3WMEA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
588
structure length
588
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAGAAQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein
molecule keywords ATP-binding cassette, sub-family B, member 1
total genus 214
structure length 588
sequence length 588
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmeA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmeA02
2CLSA 4YMTA 5GVRA 5DLQC 1HQCA 2X2EA 3M1IA 1D5CA 4PR0A 5E7MA 1E9CA 2BKEA 2JLVA 1TQ2A 5GJWC 4X8HA 1ZD9A 1KMHA 1V5WA 2EFEB 2OXCA 5L3SA 1TU4A 1TUEA 2R6AA 2QTHA 1HYQA 4KSBA 3RYTC 1FUUA 1XPRA 4B3FX 4KBFA 4OHVA 1P7CA 3RS7A 2PH1A 4LHVA 1AS2A 4DWJA 5HCNA 1TF5A 3WMGA 1XBTA 1Z47A 3U7EB 3O8CA 2IS6A 4H9GA 2QP9X 1KO4A 3Q9LA 1XCGB 3QOFA 3KKMA 1E9DA 1N6PA 3P4YA 4PC3A 4BFUA 4GDFA 1GKYA 2YOFA 3QKUA 3QY0A 1R8QA 1W46A 3E70C 2IBMA 2JJ2A 4OI2A 1UBGA 4BE7B 1PUIA 3K9NA 3OE7D 3CWZA 5G3YA 1RW4A 4MUAA 2FMXA 2JLSA 4JJKA 4RCYA 4MA4A 4DLUA 1QRAA 5FPKA 1R0XA 3CONA 2WJHA 1TF7A 4D4MA 3SZRA 1F2TB 4IJMA 4IDHA 4M8NE 2BIFA 3GQBA 3ADDA 4V0ME 2IC5A 1KY2A 3PQCA 1F5NA 3KFVA 4AKHA 1ZC4A 5J47A 1R10A 4Q47A 2WMNB 1KNQA 2QAGB 1DAGA 1HQYE 2VP4A 4CF7A 4YMUA 1KI2A 3W3AA 2HEIA 1W36C 1AKEA 1OHHA 1QHSA 2GJKA 3VKGA 3FB4A 5EP3A 3WRYC 1ZMXA 1Z3IX 3AF4A 2G0NA 4Q4AA 1XMJA 3TSZA 1NLYA 1Z83A 1Z6XA 2IXFA 4L4UA 5L3QB 3L8ZA 1ZNYA 1WDTA 2REBA 4GMDA 2VHQA 5H1YA 2WJJA 1NP6A 1SVLA 3FHCB 4DB4A 1I2DA 4K46A 4TTPA 5JCZA 4AK9A 4I1UA 4TSFD 2AL7A 4R71A 3IO5A 4YLGA 2QMEA 1KK1A 1AQUA 4B3DA 3TLXA 1VCIA 1E9BA 2H57A 4G5QA 4TYQA 1R7RA 2F7SA 5KPDA 3EASA 5FUWA 4BASA 1G19A 1S1CA 1LW7A 2HDNB 4NP6A 2AD5A 1IXSB 2FGJA 3CX8A 3RS4A 1RRFA 1UJ2A 2W2VA 3B8HA 1VDZA 4Q9KA 1IY2A 5CIWA 1CF4A 4D4JA 4US2R 4JLKA 4YXWA 4KODA 1XJQA 1KAOA 2KI5A 5L8VA 3K0FA 4TT3D 4PANA 4F7WA 4C0BA 2VTKA 4ESHA 3LA6A 1YR7A 1IXZA 3NDBB 2YOHA 1HURA 3QPVA 4NYIQ 1I4LD 2O8EB 1GNPA 1W1WA 2SHKA 4Q4HA 2RH5A 2NG1A 4GPTA 1VG1A 4JL5A 4E5UA 3EZ7A 3VNVA 5L3SB 1G8YA 3WMEA 2IK8A 2OLJA 3PFIA 1KMHB 2XSZD 1G5PA 2BBOA 5JI2E 4DDTA 4MITA 4OQLA 4WZAE 3SE0A 4FI3C 2P67A 3VX4A 5BW8A 3NG1A 2CK3A 2IW3A 1XEXA 4AYWA 3B82A 3NEYA 3PCRB 4ABYA 3ONWA 1JALA 2IXEA 3I3SR 4URZR 1XTJA 1AA9A 2YHSA 4ZV4A 2LKDA 5E7IA 2BCJQ 2ZE7A 2ZITA 3NBYC 3KJIA 1XX6A 3NH6A 1FUKA 1E3MA 4TL8A 4DRZA 5KDDA 3LQQA 4PAOA 2P65A 4BZXA 5IF9A 4OQFA 1DAKA 3AVUA 3L0OA 1G7TA 3QF4B 2B92A 2RGAA 2WJIA 3MLEA 4D26A 3EX7C 2Q0HA 4HI0E 1MH1A 4PTLA 3W9YA 3GJ5A 3N70A 3PENA 1VHTA 2VP9A 2H18A 2ZRDA 4EJSC 3KKPA 2QMUA 4FMDB 4TMKA 1G41A 4A82A 3T12A 2G83A 1FTSA 4PZLA 3QXSA 4GOJA 1DPFA 2BJWA 2RCNA 3C7KA 2JIZD 4QGHA 1MKYA 4BQSA 3ADCA 1VIYA 3LD9A 3Q72A 2FPKA 2GZAA 1C4OA 4FCTA 3AKDA 3MGCA 2BBSA 2J1LA 2XZLA 3V00A 4OQNA 4JL8A 4I99A 5KNDA 4QJ5A 4Q4JB 3FKSA 3Q7QA 4EKDA 4Q1BA 1XEFA 2J0SA 1QHXA 4TQAA 621PA 4UJ5A 2IA5A 2CHQA 3K70C 5C2JB 3BGWA 4M9SA 2Q3HA 1ZUHA 2O0HA 2H8KA 3A1UA 3TIFA 1P9NA 4UXHA 1IHUA 2HT1A 