3WMEA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
588
structure length
588
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAGAAQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-binding cassette, sub-family B, member 1
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein
total genus 214
structure length 588
sequence length 588
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmeA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmeA02
4JMPA 1C1YA 2AR7A 3VFDA 1ONBA 3QJYA 1UBGA 4KYUA 5DHFA 4TN1A 1A4RA 2HT6A 3U7HB 1EK0A 2A78A 4EQ6A 1NSFA 5LB2A 1QG4A 2IWRA 3U3JA 1AQUA 5JJKA 1ZIOA 5G40A 4F93B 2QNRA 1HQYE 3Q3JB 5AUNB 3HU1A 4QFMA 2RGEA 3D3QA 3GJ4A 4KI0A 4MKHA 5LD2C 2QSYA 1E2MA 2WWWA 2FZLA 4OI1A 2ZETA 1Z0AA 4LHVA 5HCNA 2HLDD 3EPJA 4E09A 2DPXA 3X1YA 1AN0A 2JDID 1O3YA 3PG5A 1G291 3L0IB 1NJGA 2FFAA 2NO0A 2ZU6A 5HE8A 1I4DD 2ZJ8A 2R62A 4NP6A 4LY6A 4CEJA 5DGXA 3DDCA 4M9QA 2JLYA 4DB4A 5KDOA 3ADCA 4Q4HB 3LLMA 4U00A 3KKQA 4B3CA 4AI6A 2EU8A 3CF2A 1G3RA 1VG8A 2ZRHA 4LJ4A 4CEHA 1GRNA 3MJHA 2DYKA 1TUEA 1DAGA 3SOPA 3U2QA 4MGIR 3QEJA 2HUPA 5AJWA 5SZHB 5J4LA 2WTUA 3F8TA 4LYHA 3R8FA 3H4MA 1SHKA 3SZRA 3BD9A 4YXWD 5KNBA 2DHRA 3QE0A 3I5YA 4U02A 1GTVA 1A1VA 5J47A 1G5RA 1Q20A 4V03A 4TYYA 1CULC 4JJKA 3VMFA 2GA8A 1XCGB 1R0WA 4QRHA 1VIYA 1S4QA 1X8LA 2B7BA 3FMPB 4BZQA 3SQXA 1DAIA 4PC1A 3EZ6A 1GVNB 2OLJA 1IY0A 4YQFA 2DR3A 1ZD1A 2JLSA 2ZSFA 3AQ4A 1TX4B 1N0WA 1DS6A 5TY0A 1FQJA 3QG1A 4GSYA 3TR5A 4LYFA 4YMUA 5H8WA 4ZI3A 1DAFA 2V55B 2ZRBA 1G41A 1LW7A 1ZIPA 3UIEA 2MSEB 4JLOA 1E6CA 3FOZA 2QTFA 1FNMA 3RS7A 3BB3A 2EFCB 3FMFA 2JIZA 1G3QA 2ZS7A 2ZQ5A 1KAOA 1VMAA 3KQKA 3ASZA 3U3MA 2AX4A 2WWXA 4EKDA 4LRWA 1TF5A 1YZNA 821PA 1CJVC 1OFTA 4Z1MD 4FWIB 4UJ5A 1SXJC 1OKKA 4RD0A 5JSZB 3KTAA 5A0FA 3TW4A 2V1UA 3C4JA 4ZCMA 1BMFA 2CJWB 1XEXB 4JLDA 1CR0A 3OEEA 4ZKEA 1NN3A 1E69A 2QPOA 5G53C 3WP0A 1YU9A 2OO7A 2XTZA 2FN4A 1Z6AA 3L0OA 1Z29A 2ZSDA 2FE4A 3AEZA 4IW3B 4KCGA 1G21E 4ZIRB 1RFLA 1Q22A 1TQDA 1L8QA 1GZSA 2GRJA 5AUQA 1K5DA 2VHTA 2GJAA 1E79D 3OE7D 1KMHA 2OSBA 2ZRGA 2GJ8A 621PA 2VF7A 3CKLA 5CDFE 1GL7A 4L16A 4URUR 5HKKA 4CEIA 3NKVA 1VYVA 4M0LA 2ZSAA 2XTMA 4U5XA 5JI2E 3NDPA 2CL6X 2W00A 1ZJ6A 1QVRA 2OCBA 4MRVA 3LBIA 2A30A 2QG6A 3LRPA 5LB4A 3RC3A 3LX8A 1JXMA 1UF9A 4DZZA 1NMYA 1V43A 3VHLB 3Q8XB 1D2NA 3DHWC 1QBKC 1B0UA 4XSHA 1W47A 1CU1A 1XNJA 1UPTA 2QTHA 1H65A 4P3YA 2QQEA 1NY6A 3GJ0A 4YONB 4IRUB 2UZIR 2GXAA 3LW7A 2VQSA 4KO8A 3ZGXA 1OV4A 3KUCA 3ZZ0A 4PPQA 4NONA 3CZPA 4Q47A 3CBQA 4TYPA 1YR9A 1I2DA 2ZS8A 3B7GA 5BW8A 3PIRA 3GFOA 3SDZA 4KSCA 1QHHB 1E9DA 3E2IA 3TNFA 2P2LA 1OHHD 2JLQA 1L7VC 1PLLA 1TEXA 1CJUC 1M7GA 1Q21A 2B8WA 1G7SA 1R6BX 4XD7A 1JAHA 4DIDA 1KZ7B 1AA9A 4QJ4A 5TVKA 2JEOA 4W5JA 2YNMA 1ANKA 3ZVRA 5L3RA 4UNRA 2ZREA 2WAYA 1CR1A 4B73A 1KI3A 4NU0A 4CYMA 5FBQB 4YMVA 2IW3A 4LPKA 5KDLA 4Q4AB 1KIMA 4OQMA 5JWHA 5AR1A 1D6JA 2HF8A 5GVSA 2ZROA 4G5QA 2WPDD 2GWHA 3HPRA 5IK2A 4KHZA 2J5XA 1GDDA 5FBWB 1SVMA 2AN9A 3NC1C 1KJWA 2IS1A 4CZ2A 3DL0A 3KZ1E 3SNHA 1DAEA 2OT3B 4O3MA 1JPNA 2F43A 4FINA 2R6DA 3QPUA 1KDPA 2Q21A 1YRAA 2NGRA 3KQHA 3THYB 2KWIA 1JJVA 4B47A 4DIEA 5J4KA 4OK5A 3U3RA 3D31A 4QBHA 3DM5A 1U90A 3BS4A 1R4AA 3B78A 5JCPA 1MR3F 5EXXA 4AY2A 3MWYW 3ASYA 5KDDA 1VDZA 1M7BA 5FL7A 3TIFA 2VEDA 2PZEA 4TYNA 3QF4B 1AS0A 4TSFD 1ZU5A 4DDUA 2IYWA 3KJEA 2C9CA 3U3OA 1J70A 3VQTA 3KB1A 3GLIE 2J7KA 2O0HA 4DDTA 5C1BA 3QKRB 4RD1A 3KL4A 2FEOA 2VA8A 1UKEA 3K8YA 2GF9A 1Q3TA 2Q0HA 2QRZA 4UNSA 2HYIC 2BM0A 1J90A 2IHBA 4BLRA 2BCJQ 3ZH9B 4R9UC 2FDCA 1G19A 1N5IA 2PCLA 1KK3A 1TMKA 4M1OA 5BWMA 4RFSB 4TL7A 5K8LA 3TGPA 1OIVA 3RRMA 1KSJA 4B43A 4HDQB 2VYFA 1BH2A 4PC6A 3AUYA 4EFNA 1R5OA 2VP9A 4Y0VA 2O0JA 4M8NE 5BN3A 2WWYA 1MH1A 2ECKA 4OJQA 3DMDA 2J3EA 4WIAA 4DCNA 4C7OB 4FCTA 1AJEA 1E9SA 1WDTA 5FPSA 1ZNYA 1KKLA 1GOTA 4GT1A 2VHQA 5GJCA 5JECA 2ZJ5A 3R7WB 4IOLA 5J4HA 4PX9A 5E7IA 3A1UA 2XXAA 1KKMA 1OE0A 1MOZA 4Q4HA 4A2WA 2FZ4A 3MMPA 1M74A 4A15A 1J2JA 5FUWA 2W83A 3SJCA 2FFBA 2ZE6A 1CBUA 4RZXA 2WAXA 1E9FA 4KU4A 4POAA 4AKGA 2DY1A 2Z4SA 4AYXA 3CNOA 1RVDA 4B74A 2V3CC 3VNVA 3EC1A 1PZNA 4GL2A 4G01B 4RD3A 2IYVA 5EZ5A 1JEEA 1P60A 1WXQA 3B82A 4EPRA 2V6JA 3QXHA 4GRAA 5JWRA 3RS2A 2OUKA 4GOJA 3GJ6A 1N6HA 3FHTA 2F9LA 2P67A 4M21A 2QU8A 3ICEA 4N1AA 4CGZA 4CIDA 4KBGA 1U0JA 1Z2AA 4WW0A 2WMNB 4Q19A 4I1UA 1XPRA 4F4CA 1W4BA 3HWSA 3SYKA 3UXMA 5AK0A 2V1XA 5TARA 1ZMXA 4DLTA 1T3HA 2HYDA 3LY5A 2SHKA 1G1MA 2XZPA 3ZIAD 5FR1A 4E03A 1GUAA 1UBEA 1Z28A 4JLVA 1VCMA 4L5BA 1FOEB 3C15C 2YINC 2P5TB 3V4RA 1KSHA 4OI2A 2ZSEA 1HV8A 3O47A 4UNPA 2VTKA 3NDBB 2C77A 1EFTA 2ZJZA 2YVUA 4O2LA 1DO0A 4B3GA 1JXOA 3BH0A 1US8B 2C8VA 1VHTA 1OYWA 3WRXC 1J8MF 4KLNA 2PX0A 5B57C 4MGZR 3QXJA 5FFMA 5JSZA 4BE7B 2ZYTX 2QAGB 1H8HA 1ZM2A 4JVNA 4DHEA 1KI8A 5AUPB 3RS5A 4NCIA 5FPYA 3EXAA 1XEXA 4WAUA 2Q9CA 4PSKA 4MYTA 2IF2A 1WBBA 4E5UA 2RGXA 1W44A 2CHVA 1LS1A 1TADA 2QRNA 3ND8A 1F6BA 3OEHA 4EFMA 2I4IA 3RWOA 4UJ3A 4ZIRA 4Q5IA 2YKGA 2ATXA 1KZGB 3IGFA 3M6AA 1GIAA 5CB8A 5FR2A 3SHFA 1Y63A 4V0ME 4UXHA 2OBNA 4TQUS 2JLWA 1N25A 5H70A 4A1FA 1FFHA 1JR3D 4TLAA 3VU9B 5DSZA 1UM8A 1G18A 