3WMEA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
588
structure length
588
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAGAAQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-binding cassette, sub-family B, member 1
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein
total genus 214
structure length 588
sequence length 588
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmeA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmeA02
1OKKA 1M7GA 1OXUA 1R0XA 5E3HA 2QRNA 3QKRA 1BOFA 1ZM4A 1GWNA 2C03A 2F7SA 3KKPA 2VF7A 1EX7A 3SU8A 2ZI6A 2CBZA 3AEZA 1JB1A 3R9IA 5L3QA 3EZ6A 2G1KA 1P4SA 2CLSA 3BB3A 1WCV1 2V6IA 2XZPA 3BFKA 1GIAA 2FNAA 2FU5C 1W36C 5C4MA 3W6PA 3DZ8A 4PX9A 3ZH9B 5HKKD 1E2KA 2R8RA 4OK6A 1TF7A 3GFTA 3HPQA 4MKIA 2IYQA 2VEDA 2IS1A 3FDIA 3AM1A 2V9PA 3GLGA 4PAOA 2P65A 3AGPA 2NTYC 2HF8A 1OF1A 3RS5A 2CHQA 4HATA 1U8YA 4NL4H 5J4KA 4M9QA 4JLKA 4LC1A 3RSOA 3LW7A 1NY5A 4V02A 1KO1A 3ADDA 2WWHA 1W0KA 1HEIA 1N6OA 2BC9A 5K8UA 4FW9A 1G1MA 1RRCA 4R2HA 2DFLA 4RFVA 3IKJA 1KZGB 2RMKA 2WJJA 1XTQA 5D3MB 2ZITA 1KYIA 3VFDA 2FFHA 3W3ZB 2A5FA 4Q18A 1FZQA 3UPUA 2O8FB 1F60A 1J2JA 2RCNA 4LJAA 1R4AA 1G7CA 2VRWA 3I72A 3F8TA 4PPFA 1JXOA 3LV8A 4KBFA 1QHHA 1R0YA 1R10A 4WA7A 3BH7A 1GNQA 1N0WA 1DAKA 1JR6A 3AVQA 2EW1A 4M21A 2XX3A 2CMKA 1TPZA 2PH1A 4GT1A 4BFYA 1TQDA 3TVDA 1AS0A 4TMZA 2ORWA 1E0SA 1ESMA 1KSJA 3PFIA 4BFSA 2C78A 2O5VA 3U3RA 4IDOA 1SKYE 1U0LA 2V7QD 4RKFA 4B71A 5CDFE 3FFAA 1X6VA 1E79D 2R62A 3KJIA 3IO5A 3GPLA 2G88A 1TQ6A 3JVUA 2IWRA 4Q03A 1XEXA 4O25A 1Z6TA 4HZIA 1FUUA 1Z2CA 3RRZA 1D5CA 2GJ8A 5JJLA 4F93B 2NO6A 1JAHA 4PO1A 4YMVA 3SYLA 4HLUA 3SI7A 4D4KA 4Q4AB 3ETLA 2G6BA 1G3IA 3SEAA 2QT1A 4ON9A 3ZZTA 2YOHA 3LVRE 4DDUA 2HF9A 2RGXA 4AG5A 2W0MA 3ZDQA 4NKRA 4E07A 1DAGA 3CNOA 5BYJA 3L0PA 1G20E 2ZI3A 4ERNA 2ZRBA 2CJWB 2ZVPX 1GUAA 3PUWA 3QNUA 4KVAA 1GOTA 3HJNA 3OHMA 1F48A 821PA 2C9CA 3K1JA 1KJZA 2QZ4A 3U44B 2RKOA 2ZJAA 4C0QC 3OEEA 2ZU6A 3TVTA 2ONKA 3EA0A 3W3AA 2Z83A 1GTVA 1QG4A 3CM0A 4BLSA 3LXXA 2GXQA 2CLCX 3MJHA 4RFSB 5GVSA 3SQWA 2X2EA 2JASA 4JVNA 4PO9A 1OHHD 3WBKA 4IDHA 2WWFA 3IBYA 1YR6A 4L9WA 1F2UB 4JSTA 3B1VA 2ODBA 1HT2E 1TX4B 5KPJA 2CCGA 1NN3A 3B9QA 3VX3A 2C2HA 2L0XA 1EFUA 5HZHA 4TT3A 2WIAA 2J7PD 4PPGA 1R7RA 3CONA 3MWLA 4LYJA 2OAQ1 4B3CA 4TL9A 2O8BB 2F1JA 4XWKA 1OLOA 3SOPA 5JI2E 2RGNA 4Y0AA 4CT4B 1CR1A 5KYKA 3KQUA 1JJVA 1I2DA 4QL3A 1KAGA 3NH6A 3T1VA 2AXPA 3THYB 1OJLA 2DWPA 3VX4A 2ZM5A 4KFRA 2ZRFA 1OH5A 1OPXA 1R8SA 1HUQA 2F43B 3AB3A 1JR3D 2PCJA 3L0IB 3EAQA 4TYYA 1Q3HA 2CVFA 3TAHA 2KE5A 1SXJD 1IN8A 4P3YA 2D2FA 4W5HA 4MGKR 5FL7D 3VKWA 2QGNA 5AJZA 2JGNA 1ZUIA 2Q3MA 1T8TA 2ZS7A 1YU9A 3CO5A 3H84A 2IL1A 2HJVA 2F1HA 3UMFA 1Q20A 2GXUA 1V5WA 3JZAA 4CDGA 4LJ9A 2CK3D 2ZPTX 1G9XA 2H1LA 4KVGA 4QBGB 5B30A 2MSCB 1XTJA 2X77A 2ATVA 3TQFA 5J4VA 4B33A 1JI0A 4OQMA 2DYKA 2ZREA 1ZM2A 4H1VA 1SXJC 2O8FA 4P33A 3D3QA 1KO4A 3MUFA 1XD2A 4UXHA 2BEKA 1F2TA 1IN4A 4F4CA 3KKMA 3V9PA 1GDDA 3FKQA 3LQQA 3M0EA 3BIFA 1OW3B 2BBOA 2ZRLA 1C1YA 4ZDJA 4HLDA 2O8DB 4AKIA 1ESNA 1XEFA 3QPVA 4B35A 621PA 2WVJA 2HLDA 3RNLA 3B78A 1R8QA 2IUUA 4BUJA 2ZRNA 1E9SA 2A5DA 2W6JD 2JIZD 3EC1A 1XZQA 1R5OA 4Q01A 3TLXA 4TYNA 1ZW6A 1QHNA 4MYCA 3QVUA 4GBMA 4RCYA 1SKYB 1ZYUA 2FN4A 5KUTA 4TWZA 3BRWD 3NC0C 1NY6A 1WA5A 3W8NA 2J59A 5CLLA 3V4FA 4ACAA 3FHTA 2GZAA 5FUVA 1NVUQ 2XSZD 1EWQA 3ZIAD 3QE0A 4FINA 4A0RA 4Q1EA 3RANA 3K8YA 3OE7D 1XDBA 1CP2A 2PT5A 2FOLA 3TRFA 1Y3AA 2FH5B 1BS1A 4DSTA 3EASA 1ZM7A 3C4JA 1E0KA 2CJWA 5AUOB 3I73A 2QMEA 1YRAA 2J0VA 1MO3A 1GAJA 4RD3A 4ASUD 2XOKD 5J4YA 2IS2A 1KDTA 1ZJ6A 4EJSB 5FUXA 3WMFA 1P7CA 5F9FA 3BB4A 3NBFA 3RDPA 3SYNA 1UBFA 2J9RA 4OYHA 4D0NA 1JXMA 2I1VB 2V6JA 4RFSA 3SHWA 1JNYA 3F0TA 4DLSA 4LHXA 1U94A 4PR0A 3GFPA 1KHTA 4A8JC 3EZ9A 3IHWA 4EFNA 3OIYA 2B8WA 1Z0JA 2Z4SA 2GWHA 4NZYA 5FTNA 3Q8XB 3GLFA 4PO8A 1OFHA 2P0EA 4A2WA 1FTNA 4YONB 1G7RA 2Q3HA 4TQUS 2CL7X 2GXSA 3GLHA 5HTKA 3LX8A 2G9NA 1YZQA 4H1UA 4C0BA 4B3XA 2FSIA 2EVWX 5J5CA 3KTAB 4A2QA 4TTPA 4LUCA 1Z07A 4XD7D 4FMBB 3NWJA 2ZYTX 2V8OA 4YMSA 1OH8A 3AVXA 2TMKA 2ZE6A 1ZCAA 5FPKA 1W48A 1S8FA 2CEAA 4CRWB 3TW4A 3T35A 2GVZC 4QXAA 1GKUB 1UDWA 1UJ2A 3DO6A 3AKDA 1TF2A 3MJRA 4A0FA 3CLVA 3EZFA 2QMUA 2ZUDA 3SE0A 4BLOA 2YV5A 1WMSA 2WPDD 3QBVA 3KL4A 2IEZA 2VF8A 1FNMA 2HYDA 2A5YB 4D25A 2BKEA 1D2MA 3SFZA 3KQHA 4OHZA 3K09C 2WMOB 2A2ZA 4V0OA 2ZYWX 2GDJA 4EQ6A 1OYWA 1AS2A 4OHWA 4OKSA 2O8CB 4HUTA 2Z0MA 4BZXA 3RWOA 2IYZA 5TDHA 2HT6A 3SJCA 4R71A 4M9XA 2WM9B 4TTQA 1M7HA 5JWHA 1K5GA 3JZMA 3QKTA 4RKEA 3MFYA 3DVLA 2O8DA 5DISB 5IT5A 4KSBA 1YR7A 1Z0AA 3DM5A 4IRUB 2XXAB 3A1WA 2Q3FA 3W6NA 1UBEA 3H0KA 1XBTA 1YE8A 2ORVA 3WMEA 4DSOA 1CXZA 2ZAOA 2GRJA 2QE7A 4BRWA 1FUKA 2RGEA 4XJXA 1NKSA 3U4QB 2VPPA 1R5NA 5AUPB 1Z63A 4FXPA 3AVOA 4TN1A 3UWKA 4NCJA 1IONA 5CDFA 4G5SA 3RRNA 4OL0A 4V0LA 2VBCA 1CR2A 3FKSA 5J4HA 2GZHA 2DHRA 1ZNWA 3U3JA 1E9FA 5ANRB 4O2RA 2ZYVX 2I3BA 5FOTA 1FX0B 2HV8A 3CUEF 3PUZA 1ZU5A 2PJZA 5AJYA 5JZVA 3B1ZA 3SFVA 1OFUX 4KCGA 4P31A 4DT1B 2H7VA 1EESA 4ARZB 5EP3A 2WJVA 4LBZA 1NVVR 2OFOA 4PTLA 1KNQA 4YLGA 2V1XA 2ZE7A 4LJ4A 3QXXA 3VTKA 