4ZDWA 1N5JA 4RZ2A 3BH0A 4HLCA 4TMWA 2GHIA 2WPDD 3TVDA 4DCTA 5L3QA 3PUZA 5F9HA 1D9XA 3Q3JB 4RZUA 2PLFA 3QF7A 4UKDA 1KKLA 2WTUA 3QQ5A 3J81k 5FPHA 2VRWA 2FPMA 3SYLA 1S9DA 3I4LA 4YDHB 1OH7A 1HT1E 4D0NA 1T8TA 1T5LA 2VP2A 1P2UA 1NMZA 2QP3A 4HUQA 3CR7A 4MGIR 1EXMA 1N6OA 2AKAB 2CEAA 3REGA 4PSVA 1T5IA 1S0UA 2RAPA 1NVXQ 4BFYA 4A9AA 1G9XA 4PAQA 4BLPA 4BFWA 1D2NA 3BB3A 4GMXA 1Z6AA 4KYUA 4M9QA 3WP0A 1R0WA 1KO5A 4X8MA 1E9EA 4MDFA 3G82C 2CLCX 1KO7A 3PXGA 2EYQA 4JJZA 3ECCA 3ADKA 2QSZA 3O8BA 3LWNA 1VIAA 5SZJA 3VU9B 3AVVA 2G77B 5LBIA 1FP6A 3OE7A 1G4UR 4HLUA 5CB8A 3KXLA 2ZYWX 2P3SA 2RGXA 1SZPA 5EQTA 4TLDA 3CR8A 3H1TA 3THXB 3KL4A 4LBYA 5AWFC 4FMCB 5JBQA 4LV6A 5CIQA 1C9KA 1QVRA 1VTKA 1OXVA 2GTPA 4OHXA 3SYNA 3A1VA 4O3MA 3GJ7A 2XXAA 1UKVY 2QRZA 2NIPA 4Q03A 2FDCA 4OI4A 1VCOA 1M34E 5EUQB 1Z2CA 2PL3A 2ZRAA 4M2LA 4PPNA 2ZROA 1QHIA 3QG5A 2I1VB 5DI9A 1H8HA 3ZVLA 1H8EA 2P6NA 3I5XA 1EFUA 2XNDD 3RABA 4ITRC 1R0YA 3PUVA 4LHXA 1KJZA 4LI0A 2ZS9A 5BXQC 3GJ0A 1OH8A 1G1MA 1S2MA 5AJWA 2ZJBA 4OHYA 1GRNA 4U02A 1KJWA 1IY0A 4JSYA 3SI7A 5AJVB 3SDZA 1GAJA 2QAJA 3WHLA 3VFDA 4FWTA 4A2QA 1E1QD 4JYBA 1XTSA 1MO5A 4QG7A 1SVIA 3B60A 1Q1EA 3H84A 1P75A 3KJEA 4JLNA 1FQKA 5B57C 5B2ZA 1GNQA 2OO7A 2ZJZA 1GZSA 3HJNA 2W6JD 5TV2A 1ZU4A 1N3BA 4BZPA 1F3OA 1X1SA 4C4PA 2WMOB 1GWNA 4MYCA 1G291 1OV4A 1Q22A 1QHNA 2DFTA 5ANRB 4ZKDA 1T6NA 5FTLA 4A0RA 1U8ZA 2XAUA 3RSOA 2R6FA 2QA5A 5FFMA 1D9ZA 2I4IA 4NYMQ 2D2EA 2C04A 1XF9A 2IYZA 1OB5A 4DSOA 3I1FA 4LK2A 3CF2A 3NC0C 1CTQA 5HE8A 2N46A 4JYCA 3NHAA 4PQRA 4IFBA 4DCNA 1N6RA 4XIGS 4LYAA 3ZVRA 1NKTA 2A7QA 4RKFA 1G3QA 1TEXA 4JT4A 1G20E 1ZINA 2OCYC 2WWFA 2GILA 1ZM9A 1EFRD 3VX3A 1GSIA 2ZSAA 1UBEA 2O8FB 5KSZA 1PV4A 4Q4HB 5J4KA 1DOAA 2FEOA 2EFHB 2AKYA 5EUMA 3RRMA 2G6BA 4AG6A 4NE2A 2GNOA 1Z0IA 2BMDA 4P0TA 2UVQA 3ZLJA 3O47A 1K6MA 2WWGA 2FOLA 2IUUA 1V43A 1NI3A 2J46A 1HH4A 3LQRA 4Q7LA 1B0UA 3VKHA 4Q1FA 2X8AA 2JJ1D 1KK3A 3GJ6A 2ZREA 4LYFA 4MYUA 4GI7A 2QPOA 3ASZA 3CF6R 4PPQA 1AQYA 2DWQA 3W34A 5JZVA 1JR3D 3THXA 3PEYA 2ZUBA 4Q18A 4URUR 2C78A 4TTRA 2RHMA 5KUTA 5FTJA 1CXZA 3UXMA 1G64A 2OAQ1 4U7DA 2BBTA 4M4SA 1LVGA 3U60B 3B1WA 4FMCF 3WNCA 3CIOA 4BFVA 4RZ3A 2VEDA 4M9ZA 4KFSA 1XD9A 2CNWA 2W6JA 1N5IA 1CJVC 1N0VC 1G4AE 1IONA 4QJ4A 1FZQA 4ZI2A 5KNCA 4ILEA 2O8BA 2VA8A 1E2MA 4D82A 3DZDA 4GSYA 1GL7A 4B48A 1T0JB 4MGZR 4BWYA 2G88A 3KTAA 1N0UA 3ZS8A 4BFTA 4CEIA 3QXCA 1E69A 2W0MA 1OYWA 3OFND 3WY9A 3ZS9A 2FEMA 4I1VA 4NTZA 1II8B 4D4LA 2AN9A 4IVRA 3AM1A 4TLCA 1KTVA 3P20A 2PJRA 3V4RA 2WPDA 3F5FA 1H8ED 3LBIA 2GXQA 4KFTA 3TSOA 1X8JA 2QM8A 2A2ZA 4PC7A 3UWOA 3C5CA 4BEJA 1OIWA 2B8TA 4Q7JB 1FMJA 1Q21A 3EAQA 4V0OA 1S1MA 2FFBA 4A6XA 3IIMA 2PMKA 2CHVA 3U3JA 2QUZA 5KSOA 2IYRA 4OYHA 2E87A 3QNUA 3CRQA 5CM9C 1IQPA 4HLQB 3EG5A 3AV0B 4LJ8A 1ZD1A 5GJCA 1N6HA 1S3SA 3ZJYA 5F2EA 2JJ1A 1W0KA 2QTVB 2ORIA 3BD9A 4MRRA 4NL4H 4Z8YA 2YJTD 5HR5A 4RY2A 4WW0A 4B3XA 3KXIA 4DT1A 2UKDA 4EUNA 1UBFA 3VMFA 