74A 1N0WA 3OHMA 5CYOA 1W36D 2QAGC 4NCIA 2WIAA 3T34A 5FPSA 1KI4A 3BFXA 4BLRA 4TZ6A 2XNDD 2CNWA 1KO5A 2XTMA 3AH8A 3VHXA 3LD9A 4GSYA 1FL9A 2KBFA 1U90A 2ZITA 5G3YA 3RS3A 3UATA 3N5CA 4JBYA 1V43A 1N6RA 2HCBA 5H1YA 2ATXA 4GP7A 2WJGA 2ATVA 4IVPA 3FDIA 4BEJA 1MO5A 2AN9A 5CYPA 4LZZA 5JHGB 4CRWB 1KHTA 2F1RA 2CCKA 2VP4A 4C0HA 4DRZA 1OH8A 5EUQB 2IXGA 3KQKA 1NN5A 2DHRA 4AYXA 2OO7A 3FFAA 2GZDA 4MKFA 3GCGA 4B74A 4GFDA 4IW3B 1N5JA 3UXMA 2EQBA 2GESA 5JRZA 1N0VC 5B57C 3TUIC 2J45A 4DCNA 2QRZA 5EE1A 4XTRA 1YR7A 4CYMA 2ZS9A 2HT1A 1CR2A 2VBCA 3CPHA 3CRQA 1BMFA 1N0UA 2IYXA 1UBEA 1ONBA 1ZM2A 4NH0A 5AJZA 1TPZA 5FOTA 3SJCA 2QP9X 3WP0A 1J2JA 1E2FA 4JL5A 3KXLA 3C8UA 4RD1A 4KU4A 3WNBA 3F0TA 1R0ZA 2OT3B 2F7SA 2OAQ1 3FTQA 5FL7D 3T5GA 4LJ4A 5SZIA 1ZYUA 2WICA 3CRW1 2ZRPA 2JA1A 2GCOB 1NVVQ 2WWGA 5DHFA 4TWZA 1JR3D 3RAPR 3OIYA 3IILA 1CBUA 3AGQA 1X6VA 4EQ6B 2IS1A 1E9DA 4HUTA 4MGZR 5IK2D 5CLLA 2VSXA 3JVUA 4KYIB 3GLIA 2PL3A 4ESHA 4JKYA 2ZXUA 4QHSA 1UBGA 2E87A 1ZW6A 2QORA 2YZ2A 2X19A 4FCWA 4LJ8A 2G1KA 3UMRA 1W49A 1FTNA 2FEMA 4B34A 2QTVB 4QJ4A 4M21A 2QEQA 3KKQA 2FZLA 1I4DD 2JDIA 5H8WA 4GOJA 4Q4JA 4HDQB 1Z6TA 1XEWX 4Q1BA 3K0CC 4TMZA 3OAAA 4A9AA 1TL7C 4HDOB 4C0KA 2Z4RA 1UBCA 3CX8A 4JBWA 4TQ9A 2DYKA 1D9XA 2V9PA 3GMTA 3THYB 1VCMA 4V0NA 2QENA 1Y3AA 1NG9A 4TMKA 1KI8A 2XB4A 3AP2A 1P7CA 5IF9A 2JJ2A 1AQUA 4PPGA 1EFRA 2ZAOA 1AS2A 4R9UC 1OJLA 4QNRA 2WSMA 2QROA 3GJ6A 3K8YA 4OK5A 4US0R 1N2CE 3MLEA 2AK3A 4MGIR 2RGNA 2ZJ8A 3NG1A 3ND9A 4GPTA 3UMSA 4B71A 1XTIA 3DEFA 1KI6B 4P33A 4PSAA 1GKUB 1MR3F 4BECA 4EPVA 1Q21A 3U7EB 1ZU4A 1RC8A 3AM1A 4QHYA 4WA7A 3JZMA 2A9KA 4AKHA 3FFBA 1W7AA 1KK1A 2QU8A 1J99A 1KY2A 3KJIA 2FSGA 1Q57A 2QPAA 3T1OA 4KJZA 2H7VA 4EAQA 3THYA 4XVRA 4QNMA 3P20A 3IDQA 1T0HB 3HU2A 3KJHA 4A6XA 2TMKA 2VHUA 1ZRHA 2AD5A 1XBTA 3AKCA 3VTKA 5GVSA 2ZREA 2QE7D 1QF9A 2AKAB 2EFGA 2OXCA 3RRZA 2CDNA 3TQFA 1VYVA 1E9BA 5TV2A 1GILA 2UKDA 2IYVA 2AD1A 1KK0A 3KQNA 1GKIA 5G41A 1EESA 4DSTA 4GP6A 4EFLA 4B3CA 2JLZA 1IXSB 3QPWA 4LOAA 1OHHA 1KI2A 2WV9A 3PV0A 4YXWA 4DLTA 1UPTA 5FR1A 4N1AA 1JI0A 4DEXA 1OB5A 4TSFD 3NDBB 4Y0VA 3J81k 3MWKA 4F93B 2W6JD 1TU4A 3SFZA 2FGJA 1HA3A 1HT2E 2W2TA 2W0SA 2GHIA 2P6NA 621PA 1E9EA 2NO1A 4D2IA 3AKYA 4C30A 3VR2A 1FP6A 4ZKEA 3C5HA 1RVDA 2VP6A 4X8LA 1NL3A 3THOA 4DLSA 1E79D 2P6UA 4CEJB 5A5GA 2BIFA 4O0MA 1PUIA 4MUAA 2CLDX 1N5IA 1WRBA 4LYFA 5CDFA 1ZD8A 2GJ8A 1DG1G 2NPIA 2GXUA 5JSZB 1DADA 2MSEB 1II8B 1O87A 2EWWA 4RJLA 1TEVA 4J0QA 3S1AA 2ERXA 4FMDB 4FMDF 3SJAA 4C9BA 4CIDA 2G9NA 2J0SA 3QI2A 3VMFA 3U2QA 1SXJB 2IW3A 4OK3A 4M1KA 1F2TA 3C7KA 1OKKA 1HUQA 1YZQA 2ZYUX 2OCBA 4XTCS 5CITA 3LVRE 1FX0B 2XSZD 3ZS9A 4BFYA 2AFHE 1L4YA 1E2HA 1KIMA 5JBQA 5KNCA 3L0SA 4NE2A 2BBSA 4URWR 1G7CA 2OE2A 3KQHA 4Q00A 4G3XA 3CZQA 1P61B 2O0JA 2ZRDA 4C2TA 3A1SA 3ZJYA 2KI5A 2FSFA 3GLHA 2IYYA 1PV4A 1WBBA 1IN6A 3I5YA 1M6NA 2RCNA 3BGWA 2BV3A 2ZRBA 2WBLC 2F3TA 1KY3A 1XMSA 1II8A 3HPQA 1ANKA 3O8BA 2W00A 3IBYA 1Z3IX 2CCJA 4ABYA 4JJKA 2EFEB 2XTZA 4U5XA 3I8XA 3GLFE 3LLUA 4XD7D 1CR0A 2IA5A 4M9XA 4A2QA 2RKOA 4C2UA 3ONWA 2J0UB 5FOUA 3DZ8A 5IRCD 4KFTA 2IHBA 3KL4A 2W0MA 4LUCA 2WVJA 4W5WA 1FPMA 3LW8A 5FTJA 2O8DA 4UNQA 1HURA 4QHTA 1G18A 4ESVA 4IDQA 3SNHA 4Q4HA 4HUQA 4JT4A 4L16A 3WYAA 4UNNA 2O0KA 4LJYA 1HV8A 3WNDA 3FKSA 1Z47A 1VHTA 1RIFA 5TY0A 3B9PA 1ZMXA 1W5SA 1CR1A 1CJTC 2GVZC 1T6NA 2WWFA 1QG2A 2GJAA 1KNQA 1PLJA 4Q18A 1UDXA 3MRSA 1G5PA 4HB2A 3P1JA 4EKDA 5C4MA 4AYWA 4IJMA 4EJSB 2VPPA 2CCGA 1OE0A 2BMFA 1IN7A 2ZI3A 5BYKA 2QL6A 4QBIA 4B33A 1GP2A 4JS0A 3KXKA 2AR7A 1WMSA 2F9LA 2D2EA 1CJUC 2VHTA 1KZ7B 1GUAA 1JJ7A 1XJCA 5JI2E 2J0QA 5M04A 3P32A 1JXOA 1ZUHA 1P2TA 3BERA 4I99A 2ZJYA 1ZM4A 1IXZA 2VH5R 3K9HA 4A4DA 1EX6A 3CUEF 3EAQA 3KTAA 2NO7A 4G0NA 2Q6TA 2FU5C 5JJKA 1TAGA 1ZBDA 5F9HA 1GOTA 4EFNA 2RGEA 4P0TA 3QKSB 4JSTA 2BBWA 2O0HA 2JIZD 2DFNA 5EJEA 2J41A 2OLJA 2HXSA 3B85A 5G40A 2NZJA 3VX3A 2FNAA 2J3EA 1DAMA 2YHSA 5KNBA 4HZUA 2CHQA 4P3YA 4NCHA 3IIJA 3T15A 2OV2A 3BB1A 1N25A 2BC9A 1IJFA 1SVWA 1XCGB 1FMLA 1LV7A 4RSGA 2DFLA 2J7PA 4BFSA 1ZJ6A 1ESNA 5ANRB 3CLVA 3B2EA 1A5TA 3D31A 4ZIRA 1F6BA 4OJKA 1KZGB 5L8VA 2F1HA 4R7ZA 1SULA 3SJBA 2GF0A 3NDPA 1LY1A 1KK3A 3P26A 1VG8A 3FVQA 2HF8A 1NN3A 3TE6A 4LHYA 1WE2A 1T8UA 1NVVR 3M0EA 1CRQA 4YONB 1F2UA 2IWHA 1G21E 5C4GB 2GXSA 2WHXA 2PCJA 3KXIA 821PA 2O8EA 1NY6A 4D81A 1Z6GA 4HLQB 4LYAA 4O2RA 3GLGB 1EFUA 4B73A 4U7DA 2QMOA 3W8RA 3K9LA 3CM0A 1YKSA 4O3MA 4LX0A 4UNPA 3SC3A 4NDZA 5JS7A 1NY5A 2DFKB 2ONKA 2PLRA 4DKXA 1Z6AA 3FKSD 2NG1A 3H4MA 2ANBA 3NXSA 2O8BA 1DE0A 5JJLA 3AVVA 2BVNA 2VL7A 1FX0A 3R9IA 5L3QB 4N0EA 4UJ3A 4FIDA 2AHOA 3K0FB 2YOGA 1FQKA 3H0KA 2ZI6A 4M1TA 1U98A 4KFRA 1R4AA 1KAGA 2H18A 4BFWA 3HYTA 4PAQA 4QM6A 2VA8A 1E0JA 2W2VA 4BZQA 3A4NA 1CR4A 1VYTA 3KJEA 2PT7A 3EA5A 4Q47A 4AKIA 2R65A 1XU4A 1E99A 3OIUA 4E09A 2ZSAA 4KFSA 2ODWA 2I1VB 2XJ4A 2D06A 2G6BA 2HDNB 3MWJA 4IOLA 3VKHA 4C0JA 3KKPA 1VYUA 1ZP6A 1ZNZA 4Q9KA 3K53A 4M53A 4TMTA 2FJUA 1F2TB 3THXB 1ZD1A 1AZSC 2IF2A 3Q3JB 2B6HA 2DPXA 2H8KA 