4BE7B 3VKGA 5DN6A 1G64A 1FP6A 4FI3C 4Q1CA 3U7FB 1RFLA 1VCNA 2C9OA 1D6JA 2ZSFA 2G0TA 2VP4A 4JLMA 2CE7A 5H1YA 3OIUA 4QM7A 4AURA 1WP9A 2KBFA 3EA5A 1UAAA 2GEUA 2ASEA 1GL6A 5JLJA 2CL6X 2IS6A 4JLAA 3BFXA 3T1QA 2FPKA 2BBWA 5JJIA 5FR2A 4MRVA 1VHTA 1GNRA 2J0UA 1XTRA 3BERA 3AF3A 3S1AB 2BEJA 1MKYA 3VR6A 4B3DA 4PHTA 3AVYA 2G3YA 1N6PA 1BMFA 2OSBA 2P67A 1KK2A 2LCFA 3EPKA 1Z6XA 5EJEA 1YZNA 2YWFA 1IJFA 3TIFA 5JI3E 4A2PA 1DO0A 4I1OA 4BFXA 4LHYA 1E99A 1W2HA 3SBDA 4S35A 4YMUA 3NH9A 5EXTA 3OEHD 1NVXQ 4DDWA 5EQTA 2ZJZA 4IFEA 4JSYA 2ONJA 4KU4A 4UJ3A 4F91B 1KMQA 4BLQA 3KUCA 3I8SA 4E22A 4NYIQ 1ZU4A 4IHQA 2JLVA 2WICA 1E32A 3G82C 2OO7A 3NXSA 3OEED 2EFDB 2WSMA 4Q4JB 4JLNA 4XSGA 5IHPA 4LBYA 4ITRC 4UNQA 3CIOA 2IHBA 5B2ZA 1W4RA 3FOZA 1TQ2A 3GP8A 5FPYA 1EFRA 1G8YA 5CIQA 2GBLC 2QM8A 2OFWA 3SYKA 2JJ1D 1ZNZA 3B7GA 4R98A 3C16C 4LV8B 1T6NA 1SHKA 1JJ7A 3U3MA 2JA1A 1Z0DA 2LWIA 2IC5A 1JEEA 1NF3A 1V43A 4PQYA 4QGAA 4B6EA 1FP7A 221PA 3T12A 3T1TA 2O8CA 3B13B 1D8TA 2QSZA 4NYJR 4LWZA 4LHZA 1Z8FA 1ZC4A 3QBTA 1CIPA 3IIMA 4B74A 2X2FA 3FWYA 1Q12A 1BKDR 1E1QD 1G8HA 1J70A 4QNMA 3I5XA 4IVRA 4EPXA 5A4JA 3TR5A 3A58B 5DYIA 1XD9A 4XTCS 4LBVA 4NMMA 4QBFA 2G0NA 4IEEA 2XXAA 2WBLC 4Z8YA 3TH5A 3HU2A 3K53A 2CVHA 1G7TA 2P5SA 1G5PA 3I4LA 2C98A 4JLOA 1FNNA 4NPHA 2F3TA 1XTIA 1Z0KA 3DMDA 1DARA 3WRXC 2ZU0C 1OSNA 1FMJA 2FSGA 2V55B 3QXHA 4Q4HB 4EDHA 2BV3A 1KDRA 1NIPA 2FE4A 4WXRA 1G7SA 2RGNC 3PQCA 2UKDA 1N6IA 4GP7A 4Z1MD 4F7WA 2CDNA 1AZSC 3TW8B 5DLQC 3I61A 4BLPA 2W2VA 1RW4A 2EWWA 4DT1A 3RAPR 1A7JA 4IXNA 4QGGA 1OIVA 3AKCA 2O0HA 2ZR7A 3A37A 4ARZA 3WBJA 4XH9B 3LNCA 1N0VC 3IBGA 2IWHA 4KITB 4DCNA 2GZDA 3UMSA 3T5GA 1QHSA 4RZXA 3CX8A 3WYFA 1MH1A 5DIFA 4D6PA 2ZRAA 3NHAA 4HEJA 1H8ED 1P73A 3C14C 4JMPA 4XVRA 5DNYB 2J5XA 2FGJA 4C0AC 4M53A 5CIWA 4Q1DA 1VG9B 3VHLB 4D2IA 1VECA 1S2MA 1X8KA 1COWA 1VYVA 4C9BA 1Q3TA 1GITA 2GCNA 3WP1B 5L3RA 1DS6A 2RGDA 4RJLA 5LD2C 1NVVQ 3PR1A 2XZOA 3KFVA 4TLDA 3QSYA 1NBMD 3H2YA 2FPMA 1TNDA 1II8B 1WRBA 3L8ZA 4PAMA 2BMDA 4IJMA 4LPSA 1E2PA 1KY2A 2PT7A 1IY2A 2VHUA 3K9LA 2CCJA 4WZAE 5JS8A 2KSQA 1VMAA 3PEYA 4EPVA 5KPDA 1GZSA 4C2TA 3EC2A 2PBRA 1J7KA 3O8BA 4IDQA 1MO4A 2IUSA 5FTJA 1QHIA 2VSFA 5IDVA 4Q7LA 1N6KA 5A5GA 4B44A 3CPEA 2QAGC 1I4LD 1CR0A 2AD5A 2AN9A 2DY1A 2FFQA 3ZZUA 3IUYA 4QKQA 1VG0B 1CJKC 3MGCA 3BBPA 1RRPA 5F98A 2I1QA 1QHGA 2D06A 3EWSA 2C96A 4EFMA 4XSHA 5DYGA 3UANA 2BHRA 2PEYA 1FOEB 4Q4JA 1E96A 4AYWA 3PV0A 4UKDA 3RC3A 1GRRA 4OI1A 2D62A 4LSGA 5HZKA 4FWTA 1OIXA 4LJ7A 3PUVA 2QM7A 1MT0A 1SQ5A 3L82B 4IXMA 4MKGA 2AKAB 4A15A 1T8UA 2PJRA 2J87A 1W4BA 1CS4C 1RE0A 4M4SA 4WOPA 4GZMA 3SNHA 4A0GA 1PLLA 4AYTA 2XGJA 4FCVA 1QRAA 3CPHA 4XOIA 2IXFA 3DEFA 4OI2A 1XCPA 3T61A 4CEHB 5HE9A 1XF9A 5AJVB 4TLCA 4EPTA 2X19A 5JCZA 1G19A 2XJ4A 1P2VA 3L2OB 4HAZA 4KLZA 3UXMA 4PC1A 2QRZA 4GOJA 1TQ4A 4TQ9A 2HCJB 1P62B 1XXHA 4FMCF 4BEJA 5F3WB 2B92A 4NP6A 2BOVA 4NYJQ 4AIIA 1U9IA 4PZLA 3LXRA 4DLXA 2QN6A 3M4YA 3QVVA 3K0AB 2QBYB 4EPYA 1KJWA 5L3SB 2FF7A 4JIMA 2KB0A 4DCVA 5TXGA 4Q4HA 4DCTA 1DAHA 2PL3A 4UJ5A 4QNRA 4B32A 2GJKA 1A2BA 5JHHB 1RIFA 3NEJA 1MO6A 1HE1C 3I1FA 2YC2C 1XTKA 2GJAA 4NU0A 1EFCA 2QP9X 4ZDKA 1IXZA 4HUQB 1X1RA 2JDID 4QJ4A 4V0MA 4C0SA 2O8EA 1GRQA 1ZINA 4KYIB 4O2LA 1KI9A 5FTMA 5KNBA 4W5WA 5FTKA 4A36A 1XCMA 4IDNA 1OFIA 2ERXA 2HXYA 2JJ2A 4D26A 2VH5R 3IIKA 2G1JA 3A6PC 4US2R 2KJQA 1YQTA 1GG2A 5EE5B 1TU3A 1UKYA 1MABA 2IF0A 2AHOA 5FBQB 1E4VA 1P9RA 3IGFA 2JLZA 3TMKA 2FFBA 4Q1FA 5FOSA 2A5GA 2MMGA 4KI0A 2P3SA 5EP1A 1W5SA 2FX3A 3FMPB 4B48A 2XNSA 1TL7C 3L43A 1ZD8A 3K0FB 2OCAA 3GCGA 2LKDA 5CM9C 1Z6AA 3G0HA 2GHIA 4MYTA 1XMVA 3TJZA 1RRGA 1N25A 2ZJ5A 2BJVA 3MWJA 5EXXA 1E6CA 3SHFA 4M0LA 2XZLA 5G40A 3U3OA 2NIPA 1II8A 1W7AA 4B6FA 2A3RA 1GKYA 3KB1A 1GVNB 1M1YE 1S0UA 1X3SA 2QT0A 3DHWC 6Q21A 2GNOA 2XTNA 121PA 4MGIR 2XTMA 3MWYW 5EXSA 5BXQC 4MRNA 2QPOA 2F6RA 4LJ8A 4KODA 5EP4A 4Q9IA 4V03A 4B47A 2DFTA 1RVDA 1L2TA 2FSFA 4Q19A 1KKLA 3MG9A 4MRSA 1G3QA 2OM2A 4L9SA 3UKDA 3OAAA 1PLKA 3PITA 1P60A 4TMXA 4DLVA 3QF7A 1OYYA 2ZRHA 3KKQA 4LC0A 3X1WA 2I4IA 3A1VA 2ZI7A 1A82A 3VR4A 1II0A 4TLEA 1Z0FA 4R9UC 2ZTSA 3CWZA 1E2GA 4U7DA 1TF5A 2VP0A 4UNPA 4DLZA 3KX2A 2PEZA 3K70B 1US8B 4WZ6A 2A5JA 2IK8A 3ADBA 3MD0A 4NTZA 4QRHA 4R2IA 1AZTA 1MV5A 3PXGA 1KO7A 3OFNA 4TL8A 2Z4RA 3CX6A 4N0EA 4A92A 3NIBA 3GJ5A 2NO1A 3IQXA 5J47A 3THWB 2H16A 3C5CA 4QOSA 2HXSA 4URUR 4KFSA 5K8LA 1T4GA 3PUYA 1G291 1NNEA 1BMFD 2OHFA 3OIWA 2V54A 3GJ6A 2IA5A 1X8JA 2DFNA 2CHVA 4HDQB 3BAFA 3BC1A 1R2QA 4PC7A 1AIPA 4M1TA 4DLYA 3KFXA 1KMHB 2GAOA 3P4XA 4ZI3A 2J46A 2BWJA 4G5GA 5EXPA 4K8OA 4GOKA 3R8CA 2A78A 4TL6A 4ZPXA 4LRWA 3LVQE 1ZVQA 3U2QA 2HCBA 4MQBA 1E98A 1FMLA 5TY0A 4KFTA 2QBYA 5G53C 5L3SA 4W7SA 4XVQA 4FCWA 3ICEA 3LY5A 4C7OB 3CW2A 4OQXA 2JLQA 1P2UA 2NOAA 5L3VA 4QG7A 1NRJB 1OXVA 1E9RA 3AQ4A 5GJWC 3PEUA 1VCIA 4FMCB 3M6AA 1QF9A 1KGDA 4XTRA 1X8LA 1CULC 1E2QA 1XEWX 1G3MA 3ASZA 1W36B 2A30A 4DEYA 1E2JA 1B23P 2C95A 4LYAA 3HPRA 2WKPA 4IOLA 1DBSA 2RGGA 4HB0A 4DDTA 1YZGA 4DRZA 2WAXA 1N2CE 4RD2A 4A1FA 4PPQA 1Z6YA 2CNWA 2N46A 3BK7A 5C1BA 1KI6B 4AY2A 2QG6A 4I4LA 4OHYA 2RGCA 1MO5A 4MRRA 1JR3E 1SVWA 