3WMEA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
588
structure length
588
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAGAAQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ATP-binding cassette, sub-family B, member 1
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
total genus 214
structure length 588
sequence length 588
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmeA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmeA02
1H8EA 3DMNA 1J90A 4I1VA 1S2MA 1IN6A 2VSXA 4IJMA 4NCIA 4XJXA 5FOTA 1PVOA 2G88A 4A1FA 5K8LA 4LJYA 1E9AA 4GMXA 1XJ0A 3W34A 1U0HC 4XVQA 4LBYA 2RCNA 2YOGA 3QNUA 4FWTA 3MUFA 3PUVA 5JRZA 2PBRA 1E9RA 2QORA 4W5HA 3K8YA 2OT3B 1W4CA 3TIFA 1M8PA 4P32A 1LB1B 3V4FA 5TXGA 3QBVA 3DVLA 1FX0A 1IOZA 3EIQA 2FU5C 3U7FB 3OIYA 3DM9B 1NMXA 4CEJB 3TAUA 1XZQA 3U3OA 2F1HA 1E9FA 4HAYA 2B7CA 5JHHB 1Q20A 2GBLC 3SDZA 4EAQA 2XGJA 4AI6A 1YHNA 2FX3A 4NYMQ 4Q21A 1KNQA 3K9GA 4LSGA 4I1SA 1TX4B 2BKEA 4YMUA 3EIEA 3U44B 1LS6A 3ASYA 5LB4A 1VKJA 4DUGA 1YR8A 3JVVA 4Q9LA 2GVDC 4LPSA 3SHWA 5DGXA 2AK2A 3LY5A 2H17A 2ZJZA 5FBRB 1XFAA 4ZI3A 2P65A 3THYB 4RZ3A 2EFCB 1J99A 4ACAA 2CDNA 4IRUB 4TZ0A 3KQUA 3X1ZA 1UPTA 1XCMA 1P3JA 4AKGA 1IY2A 3M4YA 1SKQA 2XOKA 3FMIA 1KI4A 1UBEA 1W4RA 5HR5A 3B7GA 4UNQA 5AUOB 5B30A 1J8MF 1Z3IX 1II8B 4HDCA 1GG2A 2NZ8A 2VP2A 1PLKA 3SQWA 5JZVA 4II7A 2ZIAA 4Q1BA 1TEXA 4F7WA 4LJAA 3B1WA 1SXJE 2O8CA 5H8WA 2QU8A 1NLYA 2NQ2C 4TMVA 2BM0A 3ND9A 4IXMA 2AFIE 1F2UA 2ZJ8A 3BE4A 4GOJA 4Q19A 3CRW1 1XB2A 2FPKA 4Q9JA 2GXSA 1P2SA 2QENA 3IEUA 4IVPA 5FPSA 5IF9A 4GPTA 1TMKA 3C7KA 4P0TA 4RSGA 1BH2A 3NBXX 2FV8A 4L4UA 2PT5A 4LCBA 2QQ0A 2Z43A 4LJ8A 3BJIC 3LXXA 3IBGA 4QGFA 1U0LA 4C30A 3UMSA 4B3CA 4L16A 3I4LA 2QUZA 3CRMA 3Q5EA 1S0UA 3RS2A 4LV5B 2XAUA 3T35A 1JAHA 1OXSC 5FPYA 5A0FA 1D9XA 5E7JA 3AV0B 4R7ZA 1HURA 1S4QA 3BH6A 1R5NA 1E0SA 1NBMA 2CL7X 4BASA 2QN6A 4LJ5A 221PA 3IIMA 2AX4A 3KXLA 2ZRCA 3T1VA 4G01B 2ZM5A 1JB1A 1KY3A 3RWOA 3IQWA 1A82A 4HB3A 3GEIA 2FSHA 2BC9A 4DCUA 3CKLA 2EFEB 3T1TA 4IDOA 5EJEA 1F60A 1XEXA 4OQNA 5BQ5A 4DLVA 3U7GA 2W6ID 1OH5A 1OIXA 4ASUA 1DAFA 3ADKA 3DMDA 1E2MA 4TQ9A 1JAIA 1FUUA 2GNOA 4F4JA 4B43A 3B82A 3PG5A 5J4VA 3RRZA 2UZIR 2OHFA 4BECA 1D2NA 1XD2A 2FFAA 5EZ5A 3UANA 2IYUA 5M04A 1CJUC 4G5RA 4Y0VA 1ZU5A 2ECKA 3ZYCA 2HF9A 4Q9HA 1UF9A 4KODA 2F1RA 4C0LA 2HLDA 2ZYVX 3H0KA 2EWVA 1G7TA 4V0MA 1W46A 2AFHE 3QENA 4XWAA 3MLEA 3RS7A 4N1AA 1XEWX 4Q4HA 2F3TA 4FXPA 5J47A 2IS2A 3X1YA 1U8ZA 3QVVA 1FP7A 3HPQA 1G8PA 5FTJA 5IHPA 4C0JA 1YZKA 3A58B 4D6PA 1KI9A 2A5JA 3IPXA 2GZDA 4KHZA 3EG5A 2H92A 2V1UA 3KQKA 1NVVR 1YKSA 2VBCA 2ORVA 2YHSA 3L8ZA 3LBIA 5FFMA 4URVR 1ONBA 2CJWB 3IGFA 2ATXA 1SHKA 3GLHE 1E32A 3OIUA 4Q66C 1KJYA 3TQFA 1GNQA 1Z0AA 3OF5A 3SNHA 5HPYB 1VYTA 1XMJA 3EZFA 4FWIB 3BXZA 2ZSDA 3THOA 2OAP1 2QY9A 2BDTA 3AF1A 5KSOA 2ZAOA 4EFNA 1RJ9A 3CWQA 4DLYA 2IS4A 1K6MA 5DI3B 5F98A 3AVTA 3TW8B 2KBEA 4YMWA 3T5GA 1DAIA 5EE0A 2AHOA 4MQBA 3NBFA 3QPVA 3VKGA 2ZI5A 3NIBA 2ODBA 1L7VC 2ANBA 4ZDWA 3A1VA 1KYIA 1ZINA 3B1VA 1G5PA 1KAOA 2J0VA 3IO3A 3NH6A 2XNDD 4QNRA 2ZE7A 2ZUBA 2P67A 4OHZA 4DB2A 1NVWQ 4LYHA 4BZXA 2ATVA 2WJJA 1OFIA 1E1RA 5F3WB 1FP6A 3ZLJA 2BBWA 2F43A 4EPYA 1UAAA 1AGRA 3LBNA 4BFUA 4MKHA 4Y0AA 4QXAA 1XXHB 2W00A 3V4RA 2JLWA 4W7SA 4C7OB 2BKUA 5CM9C 1TU3A 2GBLA 2IEZA 4ZDJA 4C4PA 1KZ7B 4UXIA 2VF8A 2FSIA 3CUEF 2DPXA 5BXQC 4PAOA 4MGKR 2QPOA 4AK9A 1Z0IA 4IEEA 4KAXA 3MD0A 3U5ZB 4JBWA 4PHHA 4E5UA 4CYMA 3REGA 4ZKDA 1E79A 1ODFA 3OFNA 3PEVA 1VG1A 2AD5A 3Q7PA 4HAWA 5FBVB 1IJEA 1GNRA 2ZR9A 2IUTA 1W47A 3MAAC 2B21A 2UZ3A 1X8JA 4PZZA 5CIWA 3QEJA 5JJLA 2HUPA 1CU1A 2QPTA 4ZIRB 1IN5A 3U2QA 1P9RA 4XTRA 1IBRA 3LVQE 2ZE6A 1G1MA 4YONB 2FJUA 3CW2A 3DOFA 3NH9A 1GL7A 3B1ZA 4MRRA 4NONA 3AVVA 421PA 2BIFA 5TY0A 2CVHA 1BMFD 1VG9B 2AR7A 2E9SA 1G6OA 3F8TA 3B5JA 3TQCA 3U4QB 2FZLA 5DNYB 2IT1A 1R0XA 2DWQA 4RCYA 1DADA 3R9XA 4BPBA 3TBKA 1Q1BA 3MGCA 5FPKA 4U00A 1JJ7A 2RGCA 2NZJA 2YWFA 1Q1EA 2D2FA 3CNNA 4BFXA 3K0AB 5LD2C 1UKVY 2HF8A 3PFIA 2WKQA 4XVUA 1KDTA 4LRWA 1GDDA 2CHVA 2D3WA 4LV6A 5HZKA 2VSFA 3CRRA 2BM1A 1AM4D 4QJ4A 4B75A 1RRCA 2R6FA 1DTSA 1A5TA 4ZDKA 2G1JA 3GPLA 1N6PA 3PEUA 2PMDA 4E09A 4Q48A 1P7CA 1NIJA 3N5CA 3WYAA 5CLLA 5FPTA 2R65A 4I1OA 2QP9X 2GKSA 4OI4A 1JI0A 4DDUA 1QRAA 1NJGA 4CT5A 1ZCAA 2C9OA 4A0HA 5G41A 1MH1A 3LW8A 4PO8A 4D2IA 1KZGB 3GLGA 3L0PA 3B60A 1UBCA 2P5TB 4Q4AB 3Q5DA 4DKXA 1E1QA 1VCNA 5G3ZA 5KDLA 3RSLA 2QAGC 3U61B 4TZ6A 5JWHA 3IDQA 1COWD 1S1CA 2ZVPX 2IYTA 2FN4A 3K9NA 1NY6A 2ZR7A 2JLZA 1J70A 2FGJA 5KYKA 2BMEA 4PC6A 3WXMA 4EQ6A 5SZKB 3X1DA 4DCSA 2IYRA 4NCJA 3SYNA 1EXMA 2FOLA 5EQTA 3LAWA 2WSMA 3R9IA 1MO4A 4OK3A 4YXWD 2JJ2A 2CK3A 3UXMA 3K0FA 1WXQA 4P33A 3JZAA 4EDHA 3BH0A 5SZJA 4AD8A 5AR1A 2PZFA 3VR2A 4QHSA 1H8HD 3PEWA 4WZ6A 1IXRC 4KLZA 5BN4A 5CDFE 1E69A 5CJ2A 3W90A 4A8JC 4UKDA 3TMKA 4DJTA 3IHWA 2MMGA 2O8EA 5LB2A 2WWIA 1NBME 4Q7JB 1NG9A 3P1JA 3CO5A 4UXHA 1OH7A 4S2EA 4PSAA 5JSZA 1E2DA 1Z29A 2A3RA 2WWHA 3WP1B 1CBUA 3EZ7A 2WJGA 2GJSA 2WJHA 4Q00A 4IDNA 1OB2A 2RKOA 3CZPA 3GLIA 4GSYA 4PPFA 1P62B 2L0XA 1P9NA 1UKZA 2BJWA 4JBYA 4XH9B 3VR6A 3VR1A 3AF2A 