2WZQA 2QP4A 1R2QA 2ECKA 1J90A 3MGCA 4M8NE 2NO6A 4ZCLA 2I4IA 1R7RA 2F9MA 1T5IA 4MQBA 3EPHA 2JLSA 4DSOA 3QENA 1J8MF 1TMKA 4BLOA 1IY2A 1OKKD 1AA9A 4MRRA 1R0YA 2WOJA 3AF3A 1LW7A 3TIFA 1OXTA 4DHEA 3ZVRA 4B43A 1KDPA 2RGGA 1AN0A 2JJ1D 4MRPA 2KSQA 4LSGA 4NPHA 1E2DA 2IYQA 2GILA 2WOOA 2PMDA 1BYIA 1DAIA 1JNYA 5CIQA 5CJ2A 5KDLA 5EXXA 1UKYA 1XD9A 3QQ5A 2ZS8A 4FCVA 2B7BA 4JLDA 3I61A 2HJVA 5D3MA 2QMHA 3QG1A 2OILA 1G7TA 1XD8A 5EXPA 1F2UB 1P2SA 4MKGA 1DVRA 3VAAA 5EXTA 1SVSA 2HUPA 1T9HA 4Q1CA 4F4CA 3SEAA 3AP3A 2ZR0A 4Q9IA 2IT1A 2ZE5A 3E2IA 1WXQA 2C8VA 2X8AA 4FN5A 2JLWA 1T3HA 1DG3A 4M22A 5FPKA 4D26A 3RNLA 5CM8B 3SJZA 1ZM7A 4ARZB 5KDOA 4DIEA 3RRMA 2ZM5A 4E03A 1Q3TA 1R8SA 1NMYA 2CMKA 2WAYA 3U3MA 1K5DA 2XZPA 3GJXC 4OQLA 5FUYA 1JAIA 3B1XA 1KI3A 2J7PD 1GDDA 2NO0A 1TUIA 3KTAB 3AVQA 4JLJA 1N5KA 1PLLA 2AXNA 2GNOA 2VSFA 1QHGA 2ZR7A 5UKDA 2FGKA 4FWTA 1VPLA 1J7KA 4P4TA 1P2UA 2ZRHA 1G20E 5BN5A 3T06B 1N6HA 4NMMA 4A8JB 1ZC4A 1MABB 1XRJA 3AVYA 5JHHB 1JJVA 5DISB 4URVR 1NVXQ 1R6BX 2WJIA 1Z22A 3VNVA 2OESA 1E2GA 1FNNA 5EUMA 3SDZA 1A2KC 1SVMA 4IXNA 2I3BA 5F2EA 2Q3FA 1V5WA 2G1JA 3W90A 3W6OA 1Q1QA 3WXMA 4L5BA 2A30A 1Z6YA 3CR8A 1Z06A 3NHAA 3QPUA 4NKRA 1US8A 1S96A 3TAUA 5FL3A 3VX4A 1OPXA 1OV4A 3BWDD 4LRWA 4LJ5A 4PO9A 4RZ3A 3CPJB 3FMPB 1ZIOA 2B92A 2YWFA 5GADl 2IF0A 4CEHA 1I2DA 3EPKA 2ZRLA 5C18A 2WWXA 1GZSA 4A8JA 3LNCA 3LQRA 4FMBB 1ZM3A 4TTPA 2O8FA 4JVSB 3CWQA 4TLAA 3X1XA 2NMVA 3KX2A 4C0AC 4LHVA 4A0GA 3EXAA 5CK4A 5KSYA 3B9QA 5DN6A 1UM8A 1NVUQ 4A92A 3R9WA 1Y63A 1JALA 3TMKA 4EJSA 4XVUA 3AEZA 5JCPA 3PCRB 2R62A 3WRXC 4M9QA 5FOVA 2LKCA 3AGPA 2EFHB 2QI9C 3BIFA 2G0NA 2OLKA 1A1VA 4B6FA 1XJQA 5AUNB 4ON9A 5D3QA 4Q4JB 2VP9A 1X8LA 2VP0A 1FW6A 2WMNB 3X1DA 3DM5A 4LC0A 5E7JA 2J87A 1E4VA 4GOXA 2BM1A 5CM9C 4C3ZA 2RGBA 1A2BA 2D7DA 1E98A 4WAUA 3PG5A 4W5HA 2WMOB 2IYLD 4QKQA 2QTHA 2RGDA 4G5SA 3ZS8A 3OIWA 3R9XA 1GL6A 1T91A 1QHIA 3D7MA 3N2IA 5SZJA 2HYDA 5G3ZA 4QJ5A 2P67A 2V1UA 5EE9A 3MMPA 3A37A 1VCNA 3L2OB 3ZD7A 2R6CA 2V1XA 4TQUS 1VCIA 1DTSA 2YWGA 2EYQA 4UQOA 2IHYA 4OBEA 5FPYA 1OB2A 3RLFA 3L0PA 2YV5A 3CBQA 3U44A 4BZPA 1SXJA 2ONJA 2ZRKA 5B2ZA 3K9GA 2O5VA 1FZQA 3EIQA 1COWA 3GJ0A 1E2LA 2RGNC 4OHXA 3GLHE 1MT0A 1WP9A 2VP2A 2Z5FA 4B6EA 1KOFA 1P9RA 4NCKA 4NL4H 2IK8A 2VHQA 4FCTA 2F1JA 3AF0A 5E3HA 4D4MA 2ZUBA 3OE7D 2PT5A 2A7QA 2ZSBA 2P5TB 2ASEA 1N6LA 1Z63A 3B78A 4Q21A 4XWOA 1XCPA 4Q1EA 4JKIA 1WBDA 1DPFA 1KKLA 1T0JB 5HE9A 5EP2A 1P5ZB 1NP6A 1M34E 4PC3A 3SHFA 3K0EA 2XX3A 4JMPA 3BD9A 2GBLA 4GOKA 1FUKA 1F3OA 2O8BB 3L8YA 5DN6D 2FE4A 3FB4A 1W0JD 2D2FA 3TNFA 3CNLA 3K0FA 2H5EA 3EZ2A 1UADA 1AS0A 4V03A 2IWRA 3K70C 4WVFA 1LTQA 3U60B 3GFPA 3A4MA 1Z8FA 4URXR 1DO0A 1NN1A 4PQRA 4RZUA 3T5DA 1U9IA 4EIWA 4BWYA 4IFEA 3U4QB 1Z5ZA 2HT6A 3FKQA 3PEUA 1S4QA 2J1LA 5DI3A 4JL8A 2C95A 4UNSA 2CL7X 2GZAA 3IQXA 3OFND 2FMXA 4X8OA 2DB3A 3FGNA 5GJCA 3I5XA 5F9FA 4KXFB 5GJVC 4H1VA 3GPLA 2ZAMA 2R44A 4BLTA 2ZJOA 1NSFA 1XTRA 4NYIQ 4JLAA 4GMXA 1E1RA 2IUSA 4OQFA 3HWSA 4DB4A 3LXXA 4P4SA 1FQJA 2Q9CA 2RGAA 1IY0A 1WA5A 1Z2CA 2HF9A 3DVLA 3EZFA 3LQQA 3PENA 4PC1A 3VHLB 2WWIA 4B2LA 1L4UA 2V54A 2AK2A 3A36A 1X1RA 3L0OA 2ZRFA 4O2LA 3WHKA 2YKGA 5EP4A 5F3WB 4TMWA 3Q7PA 4HYYA 4TT3D 3Q85A 3SBDA 2V6IA 3SZRA 1NVWQ 4DSUA 2Z0MA 4URYR 1YZLA 1II9A 4DLWA 1T4GA 3JZAA 3E70C 4HAVA 4RD6A 4OYHA 2JATA 3O8RA 1Z6XA 1SVIA 5HR5A 2CK3D 1W5TA 5AK0A 1Z07A 1X8KA 2VF8A 2SHKA 1WB9A 5AWFC 1WDTA 4LY6A 3LFUA 2NPFA 3OFNA 2J0UA 1K5GA 3RC8A 3EW9A 5JWRA 3ZZUA 1E2KA 1XF9A 3L82B 4PSVA 4AK9A 3KZ1E 5J4LA 3CR7A 3DL0A 2JGNA 5E7MA 3BE4A 1MRSA 1Q20A 2VIIA 5LD2B 4KVAA 3C15C 1L8QA 4PZZA 1ZAKA 1NRJB 4Z8XA 3SHWA 4AURA 2VSOA 1BKDR 1KGDA 3OEHD 4Q1AA 3KFXA 3ICQB 1PJRA 1KDTA 1Z0KA 1W0JA 1ZVQA 4A1FA 4YMUA 4PX9A 4RCYA 3TAHA 3EZ7A 1A4RA 3AF1A 4JT2A 4TLEA 1KJZA 3PEVA 2O8CB 4F4IA 4Q9JA 1XMJA 4B2IA 1HY3A 1S0UA 1UF9A 4FXPA 3EPLA 2CL0X 2CVFA 3REFA 2FG5A 4RFSB 1CS4C 1ZNYA 4BFUA 4F91B 1CXZA 2ZS7A 2JASA 3W5JA 1WF3A 1KSHA 2CLCX 4CEIA 4S2EA 3AVPA 2BBOA 1OSNA 4A15A 1QHHB 2CJWA 1IN5A 4B2PA 1KKMA 3MJRA 2F1IA 4MDEA 1N6KA 4I81A 4KSCA 1HTWA 1XWIA 4OHZA 1FP7A 3QF4B 3NEJA 4Q9LA 3QY0A 5HTKA 2CE7A 3I32A 4D4JA 1DAHA 1N6NA 4LV5B 3IO5A 4PAMA 4DCVA 5G53C 4QM7A 1KSGA 4OHVA 1E2IA 4CZ2A 1UFQA 4N3NA 3ECCA 2GETA 4KLNA 4ZDJA 2C77A 2QSZA 1I2MA 1HEIA 3AQ4A 2OBMA 1HQCA 4KITB 4Q5IA 4K46A 5EE3A 3FHTA 1KO7A 1E9SA 1P72A 4AIIA 4IKEA 1QHHA 2CJWB 2XNSA 4HLUA 2DFTA 1AJEA 1M7BA 3NBFA 1IM2A 3CH4B 3GLIE 1E2QA 3RRYA 2BJVA 2V4ZA 2AXPA 5JI3E 5JSZA 2REBA 1G17A 3ND8A 3FHCB 1ZNWA 4B3GA 3GEEA 1KI9A 5HPYB 2GK7A 2GZHA 2HLDD 1KTVA 1S9HA 1WQ1R 1OXUA 1UJ2A 3A58B 1FTSA 3A1WA 4HAZA 2DWOA 1A82A 3CNNA 3WBKA 1GG2A 2ZTSA 4D0GA 3A1VA 3T1TA 4XH9B 2F43A 2ZJ5A 1FNMA 1U9IC 4XWAA 4BFZA 5EZ6B 1SXJE 1XD2A 2V7QA 2R6DA 4XJXA 3WMEA 3NH9A 2O8EB 3B82A 5A0FA 4W7SA 3DOEA 3DMDA 1QVRA 2DR3A 2PCLA 4PHFA 1BOFA 1Z0FA 2V6JA 4Z51A 4LPSA 1JXMA 1QZXA 2ZI7A 1VIYA 2ORVA 2CK3A 1NMXA 2ZI5A 2P2LA 3ADKA 3EC1A 4OJQA 4W5JA 2RHMA 3RRNA 2QRNA 2JEOA 4CT5A 1S8FA 2OHFA 3EARA 3EX7C 1XX6A 