3IQWA 4TYPA 3LBNA 2W58A 3QVVA 1Z08A 1QDEA 5KTYA 3D7MA 1Z5ZA 3IQXA 3RDPA 2FE4A 3DKVA 1GRQA 2ZPTX 3DZ8A 2IYLD 5KSPA 4BEBA 4HAZA 4WA7A 1W44A 1JQLB 1E2QA 3O8RA 2DCUA 2QL6A 4OHZA 1YRBA 1KNXA 2OAP1 2DBYA 2GCOA 2Q21A 5D3MA 1II8A 2JCSA 5CYOA 3LX5A 1W5TA 2OM2A 2F55A 1R5NA 5IRCD 2ONJA 3TR0A 3AVYA 2N1BA 4FCWA 1SVMA 1TUIA 3GEHA 3TUZC 2WWYA 1SKQA 5FR2A 4PFSA 1W5SA 4XWAA 4NCNA 4PQYA 1YR9A 2FFHA 4Q19A 1Z07A 1HE8B 3NH9A 3FFAA 4B2LA 3QBTA 1SVOA 3CB4A 5DISB 3K9GA 1RFLA 2XZPA 3GMTA 4QBFA 1OFIA 2D74A 5BYJA 4KCGA 5FBLB 4ZCLA 3SNHA 4UNNA 1T9HA 1T8UA 2WOJA 3QUSA 1Q3TA 4JT2A 1U81A 3C15C 1RJ9A 3PV0A 4LHYA 1OB2A 2GDJA 3HR7A 1Q20A 4PC1A 3HYRA 1QHYA 2WSSA 3F3YA 3SJZA 4EJSA 3B85A 2O8EA 4RVCA 3TW4A 4AKGA 1SVSA 1OJLA 2VP6A 3FGNA 2C9YA 2CL0X 4NCHA 4KSCA 5KDOA 4B34A 1M7BA 2IYUA 2O0JA 1HE1C 2EU8A 2H7VA 2ZRCA 3OEED 1P9WA 1FFHA 2VHUA 3MJHA 4DLVA 2C77A 1G6HA 2QRNA 4DEXA 3REFA 3BIFA 3RAPR 3SQWA 3BC1A 2Q3FA 4US1R 4LV5B 4M1SA 5JSZA 3QI2A 4LBZA 2NZJA 2PT7A 3MCAA 3QEJA 1LF5A 4BFSA 4C0AC 3CNNA 5K8LA 1EWQA 4ERNA 2PCJA 3K8YA 4GOKA 1QG4A 5J4HA 2C98A 3THOA 1SVWA 4F92B 3B1XA 4TMVA 4ZKEA 3QEOA 5C18A 1BYUA 4DJTA 2A5GA 2ZANA 1UF9A 3NIBA 4IEIA 4Q1CA 4QM7A 3SOPA 4X8OA 4UNQA 1E9RA 4QGAA 1Z0DA 3Q5DA 1LS1A 5DNYB 4LJ5A 1B23P 1E99A 1M6NA 4RD6A 2J41A 2WWHA 2ZTSA 5JI3E 4BRWA 1ZNZA 3HU1A 3CPHA 1NSFA 1AK2A 3CO5A 2QP4A 2WWWA 1RRCA 2MSDB 4PO9A 4QGGA 1FNNA 2ZR7A 1YVDA 4IHQA 1GM5A 4AC9A 1CIPA 2V9PA 4IFEA 3VTKA 1S4QA 1XMSA 1WE2A 2GJSA 1XEXB 1IBRA 1OF1A 5SZHB 2YINC 2QAGC 2QT1A 3THWB 3KFXA 1DG1G 1VMAA 3UWKA 1YZTA 5BQ5A 2PLRA 2V6IA 2X77A 3G5UA 3U4QA 2K5UA 2OEPA 5G40A 2OZEA 1LNZA 5FOSA 2GEDA 2GXSA 1XZQA 5H70A 5D3MB 1ZIPA 2V55B 2UZ3A 1Q0UA 2XOKD 2WWXA 4HZUB 1ZYUA 4F93B 1GOTA 2TMKA 1WXQA 2JLWA 3CF0A 4Z8XA 4YMWA 3ZZ0A 1UPTA 4CEJB 1J99A 4TL9A 5GVSA 3JZAA 3MAAC 3N5CA 1K8RA 2BBWA 3LX8A 2JLYA 2ZM5A 2CJWA 3L2OB 1Z0JA 2YKGA 4GOXA 3CRW1 1Z0AA 3AVTA 2RGGA 5EE3A 3D8BA 1WF3A 4CEHB 1YZNA 2Z5FA 5AJYA 4DT1B 4CYMA 2CVFA 4O25A 2HF9A 4NHOA 1GDDA 1E2JA 1E2EA 3D3QA 2DFNA 1G7RA 1UAAA 2QU8A 1ZP6A 4MH0R 4C0KA 5JCPA 2HYIC 1WBBA 4Q4AB 1G21E 2DPXA 5JS7A 2GEUA 1TAGA 2QSYA 2O8CA 1OW3B 1WRBA 2ZJ5A 1U94A 2ZRFA 3AP3A 1ZD8A 2HV8A 3T06B 4TYYA 2AFIE 1EFRA 3MWJA 1LTQA 5JS8A 1N6LA 3QXXA 3ND9A 2XB2A 5CLLA 1YZLA 3TQFA 3CUEF 4FXPA 3CZPA 3RS3A 5EP4A 4Q4LA 1CRPA 4Y0AA 1HT2E 2IS4A 4JLJA 4DC9A 2V7QA 5LB2A 2DY1A 2WWIA 2FA9A 5IDVA 2QGNA 2P5TB 3IHLA 2YNMA 5FBQB 1VECA 5EXSA 1KI3A 4MKGA 1AZTA 2HT6A 3RSLA 4A15A 2J0VA 1JI0A 4YQFA 4JVLA 2ZXUA 1BYIA 4UQOA 3KB1A 3EWSA 4PHGA 3S1AB 4P4SB 5HTKA 1WP9A 1D2EA 3R20A 1OH6A 3AF2A 4B73A 3WMFA 1TADA 3RLFA 3L0PA 1GG2A 4C0QC 3HYTA 5IK2A 4GBMA 5FPYA 4LRWA 3JZMA 2ZI9A 1AGRA 1NF3A 1A5TA 4L16A 4XVQA 1OHHD 1BMFA 3VR3A 1DAMA 2RGNA 2BKUA 4Q4JA 1J70A 2ZR9A 1Z6TA 2FPLA 3LO5A 4ACAA 4DIEA 5AUPB 4PAMA 2NQ2C 3AGQA 4A8JA 3AP1A 4B44A 4CIDA 2NGRA 2JAQA 4NYJQ 5D3QA 2IXGA 3F0TA 4GP6A 1JR3E 5DHAA 3RHFA 4KFRA 3G0HA 2QROA 