4DDWA 2F7SA 4PFSA 2JAQA 1VTKA 3FHCB 2GILA 3FYHA 3DDCA 3QI2A 4AG6A 4MYTA 5EXXA 4E07A 1KO4A 4B3XA 1YZNA 4LWZA 1ZUIA 3NG1A 1W5SA 3FDIA 4UQOA 4B48A 1DELA 1Q1ZA 3E5HA 3SBDA 2AD1A 1D8TA 4OHWA 4PQYA 4TMWA 1NSFA 2ONKA 2BMDA 1Z6YA 5CYOA 5FUYA 1Z47A 4V0ME 3I8XA 4WA7A 3NKVA 1JR3D 3KB2A 1YR7A 1Z08A 4H1UA 4LBZA 1HYQA 3T12A 5FI0B 1XDBA 1XPOA 2AWNA 2BMFA 4PPGA 1N25A 2IXGA 4HLCA 3LVRE 2CNWA 2ZYTX 4JVMA 3I3SR 5LBIA 4YMTA 4JLOA 4C0KA 2VHJA 4LK2A 3WY9A 5KSPA 3WHLA 2X19A 3E1SA 4YMVA 1M7BA 2X8AA 3MWLA 2J41A 3SZRA 5JFGA 4P3YA 1D2EA 4NYIR 1N5LA 2D4HA 2C98A 1ZD8A 3KXIA 4HZUA 3FHOA 5EXTA 3QEOA 2Q21A 3QXSA 2OLKA 3AVUA 5CK4A 2PZGA 4J0QA 3VTKA 2BOVA 1D6JA 4ZDIA 2HEIA 4O2RA 3GEEA 5JS7A 3QKSA 4LHYA 4TSFD 2DCUA 4QJ3A 4UNNA 2EFDB 1KIMA 1T91A 5CLQA 1HT2E 2X2EA 1E4VA 1XMIA 2NO1A 3WBKA 2W2VA 3UK6A 3CZQA 1KJZA 1UM8A 2ZS9A 2KI5A 3MRSA 3ONWA 2ZJ2A 4PHTA 1N6LA 4RVCA 3RAPR 2O8BA 5FUVA 1Y3AA 2REXB 2OO7A 4YQFA 2EQBA 2WWWA 3C15C 2ZSBA 4TT3A 5HCNA 4D4LA 4WBSA 1NN3A 2ODEA 3EZ2A 2VP9A 3LFUA 4PQRA 4DCTA 1NMZA 2BHRA 3T1QA 2NG1A 3GJ8A 3GLFB 4IOLA 4MGYR 1JPJA 3QKRB 3WNDA 3OHMA 5J4YA 2GESA 2QAJA 1DPFA 1E0AA 2Q3MA 2WHXA 2FE4A 3M1IA 4B34A 4M2LA 4PAQA 1YR9A 3WMFA 5GJVC 5IT5A 1GFIA 1G8YA 3GJ7A 4BFSA 1KKLA 3THWA 2H16A 4HLQB 2F3RA 4QC2A 3QF7A 4DLRA 1ETUA 1YJ5A 3MWJA 4KLNA 5DIFA 4TYWA 3BGWA 4LYJA 5L3SA 1OHHA 3TRFA 3KTAA 3BB3A 4LJ9A 1Z0FA 3U7EB 2OBNA 5K8TA 3T61A 1W49A 2QBYB 4HUQB 2OFOA 3WYGA 1SGWA 4B35A 3ZIAA 3ZZUA 4E22A 4WZAE 4FCTA 3I5XA 1AZSC 4D4JA 1GL9B 1G20E 1ZIOA 2B8WA 3EA0A 1PV4A 3LO5A 1KO5A 2C99A 2YWHA 5FOSA 5C2JB 4WAUA 4AKEA 1W1WA 4JBXA 4JIMA 3KKOA 4NYIQ 5DYGA 2FA9A 1E2JA 4M1SA 4M53A 1G6HA 3C16C 4QBHA 4EKDA 4NZYA 4QL3A 2PL3A 2AXPA 5J5CA 1OYWA 2XEXA 3VU9A 1US8B 5J4LA 4IOJA 4B44A 3TUIC 4TYYA 1P5ZB 1VHTA 2VPPA 1GP2A 5L3SB 1OW3B 1YZTA 2B92A 2QROA 1M6NA 1B23P 4D4KA 1W48A 4K8OA 4Q01A 1FFHA 1LFDB 4I4LA 5FTNA 2QAGA 5DN6D 2V54A 2HJGA 1UEIA 1G8HA 1KOFA 2KSQA 1YE8A 3O8DA 3VR4A 1BKDR 3DM5A 3EARA 4AC9A 1K8RA 3BRWD 1XTKA 3BS4A 5BWMA 4DLWA 1AGPA 1P75A 2ZUDA 3SU8A 1CRQA 1E2HA 3WBJA 1KKMA 2GCNA 2Y8EA 1FNMA 4BZQA 1EFRA 2H1LA 4OHYA 3I32A 1KTVA 1VCOA 4IKEA 2W0MA 3WYFA 1XMSA 3CONA 3U60B 2FSFA 3QF4B 3EASA 3EAQA 4Q02A 4A8JA 1T4GA 4UJ3A 1SVLA 1HE8B 2J0QA 3PV0A 4K46A 2VA8A 2R6GA 5JWOA 2ERXA 4MDEA 3Q7QA 2XOKD 1E9SA 3PUWA 2Q3FA 2AKAB 4TMTA 1KK3A 1UBGA 3P20A 1P72A 4FINA 3GLGE 3FKSA 2KJQA 1HQCA 3LBHA 1YZQA 4M1WA 1XTSA 4NE2A 5C46F 1T5LA 1E6CA 1X8KA 2QT1A 4Q4JA 1ZNWA 2RGDA 4A9AA 1KO7A 1R4AA 3PQCA 4Q1AA 1XTJA 5DYIA 2W6JA 1TQ4A 2NIPA 1DAHA 2VYFA 1CIPA 2FPMA 1R10A 3V9PA 3P4YA 4CEJA 2WJYA 2F55A 1E9CA 4TL9A 3CBQA 3QJYA 3DO6A 2H57A 1NLZA 1CP2A 3BFKA 4PX9A 3KJIA 2NO9A 1YZUA 1XTRA 2XSZD 4LJ6A 2R6AA 3QQ5A 4TLEA 2GF0A 3AKEA 1NIPA 4XWKA 2ZI6A 5D3QA 3GFTA 4Z1MA 1FL9A 1M1YE 2IC5A 5AJVB 3U44A 5L3VA 2ZS8A 2R9VA 2EYUA 2YWGA 3TR5A 1I2DA 4JLKA 3PEYA 3N70A 4G5QA 4F38A 4US2R 3O8CA 5EZ6B 1DARA 2FSGA 3TVDA 4Q4JB 2H5EA 2KB0A 4PZYA 1NL3A 3THYA 5C1BA 4U5XA 4F91B 1AJEA 2N42A 2GHIA 3GLIE 2P0EA 4RD3A 3K1JA 5KSZA 2PEYA 2CLSA 5EUMA 5F9HA 1KGDA 4M1MA 4URXR 3LX8A 3HU2A 3AVWA 1S9DA 1II8A 4RFSB 1N2CE 4GBMA 2GEUA 2HV8A 4GP7A 4MDFA 2WAXA 2PZEA 3P27A 1G41A 1UKYA 1OB5A 3HDTA 4CGZA 2GF9A 2XB2A 3A4MA 3I92A 4QHTA 4A2PA 2E1RA 4IVQA 2J46A 1ZAKA 5J4HA 5F9FA 4LHZA 2PX0A 3OAAD 1ZM4A 2V9PA 5FOWA 1QG4A 2QMEA 1LF5A 2ZI4A 2HJVA 2KWIA 1OFHA 1W4AA 1VIAA 2HDNB 1L8QA 4ON9A 3KKQA 4MKGA 1R7RA 2WPDA 5DHAA 2ZITA 2NPIA 5EE3A 1N5JA 4DLUA 1NI3A 3B13B 2VRWA 4IDHA 1A2KC 2X1VA 2GZAA 1GVNB 1JR6A 1E9EA 2AK3A 3DZDA 4FD2A 3ZD6A 2G0TA 5HCIA 1OE0A 2BBTA 3SC3A 1WA5A 4Q1FA 4LX0A 4DSOA 1R0ZA 3ZJYA 3P32A 1G9XA 4FMCB 3TLXA 2ORIA 3BH7A 3SHFA 3CF2A 1E96A 3LW7A 1XD9A 5C18A 2V7QD 1DO2A 2FFBA 2FEMA 1WCV1 1II9A 4QHYA 1JBKA 1VDZA 4LYFA 5LDDC 3CF0A 2CHGA 2OCBA 1T5IA 4DIDA 2DY1A 4XTCS 4A2QA 3OE7D 2O8DB 4JVLA 4PHFA 3KKMA 1U8AA 3TJZA 1DBSA 1M2OB 2FNAA 1W2HA 1U94A 3A36A 1NJFA 3CPEA 3OEEA 4DSNA 5FBLB 2HCBA 1Q3TA 4IEIA 1WQ1R 3A8TA 2BV3A 1KMQA 5KU1A 2WSSD 1CJTC 4Q03A 4BFZA 1GRQA 3FMFA 2GCPA 3IIJA 3RRNA 2QG6A 1QZXA 1T8TA 3Q72A 1LVGA 2NGRA 4KXFB 2WOOA 4JLMA 3LXRA 4KBGA 2I3BA 3G5UA 1BIFA 1XCGB 2H18A 721PA 2ZRHA 4BLQA 1QF9A 1T3LA 4BLPA 2IXFA 5EXPA 5B2ZA 2FDCA 2GA8A 2QM7A 2QMUA 3Q9LA 3IO5A 4IFEA 1KK2A 1ZJ6A 3BK7A 1CXZA 3CX8A 3B1XA 3HU3A 2BCJQ 4KV9A 3EPHA 1VCIA 2D06A 4C0QC 2ZSAA 1U2RA 4QBGB 2QL6A 3X1WA 2WV9A 2ZQ5A 4KFUA 1SHZA 4KVAA 1ESNA 4M22A 5L8VA 2W58A 3PUYA 2ASEA 1GL6A 3SJZA 2G0NA 3AH8A 2GTPA 2IX3A 2CJWA 2R44A 3B8HA 2XZLA 3PR1A 1AKEA 4TL7A 1UFQA 3GEHA 1W5TA 4HYYA 1NVXQ 1EFHA 3HU1A 4LC1A 5HE9A 1CLUA 4WIAA 5KNDA 4W9MC 4G5OA 2IXEA 2IYYA 2MSEB 4MGIR 4DWJA 3KKNA 5FOXA 2ZVQX 1CKEA 1CTQA 2JJ1D 1W0KD 2CL0X 5FOVA 3U6KA 5KOYA 1YZGA 2PCLA 5DI3A 3RC8A 2IYSA 4JL6A 4F93B 4D25A 5TVKA 4QM6A 1TQ6A 2WAYA 1XEFA 1KNXA 5EP3A 3NXSA 2TMKA 1SVKA 3IILA 3QXHA 3TAHA 3MWYW 1OH6A 4HATA 4ZCLA 1WB9A 1PZNA 3LWNA 3T1OA 4B76A 5K8UA 4IXNA 2QA5A 3MJHA 3SI7A 2A30A 1JXOA 4AURA 1N6IA 4F92B 1GRNA 4ABYA 2DFLA 4IFBA 2F9LA 1U90A 2H7VA 3AVYA 4TL8A 4RFVA 3MSXA 2CCGA 2ZI3A 1E3MA 1P61B 4R71A 1EX7A 3VX4A 2YNMA 4P4SB 1KDOA 2ZJYA 4TWZA 