4G5OA 2JAQA 3PITA 5LBIA 3G82C 5BW8A 1AZTA 4EPTA 3WRYC 4HI0E 1UEIA 4TT3A 4PAOA 2BDTA 1NBMA 5AUQA 1E9FA 2PX0A 2BCGY 2QTFA 4LJ9A 5AJVB 2Z6VA 3K0AB 4Q03A 2FFQA 1NBMD 5GJWC 1SHZA 3LH5A 2JIZA 2EFDB 4YDHB 5HE8A 3SS8A 3UG6A 1EGAA 1TNDA 1W0KD 3CX7A 1OIXA 3QJYA 4JLMA 5KYKA 2ZUDA 4F92B 3SQWA 2PZEA 1NJFA 3RSOA 1T3LA 2EFCB 1MRNA 1NLZA 1NNEA 4R2HA 5KSOA 1JPJA 1G16A 1Z0JA 1SXJC 3HPRA 3LLMA 4DCTA 2XB2A 1GNPA 1W4AA 2KE5A 3NC1C 2ORWA 5CK5A 4YLGA 2MSCB 3R8FA 2OAP1 2JLXA 5B58C 2GAAA 3CKLA 3ETLA 1MO4A 4M9ZA 4D0LB 5TDHA 1JBKA 2C5LA 2OCYC 4WIAA 1OLOA 2G0TA 2ZEJA 2ZYVX 3IIKA 2UZIR 5KHOC 3RHFA 1W36B 2V7QD 2FWRA 2WWHA 3AVUA 2NTYC 3Q72A 4DT1B 5K8UA 2BHRA 2XAUA 3NC0C 4IOKA 3TR5A 1YR6A 2IL1A 1JQJC 1CRPA 4PHGA 4PQFA 2FPLA 3WY9A 4PC7A 3T1VA 4D0NA 2EW1A 1IN4A 1OT3A 3VR3A 4TYWA 1YZNA 2J59A 2WKPA 3RS7A 1G6OA 3G5UA 1P6XA 4MGKR 2FZ4A 3KB2A 721PA 2EVWX 1IBRA 5J40A 2OZEA 4IRUB 1AKEA 1NMZA 4OL0A 4PPQA 1X3SA 1IN8A 3C14C 1JR3E 2JJ1A 3N2EA 4P31A 5B64A 1S3GA 5IK2A 2AKYA 1U94A 3CX6A 3TKLA 1EWRA 1L7VC 1G3UA 1T5LA 3SOPA 5TARA 2V3CC 4PC2A 5EXSA 2BBTA 4XD7A 4WOPA 5HZKA 2H16A 3CNOA 3IO3A 5JEEA 1NIJA 1G3IA 3OE7A 5E95A 2H92A 3VR5A 4JL6A 2IYRA 5DHAA 1XEFA 4E5UA 3OIVA 2ORIA 4CGZA 4QRHA 3GJ7A 2QM8A 3WMFA 1COWD 3IHWA 2AL7A 4M9SA 2XITA 4QBGB 1AIPA 1NKSA 1XEWY 1SXJD 3NBXX 3P4YA 1TF5A 2C96A 1W46A 2C9OA 1G9XA 1D2MA 1N6PA 1YZKA 2LCFA 2YC2C 3CO5A 3QNUA 4GNKA 5K8TA 4D82A 4MYUA 4KBFA 2R8RA 3AV0B 4PPNA 5DE3A 1IONA 2NGRA 1G19A 2OFWA 4A2PA 4ACAA 4BLSA 5K8IA 1N5LA 2A5GA 1Z0DA 2AFIE 3TW4A 4BGDA 1P3JA 1E4YA 1XTSA 2XSZA 4I1SA 5FBQB 4B32A 3RC3A 3AUXA 1YHNA 2Q3MA 2Z43A 3PVSA 1P60A 2IXEA 1E69A 3ASYA 1JAHA 1S9DA 3QKTA 1I4TD 1RFLA 4WXRA 4AKGA 4ILEA 3U44B 1LNZA 5SZKB 1G8GA 3IGFA 3LX5A 1PLKA 2BMJA 3BXZA 3SYLA 3ZZTA 4DSNA 5K8LA 4ZV4A 3GFOA 2XNDA 3RS5A 3I1FA 1YQTA 2B8WA 1NI3A 1F5NA 4KBGA 1IOZA 3OEHA 5TMPA 4BRWA 3PQCA 4A6PA 4I4LA 2RMKA 2YOFA 3LRPA 2QPTA 3K70D 4ITRC 2W6JA 2ZSDA 4LV6A 3SE0A 1UKZA 1E96A 1BS1A 1UKVY 3HDTA 1AGPA 2ZI9A 4NYJR 4BASA 3CONA 3F3YA 4QGGA 2WTUA 1KI6A 4ZO4A 3QF4A 5BN3A 1ZINA 2FV8A 4L8GA 4FD2A 1Q1BA 1RJ9A 2R6GA 4IEEA 4QGFA 1R5NA 3PUXA 1AKYA 2BM0A 3SYKA 5JLJA 4TZ0A 2IC5A 3SN6A 3F8TA 2PBRA 1E0KA 2J5XA 1NF3A 2PZGA 3GJ5A 1W1WA 2QNRA 1SGWA 2ZQ5A 2GJ9A 4ZI3A 3K0AA 4NHOA 1ZUNB 1E2NA 1DAGA 1RZ3A 1U81A 1WCV1 2YC4C 3H1TA 4C4PA 2FOLA 3LWNA 1O3YA 4JVNA 3LXRA 4KYUA 3T1QA 4DUGA 4KV9A 4DB2A 5FUVA 3GLHB 4LHZA 4NONA 4B44A 2W58A 3NH6A 1NIPA 1XFAA 5JFGA 3U3KA 1TUEA 4NTZA 3TVTA 3WMGA 1HYQA 1T3SA 2BKEA 3NKVA 4HLDA 3R8CA 2WSSA 5DO9A 3PUYA 3QUSA 4IDPA 1QBKC 2QUZA 3TH5A 4IDOA 1E1RD 3BFVA 2ZROA 4PR0A 1U2RA 5J4KA 3VKWA 4IFBA 1E9CA 3DOFA 4II7A 1B0UA 2ODNA 2Z83A 4BZXA 4MH0R 4IDHA 1MKYA 3JVVA 1X1SA 4LYHA 1ZNXA 1DS6A 2HEIA 4OHYA 5EP1A 3LBIA 4MGYR 1RRFA 3B60A 4KODA 4H1UA 1RRGA 2DY1A 3D6TB 3LO5A 3MWLA 1QRAA 2ZJAA 2YJTD 2QAGB 1RYHA 2IS2A 4I1UA 3BH0A 1K6MA 1G6HA 4JYBA 1LB1B 4LI0A 4CEJA 4ZCMA 1XD2B 4IOJA 1JQLB 3A8TA 3OAAD 4DCUA 1U99A 4YMWA 5AUOB 4IVQA 2VRWA 4Q66C 2IS4A 3U7GA 2DWPA 1IQPA 2YINC 3B13B 4K8OA 3GP8A 2NIPA 2D62A 4C0BA 1KMQA 2IYZA 4NYJQ 3QXXA 2O8FB 3HR7A 1GNQA 2GXAA 2GDJA 1AK2A 2GCOA 4UXHA 5JECA 3TSWA 5BWMA 1XXHE 4RKEA 2IEYA 5BXQC 2IS6A 2JJ8A 4O25A 5D3MB 3CIOA 3LVQE 4EQ6A 3AVOA 1R8QA 1XZPA 3TK1A 5KPJA 1TF2A 5TB5A 4ZI2A 3ADDA 3X1ZA 4HAYA 4WZ6A 3TQCA 2JLVA 4R71A 3ADCA 1E1QD 3BOSA 1LS1A 4Q19A 3KB1A 3HR8A 4UXIA 4DLXA 4ERNA 4DDTA 4JLNA 1OXXK 4FWIB 4ARZA 2REXB 3BAFA 3DKVA 4OI2A 1JR3A 5AJXA 3QXCA 1XEXB 5H68A 4AI6A 3G0HA 4PANA 4DXAA 4JLOA 1G3RA 4DLYA 4IHQA 4JIMA 2GCPA 5FFMA 4JLPA 4V0MA 4NYIR 4HB3A 3LX8A 1VG0B 2WAXA 5CLQA 2CHGA 2OXRA 4BQSA 2R9VA 4BFTA 3TGPA 2FDCA 2A78A 3KKMA 4BEBA 5L3SB 2QBYA 4BPBA 1U0JA 5AR1A 3RS2A 4CW7A 5FTMA 1SZPA 4A0RA 2NOAA 3HP1A 1E0AA 4HUQB 5LB2A 3GLIB 3QVUA 5EE0A 4F4JA 3QF7A 3Q9LA 1CU1A 4TYPA 2B7CA 2YVUA 1R0WA 3NBZC 3GD7A 3P27A 4B47A 3UWKA 3OZXA 1OH5A 1PZNA 3TUJC 4DVGA 1KJWA 5KO2A 2W6ID 4GL2A 4B3XA 5KSPA 1GITA 3Q5DA 1ZM9A 2P5SA 2NO9A 4OQNA 3TBKA 1G64A 2PH1A 2RHDA 2WJJA 4RZ2A 4JJZA 4E22A 2ZU6A 4JLVA 2QBYB 1CEEA 3H84A 4XWKA 4G5GA 4LDJA 4QOSA 3B1ZA 3QKSA 4KO8A 3U6KA 2C04A 2BJWA 3AVXA 4POAA 4TL6A 2FFBA 3A4LA 3P4XA 5GJBA 4MRNA 2ZPTX 2ZVQX 5HCIA 4ZDKA 5EP3A 1RJ9B 2IUUA 1D2EA 3RWMB 1MH1A 2CVHA 3UPUA 4UKDA 4TSFA 3TR0A 1JPNA 1YRBA 2ZRCA 3K09A 3OEEA 2Q3HA 3EC2A 3B1VA 3PXGA 2GCNA 4RD4A 4C0QC 4EFMA 3NIBA 5J47A 2GEVA 1UDWA 3SBEA 3A6PC 1OHHD 2P6RA 4PFSA 4I1VA 4OQMA 3VU9B 3B6EA 3X1WA 3T12A 1OYWA 2QQEA 3PIRA 2BEJA 3I73A 2N1BA 4F7WA 1EFHA 4A82A 3GEIA 3QBVA 3X2SA 4YC7A 3UKDA 3EZ9A 3NHBA 1AM4D 2A2ZA 2B21A 4KLZA 2JLUA 3A1TA 4LC1A 1KDRA 1NSTA 4BE7B 3VNUA 1E0SA 1GKYA 1KSJA 1U8YA 2VQSA 1RYFA 3A1UA 1YZGA 3BB4A 1G8PA 2ZVPX 5J4YA 4DWJA 3O47A 2ZETA 2JLYA 1XPOA 1ELOA 3EZ6A 4IOMA 3W3AA 4NBSA 1NJGA 2VTKA 1R10A 1XXHB 1D8TA 4WBSA 3CRMA 2VLIA 3MUFA 1BO6A 1ESMA 3THWA 2IYWA 1B23P 2YWEA 2G83A 4D4KA 3ICEA 4PXAA 2HJGA 3R7WA 1TF7A 2VEDA 1EXMA 3U61B 3UWOA 2JJ2D 1BIFA 2DBYA 5AJWA 4DDWA 1CF4A 3TLXA 3Q7QA 1JEDA 2GEUA 