4XD7D 4Q9JA 4RSGA 1RE0A 3BK7A 3TUJC 5BN5A 5HKKA 5ELXA 2R2AA 5FL7A 1U0JA 5P21A 2J45A 3B2EA 2PZEA 1BKDR 3CZQA 3MG9A 2R6CA 1OKKD 4N1AA 4DSUA 5EJEA 3IDQA 4BFZA 1KAGA 1UBCA 4V02A 1T3HA 1OIXA 3GFPA 4URVR 4RD2A 4LC0A 4V0KA 4YC7A 4YMSA 3SYKA 5KPJA 1PZNA 4EPTA 3A1TA 2F43B 1IM2A 1TU3A 1M8PA 3C16C 3OAAA 1IN6A 1JPJA 3E1SA 1E2LA 3AVPA 4DB2A 1IAQA 3OZXA 1TQ4A 1U90A 2F1IA 4L9SA 4WZ6A 1DAHA 3IIKA 2VSOA 4Q02A 2XTMA 3BB4A 1G3UA 4UNSA 2MSEB 4V03A 5FPSA 2D06A 2Z0MA 3WBJA 1AJEA 2RGCA 4JZKA 3BXZA 1BO6A 4QHSA 3BFKA 2WSSD 3DOEA 4LX0A 3P27A 4OBEA 4AURA 3LH5A 4L15A 3B13B 1S8FA 5EXXA 2IS2A 4C0LA 3T35A 5EE0A 1GITA 3QXHA 2WHXA 1YR6A 3PUYA 3UMFA 4A36A 2V3CC 3AF3A 1ETUA 1SULA 3QKSA 1F60A 5LD2C 5JMTA 2R8RA 5KO2A 3CW2A 4HATA 1W4CA 1X6VA 4ARZB 3IHWA 5K8TA 4GL2A 1S96A 3ZVMA 1E1QA 2VH5R 1BIFA 2HJGA 4WXPA 3AVOA 1K5GA 4DLXA 1YZGA 2JEOA 4LPKA 2REXB 5DYGA 2O52A 2G1JA 5LDDC 1UADA 1CS4C 5CM8B 1RRGA 1Z6YA 4QL3A 1SXJC 1P2TA 2QTFA 2GCOB 4TQ9A 1BS1A 3TBKA 5KOYA 1J8MF 4PSAA 3BERA 4D4KA 2IYQA 5K8UA 1KDOA 3X1WA 2DB3A 1Q1BA 2P0EA 2ASEA 3NEJA 1VCMA 4W5JA 4JLBA 3AKEA 3ZQJA 1Z28A 4DSNA 3C41J 1SHKA 1TF2A 1KI9A 4HYYA 3BWDD 3W6OA 4P32A 3FE2A 1CR1A 2GBLC 2FX3A 1UKEA 3DOFA 4O2RA 4DKXA 2C96A 3T15A 4XVRA 1P5ZB 2ZS8A 2KJQA 3N2IA 2FWRA 2H16A 3NXSA 1OFTA 4UNPA 3Q85A 5DI3A 3EZ9A 1Z6GA 2G3YA 3HPQA 5FTNA 1WB9A 3VAAA 3KJGA 1YQTA 3L0IB 1U2RA 1E2KA 2XNDA 4CDGA 2IYTA 3BS4A 1Z0KA 4YDSA 3UATA 3CPJB 1MV5A 4C9BA 4L9WA 2O5VA 1R4AA 2JLQA 2KB0A 3IO3A 1NIPA 1VCNA 3QG1A 2B8WA 2A5FA 2O8BB 1KO1A 3R9XA 4WZBE 1E9FA 3WYAA 1MRNA 2HCBA 2ZSBA 8OHMA 4DUGA 4BECA 1XPUA 1ZVQA 2OESA 1DELA 1EX7A 3CRRA 2ODNA 3LLUA 2ZE6A 4M22A 4NCJA 1E98A 3SJAA 1AKYA 1IN5A 2DFKB 2WOOA 4QFMA 2PT5A 2AHOA 4NYMR 1TQ6A 2ZRBA 1L8QA 3T34A 3GLGA 5BN4A 3FMPB 1X3SA 2V1UA 1XJCA 1OXXK 4ESVA 4MRNA 1KHTA 3NTUA 4W7SA 1AIPA 3U3RA 4E09A 3MD0A 4UNRA 2IS1A 5HCIA 1KDTA 1ZCAA 3TAUA 2AWNA 2JDID 4RD4A 2IYVA 4XTCS 2BEJA 2FFAA 3I5YA 1KY3A 2C8VA 3BH6A 4AY2A 3M6AA 5EE1A 2ZVPX 2YWEA 1EK0A 3H0KA 2ZU6A 4HAVA 2ZRIA 1KI6B 1RZ3A 2GCNA 4HDQB 4ZIRB 2ONKA 4MRVA 4KBGA 3RWOA 3ZZTA 2ZVQX 2CE2X 1OH5A 1KO8A 1DTSA 3NC1C 2VLIA 4PC6A 5DIFA 5FOWA 3A4MA 4Z1MD 2AR7A 3BE4A 2F43A 4C3ZA 2XNSA 4OJKA 2GF0A 4XSGA 1CLUA 4HB0A 3W8NA 4MRSA 4G01B 3HDTA 2XEXA 3UG7A 3KUCA 2MSCB 2YVUA 4XWOA 3K1JA 1JB1A 4S35A 3WXMA 1WCV1 4LY6A 4CZ2A 4G3XA 4ASUD 4BLTA 2RMKA 4UXJA 1X8KA 3T1VA 3ZGXA 5LD2B 3ZZUA 1OXSC 4PQFA 1K5DA 3KKNA 1EESA 5TDHA 4MYTA 3GJ8A 3IILA 3H4MA 3LBHA 1NIJA 4PXAA 1XMVA 5EE9A 3R8CA 1IY1A 3A58B 3PIRA 4MGYR 3RS0A 2RGBA 2FG5A 5E95A 5FUYA 1CKEA 3GJ3A 3PEUA 4RFSA 2IWRA 4QBGB 5SZIA 1CRQA 1JQJC 4TLBA 2QZ4A 5FBWB 1W36D 3HR8A 2F9LA 3CRVA 1CULC 2KE5A 2PEZA 3QSYA 1VYVA 4XD7A 2V8OA 3KJHA 4S2EA 1VYTA 4NCKA 2PMDA 2WZQA 3DL0A 1DS6A 4OK5A 2ZUCA 4HDCA 1RPZA 4QHTA 3S1AA 3A1SA 3K0AA 1RKBA 4IDPA 3DHWC 4D25A 4TZ0A 2EFCB 1VG0B 1NN0A 1QVAA 1H65A 1YE8A 3BB1A 5J4VA 3TJZA 2QBYA 5F9FA 4E07A 2OCAA 2QENA 4XSHA 