3AVXA 2JASA 2J0SA 2C2HA 1NKSA 4N0DA 1XXHA 1ZNXA 2BJVA 3UMRA 2WMOB 4C7OA 3DKPA 5A5GA 1QVAA 5JCPA 4Q9KA 1P60A 1ZNZA 4LV8B 1OKKA 3CPJB 1KSJA 5EUQB 1G3MA 2XTMA 2ZRJA 4LHWA 1FQKA 3JZMA 3C5HA 2NMVA 1L2TA 1ZVQA 2XJ4A 4V0OA 4A36A 2N46A 2GJ8A 3ADBA 2A5FA 3A1UA 3AF0A 5HE8A 3KJEA 3K0SA 4TMZA 3I61A 2HYIC 4QG7A 4A2WA 4HEJA 1OIVA 2X2FA 2XX3A 4AWXA 2GEDA 2OUKA 4V03A 1Z6XA 2VF7A 4JL5A 4GRAA 3EWSA 4K81B 1FTSA 2CLDX 1AQYA 2GEVA 1KHTA 4PHGA 2JLRA 4NL4H 2JDID 4ZIRA 4LBWA 2ZRLA 3GFPA 3FFBA 4A82A 1HV8A 2DYKA 2EFHB 3R8CA 1UEJA 2GXQA 2WJIA 3U3KA 1W36D 2DFTA 4PSVA 1M7HA 4BFTA 3OESA 3K70D 4OHVA 1E9BA 2OEPA 2IYZA 3CX6A 5FBQB 3ZD7A 1QHHB 4JLNA 5G3YA 3ZQJA 2P5SA 4AYWA 2YZ2A 2ZAMA 1KK1A 3U4QA 3LLUA 2WZQA 3GCGA 2W6IA 3O8RA 1G7RA 3TSZA 3SE0A 3K0CC 4UNRA 1FMLA 2ZU6A 2JA1A 5AUPB 1UDXA 1QBKC 1AIPA 4NU0A 1II0A 2JJ2D 2CK3D 2YYZA 3K0AA 2NPFA 4HZIA 3BFVA 4KYIB 3UKDA 4GDFA 1TF2A 2XZPA 2C77A 3KUDA 2LKCA 1A7JA 3AKCA 4JVNA 3ZVRA 4CEHB 4M9XA 4Q47A 3L8YA 1Z6AA 2LWIA 3AVQA 2NTYC 3D6TB 1W44A 3AUXA 2VTKA 4LHVA 3KZ1E 3UIEA 5IK2A 2C5LA 4B3BA 1QHNA 2Q0HA 1KI7A 4FMDF 4MUAA 4WOPA 4HAXA 1ZM7A 4ZCMA 2B8TA 5D3MB 1XTQA 4YC7A 1XZPA 1GZSA 1SVMA 3J81k 1Q22A 4NKRA 4FN5A 1NNEA 3IKJA 2ZJBA 4KO8A 2EWWA 4GL2A 4RD4A 2ZU0C 4DT1B 2J9RA 4Q4AA 2ZANA 2AWOA 3PUXA 5G40A 2CCKA 2CMKA 3NWJA 5FH9A 2P6NA 2IW3A 2ORWA 1IQPA 2G83A 5JHGB 4NYJR 2C78A 3H84A 1MRSA 4OJKA 2DR3A 4D82A 1KI6B 4ESVA 1GM5A 2FPLA 2ZI7A 1E2NA 2FEOA 3AVOA 4CEIB 2GCOB 2VHUA 4OQLA 4AYTA 4BEBA 3EPKA 1ZD1A 1NKTA 2XJ9A 3GP8A 1E2EA 3SOPA 1VIYA 2J7KA 4EJSB 3TGPA 4OJQA 2QT0A 1Q44A 1OH8A 1MABB 2QI9C 2F9MA 3BBPA 3GQBA 4C0SA 2R6CA 5JJIA 1PLLA 5CITA 2Z83A 4HAUA 1NN5A 2GK6A 5AJYA 1XF9A 4PZLA 2B6HA 2GRJA 4ERNA 2PCJA 4EUNA 4KYUA 4GZMA 4L8GA 5EE1A 4F4IA 2A7QA 1Z83A 5CB8A 1SXJD 2XNSA 4JKIA 3T34A 3U3RA 3IBYA 3SJAA 1Z2AA 3S1AB 3NHAA 2P6UA 1KI3A 1ZM9A 4CZ2A 3SN6A 1OIWA 1RZ3A 2ZS7A 1PJRA 1N5KA 4RZXA 3LNCA 4RD0A 5BN5A 2HT6A 4MGZR 5FL7D 1VCMA 4XVRA 3ADCA 2JLXA 3KL4A 3A4LA 4ACBA 4D80A 2PEZA 4N0EA 1E4YA 3EZ6A 1P2TA 3LDAA 4B3GA 4ARZB 1GSIA 1W0JD 3BB1A 2CHQA 1VYUA 1Z2CA 3WMGA 4FCWA 2P6RA 4Q5IA 5BW8A 4JLDA 3FB4A 3RYTC 2ZI9A 1JECA 3GJ3A 2AL7A 2A2ZA 1Q1QA 4BQSA 4KCGA 1QHIA 2CCJA 3D3QA 3BOSA 2X77A 3W5JA 1T8UA 1T9HA 2PH1A 2V1XA 2OFWA 4TYQA 4OI2A 3ZVLA 3QUSA 1LS1A 4G5GA 1QHGA 5LPNA 4NYJQ 2QE7D 2OZEA 3NC1C 4TTQA 3WNBA 4DC9A 2XXAB 2B7BA 3X2SA 1W36B 4DLSA 3DKVA 3K70B 1E9DA 2IA5A 2IK8A 3EC2A 1BOFA 4PO1A 1T0HB 3QG5A 2OESA 4LJ7A 5G53C 1P4SA 2LKDA 1BMFA 2GDJA 2FF7A 1X1SA 4KJZA 4TQUS 1Z07A 1JEDA 1X1RA 1XEWY 3ECCA 1XMVA 1WP9A 3OEHD 4JYCA 1Z06A 1VG0B 2IYVA 1DAMA 3RWMB 1CJMA 4GMDA 2J7PD 1F2TB 5B64A 3QPWA 4M1KA 4R2HA 1SKYB 1AA9A 1KMHB 3I5YA 2EFGA 2Z4RA 3MMPA 4PC2A 621PA 1E2FA 4V0LA 1ZD9A 5TDHA 2EW1A 1TL7C 4EPRA 5DISB 1XP8A 4MRPA 4A0RA 5ELXA 1OFTA 1VPLA 1ZBDA 3HPRA 1Z5ZA 1N6HA 3AF3A 2V6JA 2RGXA 4MKIA 1TQ2A 2AXNA 2D74A 1JXMA 4FMCF 5EE5B 1YVDA 1MO3A 5E3HA 2ERYA 3THXB 4URZR 1EWQA 4QBFA 1FZQA 4C2TA 3EC1A 4DB4A 2RMKA 3EA5A 1GIAA 1XD8A 3BC1A 2QTFA 4O2LA 5JS8A 2O8FB 4OBEA 4TQAA 5KNBA 2ZXUA 3C5CA 3GLFA 1A2BA 3QKRA 4D4MA 1GOTA 5DLQC 4DHEA 4Q4LA 1WBDA 2NO7A 4URWR 5TARA 2PLFA 1COWA 1ZNYA 4B6EA 5UKDA 4D81A 5GVRA 4CF7A 2WKRA 3CRQA 2H8KA 3K0CA 3EZ9A 3H86A 2I1QA 1IAQA 1TADA 1BS1A 4B32A 4YXWA 1OSNA 2QBYA 4HUQA 1AS0A 2C04A 1U9IC 1WE2A 1Z6TA 2JIZA 5GADl 2GVZC 2IS1A 2PT7A 1H8HA 1G8FA 2UVQA 3PVSA 4R98A 1SVIA 2ZJAA 4KSBA 1KAGA 1OT3A 4XD7A 4DEYA 1TTTA 4GFDA 4URUR 5EP2A 5A4JA 4MYHA 5FBWB 3FHTA 1DAEA 3VAAA 2JLYA 4M21A 2JATA 1R8QA 2J59A 2OV2A 4BUJA 3F0TA 3I1FA 1G7SA 2OCAA 1IY1A 3DOEA 2IYQA 3FKSD 5EE9A 1SXJB 3FGNA 2IHBA 3O8BA 1ANKA 4DDTA 1L4YA 4C0AC 1US8A 2O5VA 4I99A 4HDQB 4Q18A 4R9UC 1H65A 1NVUQ 3AM1A 4JLAA 2W6JD 2HYDA 3TH5A 1KSGA 2JLUA 4MH0R 2GWHA 5CIQA 3L43A 1QHXA 3DZ8A 4TTRA 2O0KA 4QRHA 1EFCA 4A6PA 1L4UA 1T6NA 4RZ2A 2ZE8A 5HKKD 2C9CA 5BYKA 1XPRA 2C95A 4D0GA 1KI1A 1CF4A 1I2MA 4BFYA 1H8ED 1FNNA 2VL7A 4I1UA 1IONA 4G0NA 2ODWA 4JKYA 2GETA 3HYRA 4ZV4A 1OLOA 3FMPB 2OBMA 3PJRA 3T06B 3BAFA 4C3ZA 3CIOA 1JR3A 1SQ5A 3ASZA 4DIEA 3QF4A 1J7KA 5EP1A 2VP5A 1HA3A 4FMDB 5SZIA 2IYLD 4EPXA 521PA 2OG2A 3C41J 3RSOA 4XOIA 4ESHA 1EG7A 4JLJA 5L3QB 2WICA 1HT1E 3KDSE 1CRPA 4IVRA 2IF0A 3K0EA 2QQEA 1XWIA 3P26A 4LDJA 1GTVA 1N5IA 1MKYA 2XTZA 3CB4A 2IBMA 2R2AA 2CE7A 5KHOC 1GNPA 2ZETA 4NH0A 1GWNA 4XIGS 1Q21A 5KNCA 3BERA 3ZDQA 3I73A 2ODNA 2E87A 2ZRPA 1Z0JA 4OL0A 1B0UA 4YDHB 1TEVA 1VG8A 3TUZC 4DUGD 1P2VA 4CVNA 4PANA 4OI0A 2GK7A 4JYBA 5FPHA 3HWSA 2ZE5A 3G82C 4AKIA 3FWYA 1PUJA 3FVQA 5JWRA 5FTKA 4KI0A 1KY2A 1J8YF 4TSFA 3L2OB 1KDPA 3C8UA 4LBVA 4DCNA 1S3SA 3ZS9A 2WPDD 2J87A 2R8RA 3AUYA 4WW0A 1XX6A 4MRVA 2JGNA 2WTUA 4HB0A 1CEEA 4B74A 2BCGY 1NP6A 5FI1B 2W0SA 2QEQA 1XPUA 2G1KA 2J0UB 2WWFA 1FOEB 4W5JA 2MSCB 2NO6A 1LW7A 5FR2A 1J2JA 2AN9A 3UG7A 4HSEA 1BYIA 1GITA 4NPHA 2IWHA 1AK2A 5JCZA 4PXAA 3R7WB 1Z8FA 4RD2A 1KJWA 4C2UA 2JEOA 5AK0A 1GKUB 3GJ5A 1NG1A 3GLHB 2WIAA 4BGDA 2UKDA 3UMFA 4RFSA 4GNKA 2YJTD 3IPYA 2PLRA 4GOXA 2OXRA 2HCJB 4US1R 1JEEA 5BN3A 3NBZC 2IS6A 121PA 3KUCA 1CR0A 2F6RA 3TUJC 2OLJA 1WBBA 4JLPA 1X6VA 4B2IA 2I4IA 1SULA 3NHBA 2C8VA 