1KI1A 4OQXA 5JRZA 5FI1B 1UBCA 1U9IA 4Q1CA 3CZQA 2Z83A 2WWFA 3FTQA 1NF3A 2H8KA 4DJTA 3AKYA 3IEVA 3EZFA 1II9A 3NHBA 2ZJOA 2CE2X 1EWRA 2W2VA 2WKRA 2J1LA 2IEYA 2ZIAA 3TQFA 3MJRA 2EQBA 1A2KC 5A5GA 1COWA 1XEFA 3DM9B 1N5JA 4DRZA 1M8PA 5F9FA 1E0KA 2OFXA 2Q9BA 521PA 4HAZA 1E0SA 3LLUA 2AK2A 1TU3A 3H86A 4LOAA 2HV8A 1FNNA 1GKIA 1Q57A 3PJRA 4A82A 4Q1AA 4TL6A 3TMKA 4QM6A 1Z07A 2WKQA 5JEEA 1QHHA 1V5WA 3QIAA 1BYUA 3ZD6A 1F2TB 1G8FA 2PZFA 4ESHA 2ZYUX 3DKPA 4CDGA 4OHYA 4D6PA 2JDIA 3W90A 4DVGA 1GM5A 1WRBA 2AD1A 1XJ0A 4QJ5A 3NXSA 1ZC3A 1NLYA 1NRJB 1P75A 2QEQA 1XWIA 4OHVA 4Q4AA 3CRW1 4D4LA 2LCFA 4QL3A 3L43A 3OIUA 1Q0UA 3FE2A 4XTCS 1KSGA 1OXUA 4A6XA 3C16C 2EFDB 3GLFB 5CLQA 4TZ6A 1G8HA 1F48A 1R8SA 1G6HA 1S2MA 1U8ZA 3CR8A 3NIBA 5DYIA 1M6NA 2Q3FA 3VR5A 4HLQB 1CIPA 3MWKA 1EWQA 1IY2A 2WJYA 1CEEA 1IJEA 4YXWA 4ZDJA 1OFUX 2ZUDA 5KUTA 4GDFA 3DVLA 3K9GA 3SQWA 2B8TA 1MV5A 3IHWA 5GVRA 3THYA 5L3QB 2J0VA 2ORVA 1RJ9B 4Q1FA 1G20E 4B6EA 4RKEA 2ZM5A 4B3FX 2X77A 5KPJA 1Z6TA 4NTZA 3R9XA 2D06A 2IYXA 1UAAA 3QY0A 1FP7A 1TQ2A 3LVQE 4C0SA 5IHPA 4Q9LA 4R98A 3BBPA 4GOKA 1CRPA 1N6KA 2G1JA 1U0LA 1CXZA 1TPZA 2CLDX 4HUTA 1DPFA 4TMZA 4IHQA 1VHLA 3M1IA 3QKRA 1R2QA 3TK1A 3VKHA 4NCKA 4FMCB 2X19A 2IYTA 1GNPA 3B85A 1IBRA 1ELOA 1JJ7A 1Z6XA 4I1SA 4MGYR 3A4LA 4PO8A 4B48A 4DDWA 3FYHA 5CK4A 1FL9A 1GFIA 2LWIA 2C03A 4L4UA 2J7PA 4NBSA 1GKUB 1NP6A 2QL6A 2GCNA 3SJZA 1YR6A 1HEIA 1E2HA 1QHNA 3KUDA 2FWRA 3F5FA 4Z1MA 3U6KA 3HP1A 2Z0MA 3QPVA 4DSNA 4LI0A 5FUXA 4BZPA 3EWAA 1CLUA 1W36D 2CEAA 4C7OA 3GLFE 4TLEA 3VR2A 3A6PC 4WBSA 4XVQA 4BLOA 1N6NA 4JVMA 1HYQA 5BYJA 1SVIA 3AKEA 4H9GA 3R20A 5CJ2A 3OESA 1L2TA 2XNDD 1E98A 3AF0A 4NCJA 3W3AA 1PUIA 1CP2A 2QE7D 2WZQA 2QENA 2A5DA 4LHXA 2N1BA 3MSXA 2VIIA 1JNYA 4HZUA 4JYBA 4KVAA 4EUNA 1E79A 1MRNA 1GSIA 2CVFA 3OE7A 3ZDQA 3RANA 1E0AA 2X8AA 6Q21A 2D4HA 3T1VA 2NO6A 3GJ3A 1XMVA 3EZ7A 3KFXA 4X8MA 3U60B 2FGJA 5E4FA 1XD8A 2A5JA 1XDBA 1E3MA 2RCNA 3UWOA 1AS2A 3E5HA 4V0OA 2R65A 1UKYA 3MCAA 3NEYA 3PEWA 3G0HA 2ZANA 1CR4A 2IT1A 3I92A 2X1VA 1T3LA 1CR2A 3ECCA 2VHCA 2GTPA 4IKEA 4ACBA 2PH1A 4D4MA 2BHRA 3P4YA 1DE0A 1YZUA 3GLGB 1L4UA 2OV2A 3VX3A 5EXSA 1G8YA 2LKDA 4M53A 4XSGA 3BH7A 3LWNA 4LHZA 3RS3A 2VSXA 4MRNA 1DAKA 1T0HB 3UWKA 4PO9A 2PMKA 1MO6A 1GKYA 3B1YA 1SULA 2C9OA 4YLGA 3A8TA 4GZMA 1EGAA 1P2SA 4TMKA 3NC0C 1HUQA 5DIFA 4UNNA 5J40A 4IXNA 4Q7JB 2O5VA 1KHTA 1OXTA 2VP0A 3DEFA 4F7WA 4KXFB 1S1MA 2IEZA 1US8A 1OHHA 3PENA 2R6GA 4LHWA 2AXNA 4C2UA 4Q18A 3TUIC 1ESMA 5J4YA 4C0HA 2O8EB 1UADA 4I1OA 1DARA 3SFZA 4QHTA 1E99A 2IXGA 2QAGA 1EFCA 2WWIA 1E2KA 1XJCA 2VPPA 1I4LD 1SGWA 1MO3A 4GP7A 4OI0A 2DBYA 3Q5DA 1EFRD 1NLFA 2OCYC 2F1JA 2WPDA 1JR3E 4Q02A 5B30A 1E2IA 4NHOA 2OLKA 1PVOA 1AQYA 1FX0B 1HH4A 1FP6A 1T8UA 3N70A 3UMRA 1E2JA 2ZYWX 3H0KA 4JJZA 2QT0A 5P21A 2XZLA 1CS4C 2G0TA 5FH9A 2QM7A 4OKSA 2ORWA 3EA0A 1VIAA 5HZKA 3IEUA 3T1QA 3FWYA 5FUVA 1HY3A 2QMHA 1ZNWA 2V7QD 4DCTA 1KOFA 3GEIA 4PHTA 4QC2A 2BDTA 3VU9A 1G4AE 3W9YA 2WIAA 3O8DA 1M2OB 1R7RA 3WRYC 2FSIA 3MWJA 4ZI2A 3GLGE 2D3WA 4R2HA 1G3IA 1G8PA 2CDNA 4URXR 1E32A 1UJ2A 3AVQA 3BAFA 4J0QA 3THXA 4LJ8A 4Q4LA 1XPOA 4IOJA 1ZP6A 3K09A 1YZKA 2PEZA 3V9PA 5GJBA 4M1KA 3SHWA 3ND9A 4XH9B 2GXSA 2KBFA 1TF2A 2C95A 4PPNA 2ONJA 3IKJA 2ZS9A 4NCNA 4Q9HA 2QPAA 1ZM4A 2VH5R 1NBMD 4GFDA 1NNEA 2OESA 4AKEA 4PQRA 1IXSB 4DLYA 1J8YF 2A2ZA 4US2R 3G82C 3T06B 4EPXA 2ZU0C 4EIWA 1JAIA 1VCNA 2GEDA 4QBFA 2WKPA 4AK9A 2JJ2D 5DLQC 2C9YA 3D8BA 4Q9JA 3A1SA 2QI9C 4EJSB 1F2TA 1S3GA 2GAAA 1NSTA 1W36B 1J7KA 1D9ZA 4TYWA 3Q7QA 1E2GA 3BK7A 2J0QA 3UPUA 2ZRPA 3BIFA 3EAQA 2HCJB 1ZRHA 2CMKA 5JS7A 2WHXA 1P6XA 1MO5A 5BYKA 2OBMA 1XCMA 5JZVA 4BWYA 4MUAA 2ORIA 3U44B 5CJPA 3PUYA 3BERA 1XMIA 2FSHA 3K0AB 4ZO4A 4B34A 2FG5A 3REFA 3T1TA 3GLFA 5KYKA 1IONA 4JBYA 4AG6A 3P26A 2R9VA 1W46A 5KHOC 3AVTA 2DWPA 3PQCA 1XD9A 4IVPA 3V4FA 5CLLA 3KJIA 2LKCA 3ZJYA 5K8IA 2GNOA 2C2HA 3FMIA 4QGHA 2IYZA 2IUUA 4U7DA 1RPZA 3LBHA 2O8CA 4KFUA 5EE9A 2FU5C 5CIQA 1QHXA 1RJ9A 2C99A 2UKDA 4LC1A 2QBYB 5C4MA 4R7ZA 4D82A 2AK3A 2NO7A 3I61A 4C0AC 5EP2A 2JCSA 3T35A 1IHUA 3UKDA 1OXXK 1NN1A 1S3SA 1G17A 3PV0A 3C41J 5LDDC 3EA5A 2WSSD 3CRRA 4JBWA 3ZD7A 3B8HA 3K0FB 1S9HA 1MRSA 4FCWA 3PUWA 4HATA 3K70C 1SXJE 1XXHA 3NHAA 2JLZA 1E2FA 4ON9A 3WNBA 1OIWA 1UDXA 4MYUA 3P20A 2ASEA 1IXZA 5EUMA 3QBTA 1NLZA 2F1RA 2GEUA 3SS8A 3NBYC 3WNCA 3GJ7A 2QP4A 4JSYA 4II7A 4QGGA 1JALA 4I99A 3SE0A 2REXB 3OIWA 5AWFC 3A1VA 2WV9A 3TBKA 1JPJA 4LPSA 4AD8A 4EAQA 2V6IA 3BFVA 4UXJA 5KSOA 2P65A 4FW9A 1I4TD 3FVQA 2ZRJA 5JFGA 4M9XA 4KLZA 2GDJA 2PLFA 3C5HA 4BFVA 2WSMA 4BRUA 1ZM7A 3CF0A 2KE5A 5FBLB 3GJ5A 5BN5A 1VYUA 3TW8B 5E95A 4PO1A 4QBIA 3R8CA 3VX4A 4NE2A 4LBWA 2R8RA 5TXGA 3P1JA 2CBZA 1EX7A 1YR7A 1MO4A 1OH7A 5JHHB 2CHQA 1VECA 2RAPA 3Q7PA 4PFSA 3VR3A 4EFLA 1RRGA 1JB1A 2WOOA 4P32A 4CVNA 2JATA 3KQNA 1KDRA 2BIFA 4FMDF 3MG9A 2HF9A 5KSPA 4TT3D 2W2TA 3TAHA 2FV8A 1KO5A 4WXRA 2ODBA 2P6NA 4NH0A 4OL0A 1T91A 4RZUA 3Q9LA 4V0LA 1G7TA 1NMXA 4ASUD 2GHIA 2W0MA 3K9LA 1G16A 3BXZA 4DCVA 3QKUA 4WZ6A 2NO1A 5K8TA 4D80A 3EG5A 3IIJA 2OAQ1 5IT5A 5FPHA 1E2DA 1KDTA 1E9AA 4M1MA 2OCPA 3I72A 3GLIB 4YDHB 2ZR0A 3O8CA 