1QZXA 1U0LA 2X19A 3OHMA 3T5GA 4B71A 3ASYA 2YWHA 3OAAD 1G3IA 4F38A 5SZKB 3DM5A 1E79A 4Q66C 4LHWA 2OT3B 1EG7A 2KWIA 3ND8A 1TQDA 2BOVA 2ZEJA 4N0DA 5JFGA 2O8FA 1NJFA 3VKWA 2A5DA 2CXXA 4LJ9A 3I62A 1XP8A 1G8FA 1PVOA 3IPXA 1ZUNB 2H17A 3QVUA 4C7OA 5JJKA 2CCGA 2H1LA 2A5YB 3LVQE 3AKYA 1U9IC 2AXPA 3EA0A 2ZJOA 3IBYA 1XFAA 2C9CA 2NO0A 5J4LA 4PO8A 2GCPA 4EPVA 3UG6A 3L43A 4POAA 3IKJA 1P62B 4WIAA 2GF9A 3ZQ6A 3AKCA 3F8TA 4C0HA 3GFOA 2H5EA 3ZH9B 5HKKD 4TZ6A 2J59A 1SHZA 2XITA 4GNKA 1SXJA 2JJ8A 421PA 1AGPA 1RVDA 3GLFB 3HU2A 2DYKA 5CITA 3JVVA 3I72A 4EFMA 1COWA 1A2BA 4OI1A 1QHHB 3R7WA 4FN5A 2F1RA 5CK5A 1E9SA 1MOZA 721PA 3X1YA 1XD2B 1G7SA 1NN3A 4HB2A 1P60A 2V6JA 4LYJA 4I1OA 3K0CC 3K0SA 4NPHA 2ZJ8A 3LDAA 1WA5A 3DEFA 2QPAA 4JVSB 3Q5EA 2GA8A 1WQ1R 1U99A 2N42A 3KXKA 4TSFA 3EXAA 4X8LA 1Z29A 2ZI3A 4E03A 2CL7X 2OSBA 2Q9BA 4B74A 3CWQA 2Q6TA 3U44A 5G53C 3IPYA 2QE7D 4AKEA 4JIMA 3MFYA 5CJPA 2EVWX 1SQ5A 2XX3A 2CNWD 1J90A 3LXXA 4N0EA 4CEHA 1N6KA 1ZAKA 1N25A 2FSFA 1NLFA 3LW8A 3ZYCA 5CJ2A 2L0XA 4M21A 2VO1A 4JBXA 4DLWA 1ZW6A 1FX0A 2ZRGA 2VHCA 3SBDA 1US8B 2IF2A 4IXNA 1N5KA 3QIAA 2BMFA 2ZRLA 1KDPA 1E4VA 3LAWA 4URYR 4F4CA 4MGKR 3BH7A 3VU9A 3UMSA 1W7AA 2B7CA 2C2HA 2GAAA 4GRAA 5L3VA 2KBEA 4A2WA 2ECKA 3KUDA 5DSZA 1NN1A 4TMZA 3QPUA 2R62A 5IHPA 3RWMB 3R9IA 2V54A 4LDJA 3RS2A 2GRJA 4KJZA 3VR6A 4R2HA 1KMQA 3BOSA 4B75A 3B1YA 2YV5A 4KFUA 3U2QA 2CLDX 5CB6A 3C8UA 1WMSA 2A5JA 4ZDKA 1ZC3A 2BDTA 3PEVA 5C4MA 1KK0A 4M53A 1W0JD 4KLNA 3RRYA 3CX6A 2VPPA 3OIWA 3RRZA 4CGZA 4C2TA 1NG9A 4OQXA 4II7A 2JDIA 2IT1A 1Z8FA 4NCIA 1EFCA 2CHGA 3DDCA 2UZIR 1R2QA 2ZE8A 1NL3A 2Q9AA 1ELOA 1PLKA 4OJQA 5FOVA 4DDWA 2IEZA 2WIBA 2O8DB 1NSTA 4OL0A 4ACBA 1L7VC 2G0TA 3D31A 2QE7A 3K0FB 5G3ZA 3ETLA 2QG6A 3UANA 4IVPA 4NDZA 1E2GA 3WNBA 4OQMA 4JLAA 1LY1A 2BMJA 1XTQA 1M7GA 2OCPA 3AP2A 3GLHA 2R9VA 3K0AB 1FL9A 1E32A 2XOKA 1II0A 4A8JB 1IJEA 4TT3A 2WM9B 2ZR0A 3GLHB 4ASUA 1G5RA 5TVKA 1I4TD 2WSMA 2QY9A 3B6EA 4C2UA 2XJ9A 2FZLA 4B43A 2J7KA 1P61B 1US8A 1KSHA 3MRSA 3SN6A 1NNEA 2NO1A 4MQBA 3CLVA 1OKKA 1KOFA 2B7BA 2F1HA 2DR3A 3AEZA 4Q00A 3U6BA 3X2SA 2YYZA 1KJYA 4LUCA 2RGDA 1LS6A 3QF4A 1VPLA 2P5SA 1G5TA 2NZ8A 2R44A 1Q1ZA 3B1ZA 3EPLA 2YZ2A 1NKSA 3NHBA 4Q5IA 3ZD6A 4ZCIA 1Q1QA 1JR6A 3AB3A 4B47A 4YONB 3P4XA 2EFDB 1O87A 2KSQA 2VL7A 3PG5A 3FKQA 2AX4A 4NYIR 4QJ3A 4PHTA 1GNRA 1FW6A 1E0KA 4B3CA 2GESA 5F98A 1SVKA 1XDBA 1DAFA 4B3BA 4CT4B 3BBPA 3I8SA 1E2PA 2QORA 1IN4A 2D7DA 3UKDA 1OXTA 1E2FA 1NRJB 3ZDQA 1XCPA 3CH4B 3MSXA 3RRNA 3VHXA 3PEWA 4ZIRA 521PA 4LBVA 2DHRA 3MWKA 2GXAA 4IXMA 1KI6A 3KDSE 4BGDA 5TY0A 5A5GA 5JHHB 1XXHB 3HU3A 2IYWA 4EPRA 1GIAA 2QN6A 1G8PA 4LYHA 3PVSA 3WRXC 3AVQA 1I4DD 1BOFA 1L2TA 1ANKA 1SKYE 2CVHA 3P26A 3RVBA 3WYFA 5FBRB 5B30A 4B2IA 1QHGA 1LB1B 4O2LA 2OLKA 2A9KA 6Q21A 3KTAB 4FWIB 5E7JA 1EWRA 1PJRA 5JLJA 3GLIE 2FU5C 2GBLA 3AH8A 4PHFA 3IBGA 3GLIA 2RGNC 1MABB 1KI8A 5HPYB 3CRMA 4TL7A 3CPEA 4WBSA 3E2IA 2ZI7A 1G3MA 1FOEB 