2ZSFA 2OILA 3A1TA 1GILA 3VNVA 1BO6A 1IN8A 5FUWA 4BLSA 4YLGA 1AN0A 1XRJA 1AKYA 3LRPA 4LJ4A 2OM2A 1NBMD 4DXAA 3U7HB 3IQXA 1ZU4A 3GJ4A 3KXKA 4O3MA 2RGAA 1E99A 4M4SA 4LY6A 3TVTA 5E7IA 3D7MA 3FKQA 3B9QA 3PENA 4WXPA 2CVFA 3REFA 2J3EA 3IIKA 1WDTA 1U99A 3I72A 4MA4A 1WMSA 3HP1A 1JQJC 3VHXA 4AG5A 2QTVB 5ANRB 4ASUD 1YRBA 1A4RA 3B6EA 3LV8A 2GJAA 2PJRA 1QG2A 1ZCBA 1RKBA 5DI9A 2J45A 3G0HA 1DG1G 2W2XA 1SZPA 2FZ4A 4KFTA 5DN6A 3PITA 4EIWA 2WWYA 3CNOA 2IUSA 3KQNA 5KPDA 2QRZA 2KBFA 2Q9CA 3TSWA 3VFDA 1MO5A 1U98A 1IXZA 3SYKA 4JLBA 1IJFA 4FIDA 1ZW6A 4JJZA 3L0SA 2V8OA 3L0IB 4MUBA 4OQFA 4OK6A 2O8DA 1G19A 2HLDD 2QSYA 1F5NA 1TPZA 2DWOA 3NDPA 4LPKA 4M9SA 3UPUA 4L5BA 1TNDA 4RKFA 1NN0A 1U9IA 1LNZA 3B9PA 3CNLA 3DL0A 2O0JA 3A1WA 3SJCA 1QHYA 2R62A 2YVUA 3K09C 4LUCA 1OFUX 1FTNA 4EJSC 2EYQA 4GP6A 1W2GA 5E4FA 4A0GA 3WMEA 3Q85A 2Q9AA 1K5DA 5JJKA 1FX0B 3EX7C 2SHKA 2DWPA 4MKFA 3TK1A 1EFTA 4QGGA 3QOFA 2J5XA 3RNLA 4B33A 3GLFE 1AS3A 1CS4C 4OKSA 4RCZA 3RRYA 4BEJA 4LHXA 4PC3A 4BLRA 1VECA 2OFXA 4TLCA 1X8LA 4O25A 4L15A 2Z6VA 5JRJA 1HE1C 1S96A 1OV4A 4L9WA 1E2PA 2C9YA 3VMFA 1RC8A 3MG9A 4OQMA 4Q7KA 5KTYA 1OKKD 2ZRKA 5TMPA 4EFLA 2XSZA 3BFXA 2ZPTX 1X3SA 3B1YA 3RS3A 2ZJ5A 3ZS8A 2IF2A 4TL6A 2CEAA 3D8BA 3CH5A 2WMNB 3DHWC 4M1YA 4IW3B 1ZM2A 1Z22A 2ZRDA 1F3OA 3R8FA 4D0NA 3ZVMA 4JSYA 3KB1A 1JQLB 3LQQA 3O47A 3WHKA 1KO8A 1ZUHA 4PC7A 1OYYA 3ICQB 4NTZA 5CDFA 1RW4A 4BFVA 2FFHA 3PCRB 2GXAA 1U81A 3HYTA 2O8CB 3W8NA 8OHMA 1E1RD 1GAJA 4TTPA 3H2YA 1F2UB 2RHMA 2XB4A 4BWYA 4OHXA 4NCNA 1MR3F 1G7CA 1ZC3A 1E2QA 3AGPA 4LZZA 4BFWA 4DDVA 2RGNC 1P73A 1W36C 4HB2A 4A15A 1XJQA 2JJ8A 2W83A 1CR2A 2VO1A 1D9ZA 1OXVA 1M74A 4I81A 2CXXA 3K70C 3KJHA 1DOAA 1G5TA 1HUQA 1DS6A 2VH5R 1HQYE 3AEZA 4HAVA 1G4UR 2QP3A 3VX3A 4E03A 4B47A 4P4SA 2D7DA 1UBFA 4ZPXA 4DSTA 1E79D 1G21E 3CX7A 3OFND 4HDOB 4X8HA 3ADDA 1N0VC 3OAAA 4XSGA 5JI3E 1TUIA 2HT1A 2ZRFA 1YZLA 2ZREA 1ZM3A 2QMHA 3LQRA 1RYFA 1D5CA 1JNYA 1JR3E 5EXSA 3W3ZB 3QKTA 3VR3A 4X8LA 1CJVC 3CM0A 1EX6A 2YC2C 5DSZA 1FQJA 2DBYA 1RYHA 1WRBA 2ZSEA 3HJNA 2WOJA 3QVUA 2OBLA 1F48A 2Z0MA 4ZO4A 1NRJB 1UKEA 4EPTA 1ESMA 2GZHA 4BZPA 1IY0A 2V4ZA 2WKPA 2VQSA 5CB6A 1KK0A 1CR4A 5IK2D 1YQTA 1ELOA 2QTHA 2CL6X 4WVFA 2WVJA 1N6OA 1XEXB 3NEJA 3QE0A 4V0KA 2VHTA 1R0WA 1U0JA 2Q9BA 4DLZA 2V7QA 1R5OA 1E98A 1E94E 4CIDA 1YRAA 1IM2A 1GKYA 1XD2B 1R2QA 5FUXA 1QHHA 2G6BA 1IN4A 2ZRGA 3OE7A 2ZRMA 3NC0C 4YMSA 3Q3JB 1Z0KA 4KU4A 1C4OA 1XTIA 3SEAA 4P4UA 5AUQA 4Q4HB 4URYR 2FFQA 3NTUA 4JL8A 3SBEA 4TYNA 4B71A 4LGMA 1FUKA 3B2EA 3FFAA 4R2IA 3RANA 1G4AE 2VEDA 1NMYA 2VHCA 5DH9A 1LY1A 2WSSA 1OXUA 5H70A 2RGGA 3U6BA 1Q57A 3H1TA 1RPZA 2BBOA 5JI2E 1FW6A 3ZGXA 4CEHA 4Q1EA 4KVGA 1RE0A 4NHOA 4BLTA 2FH5B 2NO0A 3W6PA 2XTNA 1NN1A 4MYCA 1E1QD 1G3RA 2BMJA 1UJ2A 3ZQ6A 1CR1A 1RIFA 3AGQA 1G17A 3FMOB 4HAZA 3GMTA 3K53A 2O52A 3EPJA 1Z63A 3QXCA 4Z54A 4QJ5A 1Z6GA 2A5DA 1SXJC 4M9ZA 5D3MA 1HH4A 3F5FA 4NCKA 1A1VA 4MRNA 4QM7A 2DFNA 3EW9A 5KDDA 1RJ9B 2GXUA 4TLDA 3F3YA 4Q1DA 3VNUA 1C1YA 3QIAA 4DT1A 4LC0A 4Q7MB 3SFVA 3W3AA 4BE7B 4ITRC 1DG3A 1DVRA 3AP1A 4MYUA 2F1IA 3LX5A 2RGBA 4C9BA 2Q3HA 2VP4A 4UJ5A 1KI6A 821PA 4IOKA 3TR0A 2DFKB 4PPQA 5CM8B 2D62A 3AKDA 1G16A 2ZRBA 3SJBA 1MT0A 1RRFA 3W6OA 3DEFA 4M9QA 4GZLA 4CEIA 4MRSA 2G3YA 2GCOA 4OK5A 4U02A 2R6DA 2JJ1A 1W0KA 2HXSA 3K09A 5L3RA 4DEXA 5GJWC 4XWOA 3GJ6A 3BD9A 3C4JA 5DE3A 4EJSA 4QNMA 1NVVQ 3CLVA 5FR1A 1MABA 2IEYA 2VSOA 3QXXA 1O87A 3L0OA 2F43B 4KFSA 5JBQA 2P3SA 3UWKA 3LA6A 4GT1A 4PPNA 2QP4A 4BRUA 5K8IA 4QGAA 1HTWA 1P6XA 2BWJA 2I1VB 5AUNB 3QY0A 4DLTA 2RHDA 3D31A 2ONJA 2QZ4A 1CJKC 2YWEA 1AS2A 4US0R 1WF3A 2BEJA 2WWGA 3OIWA 1GUAA 3VHLB 1PUIA 2CLCX 2FG5A 5J4KA 2Q6TA 3S1AA 3EPLA 4LYAA 5JEEA 1FMJA 4CT4B 3P4XA 3C14C 4HLDA 4P4TA 1SVSA 2W2TA 4DCVA 4HLUC 4N3NA 2VHQA 5E95A 1R6BX 1VMAA 1XNJA 2V55B 4H1VA 3VQTA 4M1OA 4DVGA 4BLOA 3VKHA 3AP2A 3NDBB 3BIFA 3Q8XB 3MWKA 1M34E 2JCSA 4HUTA 2XZOA 3AB3A 4ARZA 2IYXA 5KSYA 5TB5A 5TV2A 3WRYC 2WWXA 2K5UA 3AQ4A 4DSUA 3DPUA 3RRMA 1U8YA 2ZRAA 1NY5A 1RVDA 2IYWA 3L82B 4ZI2A 2CNWD 2XNDA 4M1TA 5FL3A 1QVRA 4IOMA 3W6NA 3BORA 4G3XA 1UDWA 2VP0A 4KSCA 1G3QA 3A1SA 2MMCA 2ZRIA 3CR8A 3E70C 4H9GA 1S8FA 4BRWA 4LI0A 4TMXA 1JALA 1R5BA 2EVWX 2JDIA 3SS8A 2A5GA 4OQXA 3MJRA 4UXJA 1DO0A 4B3DA 1Q12A 1XBTA 4JMPA 2XXAA 2RGNA 2A9KA 1MOZA 2MSDB 4FMBB 3NEYA 4M0LA 3W8RA 1ZP6A 2O0HA 4PR0A 1KDRA 2VIIA 4A6XA 3AF4A 1I4DD 3B78A 1QDEA 1D2MA 1E0JA 3PUZA 3KFVA 5FOUA 4Z8XA 4EFMA 1PLJA 4D0LB 2ZEJA 1ZRHA 4NCHA 2REOA 1F2TA 2RB4A 5GJBA 4PQFA 2IUUA 4UNSA 2D7CA 4XSHA 1KMHA 4WXRA 1OF1A 3V00A 3EWAA 2DHRA 1E2LA 2JIZD 4S35A 4POAA 4TT3D 3ZZ0A 4EPVA 5JMTA 3RS4A 3TKLA 5KDOA 3A4NA 4XD7D 4TLAA 1ZIPA 3N2EA 2PX3A 2QGNA 3GLGB 4ZCIA 3RVBA 4ILEA 1GRRA 2OAQ1 4B3FX 2ZYWX 4CDGA 1MO6A 1HEIA 4NP6A 3H4MA 3RC3A 1DAKA 5HZHA 2VLIA 2RAPA 3M0EA 1G18A 4JSTA 4D26A 4EPWA 5DO9A 2QM8A 3TSOA 4JZKA 2Z5FA 4C0BA 3THXA 1TAGA 3BWDD 4AY2A 2N1BA 3ZZTA 2RGEA 4DZZA 1OPXA 4EQ6B 2CE2X 5AJXA 1AQUA 2OE2A 1G5RA 3KQLA 2O8FA 3N2IA 1OHHD 4F4CA 5B57C 2QSZA 3K0FB 4P31A 5C4GB 4CRWB 4B2PA 1R0YA 3ZIAD 4Q1CA 4RD1A 2HXYA 4QBIA 3B85A 2YOFA 2PMKA 4Z8YA 5H1YA 2GJKA 3GJ0A 1V5WA 