1S2MA 3DHWC 2C99A 2QQ0A 2QSYA 3QG5A 2WKQA 4AYTA 3PUZA 2WPDD 4QXAA 5BYJA 8OHMA 4CT4B 1HT1E 3CWZA 3K1JA 4JBXA 4UJ5A 1HE8B 2JDID 1L2TA 3FMFA 2PJZA 1UBFA 1XZQA 2XOKA 1IY1A 3ZVMA 1RPZA 2MMCA 4RD0A 2XXAB 2FFHA 4JVMA 3UK6A 4L15A 3PUWA 3H86A 4HLUC 2AWOA 1H65A 1M74A 1ZIPA 3GEHA 4KHZA 1SHKA 5F98A 1PVOA 5FH9A 3IEVA 5LPNA 1HE1C 5FBVB 1QHXA 2EYUA 4M1WA 2PEYA 3IEUA 1YRAA 3F5FA 4URZR 5DLQC 1Z28A 1GTVA 3U4QA 4PC6A 5FPTA 3BORA 4XSHA 2CXXA 1U8ZA 2XEXA 1X8JA 5AUPB 1J8YF 3RYTC 2ZYTX 2WWWA 5ELXA 3MD0A 4DJTA 3BS4A 3SU8A 4JLBA 1TEXA 3KKNA 3VKGA 4FW9A 3QKRA 2E1RA 4LBWA 4Q4AB 4LJ7A 2HYIC 2QP3A 4P4SB 3IBGA 4XSGA 5CJPA 4Q7KA 2BMEA 2REOA 3DM9B 4D4LA 3IUYA 1GM5A 2QMEA 3B5JA 3BK7A 5A4JA 3NBYC 4ZDWA 5TXGA 3RS0A 3ZZ0A 1QDEA 2NZ8A 1CKEA 1GWNA 3AP1A 5EE5B 2ZSFA 5KDDA 1VCOA 1CTQA 3OESA 2YYZA 3ZDQA 4M1MA 1DAFA 1F48A 3DMNA 3GFTA 1II0A 4Q02A 4X8MA 1KSFX 3W5IA 4YMVA 4V0ME 3O8DA 2GAOA 4P4UA 4JYCA 4BUJA 2EU8A 4RFVA 2Q0HA 3U3OA 4DC9A 1E9RA 1TADA 4US2R 2G88A 2OM2A 2ERYA 1QHSA 1PUJA 2YWHA 1C4OA 2GJSA 4KSBA 4Q7MB 4Q48A 1QVAA 1S1MA 1M8PA 4PQYA 2R2AA 1OH6A 2QGZA 2OUKA 3AVWA 3I72A 2XGJA 2HCJB 3KJGA 1W44A 3SR0A 4R2IA 2B8TA 1TQ2A 2RGXA 4K81B 2ZIAA 3LA6A 1NKTA 3FYHA 2CHVA 3Q8XB 4D6PA 2KBEA 4C0LA 4CF7A 1ETUA 2IBMA 2AWNA 3AKDA 3CRRA 2WKRA 4HAUA 4EJSC 1AGRA 2A5FA 4GBMA 1U8AA 1TX4B 1UKEA 3AUYA 1G4UR 2F55A 4MKIA 1G5RA 3W34A 4Q7LA 4HAXA 4ZPXA 5L3RA 1ZU5A 1R0XA 3IQWA 3Q5EA 4URUR 1G41A 4DDUA 1KMHA 4HEJA 4M1OA 3N70A 1HQYE 4MYCA 4MRVA 3HU3A 4RD3A 3C41J 1E6CA 4YXWD 2C9CA 3K9NA 3PJRA 3GJ3A 4QG7A 5L3VA 1SVLA 4TLBA 1YE8A 3ZQJA 2A5JA 3C4JA 4RFSA 1XPUA 1I4LD 3VR6A 1W2GA 2OFXA 2XZOA 1P2VA 1P4SA 3TRFA 2QG6A 3ZD6A 3MSXA 2G3YA 5DGXA 4LBYA 5LD2C 1DAEA 1GAJA 1M1YE 2WJVA 3CB4A 3RANA 3CF0A 3W9YA 1OXSC 5EZ5A 4KCGA 4A2WA 2ZJ2A 2HXYA 5FBRB 1XTKA 4AWXA 5SZHB 1D6JA 1MO6A 1C1YA 4GZMA 4HZUB 3C5CA 3QEOA 3RWOA 2PJRA 1UEJA 5IHPA 3LW7A 1JB1A 1U0HC 3SFVA 2ZRGA 1GNRA 3TJZA 3VQTA 2JCSA 3K09C 5H70A 1MV5A 4HZIA 2OEPA 2P0EA 1M7HA 2EWVA 3GLFA 5E7IA 4Z54A 2W2XA 2FH5B 1H8ED 2ZRMA 1LVGA 1X86B 3MAAC 4TQAA 4M1YA 2FEOA 4JZKA 1EK0A 1G3MA 2QPOA 1W4RA 2CEAA 3EASA 4BLPA 2X2EA 4U02A 1CLUA 3R7WB 2NQ2C 4V0LA 2IYUA 1DAKA 1Q12A 5C1BA 2FFAA 4HATA 4EPXA 1EX7A 5FBWB 1XNJA 2CLSA 3BC1A 4PO8A 3U7FB 4D80A 1R5BA 4KVGA 2F3RA 2XZLA 4LV8B 2IEZA 5KUTA 2BMDA 4HLCA 2A3RA 2ZRAA 4DLUA 4WZBE 4DEYA 1AQYA 3RS4A 3O8CA 2XJ9A 1RRPA 4LJ6A 4BFXA 1E94E 5CB8A 3IPXA 3NVAA 1OIWA 4M4SA 4W9MC 1NLYA 2X1VA 1XCMA 3AB3A 2JLRA 4MITA 2ZUCA 1E32A 2BCJQ 4QFMA 2PX3A 1VMAA 1ZUIA 2G77B 2QMUA 4MUBA 2VHJA 1VTKA 3V4RA 1DARA 4YDSA 4Z1MA 1JEEA 1SVKA 4LCBA 2X77A 3AKEA 3FMIA 1NLFA 1KK2A 1IHUA 1T8TA 4JVLA 1MOZA 1XTJA 2GEDA 5AJYA 1G7RA 2MSDB 5J4HA 1E2PA 2WSSD 1QHNA 2F6RA 5HZHA 3B7GA 4HDCA 2FF7A 3W3ZB 1VHLA 2J7KA 4DUGD 1BMFD 2C9YA 3VR1A 4U00A 3NTUA 2H57A 1BH2A 5E4FA 1UAAA 3L8ZA 1IXRC 2ZR9A 4QGAA 4L9SA 4OQXA 4TL9A 2GKSA 5KTYA 4R98A 4ASUA 3UIEA 2WIBA 3DZDA 1AS3A 4HB0A 4GZLA 1GL7A 5FR2A 3ADBA 3EA0A 1P9NA 5JRJA 3K0SA 4NYMQ 1KDOA 2LKDA 3GLFB 3I4LA 1DEKA 2J0VA 1Q0UA 2OSBA 1D2NA 3BJIC 1EG7A 1G3QA 3BH6A 3GLGE 2DCUA 1VDZA 3FWYA 4QC2A 3EWSA 4WW0A 3MCAA 3VFDA 4RZXA 1P62B 2ZRJA 2FPKA 3E5HA 3FE2A 4AY2A 4V02A 1S1CA 1DBSA 1ZC3A 1XJ0A 4US1R 4LBZA 2WJHA 4Q4AA 3ZIAA 2OFOA 1E79A 2QA5A 2MMGA 2CNWD 3WYFA 3DO6A 2QT1A 3ZQ6A 1JR6A 5JMTA 2C78A 3V4FA 2GK6A 3QKUA 1W36C 5JJIA 3L43A 2H17A 3KDSE 4C7OB 2E9SA 2QGNA 3CZPA 4QL3A 1G5TA 4HAWA 2BEKA 1DOAA 4LK2A 5DH9A 4PTLA 3ZIAD 2W6IA 1KO1A 3QPVA 1LF0A 2GJKA 4XOIA 5P21A 5J4VA 3I8SA 3C16C 1CIPA 4LHXA 3V9PA 4P32A 3RSLA 4L9WA 3SI7A 4CEHB 4MA4A 3U7HB 2GVDC 1EFTA 3HYRA 2IUTA 2Q9BA 3DDCA 4WXPA 3S1AB 3KQUA 2QN6A 4G5QA 4X8HA 3WP1B 4C0SA 1G8HA 2OBNA 4LPKA 4TL7A 4JLKA 3GJ8A 5C46F 521PA 1NG1A 2CL6X 3QIAA 3QKRB 2OG2A 1TTTA 2YNMA 1NBME 1IAQA 2QE7A 3OF5A 5HKKA 5DNYB 2ODEA 4NZYA 2W83A 3LBNA 4A36A 4YQFA 1K8RA 2WJYA 3QXHA 1ZCAA 2GRJA 4B75A 4DLZA 5IDVA 1N6OA 4B3FX 3MFYA 1Q1ZA 4JSYA 4Q1DA 4RD2A 5IT5A 1KAOA 1W47A 2QAJA 3M6AA 3PEYA 2PEZA 2ODBA 2ZRNA 4QBFA 4CDGA 2QM7A 2X2FA 1DO2A 1FUUA 1US8B 6Q21A 2OCAA 2FPMA 4Z1MD 4ZIRB 5KPDA 1TQ6A 1CULC 3T61A 4PHTA 2K5UA 1HH4A 3B1YA 3CW2A 2H1LA 4FMCF 4FMCB 4NCJA 1E1QA 3T35A 2ANCA 3WBJA 3U5ZB 2GTPA 2J9RA 4AG5A 1YR9A 2BWJA 3B8HA 5CIWA 2VHCA 1YZTA 121PA 1EWQA 1P75A 2ZANA 3V00A 2XOKD 1EFRD 1TQDA 4QBHA 2IYSA 1GIAA 4LHWA 2L0XA 1N6IA 2ZRIA 1KNXA 2A5DA 2O52A 2Z4SA 1SQ5A 1XP8A 5C2JB 3RVBA 4OI1A 4OKSA 1D9ZA 3DKPA 4BRUA 1OF1A 3HJNA 1Z83A 2IX3A 2JLQA 3KFVA 1M2OB 1OYYA 3BB3A 2ZI4A 1TQ4A 221PA 2CE2X 1KO4A 4EUNA 4MRSA 4V0KA 3THWB 2QZ4A 4TMVA 4XIGS 3QE0A 4GDFA 3M4YA 2QT0A 4Q7JB 4OI0A 2A5YB 3QEJA 5KSZA 5DYGA 2D4HA 2YOHA 4KFUA 4Q4HB 1OFTA 3R20A 3RABA 4S35A 2QAGA 1ODFA 2KB0A 5FI1B 3TSOA 4A0FA 3D3QA 3GJ4A 3BFKA 4A8JC 3DPUA 1GVNB 4KAXA 4QGHA 4YMSA 4AKEA 2N46A 4MDFA 3CF6R 3I62A 4B35A 1GRRA 1XMVA 3NWJA 5LDDC 2D7CA 4FINA 1FMJA 1H8EA 4G5RA 5FBLB 1BYUA 5FL7A 4AC9A 2N42A 3QBTA 4TL8A 4G01B 4EPRA 3ZVNA 3D8BA 4B3DA 3KQLA 5L3SA 1E9AA 4TN1A 1EFCA 2PMKA 3HU1A 5DI9A 