2OG2A 5D3MA 5C2JB 2QTHA 3DKPA 1RPZA 3RSLA 1SXJE 2YWGA 3KUDA 1DAMA 1DG3A 3EXAA 1Z47A 1Z5ZA 3K0FA 2GAAA 3B1YA 4D0GA 1N0UA 1Z6GA 1Z2AA 2OLJA 3CRMA 5FI0B 2Q9CA 2R6CA 2BDTA 4KV9A 3VHXA 5FBVB 2AK3A 1HA3A 2ZSEA 4PSAA 4QGHA 3CZPA 1OFTA 2IBMA 2UVQA 2BMJA 4B76A 4CF7A 3N5CA 4PXAA 3UG6A 3CH4B 5IK2A 1NLFA 2ZR9A 3QQ5A 4RD6A 1NMZA 3Q5DA 2Z5FA 4JLJA 4WAUA 2OCBA 3I92A 4X8OA 4DLUA 4M9ZA 3X1XA 4DLWA 1H8HA 4DJTA 1OIWA 3WMGA 5KSOA 3ASYA 2IEYA 2QA5A 1ZCBA 4TSFA 4LV6A 3ZLJA 1NG1A 1W0JA 3GEHA 4JT4A 3CNNA 2P6UA 1ZUHA 4Q4AA 1T5IA 1Z3IX 3LWNA 4G1UC 2D7DA 1ZAKA 3EIHA 3R7WB 3NBXX 3FGNA 4Q47A 1UFQA 2ZRGA 3TGPA 3LBHA 5HCIA 2ANCA 2QMOA 1KSFX 3U3KA 2AL7A 3M1IA 2NO0A 4ZCLA 3B5JA 3FB4A 2BVNA 2J45A 3AVPA 3BFVA 2OT3B 4WZBE 1US8A 4BECA 2WJYA 3B9PA 3UIEA 3U44A 3MMPA 1Q1QA 3FPAA 1E1RD 3BGWA 4U02A 4DSNA 2XTZA 5GJBA 1LF0A 2O52A 2JLXA 3X2SA 4HDOB 3QEOA 2NPIA 3LLUA 1L7VC 3AV0B 3UMRA 3THWA 5JJKA 2E1RA 3HP1A 3SS8A 1D2NA 4LJ5A 3SZRA 2J0QA 1EFTA 4DUGA 2QSYA 4OHVA 1YJ5A 1JEDA 4YDSA 1CJMA 1F2UA 1PJRA 2R65A 4RCZA 4NE2A 4LX0A 5KDLA 1W47A 2W6IA 2OUKA 2CLDX 3BE4A 3LBIA 2F1IA 1KI7A 1RKBA 5D3QA 4HZUB 4Z51A 3W34A 4G0NA 3NHBA 2GF9A 3C8UA 3QKUA 1YKSA 5HCNA 3K0EA 5BN3A 2EFCB 1R0ZA 4PC2A 3EPLA 1JPNA 1S3SA 2O8BA 1BO6A 1G6HA 1KO5A 4TQAA 4DIDA 4HAUA 1LNZA 3THYA 1S1CA 3KXIA 3RVBA 1QVRA 3CR8A 1KSHA 2FDCA 3LX5A 2VP5A 5TMPA 3SQXA 2B7BA 4URVR 2QMHA 8OHMA 4N1AA 2UZ3A 3CX7A 2F43A 4Q7KA 1XMJA 5DI9A 3W8RA 3BH0A 4CZ2A 4YXWD 1EK0A 2C99A 3GLIE 1RZ3A 3OZXA 2WIBA 3HDTA 3HR7A 5AWFC 1S4QA 2A7QA 2CE2X 1LFDB 1FQJA 4G3XA 2QPTA 4RZ3A 2WWXA 4L8GA 1HT1E 1P6XA 2ZIAA 5SZJA 2GF0A 1Q22A 2G83A 2W0SA 2GXAA 2NPFA 2PMKA 2W58A 1KI6A 1LTQA 1SVMA 3GJXC 721PA 3DDCA 5HE8A 1J8MF 5DSZA 1CJUC 3OESA 4D80A 1HV8A 5B58C 3AP2A 1OKKD 2DCUA 3THOA 5HKKA 1Q44A 3B1XA 4D82A 4TTRA 3I62A 1NSFA 1ANKA 1G3UA 4I1UA 2ZROA 3CF2A 1DO2A 4DHEA 1SXJB 4ZCMA 2BIFA 4Q66C 3B2EA 2IXEA 5DI3B 1DELA 5JSZB 1IBRA 4CT5A 3ZZ0A 3DKVA 4LPKA 4CGZA 3DPUA 3KQNA 4C0HA 3C7KA 3GJ8A 5JCPA 3BH6A 3U60B 4PQFA 4JKYA 5JBQA 2KI5A 3ZD6A 3HYRA 3A36A 4Z8XA 1U9IC 3L0OA 5IRCD 1ZBDA 4BFTA 4KHZA 5G41A 1W0KD 3AVVA 1QZXA 4QJ3A 4IOMA 3CNLA 4YDHB 2FGKA 2QPAA 5GVRA 3A1TA 2IYVA 1Y63A 4FWIB 2OLKA 4DWJA 1M34E 2ZJ2A 2HUPA 4NYMR 4ZKDA 4MYHA 3E1SA 4IDPA 3QJYA 3NDBB 1JAIA 1VIAA 1DG1G 4POAA 3CR7A 4R7ZA 2P6NA 1ETUA 2V7QA 3NDPA 1M7BA 4CVNA 4MYUA 1UF9A 1E79A 2D3WA 1S9DA 3ND8A 1XFAA 5J4LA 1DADA 3K0CA 3PCRB 5AJWA 4EJSA 3BOSA 3C15C 2WHXA 2WWYA 4NCKA 2C04A 4HLCA 4E03A 4NCHA 2RHMA 2FFAA 2YWHA 1O3YA 4JL6A 4X8HA 3QOFA 3K9NA 5EP2A 3KXKA 2E9SA 2B8TA 3LBNA 3LAWA 4L15A 4LV5B 1DVRA 4Q21A 5CK5A 1UPTA 1UM8A 3QXCA 3EPHA 2WTUA 4URZR 2Y8EA 3IO3A 3AUYA 1VKJA 1E94E 2ANBA 5KSZA 2ATXA 5P21A 4Q9LA 4EKDA 4AK9A 2ZI5A 1XX6A 1AS3A 5CYPA 2BM0A 4A8JB 2GETA 2QEQA 3SR0A 3CRRA 4KXFB 2FWRA 1G4UR 1VIYA 3B82A 3LH5A 3VAAA 1TADA 1UKVY 3KTAA 4F92B 4GRAA 1NL3A 4TMTA 4MKFA 1YRBA 421PA 3TQCA 4CEIB 3HR8A 3F3YA 1N3BA 4HLUC 2HEIA 1OHHA 4YQFA 1VTKA 3U6BA 4AD8A 1RYHA 4JLPA 3ZVMA 3SDZA 1EGAA 1AQUA 2PCLA 1NKTA 2AFHE 2YHSA 5ELXA 4IOKA 4NCIA 2OESA 1EG7A 4Q7JB 4OQFA 5BN5A 3O47A 2HYIC 3VU9B 5JEEA 1KDPA 5HPYB 2J7PA 3EPJA 3GLIB 1U81A 1HH4A 1YVDA 4C2UA 4A82A 2OCPA 1EXMA 2F9MA 4DCSA 3Q7QA 2RGAA 3O8RA 1G41A 3Q5EA 2EWVA 2XAUA 3RHFA 3RWMB 4Q48A 1KZ7B 5M04A 4TT3D 5FOWA 5CM8B 1GL9B 2XB4A 4GOXA 4X8LA 2VIIA 3VR3A 1RC8A 4AC9A 1OT3A 3RS4A 2OAP1 4B3BA 5CB6A 2XNDA 1SXJA 2OXRA 5E4FA 4OHXA 3T5DA 4D4LA 5FL7A 5JSZA 4BZPA 2QU8A 1P9NA 3Q85A 1NN1A 1LB1B 5BW8A 4LZZA 2ZI4A 3U4QA 1E4YA 4TYWA 2CK3A 2VTKA 4NCNA 1VCOA 1XRJA 2H5EA 3AUXA 1CTQA 3BS4A 3PIRA 4NDZA 3W9YA 4O0MA 2H57A 1W49A 3ECCA 1YR8A 3WY9A 3D31A 2GCOB 2MSDB 1XZPA 3FYHA 1IM2A 2Q6TA 4URWR 3QKRB 5EE1A 3HU1A 2CCKA 3L0SA 1FX0A 3SBEA 3RS2A 4PQRA 4Q9HA 1IAQA 5FL3A 2QI9C 4JBWA 4L5BA 1S3GA 2MMCA 4HAYA 2ORIA 1T91A 3IDQA 2HJGA 1SGWA 4KFUA 2YNMA 2F3RA 4KAXA 1F5NA 2FZ4A 4BASA 2OEPA 4GFDA 5FBRB 3AF4A 4TZ0A 2BKUA 1XMIA 2NGRA 1KOFA 4YMTA 5JFGA 2IF2A 2CXXA 5TVKA 2W6JA 2JIZA 5EE0A 1QHXA 1NIJA 4ZDIA 3P20A 4PAQA 4G5RA 4WXPA 1E2IA 4G5OA 2IYTA 2YWEA 5A0FA 1SVSA 1CRQA 5KU1A 2F9LA 2HLDD 1SVLA 2IXGA 3HWSA 4NYMQ 5DGXA 4LI0A 1XB2A 1FQKA 3PEVA 3FHCB 3H86A 3IEVA 1GRNA 2XSZA 3ZIAA 3KKOA 1P3JA 5E7MA 1FTSA 2VSXA 3KQKA 3IEUA 4GL2A 3K9GA 1EWRA 2ZVQX 4PC6A 1OH7A 4NBSA 3S1AA 3OE7A 4B73A 2OBMA 1E9EA 2J1LA 2YOGA 2P5TB 2IHYA 1VYUA 2AWOA 1TUEA 4A4DA 3O8DA 5LPNA 4CEJB 4A8JA 1Q1ZA 4DXAA 4MGYR 4ASUA 2XOKA 2IYRA 4ZV4A 4U00A 1E2DA 4MDEA 5JHGB 2YKGA 1TEVA 3F5FA 5DHFA 1AQYA 1NBME 2Q21A 3I8XA 4S2EA 2FEOA 4HLQB 3LW8A 4CEIA 5C4GB 3LQRA 4EFLA 3FVQA 2VA8A 1K8RA 2PX3A 1UBCA 2P6RA 4M1SA 3ZVLA 3TSWA 1XJQA 2NZ8A 4LOAA 3RLFA 3RC8A 4B2PA 4BPBA 5CJ2A 2O0KA 2Z43A 3ND9A 4QC2A 1XEXB 2FPLA 3GEIA 3SJAA 5HR5A 2OXCA 1KDOA 2XEXA 4MA4A 1OXSC 4WBSA 2IW3A 1XD8A 3RYTC 4DC9A 2IYXA 2DBYA 2ZJOA 1HTWA 3GLIA 2REBA 2ZI9A 1GL7A 1G17A 1X86B 2OCYC 1PZNA 2RB4A 3P4YA 3CZQA 4G01B 1AM4D 2GESA 3UWOA 2ZR0A 4Z54A 2VP2A 1LVGA 1BIFA 2JLSA 3CBQA 2IS4A 1NP6A 4DSUA 3ICQB 4HDCA 1K5DA 3KJEA 4C4PA 2ZAMA 4M1OA 1EFHA 3Q7PA 3QG1A 1AJEA 4IVPA 1P2TA 2HDNB 3CRW1 3B8HA 5TARA 2RGBA 4BLTA 5KHOC 5J40A 3TR0A 