3GLGA 4LBYA 1WCV1 4LYJA 1QHGA 1A5TA 4LBVA 5G41A 4Q21A 1Z06A 1YZQA 2ZUBA 2OAP1 4PSAA 2W6JD 4JS0A 3K0CA 2HXYA 1LFDB 1SVKA 2GKSA 4D2IA 3GMTA 4DT1B 4M4SA 2I1QA 4FN5A 4URYR 4RJLA 4ARZB 3NBFA 4A8JB 3CRVA 1ZW6A 4IDQA 1WBDA 4MRPA 1E4YA 2WIBA 4URWR 3B1ZA 3BFXA 4Q03A 2YC2C 3U6BA 1VKJA 3K1JA 3JVUA 5C4GB 3ADBA 1XZQA 2O8EA 2OCAA 4GP6A 2GVZC 1W5SA 4OQNA 1A82A 1FTNA 2GZHA 1VCOA 2ERYA 4LV8B 3RVBA 2BM1A 5DI3A 1P73A 4YC7A 3CW2A 3DOEA 3BH6A 4FIDA 5FOTA 1FX0A 3LBNA 4B3XA 1ZCAA 3LA6A 2O52A 5F9HA 5FTMA 3S1AB 1P2TA 3SYNA 4QXAA 4A36A 4ZDWA 2RGAA 1MABB 3DZ8A 4E22A 4HLUA 1E96A 2FOLA 4TTQA 1G3UA 3A58B 1QG2A 1KMQA 3B1XA 4US1R 2WM9B 4DLUA 1D8TA 1U9IC 3KKPA 3CR7A 2OM2A 1P3JA 3M4YA 3WHKA 2WJVA 2G83A 1ZYUA 4LJ6A 4DWJA 1NBME 3KXKA 1OT3A 4GZLA 4D4KA 4DXAA 2BCGY 5K8UA 3ZLJA 4Q4JB 1W0JD 1AK2A 2FF7A 4EPTA 4KITB 1ZC4A 4JVLA 5HE9A 4MYHA 2B7CA 3KXIA 3HPQA 4JL6A 1W0KA 3FMOB 1RRFA 3OIYA 4KAXA 4FCVA 2GCPA 1MKYA 4C30A 3THOA 2R44A 2BMDA 4GOXA 8OHMA 5IRCD 2NG1A 1VG0B 5JEDA 1XTSA 3RDPA 4A4DA 4LJ7A 4US0R 4GNKA 5HPYB 2YOFA 3X1ZA 1VCIA 1XTRA 5DN6D 3C7KA 3X2SA 1YZGA 2KJQA 4EJSA 4BFXA 2GBLA 4JLMA 1KO4A 1R8QA 1NVXQ 1S0UA 2NIPA 3ZS8A 4PC7A 2V8OA 3U3KA 1ZD8A 4NDZA 1FUUA 2CNWA 4OBEA 1AKEA 1F2UB 5GJVC 1GRRA 1ZM9A 2H17A 4P31A 3UANA 2XX3A 3ADKA 4V0NA 2XNDA 4YMSA 4NPHA 1LY1A 3U44A 2QE7A 4PHFA 1IAQA 1LF0A 4HAXA 2MMCA 1GILA 1P62B 3QENA 5JJIA 4G5RA 3IIMA 4OK3A 5CDFA 4CT4B 2GK6A 3RNLA 2GZDA 2DFTA 1XTJA 2QMOA 2XGJA 3KX2A 3WNDA 3LX5A 1OFIA 1II0A 2VP5A 3NEJA 5HR5A 1VPLA 1NIJA 4P4SB 2P6UA 4EPYA 1N6LA 2BJWA 2ZITA 2GF0A 2ZI5A 3FKSD 4Q7MB 2H92A 2O0KA 3HYRA 2BMJA 2MSCB 1EX6A 1S1CA 1ODFA 2R6AA 4IOMA 2N42A 5F98A 1SZPA 4TQAA 2EWVA 2RMKA 4LWZA 3PEYA 2JAQA 3K0FA 2ONKA 3C14C 3W5IA 3BRWD 3H1TA 2ZI9A 2ZYVX 5DISB 221PA 3SU8A 4C0LA 3A1TA 1OIXA 4MDFA 3ZQ6A 4OI4A 3U7FB 3AP1A 2FPLA 3CX8A 3T12A 1AZTA 3L0SA 2ZUCA 1TQ6A 4M9SA 2O8BB 3ONWA 1WB9A 3WBKA 3MLEA 1UKVY 2C04A 4GI7A 3CH5A 3MUFA 2NPFA 1U2RA 2RGBA 2QPTA 2VL7A 1NIPA 2CJWA 3LH5A 3SN6A 1X1RA 5CM8B 5JLJA 3N5CA 1KK2A 1RZ3A 2YWFA 2E1RA 2BJVA 3L8ZA 2IXEA 1JBKA 2XEXA 3AGPA 1P9WA 1SHZA 3ZZTA 1LB1B 1N0UA 4Z54A 4OJKA 1IY1A 3TJZA 2NMVA 1Z3IX 3AF4A 3EZ2A 4O2RA 3B5JA 4OHWA 3G5UA 4AC9A 1XZPA 3MRSA 5FPTA 3EIQA 4ZPXA 1KY2A 5F2EA 1EFRA 3AF3A 2BKUA 3W8RA 2IF0A 2OFOA 5IF9A 3CLVA 1Z47A 1IM2A 5KO2A 2ZEJA 4EDHA 2OE2A 3QI2A 3E70C 4BEJA 1Z22A 3B6EA 3SJAA 1P4SA 2VHUA 3AKCA 1UBFA 3IO3A 3U4QB 3AVXA 2F6RA 1NY5A 2BMEA 2V7QA 3IDQA 3WP1B 1Q12A 2QP9X 1NN5A 4B71A 1AIPA 2PL3A 1OPXA 4IXMA 4ILEA 3EPHA 5KOYA 2H1LA 4RY2A 2VHJA 5L3SB 1IN7A 2YC4C 4A0RA 1ZD9A 2YWGA 4PZYA 3T15A 4DSOA 4QOSA 3OFND 1P2VA 4B3BA 1UDWA 4DB2A 3C5CA 4LGMA 2FMXA 3VKGA 4NYJQ 4CF7A 3GLIA 4RD4A 4NYMQ 3TRFA 1T5IA 1FUKA 4D0NA 5FOXA 3UMSA 2E9SA 2W0SA 1KGDA 4JSTA 3AVVA 5E7JA 1OYYA 4RKFA 4X8HA 1Q1BA 2C98A 3EC2A 5H1YA 4HI0E 1XU4A 2I3BA 1VYTA 1NBMA 2KI5A 1S96A 4LJ5A 2HLDA 4JT4A 4EPWA 1BS1A 1YKSA 2FNAA 4YDSA 3VR6A 4NZYA 4Q48A 3RS4A 2QY9A 3X1DA 1SVSA 2ODEA 2RGDA 2HT1A 3TLXA 2IS6A 2DWOA 2JJ2A 4IVQA 4JVSB 4LSGA 1W1WA 2ZJAA 1PLKA 3CPHA 4PSVA 4Q9IA 5FTKA 1OXSC 2BOVA 2NPIA 2IBMA 3REGA 1LF5A 4RD2A 4BFWA 2RGGA 2YWEA 5CITA 1P7CA 3VTKA 4HAUA 2D7DA 4IEEA 4Z51A 1A7JA 2CCGA 2GESA 2QAGC 4A2QA 4JKIA 2Q3MA 4TQ9A 3K9HA 2FGKA 3WMGA 1IOZA 1Q3HA 2ZRLA 1HQCA 3CUEF 4M1TA 5DE3A 3EPLA 3E1SA 3HR7A 4M2LA 3AV0B 3OHMA 2ZE5A 4BLQA 2AD5A 2IWHA 2JA1A 1WA5A 4AIIA 1HE1C 4OQFA 3QF7A 1FZQA 3ICQB 3QF4A 1PJRA 1DEKA 4IDPA 4HAYA 2JASA 1MABA 4YMWA 5GJWC 1U94A 2IYQA 4JZKA 3N2IA 4FI3C 3K53A 1K6MA 2Z43A 4B33A 5EP3A 4B35A 4FWTA 3W3ZB 1IN4A 3O8BA 5JHGB 2JGNA 2H7VA 3CH4B 4P4UA 4NYJR 1PUJA 2CL7X 2ZRAA 4Y0AA 2Z5FA 5LPNA 2WSSA 2CVHA 4RFSA 1GITA 1SXJD 3K09C 1OFHA 3FHOA 5KNDA 3GP8A 1E1QD 3ZVNA 1X1SA 4LV6A 3J81k 3LXXA 1N6RA 1OW3B 4FD2A 5JJLA 2G9NA 2EFEB 2PZGA 5KU1A 4PAQA 2ZVPX 2QMEA 2JLRA 1GAJA 4W5HA 4KFTA 4KYIB 3NH6A 5SZKB 1QZXA 3RS0A 2IHYA 2DB3A 3CPJB 5CM9C 3QQ5A 1DTSA 5EE3A 4R71A 2MMGA 3VNUA 4AKIA 1DAMA 2ZI3A 3KTAB 4RCYA 4TLCA 3UG6A 3RWMB 3R7WA 3RLFA 3D6TB 3DZDA 2JLUA 3BB4A 1KK0A 3FGNA 4BLSA 3FDIA 4B3DA 3KQUA 4N0DA 1M7HA 3A4MA 4HB0A 2R2AA 2DFLA 4KFSA 3A36A 3ZYCA 1KAGA 4B2IA 4L15A 3WMEA 2ZVQX 1DELA 3QXCA 4JIMA 1YQTA 2KBEA 1F2UA 3GEEA 3O8RA 4AWXA 3DMNA 4KSBA 1QVAA 3CNLA 1IJFA 2X2FA 4JL8A 2OXRA 4MRSA 3WHLA 1DG1G 3KKNA 4IJMA 2WVJA 3D7MA 2D2EA 1P61B 2W6ID 3QVUA 2RHDA 2Y8EA 1KTVA 2GEVA 1HA3A 4V0MA 4ZCIA 1DBSA 4HYYA 1AS3A 2RB4A 1KI6B 4LV5B 3T1OA 3DKVA 4HEJA 4TT3A 2CLCX 3PCRB 1AM4D 2QA5A 2B92A 3BORA 4NCHA 4QM7A 4F92B 3QXXA 2P3SA 3JZMA 2X2EA 5F3WB 1KO8A 4ASUA 4LJ9A 3OAAD 4UNQA 5LD2B 4HUQB 3T34A 5SZJA 1ZAKA 2V54A 3FFBA 4F4JA 4ZDIA 4R2IA 1TF7A 1E2NA 2P6RA 4ESVA 2DFKB 1FQKA 3EASA 4DLXA 4BRWA 2W6JA 3GEHA 1NVUQ 1G4UR 2EYQA 1G6OA 1CKEA 4BEBA 5AUOB 3MAAC 2ZRDA 3FHCB 1XEWY 3HU2A 4OQLA 1Z0DA 3VR1A 4C0QC 3I3SR 3AP3A 1N0VC 3WY9A 3BE4A 3RHFA 2PX3A 5FL3A 4QBGB 3PR1A 3CF6R 4TTRA 3QOFA 1OXVA 3LFUA 1IN5A 5FTLA 3LW8A 1E1RD 4JLKA 3LV8A 1TAGA 3NBZC 1C4OA 2ZJBA 3AP2A 1R5NA 2XOKD 1GNRA 1X86B 4N3NA 1EXMA 3X1WA 4XVRA 3SJBA 4QHYA 1KDOA 5FTNA 3I1FA 1T5LA 3CM0A 4DLWA 4OYHA 421PA 1DG3A 1OB2A 4LX0A 4NMMA 1G5PA 