1YVDA 3IHLA 2VF7A 3LV8A 4M2LA 4OHWA 2F43B 3K70B 4A0HA 2ZSEA 2FA9A 5EQTA 4HSEA 2O8DB 5HKKD 1CJVC 5DI3B 4UXJA 4TLCA 4AD8A 1Q3HA 3WNCA 3CRVA 1G7SA 1E2EA 4AG6A 4TTQA 5FI0B 5FTLA 3EPJA 2GWHA 2V55B 3OEED 4GI7A 4G1UC 2Q9AA 4TTRA 2C98A 3KUCA 5JCZA 1QHYA 2I1QA 4RVCA 1SVOA 2KWIA 3AF2A 1VKJA 4M1SA 5JWHA 2UZ3A 4IEIA 4RKFA 3MWYW 2VP5A 4PZLA 4XVQA 5HCNA 4MYTA 2QY9A 2LWIA 1Z0IA 3PUVA 5B30A 1YZUA 4B48A 2D3WA 2ZE6A 421PA 1GRQA 4GMDA 3VU9A 4E07A 2J46A 3BBPA 4ZKDA 3SQXA 2UVQA 3LBHA 3BH7A 1DELA 3MG9A 3ZH9B 1N3BA 3U3JA 1OFUX 1XMIA 3B1WA 1P73A 2P65A 3KUDA 1OW3B 1OXVA 4NP6A 2WM9B 3BRWD 5KNDA 2GBLC 1XEXA 2HLDA 1G1MA 4RY2A 1Q1EA 1W48A 4TYYA 4I1OA 4IDNA 4Q9HA 1J70A 1Z2AA 1VECA 2BKUA 4DZZA 1VG1A 2ZE8A 4YMTA 1U0LA 2HV8A 1KYIA 3QOFA 1E2MA 4PZYA 1OH7A 3GQBA 4QJ3A 4LJAA 4TYQA 3FHOA 1SKYE 2XTNA 1RRCA 1G291 3QXSA 4PHHA 4NYMR 2RAPA 5DIFA 4EPWA 5FOXA 5FUXA 3ASZA 4CVNA 5CB6A 4CEIB 1NN0A 1Q22A 1E2JA 1H8HD 1G8YA 1XTQA 2ZJZA 3H2YA 4ASUD 3GLGA 1E3MA 1D5CA 4N0DA 4MYHA 4EDHA 3VR4A 3W8NA 1P9WA 1W2HA 4FI3C 4Y0AA 1KJYA 4C7OA 3LY5A 4IVRA 3WYGA 3ZGXA 1Q44A 2PLFA 1W4CA 3CPEA 4DT1A 2WWYA 4UNRA 2O8CA 3W6PA 1RKBA 5DSZA 2PZFA 3X1YA 2RH5A 4V0OA 4DLRA 3LDAA 2CBZA 1R5OA 1CP2A 5DYIA 2C03A 2OCPA 4MKHA 1LFDB 4GRAA 4H9GA 1Z29A 4ZDIA 4Q4LA 4TYNA 2RGCA 1ZD9A 2IXFA 3EG5A 3THXA 1CJKC 4D25A 2XXAA 4BFVA 4DBLC 4F38A 1YU9A 4NCNA 1FOEB 2ZU0C 5FOSA 2KJQA 3QVVA 4PSKA 4LGMA 5FPHA 3KKOA 2FSIA 2WPDA 3PR1A 1VG9B 3AF4A 2C2HA 3UMFA 4IXMA 2VYFA 4EPYA 2BOVA 3K0CA 1XB2A 5TVKA 2GF9A 3SYNA 2FX3A 4L4UA 5J5CA 1FFHA 4TLDA 1W4BA 4B76A 1XXHA 4DDVA 3LAWA 3ZYCA 1CJMA 2VO1A 2IYTA 5FOWA 2AX4A 3UG7A 4LBVA 1XPRA 4LWZA 4PPFA 4Q01A 1KI7A 2GA8A 3TSZA 1MABA 1ZCBA 2R6FA 4LYJA 2DWQA 4HB4A 4OI4A 3U6BA 5BQ5A 2GXQA 1G8FA 3EWAA 3CH5A 3PEWA 3ZVLA 1IJEA 4ACBA 1A7JA 3FMOB 1OFHA 1Z0AA 5KOYA 4M0LA 5JS8A 1M7GA 3ZLJA 1C9KA 2Q21A 1JECA 3W6NA 4ZCIA 3FOZA 3AVTA 2OBLA 4Q1FA 3CF2A 5JEDA 1S3SA 1XDBA 3M1IA 1W0KA 1G4AE 1MO3A 1RW4A 5FTNA 3IKJA 1QG4A 4KI0A 4BLQA 2ZE7A 1RE0A 3QXJA
chains in the Genus database with same CATH superfamily
1YHZA 5FTKA 1E8MA 4NU0A 5BN4A 3SBXA 3KWJA 5GTDA 3O1JC 1B6RA 1TGVA 4G8DA 2CSUA 2E3JA 5DCUA 5CG2A 4C7KA 2NN3C 1CZUA 1R4ZA 4S24A 3SXUA 1Y8QB 3EIEA 4B3BA 5AQEA 1SKQA 3H17A 1BXGB 1M34B 5ADWA 4F9TA 3AEUB 3TLBA 2BEVB 2YY7A 1NW6A 1PGJA 4I19A 4F6LA 4BAGA 1WZUA 1IMJA 2OZKA 2R8XA 3BPSA 3FCEA 3GLUA 3GMSA 1GRNA 1Q6ZA 3MJHA 3N0XA 4PCLA 3LY7A 3RDPA 4EQZA 1OFIA 4P58A 4GSLA 1AHIA 3W2GA 1OIVA 2ZYWX 1CPYA 1GGMA 1NVTA 4HGRA 5HIMA 3RPEA 4DEVA 5KU1A 2FLVA 2OCIA 3UHPA 1U0RA 2ZJBA 2AG5A 2FPSA 3GB9A 3H4IA 5KX5B 2FVYA 3PFIA 5CGZA 3QX9A 1IOLA 4IHAA 3I92A 4G9BA 3FYUB 4P2BA 3OJCA 4V1CI 4LRUA 1QQ6A 3VVLA 4GT1A 1DWUA 1L3BA 5GVRA 2R751 4ZZ2A 2IZ0A 3NHFA 1O97C 3OHMA 2HBRA 1C9YA 1W36D 3DB1A 3KR1A 3UBTA 3FCAA 3OT1B 2MTBA 2QN2A 3B48A 3CWCA 3F8SA 1CUEA 3PWKA 3O2NA 2UXDB 2DUJA 4QPCA 4WE3A 4C43A 5HKBA 1QIDA 4FGKA 4GSYA 1RD4A 2Q7DA 2V6MA 3HB4X 1T8SA 1NW9B 4G8JA 4P3PA 4F11A 1IPHA 1EXDA 3WK9A 3F7NA 2YW9A 2DE0X 1D7AA 2GPBA 3V97A 2R3SA 5ALWA 2HO5A 3FDIA 4IJ6A 5D3KA 3FN4A 5JDCC 1MO5A 1T34A 1PL8A 4BDTA 4EHJA 4LZZA 4IRMA 5L9AA 1OH8A 2VP4A 3C7CB 3EJWA 3KZVA 4OXNA 4H4CA 1KARA 3VKFA 3WLQA 2IXGA 5MGBA 3KQKA 1NN5A 2DHRA 2HLPA 2OO7A 2VBGA 2GZDA 2QRJA 4RF4A 1MH9A 1T5SA 3OETA 5IAOA 3GCGA 1OI3A 2OZLA 4IW3B 2EQBA 2GESA 4O5OA 4XVHA 4MB0A 5B57C 4KIFA 2J45A 4M55A 2QRZA 5H16A 4XTRA 2QYTA 4F8YA 1RBYA 1GG8A 1PWZA 1L7NA 2N0SA 2Z98A 4KO1S 1L8XA 1OROA 3NWBA 4QU9A 5JDIA 1K63A 4GUAA 4XUDA 5B4TA 1BMFA 4M0EA 4NZNA 2I6SA 1S02A 5FOTA 3SJCA 4ZGBA 2QP9X 3FOEC 3FM9A 4XA8A 1E2FA 4BY9E 4Y6QA 4RD1A 4BGUA 3WNBA 3WHIA 3MRTA 1EBUA 3SS7X 1R6TA 1RHKA 4DM4A 3T5GA 1XK6A 3GLRA 3INRA 3KQYA 4I9HA 3TRHA 2Q1TA 3KDAA 1ZYUA 2R6R1 2WICA 1I94B 2JA1A 1K7EB 2WWGA 4MS4B 3IILA 3H7IA 3AGQA 1ZXLA 3TTSA 2WWRA 4EQ6B 1FFWA 3D64A 2W48A 1H5UA 4DB2A 2IDZA 4JB0A 2OGUA 4I3HA 4HUTA 1PVVA 4DUPA 3CT4A 4DR6B 4H60A 2ZB2A 1I8TA 2BP7B 2FMUA 2YNMC 1PL6A 3JVUA 1BX1A 1PTKA 3C87A 2QN8A 4C7BA 5AKKA 3KQPA 3GLIA 3OJLA 3BWXA 4IF6A 1UBGA 4FCWA 5DE3A 2G1KA 4ZJYA 1DFIA 3IPRA 1YJBA 1CZKA 2GBGA 3BMNA 2W2MA 4HGQA 3AUAA 5B3JA 5DT9A 1ZOIA 4I6JA 4QJ4A 4N8EA 5LQSA 4KRYA 4QBKA 2QEQA 3KKQA 4I2NA 1I4DD 1FJXA 5EQDA 4JCCA 4N39A 3S28A 4Q4JA 5JCOA 3NW9A 3T3NA 1ZRMA 4BNGA 5BSEA 4HDOB 4C0KA 2Z4RA 1GUBA 5DLDA 1CUBA 3C3JA 2BD0A 3CX8A 3TTUA 3WB1A 5BORA 4NLLA 1VBMA 4XAQA 4B3RB 1D9XA 3ESYA 1A04A 3VZPA 2Y1XA 2GRAA 3ABOB 4WSOA 1N2OA 1SOMA 4DQVA 1NG9A 4EHNA 1G2QA 3AP2A 1YZFA 2JJ2A 2NUAB 1CRWG 4XFDA 2UYCA 1HEUA 1NRWA 1EFRA 1P1KA 1TK9A 5MFPA 3AEXA 1YO6A 2EL9A 4CMGA 3IDZA 2ZTVA 3AUFA 3V1UA 4OK5A 1KEEA 1PJZA 2P9ZA 2GK4A 2Q45A 1U3CA 3THRA 4YX9A 5CLJA 1X74A 3OZRA 3AR2A 3AY0A 5BSKA 2NP6A 4GKBA 4IR7A 5B36A 1LI7A 3LC7O 4EPVA 2BFAA 2C2KA 2NYRA 4XYLA 3RU9A 4DJTA 4WECA 3ZGOA 1Z5PA 1RAFA 3FFBA 1KK1A 1OAOC 1ZD5A 2D1TA 1T2DA 4JJ8A 1V5GA 3IR7A 4NEGA 3TLKA 2QPAA 1Q57A 2VDLB 2B5OA 2H7VA 3UJBA 5HJ7A 1NFFA 4WFIA 3RSHA 4XVRA 1Z75A 2V7XA 1F0PA 3TQQA 3KJHA 5FJJA 