5JHGB 3C14C 3NBXX 3UMRA 4V0NA 3TVTA 3UIEA 1N5LA 1ZM4A 3QXJA 1RIFA 4XJXA 5DI3B 5BN3A 5JEEA 3FOZA 1GP2A 1YZKA 4BRUA 3MWLA 2ZRKA 4FCVA 1E0JA 4HAUA 2BM1A 1XCMA 1W4BA 4LGMA 4CW7A 4IDQA 4B33A 2ZI6A 5C46F 4CEJA 1JXOA 2V1XA 2ZUDA 2HLDD 1PLLA 2E1RA 2D62A 2QI9C 3EIEA 3FKSD 2QAGA 1FQJA 4KV9A 4KHZA 1Q12A 3I61A 2ZYTX 3TE6A 3CNLA 1XD2A 3BRWD 4Q1EA 3BORA 1MO4A 3PITA 4OI0A 1W0JA 2W6IA 3SU8A 2GXUA 2QBYB 2IYXA 1EX6A 2NPFA 2JLZA 2J3EA 3GJ4A 4AYTA 5GJBA 2X1VA 1CBUA 1GILA 2Z43A 4HSEA 3OEHA 1YZUA 4OKSA 1GL6A 2OFXA 3VR5A 1NMXA 3ZD7A 3HPRA 2A3RA 2QT0A 3A4LA 4C0JA 1TPZA 2VF8A 4F4JA 2BWJA 4KVGA 3VR1A 2EQBA 3AGPA 4TQUS 4F91B 1U0HC 4FMBB 4BPBA 4RD0A 5DN6A 3CBQA 3C4JA 5H8WA 2FH5B 1JJVA 1KIMA 3GEEA 1E1RD 4IVQA 1ZCBA 3TAHA 4HLDA 2FSHA 5FUVA 4C30A 1KYIA 3OIVA 3EC1A 1Z63A 2AFHE 2G9NA 2ZS7A 4A0FA 3FDIA 1OYYA 1W36B 1J8YF 3QKTA 4LCBA 3TR5A 4WXRA 1KDRA 4D0GA 3GEIA 1NY6A 5KU1A 2FNAA 4Q21A 3D6TB 3LVRE 1AN0A 3H86A 2P2LA 1VYUA 1JECA 4W5HA 4QKQA 4MUBA 1DEKA 2WV9A 5B64A 1E2DA 3NKVA 2REOA 3WBKA 4DCSA 5FOUA 1E94E 4DZZA 3CNOA 1N6IA 4XOIA 4QOSA 2ANBA 4U00A 3ICEA 2BEKA 4H1VA 1CJTC 1MRSA 4JMPA 2GK7A 3U7FB 5FI1B 1J7KA 2J7PA 2WKRA 4TMTA 4KAXA 2RB4A 1KI1A 3K09C 4GZMA 5EP1A 2PZGA 2IX3A 3L0SA 1UKZA 1DO0A 1W0KD 4P4TA 2CCKA 1RRPA 2CBZA 4RFVA 2LKCA 1A1VA 4FD2A 5AUOB 3X1XA 1Z0FA 1DG3A 4NBSA 1RYFA 4EFLA 5JWRA 3UPUA 5DE3A 4PPGA 4V0LA 2KBFA 4G5SA 4RFSB 3TH5A 2NTYC 4DIDA 4D81A 4MDEA 5AJXA 2ZRNA 2EYUA 1CJUC 4I1SA 1AS3A 3OF5A 2ZSEA 5JWOA 4HAXA 3TRFA 2NO6A 1N2CE 2ZRHA 1XEWY 5JRZA 3IGFA 1E2NA 3DM9B 2W0SA 4LJ4A 5C1BA 4ON9A 4B2PA 5FOXA 1XMIA 2J0UB 2QGZA 2VQSA 3GLIB 4ZDIA 4JLDA 3A6PC 2ZETA 2CJWB 3ICQB 1FX0B 3K0CA 3K70D 5TARA 2XTNA 4MKHA 3W6PA 4E22A 2GAOA 3EZ2A 4YXWD 4YMVA 2OCBA 1ESNA 2F6RA 1E0AA 4Q1AA 1F2UB 3U7HB 1Z06A 4DUGD 4ZDJA 5KYKA 4B32A 4DEYA 2XGJA 4IOJA 1OIVA 2JJ2D 2D2FA 3VNUA 5J5CA 3K0EA 4HB4A 1P2SA 4EPWA 1XXHA 1U9IA 2NPIA 5J40A 3GFTA 1F48A 1I2MA 2C99A 2FGKA 1KSFX 4JLPA 4Q7KA 3U4QB 1CR0A 4BZQA 1AS0A 821PA 3KX2A 1W4RA 3T61A 1F6BA 5KHOC 2VF7A 1EGAA 1FTNA 1CR2A 4RJLA 3U5ZB 2WIAA 2FZ4A 2H92A 3GP8A 4MKIA 2WJVA 1Y3AA 2IUSA 3KQNA 1OFHA 4FINA 4DVGA 1CU1A 1P2VA 1XNJA 1W4AA 3FVQA 5G41A 4AWXA 2EW1A 1JXMA 4A6PA 3SHFA 1ZJ6A 3B78A 3NBFA 2HYDA 4M1YA 4TYNA 3LRPA 2C95A 4F4IA 4Z51A 1CJMA 4BFXA 5EZ5A 3I73A 4M0LA 1JBKA 4JBWA 1ODFA 1MR3F 1N0WA 1DAEA 1R8SA 4R98A 4XTRA 4B35A 3ADBA 1JEEA 1MT0A 3MWYW 2ZYUX 2ZJAA 4R2IA 2W2XA 4LV8B 2BM0A 3AUXA 3KZ1E 2A78A 4D2IA 4R7ZA 2EWVA 1TNDA 2WJGA 2YWGA 2J0UA 4LJ6A 4GP7A 4W9MC 3GLHE 3TW8B 5C4GB 4ZI3A 5JRJA 2OG2A 3EPJA 2GJ8A 1JEDA 3FMOB 2HLDA 1CEEA 4JLMA 1T3SA 1XTRA 2BC9A 4C0SA 1U8AA 1VKJA 3P1JA 5EXTA 4R9UC 1PLJA 1SXJB 3LXRA 2BHRA 4WOPA 2EWWA 3SJCA 2MMGA 3RC8A 3KB2A 4AYXA 1YZQA 4EDHA 2IL1A 3TQCA 3GJXC 3SJBA 5DH9A 1G18A 1T0HB 4W5WA 5DHFA 3CX7A 3M4YA 4M1MA 4OK6A 4A0GA 3EIQA 1KGDA 1P73A 1CJKC 4PPFA 4PZYA 3U44B 3GD7A 5M04A 1YHNA 1ZU5A 3PUWA 4OK3A 2DFLA 1RJ9B 1LV7A 2IHBA 