1U99A 3KXLA 3T15A 2WPDA 1P75A 3GLFE 2ERYA 5FBWB 1IXSB 1XPOA 5EE3A 1T5LA 3ZQJA 2BCGY 2WZQA 3IIJA 2WKRA 3GLHE 4DEXA 4HSEA 2REXB 5LBIA 3TSZA 2PLRA 3VNUA 3UATA 3SJBA 4K81B 5E7JA 2R44A 3QF4B 4MKHA 1KI2A 2GCOA 3ZD7A 2D7CA 1ZIOA 4BQSA 2W00A 4II7A 2VHTA 1OV4A 4TMWA 4TYPA 1KAOA 4AKHA 1AN0A 5H70A 1UKEA 4FMDB 1CBUA 2MSEB 4QM6A 5FI1B 3A4MA 1ZD1A 2IYWA 2HT1A 4Q9KA 1RJ9B 4OK5A 3AP3A 5EE9A 2ZSBA 4BRUA 2GTPA 1G8PA 1GILA 1W4CA 2NQ2C 3N2EA 2W2XA 1KI8A 3BORA 5LB2A 4I99A 1F6BA 2AKYA 2RAPA 5SZIA 4JVSB 5JECA 1QG2A 2DWQA 5GJCA 2ZETA 1IXRC 1Q0UA 2LKCA 4JLVA 1XMSA 1AGPA 1R6BX 1G16A 2DWOA 3LD9A 2GILA 2YZ2A 1VYTA 2XITA 2ZXUA 4BEBA 4UNRA 3W5JA 4ZDWA 3NBYC 1J8YF 2B21A 1YZTA 2R6DA 3GJ3A 1T3LA 2QE7D 4JLDA 3HYTA 5GJVC 4B2LA 4AKGA 3BXZA 4QJ5A 1TTTA 3AGQA 3RRMA 5KSYA 1NMXA 3CPJB 4FN5A 2DB3A 3A4NA 1Q1BA 3FKSD 1SULA 1XD2B 2N42A 1F2TB 1NMYA 3B6EA 1ZP6A 4RD4A 5LD2B 2REOA 4CEJA 4LJ6A 4JS0A 3ZVNA 2R2AA 4Q4LA 1U98A 4TLBA 3EZ2A 1E3MA 3GJ0A 3I3SR 2ZQ5A 5FBLB 1CRPA 2P2LA 4W5JA 2GJ9A 5DHAA 1GM5A 1KI4A 2Q9AA 5F2EA 4LYHA 4M1YA 4EAQA 3R9WA 2QP4A 3QEJA 4C0KA 2VYFA 2OBNA 2VO1A 2R6FA 2VHCA 4M22A 2PZGA 1CU1A 2QAGB 2VHJA 3P32A 1CJTC 3FMIA 3GJ4A 1DAIA 3GEEA 5DN6D 1G8FA 3CF0A 1F3OA 3WNCA 2OE2A 3I5YA 4P32A 2VSOA 1FFHA 3P26A 1W1WA 3NEYA 4MGZR 5BYKA 2ZE8A 2FG5A 5G3ZA 3R9XA 4US0R 2VHQA 4ACBA 3QXSA 1E2NA 1WBBA 2R9VA 4OQLA 4C0LA 1JBKA 4K46A 4PSKA 4ABYA 1KK1A 3CH5A 3IPXA 2BBTA 1BH2A 2V1UA 1P61B 3K0CC 4I81A 4CW7A 4EJSC 4IKEA 4L16A 3OEHA 4QFMA 3EIEA 3TSOA 3CWQA 2GBLA 1IN7A 1PUIA 2CHGA 1P9WA 2GJSA 2C9YA 4N3NA 1UKZA 4DVGA 1BYUA 4CEHA 3TKLA 4PC3A 1GSIA 2KWIA 5EZ5A 1W4AA 1N5KA 4US1R 3I32A 1VDZA 4C0JA 1L4YA 4YMWA 1OE0A 1TEXA 2F55A 2JATA 3ZGXA 4PSVA 1KSGA 1TMKA 1M74A 2YOFA 1E9DA 3SJZA 3H4MA 4LJYA 4Q5IA 3O8CA 2JJ1A 4JKIA 5KTYA 5CITA 2SHKA 2NZJA 1N5LA 4F4IA 3K0AA 5FTLA 2IYUA 3KQLA 4TZ6A 2WWIA 1IN5A 1ZC3A 1II9A 2VL7A 1D2EA 2QNRA 4GP6A 2Q9BA 4B3FX 3QF4A 1CJVC 1WB9A 4TYQA 4ILEA 1RYFA 1Z83A 3GLFB 1EFRD 5AJXA 1E69A 3GLHB 3UG7A 4C3ZA 3FMOB 3KDSE 4HUQA 1E1QA 5K8TA 4BFZA 4AI6A 1C4OA 3LA6A 3ADKA 3TUZC 2O0JA 1RJ9A 1D9ZA 5JRZA 1B0UA 5JS7A 4RSGA 2BMFA 2PZFA 3N2IA 4IVQA 4DIEA 1DAFA 3V4RA 4RZ2A 3E5HA 2H17A 3UK6A 2JLUA 4HB3A 4RD0A 1HY3A 2IT1A 1DTSA 3MLEA 5JWOA 5KDOA 3MRSA 3QUSA 2D4HA 3DOEA 4Q1AA 2XNDD 4JL5A 1P5ZB 1PUJA 1ZIPA 1SKQA 4B43A 5FOVA 5KO2A 1U90A 1L4UA 5FPTA 2DR3A 4OI4A 5KNDA 5EUMA 3W5IA 5CB8A 4Z1MA 4M9SA 5LDDC 4CIDA 2V4ZA 4DZZA 1ZNXA 2VLIA 3W90A 1A2KC 4A6PA 4EQ6B 2GKSA 3RS0A 4IEIA 4AYXA 4DBLC 4MITA 2G77B 3E2IA 2QROA 4DKXA 4UQOA 2EQBA 3WYGA 4F38A 5FOUA 1KO8A 2QUZA 3J81k 1W5TA 5JWRA 1W2GA 4OK3A 1T3SA 1NJGA 3LO5A 2ZANA 1P2SA 2B6HA 3ZVRA 1UBGA 4UXIA 1H8EA 2C77A 4QHYA 3WNBA 1IQPA 3IHLA 4PANA 4IOJA 2RHDA 4A9AA 3X1DA 3KJHA 1N6HA 4QBIA 2GCPA 3AF1A 1Z06A 3PUXA 3RRYA 2ZSDA 4TMVA 3NKVA 1MRNA 1S96A 1AKYA 2JEOA 1NN5A 3LRPA 2QORA 5H68A 1ZMXA 4RD1A 2ZJBA 1XU4A 3A1SA 1ODFA 2QAGA 2ZRMA 2FMXA 4QHSA 3VR1A 1NBMA 5UKDA 4MRPA 1KY3A 3LFUA 2WOJA 1COWD 4GPTA 4RVCA 2IYSA 4AKEA 1HE8B 1XCGB 2JAQA 2WWWA 4A6XA 2WV9A 4JVMA 2OFXA 4LDJA 3JVVA 3U7EB 5JEDA 3TUIC 3FMFA 1G5RA 1SVOA 2QENA 4DB2A 1KKMA 1XNJA 5K8IA 2QY9A 4NH0A 4UNNA 4TMKA 1AK2A 2WSSA 1OB2A 2QP3A 1T9HA 2E87A 2QTVB 3R20A 5AUQA 3ZS8A 1JECA 1E2FA 1SHZA 3TUJC 2GA8A 5FH9A 2PZEA 3KKNA 4JJKA 1KMHA 2EFEB 1HURA 1XPRA 1LV7A 3EZ7A 5KOYA 4TLAA 2B7CA 3VQTA 1WXQA 3C41J 1VCMA 1C9KA 4BFWA 5SZHB 2QAJA 1ZNYA 4XVUA 4Q00A 3QKSB 2XB2A 2QTFA 3NBZC 4JT2A 1E9CA 4DDVA 3L8YA 2JCSA 4QGFA 3X1ZA 1W44A 4C7OA 2W2TA 1W46A 3NG1A 4M1MA 2J0UB 1XJ0A 4PHFA 1YZLA 4HB2A 1G5TA 4AG6A 4HAVA 1WE2A 3K0SA 4NYIR 3CKLA 3WNDA 1TUIA 2KBEA 5CJPA 5FUYA 2OILA 2IX3A 2YVUA 3BB1A 4MDFA 1QHYA 1AA9A 1KTVA 3R8FA 2F1RA 2ZYUX 1D9XA 3CRQA 5TV2A 4P4SB 2AX4A 1IJEA 1A4RA 1QBKC 1VG1A 3GJ7A 4QHTA 2ZRIA 3MAAC 3QPWA 1WF3A 2ZJ8A 5EZ6B 3TK1A 4LYFA 2EU8A 4Q9JA 1ZM3A 2AR7A 3CRVA 2AWNA 3DOFA 3MCAA 4W9MC 1NJFA 3T34A 1E0JA 2JLWA 4ZKEA 4GSYA 3VNVA 4PFSA 2ZEJA 2ZRDA 3IPYA 3VR2A 2JDIA 5SZKB 1R0WA 2FV8A 2QQEA 4LCBA 2R6GA 3K9HA 1XP8A 1EX6A 4DCUA 1SVKA 1AKEA 4JJZA 4EIWA 3WRYC 1J99A 3FTQA 2WAYA 1XJCA 1CF4A 4OBEA 5C46F 1N5IA 4BFVA 1E9BA 1NG9A 1XXHE 2J41A 5CYOA 5AR1A 1X1SA 4LGMA 4ZIRB 1KI3A 1S1MA 4Q02A 1CEEA 4LBWA 3SC3A 1Z29A 3IILA 2YJTD 4CYMA 3EX7C 2JJ2D 3QIAA 1G6OA 4MUBA 4C30A 1JPJA 2GK7A 3AKEA 4NONA 3TNFA 2YYZA 4LHWA 5LB4A 1PLJA 3MWKA 1OXTA 1G8GA 2H92A 3R7WA 4D0LB 5JMTA 1G3RA 1KI1A 2R6AA 3AVUA 4HYYA 3QY0A 4BZQA 3GLGE 2FSHA 2WJHA 4BLRA 2VP6A 2ODWA 1WQ1R 1ZD9A 2BBSA 3ZQ6A 2AK2A 2BJWA 4GZLA 4V0ME 3NC1C 3QENA 1IOZA 5G3YA 4B2IA 3PENA 4I1SA 1OB5A 2ZUCA 4KLNA 4D4JA 2WJIA 4KJZA 5CLQA 5L8VA 3PVSA 1O87A 5FUWA 2QL6A 4E09A 3ZS9A 4DB4A 1ELOA 3D6TB 1G21E 2NO7A 2Q0HA 5IF9A 3CF6R 3VR5A 3GQBA 2EYQA 4KSCA 1TU4A 1KIMA 1UADA 4JVLA 3PJRA 2J3EA 1XEWY 4P4TA 1N6RA 2NMVA 1E0AA 2GEDA 1VHLA 4XIGS 4BFUA 3QPUA 4U5XA 4HB4A 1S9HA 1T3HA 2C5LA 3Q3JB 4AWXA 1H65A 1WDTA 1YR9A 1CLUA 4GMDA 2FA9A 3TBKA 3FHOA 4HZUA 3PEWA 3OAAD 1YZUA 1LF5A 1A5TA 1LS1A 1M6NA 1T0HB 4FIDA 4MUAA 4NHOA 1E2HA 3QKSA 1MRSA 2ODEA 1HQYE 2JJ8A 2NO9A 3E70C 2H18A 2JLRA 1E2MA 3DM9B 1LS6A 1G4AE 1KK3A 1GNPA 1SZPA 2YC4C 