2IYLD 1R0ZA 1UEJA 3I32A 4PAMA 3W5JA 1RYHA 1BKDR 2ZR7A 3W6PA 5EJEA 2REBA 2QTVB 1UKZA 5FOVA 4TSFA 3U4QA 2EW1A 5EP1A 4C0JA 1UFQA 2WWGA 3Q72A 2ZI4A 3QUSA 2D7CA 2OG2A 3L0PA 4TMTA 5BXQC 2OXCA 1Q44A 2HJGA 1MT0A 3HDTA 4MQBA 2KB0A 3LNCA 2Q3HA 3PEVA 4S2EA 4MRRA 1E2EA 4PQFA 3AUXA 1U98A 1U99A 1COWD 1Z63A 4W9MC 2A5FA 1W0JA 2RGNA 1SXJB 2ZSBA 1F3OA 1LVGA 5BQ5A 1Z0JA 3BFKA 1C9KA 4AKHA 5FPKA 4WVFA 4LCBA 1RC8A 2PT7A 2QROA 1G7RA 5E3HA 3U5ZB 2PBRA 2PEYA 4QGAA 5JCZA 2GJSA 2J59A 2OBLA 4PPFA 1RW4A 3AM1A 5CB6A 4DUGD 2C96A 2PMDA 4RZ2A 4Q66C 3PEUA 3K0CC 1SKYE 1JI0A 2FFHA 5JMTA 5L8VA 2HDNB 3WXMA 1FMJA 4B6FA 4BZXA 1T0JB 2YOGA 5EE5B 2IL1A 3QNUA 2IK8A 121PA 4TZ0A 4Q01A 2JJ1D 5KSZA 1L4YA 5DN6A 5EQTA 2B6HA 2IS4A 1VTKA 3A1WA 1KNQA 3B2EA 5FBVB 3N2EA 2XXAB 1QHYA 3DOFA 3NTUA 2W58A 4B32A 5LBIA 2YYZA 3OF5A 5E7MA 4RVCA 3RRNA 2BVNA 2OZEA 1JECA 1XTKA 2FSFA 1U8AA 2BBWA 1N6IA 1G7CA 3IBYA 1FW6A 5L3QA 3UG7A 3IO5A 2AKAB 2HCBA 4JLJA 1AGRA 4KVGA 2BC9A 2OEPA 3EX7C 3V00A 1NN0A 4UXIA 4M1WA 2ZRIA 5JI3E 3B13B 2I1VB 4W7SA 2VP6A 4RCZA 1ETUA 4XIGS 2HJVA 2XSZD 3RYTC 2MSDB 2WJGA 2ZE7A 2GJKA 4NL4H 4HAVA 1E9BA 4HLUC 4A0GA 1N6OA 1HT2E 2XB4A 3A37A 4JYCA 3AF2A 1KNXA 2IYRA 3FKSA 3ZIAA 3I62A 1NG9A 1TEVA 4LJYA 5J5CA 3PUVA 4DKXA 1OH8A 1W4RA 1W2GA 1LTQA 2CK3D 1Z0IA 3LD9A 5D3MB 3EPKA 3NVAA 1XJQA 4XWAA 2ZAMA 2A5YB 3LO5A 1QHIA 2J7PD 1KYIA 2G3YA 5FOWA 2P0EA 4K8OA 3B1VA 1NKSA 1CTQA 4ZCLA 4B44A 2WOJA 4DSUA 5FOUA 2VF8A 3I8XA 1XP8A 3HR8A 3P32A 2CCKA 3CB4A 3PVSA 2G77B 2FA9A 4Q00A 2ZTSA 4DLZA 1KI9A 2IA5A 4TLDA 1BOFA 3EZ9A 4IDOA 5EE1A 2H5EA 2ZRMA 3B9PA 1X3SA 1DADA 2H57A 4Q9KA 4EJSC 1EFUA 4MKGA 1ZINA 2EYUA 2GBLC 1X8JA 3IQWA 5EP4A 1W36C 4MGKR 1HE8B 2BBTA 3FB4A 3SR0A 3KFVA 1JR3A 1E94E 1KI2A 2B21A 2VSFA 2YOHA 3AGQA 3K9NA 3GFTA 4KJZA 2ZI7A 3BB1A 3GLHB 4BFYA 4TTPA 3VKWA 4XWKA 3LVRE 4BFTA 2ZRCA 5EE0A 1K5GA 1KJZA 3M0EA 2WJIA 2J9RA 1KI6A 1R0XA 2VLIA 1KJYA 2XAUA 3BJIC 1EFHA 4PANA 1U0HC 2IUSA 2E87A 5DH9A 4LYAA 3K0EA 1Z0FA 1OF1A 4M1YA 3DO6A 1YRBA 4IDHA 4CRWB 1ZCBA 3QVVA 1SQ5A 5EXTA 1KO7A 1W48A 1NI3A 3MFYA 4C9BA 3OFNA 1U8YA 4XVUA 2EWWA 4HUQA 4EPVA 2QZ4A 1XCPA 4G1UC 4ABYA 5A4JA 5EZ6B 3KJGA 721PA 5D3QA 1BYIA 4CW7A 4IOKA 2VBCA 1M1YE 2VO1A 3MD0A 1OB5A 1Z5ZA 3PXGA 1T6NA 2GJ9A 3ZQJA 3WYGA 4MYCA 2XB2A 1D5CA 4BECA 5JRJA 2CHGA 1LNZA 1VG1A 1T4GA 1DO2A 3F0TA 3CWQA 2BEJA 5FUYA 1P5ZB 3QKSB 3TE6A 1QRAA 2BMFA 3TR0A 4RFVA 1N5LA 2J0UB 3CO5A 2O8DB 4F4IA 4QNMA 3CX6A 1ZVQA 1XD2B 1CJTC 2JLVA 1D2EA 5CK5A 1Z6YA 3MWLA 1R5BA 1CJMA 3AVUA 1BO6A 1H8ED 2ZI6A 3EW9A 4JLBA 5FOSA 5G3ZA 1Q1QA 4G5SA 3GLHE 4TLBA 3RABA 4KFRA 5DO9A 5ANRB 4V02A 1W4AA 4LK2A 2VSOA 1AZSC 2UZ3A 4I4LA 4M22A 1XFAA 4JBXA 1Z2CA 3KQLA 5B64A 4QNRA 1GL6A 1GWNA 2QSZA 2XTNA 4F38A 3THWB 2ZJYA 4DCUA 1G8GA 3TUZC 1YJ5A 3UATA 1WE2A 1OJLA 1NVVQ 2AXPA 4H1UA 2ZRFA 1XB2A 1XMSA 1JQLB 4TWZA 4BUJA 4YMTA 2IC5A 2ODWA 2P5SA 4IFBA 4C4PA 1Y3AA 1N2CE 2OFWA 3TVTA 1RE0A 3CNNA 2O8FB 3T5GA 2ZPTX 1G3MA 1NVWQ 3W8NA 5AJZA 2CE7A 4JL5A 4PPGA 5KTYA 1SXJA 3IPXA 1E1QA 3W6OA 4DDVA 4N0EA 4A0FA 2QUZA 2VP2A 3GFPA 4JT2A 2EVWX 4FMCF 3PFIA 4PC3A 3IHLA 1E2QA 2G1KA 2QM8A 3ETLA 3EWSA 4JLNA 1O87A 2JJ8A 1VG9B 5M04A 1X6VA 2XITA 3ZVLA 5FTJA 4W5WA 4A9AA 4Q7LA 3AKDA 3LXRA 3CX7A 2GAOA 3IQXA 1E4VA 2AFIE 4DSTA 4AYTA 3C8UA 4HZIA 1PV4A 1ZUIA 1T9HA 2G6BA 1TU4A 4A8JC 1GP2A 4K81B 2GZAA 2Z6VA 2XJ4A 1RKBA 3BOSA 3NWJA 1R10A 3K0AA 4PXAA 4RZ3A 3P27A 1Q1EA 4QG7A 2A7QA 2GK7A 1F60A 4HB4A 2R6FA 1IQPA 2QT1A 3U7GA 4E07A 4HZUB 3QXSA 2G0NA 2F1HA 5IDVA 3W34A 1Z83A 3CONA 3B60A 3I4LA 4NKRA 4F91B 3WMFA 1X8KA 2GXQA 2QBYA 3AVWA 2FJUA 2W6IA 3OIVA 4KBFA 3AB3A 1KY3A 3B9QA 1NL3A 1QHSA 5KPDA 4BQSA 3QG5A 1NMZA 2A3RA 1NVVR 1G9XA 4OHZA 1E0JA 4LC0A 4D25A 3CWZA 4BASA 4ITRC 2Q9AA 2WJHA 2GCOB 5KNCA 3LQQA 1XTQA 3I5XA 1B23P 2YWHA 2DCUA 2YV5A 3WYAA 3U61B 2J0SA 3SFVA 2JIZD 3TSOA 1E9CA 2BBSA 3OAAA 3ZZUA 2FPMA 1YHNA 3NBXX 1Q1ZA 4P33A 5H68A 2WBLC 1NKTA 1KO1A 4HLCA 1Z8FA 4QHSA 4WZBE 3VHXA 4BLTA 1HURA 1N6PA 2QP3A 1QDEA 1A2BA 1T8TA 2NTYC 5HTKA 4B76A 3AVYA 2GXUA 5D3MA 4QKQA 1OKKD 2HEIA 1II8B 2NQ2C 3PUXA 1BMFD 1SVOA 4DLSA 1TUIA 1E9RA 4BFUA 3GQBA 1DAHA 3MGCA 4JLPA 3KJHA 4G5OA 2CCJA 4WZAE 4B2PA 4LBZA 2ZRKA 3OEED 4PC2A 5CIWA 4TMWA 2GETA 2IYSA 4CT5A 1LS6A 2EFGA 3LQRA 4PTLA 3GPLA 3IPYA 4FMBB 2EFHB 3X1XA 2IXFA 1WP9A 3QKTA 1XTIA 4A6PA 5JS8A 2A9KA 2A5GA 2H16A 3R9IA 2H18A 1I2MA 4BPBA 2F1IA 1OH5A 2N46A 5TB5A 1W49A 1YZTA 1T3SA 1E1RA 2CL0X 4PHGA 4ERNA 5HKKD 1DVRA 2PJRA 4TL9A 4GPTA 3IILA 5AJXA 1NG1A 2FX3A 4FMDB 4PQYA 2XOKA 5C2JB 1FMLA 4G3XA 1KSFX 4S35A 1BIFA 1K8RA 1XMJA 4K46A 2ZAOA 3QPWA 1YVDA 1ZM3A 4JKYA 2FH5B 5DHAA 4MDEA 4ZV4A 3CRQA 2ANBA 5G3YA 5JWOA 2QMUA 4V0KA 3TAUA 2JLXA 4MA4A 1RRPA 4C0BA 5ELXA 3GLHA 1HT1E 4B2LA 1GL9B 1HTWA 4LZZA 3BC1A 2BBOA 3IUYA 1Z08A 2OILA 2REOA 5DYGA 4GBMA 4EQ6B 3LDAA 4HLDA 4IFEA 1U81A 2QQ0A 4G0NA 2PLRA 4UKDA 4A92A 3THXB 3VAAA 3IIKA 2F7SA 2D74A 2HXSA 4OHXA 4UQOA 3SBDA 3SC3A 5AJVB 1TNDA 5CYPA 2C78A 2J41A 4ACAA 4MKIA 2YHSA 1EESA 3U7EB 1IXRC 1AKYA 1IN8A 4URVR 3VR4A 3KKMA 2VP4A 1OH6A 2AWNA 1QF9A 2D62A 2GILA 2NO9A 4DT1A 2G88A 4MKFA 1RIFA 1N3BA 2K5UA 3SEAA 4XD7D 