2O8EB 3QKUA 3FE2A 1R8SA 2DB3A 2IWRA 3FPAA 3X1XA 4B6FA 4DRZA 3UATA 5JSZB 2VP6A 1S3GA 3RDPA 3RS5A 3CF6R 1CULC 4M8NE 2A78A 3TW4A 1I4LD 2QPAA 4NMMA 3I8SA 3IEVA 1KO1A 1NF3A 2YINC 3GLIB 3I62A 1GKIA 1O3YA 3RS0A 3E2IA 4JLVA 4TYPA 1RRPA 3M6AA 1TQDA 1OXXK 4FI3C 2WM9B 1IN7A 1DE0A 2YOHA 5DHFA 4OI1A 1EGAA 1LF0A 5B58C 1IXSB 1XXHE 2ZROA 3AKYA 1SXJA 4RY2A 4HI0E 4NDZA 3R20A 4GOKA 1UADA 2OCYC 2Z4SA 1OXTA 5KO2A 1ZC4A 3GFOA 1Q3HA 1S9HA 4IHQA 2LCFA 2FMXA 3AVPA 3CR7A 4TMKA 4TN1A 5IDVA 3U3MA 1EFRD 2G9NA 5FL7A 4CW7A 2QGZA 1P9WA 3CRVA 1W7AA 4QGHA 5CJPA 1P2UA 4QKQA 1BYUA 1AZTA 3GD7A 4C0HA 1W0JA 1MRNA 3WRXC 3RABA 5JEDA 3FTQA 2OXCA 3UG6A 4B2LA 3LLMA 2JLQA 1I4TD 2XITA 2GAAA 1N6RA 1RFLA 1S1MA 4JT4A 4NBSA 2IHYA 3PXGA 3T15A 2V3CC 3QBTA 1LTQA 3TE6A 3T5DA 4B73A 1G291 1FPMA 2FWRA 5BYJA 2OCPA 2PJZA 3KX2A 4DBLC 3K9LA 3AP3A 2QE7A 3IHLA 3NBYC 3SYLA 3MCAA 4HZUB 3HR8A 1N6KA 1E2GA 1YR6A 2ZRNA 4AKHA 5L3QA 1KSFX 4QOSA 1HY3A 2FGKA 2OSBA 1JPNA 1Y63A 2CBZA 3EIHA 3VR5A 3IUYA 1M7GA 3KJGA 3QKSB 4JVSB 1F6BA 1N3BA 3OEHA 3K9HA 4HLUA 4RJLA 4Z1MD 1YU9A 2F1JA 4G1UC 4O0MA 4PAMA 5AWFC 3QXJA 2J7PA 3SR0A 2O8BB 1X86B 4FW9A 3W5IA 2C96A 3RLFA 1OJLA 3CPHA 4OYHA 4V02A 3OIVA 5C4MA 3ICEA 2ZYUX 4JJKA 1T3HA 3KFXA 4Q7LA 1Z0DA 1JJVA 1T3SA 3EXAA 3VKWA 6Q21A 1C9KA 4G5SA 4U7DA 4IDPA 2YC4C 4QFMA 3QSYA 4AYXA 2J0UA 1W4BA 4W5WA 1NLFA 5SZHB 2IL1A 2EU8A 4X8OA 3THWB 1G8GA 2QNRA 4DLXA 3R9WA 1KI2A 2V6IA 1G3UA 5CK5A 1E2IA 5P21A 2GAOA 4GI7A 3A6PC 1RRGA 5AJZA 2YV5A 4RD6A 5LD2B 1EK0A 3R7WA 5J40A 3KTAB 3PIRA 3WNCA 3FOZA 2JLVA 3QG1A 5AJWA 4Z51A 2RH5A 1TUEA 2YKGA 3GLHA 2NOAA 1XCPA 5E7MA 3WP0A 1EESA 4KFRA 2GJ9A 2WBLC 3NVAA 4PC1A 1MV5A 3HR7A 3SFZA 2D2EA 4KBFA 3ETLA 3LH5A 1KSHA 1QHSA 1DEKA 3ND8A 4IDQA 5FTLA 2REBA 3JVUA 5EP4A 3ZVNA 2ZR0A 1NSTA 2J1LA 4WZBE 3ZH9B 4FCVA 4JT2A 5KUTA 3KKPA 2AKYA 4X8MA 3W9YA 4TLBA 2BBSA 4NYMR 4A4DA 5KPJA 1EWRA 1V43A 2C03A 3QPUA 4RKEA 5FTMA 3CWZA 2KE5A 1N6NA 3BB4A 3VU9B 2ZJOA 4V0NA 4A92A 1N0WA 3CH4B 5JECA 3OZXA 1TU4A 1SVOA 1ZYUA 3MFYA 5GVSA 2G77B 4MITA 1TF5A 4HB4A 3U3JA 1XU4A 3UWOA 1ZUNB 2QRNA 1TF7A 2A5YB 1XJCA 1LV7A 1ZMXA 2QMOA 2QAGB 1G64A 5CYPA 1DAGA 3KQHA 3SQXA 1N0UA 1K5GA 3LD9A 5HTKA 2BEKA 5F2EA 4AIIA 5IRCD 2ZUCA 2WIBA 4PSKA 5H68A 4A0FA 2ZTSA 1VYVA 1G3IA 2WJVA 4Q9IA 1E2KA 4RZUA 4L9SA 5JLJA 3TNFA 1E0KA 4YDSA 5GJCA 4KITB 3OEED 1Z28A 4UNPA 4JS0A 1SVWA 3GJXC 3A37A 2JLSA 4PO9A 5HKKA 4ZKEA 1VHLA 4LOAA 2ANCA 2P2LA 4A8JB 1EFUA 3RHFA 4PTLA 1SKYE 1IHUA 1Q0UA 1KI8A 2BVNA 1T0JB
chains in the Genus database with same CATH superfamily
1P2GA 4FYPA 4IJMA 3GHHA 1KYZA 5FOTA 3STHA 5GIOE 1COZA 1ODIA 3BRQA 4H08A 4A1FA 1CDOA 1GG5A 1CQJB 2J9FB 2QL9A 1SKUA 2BFMA 4U7HA 1G1AA 2YOGA 3PZRA 1E1CA 4AZ0A 5TS2A 1TT5B 4DMMA 4BNJA 2GS9A 1KJJA 5JRZA 3DDHA 1RQ7A 2JFBA 1ZO8A 1I1QB 2EHDA 2H65A 1RACA 2LZ0A 1V1MA 3P2YA 4KN5A 4PHCA 5K0EA 3VNQA 1KWGA 5I7OA 3TRDA 1MG0A 2VHYA 1Y81A 3OURA 1UC8A 1YGPA 2R7NA 2H0AA 3GEBA 5E0KB 3DVLA 5F21A 3TW6A 4AW9A 1IOZA 4B4UA 3EIQA 1L6IA 3OIYA 4CEJB 2FF5A 4LYYA 1XZQA 1IIRA 3U3OA 3IE0A 3PXAA 4GXNA 2J9YB 2FW8A 4RK0A 3GYGA 5EIOA 4HP8A 4K9DA 4N7JA 2HADA 3ZCUA 1YHNA 4EAQA 2XGJA 4AI6A 2CDRA 2R4TA 4Q21A 1S7GA 1UDCA 8ATCA 4UULA 4I1SA 3QVMA 1Y33E 4ADSG 3N9IA 3FOBA 2BKEA 2KM1A 2EXXA 3JQAB 1RHMA 5JJBA 2W48A 4OP3A 5EUBA 2DF8A 3T7SA 5KX5B 4ZZ1A 3SHWA 2CWDA 5JISA 3ABIA 3M4ZA 3CLKA 2XCIA 4L78A 1RLMA 1N0HA 2ZJZA 3ZY3A 3S28A 3EXIA 2P65A 1B1CA 3R3WA 4HJRA 3A70A 3ILYA 2CDNA 2JIOA 1BGWA 1EK5A 1P80A 1QE3A 1E3DA 5AW9A 3FMIA 2C29D 3II6X 1VLZA 2CEKA 1NZJA 2DPMA 3N3AC 4MKZA 1WLSA 1LUAA 3O94A 2Q2VA 1CQXA 1II8B 3K3PA 3MTBA 4HDCA 5L4LA 2NZ8A 2ZJ4A 3C6MA 3ILSA 3SXJA 2IOHA 1PLKA 4R7TA 5BNFA 4R2XA 5EPEA 2PRYA 3NP9A 1XVIA 3I01M 3QLEA 2FOIA 3AM5A 1MA3A 2ESRA 3L5KA 4II7A 4L5AA 1QQAA 3NB0A 1IFXA 3L4KA 1JJIA 3VZSA 2O8CA 1YACA 4JA0A 5LBUA 4AJ2A 1M1NA 1PRYA 1P0FA 2BM0A 3WE7A 3BE4A 5JH7F 5IW8A 3CT4A 3CRW1 2FPKA 3FDZB 4Q9JA 3IR5A 5EKXA 3S99A 1BA2A 4BO0A 3HR4A 1M2EA 4W6ZA 4WFQA 2QENA 1ZR2A 3VUFA 1G9TA 4E3WA 5MN6A 2AOTB 3ZW7A 1QFMA 1TMKA 4P0TA 4RSGA 1ZGGA 5B37A 2QB5A 4UCFA 4XE5A 3KKKA 3NR2A 3QM1A 4LQ4A 4NXMB 1DQRA 1U8UA 2DPGA 1X42A 1M1UA 2PT5A 4G0OA 2QQ0A 2Z43A 4LJ8A 3SSMA 3UMSA 4CR6A 2JGAA 2WD7A 5E6UB 1MDBA 4KQWA 2GXAA 3P9PA 1XV5A 4LE2A 1YRQA 1YZYA 3Q5EA 1JV2B 3RS2A 2QD4A 4LSZA 2UVPB 1CF2O 5EJIA 4QUBA 3BL5A 3WWCA 1P0PA 6LDHA 3C5WP 5A0FA 4CUKA 1D9XA 1YOVB 1HURA 1SHUX 1JMVA 2Z95A 3JQBC 1NBMA 2CL7X 2QRMA 1JIVA 5ARBA 3FOFC 2WM8A 4MIEA 4BVEA 2C3PA 221PA 3JQGA 3HA3A 2AX4A 3KXLA 3PCTA 2ZRCA 1UPAA 4K6GA 1JB1A 1A27A 4CQMA 4CMGA 3EUAA 4P93A 3TX2A 1P7ZA 3GEIA 1W581 2OORC 5A5EA 2ZWAA 5DV9A 3SDSA 4JGBA 5C8YB 4OX9Y 2X3UA 3W8FA 4BL5A 1N5DA 2GN1A 1ID1A 1GTMA 1ODTC 4WK4B 2M1ZA 5L51A 4XGRA 1V7QA 1IJBA 1T5OA 3BREA 2BMAA 2W6ID 4HPJB 1OH5A 3CF4G 2YV2A 3PFGA 4G4SO 3I45A 4TQ9A 3FBTA 4MV1A 1P6UA 2YWJA 1AN9A 1JAIA 3GBPA 4RS3A 2JCBA 1DLJA 4F3YA 1U5BA 1IATA 2ECFA 3B82A 4JI4B 4F2HA 5J4VA 4WGFA 3RRZA 2UZIR 3QMMA 5IZCA 5BYBA 1D2NA 1XD2A 1QYRA 2XB8A 3DT6A 5TGTA 1VSQA 3UANA 3GN2A 2QRKA 2IU4A 4P3XA 3G8DA 4ZREA 1CJUC 3TLJA 4FGKA 5HUQA 5IJ9B 3ZYCA 4FGJA 5M04A 