4BWYA 2ODNA 2X8AA 4PHHA 4UXJA 3TAUA 2ZRCA 4O3MA 3TE6A 2WMNB 4GNKA 1DOAA 4YC7A 5DE3A 3RS3A 3GFOA 1SVIA 3VMFA 3EIQA 4PZZA 3U7HB 4KO8A 5KSPA 4LY6A 3OFND 2GEVA 3OIVA 2QQ0A 1JQLB 2GK6A 2VQSA 4P4SA 1NLZA 3AVWA 3DZDA 4V0NA 2EFGA 3Q72A 2QGZA 2V3CC 3DMNA 1Q57A 1UDXA 1HYQA 1NSTA 1MOZA 3V00A 1N5JA 5C18A 1WBDA 1ZUNB 3FFBA 1I4TD 1YHNA 3B1WA 3THXB 1J90A 1AGRA 1K6MA 2W83A 1LW7A 1U0HC 3BWDD 1N6NA 2BCJQ 2ZUBA 3SN6A 1ONBA 1NVWQ 2Z6VA 4P0TA 4WVFA 521PA 3REFA 4ESVA 3RS7A 5BN4A 1T0JB 5GADl 2RH5A 4DLTA 2FEMA 1JR3A 4EUNA 2JLYA 2WOOA 1QDEA 3H1TA 1LY1A 5H8WA 4OJQA 4HAXA 5BWMA 1PV4A 3FE2A 5DI3A 5FPSA 4XWOA 2FZLA 4N0DA 1U8AA 3NVAA 4F4JA 4OI0A 1I2MA 2PX0A 4FMDF 1UEIA 4RY2A 1Z22A 4M1KA 3T06B 4URXR 3U6KA 3WHLA 2ZJYA 3U5ZB 1XPUA 2AFIE 4DLRA 5FFMA 3GD7A 2EYUA 5FR1A 3AKYA 4PPNA 4ZIRA 2AXNA 4M2LA 1YZKA 4G5QA 1QVAA 1G18A 5JRJA 4MH0R 3U61B 1Z28A 3C5HA 3EW9A 2XJ9A 2CNWD 3LDAA 4H9GA 1XXHB 3BJIC 4JYCA 3ADCA 5L3QB 2NG1A 5AUNB 4B34A 2ZS9A 1M8PA 1I4DD 3OF5A 4IFBA 4JZKA 4LHVA 3DL0A 1Q21A 4TL7A 3WXMA 1NI3A 3KJGA 4OJKA 3X1YA 1KJYA 3EWAA 3AF2A 1HQCA 1GP2A 4UNSA 1IY1A 3KB2A 3WHKA 4D81A 2VP9A 4WW0A 4Q1BA 2GVDC 1P72A 1Q1EA 5E7IA 5KDDA 3GLGB 2BMEA 5EUQB 1R5BA 2D2EA 2ZRJA 3VKHA 3WP0A 4JBXA 5FOXA 4ESHA 2O8EB 4V0KA 3IQWA 1ZM9A 1FW6A 1DAEA 5IK2D 2BM1A 1JALA 2DFKB 1U0JA 4FD2A 2WJGA 1E9AA 3QXJA 1H8HD 3ZJYA 1PVOA 1MABB 1FPMA 3NTUA 4M8NE 1ZRHA 1IHUA 3P1JA 3PG5A 4TSFD 5FPHA 3REGA 1W0JD 4FCTA 4E5UA 1BYIA 4J0QA 4HAWA 4QBHA 5KNCA 1CR4A 4GI7A 4IW3B 1L8QA 3N70A 2UZIR 1UEJA 3WYAA 1QHHB 4PHGA 3T1OA 2X1VA 1VPLA 1IY0A 2ZSAA 3W6OA 1GFIA 4RZUA 5BQ5A 3QG5A 4JYBA 1Z08A 2OV2A 1E1RA 1MR3F 1JQJC 1OXXK 1CKEA 2ZS8A 4I1VA 3P27A 1NN0A 2ZRPA 4ZI2A 3AVTA 1XTSA 5F9HA 1N6LA 1OH6A 2DPXA 2WKQA 3HU3A 3G5UA 4X8MA 4URYR 4WIAA 3EG5A 4M1WA 3K70D 1Z0IA 1KK0A 4OQNA 3RABA 5TB5A 4KBGA 3ONWA 1RRFA 4A0HA 2IUTA 4GDFA 3A4LA 1VG8A 1DEKA 2CL0X 1A1VA 4ZO4A 4PZYA 3BD9A 4Q7MB 1DE0A 4B3GA 2J7KA 2FJUA 3A1UA 2ZE5A 3U7GA 3VU9A 2WSSD 4DUGD 2IYYA 2IYLD 1U8ZA 2ZRKA 3MSXA 3K70C 3Q9LA 3D7MA 2W6ID 3THXA 2C8VA 3KZ1E 4JBYA 4BGDA 3LLMA 5DO9A 4XD7A 3K09A 4JL8A 4JLBA 5DH9A 4EPWA 3A8TA 5CK4A 5B64A 5E95A 2WWGA 4Y0VA 2PMDA 1M2OB 1NLYA 4YXWA 3GMTA 2AD1A 1GKIA 2A9KA 2OZEA 4GMXA 1E2EA 3AH8A 4XWAA 1U2RA 3EARA 5AK0A 5B57C 2YINC 1TAGA 1E2LA 2ECKA 2K5UA 3ZYCA 4ZCIA 2OBLA 3B60A 4L4UA 2D74A 2N1BA 2J0SA 3AF0A 1DPFA 2EFHB 3AP1A 3QI2A 1XWIA 1KNXA 3CB4A 4HI0E 2H8KA 4P4UA 4B75A 1IN6A 4D4MA 4KYUA 3D8BA 2PLFA 1W36D 1FL9A 4LK2A 4EPRA 3B85A
chains in the Genus database with same CATH superfamily
1ZH4A 4B5LA 1OXUA 2EF1A 2QRNA 4YP5A 1SXHA 5F35A 5HS6A 2EJVA 1ESDA 5C8YB 5T8KA 3KE9A 2UUBB 3BIWA 3RM3A 1HDRA 4Y67A 1OWOA 4IIFA 5L3QA 2I4TA 2EFYA 5A06A 1WCV1 3L6OO 3NAZA 4DC1A 1C30B 1E3WB 2HIGA 2W6ZA 4R0NA 1YBVA 1YE5A 3DZ8A 4PX9A 3TAXA 4GPZA 1E2KA 1ENYA 2ZWMA 4U7FA 1OPRA 1TF7A 2IDZA 2V0NA 3KKEA 1B2RA 2X2OA 1ZRNA 5ECDA 5K3AA 1LPMA 4RYDA 1V95A 2EV9A 2V9PA 4S2UA 2PUCA 3L79A 1H2FA 4PAOA 2P65A 4PZEA 3RRFA 5BSGA 2DHEA 3NYWA 1OF1A 3QZUA 4PFQA 2WLSA 4YGYA 2NN3C 3GDFA 1U8YA 2JVIA 4Q9AA 4OSPA 3GXBA 4QULA 4JLKA 1RWBA 1CY8A 3HDVA 1SCBA 3ZJUA 3F9CA 1SG0A 3ADDA 3Q8WA 2W2MA 1N6OA 3E7WA 1ITZA 8ABPA 2AI3A 1Y4ZA 2QN1A 2JFQA 2YV1A 5IJWA 1MB0A 2ID7A 2VG8A 3PHIA 1KZGB 5CGQB 1XTQA 2P9JA 3TQHA 4YAUA 1KYIA 4NZMA 2ONYA 4NE9A 1KC3A 4EHDA 2RCNA 4LJAA 1R4AA 2Z56A 2FXIA 2FSPA 4K05A 4GYYA 2VTEA 4QO8A 3A28A 4QE3A 4RJKA 4EGJA 2Z2YA 1AQLA 4Y6OA 4I4TA 1PX2A 1UM9A 2QLFA 3AVQA 3MINA 2EW1A 5CB4A 2XX3A 4K87A 2EAUA 2AJLI 4GT1A 3WQRA 3K1AA 3PWZA 1M54A 4CMEA 4TMZA 2ALJA 3JQFC 1YHZA 3ORYA 5EC8A 3ZQUA 1CRWG 1U11A 4UBKA 3U3RA 2P8SA 4RKFA 1ZMOA 4B71A 5IKEA 3OMWA 1LW6E 3M6LA 1E79D 3G68A 4YO8A 5EL0A 3IMKA 3KJIA 3RR2A 4W5QA 1G98A 2NYRA 5G4LA 4WKBA 2G88A 4M49A 3HADA 2IWRA 4N0MA 4NAHA 3UJ7A 1I6WA 1NU8A 1Z6TA 3BRCA 2QVCA 3CLHA 3HJRA 2FZCA 3DLPX 1CUCA 1L0BA 4A8HA 4YMVA 4ANFA 4AN4A 4KE7A 3ETLA 4RDIA 4LGCA 2D4AA 4M1EA 3ODPA 2IDMA 1JSZA 3DAPA 1J2EA 3EISA 3LVRE 3HWWA 2GYWA 1IE3A 2RGXA 4E13A 2IP2A 4IIGA 4NKRA 3OQ1A 3WP0A 4J0HA 4E07A 1LUAA 5F5LA 4J2OA 4YV1A 2VRBA 2CFIA 1BH6A 4UFNA 3OSZA 3A7EA 1GOTA 1GL3A 3DTVB 1W94A 1JGTA 1O4WA 4CXMA 2GBPA 4C0QC 3F8WA 4EUFA 4S1WA 1J39A 1TQ8A 1ZWLA 1CP3A 2O7QA 4G97A 4IDBA 3RHSA 2YJ3A 3RARA 3CM0A 4ZO7A 3G89A 2F62A 5J1TB 2CLCX 5AXCA 5CA1F 1YWGO 1W0CA 2ZFUA 3WJ2A 2GEJA 3EWIA 2WYOA 4O59O 1EWTA 2AEMA 4NBVA 2ACKA 3QTTA 3R2JA 3V5NA 2Q28A 2PE5A 4LZNA 4MQMA 3SXPA 4AUKA 2QL7A 3OU2A 1I94B 1AKTA 4OL9A 5EMJA 1SY7A 1VOTA 4K9PA 1NTOA 4GE0A 4M8IA 4QIHA 3VH2A 5K6TA 1PK9A 1XK6A 1GCAA 2XKKA 2L0XA 1EFUA 3K05A 3NBAA 1ZCZA 4TT3A 5DLEA 5LQSA 5KQPA 3Q9NA 1ZUD1 2IE0A 2OAQ1 4INPA 3TNLA 4B3CA 1OASA 2O8BB 3KBOA 4TVBA 3SOPA 1CR1A 4NF2A 4TS4A 1I2DA 3EULA 3G9TA 3PIDA 4R16A 4N0QA 3RIXA 3FCAA 4OQYA 3NHRA 1TECE 3EGXA 3T1VA 3T9DA 3ZPXA 4H1WA 1UZNA 4YCNA 2GD2A 3VX4A 1J6UA 5CT4A 1HG0A 4GX1A 3DB1A 1HDCA 3KR2A 3VHQA 2CF6A 2Z2KA 3C6KA 3TCKA 2QNIA 3AB3A 1G8JA 3K0BA 3L0CA 4NXMB 4TYYA 4UAJA 2JC3A 3IV7A 1EM6A 3AB7A 3TQSA 4W5NA 3L7NA 3R41A 3AKZA 4GE3A 4OKNA 1U3DA 2E18A 2GPJA 2UUOA 3TNYA 4DVJA 2JGNA 1ZUIA 3EPRA 2Q3MA 4C76A 3OZVA 