4ARZA 4DLVA 4A8JA 4MH0R 2BWJA 3RSOA 4C2TA 2CXXA 2OHFA 3RSLA 5HCIA 5B2ZA 1JR6A 3I73A 2IUTA 1WQ1R 2NOAA 4DLRA 4DUGA 4CEJB 3QKSA 5UKDA 1J99A 1R0YA 2AHOA 2Z4RA 5C18A 4A0HA 4L8GA 2J0UA 5TV2A 5IK2D 3W6NA 1Z0KA 4CEHB 2O8DA 1SVWA 3BWDD 1ZNZA 3GD7A 4HB3A 4X8LA 2Q6TA 4C0KA 2JJ1A 3QSYA 3EIEA 4A2PA 2QAJA 3RRYA 1OSNA 1XD2A 1SKQA 2ZRNA 2IS2A 3OZXA 4WA7A 1PLJA 3CPEA 2AKYA 3TVDA 1P2UA 2ZE8A 3RAPR 5SZIA 4BFSA 1E9EA 3F3YA 1OLOA 3H84A 5TMPA 3S1AA 3BGWA 5FL7D 2ODNA 4XWOA 1P9RA 1ZBDA 1XBTA 2W2XA 4HAWA 4AURA 4MUBA 4B75A 3L8YA 4M1SA 4ZKDA 2TMKA 2O8CB 1ZU4A 4TYQA 3K70D 4IDNA 3THWA 1P9NA 3ZS9A 4IVRA 1W7AA 1FTSA 2XJ9A 4DC9A 2XSZA 1G64A 2F9MA 3SBEA 3TSWA 4BLPA 2IYYA 3KDSE 4NYMR 1N5KA 1W4CA 1KK1A 4Q4JA 4LDJA 1GRQA 3FFAA 4DBLC 3RRZA 4QJ3A 1TL7C 5EXPA 4Q1DA 3T61A 2J87A 3PITA 2AWOA 1XXHB 3ADDA 2O8FA 1IN6A 1JEDA 4DCSA 4KODA 4O25A 3AVPA 4L9SA 4TMVA 3R9WA 5J4VA 4XJXA 2BEKA 2CK3A 3I8SA 2RGNC 4PHHA 1M34E 5HZHA 3JZAA 3WBJA 1W0KD 5EUQB 4D81A 4PZZA 3H2YA 2ZR9A 1EG7A 1CF4A 2ERXA 2WWHA 1ZNXA 4IEIA 3T5DA 4WOPA 4C3ZA 4D4JA 1G5TA 1KI4A 2PCJA 3PUZA 2WMOB 4L9WA 4RD6A 1D9XA 5B58C 1DOAA 4NYIQ 3AVOA 3ZVMA 4P4TA 5C46F 3WYFA 3EARA 2ANCA 3TH5A 4D0LB 1XPUA 2F3TA 3JVVA 2ATVA 3UMFA 5L3VA 4KV9A 2DFNA 1KMHB 2V4ZA 3HJNA 4GMDA 3SYLA 2CNWD 3HU3A 4HSEA 1WMSA 2FEMA 4H1VA 1JQJC 3IBGA 1ZUHA 4CEIB 4PAOA 2RH5A 5BN4A 4DEYA 4RSGA 2AL7A 3NG1A 4Z8XA 2QN6A 2WICA 5CYOA 4OK6A 4BGDA 2ZXUA 2GVDC 3L82B 5DI9A 2RKOA 3B1WA 3P4XA 4XTRA 2D2FA 3HYTA 3GJXC 4PZLA 2QGZA 3RC8A 1GG2A 3DPUA 3TKLA 3AF1A 1XEWX 4P4SA 3KB2A 2FFQA 1ESNA 1XF9A 1F5NA 4I81A 5JBQA 2VRWA 2BV3A 1KI7A 3QBVA 2IYUA 1Z6GA 1XXHE 2J46A 1CJKC 2BKEA 4TMXA 4URZR 2GCOA 2UVQA 4Z8YA 3Q5EA 4AG5A 5AJYA 3FPAA 2YJTD 1CRQA 3AH8A 4D0GA 3A4NA 2NZ8A 1GNQA 4FXPA 3KXLA 4BFZA 1RRCA 1TTTA 2F55A 4JLAA 2ZJ2A 2XZOA 4I1VA 4HB2A 1UEIA 2F3RA 2O8BA 4LJAA 3GCGA 4LHYA 4AYWA 3L2OB 3NH9A 2QORA 1P72A 3CIOA 3SI7A 4PR0A 2PJZA 1YR8A 4HDOB 1YE8A 1W2HA 2AFHE 2NZJA 5TDHA 1II8A 3K0SA 1ZUNB 3TSZA 1D2MA 1H8HD 3TQCA 1RYFA 2J45A 2FPKA 4DEXA 1SKYB 4XOIA 1XRJA 3KKOA 4NYIR 5KSYA 3FKQA 1S8FA 1YZLA 1TQ4A 2L0XA 1WF3A 1SVLA 4G5GA 4MITA 2CLSA 3OEHD 3CRMA 4O0MA 4X8OA 1NJFA 4QGFA 4Q7KA 2V9PA 2RGCA 3GJ8A 2F43B 1S9DA 5GADl 1E2PA 2XNSA 4D26A 1H8EA 2R6CA 4ZDKA 5DI3B 3LAWA 2IX3A 4M9ZA 2WJJA 4Q1EA 1E2LA 5DNYB 1FPMA 3Q85A 4LUCA 4Q1BA 2KSQA 3TUJC 2RHMA 3UK6A 2QGNA 4P0TA 1XX6A 1W5TA 4TL8A 1AGPA 4GMXA 2C5LA 5FBRB 3EIHA 2DWQA 2PT5A 4HDCA 5FI0B 3K70B 4WXPA 2YZ2A 1LV7A 2FSGA 3QEOA 5L3SA
chains in the Genus database with same CATH superfamily
3P8ZA 1CJBA 1AOXA 3O5AA 3LYHA 4X62B 5A0TA 4XIIA 1TO6A 2GM3A 4QUHA 3X3HA 1SKBA 1BH6A 4TN1A 2BFBB 3K1ZA 1V47A 2ZYDA 3O90A 5JJKA 5KQGA 1K3FA 1NUHA 3PPXA 5EHXA 3ZU5A 4RPJA 1C1XB 1IG3A 2FW9A 4F93B 3W2HA 4YGXB 2XWJI 5GGYA 1TM7E 1HQYE 3DEYX 3OQBA 4HMOA 4L9AA 3U80A 2YDXA 4YTEA 3DOUA 3HU1A 2VRCA 4UPEA 4Y6RA 5BN3B 2Q1UA 5LD2C 1TYCA 3D4BA 2NAFA 3AR4A 3KHUA 4D92A 3U0VA 1EE2A 3D59A 3GV0A 1ZH0A 1IBCA 2ZETA 5HCNA 4YFVA 1VHQA 2HLDD 3Q2IA 4AWBA 3EPJA 3PZBA 2YUTA 1J9ZA 4B4OA 2OYRA 3IVGA 2PYDA 1G291 1N8TA 1NJGA 1UINA 3PG5A 3H2KA 4K6HA 1Y7LA 5LC1A 4IHJB 3ZE0B 3M3HA 3K1TA 2C7QA 5F1KA 3HJFA 5DGXA 1U1CA 2RK4A 2VJQA 2I2WA 1OC4A 4DB4A 2GYVA 4K5QA 1B00A 3U39A 3FOCA 1NXVA 2CY0A 2DY0A 4U00A 2UVPB 4B3CA 4HFRA 3OKCA 2V58A 1FFCA 4HRXA 4ES6A 5EG5A 4AG3A 1DX9A 3ROTA 3U7JA 3OZIA 1SIBE 2WD7B 3TIIA 5SZHB 4F86A 1MC8A 2D0DA 3L8FA 3CMMA 3N39C 1XAGA 1N36B 4JBIA 1SHKA 3NYQA 2BFAA 1DEOA 4DN6A 3A6LA 1L6IA 2QN2A 5KNBA 1I4WA 2WKWA 2R5NA 5L4SA 4PYQA 4KIFA 4U02A 1W73A 1GTVA 3HL4A 3QWIA 4ZMRA 4CLRB 1G5RA 3L84A 1CULC 1UWKA 3VMFA 3QEKA 4MVJF 1L0BA 1P2FA 2YQZA 3OZUA 3AUFA 1Z74A 2OGZA 4BATA 3OCWA 2NVUA 2G4LA 4RXTA 4ZV7A 2PZAA 3JYLA 2B7BA 1L8AA 3GAMA 3FMPB 3QUTA 4KQHA 4BNDA 4BZQA 1I33A 1DL5A 2I78A 4HNGA 1BU5A 5JNVA 1IY0A 1ITZA 1SC1A 2Y71A 4MKXA 5ALZA 1OROA 5LMNB 1ZD1A 2G1PA 1FJ2A 1X92A 2E6KA 4EHBA 1KYVA 1TX4B 2RSLA 1J9EA 1DS6A 1CB0A 1K86A 1FQJA 1UWLA 3CZ9A 5IMSA 1J8QA 2G9QA 3GGSA 2IPOA 4K3VA 5DTEA 4NJOA 4I7EA 1DAFA 4RHFA 3UIEA 1LW7A 5A3SA 3FOZA 1FNDA 1UM9B 2HWYA 4CLHA 2C9DA 5KBYA 3FMFA 4U2CA 2JIZA 2ZS7A 3D4OA 3FWPA 1YB5A 1U8FO 1KAOA 1I94B 1YTLA 3L7CA 3WYEA 1VL6A 3EXG1 4GPIB 1N5DA 1JHXA 4LRWA 4MI9A 4AP6A 1MB3A 2Q1SA 4BVGA 4YRCA 3GCZA 1U28A 1AXGA 2HX1A 1OFGA 4N54A 4BB9A 3HXOA 3F5QA 3IUPA 2VP3A 2C92A 1QDLB 1OLXB 3JWIA 5DLEA 1NUPA 3C4JA 3G5AA 5U9CA 2CJWB 1YA4A 1T1SA 4ZQEA 3BVPA 1FUEA 2OENG 5LUBA 3VR2D 1QCZA 1CR0A 4EP1A 4BBPA 2BEVA 4ZKEA 2B20A 1KIAA 1CUGA 4J0KA 4OOFA 5G53C 1IIRA 3RUCA 3WP0A 3OTGA 4DR5B 1OAKA 1OX4A 1I3CA 2HGZA 3FIJA 4TXMA 1Z29A 3WFIA 2ZSDA 3HJUA 1G21E 2WW8A 1TQDA 1L8QA 1GZSA 1VIDA 1WMDA 3PGKA 2QVLA 4G41A 4A1OA 2GJAA 1E79D 2RAUA 3AUSA 3OE7D 2FK8A 4M1EA 3RG8A 5A2QA 621PA 4O3FA 4PN7A 3CKLA 1GL7A 2C61A 2QUKA 3QHQA 2X9LA 1XR3A 4L0DA 2ZSAA 4JB3A 4YAJA 5ICMA 1HG1A 4MA5A 4AZ0A 1C0LA 4QRDA 2OCBA 5FOQA 3L6CA 1EIZA 3JTMA 3L6RA 3LBIA 4MLPA 5T5QA 4DOMA 4F5EA 1JAZA 1VLQA 3HLTA 3SYTA 3FPEA 2GFIA 4ZAVA 1A5BB 4ZYUA 1JXMA 3WTBA 1UF9A 2D54A 4FYHA 1NMYA 1QGUA 5EC8A 1S2OA 4JGBA 1Z16A 1QFZA 2WINI 4JUCA 1RKXA 3D0KA 3OWOA 