1N32B 2AN5A 5EJ2A 1ECCA 1YL6A 2F1RA 4ZEWA 5CEEA 4QD3A 6AT1A 3H0KA 1N36B 2UZAA 1G7TA 4V0MA 4MOWA 4YI5A 4PQGA 3KETA 1XEWX 4Q4HA 1JVBA 2F3TA 3TEFA 4MEJA 3ZEIA 1DEOA 2GAJA 4PZEA 5CVVA 5DHUA 5ALKA 3L84A 3JWIA 3MD9A 5IHPA 3B6IA 1QX4A 3CY6A 4AJLA 1P5HA 1M75A 3AL0C 4V2UA 2GZDA 4ZMBA 3WGVA 7REQA 1D03A 3EG5A 4MDHA 5F12A 3SQNA 5GV7A 2V1UA 2C9ZA 1YKSA 2VBCA 3PVCA 4MLDA 2C1ZA 2VS1A 4Y2PA 3LBIA 1Y98A 4GL4A 3M5DA 1ZITA 2P4HX 3OIUA 1UBRS 1E32A 4Q66C 4ALKA 1KAQA 2VBIA 2F9FA 4IX1A 1R64A 3MRVA 4ZOEA 4X1IB 1E89A 3OF5A 1AGNA 3SNHA 3K32A 2IQ5A 4DS3A 2QJOA 4FWIB 1QIHA 4O4JF 2OAP1 2QY9A 4NHEA 4PGMA 4I14A 3CLHA 2I6QA 3IIIA 5DWQA 5KTPA 1MOPA 2BL4A 5AVZA 1QO0D 5FBKA 5K6AA 5DI3B 5F98A 1L5WA 1GPH1 3K31A 4I4IA 4YMWA 3RTCA 4HNHA 1L4LA 1TM7E 2C2KA 3H5AA 3ZHYA 4CLRB 2AHOA 3PNBA 1V3VA 2J33A 5IXYA 3KSAC 3M3PA 3NBFA 4IDGA 2NVWA 4F5DA 1LI7A 3IP5A 4DV4B 1R0SA 4Z0NA 2OAEA 4KO4S 1RLTA 2ANBA 4JXKA 3JQ8A 1W34A 4O1MA 1EYZA 3B1VA 3EULA 1TCVA 2J8ZA 1KAOA 3PI7A 4QNRA 4EF6A 3VDNB 2C07A 1MPXA 2P67A 4KQGA 4OHZA 4HUJA 3K9CA 4RM3A 6REQB 1IRXA 1SB8A 2JFNA 2QVXX 1NVWQ 3NHLA 4Q3LA 4Y2UA 3THRA 1QOPB 4DJDC 4V1CA 4ARIA 1PZGA 1JFFB 1OFIA 1R0RE 5F3WB 2PUGA 3QEBZ 3ZLJA 3BMOA 3QWHA 4XVCA 1ISJA 3O26A 3OZUA 1LSOA 2H2GA 4YRLA 5TT0A 4CMEC 1EX9A 4J9UE 2QNIA 3U39A 1CWUA 4YRSA 1I24A 1Y4UA 4QXAA 4H16A 1NXXA 2A88A 3DYVA 4C7OB 1SUEA 3DHEA 2GBLA 2IEZA 3EDOA 3LY9A 4PLTA 1HNNA 3F6CA 1TO1E 2K2QB 4HS9A 4GWKA 4LRQA 5EIBC 4IJUA 3LY7A 1KZ7B 5LYYA 1UINA 5DJ5A 4UXIA 2TS1A 2VF8A 2FSIA 1A4IA 2HCRA 2X9LA 4HGOA 3RSFA 1XELA 1UOPA 2P6PA 2QWXA 1O0BA 4PAOA 2WYVA 1PEYA 4MWTA 4W7IA 4PXYA 1SBTA 1Z0IA 2Y67A 3PQ8A 1GCAA 4XASA 4AXXA 3E22B 3T8YA 3MD0A 1CK4A 1UXHA 3U5ZB 2FXVA 3P2OA 2HQBA 4I55F 4E5UA 3BK2A 3V32A 2NLOA 1E79A 3PEVA 2PWBA 4OBWA 5AOAA 3RS8A 4TVSA 1GAXA 1GNRA 2PH5A 1YMQA 5LOVA 1PR0A 4PZZA 3AFIA 1U11A 3LWZA 2IU0A 1Q83A 2H2DA 2ZIUB 3PX7A 7REQB 1IU9A 2FR1A 1IN5A 1BH6A 1RNLA 3JCZA 4FKBA 4OIMA 2EW8A 4KE7A 4XTRA 1B74A 4F9FA 3LVQE 4YONB 5I3CA 2FJUA 3DOFA 1BSVA 1YZ3A 3I39X 3NH9A 4G25A 3LVFO 1EVJA 4G41A 3O83A 421PA 3A4VA 1DIRA 1AO3A 3QU4A 4K2HA 2PV7A 1NXQA 5CBKA 1P74A 2CVHA 4JFRA 1BMFD 3QOYA 4XM1A 3PX2A 4AL4A 4RLFA 3F97A 4RPGA 4CR8A 4EKEA 5DNYB 2IT1A 4RCYA 1KERA 4WUTA 1GGNA 1TAQA 3T9FA 1HETA 3S1LA 4EB3A 3PNYA 1L5YA 2PZLA 3MGCA 4KYVA 4U00A 5DTJA 5IN5A 4BC1A 2NZJA 4HGQA 2G9QA 5LD2C 1X39A 2HU7A 3K0AB 1UKVY 4ZHQF 1UDAA 1T0PA 3FUCA 2ETVA 4EABA 2JLBA 4K40A 4AKSA 3G0CA 2CHVA 5HJ2A 4F4DA 5HZKA 3CRRA 4HL6A 3V4OA 1AM4D 2JFPA 3K4PA 4QJ4A 2EZUA 4MP8A 3NC4A 4PYKA 1OQAA 3KT8A 1M3SA 4RHXA 3GPLA 2G1JA 2H08A 1TLTA 3PEUA 2PX2A 1L5VA 3HDGA 4I5EA 4P08A 5F51A 5KREA 4XGIA 4G5XA 4KAAA 4ME6A 5FPTA 4ZYUA 4ZVVA 1DJNA 2GKSA 3V33A 2VC2B 3F6EX 1JI0A 1JDTA 1F0NA 2C3OA 4OI4A 3A2MA 3R40A 3BQNB 4M1ZA 1KR5A 5JROA 4DBLE 1C7QA 1JDZA 3E0QA 3LW8A 4ND8B 5A4KA 1CUVA 5TF4A 3GLGA 4QLAA 3L0PA 5KNBD 3B60A 2EZ8A 3SFTA 3ZHSA 3T3MB 1MB4A 4NZOA 4Q4AB 3D2LA 3EGDA 3I5UA 3K72B 1T9BA 2MWMA 3F9RA 3P5BA 3Q5DA 4JITA 5G3ZA 1JLLB 1K7FB 4CIYA 1TDJA 1Y9DA 2D13A 2QAGC 5TGDA 4E70A 2R8XA 3L1HA 2A0FA 2GN0A 2IYEA 2ZVPX 1P1KA 1V8OA 1NY6A 2W98A 3PYMA 1ZN2A 1J70A 3TZQA 4AF6A 1GY8A 1NFFA 2P9GA 1K7CA 1XZIA 2PIAA 4EHFA 3IE1A 1P0IA 1LDBA 2CZGA 5I51A 2JBAB 5G1PA 4UM9D 3WXBA 2IZZA 3R9IA 3Q6MA 3J81A 2CK3A 2I99A 3L1JA 2QVLA 4L8YA 1RQNA 4P33A 4EDHA 4YP0A 5SZJA 3QV1A 5AR1A 3KUKA 3QE9Y 3N2KB 4RK6A 4X3CA 3MJTA 4B8YA 2QVYX 3ID6C 3L9WA 4G8CA 5CDFE 2QTTA 1B8UA 5A6SA 3HK2A 5KHAA 3TMKA 4YJFA 3U4GA 4MUJA 2MMGA 4Z5XA 1QIEA 1LPAB 1SD2A 2BM9A 2WWIA 4ZTBA 1RABA 2CN1A 3DE1X 3EMBA 4KQHA 3BX1A 3MQFA 4NARA 4S2EA 4PSAA 2P91A 4UXHA 3QUBA 1E2DA 5JSZA 4B7XA 2A3RA 2WWHA 1A77A 2W8BA 4UVIA 2XE4A 4DR4B 1ZLXA 5JS2A 4IDNA 1WDMA 2GYVA 3USZA 4GSYA 5FNVB 4BLUA 1P9NA 2J31A 1AUPA 3SVZA 4JBYA 1X7HA 4X20A 2C2YA 4G6ZA 5KTTA 3ZWXA 1HM5A 2F7SA 5EHZA 2Q5FA 1ODSA 5I4CA 4R0VA 2R6HA 3BK1A 5BN5B 4EG7A 4IDBA 1BGXT 1R00A 1IH8A 4RJKA 4BNTA 5BVHA 1T9CA 1ZA1A 2OQVA 4CKCB 1MVNA 3FHCB 1MF7A 2GILA 2AOXA 1OA0A 1VFNA 1ZOLA 4AG6A 3GDFA 4B17A 1XO1A 3ZCTA 5EXXA 2HO4A 4FTWA 1KO4A 4MCJA 5JXWA 4ZVUA 4D6XA 3WGNA 2DEUA 2AFRA 1LNSA 4UQOA 1Q1ZA 2OHXA 2AD1A 3UQYS 4DANA 2B98A 1QH8A 4RU1A 1NSFA 3S40A 1A04A 2OP1A 1E63A 5FUYA 4CF6A 1Z47A 5E6RA 4IDDA 7GPBA 3NKVA 3INNA 4IMJB 4C14A 4DV6B 3LCRA 3X1KA 1W2WB 1FDIA 1Z56C 4XQ0A 3T12A 1GPMA 1OTXA 4Q6BA 4X1KB 1DBVO 2Z5GA 4CMJA 1XDBA 4L3VA 1PJTA 2AWNA 2ZKIA 2OUIA 2INGX 2CV0A 4RY0A 4IYJA 2IXGA 3HB9A 4ZVNA 4BNWA 5B4TA 1B76A 3O9VA 4UAGA 3PC8A 3JPYA 4L3OA 4JVMA 3M1LA 3N2NA 4NBTA 5T4FA 3EPPA 2R1ZA 2OGWA 2XUHA 3LM8A 4JLOA 3FTCA 2FKNA 2AQ8A 3KYDB 4H7PA 4LMAA 4WLEA 5F52A 4C04A 1GG8A 3ORYA 1VSVA 1U3TA 4YMVA 3E1SA 3Q0TA 1E7MA 2X8AA 3MWLA 2J41A 3W3AH 4AG3A 5JFGA 5JANA 1D2EA 3FWPA 4GGMX 3ROXA 2B1GA 2D4HA 1OCEA 1ZGHA 2C97A 3KXIA 3DVRX 3FHOA 3OZDA 4OHRA 1PEDA 2EGUA 3KC2A 2DUJA 4ZQGA 2OYCA 1FP4A 1YL7A 2B4TO 3IA7A 3QXSA 3N2GA 1SG0A 4J0QA 3OD1A 4HVCA 5JBNA 4J1NA 1Z7YA 3ZHXA 5JS7A 2FKAA 3GRUA 3LWDA 1TIKA 1QUEA 1GPDG 2W71A 2JHPA 1T91A 3L6OO 4F8JA 1NZFA 1HT2E 2NZ2A 1E4VA 1XMIA 2NO1A 2PX8A 2QG4A 3R4VA 4XYLA 1F8GA 3ENKA 3N05A 3CZQA 