2TMKA 3ZEIA 1ZRHA 4L6IA 2CN1A 5K0LA 1XBTA 2DC1A 4DQXA 5IS2A 5LU8A 3MMZA 2ZREA 2EEPA 3L7YA 1EUDA 1UXOA 5AW0A 3ESAA 3I4CA 3B3GA 3TQFA 2AH5A 5TV2A 5TPWA 1J07A 2AHRA 2UKDA 4NATA 3UF0A 3Q0TA 2IYVA 2Y0BA 3KYDA 1P8AA 1AUQA 3KQNA 4PR3A 4KX5A 1UXGA 3SX2A 5BYAA 4GSKA 2FR8C 4B3CA 2JLZA 4F46A 4X84A 1OHHA 2VTEA 1KI2A 2WV9A 1WTCA 4DLTA 1JU9A 5DASA 1KVUA 1X80A 1PL7A 1SHUX 2E4ZA 5IEJA 4GKJB 5KHAA 2AOTB 4J43A 2A67A 1P2GA 2Z5GA 2JNWA 1HSOA 4FNGA 4N1AA 3TXAA 4TSFD 4Y0VA 3IC5A 2NZYA 3DPSA 3K5IA 1SUBA 3O7MA 3U19A 2A57A 3SFZA 2FGJA 2J3KA 2BHNA 1Z4KA 3MGBA 1E9EA 4PQGA 1U2DA 3KAQA 4CCYA 2NXWA 2JKVA 4Y9DA 4C30A 7REQB 3VV3A 1RVDA 2VP6A 3L8HA 1XTPA 3F9CA 4CEJB 1O9BA 4MB6A 5CD1A 1K97A 3IQEA 2ECQA 2IYPA 4O0MA 2V9CA 4MUAA 2RFLA 1H94A 1OQAA 1N5IA 2FZVA 3B70A 3D0QA 3LLVA 3O73A 2GJ8A 4FE3A 1DG1G 4XDHA 3U7QB 2PTHA 2GXUA 2BFDA 1PX2A 1DADA 5CBPB 1J8VA 2IXDA 1YAHA 2EWWA 3F67A 4W8OA 1RLOA 4C9BA 2JCYA 4GYYA 4CXMA 3QI2A 4E5NA 4YJ3B 4LXHA 1BS9A 5I7FA 1JA9A 2V6FA 3QBEA 2Q5CA 4M1KA 1F2TA 4LXTA 1OKKA 1ZY2A 5T4FA 2C7GA 3RROA 1FX0B 1Z9BA 3FTCA 3WB2A 4MV8A 3TTTA 1L4YA 1E2HA 3O4RA 4DARA 1SQ6A 1VE9A 1ZWKA 1HFEL 2XKJE 1BJRE 1U0OC 3L0SA 4RXMA 4XCVA 3UY4A 5A03A 3T5PA 2AFIA 1MP0A 2IE8A 1WZCA 2OE2A 2BEWB 4MS1B 3D81A 3KQHA 3QHPA 1P5RA 3NC4A 3N6RA 4Z0NA 4BNIA 4O4JA 5TQVA 4D7AA 4CM6A 4C2TA 5CXXA 3VZCA 1IN6A 3N2GB 2MT9A 1MQ9A 4BX9A 3I5YA 1GZ4A 3BGWA 1KP9A 3OFSA 4J6EA 2FN3A 2B78A 1XZBA 2RG1A 1H2FA 3LWDA 4R51A 2WBLC 5FTWA 2NSYA 1GGVA 1KY3A 1XDGA 2JIDA 5A0TA 1ANKA 3VU8A 3OTQA 4FDAA 2CNLA 4ABYA 3K9CA 3SWWA 3AJDA 4U7JA 2EFEB 3ESRA 2BFCB 5I5EA 4F3YA 2CL5A 2XTZA 2A59A 4BBPA 4XD7D 1TYBE 4HFNA 4DCMA 4C2UA 1L5SA 1T1JA 2JZCA 4RZSA 1ID1A 1OREA 4M88A 3VZBA 2H1OA 2MYTA 1O5IA 5FOUA 4XEUA 5A4KA 4KWHA 5BSWA 5EIBC 2AOWA 2W8BB 1MAAA 3QLUC 4CIYA 1FSZA 3UJ6A 4K9OA 5DNUA 4B4DA 1HURA 1FYXA 1ZQ1A 3TJRA 5EJ8A 4IDQA 4Q4HA 4HUQA 1SXIA 4JT4A 4ZOLB 4P7GA 1GPNA 3WYAA 4UNNA 2IOQA 1X8XA 4LJYA 1FXWF 1HV8A 1TKAA 2XRMA 5DP2A 3WNDA 5JXIA 2HU8A 4G37A 1Z47A 4XJVA 2REQA 2NU7A 1YDGA 1RIFA 3QFRA 5TY0A 2B36A 5I7SA 3PEFA 1EVKA 1OLSB 1C7FA 2NW6A 4N4AA 5GZ1A 1ZMXA 3MIIA 1P5JA 3IHTA 3HYSA 4MVJE 4FJ0A 4PRZA 3FXAA 1VPEA 2GVZC 4JX8A 4LHEA 1QG2A 1DC6A 3ITEA 3PXBA 4N5HX 1VBKA 4MI9A 4WA8A 5LP6C 1ZR2A 4HB2A 3TLYA 1YCFA 4AYWA 2P8JA 1FP2A 2QUIA 3NYRA 2XMSA 2YHIB 4EJSB 3TIVA 1OE0A 1QWOA 2BMFA 3GA0A 3DE6X 1JHVA 1HLDA 4EMBA 4MS3B 4B33A 3CTMA 3I9FA 2RSLA 5EPOA 5L7WA 3IBSA 4KKVA 5CVVA 2H29A 1CJUC 3R6GA 4ENUA 1GUAA 3STYA 5FEMA 3WK7A 5M04A 5AVSA 1TOAA 3IA7A 5HDQA 4UVHA 3ET4A 1AC5A 4ZQGA 1ZNQO 4NSNA 2X4LA 1PX0A 1RPAA 4YUWA 3IBTA 1Z36A 3GEPA 4ZRMA 1IXZA 4A4DA 1SCIA 1ILWA 2JKZA 3A3YA 3CUEF 4HGZA 2WIKA 3KTAA 4UM5A 4G0NA 3ILXA 1BXZA 3L7DA 2UVDA 3VRHA 2I29A 1TAGA 3D3JA 2CVQA 4PY2A 2EX0A 2AJDA 3PGMA 1LBSA 4E1VA 3BEOA 3IUSA 4HH4A 4D74A 1B8PA 3E7XA 3QKSB 2B4TO 1JHYA 1XRNA 5DCYA 5SYMA 1VYHA 2J41A 2I8LA 1CF2O 4MUGA 2J3EA 2R4TA 4WJZA 5IM5A 5THQA 2OK7A 5KNBA 3M2TA 4HZUA 2CHQA 3BIOA 3W78A 3HEMA 3PHGA 4H7KA 5JQWA 4Y2JA 5BT9A 3KETA 2JH9A 3M5WA 2JCXA 3T5BA 2G4VA 1XL0A 4LJRA 4YWJA 2Z57A 2ECOA 3MB8A 5DTEA 4QARA 2NQ8A 4QFCA 3H5LA 4BFSA 1T2VA 3C1AA 2F2TA 3NRCA 3L41A 4WRRA 3CLVA 1TVKB 1MJGA 1H6AA 3V2IA 4CFSA 3N7UA 4ZIRA 4FDMA 3W1VA 2IELA 5KWEA 1WHTA 2X6QA 2EKQA 4RGQA 4S3MA 2F1HA 2WHPA 1SULA 3SJBA 2E49A 5KQPA 2VNJA 5FUQA 1U4NA 3FVQA 4G0YA 4QOIA 1Z8DA 1T8YA 1T8UA 4YONB 1CRQA 3V5NA 3QFFA 4QXMA 5C4GB 4A5SA 2C58A 1NMSA 4MGEA 3TGWA 1RTKA 3PRKE 1AMOA 3GR6A 1TI7A 2JK1A 4I5IA 1JZTA 4EK9A 1D2AA 1I24A 3O4IA 4NBNA 5LWHA 3OFJA 1C7RA 4LYAA 1H93A 4O2RA 4WKNA 2P9YA 4B73A 5IUKC 3BQ9A 1SHJA 1L7AA 4QASA 4B7CA 3K9LA 1I6KA 3S7ZA 4DG5A 4O3MA 4LX0A 3D1VA 4JEIA 2ZBVA 4NDZA 3MBIA 5DW0A 2DFKB 1SBTA 2PLRA 2C7PA 3OZCA 2ANBA 2QW8A 3KU4A 4EI2A 4I55F 2BVNA 2OCXA 4XW2A 3D6JA 3TQRA 3FYUA 4J4BA 1OMOA 2FXVA 3K0FB 1IBMB 3KWMA 5FAXA 1H4VB 4L22A 5KTOA 3HABA 4I8XA 1PSWA 4F5YA 1ISRA 4PG4A 4JX9A 3LPLA 2JFOA 3AERA 4YMLA 4WESB 1SCBA 4IO0A 1YDHA 3TQOA 3ZJ5A 5DN9A 2BGWA 2Q6IA 4JJIA 1Q0HA 2GN4A 3WYEA 3A4NA 1QS0B 3ABIA 1CR4A 1NM5A 2O59A 3MAJA 1JEJA 1SCUB 4YCLA 1SUIA 4OREX 1V7CA 2O2SA 1T8PA 4L8FA 3DDWA 1NQ5A 2R65A 2WU1A 4AKIA 2XGOA 3QBJA 1VL8A 1M2EA 5B12A 1P1RA 4FM9A 4E09A 5JXHA 4KFSA 3WIDA 2I1VB 2ZSHA 3ZW8A 2HA5A 2POQX 3RWBA 1YXMA 5CLIA 1V6SA 2R79A 3KKPA 5G1PA 1NF9A 5ARCA 4G8CA 4CIAA 5F5XA 2JLCA 2V3WA 4OHMA 3V1NA 3TUIC 3FZEA 1F2TB 1OTYA 3THXB 1SD2A 2WT4A 1ZD1A 2IF2A 3E8MA 2OZLB 2FW7A 3OO1A 5J2UF 3OECA 1R2QA 1EYZA 1OBOA 1I4EB 1YOVB 4M8NE 4R1MA 5BURA 3ER9A 3BK2A 4ZCLA 1F1JA 1C4XA 1R7RA 1YE5A 2F9MA 1N8TA 2Q50A 1YDWA 3F49S 3C70A 5E9WA 4DLKA 3PT5A 1ZL0A 3QENA 1TMKA 3EOBI 3IODA 2AE1A 1EINA 4DRXB 2ONZA 3TIFA 2BHTA 4OHCA 3ZVRA 2RGGA 4PIPA 3BL8A 4NPHA 4MZDA 2YWRA 3ZKWB 4HGPA 1M5UA 1ZISA 4CHGA 3BSYA 3HBJA 3O84A 2P9HA 3Q5GA 1UKYA 2EZ9A 1SUEA 4JC0A 4OMUA 1NGSA 2B7BA 2X2OA 4R8RA 2CDAA 1PSDA 2HJVA 2ZBFA 5D3MA 1KDYA 3TB4A 4C4RA 4V1CB 2MOKA 3F1LA 3UXYA 1P2SA 2Y0EA 2IEDA 1DVRA 3GZNA 3VAAA 1BA3A 1I3CA 1SVSA 