1T1IA 2CHEA 4R40A 1SBZA 1Z6PA 2W8ZA 4OMCA 4PZCA 2VCHA 1FUIA 4X7BA 3AKZA 2QQEA 9MHTA 2EZUA 1VL8A 3GJ0A 4JJIA 4IIUA 4IRUB 4WCFC 4QZVA 4COKA 1KDYA 2HRQA 1A95A 1YWGO 3MFQA 3WJ2A 3LW7A 2VQSA 5IN4A 3CUVA 3AESB 3A9WA 3LCVB 2NU8A 1ZS9A 3G5TA 3TECE 2ZBEA 4YACA 1YFKA 1BHO1 2JI6A 4GGPA 4Q47A 3S40A 3L7AA 4P3XA 5B1YA 3SDZA 1E0DA 4KSCA 4I3HA 1E9DA 4ZOBA 3TNFA 4ER7A 1YB6A 4HDNA 1OHHD 4RELA 3MD9A 1PSZA 4YCDA 1L7VC 4C06A 2E2WA 1EVEA 1K0UA 4RKWA 1Q21A 1Z34A 2G0AA 1AA6A 4XD7A 4ZYWA 5TVKA 1Y1PA 3TXXA 1WXWA 5B4TA 1YMQA 1YBVA 3UJ9A 2ZREA 3FB1A 5E7QA 4EI7A 1Q83A 3A0RB 3ESBA 3GZNB 1D07A 4YMVA 4WESB 3X1WA 5AR1A 4PN3A 2G4CA 2H11A 4FX2A 3V32A 1M0EA 1QLWA 2AR0A 1MX9A 1WB5A 3O8NA 3PHCA 1XYVA 4G5QA 4I5IA 2J5XA 1GDDA 4KHZA 3U7IA 2W48A 1KJWA 1Y80A 1E5TA 2W11A 4AS3A 2RHTA 2IS1A 4GVXA 1YNOA 4OGFA 8GPBA 1YS9A 2G9UA 4RO0A 4O3MA 3ZOKA 1B7GO 1DZIA 2C9MA 2FFJA 1C14A 2ODPA 1QYRA 4NBRA 5EZYB 5F12A 4KMOA 2Q21A 3IVMA 2NGRA 1AKTA 3ISTA 1DP4A 5JNSA 4B47A 3SSMA 3MT9A 4DUPA 3D31A 3QUCA 1P4JA 1NJ6A 1OJ7A 2UZ1A 4Y2UA 1DXHA 5FKJA 4HX5A 4DMUB 1TQ8A 2Q0XA 1M9NA 5EXXA 3ASYA 3MBOA 4H2DA 5FL7A 4GM1A 1N75A 4HP8A 2O1XA 3TIFA 2PZEA 4IIGA 4C7VA 4W5NA 1VE9A 3CWCA 2B35A 4N8EA 2FZCA 1PBNA 4XGIA 5E4YA 3D6VA 4BVEA 2HRRA 2ENUA 4AJKA 3MRTA 4J94A 3VPHA 1H2ZA 1N2IA 3RVLA 1NXTA 1J70A 3DZCA 1XZDA 2PD6A 3DKKA 5C1IA 2O0HA 4TSRA 3K72B 2JFNA 1RHKA 2GR9A 3KL4A 2HW8A 3DSRA 2WDPA 2GF9A 3R7FA 3K30A 4UNSA 2DOKA 2E7ZA 2V7EA 2YBEA 4A8HA 5K9ZA 3PJGA 2HYIC 4OHKA 1IDN1 4I4TA 3KWJA 1N5IA 2X23A 2CB9A 1XNQB 4JA2A 1KK3A 2WKSA 4FJ0A 4DJAA 2GBGA 1NF2A 4BNDB 3D7RA 2GK4A 1KSJA 3IRUA 2NQ8A 4UHCA 3ZNPA 4HDQB 4JU8A 1GPAA 3E7FA 1D7AA 4Y0VA 5JO9A 5JZSA 1DQSA 1NJSA 2PAFA 4NDNE 4M8NE 5DWDA 1I9GA 1PEDA 1QYWA 4DLPA 4MQMA 1AGYA 1WB4A 2HSGA 2PANA 4K1XA 4TKMA 5KWSA 1QAOA 4LYEA 1L5MA 4CMJA 3ZN2A 3HHPA 5KYYA 5CVCA 3P9KA 4XQGA 5IVKA 1IVYA 1KKLA 4G25A 4GT1A 4HHEA 1ZH6A 4OAPA 5GJCA 1ZH4A 5JUWA 2ZJ5A 3NGXA 3NALA 3DO8A 2H06A 4MWEA 1KU6A 1PQWA 2XY4A 4F6CA 3A1UA 5BT8A 3PT9A 3GAZA 5LL6P 3DE1X 5LA6A 2V74B 3MUNA 1G98A 2IIVA 1M74A 2Q4RA 1J2JA 1PBTA 4EMTA 3L6OO 1Z56C 2ZE6A 3BMQB 3VNSA 4Y6PA 1XTPA 4X60A 4YHHB 3VBCA 4POAA 1IZ8A 4YMGA 2Z4SA 1IEWA 3CNOA 3GA0A 1M0SA 3IMFA 4RPHA 2XNJA 3EC1A 4WA8A 1XU9A 4GL2A 3ML1A 3ADOA 4G01B 3J80A 4ZJYA 2WA1A 3B82A 3P9XA 3ER8A 3QX8A 4GRAA 2LCIA 4G5FA 3U31A 2OUKA 3GJ6A 2EG5A 4GKBA 4RWZA 2F9LA 1KYZA 4YCJA 3DV2A 3GUVA 4B6OA 4DLKA 1Z8HA 1OBCA 4KBGA 3BXOA 1C4XA 3O8QB 4UE2A 2I4MA 3EUFA 3G85A 5EHIA 3LT4A 4WW0A 5L4LA 1YCDA 1Z82A 2FJPA 3D3WA 2QV7A 4I1UA 3W9SA 2C20A 3U26A 1EXVA 3OF3A 3PX3A 4B1FA 1XPRA 4F1WA 2HOQA 4EABA 5DP1A 3NB0A 2INGX 2MDTA 3BD8A 3TRJA 4E2FA 2HDOA 4DLTA 1F3LA 2HYDA 3MWEA 5BUSA 3LL7A 2E5WA 3ROMA 4AJPA 2CFOA 4PQGA 4HFMA 4JLVA 1VCMA 1DC7A 1D04A 1WXFA 2C07A 1MHPA 1X7ZA 3O0TA 3C15C 4X95A 2YINC 4BTVA 3K4QA 4TV8A 5HRCA 3PJFA 1J0CA 1PV2A 2QXUA 2TMYA 3LGAA 2AS0A 4OI2A 2ZSEA 1ZMRA 1GAEO 2O2GA 2QL9A 4RHTA 4ALLA 1A8IA 4G0WA 1SC3A 4PFJA 5CX1A 1XRQA 2ZJZA 4IDGA 2NN3C 3A6ZA 3BH0A 3LRXA 5TF4A 1VHTA 1OYWA 3Q9UA 3WKBA 3WRXC 4DAEA 3G9TA 4F2WA 2IEAA 4OXQA 3QBEA 3TW6A 5I7UA 5B57C 2ZBUA 3L49A 3L77A 3QQPA 4MGZR 4Y1GA 1BXZA 1UC4B 3WXBA 2VUTA 2JFFA 3LBFA 4WBXC 4IP0A 2QAGB 4A8TA 1H8HA 4FBLA 4MW1A 4R1MA 3UOGA 2D8MA 1ZWLA 4NCIA 4IMRA 1XEXA 4FEGA 4JX9A 4UHBA 3IKLA 4ENSA 5GOTA 3L1VA 1R4NA 5A03A 3GPBA 2NZ2A 2MYUA 2I6XA 3HFRA 1W44A 3MIIA 4YJGB 5ECWA 4MUYA 1FMCA 1TADA 2IYFA 1TJ4A 2F90A 4C7JA 1U0OC 3ND8A 5BRNA 4EFKA 2Q5EA 1ARZA 4CUKA 1PR4A 4KQ2A 3WGJA 2R6HA 2ATXA 1T13A 1UDRA 3G89A 1MA3A 3CO0S 3K5WA 3LWZA 1DBPA 3VR3D 1ZN8A 4BE9A 1N2OA 2B25A 4V0ME 3GVCA 2VAPA 1HZJA 1N25A 3IDSA 3VU9B 2C9ZA 2JGDB 5BV0A 1JIVA 4UDNA 5DSZA 4JI1B 2FZEA 1G18A 3UMMA 5DTQA 2P2SA 1E62A 4P35A 3T7RA 1PEYA 4PGMA 2I66A 4HQ0A 3TSAA 1YQWA 4M0KA 4FN4A 4MUIA 3TLGB 3IEVA 3LQFA 1UH5A 1WIWA 3NHBA 1U7WA 2FE1A 5A4AA 3PL5A 3ILXA 2QRVA 3C7CB 1EWRA 3CZAA 3ITEA 2OP1A 2WKRA 3NT5A 4H27A 4JAVC 2VDRB 3UV7A 1PYOA 1Z2OX 2W4IA 2ZIAA 5TPZD 3MJRA 3NPMA 5LOVB 4YRJA 2IPMA 2WE8A 4KPYA 4DZTA 5IJ0B 1ZQ9A 1XEFA 4HQKA 5K0CA 4O1HA 4UFNA 1LI4A 4ENPA 5J9FA 5K99A 2WUGA 1KTIA 3HDJA 3A3PA 3JYHA 1KFEB 3AUJB 2W2LA 1VJ5A 4OJTA 3UWPA 4AW9A 4HAZA 3SEZA 1D1TA 1JHAA 1QP7A 3DE4X 3LQ4A 3LLUA 2NAPA 4RHCA 2AK2A 5DW3A 4FR0A 3PUJA 3R3SA 2A0XA 4LOAA 3H3FA 2Z8ZA 3TIXB 3OX4A 1IK6A 2P8SA 4S1PA 4A82A 1IPFA 4Q1AA 3PJRA 1DWPA 1MIOA 2I6UA 2VHXA 3HYSA 1JDPA 3NTLA 3DLIA 1CUWA 3U7RA 1QHHA 1V5WA 3N0XA 3O8OA 2XE6A 3QIAA 3R41A 4P9NA 5A3VA 3ZD6A 2PZFA 2ZWVA 2R11A 2A9JA 4H7DA 2PNFA 5IDYA 3D5TA 2AZDA 1DXQA 2ZULA 3CX4A 5LBUA 1VRVA 3H1BA 1X2BA 3FTCA 1HSZA 4J0FA 5AOAA 2H65A 2VG8A 4XE5A 4OFZA 3OSZA 4M1QA 1J2RA 2YXBA 1J00A 3CRW1 3E9EA 1A4XA 2LCFA 1TEHA 3GUYA 3OIUA 4HDRA 1TVKA 1YOVB 1DKUA 2HRZA 3FE2A 4LOHA 5CG1A 1YNSA 4XPIA 1P0MA 3C16C 4QYIB 5DJ5A 2E5FA 2A67A 2EFDB 1N1DA 2WHQA 4OHBA 5ECYA 5NULA 1M1ZA 4CLXA 1K7XB 1UQUA 1G8HA 4Q9AA 1U8ZA 3CR8A 3HN6A 1M6NA 1EUQA 4M1ZA 1VSVA 5ENZA 3VJKA 4WXMA 3S5JA 1WTCA 2WF5A 1TTQB 3PB3A 3R6WA 3UTCA 3C5WP 2PLAA 2JHFA 1EWQA 3KHTA 3N87A 5JAUA 4GDFA 4XX1A 3DVLA 4X1KB 2RK6A 1GCOA 2YVQA 3IHWA 5LA6F 1WDKA 