1GG8A 2NU6A 1O97D 1D2HA 3P7MA 4GBED 4IH9A 1M6WA 1UQTA 2HJVA 5DCYA 4AU1A 1V5WA 3JZAA 4LJ9A 4MV6A 4QBGB 3RBAA 2MSCB 5FDFA 3KTOA 4QYTA 4EUKA 2BGWA 1BN6A 3QQPA 4YRLA 1OQAA 1SXJC 3AR5A 2O8FA 4ZC8A 4K9NA 1IHXA 3OKPA 3QVJA 3LDGA 1GDDA 1TU0A 4LWOA 3FKQA 2H4XA 3RVDA 1MB9A 1VPWA 4I8IA 2QLLA 3AEQB 4Q4CA 5DBGA 3WE7A 1RJWA 4EMUA 1Y7PA 4GQBA 3ROEA 4HN4B 2F9FA 1FSGA 3ETJA 3TDNA 4AKIA 3LYHA 3EJ6A 4HBZA 3NYQA 2JKYA 2I71A 3QPVA 2YNMD 2ZSHA 4B35A 2VSQA 2WINI 3AK4A 4BNHA 4BNMA 1QGOA 4DAOA 5EWMA 1JX6A 1JIUA 3PQ4A 2BFCB 4MRMA 1XZLA 2OYCA 1E9SA 1V4VA 1U4OA 4RDXA 4TTJA 4GQAA 4FDAA 1SRQA 4ZZ2A 4ID3A 4MK4A 2PSDA 3K4QA 5JVDF 2Q7DA 5IW8A 3IURA 4CLDA 1NBWB 4CMGA 1T1RA 3QVUA 1HQKA 1QHNA 2RH9B 1Y8AA 4GBMA 3L4SO 4RCYA 3J81A 2XA1A 3AFGA 2JLBA 3AJDA 4HHEA 4LKOA 3S6JA 5KUTA 1LK0A 1X1EA 3GMIA 3QFCA 2XCIA 4WCFB 1SQ6A 1Q1AA 3ISVA 4MS1B 3T4UA 4X1YB 2C9BA 5FLXA 4ACAA 2GZAA 4LDRA 1SJ9A 3I12A 2W8ZA 1G2OA 2RB5A 5G0WA 4H7IA 2O19A 4YCLA 3D9QX 2J30A 1XDBA 2BEWA 4Z3KA 3KU4A 3T3GA 1Y3AA 2FH5B 4KVZA 2VHVA 3C4JA 3IALA 2CJWA 3JYQA 4IHJB 5J2TF 3I73A 4B6GA 2QMEA 4KGVA 1YRAA 2OHVA 1EVEA 3A14A 1X70A 4DJDC 4RGBA 1GZ3A 5M3BA 2GS9A 2XOKD 2IS2A 2R86A 1ZBQA 4EJSB 1YJAA 1U1EA 5FUXA 1SKUA 4C6TB 1Z45A 3RDPA 2PTGA 4D56A 3KUUA 3D8TA 1PL7A 2J9RA 4OYHA 1RMYA 1WXEA 3BWVA 3QUCA 2MINB 5CVEA 4D0NA 4XB1A 1UXOA 5DP2A 4O4IA 4RENA 3OE1A 1ZK3A 3QEAZ 3SQMA 2A84A 3VZDA 3V8RA 3TQQA 2JF0A 1N2EA 2XKBA 2PS9A 4MQUA 3AEKA 2PL5A 4G26A 4HUJA 3OIYA 4U0KA 2Z4SA 4NU5A 2HL6A 1E6EA 4U2GA 4NZYA 1Z0SA 4RKWA 1ZSYA 3Q8XB 4N6GA 4PO8A 4ZEVA 1N92A 1A8IA 1FTNA 4YONB 4MX8A 3GD5A 3OCWA 1O5TA 2CL7X 4BKPA 5DM4A 3OPYB 1ECJA 5CA1B 3COJA 4AAYA 2C8KA 2QRJA 4LY9A 3TIIA 3IODA 4B17A 5DTMA 4WNAB 2TMGA 4O5AA 3MM4A 4BP8A 4F6LA 1XZ8A 2C92A 3P9IA 3DE7X 3PRJA 4A2QA 3OU7A 2VYVA 4IDAA 1Z07A 2BT4A 3C24A 4MNTA 3VPFA 5KNBD 4BVAA 4FE7A 1N0HA 3F9IA 5KOHB 4KQGA 1C8KA 1RC0A 2P8JA 1OH8A 4MTLA 2ZE6A 3HUUA 3AVXA 3RKRA 2GVNA 5IAAA 1X94A 3E7PA 3NRCA 4B7XA 4RHEA 4CRWB 1YA8A 1E1LA 4A0FA 1G38A 4LGVA 1TF2A 3CLVA 1XRSB 3EZFA 4R84A 4Y2XA 4PX3A 4XQGA 3SE0A 3SIRA 2I6TA 2R6R1 2YV5A 1WMSA 2RC5A 2WPDD 3EGIA 3JU3A 3KL4A 5ALRA 3FN4A 4D25A 3SFZA 5BRAA 3KQHA 3K09C 2WMOB 2VOEA 4V0OA 2GDJA 3TJRA 2PGXA 2VHZA 3ETEA 5BR1A 1SK8A 4B2YA 3ZDRA 5JC8A 1W9HA 4WASA 5ERGB 4DCPA 4YAGA 2CV1A 2Z0MA 3RWOA 5FNVF 3ETHA 3SF8B 3EYAA 2IYZA 5TDHA 3SJCA 1SD5A 1QYCA 2GLUA 5NULA 3W05A 3KKZA 4PZAA 3STTA 4X63A 5K6AA 4KXXA 1FNCA 3DJYA 3HNOA 2CDBA 1K5GA 1CDZA 2IZZA 3JZMA 1FBNA 1P4JA 2OK8A 2PD6A 3AINA 4ZEXA 3W5SA 5IEJA 3CNBA 4MB0A 4OB6A 3A1WA 3JAKA 1PJTA 1T29A 1H2RS 2I80A 2PANA 5LN1A 2O2HA 1UBEA 3GWGA 3DA8A 1XBTA 1YE8A 4DA6A 4D4GA 2PD3A 1E20A 2QE7A 2C2WA 4BRWA 4XWWA 2RGEA 2BGIA 2WPNA 3DMRA 1DXQA 3MTAA 2VPPA 4FZ5A 1P39A 5K0NA 3TSYA 3U3ZA 1OVGA 2QL5A 3G2HA 1S2OA 3RJMA 4AP5A 3UXEA 1VPDA 1IONA 2QVBA 2PMBA 4G5SA 2EXXA 2FQWA 3GUUA 3GH3A 5KHLB 2VBCA 4HYQA 4ZJUA 3FKSA 5J4HA 4P8RA 5JASA 2GZHA 4N48A 1WZCA 3U3JA 4KDFA 3GV0A 4X65B 4LCEA 4DV1B 2VDLB 2I3BA 3M2PA 2WJAA 1ZU5A 3FYUB 4JELA 3B1ZA 1ZGHA 3O8OA 4FOSA 3UPDA 4HTFB 2H7VA 4YNBA 3R5FA 2XYPA 3CNQS 3LP5A 3RVSA 2YS6A 3ZDBA 1UZLA 4IV8A 4LBZA 1WY5A 2DSNA 2HKIA 1WKCA 1NNUA 1TMYA 1WHTA 2OFOA 2P6OA 2QTVA 3C39A 3I9KA 4OGKA 3EFHA 2UYHA 4UUPA 1GDTA 4RJJA 1XZDA 1V2GA 1TRHA 2V1XA 2ZE7A 3Q7SA 4LJ4A 3ZWMA 1X7XA 4BE7B 2Z1MA 4JD5A 1J07A 1BXGB 5MGBA 4M7PA 5DN6A 1JKMA 1JH9A 4QYIB 3G7UA 1JHXA 4L3WA 5TPZA 1D6JA 4ZP1A 1U8EA 1Y4DE 2B2XA 3DBLB 5D5PA 2MIIA 1AF7A 1GCGA 4QVGA 4X92A 1SOAA 1UAYA 1XAIA 2O2YA 5J2TB 1WP9A 2P2NA 1EJ2A 4QM7A 1YULA 2GEUA 2VFAA 2ASEA 4K3UA 5JLJA 4A0SA 3FROA 4F2HA 1PT8A 2NO5A 3FUTA 1E8DA 3PPVA 3EDOA 5GVRA 2PX6A 5SY9A 1WPRA 2BBWA 4L1KA 1RSZA 5DB4A 4MRVA 3FNQA 2REQB 3OIGA 2VYNA 3ANXA 3VR6A 1DFIA 1MKYA 1SCAA 3WWYA 2G3YA 2W2NA 7REQA 2AMLA 2R751 1G2IA 1I80A 1QZUA 2QN9A 4HC4A 1WVGA 1XVAA 4FNAA 4XA8A 1ULZA 4ZRNA 3PT5A 3SBXA 4EHHA 3EPKA 1Z6XA 1YZNA 5CLIA 2WG1A 4ZD6A 2ERCA 3D6NB 4CR7A 4R0MA 2FQQA 5ALMA 4BQRA 4G0PA 4I1OA 3PT9A 4HWPA 3NWBA 1W2HA 4OQQA 4YMUA 5A02A 3COPA 4MI1A 4AX4A 1ML3A 4DDWA 4QQKA 2L19A 2ZJZA 3L77A 5KX5A 4MVYA 4OLAA 2Z9CA 2ONJA 3RBVA 1QQBA 1FA9A 4F91B 1KMQA 3DE4X 1QVVA 3H1PA 3KUCA 5IJXA 5F1KA 1C1XA 2WICA 4HSGA 3KPUA 4QXPA 4RORA 4ZI7A 1TKBA 3DSRA 5EWJA 1JLMA 3ZNNA 1QANA 4Q4JB 4MR8B 4XSGA 1DSSG 2ISSD 3HHPA 4ITRC 3CIOA 4EKEA 3A9SA 3A70A 2XWJI 1DRUA 1EFRA 5DNVA 4HX5A 1TQHA 2P6PA 1SCKA 2VJCA 1QUFA 1GFZA 1ACLA 2UYYA 3B7GA 3C16C 3DUFB 2P27A 1TUGA 4LV8B 4R98A 1N77A 1Z0DA 2LWIA 1EEXB 1JEEA 1V43A 1Z7GA 4JBGA 1JEYA 4NZNA 2H11A 1JE0A 2F90A 4CFSA 5TQ2B 3T1TA 3ROXA 2Y0PA 2O8CA 3VISA 2QSZA 1PDOA 4ZU3A 3WLRA 2CBXA 1JJBA 3R3UA 2BD0A 4F46A 3L9XA 1D0VA 1T25A 3PFKA 1CIJA 2JGKA 3EIUA 4R8LA 4RETA 3F4LA 3HCCA 4QNMA 3H9QA 2CYBA 4FDVA 5EHZA 4WT7A 3AUJB 1JYFA 5KTRA 1J56A 4HF7A 2V7EA 2G5GX 2CYCA 2HRZA 4EBBA 1O4VA 1EVJA 3GJYA 4YQZA 5AKLA 4YT4A 2XXAA 2JHFA 1BQ4A 4TUYF 3HJTA 4JOBA 3TH5A 2FVYA 2XMGA 2GBFA 2QYOA 2PMWB 3A1NA 1IOLA 3I4LA 2X9GA 2C98A 3BWEA 3M33A 4G85A 4JLOA 4NPHA 4QUGA 1XTIA 1BWQA 4YRMA 3WRXC 3MBIA 3KYCB 4LEIA 4X7PA 1WXWA 2V55B 1DC8A 1EAYA 4FQ5A 4L2IA 3MMSA 4Q4HB 