5EHXA 1UM8A 2ZS9A 3PTZA 4RVCA 3ZGZA 1N6LA 3JASA 4JI1B 2PMWB 2FEAA 3HV2A 2H85A 2C42A 2REXB 3FPSA 3QPCA 2YIVX 3ROMA 2EBUA 1UR5A 1VHQA 2FSVA 2GO7A 3AHEA 3B3JA 2ODEA 1L7PA 3BRSA 2VP9A 4XUEA 1EDEA 1JJFA 3C0KA 3F3MA 4XB6B 2NV2B 4PR3A 3FA2A 3GJ8A 4DUPA 1T8YA 3QJ5A 1ECFA 4QU0A 3GT0A 4S12A 1MX9A 2BGKA 3AEUB 3VU1A 2LV8A 5C8YF 5J4YA 1CUUA 4ZARA 3ZG6A 1DPFA 2X3YA 4YUWA 3M1IA 3TIGA 1ISPA 1YRWA 4Z86A 1GFIA 2CBGA 3W5BA 1Z8NA 3GJ7A 1U28A 1KKLA 2Q41A 3AJEA 3THWA 4LJKA 4MV7A 4M0UA 4O08A 1Q7EA 4JHLA 5HF8A 3QF7A 2PGAA 2P4UA 1YJ5A 3AT1A 3PD7A 5DIFA 2OR3A 3LKBA 2EFYA 4MA0A 4LYJA 4E46A 4YUXA 5L3SA 1RQPA 3FPGA 3KTAA 5GP1A 5HUJA 5A3QA 2OBNA 1QBGA 4HRYA 4B3IA 2VEOA 1O6CA 4HUQB 1RJGA 5DBFA 3U44B 3JX9A 3ZIAA 2PFSA 4L6AA 4WZAE 2QTZA 4FC7A 2JFFA 2R8BA 4ISBA 4U7JA 1G20E 2B8WA 8MHTA 4D9MA 1SH7A 1Z4QA 2RGYA 3HKDA 5AM2A 3PHCA 3EIXA 4UUQA 2D5AA 3DOJA 2H1OA 4JYPA 3KKOA 3O8QA 5CXUA 3SCZA 1N34B 4KACA 1FVHA 3D8HA 3THSA 5LWQA 3KQQA 2DPHA 1G6HA 3PDWA 5HX7A 3QKWA 4QBHA 2VCYA 1DKQA 1E7SA 1GT91 1PVVA 4EECA 4CCSA 4L28A 4MW5A 4U63A 5J4LA 3RT1A 3TUIC 4CFSA 3LK7A 3F73A 4KR3A 1URPA 2Y1GA 4YLEA 1K06A 3EVNA 3ESRA 1RIIA 4R0MA 2B92A 4NPCA 2Q1XA 2QROA 1B23P 2P27A 4Q01A 4I4LA 3RBZA 1RKQA 1Z5PA 1DC7A 2B1QA 3HDQA 1LJUA 3CNQS 1G5IA 3N6VA 4HZGA 4BN0A 5CCEA 5DN6D 3FR8A 1QRTA 3HVJA 1FTWA 1UEIA 1G8HA 2KSQA 5A9RA 1SCJA 2JKYA 5AKGA 2EOAA 1BKDR 1EIZA 3ISVA 3DM5A 4KN9S 1CUCA 5M5BA 3PPYA 4AC9A 3LTNC 3UXHA 3EGIA 3MBIA 1EBBA 1XTKA 4UTNA 3FIUA 4DLWA 1GZUA 2ZUDA 4UEJA 4X93A 1M8KA 1CRQA 2WIKA 5FWXB 1KKMA 2GCNA 2ZSUA 1FNMA 4BZQA 1EFRA 1XLTA 4PAGA 3U4IA 1KTVA 1HGXA 1VCOA 3KELA 1DC4A 3OVMA 5C7IO 4MS3B 4MVJG 2H1HA 3K92A 3WYFA 3G88A 5KTRA 1TZBA 4RACA 3EASA 2NM0A 4N0MA 4A8JA 1C9JA 1EWYA 3D1LA 1UL1X 2BFDB 2V4UA 4WGGA 3CXUA 3PV0A 4WOKA 4K46A 2VA8A 4YB8A 4LRXA 5DNAA 5JWOA 2Z3WA 4OCZA 1Z0SA 4NAVA 3EHEA 1SQFA 2AS0A 3P2IA 1OWNA 4N6GA 3U3XA 3G79A 4EOGA 1XDGA 4RL6A 1FP2A 3GWGA 3P0HA 4TMTA 1ZFNA 3GW8A 2IV7A 4FINA 4A8PA 1T8SA 4PYRA 5JAMA 2ILTA 1HQCA 1YZQA 4NS4A 1T13A 3W8EA 3WSVA 2AQHA 4Z0HO 2RJNA 4FYMA 4GYWA 1E6CA 1T8WA 2X1HA 4B2YA 4DCJA 1NX9A 2ST1A 5CXXA 2YXDA 3EDRA 3PQCA 1NDQA 3GRRA 1UFKA 1IQRA 2NPOA 3SBDA 1TQ4A 4Y7DA 1IHXA 4HDMA 1CIPA 3AESB 2YN4A 3O92A 5KQRA 4B84A 1S2IA 4HK4A 3V9PA 2YNMC 3T5TA 2P77A 1M0TA 4XWWA 1SCAA 3PRHA 1UQTA 1U04A 2P2ZA 2C57A 2H57A 1I3NA 3BFKA 4J7AA 3ICCA 1W35A 4PX9A 2NO9A 2XSZD 4I50A 4W7HA 2ORYA 4CMCA 5GONB 4FWBA 3QQ5A 3H65A 2GF0A 1K89A 3H9EO 4KWTA 1SFRA 4C05A 1Q1AA 5EZSA 4XWKA 2ZI6A 3LL4A 1FL9A 2V98A 1M1YE 3NRJA 4UUNA 4ZQHA 5AJVB 4LY0A 2WJ4A 3F8WA 4MVJF 1EB9A 1IUOA 4BO9A 3N70A 2WY2D 1K97A 5FO0A 3UO8B 2FFJA 1C9DB 2PU5A 4CR7A 1W75A 2H5EA 1PZEA 2KB0A 1NL3A 4FHZA 4JSRA 1OX6A 4U5XA 3SEFA 4F91B 4QAJA 3OQOA 3JD4A 3WTBA 2GHIA 4ENSA 4RD3A 3K1JA 2WJPA 2J67A 4FQ5A 3WLFA 2H52A 1U2ZA 5MN5A 1KGDA 5DP2A 1GCUA 1HOTA 4IRMA 3TWOA 1SPBS 4OQQA 4H60A 2P4QA 3KPVA 4CLOA 5IAGA 1NXSA 5BN3B 2QZZA 2NNWB 3GOQA 3HDTA 3L07A 3T4PA 6YASA 4URFA 2P1DA 4EMTA 1L5OA 4KE9A 4CQJA 5IVKA 1FFXB 3SX4A 4QHTA 4A2PA 3CS3A 2E1RA 1LC0A 3N7TA 3NAZA 6PFKA 4IQFA 5F9FA 4XEUA 3R3VA 2QX7A 4RMIA 3W7BA 3WB0A 4LHZA 1QLWA 1ZM4A 2HN9A 1LF5A 1NQVA 2Q0SA 2ZI4A 4BVFA 1RZVA 3P9IA 1FDUA 4WACA 2F3PA 2BGUA 3G9XA 1FFGA 1ZD4A 2ZITA 3DNPA 5EE3A 1OREA 5REQB 1NI3A 1PZMA 1XALA 1VSUA 5AOBA 1Y7HA 1A2KC 1KA9H 2GZAA 3H9QA 2GTHA 3GGGA 1M2OA 3MUNA 4TVBA 3DZDA 4CMKA 5BWNA 1DX6A 3S2ZA 1M34A 4FLMA 3R77A 2ATIA 4W9RA 5HCIA 1K9SA 2GEFA 5K3DA 1WA5A 3FLBA 3M4JA 2AGVA 3ZJYA 5C9ZA 5CH5A 4B6PA 3QUCA 1G9XA 1E6EA 3PXBA 3FPEA 2AKEA 4XWAA 5DHTA 5LKAA 3I28A 3KAPA 1N2ZA 1O6BA 4KKXB 5BT8A 5K2OA 4Y9TA 5ALQA 1OLXA 2JD1A 1MTOA 3ZX5A 4LE0A 3ILVA 2UUAB 1QIJA 2JFZA 2RI0A 4AY3A 4YJ2A 2OO3A 4JDUA 4ZVOA 1ZH0A 4DJAA 2V7GA 4C08A 5DBIA 4LYFA 2I29A 4IJ5A 4EG4A 5EPUA 3V55A 5JYDA 3DLHA 2V0GA 2TECE 3VV3A 2OCBA 1FTYA 1M8JA 3G0IA 3KG2A 4X6YA 2GZMA 1UC5B 1CY7A 4A2QA 3OE7D 1ORHA 4HGZA 3F1LA 4RA9A 3KKMA 1ESZA 3CPEA 4BMVA 4N3BA 1USVA 3HDHA 5DU2A 1JQ3A 4RNDB 1EFAA 1U1DA 2I4RA 2HCBA 2WZCA 1BX1A 1Q3TA 2JI8A 3MJVA 2GFHA 4KPUB 4DF3A 3PE3A 4D4IA 1L4MA 2IH2A 4OHPA 2WSSD 4I6JA 4ALLA 5I9BA 4BFZA 1HORA 3FM9A 3FMFA 1XWFA 4AO8A 3IIJA 2FYTA 3ORQA 3NBKA 1OTYA 1HK7A 2QG6A 4IDEA 3RRNA 3OQNA 4NOMA 3K96A 2BSXA 2YJ5A 3H1AA 3LC0A 4NENB 2WOOA 3DB2A 4CL3A 3YASA 4YWJA 5BRJA 4P7GA 1XZHA 2I3BA 2WIGA 5AKLA 5BQXA 1NASA 2Q6LA 4FKZA 1X94A 2FX2A 3HCDA 4FGWA 4GOND 4UU0A 3UB3A 1Y1TA 3V8MA 1T3LA 1XVTA 2CXRA 2IXFA 2WFLB 3F6PA 4IBOA 3HJBA 2FDCA 4AZTA 4WESB 5F73A 1O54A 3T5BA 2WV7A 1CSEE 3IO5A 1Q2UA 4IFEA 3CX8A 4JAVC 1QH0A 2Z30A 3ZGOA 5J2UA 4N7MA 2BFFB 3OM8A 1R4MB 3TXYA 3OCXA 5ITZB 2K2WA 3IAHA 3HM2A 3X1WA 4J75A 1WW3A 1SHZA 4Y7CA 1ESNA 4M22A 1ULTA 1Y3HA 2P3LA 1AY0A 2PQ0A 3DGEC 2ASEA 1FXWA 2C4NA 5G0VA 1J0EA 1PQ4A 1Q0HA 3H11B 2G0NA 1VBKA 3ESQA 4BRZA 3HMKA 4KDRA 2ZCUA 2R44A 5F1OA 1DIOB 2IX3A 3PR1A 5ICEA 2XZLA 4CKBB 2XBUA 3UCEA 3CNBA 2GLTA 3GEHA 1MJGM 4RKRA 5ECWA 4GPD1 2C8KA 1V25A 3IOYA 3BMNB 4KQ9A 5HE9A 5E6SB 3ITEA 2X8JB 2XQFA 4P84A 3WQHA 4O5OA 2PE5A 1KU0A 1PT6A 4MGIR 3KKNA 4B6OA 2ZVQX 3TNYA 1SB9A 2WU1A 1W0KD 2CL0X 3HQ4O 5DCYA 1VKOA 