5EXTA 2X7JA 4F4CA 1FRFS 3SEAA 3OU7A 3SIPA 1ZIYA 2C8VA 2JLWA 3LP6A 4D9IA 3WB0A 1T3HA 1Z2EA 2O3SA 4M8LA 5FPKA 2I0FA 3KTOA 4YMIA 4F9FA 2IH2A 4Y2XA 1BOOA 4OU4A 1UZUA 2C9ZA 5CM8B 1BGWA 5IM4F 1Y7LA 1V47A 3L6BA 4EZEA 1TUGA 1Q7BA 4HFRA 4C4AA 3U3MA 1K5DA 2XZPA 3IQIX 3R5XA 4EG0A 5FWXB 1KI3A 4O08A 3PTAA 5MN4A 4MQ4A 4MQ5A 3G5TA 2G71A 2I1LA 2H2HA 2JFHA 4JOSA 3TFQA 3QVJA 3E58A 3WKCA 1PLLA 1IJKA 3KD2A 5D5QA 5UKDA 5BN3B 2WVGA 3ADPA 3HSYA 3KAPA 3I09A 1UIMA 3MMSA 2H11A 2O19A 1T36A 5C3UA 2E2WA 3CIFA 1DCTA 3SVTA 1QTNA 5SYNA 4HNUA 1XKTA 4D3XA 3PJEA 2WA1A 1GTZA 3KYIB 1KFCB 1XRJA 2IDMA 2PSEA 3W5DA 3AVYA 3CEAA 3HCWA 4B5LA 1JJVA 4URVR 1NVXQ 4JSRA 5EAIA 2OESA 1DDIA 1E2GA 4GPIB 1UK7A 4HPJB 5THXA 1A72A 5EUMA 1A2KC 1SCJA 2WFAA 4ZAGA 2D4AA 5F2EA 1TA0A 4AN0A 1V5WA 2G1JA 2Z2XA 4F45A 2IRWA 1Q1QA 1QYDA 3NU1A 1MU0A 4L5BA 1GRCA 1Z6YA 1CQJA 3O93A 3EJ6A 1US8A 2X9GA 3ANTA 4JB2A 3M81A 4RAOA 3DYBA 3TAUA 3I01A 4BNTA 2CLOB 3VX4A 4LRWA 4TKZA 1JTVA 3E8SA 4MCAA 3EGVA 4YRLA 2YWFA 1J9GA 4WL0A 5BRJA 5GADl 2GGSA 2IF0A 1C9EA 2P9EA 3S0JA 5GIOE 1VJTA 1G66A 5KCZA 4G5FA 3KLPX 2MWMA 4A8JA 3H05A 4LSZA 2HJSA 1QP0A 2FETA 3D4BA 3IRUA 3OD1A 4IIVA 4TTPA 4NJMB 5IN4A 2NMVA 3ZU4A 1GT91 1MAHA 1VPVA 4BMVA 4C0AC 5BR7A 4LHVA 3HQ4O 1NVEA 2WYOA 1JT2A 3KQSA 4DMFA 5HYVA 3VJMA 5KSYA 5DN6A 2VRCA 2WJZB 1ABFA 3K6RA 3IP3A 2ZM6B 3TMKA 3V1MA 2R62A 1ODSA 3GT3A 1G60A 4M76B 3WRXC 2J07A 2X0KA 4G8BA 1Q1GA 2LKCA 2DQZA 3AGPA 3MF4A 2EFHB 2QI9C 4XYBA 4BMPB 3HCFA 2WD9A 2ZAIA 2OLKA 1A1VA 2I67A 4IDBA 1QO9A 1K9VF 5AUNB 2A0YA 3MOGA 4ZK2A 2A4KA 3RYFA 4C7MA 1FW6A 4N65A 3D7RA 3MYRA 2J87A 3OHPA 4EFKA 4XM2A 3WDLA 4MHSA 5CM9C 3UMMA 4GX2A 4OGWA 3EFEA 2XOXA 1JPUA 5DU2A 3TLGB 1YL7A 3PL5A 3PRYA 4ZPJA 5IZCC 5IBRA 2M1ZA 3W3AH 5KYWB 1RS0A 3PJFA 3PG5A 4HDNA 1T4MA 4Y2VA 3JYHA 3R9XA 1FLDA 1GL6A 2V0NA 5BVGB 3SR3A 4LDRA 2BFBB 1QHIA 3D7MA 3N2IA 1HORA 5SZJA 3TXYA 4EZBA 1OAAA 5G3ZA 4QJ5A 5EE9A 3T7EA 5JRDS 2CJPA 1I0ZA 3VHXB 1VCIA 2YWGA 4OBEA 5FPYA 3L1IA 1OB2A 1YB4A 1I0IA 3K4QA 5CFMA 1JKFA 2I2WA 2X0FA 4FB5A 3C6BA 3U44A 1KS2A 1I2CA 4L72A 4Q39A 1Y8ZA 1Q2XA 4MIOA 5EMHA 1KAEA 5BYBA 3UXEA 1WPRA 2XLCA 3GJ0A 1E2LA 1I4WA 1V5FA 1LGYA 1MT0A 1WP9A 3HDVA 2Z5FA 1D2GA 3C6MA 1P9RA 1ADYA 1SBCA 3PS9A 3IQZA 1IVYA 5AM0A 1VGVA 2F1JA 4R0VA 5HXAA 4U7TB 1CUJA 1PFWA 2ZUBA 1JBQA 3MJ4A 2PT5A 2EKDA 3QE3A 4JFRA 4OO3A 2P5TB 4FSXA 3FDXA 4RDHA 1RHRA 4B87A 4CMCA 4EJ6A 2UXBB 3BIXA 4WESA 2Q28A 3B78A 4RAQA 4XWOA 5HUJA 1FNBA 1XCPA 1SD5A 3SM9A 1Y9JA 3H4VA 3PEYA 3WYDA 4AW9A 3AHGA 8GPBA 5K2MA 1AE1A 1THTA 1R0RE 1T0JB 5EP2A 4DJAA 4CTNA 1JAXA 1R4MB 2JRCA 4OIFA 2FRDA 1SCUA 1M34E 4OBXA 4QT0A 3IE1A 2A84A 2YJGA 3L46A 4N3BA 2ZVDA 1VI5A 2QL9A 3SHFA 5DTMA 1OXMA 3JQCA 5JY6A 4OHFA 5TX7A 2XYVA 3CVYA 3GGPA 3OG9A 4I6GA 1NOIA 2FDRA 4OCZA 4CM1A 1OWMA 2O8BB 3L8YA 5D5PA 1I14A 2Z6UA 1RKXA 2EC5A 1LJUA 1R6AA 1W0JD 2XVMA 3VBEA 2O4UX 3DDNA 4O4IB 1LC3A 1V9LA 4AAYA 2H5EA 5AW8A 2H48A 2FLWA 2QD2A 3K70C 1BXRA 4DPKA 4EA6A 4MVJH 1RZUA 1Z2PX 2G63A 4E5PA 5AJHA 4TLMB 1M1YA 1S8NA 2HU5A 1DO0A 1NN1A 3B9BA 3A6JA 3T5DA 1U9IA 5MDHA 4KAFA 4C22A 1OFUA 1ZXBA 1DJQA 3CZMA 4IFEA 4RTSA 3FKQA 2VWPA 1S4QA 1Z4LA 2J1LA 4PLGA 5MFZA 1M8JA 1Q17A 1FJHA 2DT8A 2P3OA 4UNSA 3STUA 3OFND 3UGJA 2HPVA 2FMXA 2QRQA 1N5RA 1AURA 1ONPA 4L95C 5AI6A 4EGAA 2JFWA 3FOAA 3PD7A 5GJVC 4E11A 3F98A 4DA8A 1WVIA 1Z2DA 1NSFA 2IIVA 3BWEA 3I2FA 4KIUA 4DA0A 1EA5A 3H42B 4R2WA 1L5MA 1HZJA 2IUSA 3HWSA 4DB4A 1UAYA 2P68A 3HE3A 3LXXA 4P4SA 2RGAA 5COQA 2EATA 2CNKA 3DVLA 3E3LA 4M9CA 4PC1A 5DNEA 5I7AA 1E6UA 5M34A 2C3YA 1W8IA 4B2LA 4O2LA 3A36A 3WL5A 4QYXA 5C8YF 3P0HA 1FMFA 1C30A 3LUHA 1DWPA 2PO7A 3HRHA 5EP4A 1FTQA 1ZK0A 3C43A 3DEJA 4IZIA 3LKDA 3S1LA 5F3WB 2BN4A 4NMXB 5FADA 4CETA 1V1RA 3QVWA 2CLKB 5BQ3A 1UZMA 3Q7PA 1CT9A 2ZBPA 5CTJA 2GZMA 5J5VA 1G2OA 4GD3Q 4MPTA 3SBDA 1QRUA 2QVGA 2PYDA 3LQ4A 1CE8B 2IXBA 3MS7A 2FSPA 2CZGA 4ZVTA 1CR6A 4TV9B 3OC0A 3OX4A 4O2AB 1D2CA 1H1LB 4OYHA 2JATA 4QO7A 1SVIA 1X7GA 4MW1A 4PYIA 5HR5A 2BFOA 3O8OA 2CK3D 4BQPA 4DA7A 1A76A 2NTNA 4FGLA 2FUCA 3OPYA 2GCEA 3A9TA 3M83A 3UB3A 3CEHA 5HIJA 2V7VA 3OFNA 5IWAB 3RC8A 2VCYA 3GGJA 5JWRA 4NY1A 3ZZUA 5ALXA 1BCSA 3L82B 4YUAA 2DSTA 5C9ZA 3OWXA 5J4LA 3CR7A 2PFSA 2JGNA 5DKFA 5E7MA 5KWVA 4X3CA 1TTHA 2VIIA 3LTNC 5HDBB 5LD2B 3OIFA 3A6GA 4HP8A 4KVAA 2Y0CA 3FOFC 2OSVA 3C15C 1NRJB 2A9JA 4Z8XA 4AURA 1NW4A 1BKDR 5AKYA 4Q1AA 2PNJA 5EJFA 4GYWA 3ICQB 3W8EA 1Z0KA 2PVSA 4LE2A 4KZPA 1BXKA 4RCYA 3TAHA 2B9EA 3PD1A 3AF1A 5K6RA 1ZZEA 3F6BX 1RR6A 1BSVA 4MW7A 4ZVQA 1WU7A 3QWAA 1UMDB 4DA6A 5FX2A 1U0BB 3DZHA 2O8CB 3RQIA 2EKZA 1TW2A 2XBLA 1NE7A 2NYVA 1HY3A 4FXPA 4AY5A 4HNQA 2B34A 5AW3A 1AF7A 1OUMA 3KPWA 5CT9A 2R7NA 1ZNYA 4R81A 3MWEA 1V7ZA 2ZK7A 4F91B 2BT4A 2HDWA 2HWYA 1NNSA 2ZS7A 4WOCA 2JASA 2ZBGA 5BNTA 4OX9B 3T6KA 3CX4A 4C4TA 1YH3A 3DJYA 5TQJA 1YFLA 3T4UA 3H4TA 2VQEB 3AVPA 4JOCA 3BM5A 3VSDA 5FEUA 2JH8A 2CJWA 2JAHA 2ACEA 1KKMA 3MJRA 3OPVA 4NQZA 4I81A 4EA9A 3L0ZA 1U2SA 1XWIA 4OHZA 1O0BA 1DC7A 4Q9LA 1HX7A 1JDJA 2CE7A 