3KSDO 1YS1X 4O6VA 4UHKA 2Q07A 1NUHA 1KDRA 1Y6ZA 3OKCA 2QF7A 3KWMA 2RGNC 4Y6PA 4C14A 3OBIA 3ACCA 2XWSA 2HK9A 3FA2A 3UMGA 4BKMA 5KYUB 1Z4QA 3OZIA 1CFJA 4GP7A 3S40A 2CDNA 1WDWB 3GX1A 3KD3A 1MGPA 1TXGA 3QLVA 2FP4B 3MJVA 1RKVA 1U9YA 1ZLXA 5LWQA 2EWWA 5DTJA 1U4SA 1WEKA 2ZQYA 3KALA 4Y2JA 4IXNA 2CD9A 1GSOA 1F6DA 1KARA 4XEHA 1WUHS 4IKOA 3AR6A 4MO2A 3VC2A 1M6VA 3RRJA 1N5OX 3IVCA 5EHXA 4DCNA 4RTNA 1D4ZA 3T5GA 2IEGA 3CUWA 3IIEA 3LHSA 3NHFA 4RZXA 1O9HA 3HQ4O 1MH1A 1VE5A 1KS2A 4F9TA 1JDUA 1TVKB 1NAHA 1KQNA 3SLKA 1I13A 2YJ5A 5DNYB 3E58A 5JQGF 5ALDA 4E2WA 2FGJA 4GX5A 4WJZA 1AMUA 4YJ2A 3QOYA 5K03A 4MR9A 3VHLB 4D2IA 1A2QA 3C6QA 3SD7A 1S2MA 1ONNA 1TVEA 4FEEA 5IKMA 3ZLTA 1OLXB 3DO8A 5JH7A 1YCGA 4CHTA 1J22A 1JE1A 3ZY6A 5KYXB 3FPLA 3WLMA 1DPGA 3PC8A 1X92A 3HY4A 4LISA 5I5GA 4YN3A 3C7DB 3AHDA 3WOVA 1D6SA 1Y9EA 3BXHA 1NW3A 4XAQA 4EHJA 4JI7B 4PC3A 4IJMA 1KY2A 5AJTA 1HNZB 5H80A 2L17A 2DUJA 2POQX 2CXRA 5EIAA 3PEYA 5EPUA 4WMLA 1FS6A 2X2PA 4EPVA 4ZVQA 4C2TA 1J7KA 1AH2A 2FR0A 3QYAA 2O3RA 3VUFA 5F5NA 4Q7LA 2JAHA 4ONEA 4D3SA 3W0LB 3ZC3A 1CR0A 4ZJZA 2AN9A 3HUDA 5FLKA 3FPSA 5HM6A 3FBGA 2FFQA 4EA8A 3ZHOA 3OZCA 3OTHA 1QZ3A 4QPZA 5FJIA 1JJIA 5I9LA 3OSUA 4G0VA 2HFJA 3MGCA 5ALYA 1RRPA 2PUJA 3MYRA 2HHCA 2ZB2A 2OVFA 1R74A 3KVOA 4FD3A 3W1EA 2PMFA 3E5MA 3KJFA 1QHGA 2D06A 2P11A 3MCVA 2PNFA 2E21A 3T99A 3CGWA 3QKIA 4MVJI 2GRAA 4UW9A 3VC1A 1B8PA 1D2GA 4D43A 3CXUA 1D5WA 4ZQIA 1B41A 4KIJA 2DPMA 2GB4A 2PEYA 1DV1A 4TM8A 4UEKA 2WNSA 4E2YA 5B3LA 1XTPA 4UKDA 3SCZA 2H0QA 3OT4A 1NPDA 4JJAA 2ZR8A 3QRWA 1ZW1A 1MT0A 1SQ5A 3OG9A 4JNKA 3TDKA 1SBNE 2XGSA 2J5KA 5I9TA 4D96A 1K3FA 1S6YA 5AKIA 2OFFA 3PZBA 1QXSA 2WTNA 1H0RA 4U6NA 3SNHA 1N32B 1A5BB 4DMUB 1VKZA 1KPGA 4RA6B 2JAWA 4W82A 1PYOA 2RHJA 3DEFA 3I04M 5COQA 2K7FA 2YYYA 4Z2YA 4ZICA 4PYRA 5A04A 2G80A 3IQEA 5EN4A 5DYYA 5HE9A 2C5SA 3D5TA 4L07A 3FI0A 4M8KA 5DEOA 5IFKA 2EL9A 2LP4Y 4LRYA 3IIIA 3L2OB 3MNFA 5LQCA 3UXMA 2BM8A 5B2FA 3DDNA 3OJ0A 4PC1A 4AQ7A 2HCJB 4DPMA 1A50B 1S8AA 3ZBTA 2PLNA 4RJIA 4BEJA 1ZICA 3TINA 3MS2A 2AF4C 1XDZA 3GAZA 4NYJQ 4MS4A 4DLXA 2QN6A 3K0AB 5CCXA 2QBYB 4PGFA 4EPYA 1KJWA 2FQXA 2HSJA 3CISA 3JVEA 3M2TA 4JIMA 4UAUA 5TXGA 4DCVA 2GTIA 2IGBA 3DF7A 2BYTA 1DAHA 1MZVA 4UJ5A 5JAMA 4B32A 2GJKA 3IYLW 5C32A 3TLMA 1O6CA 1EJ6A 3UGTA 1WU8A 5DHPA 4GKKB 1WP4A 2YC2C 3PKZA 2FLWA 5CW2A 4TVSA 1VXOA 1EFCA 3WGTA 1V26A 1VIVA 3VPGA 4HUQB 4DXDA 5JNWA 3SDBA 4V0MA 3GZNA 1R9NA 1VBKA 1Y1RA 4YACA 3TW8A 2O8EA 1UOOA 1KI9A 2IHJA 3KS9A 3R0QA 4PNPA 1KE2A 4HVCA 1OGIA 1X9IA 3N39C 3IIKA 3WLLA 4US2R 1JKJB 1JZSA 2KJQA 4YO7A 3ROZA 4CE6A 3L7BA 1JLSA 5LYJA 1TTPB 5TGZA 1GG2A 1GZ5A 3INRA 3IGFA 2JLZA 1T8WA 2YY5A 4L7VA 4BFCA 1J9ZA 5TE9A 4EK9A 2WNHA 1GZDA 3RVLA 1CQXA 3T3HA 2ACVA 3WLTA 3B3QA 2J3IA 5ICMA 5PGMA 4D7AA 1QIKA 1TL7C 3L43A 2C9ZA 3K0FB 3EA4A 5BW4A 3B12A 1LBEA 5CM9C 4C7OB 5C8ZA 3HI6A 4PNZA 4DGSA 1XMVA 3EVNA 1NKVA 3PVCA 2P9YA 3QI7A 1RRGA 2QTBA 4OQDA 5TMDA 2ZJ5A 1KIFA 1Z33A 2PRIA 3U80A 2EX0A 4OPMA 1ENZA 4M0LA 3SHFA 1QIIA 5G40A 5JQGB 3BHIA 1UWKA 1II8A 2EG5A 3O4VA 2G4CA 4IR7A 3L8GA 1QDUA 1GTSA 2XAAA 2BM9A 4WQMA 2A3RA 3KB1A 2E48A 3D59A 3H2SA 2XTNA 3AF5A 2XTMA 5BXQC 1FFWA 2VDMB 1EP2B 2IP4A 2QPOA 2PSJA 2R6JA 2F6RA 4KODA 1ZD3A 2VN8A 3ROQA 3SYTA 3W8DA 4WZAB 3WIEA 1GNSA 3VR5D 1N1DA 4K86A 4RXUA 4AJLA 2ECFA 1G3QA 4L9SA 3S1LA 1XQWA 3G5TA 5DNEA 3VSBA 1P2BA 1U2GC 3DZJA 2TS1A 1G8MA 1J23A 1RRMA 1WZNA 4PM4A 2F59A 4KR6A 3QF7A 4J0DA 4TTVA 2WHPB 3X1WA 4E3WA 1W88B 1NR7A 1USIA 2EIHA 3L8CA 4DM7A 3PJEA 1Z0FA 1FJGB 2NV6A 3DHEA 1ONSA 1QVWA 4O4JF 1WQ4A 4R9UC 2DQZA 1QE0A 3CWZA 4HR7A 4UU8A 4EVRA 1Q0HA 1L7QA 2ZKIA 2PEZA 3BRQA 2C3YA 1QG6A 1TCAA 4YALA 3ZZMA 3ADBA 3IR7A 3SJ7A 3MD0A 3NBUA 3B3GA 4EG7A 1O0SA 2CHEA 2ZCUA 2XDQA 3WNVA 4NNPA 3CX6A 2ACWA 3D3EA 3NIBA 4A92A 1ODSA 1SM4A 3LIPA 3GJ5A 3IQXA 3QE4A 3ADPA 1ES9A 4URUR 1R8XA 2VJNA 1W87A 4DG9A 1T4GA 2VTBB 3AR8A 4W8GA 2AOUA 2VJLA 3ZDZB 1OLSA 1LLUA 1EWVA 3EDQA 4LYDA 2DFNA 1SOUA 2FWIA 3D8UA 5EHQA 4EO7A 3BC1A 5I5EA 2Z57A 5HKAA 2RCYA 1OAOA 3VU8A 3H16A 4DLYA 1KMHB 2GAOA 3ADOA 3HXPA 1W19A 4P5DA 1NX9A 1U02A 3WLKX 1TCCA 3H65A 1IPHA 5EXPA 3CEPB 1KMCA 3R8CA 3ZW9A 3OQMA 3EDCA 1ADFA 2R1TA 4ARSA 2ON6A 3FTEA 1U4NA 5ESXA 2W98A 1JPVA 2BDUA 1L8AA 3WYEA 4CM6A 1M1NB 3DMTC 4RTMA 4GRIA 1DCKA 5DEIA 3DEKA 4OAPA 1UBJS 2VPWA 4YTEA 5G53C 2PN1A 1K6XA 1RQLA 1GG5A 3ISTA 3LY5A 1ISFA 1LQ2A 3CW2A 4OQXA 1LDYA 3EXEA 5L3VA 4QG7A 1ZO8A 3RIMA 4DYVA 4E5VA 3AQ4A 1FY2A 4HMQA 2BTQA 4HO1X 4CT0A 1XF1A 3ITKA 3IULA 3M6AA 4MDYA 4XQ9A 1QF9A 1EZZA 4IQ4A 4UEWA 1X8LA 1CULC 2X3UA 3O3MB 3F46A 1VBFA 3AT1A 1W36B 1HTTA 4D0RA 1VP3A 3AOEC 2WKPA 3DFUA 1I10A 4HQOA 2WAXA 2JFOA 1M10A 1BCSA 4J90A 3Q0EA 2RKWA 4FX5A 1ZA1A 4A1FA 2ISQA 1L4LA 3FOCA 3BK7A 3TGLA 4BQEA 4AY6A 1KI6B 5TJ9A 3UHPA 4AY2A 1CDDA 3OZSA 1NM5A 1AXGA 2RGCA 4Z49A 3QVMA 4BIMA 1IMJA 3P2IA 1GXSA 1Z5WA 4WZZA 5TT0A 1EK1A 5J5VA 5C2JB 4AG3A 4FYWA 1E7WA 4FDLA 1QZZA 4GRDA 1SXJE 1Q0RA 3IQZA 4HEQA 1YL7A 5CDHA 1DG3A 3UZUA 5H3HA 3WSTA 3ZD8A 5J9FA 2Y1EA 3KZCA 1UR5A 1QLWA 3P5BA 4OXNA 2OLJA 3CRMA 3QUQA 3F3KA 3GUCA 3AEXA 1K0UA 1SB8A 4F6RA 4KH0A 2Q7OE 5FBVB 