4YCCA 3VBEA 2VNJA 2CLHB 1JXQA 3D64A 4ND2A 3T7DA 5CLFA 3GFSA 1V8PA 2KHZA 2POCA 2X77A 4UCXA 3MT7A 1BDMA 4GMKA 4NTZA 2QLNA 3L9XA 3PK0A 3IVCA 2IYXA 3KV1A 4PLPA 3QY0A 4YJFA 3WGQA 3I9JA 5LFAA 3N8NA 5AD1A 2WB2A 3E84A 5BR4A 4C0SA 4Q9LA 2OG1A 3BBPA 5K3SA 4GOKA 4Z4IA 1N5MA 1URPA 1CRPA 3CUKA 1FCJA 2G1JA 1Y8AA 1TPZA 1YS6A 3L3BA 3ICPA 4QUAA 1Y3DE 5DM60 5TLSA 2VTBA 1VHJA 4GLBA 3AL2A 3QKRA 4X93A 3H6GA 4NK5A 4YRDA 3QTTA 4NCKA 3G8CA 4MINA 1LRKA 5C5IA 3COYA 3MMXA 4JJ4A 3NRJA 5IAEA 2Y1OA 2P4UA 2DC1A 2IYTA 3E9CA 1IBRA 1ELOA 1SB9A 2BFOA 3H8VA 2XHZA 3NXKA 4G4SP 4MJ7A 4YXFA 2QMZA 5CPFA 2BTEA 5B1HA 4DDWA 1V39A 1CE8A 5CK4A 1FL9A 1N1MA 1IDOA 4WWHA 4A27A 1GFIA 2LWIA 4L4UA 4OHUA 1NUAA 1ENOA 3W2FA 4AY4A 1FLDA 2P9BA 3R74A 3OTHA 2GCNA 3SJZA 1YR6A 4CM8A 4GVLA 4AB1A 2H31A 2QV0A 2IPLA 2B1QA 4Z1MA 1BGXT 1E1MA 1U1EA 2XLCA 2Z0MA 3WBFA 4OKIA 3QZUA 4KN8A 4TV8F 2AFHB 2GPYA 3B7WA 4CPDA 2OOSA 2V8BA 2YZKA 1CLUA 5CT9A 1C7ZA 4COOA 1QC5B 4QQRA 3KB6A 2CEAA 3LTEA 4RHEA 4C7OA 3GRAA 1L7EA 3TBHA 2QD1A 3WFJA 2FUKA 5ALWA 1UXKA 3T52A 1QO7A 2GM9A 4WZAA 1SEVA 3Q2OA 4W63A 3ZZMA 3M89A 2C3UA 3H16A 4AJ9A 3I6ZA 4JVMA 4D6YA 1M2GA 2GN0A 5BYJA 1EVYA 4KIJA 4WGFA 1W0CA 4MGHA 4IJKA 3OESA 2XNDD 1GCAA 2IODA 3W6UA 1L8OA 4DM7A 3W3AA 1WHSA 5AK3A 2RGUA 4J43A 1GGJA 2QENA 2A5DA 1JVNA 2N1BA 4DUZB 1GT6A 2JIBA 3FVWA 4NH4A 4RNCA 1C1DB 1MRNA 1GSIA 2CVFA 2QKYA 4C1NA 5IYZB 3LUJA 2E55A 1V7CA 4HG2A 1E0AA 6Q21A 2IH2A 3T1VA 3DBOB 4N5IX 1CUZA 4EO9A 1YV9A 3GJ3A 1XMVA 1NR1A 1YZFA 2GPBA 4LDAA 2R1TB 4CTOA 1B16A 2W37A 3NM5A 1F38A 1XD8A 4AUKA 1MP0A 1I7LA 1XDBA 1E3MA 3UWOA 1AS2A 3E5HA 1RHUA 1XALA 1UKYA 3M7IA 1M6WA 4GLFA 4HR7A 1I24A 2IT1A 2OXFA 2ZANA 2C94A 1WX1A 3I92A 3SP1A 3SPXA 1KMCA 1E6WA 1Y8RB 2WP0A 4G5HA 4X0EA 2HGSA 2PH1A 5AKJA 4D4MA 4B3IA 5JJBA 2Q3LA 1Z4IA 3BA1A 3AY6A 4JQYA 2EKDA 3GFFA 1BCRB 2F64A 3HVIA 1PHPA 2LKDA 2PGNA 3P9ZA 4Y2TA 5F1PA 3P9SA 3RS3A 3L7KA 4DM4A 2ZYIA 3AILA 3AM3A 3CQ9A 3HKDB 1V1JA 1YJXA 3UB3A 1PG2A 2CNLA 3P45A 2DKFA 5LZ8A 1U31A 4PRLA 1MO6A 1BE8A 3RW9A 3S7TA 3VC3A 1Z4NA 1AQNA 4NXMB 2OM6A 1EGAA 4OHFA 3WE7A 4UNNA 1SELA 1BDIA 4G26A 2NVWA 3WQQA 2RB5A 3S8MA 2O5VA 3HNPA 1JTVA 1R6VA 4YYEA 2P6OA 1DCMA 1DQYA 1OXTA 4KYVA 1INLA 2VP0A 1J1IA 4F7WA 5ABPA 1PVDA 1S1MA 2O1EA 1US8A 2GN6A 4FQ5A 4RCVA 2VXYA 4XUGB 1QO0D 1Z5NA 3V7UA 4Q18A 3CLRD 1JG1A 1ESMA 1E6EA 1GU1A 1LPSA 1PCXA 2R1VB 2SBTA 3JSAA 2FPGA 3TZCA 2OZLB 2BFCA 3RU9A 3DWGA 5C8YB 3D8SA 3OWXA 3GNSA 1UOOA 4JGIA 3FLAA 2Q8QA 4N5HX 2JGMA 2EDCA 1GKKA 3C48A 2WWIA 5CB4B 1E2KA 2PL9A 3R7DA 2VPPA 5JPDA 1I4LD 4UBMA 3MWGA 1YKGA 1MO3A 3U19A 4AKSA 2DBYA 5C34B 5AQEA 2I7VA 1NLFA 1K6JA 1PEKE 1FNBA 5CLIA 3R5FA 1DXYA 5B30A 4CDNA 2V6FA 1XTZA 1LPAB 1PVOA 1ULTA 1AQYA 1ZSYA 1T8UA 1HH4A 1FP6A 1XYYA 3B9RA 3RSFA 1A27A 3H3XA 3KAKA 4MVXA 3C6BA 1H6CA 1IQ0A 1P7ZA 2W71A 1T5OA 4JJZA 2G0TA 5HBGA 5P21A 2QM7A 9GPBA 5FH9A 3FETA 1MU0A 2JW5A 1KGSA 2XH8A 2HFKA 5F4BA 2QJTA 1ZNWA 2SECE 3RSGA 1Y1RA 2QIOA 4U7PB 1Q7TA 5E2IA 4BTEA 1S2LA 2IZ0A 2WIAA 3QX9A 4Z4QA 1LSJA 1M8JA 3DFZA 1M67A 4ZI2A 2APJA 3A7DA 4FSXA 3HU5A 3TQRA 4OAQA 3HK2A 4YB8A 4R2HA 1LRLA 1G3IA 2IXTA 3MZ0A 1MDFA 5C7OO 4FHDA 1QGDA 3L1UA 1XPOA 2LBPA 3THXA 2VJBA 4Q4LA 2VHVA 1CFJA 4L50A 2P8JA 1ZP6A 2O9JA 3C4QA 3PPIA 4L4ZA 1XTUA 2DU8A 5G02A 3UK2A 1JWAB 1LLFA 1CZKA 2XDYA 1W76A 2QJOA 3I64A 4KXMA 3FRHA 4O08A 3ND9A 4QVIA 2ISCA 5FV7A 3AFOA 2GXSA 2TMDA 2XA1A 3G2QA 3R1IA 2EBUA 4ZODA 3T3IA 5D2CA 2LTAA 1YUNA 4BKMA 4WJKB 3IKJA 4ZT2A 3D8UA 4NCNA 4Q9HA 2HCRA 4E33A 1ZM4A 3RARA 3COVA 5G4KA 3MAJA 2CFSA 2OYCA 1QK3A 2CVQA 3FJ1A 5K51A 4GFDA 2CZQA 3DMHA 3RS9A 3E3OA 2V7XA 5TRTA 2XQJA 3EMBA 1TK2A 5G0SA 1U3FA 4CDRA 4ZQIA 1I5RA 3N2KB 2CEKA 3IQHX 3OD1A 2J6BA 3C3YA 4RBNA 2C59A 2DHDA 4EIWA 1JAIA 2GEDA 5LYYA 4BNNA 3GNQA 1N4AA 2AW3A 1P0FA 2MU1A 3HB4X 2C9YA 3UMVA 1KFJB 4Q9JA 1JJIA 3AHDA 4MQ4A 2QI9C 1Q91A 3OIGA 3HCWA 4EW3A 2GAAA 1A69A 1NSTA 1D9ZA 4MQUA 5A6SA 5EGSA 1E2GA 1NOJA 3BK7A 1MFPA 4HXEB 4FB4A 2GBCA 2J0QA 1YS4A 3T5AA 1DWQA 1PR3A 2ZRPA 1CVRA 4CR6A 5JS7A 2WHXA 1WHTA 3V1KA 1XZAA 4G81A 2DBVO 1Y5NA 3ILHA 2OXTA 3NNNA 1MX5A 1RYEA 1CWUA 2I7CA 3BERA 4ZYLA 3RADC 1I5OA 1XMIA 2FSHA 3ZBPA 4HGRA 1R0LA 3ZKWB 3FUVA 3ZV5A 1LBIA 2JGRA 4GKKB 1CQJA 1IC6A 2F3SA 4UEQA 1W46A 5KHOC 4LJLA 3AVTA 2F8SA 3LQ2A 2FQXA 3TM4A 2DTXA 1POWA 1NXOA 5A4MS 4BU1A 3SBXA 4ZVOA 3NQ41 1U8EA 2XVZA 1CF2O 3JALB 3LVFO 3M6IA 4AY3A 2IYZA 4U7DA 1RPZA 1IOVA 1E1YA 2FU5C 3I9FA 1F0YA 2H1RA 2UKDA 4P4GA 1E77A 3IUNA 3N1UA 5C4MA 2QBYB 1FXWA 5IDXA 1WCWA 1A4UA 5FBZA 2RBKA 4H1TA 2GBPA 4CIAA 3GPIA 3RWBA 1OXXK 3SR4A 3V1LA 1S3SA 1BJRE 1G17A 3PV0A 5E8JA 5JJCA 3VA7A 2C7OA 4GBJA 5CH8A 3B8HA 5HUJA 3NIDB 5BV2P 3OPNA 3PUWA 1ZJZA 2E4XA 1SXJE 1UUFA 1XXHA 3NHAA 3RREA 1E2FA 4ON9A 3VH3A 3WL5A 3NVKI 5HA5A 1P1IA 3ETJA 2WF9A 1GGKA 4GF5A 1B3RA 1NLZA 2F1RA 4ZICA 5GM1A 1ZCFA 4QYSA 3UB2A 5BUCA 3IBTA 1L3CA 4JWKA 4IUYA 2PGOA 3SS8A 4QPCA 3LCRA 2HADA 2FW7A 2FPPA 1Z15A 2QP4A 3HWX1 4FT2A 3RSHA 1NPYA 1JW9B 1NW6A 1JIIA 4QODA 5BSFA 1JVBA 1IEVA 4HRVA 3TBKA 5H16A 4P93A 4LPSA 1YL7A 1CDDA 3CJRA 4ZAGA 2E89A 4UXJA 4BP3A 4RZIA 3FLMA 2ZRJA 5L45A 3FCYA 2GDJA 2W98A 