4PHHA 4IKEA 4OHWA 1DBSA 3CKLA 1VHLA 1NVVQ 1G16A 3LW7A 2JASA 4FW9A 2NMVA 5AUQA 2E9SA 1DO2A 4NONA 1GVNB 4UXIA 2JATA 3JVUA 3EPKA 2QEQA 4AIIA 1TL7C 4KVAA 4QNRA 2CK3D 3OEHD 4ZCMA 1DADA 4HDOB 4URXR 3SHWA 3DO6A 4JS0A 2ODBA 1ZBDA 4HEJA 2QMOA 5GADl 1U98A 3PR1A 1NBME 1VG9B 2C5LA 2WKQA 1ZUIA 3SFVA 1AZSC 1DVRA 2ODWA 4DLZA 1R6BX 2PX3A 3SR0A 4DBLC 5DN6D 3PJRA 4D80A 3FHTA 5DYIA 5AK0A 2ORWA 2B21A 2GVDC 5EE5B 1F2UA 3L82B 2AK3A 3VR4A 1IXRC 3IIJA 3WNDA 3QKRB 3QBVA 2ATXA 3A37A 4BLQA 3OEEA 4CT5A 1HTWA 4EQ6B 3GLGE 1OSNA 3OFNA 3UK6A 1NBMD 1G8HA 2P6RA 3QJYA 2F3TA 1YKSA 3ZIAA 1OXUA 2GEVA 4WVFA 2GZHA 2WAXA 4PZZA 4ARZA 5FUXA 3A4NA 2I3BA 3TNFA 1JJ7A 2JIZA 2CE7A 5TMPA 4PC2A 3FWYA 2QM7A 3A36A 1NLZA 5FTKA 2ODEA 3X1ZA 4A8JC 4TN1A 4EPYA 4D6PA 1W2HA 4G1UC 1A4RA 5LB4A 3OESA 5TXGA 4DLSA 3W6NA 1J2JA 4LJ7A 3TMKA 5AR1A 3FYHA 2IEYA 2GKSA 1Q44A 3LNCA 4RD3A 2FFQA 4Q48A 2ZAOA 3DKPA 2OBLA 3C5HA 5KNBA 1FP7A 3DMNA 1NVUQ 5A0FA 1E6CA 4TTQA 4P4SA 5JJIA 3FMIA 5EXPA 3HWSA 4TWZA 2Z4RA 2ZI5A 4G5RA 2ZQ5A 4JBYA 4RZXA 4RKEA 4HZIA 3WYGA 4M1WA 1T91A 4LOAA 1HUQA 4Z1MA 1KI4A 1RYHA 1KI7A 221PA 5E3HA 1IJFA 1P9RA 3SQXA 1BH2A 1H8HD 2FV8A 1M7HA 1WBDA 1XEWX 1GFIA 1TX4B 3GLFE 2X2FA 5AJZA 3W3ZB 1U8YA 3GLFA 3H2YA 3SS8A 1JNYA 3MJRA 3EW9A 3VQTA 4DDVA 2VSFA 4B6EA 1YJ5A 2YOGA 2OFWA 4KLZA 5LPNA 4QRHA 4K8OA 1KZ7B 3KQKA 1M2OB 4LBWA 2DWOA 2ZJYA 2FJUA 4DHEA 1W48A 5KDLA 2F3RA 2R65A 2WICA 1A7JA 1G17A 5FPTA 1HV8A 1DAIA 2BV3A 2BMEA 2JGNA 3NVAA 2J87A 4H1UA 3B5JA 3X1DA 2V4ZA 4A92A 2AWOA 4HZUA 1HEIA 4LJYA 4HUQB 1FMLA 1YR8A 1X1RA 4KXFB 4PSKA 1UFQA 4G0NA 3A1WA 1T4GA 1Q3HA 3O8DA 4KU4A 4LZZA 1E4YA 3IUYA 1JAHA 1S9HA 3Q8XB 1MABA 3AVWA 2GJ9A 2AD1A 1OLOA 3OIUA 2ZE5A 1JAIA 2I1QA 2D4HA 4A2PA 5TB5A 2Y8EA 1R5OA 1NN5A 1W47A 2V7QD 1E79D 1E2IA 5JEDA 4XWKA 2HCJB 1A2KC 5KSYA 2JLUA 3LLMA 2PEYA 5FH9A 4IRUB 3FPAA 5H68A 1D8TA 1QG2A 3M0EA 1UDXA 4BUJA 1P4SA 2HUPA 2O8CB 1COWD 2CDNA 1DE0A 1Y63A 2WJYA 5BWMA 5FBVB 4Q9IA 5CDFA 3SBEA 5JECA 121PA 1R0ZA 4I4LA 4DLYA 2VP5A 4GZLA 4JKIA 3EA5A 4JVMA 4BLOA 5B58C 1ESMA 3AUYA 1XWIA 1P72A 3AF1A 3HP1A 2GZDA 3WHKA 4NYJR 4LWZA 4DLRA 5DO9A 1ZM7A 5FI0B 1SXJD 3FTQA 3MUFA 4DXAA 3EC2A 2XZOA 3K70B 1EFTA 1F2TA 1X86B 2BCGY 2FF7A 2ZAMA 2W00A 4Q9LA 1QHHA 1A82A 3A8TA 3IEUA 5EZ6B 3R7WB 3LV8A 1W49A 1ZIOA 2CCJA 1Q57A 1QBKC 3NDPA 5FOTA 4M1OA 2ATVA 3DVLA 3W5IA 1XJ0A 1JR3A 1UDWA 4Q1DA 3VR2A 4TL6A 5IK2D 2IYSA 4HB3A 2YC4C 1P6XA 2EFGA 1TTTA 5IT5A 3CM0A 2XTZA 3I8XA 1XRJA 3EARA 2GJAA 3K09A 4B76A 1KK2A 2PCLA 2Q3MA 4B3GA 2OHFA 2YC2C 3KKQA 2D3WA 3OIYA 3R8FA 2O8DA 1P3JA 3AQ4A 3QENA 3EZ6A 3W5JA 2GETA 2OFOA 2RHDA 3QKSB 3T1TA 3RC3A 1EFHA 2MMCA 3V4FA 2GWHA 4QBHA 4GT1A 4EPXA 2ZRMA 1GTVA 5HE9A 2R6GA 4QNMA 1FPMA 4M1TA 5FR1A 3T1OA 1X8LA 3LY5A 2FSIA 3DPUA 4URWR 4CRWB 5CLQA 4TYWA 4L8GA 4FMDF 1XZPA 3N2EA 4IDNA 4B6FA 5AUNB 5JJLA 1XPOA 4QM6A 1ZM3A 2WBLC 4XVUA 4LSGA 2Z83A 1CP2A 1KSGA 1NBMA 1IN7A 2ANCA 2BJVA 2JLRA 5L3RA 1II9A 4EQ6A 