4QGHA 4CLEA 1EGHA 1OFTA 4R2WA 3VAYA 1CQIB 5JFOA 2RIRA 4J0IA 1GEEA 3UG6A 1VPVA 5EUBA 1HZZC 5AOAA 4UD2A 2QVLA 2VDNB 3Q5DA 4JLJA 1SC4A 1THGA 4UAVA 3ZVKA 2Z98A 3DYVA 4DLUA 4PQGA 1NUQA 4DLWA 1OBFO 2WIJA 5KREA 1OIWA 3NOXA 5KSOA 3OTIA 4DSAA 1A8SA 2IEYA 2QA5A 4A23A 1R0BA 4X60A 2ZLBA 3RJTA 3ZOZA 4RLSA 1P3DA 4E21A 1UPFA 5HRUA 3LKDA 4CM9D 1K6IA 4AKTA 1W0JA 2VEOA 4QGBA 3RG8A 2ZUUA 3IRUA 3JYPA 3HN2A 3AIIA 1ZUHA 3ZJ4A 4DARA 1WG8A 2GF2A 1T13A 3LHDA 2ZB3A 3HYLA 4LOLA 3OQIA 3OLQA 4JAVC 4R9NA 1XQ9A 4V0SA 5AW8A 1Q15A 3I58A 4GL4A 1A9PA 1HI9A 1PFGA 2ORYA 3AUFA 1EB8A 1IEXA 3Q41A 3DDUA 2JI9A 1I3MA 3LP6A 2Y4OA 4HQRA 2O20A 4MEAA 4O4LA 4ECAA 3NBXX 3VC3A 3P9XA 3IR6A 5DTQA 3TGPA 5HCIA 2V7TA 1ESEA 3IT2A 3U3KA 4EG1A 3M1IA 2NO0A 1G9SA 3G7SA 3BGSA 2J45A 2OBYA 5CX1A 1LDMA 5FEMA 4KPUA 4BECA 4AZ0A 1S7CA 4AJEA 3V4ZA 1Q1QA 3LQ4A 3AHJA 3FPAA 1F38A 3DH0A 1RQXA 4LMPA 1KY5A 5D3ZA 1SEVA 1IU9A 4L4RA 2LXNA 2B4AA 3DKRA 4RVNA 4DPLA 1DJLA 3QEOA 4CMCA 2XUHA 3LLUA 3UMRA 3L1HA 2Y1KA 4X71A 2ONZA 1QK5A 3JX9A 4DUGA 1MIOA 4E33A 1YJ5A 1JEDA 3HCWA 4YDSA 1CJMA 2R65A 3TRKA 3CMCO 3RVPA 4HWSA 1YV9A 3DFKA 1B93A 4LX0A 1X1AA 1LX6A 2W6IA 1A5SB 1B2LA 3D8NA 3I01M 3ZCSA 1JFRA 5ITZB 3EQ7A 3A27A 4N7RA 2IOYA 2XY4A 2J9GA 5I4BA 3HXTA 4E5SA 2F1IA 1ICEA 5IZCA 3OE4A 4KBYA 2J8ZA 1T9GS 3E7DA 4ODIA 5CT8A 3T7SA 5BN3A 3UWPA 1R0ZA 4PC2A 3NP7A 1S3SA 3VUEA 1BO6A 4LHEA 4S1VA 1CUSA 1T4CB 2BELA 4TQAA 3UAXA 4HOYA 4C0XA 4XGKA 1WJGA 3MMNA 4QAJA 2AZXA 3O8NA 1ZXLA 2OYRA 3RVBA 5JUWA 2RHGB 4XFDA 1KSHA 3HO8A 2FDCA 3RSGA 5TMPA 3SQXA 1TO1E 1VJGA 2B7BA 2ZYIA 8OHMA 3EXHC 3RUIA 4P7FA 4RS4A 1MTOA 4WXMA 1DJNA 2O07A 2H5JA 4YXWD 5ILGA 3WJ1A 1PTKA 3QOWA 5GOTA 2C99A 3DZFA 4D6XA 1TZKA 3ILVA 2NZXA 4FZRA 3HO1A 4L8GA 1HT1E 4FYXA 4J7CA 2ZIAA 4OXIA 5SZJA 2YV3A 1BX3A 4X20B 4QREA 5COAA 3VR5H 1TE2A 4GEGA 2R8YA 5B7QA 2C2XA 2W58A 3QBJA 5I01A 2JL1A 2DT5A 4UQPA 3GEBA 3VZSA 1JSXA 5HE8A 4D80A 2HPAA 3I28A 3OJWA 4XGRA 1UPBA 4HD8A 3AP2A 5DTRA 4KQ9A 1N2CB 4CR6A 2JFUA 2XNJA 3RUPA 1DJMA 3MB5A 3G2OA 1MPTA 1Q44A 5HKKA 2XVAA 3VKUA 4WI1A 1D1SA 3A1FA 3HN7A 3MHTA 4TTRA 1WULS 2XKAA 5L40A 3H1GA 1BKSB 1E8NA 1V2HE 3UAWA 4KNVA 3WLJA 3CUTA 2R0QC 2BFMA 3H5TA 3IJPA 1PJAA 2F8LA 3AI7A 3D6JA 3JPYA 3NNSA 2VR1A 1YE3A 2HB6A 2ZROA 4X84A 3RVQA 1O57A 1ESZA 2BIFA 3RHZA 2R5NA 3W6ZA 4HNTA 3VJLA 2H4JA 5JROA 4MWSA 3B2EA 2JFVA 1UXIA 5DI3B 5JSZB 1IBRA 2N3ZA 1JEQA 4GGMX 4TRNA 3PXCX 4HH1A 1D1PA 1IPFA 2QM3A 1H69A 1PEKE 1J2YA 3LC7O 2NYUA 3STXA 3U60B 2HTEA 4L8WB 4LMAA 4JKYA 5EOVA 3BXFA 3TZLA 1A3CA 1KHHA 2KI5A 5A4IS 5REQA 2YHUA 3O94A 4JYAB 3EXFB 4FPXA 5F4BA 2G06A 2C2BA 3JWIA 3L0OA 1EU1A 5JPIA 4EVIA 4YRKA 4OXXA 5HGJA 1ZBDA 4A16A 4BFTA 4ZANA 4D5GA 3D0RA 1CDOA 1OILA 4FX2A 5KAMA 3NAQA 2Z95A 4QLOA 4Z0HO 4MWBA 1QZXA 4CMHA 4JY7A 3BREA 5A62A 1G0NA 1UH5A 4YDHB 3W7AA 4FQ8A 3T9CA 5CTAA 1M8JA 4UHHA 3VHRA 2WDZA 5BSTA 1CUZA 1KFKB 3WQSB 2HUPA 3BTSA 3VVLA 4MYHA 4ZKDA 4OX9Y 2HNKA 1ZK2A 3LNTA 4NATA 3TXAA 1GZUA 4RULA 3RG2A 3H5RA 2CDRA 3AIKA 1BJRE 5BW5A 2YS7A 3VVMA 1RI3A 1YBHA 2PYDA 3P9PA 4POAA 5TEWA 2JD1A 3CR7A 1LZKA 5HFAA 4GLLA 1UF9A 4WOKA 1E79A 2HWWA 3QLJA 2V6GA 4H16A 2R47A 3K0CA 3PCRB 4FFBA 1TC2A 3MJTA 3GO4A 4JEIA 4H77A 5AJWA 4RKYA 5CU7A 3HB7A 3KK0A 1P7PA 4ZOBA 3HCDA 3WGHA 2N9UA 3MEQA 4MCIA 1KGSA 1V9CA 4NCKA 1Y4SA 4HLCA 3S55A 4U39A 2G9ZA 4WZBB 3Q3CA 1O3YA 2GN4A 4JL6A 4KB5A 4PIVA 3EF1A 4YRGA 3KXKA 2E9SA 3LBNA 3WGUA 3LAWA 1DVRA 5C1IA 3QXCA 1F0PA 2QUHA 1OI7A 4RVDA 5KQLA 2I22A 1SBTA 2WTUA 3NATA 2DJ5A 4NFLA 1YOVA 3R5SA 4ZYYA 2FMUA 2OGUA 3GT3A 1K3UB 2HQRA 4C7XA 4D9FA 4TRMA 1QAMA 4PSDA 1VKJA 1EGQA 5KSZA 1RWNA 3HJAA 1RKQA 3L1VA 3SKXA 4QDZA 1OR8A 5P21A 4Q9LA 4G8BA 4BMCA 4EKDA 1XX6A 2OP1A 5CYPA 2IIQA 2BM0A 4Y1GA 3WGKA 2GETA 3OMXA 2X4DA 1TEHA 1ZD5A 2C83A 1RBQA 2XGGA 3A4IA 4NBUA 2BGGA 1XU9A 1A97A 1JLLB 3DE1X 3VDRA 1TADA 1SU8A 1FRNA 1H2EA 4UMFA 4TMTA 4MKFA 3O2QB 4O1IA 5AK5A 1V1JA 1MNAA 2YL2A 4JROA 4MKRA 2RSLA 1LPAB 1MW9X 3F3YA 2NACA 2YJGA 4XVHA 3VJRA 3WGJA 2A3NA 2CF5A 4HLUC 4BVEA 4TX1A 2F48A 4FUQA 2Q99A 4AD8A 1YL5A 3NEPX 1RYHA 2GZMA 4PRKA 3CJRA 1U3WA 1EGAA 1ZY2A 2AFHE 2B4TO 1L5GB 2YHSA 3FDFA 1LPOA 4C4XA 4IOKA 2IY7A 3F1LA 3L93A 4R7TA 2FMKA 2BEVB 4K6KA 3EYWA 3PI7A 4MUMA 1QDLB 3FMVA 4WK4B 3O47A 5FO1A 2IV2X 5HNKA 4QU5A 1KDPA 3GB9A 5JLAA 4ER5A 5JO0A 3EPJA 5ES4B 1U81A 2CFRA 3BG5A 3LZDA 2ZWVA 4KPFC 3TXYA 3L5KA 1BHSA 2ZIGA 4HKTA 4HJXA 3OU6A 4EDFA 2F9MA 1EUDA 3S8YA 2H1RA 3ZNPA 1G41A 4KQWA 2XMZA 1H4SA 2VT6A 3AR2A 3R7DA 5M7EA 2XAUA 1RYYA 2A9RA 4Q48A 3RGWS 1YDMA 5FOWA 1GL9B 3HDJA 4KTTE 2VIIA 1RC8A 4AC9A 3W6UA 4CDNA 1OT3A 3RS4A 3WI7A 3PC6A 3HL4A 5CFZA 3AY6A 2JW5A 4O4HB 2OAP1 4Q93A 1O58A 5CW1A 1N4DA 5AQEA 3T5DA 4OHXA 4M88A 2OFPA 3OPYI 1PZXA 3JQCA 1QP4A 2L18A 1G5HA 3SY8A 1P9NA 2FE1A 1NN1A 4FGWA 3FXAA 4PZUA 4JI3B 5BW8A 4M0EA 1SBHA 2LGJA 1E4YA 2YJNA 5F1PA 5F51A 2IITA 2VTKA 5CFRA 4TYWA 1CUJA 1P1BA 1W6UA 3EC7A 2H5EA 1SK9A 3W9YA 4RPGA 3W1VA 3ZWXA 5LQUA 3I53A 3N2NA 1YKFA 1ZFNA 2XWQA 3JXEA 2GCOB 4LJSA 4WNCA 5IABA 1VZ3A 3GPIA 4LOJA 4N0PA 5IWAB 5TMBA 1X8XA 2HGSA 4HRVA 2NT3A 1IVNA 2YTZA 4PWYA 4YB8A 1FX0A 1O96A 1WB5A 2GLXA 2FHPA