4BJ1A 1YZGA 3U6KA 1NQAO 4JL6A 3TW8A 3ZUPA 4ND1A 2WAYA 3WLAA 3G68A 2ATCA 4PRLA 1T1SA 3NXSA 1SVKA 3E23A 3IILA 3QXHA 4R5HA 1EVKA 1FYDA 3KV3O 1PZNA 2A1TR 3VYWA 1B43A 3LWNA 3T1OA 4NR0A 3D5EA 3HE3A 4YCAA 2NO4A 4U7TB 5DNWA 3SI7A 5JOQA 3W9BA 2JAOA 3B36A 2NTVA 4HRVA 1X1BA 1YHZA 2ONCA 1D8AA 3STWA 5LIPA 4F92B 3WGTA 2OGTA 4CLHA 4JXZA 2E5LB 3VMMA 4ABYA 4P36A 4J6FA 3QVLA 3FVTA 2B4YA 3LIPA 4IFBA 4YJGA 3SX0A 2HPZA 4E2FA 2DBQA 1H3NA 2IY9A 4L7QA 3FTPA 3R0ZA 2L69A 4Q37A 1RMTA 3MSXA 1RHRA 4HLNA 1OVGA 4CKWB 2JGDA 5EJ6A 2ZI3A 2B83A 4R71A 4WOCA 3UWPA 1EX7A 4YAGA 2IIQA 2ZJYA 1SKAA 4JNCA 3CUTA 2PNJA 5IABA 2J0SA 1YXMA 1UCFA 1UJNA 2BJVA 1W8IA 3DKPA 1USUA 2KYRA 2VKTA 3ZQJA 1OKKA 4AECA 2XTMA 2ZRJA 2WUFA 2WR8A 4G84A 2NMVA 1ZVQA 4V0OA 5FBHA 3CZ9A 3G2QA 1RC0A 4MUNA 2COEA 1QRRA 4N40A 3ZXIA 3A1UA 3DMTA 1SU4A 3AF0A 5AO9A 3TGWA 4AM8A 3C97A 1X1CA 3EXFA 2XOEA 5IJZA 1LEHA 1NR1A 4TMZA 3I61A 2HYIC 1OIVA 3E27A 1HPLA 4GVPA 2J6HA 1ZONA 5HQJA 4O8CA 2GEDA 3WKBA 1T4CB 1Y8QB 4JL5A 1EDOA 5BV2P 4L27A 5I8ZA 1FTSA 4MGEA 5E9JA 5A2GA 2Y77A 2PWYA 2JLRA 1AKQA 1EFDN 1OXMA 4EFDA 1VZ2A 4ZIRA 4YCMA 1M76A 2EFHB 1E7WA 1UEJA 2BJHA 4MJLA 4EHAA 5B1EA 3WFJA 4QBKA 1WZ2A 3MEQA 1ATZA 2DFTA 3TB6A 3SFZA 3OESA 2HAEA 3LYUA 1BKYA 4KQ6A 2IYZA 3NOXA 3CX6A 2ZB7A 3WLLA 3G5AA 5GV8A 3L77A 1N8KA 1ARZA 3KIPA 3ZD7A 2IUYA 4AYWA 3FETA 1DL5A 1MDFA 1Z0UA 2PMFA 2BONA 3WC4A 2R7KA 3K1ZA 4EUHA 4JR2A 1J1IA 2H07A 1LK7A 3GCGA 3O8RA 1W30A 4GSLA 3T52A 4UCWA 4Z2YA 4UNRA 3BCHA 1N57A 4DMKA 2HWYA 3GDOA 1RCTE 3I9NA 2NUPA 3K2EA 1QYIA 3O75A 1AIPA 4GMKA 4MUHA 4NU0A 1II0A 3PDCA 2NPFA 3UJ8A 3G7NA 4UARA 2XODA 3UENA 1NV9A 2J48A 1J20A 4KYIB 1TF2A 1VMDA 2GPTA 3JW8A 3V7FA 4BQOA 2FPOA 2RKWA 3G8BA 1K7YA 3KQSA 2G5GX 4MQEB 2NXCA 4UNIA 2LKCA 3ZE7A 5BV1A 4JVNA 5SY4A 2JANA 3I9FA 4M9XA 3OZIA 2HZ7A 1Z6AA 3ENVA 4LJLA 1ZJYA 2X0NA 1W44A 4LTNA 3UHAA 5A4FS 1QP8A 2VTKA 4LHVA 5IN4A 3KZ1E 3QIVA 3BWBA 1JE1A 2AJCA 5IK2A 4B3BA 4KUGA 1DX4A 1PBTA 1KS9A 1U8FO 1V16B 3CLTD 3TL2A 1RC1A 1RQGA 1CY6A 1ZM7A 2B5OA 4JJAA 4U7GA 4X3OA 2PD3A 4MUKA 5C81A 5C80A 2ZQYA 3MWDB 2NXNA 3MOSA 3AMVA 1GRCA 1YONA 1F9EA 1TKCA 3DTVD 3IKJA 1CF9A 5BUCA 1LWNA 1HDGO 4KO8A 1QO7A 2DECA 1WPXA 2EWWA 5LP6B 3OIGA 4J49A 3LC7O 3G2HA 2FUG1 1THGA 4KZKA 5LQJA 2PS9A 2WYWA 4TM8A 4GBJA 1QCYA 3NWJA 2ISSD 3B1FA 2P6NA 3OZWA 4K8RB 2IW3A 1YR1A 1IQPA 3F5SA 4XIJA 3W1VA 1B8VA 4O4IA 1G0NA 5EN4A 1MRSA 1OGYA 1TPYA 3A0UA 4OJKA 1DRWA 5H3HA 4D82A 1KI6B 1ZN9A 5A3VA 3NAGA 2C61A 4UCXA 4WNYA 4K9LA 1PS8A 2A35A 1LSUA 2O8VA 1GM5A 1E2NA 4QPDA 3MTDA 3GUVA 2FEOA 3MWEA 5CNMA 4D9BA 3WZLA 2GCOB 1YR2A 3EPKA 3KQPA 1QGUA 3OQMA 4EJSB 1P0MA 4O2AA 2QYSA 1GPNA 3EWNA 4OJQA 4CKEB 3HFJA 2A0WA 2FLWA 3GQBA 3LUPA 3QELB 3BZWA 2P40A 3HXQA 3WGJA 4WZBA 3GGDA 2Z83A 4HD8A 4BZZA 1PGNA 4ZRMA 1XQXA 2HU2A 4OPMA 2C3MA 4HAUA 1NN5A 3EJ6A 4L0MA 1OWOA 1J9ZA 1XF9A 2BGTA 2LUOA 4F9EA 2GRJA 2PCJA 3AO0B 2GPAA 4G0XA 4GZMA 5CB8A 1TXGA 1SXJD 3T34A 1W94A 4R1LA 2XMSA 3U3RA 5FNZA 3V8RA 2MYUA 3ZCVA 1SBIA 3AYXB 4PZDA 5BPHA 3LC1O 4I66A 1RI4A 1RZ3A 2HHLA 5LXTF 3WLMA 2Z9CA 5I7EA 4GIBA 3LNCA 1EKXA 2HT6A 3C98A 1MH9A 1VCMA 4XVRA 2JLXA 5GONF 2ZB3A 2NSHA 4D80A 3RKRA 4Z99A 5EYPA 4F1KA 2R6ZA 1T4BA 2Q0QA 4FHGA 4HN4B 2W4MA 3LUKA 4XXHA 2XMBA 4MW6A 4NMLA 2BFBA 3ELWA 3G0DA 4EVRA 2WF8A 1KEVA 1S3FA 1R88A 3RYTC 1JAZA 4LXUA 1GUYA 1BEZA 2XMRA 2FMUA 2ZBFA 2NQ8A 3KUXA 3DMRA 2A2ZA 3DZCA 5BY2A 1KEEB 1OI2A 4KGXA 1Q1QA 4R05A 4RV4A 2EBHX 1QHIA 1FFYA 3M3HA 4QARA 3BOSA 3ZDZB 1EVQA 2PH1A 1A9RA 4JU9A 4QOIA 1A9SA 1P1BA 5IHXA 3EMKA 3UOWA 3OQVA 5KZMB 2VHEA 3IAXA 4IXWA 5TS3A 3IC5A 3KPYA 1RKUA 3HBLA 5C5DA 2I3GA 5IT0A 3PR2B 2X8WA 4WCFB 4TN5A 2XKAA 3NC1C 1L7BA 1E18A 2NXEA 4LN1A 4DREA 4DLSA 4LF5B 3K70B 4EZBA 3AL2A 3EC2A 3PQ3A 3DXFA 1T0HB 1SCBA 2OESA 3TRIA 5AXCA 3E5MA 2LKDA 5F7JA 2IJGX 2XQVA 1E1NA 4IX9A 1Y6JA 2FF7A 4KAJA 4TQUS 5AKIA 2EL9A 3G1WA 3B89A 1X1RA 3NTRA 4FOSA 1XMVA 1EUCB 2PKQP 3A31A 5CDTA 2ZPAA 3DXXA 3V4VB 1ILEA 3RWMB 1AX9A 4DNOA 5BSVA 1ENYA 5CT5A 3UKJA 4GMDA 4GLFA 3N0TA 3P0RA 5B64A 5IT9A 4UAUA 4QXPA 2CUTA 4ZTUB 5FRDA 1SKYB 1KMHB 2JB9A 2OBYA 1MOSA 1C8LA 1ONPA 2QVGA 2VXYA 5CVJA 3ZDRA 2E3JA 3QUTA 5LNK6 4RHTA 1H69A 1Y8AA 2PUHA 2VTEA 4W9NC 5I9MA 4YRGA 621PA 1L5RA 4IJ6A 1N2XA 2BGMA 1MJ5A 4UU8A 5TDHA 5JFOA 2ZFUA 3R3JA 4Y6QA 3I6IA 1KZ1A 3ZHOA 3B51X 1Z4OA 1Y6GA 1UZLA 5DISB 1OFTA 1Z5ZA 3D4IA 3H9CA 4QAQA 4QOHA 1YJAA 3AF3A 4X41A 1T2DA 4IRXA 2V6JA 2V7WA 1GPUA 3S55A 2FSPA 1L1EA 1FCJA 1SZJG 2GK3A 3AR3A 3ABRB 5EE5B 3E9CA 1C0PA 4JLSA 1MO3A 3KJNA 3THXB 3WK6A 5DK6A 4HDSB 4URZR 1EWQA 4OSPA 3OX4A 3ZI4A 1FZQA 3LRXA 2IBSA 4DNXA 1VPWA 5LQSA 2Y9PB 2RMKA 1BN6A 1YUBA 2QF7A 3PNPA 3TDKA 2B99A 2O8FB 4GI3A 3ZBTA 4FOPA 4YUYA 3PC2A 4WLUA 2VNJA 5DBEX 4XGQA 4DUYB 3KJFA 4TV8B 5EMNA 4H6XA 3P97A 5I6DA 4DHEA 4JYAB 1JNXX 5EI5A 4Q4LA 4DILA 4MR9B 1E1DA 1O97D 1QPZA 2NO7A 4TKMA 1DCMA 4URWR 3KLOA 1GCIA 2I2BA 1COWA 2PLFA 4O3FA 5CW2A 1CV2A 1FEZA 3AQIA 2VDLB 3ZKWB 4EHHA 4ETIA 5IDXA 2WSYB 4CF7A 2WKRA 3PHGA 1RM5A 3CRQA 2H8KA 2CL5A 1TADA 3QFFA 3KB6A 3WDLA 3G9TA 1E1LA 2C4KA 2WAAA 1E8DA 2VJAA 3RC2A 2QL7A 8GPBA 2ZCJA 2YBEA 4GR9A 4D9CA 2QBYA