4QTYA 2YXDA 1ZM7A 1N32B 1NATA 5TVGA 1WU7A 3NW9A 1F51E 3ZJTA 2C4WA 2QUHA 4PNPA 2PN1A 1PYGA 4RJJA 4GRIA 4WGGA 4Q3OA 4F6LA 1E3JA 2EP5A 3F7NA 3P1JA 1QYCA 1O08A 3TFQA 1NBWB 1QYIA 3QM1A 1AKWA 4IUBS 3VC2A 4BWVA 5KTMA 2RE8A 4JIGA 3EGIA 3TGWA 1OH7A 1GNLA 2CHQA 2PSSA 3Q7PA 4ATNA 4QUJA 5T3YA 1RQPA 1SC9A 2NTEA 1RRGA 2WOOA 4CVNA 2JATA 2PR2A 2WR8A 4LNAA 2LCQA 1YL6A 5JPCA 4FMDF 4U2KA 3MG9A 1IMJA 3KSBC 5KSPA 3PBKA 3R2JA 2EC5A 3JU3A 3LKDA 3TAHA 5BNWA 1XWFA 4GR5A 1KO5A 2PRKA 3K2BA 4KOAA 1A7KA 4LF9B 4NH0A 1T91A 1VB3A 2EZ9A 3Q9LA 2HA2A 3VTFA 4XQCA 4E21A 4V0LA 3HEBA 2E48A 1SD2A 3WLOA 4ASUD 3GRUA 3K9LA 2PRYA 3SXUA 2Q0SA 1G16A 1NW9B 4OG2A 3O84A 4YA6A 3UJ6A 1C7IA 3PS9A 1KEZA 2CZCA 4FFBA 4HUJA 4DMHA 1E9AA 4M1MA 1EP2B 2D7JA 3QYAA 4CCAA 4NZPA 4XQEA 4YDHB 4CG2A 1A8SA 2YYSA 1WCV1 3EEQA 3H1EA 2E1PA 4F6RA 1KP2A 5KS2A 1A5TA 1VB5A 4LBVA 4Z99A 2YIVX 1S02A 1DT5A 2ZUBA 5ERGB 1XJWA 3LOPA 2OAP1 3K1YA 1T2UA 1HBJA 3UFBA 4CL3A 2W6JD 2G82A 1G6Q1 4G6ZA 3UZUA 3NMUF 2OC9A 3FVTA 2PKCA 3N0RA 4D2IA 2Q4TA 3JQ6A 4PLFA 4QGBA 1Q7RA 3RJ5A 1F7VA 2ZCUA 4YRLA 1DX6A 5J2TA 3A6JA 3NBFA 4A8JB 5KOIA 4IDQA 5EKSA 1WBDA 3BTVA 4J7AA 3B1ZA 5FUQA 4Q03A 2DULA 1P77A 5DT9A 4D3FA 5D7BA 4LVCA 2DUJA 1K08A 1DUIA 1FTNA 2GZHA 3FGPA 1H2YA 1S5PA 5IAAA 4DNPA 2RJOA 5LCXA 3O73A 4BN5A 1LGYA 3UAOA 3LKVA 3WHPA 1EXNA 1P73A 2BM8A 2OSVA 4J6FA 1UJ4A 2R5FA 3TLAA 3BPSA 2WG2A 1CUCA 1F1JA 3IERA 1UR5A 4B3XA 4UPVA 5EMMA 2VCYA 1K89A 2OV6A 4QAQA 4IGEA 1VPEA 1GGMA 1V16B 3QRWA 1QF7A 5EIBC 3TXAA 4WK2B 1STOA 4PXYA 4N03A 4UULA 4F3CA 1MEOA 2RGAA 4RV5A 3CT6A 2DJIA 1KAMA 4RV9A 2QYSA 3COPA 3EGXA 3KVNA 3T6KA 3H4IA 1DIRA 1KMQA 3WB1A 3B1XA 3AEQA 3JVEA 3IT2A 2WM9B 3OUTA 4EELA 3H6HA 1ZXLA 3JVIA 3K0HA 5FD8A 1P3JA 2MWMA 4QSHA 1T1EA 2BELA 2OBXA 2WJVA 2G83A 2XMPA 2J3HA 2ZBPA 2IHZA 2PL5A 3EIFA 2AI3A 3N76A 1LKZA 4F46A 1KJ8A 1QSGA 3IOBA 1P0QA 4WTOA 2COUA 1X7GA 1FXWF 5HM6A 1UC8A 2NYRA 1BRTA 1G4HA 3DPSA 4TV9A 2JRLA 1G8MA 3I53A 1U0BB 2X5XA 1P31A 2WWRA 5CX4A 2YRFA 1W0KA 4O4LF 1XDGA 3GN2A 5ENVA 2JVJA 4FCVA 2GCPA 2G63A 2R7NA 4GOXA 2NG1A 1K27A 3Q6MA 3JQGB 5DYTA 3VYWA 1RTTA 1Z45A 1X80B 1TCVA 3G2IA 4INPA 3N2NA 4HQFA 4DUYB 1L1EA 4LJ7A 5TT1A 4LXYA 5CT8A 4ZD6A 5CBPB 3PA6A 4TKLA 3ZU4A 3CUSA 1XTRA 4MV9A 4MW9A 1BE6A 3X1ZA 1EUDA 4RL6A 1H22A 1H2BA 1LK7A 2JLCA 4MWCA 3K92A 4BFXA 4E3ZA 1FYXA 2GBLA 2MYPA 4OXYA 5HTOA 4CF6A 3MJTA 2EL9A 2V8OA 3JAWA 1ZD8A 1BX3A 4CU2A 1FSPA 3I34X 3Q11A 1YU6A 4UW9A 1BWQA 1ZM9A 4FDMA 1O9GA 4V0NA 1EFPB 2JAOA 2OQIA 3U44A 4BO0A 5LZ4A 3A2KA 4EG5A 3K20A 2H0AA 3UT5A 1LF0A 2A3NA 4HAXA 2MMCA 1XPJA 3NTXA 1GILA 1P62B 1SOAA 5ADHA 3QENA 3NDIA 4F3TA 3KUUA 2DLCX 1PZMA 3HKEB 2BW0A 4PVDA 1IHXA 5E4JA 1PJ4A 2XGJA 4Y98A 5ARCA 3LX5A 2VP5A 2VCEA 1DLJA 1NIJA 3AYZB 3LF1A 3V4LA 5MN4A 4EPYA 2FRDC 3T3HA 1N6LA 1K98A 5J63A 1GUBA 5FWXB 1CUEA 2LDBA 3FYDA 1DOZA 2BMJA 2R87A 1YF3A 2FW8A 4D9GA 3EVCA 1P44A 5F98A 3LOQA 1DTWA 5DHUA 4V1CB 1ECJA 2Q46A 1WB6A 4ZEMA 2B4YA 3E3MA 2JIDA 4M49A 3OPYA 3LCMA 4ZALA 3BRWD 3W5IA 3PWZA 2ZI9A 2ZYVX 3GDGA 3RU2A 4C0LA 1QGED 1QHEA 1TKRA 5DX8A 4DKJA 1XCBA 3WNQA 2FPLA 3HWWA 1LI7A 1AZTA 3KC2A 3QITA 2ZUCA 3CJQA 2HZ7A 2WC1A 1ADYA 1NVAA 3ZWPA 3OEWA 1VGQA 3WBKA 5B7GA 3ZDDA 1S3IA 1U0TA 3TR6A 2FQWA 3NHZA 2NPFA 1U2RA 2RGBA 4CTJA 3ZHXA 1NIPA 2O3UA 2W2KB 3LH5A 1WCIB 4R9NA 2DBZA 5ALJA 2IHUA 3H8SA 5H83A 2PSDA 5CM8B 3AIOA 3IXMA 1SN7A 1OYOA 3N5CA 4BOYA 2QI9F 3IP9A 2E1RA 4O8CA 1PYDA 3HV2A 1NX6A 1JBKA 2XEXA 4GPEA 1P9WA 1J2EA 1LVHA 1OZFA 1LB1B 1N0UA 4NDAA 2NV2B 3T5BA 1M10A 3KO8A 1IY1A 1GD1O 4JROA 4KXVA 3R0QA 4DLSA 3AF4A 5J2TF 5T8KC 3NJ4A 4JITA 3IESA 2EBWA 4OHWA 4WL0A 3G5UA 3DKRA 2XRFA 4PWYA 5B58T 3JAKB 1PJBA 2HPVA 3W8FA 4AC9A 3CY6A 4ZPXA 1D6SA 3L6UA 3UF0A 5F2EA 4F45A 3AF3A 5JQGA 1XZEA 3W8RA 4QIHA 4RH0A 4AMBA 4UMFA 3CLVA 1M2NA 4RJTA 3BGDA 4KR3A 5KO2A 1KPHA 2W7TA 2YZGA 4IF6A 2HIAA 5F35A 1C3LA 3TL6A 3EGDB 1Z22A 3B6EA 4J0DA 3T4EA 1KF0A 1TO2E 2VHUA 1DEAA 2MJLA 3JD2A 1UBFA 2WYHA 4U9HS 2UUAB 3AVXA 3KAPA 4J76A 3FTFA 1NY5A 1UMKA 3LYAA 4Y2QA 4INOA 1RD4A 4C5BA 5EI5A 3NATA 2I71A 3FHLA 1NN5A 4B71A 1Y9AA 5TSDA 2ATEA 2FX2A 3IB3A 3R5HA 4ENQA 4ILEA 2IDJA 2XYGA 3R0IA 3DV0A 4RY2A 2YC4C 3V80A 2YWGA 3JX9A 2BHSA 3PCXA 4DSZA 2D59A 2VYVD 3O6VA 1E7RA 4M8IA 4DB2A 3C5CA 4G4JA 4LGMA 5FWYB 1VLJA 1BD4A 1YS2X 3B3QA 4LZPA 4NYJQ 4E2ZA 2DBRA 3BWCA 4IG9A 5JC8A 5MN5A 3GLIA 1PSDA 3BJEA 3IKTA 3DL7A 1T5IA 1RM3A 3QVGA 4UMDA 2B1IA 1T8YA 1FUKA 1ORVA 1J23A 3IAM1 5FOXA 2XDAA 3DLTA 5HQJA 1ID8A 3AVVA 2ID7A 3CW9A 3IP8A 4LXXA 4WNAB 1BW9B 1OYYA 3PUKA 1MHTA 2CMFA 3L1IA 5KYUB 3VC1A 3WGKA 5BXYA 1P2BA 2OV4A 1IQRA 3E7XA 3PGJA 1BS1A 5BPHA 1SCDA 2X0RA 1WUHS 5SY4A 4OGLA 4Y2SA 4DV1B 4NCBA 5DM2A 1SVSA 3L79A 2VNKA 4GKJB 3JWPA 1N5RA 2ECQA 4TV9F 3B1KA 3PFGA 1EDEA 2CLFB 4ZCQA 1A7UA 4EHKA 2JJ2A 3L0ZA 1LBEA 1UXGA 2ZJAA 3TLYA 1SVNA 5FTKA 5ED4A 4MWSA 2B4QA 3REGA 1LD3A 2HMWA 2VKQA 3DEHA 4RD2A 3SEFA 4WQMA 2RGGA 4WY2A 4DYVA 5CITA 2Y1DA 3FLBA 1P7CA 4I5GA 2D7DA 4YRTA 4GUAA 1PE0A 1P8AA 4WN9B 3ZJVA 2Q3MA 3QU4A 2QLMA 3EA4A 3Q3GE 4K1LA 5KYWA 3TG8A 1IOZA 1Q3HA 1HQCA 4AF6A 4EZEA 3EPLA 3E1SA 5JZ9A 3ENNA 1CVLA 5AVYA 3N5KA 2ZBRA