1YQUA 2ISCA 3IB3A 4MPRA 3HM9A 1NAHA 4LV5B 3IA2A 2QRMA 1GQYA 4H0NA 4WERA 1E1NA 2YMPA 4KPUB 2D5IA 4QQNA 2C1ZA 3FLBA 3TNLA 3T0IA 4CMHA 3A70A 3H18A 3WLJA 1AB6A 4MCJA 1P81A 2DZDA 4ITUA 4PYKA 3NP7A 1E63A 3VR4D 2J5QA 1H1TA 2XB6A 3GEGA 3I3OA 2BM9A 4CKYA 3FHTA 3V4ZA 2K2WA 2YV1A 3L79A 1P72A 3CXRA 5AVZA 2GOYA 4YRDA 1E64A 4TQGA 3C5VA 2XDQA 1MB4A 3F9RA 3MS4A 4IYRA 1PJLA 1B76A 5D00A 3IKMB 3R74A 1ECJA 2NNWB 3GA5A 4YUZA 1UT5A 1D6MA 3CH4B 5FHQA 4W5OA 4RF2A 5CMLA 1BHJA 3RRYA 2HA4A 3WRYA 1RQLA 3GFFA 2G1UA 1IIBA 5AW2A 2PH3A 5JI3E 2OVBA 2YIMA 3L4EA 3OICA 1QIGA 5J59A 3E5NA 3MHPA 4KXVA 4QGBA 1ZNWA 2WKSA 4B3GA 1KI9A 1CVRA 3D3WB 2E89A 3MXTA 4QDOA 1KU6A 2HLDD 3MCVA 5CW2A 3TW8A 1OXUA 2IITA 2TMYA 3EGWA 4QPZA 2E4UA 4GPD1 4L57A 5LYYA 3VR0A 2ZTSA 3WBKA 4KO2S 3A1VA 4BO2A 3A1EA 3FCYA 3KZOA 4MLPA 1C7QA 2F43A 5LPNA 1DUSA 4XWAA 4CM9A 4BQNA 3MZ0A 3N75A 1SXJE 3STWA 2CJFA 1G9TA 4HWSA 1MVLA 4GOOD 4JNCA 1IY9A 2BZ1A 1WDKA 3NH9A 2CD7A 3B82A 5DIZA 1J8QA 3CUUA 3HKEA 3DMDA 2Q4EA 1DC5A 4IBOA 1A7AA 3K2QA 3GP5A 3TOXA 2WM2A 2P78A 2QU7A 3EF0A 1JZQA 1RTTA 3CNEA 4FOPA 4YCSA 2FPXA 2ZI7A 4KQIA 1VIYA 1Y37A 3GPIA 3U16A 2GEBA 3DEKA 1XMQB 2CK3A 1YMQA 1YZ3A 1NMXA 2ZI5A 2EBFX 2P2LA 3RRNA 1YNOA 4MUIA 3EBLA 1S8FA 4MVJA 5F1KA 1MGPA 3OVMA 1LJLA 1UJCA 3M8KA 4MR7A 3U31A 1AK9A 3PYXA 1N92A 3LSYA 4AULA 5IZ4A 4C4SA 1OILA 2QI9F 4S1OA 5CP8A 3W77A 4FYPA 1TFRA 2R1TA 3GUHA 2W6NA 4PGGA 4TT3A 4ZT4A 3WRYC 3T52A 5CH3A 5BUCA 2BDTA 3F96A 1Y5NA 5I7HA 3WWYA 1A5AB 2NUTB 4H77A 4W9NA 4GBED 4ZAWA 5AUQA 4LJ9A 2Z6VA 4RKQA 4FKBA 3I6QA 1B2LA 2WI8A 2WLSA 3LH5A 1KE1A 3W9SA 2JIZA 3OQMA 4LX8A 2H9IA 1TTPB 4M99A 3ILYA 4IMIB 3DBVO 2VK2A 3DW1X 4WJKB 3TMAA 3GZTB 4JLMA 1Q6YA 4JH0A 2BELA 2W2LA 3S3TA 3UOWA 3SQWA 1TMOA 4QWWA 2EFCB 2WUWE 2YZKA 3AUTA 3NHUA 3P2EA 1NI4A 4HNAA 1KFBB 3HB9A 4KE7A 4U3JA 4UFPA 3I6YA 1G16A 2PKQO 2WHPB 3HPRA 3RUCA 3RSZA 3VPHA 2WYIA 2ASVA 3ILHA 3L9WA 4BNMA 2XB2A 2BTQA 4YLGA 3TTXA 5IPFA 2OAP1 3OZDA 1RM0A 2Q2VA 3L7KA 3PJGA 3AY6A 5CNKA 1F0KA 1MO4A 4PGAA 5TJHA 2RE8A 1LZKA 3TDKA 2NAFA 1O4VA 1GAXA 2X0EA 2LDBA 2DJIA 1WXHA 2G0TA 1A2OA 5EJ2A 3VI3B 4RXTA 3OZFA 3IFSA 3EXHB 3QEMB 5LUAA 2XA9A 2WWHA 2XE8A 1LTKA 5CG1A 3PQDA 4D79A 2O7VA 1UBTS 1USWA 2VSYA 3QEKA 4N40A 3HVUA 3QX7A 3RIXA 1W25A 2OPHA 4PHGA 4ND8A 5HRCA 3T1VA 4D0NA 3NBAA 2EW1A 3QFTA 1OT3A 3GJYA 3L0CA 1ZHFA 3MWDB 4JJ4A 4LNUB 2RI0A 2WKPA 5KTKA 5T7BA 3EF3A 3BRQA 2FZ4A 9GPBA 2O2YA 3CKYA 2GO1A 4JYPA 1IBRA 2JEYA 3LNTA 4CG0A 4YRGA 5AKZA 2XUOA 3ZXSA 5DM60 4ZJZA 1AKEA 2K7FA 4LSMA 1K8XB 1VC2A 1ZW1A 3CN9A 3C14C 3I64A 3OE4A 1R0SA 4GOLD 1DIOB 2Y76A 4XX1A 5DLEA 5E1OA 3K4HA 5IK2A 4BJ5A 3WLPA 3EODA 3GI1A 1LBTA 1S4MA 4Z4CA 1G3UA 3TD2A 2COKA 3UJ9A 2V3CC 4PC2A 4QICA 3P9IA 1YE3A 5ITZA 1U1FA 2BBTA 1EK2A 2HWUA 4QYIB 4XD7A 2H16A 1DBIA 3DDZX 3IO3A 4FPXA 2PDAA 4AS3A 1G3IA 5IJXA 2XMPA 1O54A 4RK7A 4J7CA 4JL6A 1JE0A 4QD3A 2ICAA 4E5UA 2CMFA 2ORIA 4FGJA 4B4UA 1WR8A 2M9MA 2ZW9A 3GJ7A 4FQ8A 2QM8A 4OXQA 3TVYA 4AX4A 4P8RA 1DCFA 4DIUA 5TQ0B 2OGZA 3JASB 2AL7A 2JGMA 3T41A 2BISA 2KPOA 3NVMB 1KL7A 3NBXX 2WDZA 5EJ5A 3E0QA 1YBHA 5C4IA 3SF8A 5K8TA 2GHQA 3QJGA 4LYEA 4D82A 4MYUA 1V45E 4CL3A 3AV0B 4UTVA 1IONA 1LDMA 3AIKA 3PRJA 4JOQA 1CEXA 2OFWA 3TBHA 3R9XB 3EVEA 2I9PA 4BLSA 2A5GA 4G56A 1HWYA 4H6PA 3STTA 1G63A 3TW4A 2VH1A 3U48A 4GZ3A 4BGDA 1E4YA 1XTSA 2E6UX 2QRHA 3FGPA 2QD5A 3IYLW 3H6HA 3K8QA 1FK8A 4I1SA 4B32A 1M73E 1I5OA 3RC3A 3ZV7A 1YHNA 2CVPA 2Q3MA 2Z43A 1X1DA 3PVSA 4OYRA 3LHDA 1DV2A 2O2XA 5EVJA 1GA1A 4BXOB 1PEAA 1UJBA 1MEJA 1IK6A 4WEQA 4BGEA 3FLAA 5HUQA 4HC4A 4MVWA 1UQUA 4OFBA 3ADOA 1LNZA 1ZD2P 1VA4A 3GGDA 5JVDF 3U44B 3RU3A 4KDCA 4ODIA 5IULC 3E9DA 4MMXB 3OCVA 1J0BA 1HC7A 1DXOA 4JJ7A 5REQA 3SR4A 1QYRA 1ZBQA 3IGFA 3LG2A 3V8PA 4WOBA 4DBZA 1LJ8A 3T5AA 5DULA 3U1BA 4D0RA 3ZE2B 2XYQA 1JQ3A 1XELA 2VN8A 4TS9A 5TMPA 5D5HA 1KETA 4A6PA 1FFDA 3WLFA 1R9NA 2YOFA 3LRPA 5BOVA 4D8TA 2EJCA 2Q99A 3J7TA 3K70D 3JXEA 2ZSDA 1U0NA 3MPUA 3SZGA 3SE0A 4BX0A 4RPHA 4F7DA 1UKVY 2DOKA 3AHJA 2A0UA 5ETJA 1Z7EA 1Y5MA 2ZI9A 5I9SA 5IYZB 3V1TC 3FZNA 3EQ6A 3F3YA 5BR4A 3WQRA 4FCCA 1L4EA 2O3UA 1E3SA 1N3YA 3QF4A 4QPDA 5BN3A 2C59A 1ZINA 1BDMA 3GIDA 5ECWA 4GIBA 2FQQA 3P96A 4K0RA 2R6GA 3HV0A 4QQRA 5JD3A 4IEEA 5JH7B 1R5NA 4E7OA 2JFNA 4HS4A 1AKYA 2ACKA 4YJ2F 1YVUA 2CLHB 1FVOA 4Y9TA 3G2PA 4ZVOA 2YXEA 1JDBC 5IF3A 3AR8A 3F8TA 5P8WA 1EX1A 2A9PA 4I4TF 3HP4A 3N0TA 3HKCB 3CZCA 4PZAA 4M6WB 2GN6A 1NUTA 1SGWA 2ZQ5A 4RGVA 2GJ9A 2W43A 3S55A 4NHOA 3VC3A 4ZI3A 1E2NA 1DAGA 1WCV1 2YC4C 3IIEA 3H1TA 4HX5A 4E0BA 1Y7TA 2FOLA 2JZOA 3LWNA 3HZHA 1A98A 1MPTA 1JSZA 1O3YA 4G0OA 4RANA 3T1QA 4K0KB 2XMCA 1E7MA 4LHZA 4B44A 2W58A 3AHCA 3HCRA 1ZOOA 3U3KA 4NTZA 4MLDA 1L7QA 1RPTA 2R68A 2Z2IA 5DO9A 2HAEA 3CEJA 4IDPA 1Y7IA 2WUEA 3SYMA 4IDOA 3UNXA 3ETJA 1T9ZA 2QUHA 2YJ5A 4LOKA 1DLJA 5M3BA 2FPIA 5J4KA 1TECE 3DA8A 2VEOA 5H3LA 1SRRA 4ZN6A 7MHTA 1B0UA 1EFPA 1MW9X 1XMOB 2A92A 3AUSA 4GW3A 3T3GA 2AOTA 1E5QA 3HYLA 1DMSA 1PQWA 3HY4A 1D03A 1UBOS 2PWBA 4NJMA 5EG5A 5IBQA 3K73O