3L8YA 2ORVA 4N3NA 2NOAA 5K8IA 1GKIA 3Q7PA 3GLGB 1BMFD 1E2HA 1JPNA 1NMYA 3W8RA 2QPTA 2D7CA 1UM8A 4JLOA 4TLEA 5F3WB 1L4YA 2QQ0A 1IOZA 3FMFA 4AKIA 1ONBA 4IEEA 4NZYA 1M1YE 3PUXA 3U3KA 1GRRA 2PZFA 2ZSFA 4QC2A 5JWHA 2OV2A 2NO7A 3NBZC 3ZIAD 3MMPA 4BLRA 3SFZA 5FL7D 4M9XA 2IUTA 2VHJA 3EIHA 4U5XA 4AD8A 5BYKA 5UKDA 5E4FA 2VYFA 5DGXA 3V9PA 4NH0A 4DCUA 4I81A 1NVVR 1VG8A 1YU9A 1UEIA 3ZVNA 1E9AA 4LPSA 2J0QA 4P31A 1DARA 5EP2A 4V0MA 3U3OA 4M1KA 3RS5A 3B9PA 4MRPA 1G7CA 2WAYA 3WP1B 2VHTA 2ZIAA 1Z2AA 2OXRA 4NMMA 4DSTA 2YWFA 2OBNA 4A1FA 1W2GA 1HA3A 3AF0A 3T1QA 4HUTA 4J0QA 2C9OA 2Z4SA 4A4DA 2XXAB 4DDUA 2Z6VA 2HF8A 1NVWQ 2CL6X 4EJSB 4IOMA 3P32A 1SGWA 4JSTA 1ZRHA 3THYB 3EWAA 3KKOA 1L4UA 1ZM2A 4BLSA 2JA1A 2LCFA 2WKPA 3U3MA 3R9WA 1XU4A 4LHZA 2HXSA 4XH9B 2RGEA 2ZRPA 1RC8A 2A30A 1GKUB 2WVJA 4NU0A 1ZNXA 3RNLA 4EFNA 5HZHA 2GVZC 2J9RA 4QXAA 3AVXA 1KZGB 2OUKA 3K53A 1E0SA 1GUAA 3K9LA 3LFUA 1G8GA 2VSXA 3B1VA 1NG1A 4UJ3A 2AK2A 4ZO4A 3VHLB 5J4YA 4AI6A 2NO9A 1OPXA 2IHYA 4A0HA 1CR4A 5CDFE 3U61B 3EZFA 1TMKA 4GFDA 4JLVA 4G5OA 1G6OA 4HAWA 4Q01A 1NJGA 1PUJA 4LC1A 4KO8A 3TKLA 2ZRJA 1XB2A 4JL6A 1D6JA 1D2MA 1UKYA 4PX9A 5FTMA 2OBMA 2F1JA 2G1KA 4FIDA 3RANA 2OILA 3U6KA 1OT3A 3GPLA 3B7GA 3I92A 3THYA 1NY5A 4WAUA 1ZNWA 2OE2A 3U7GA 1IN8A 4IW3B 1OE0A 2O0KA 1YRAA 2XSZA 4TLAA 2XB4A 2F9MA 3DMDA 4PO1A 3KQUA 2IF0A 2W83A 1UEJA 2AXNA 2C03A 3BJIC 1S3GA 2ZU0C 3W90A 3SC3A 5HZKA 2W2TA 3BFXA 4DCVA 4C7OB 2QMHA 3NWJA 2ZSDA 4KI0A 3IEVA 1LF0A 3FHOA 3FFBA 1TEVA 1LFDB 1HY3A 2VP0A 4HLUC 1R5BA 4NKRA 2IWHA 3THWA 3K9HA 1M74A 1Z22A 4JVNA 4K81B 2JLXA 2VBCA 2CMKA 2PBRA 4KYIB 1SKYB 2P6UA 2R6DA 5FL3A 2J7PD 1C1YA 2FN4A 1XD8A 2ERXA 1XXHE 3QPWA 3SEAA 1AM4D 2ZJ2A 1MO3A 2QNRA 3GCGA 4P4UA 4IOKA 4Q9HA 3TSWA 2W6ID 4IOLA 4ZPXA 2DWPA 4P33A 3BAFA 4P3YA 3QKRA 3BFVA 4IDOA 4QGFA 2PX0A 1E1RA 1T3LA 2BVNA 2ZYVX 4HAYA 2GK6A 5CYPA 3TK1A 3TUIC 3E5HA 3TGPA 4L5BA 2QQEA 1QF9A 4CEIB 1GL9B 4AG5A 4O0MA 3B9QA 1XTIA 2LWIA 4RCZA 1KSJA 2VIIA 4JKYA 1N6NA 2ERYA 3EPHA 2ZI4A 4KITB 4G5GA 4US0R 3CH5A 4CVNA 4Z54A 4Y0VA 2IYYA 4TMXA 4EIWA 2FSGA 4EAQA 3KQHA 5A4JA 4LJAA 4RD1A 5JSZB 4MKFA 2HJVA 2PJZA 3KQLA 1FNMA 4D0LB 1G3RA 2J5XA 1KKMA 1O3YA 5CK4A 4MYHA 4QBIA 3T5DA 1OFUX 5GJVC 1MO6A 4Q7MB 1SXJE 2Q9CA 1E96A 2HXYA 3I32A 4QHYA 1XTKA 2RKOA 3QE0A 4DLTA 2XJ4A 2B6HA
chains in the Genus database with same CATH superfamily
4YMTA 3BE8A 1YDEA 2X2EA 2WIGA 4MVJP 3M1IA 5B5SA 2ZBEA 1E9CA 3DOJA 3I34X 1GG8A 2B9EA 3I1YA 4LDAA 4Z7OB 1V5WA 2EFEB 3FX2A 1BROA 4HRVA 3L8CA 1HYQA 1D2GA 2D8AA 1PGJA 5EWMB 4QPJC 5DNDA 4OHVA 1EXNA 1P7CA 5D5PA 3RS7A 1NZFA 1XSEA 1EM6A 5IAGA 1VKRA 3DVRX 2V5VA 1TLTA 5GIPE 1XBTA 1MOSA 4WGGA 2IS6A 4LRXA 4MS1A 3AZQA 1RBQA 1E9DA 1YB7A 1LBHA 2V4MA 3DZGA 3ULKA 1XZBA 3PXUA 3WO0A 4JJ7A 2VTVA 4GKKB 4Y0NA 4GDFA 1QQ5A 3C5VA 4AB1A 1GKYA 4WQMA 3QY0A 1R8QA 1Z34A 4AZ0B 5CFQA 4LTDA 3BRSA 4OI2A 4M7OA 2P2SA 2Y1DA 2GTHA 1I5EA 1PUIA 3K9NA 4GAEA 5EZYA 3B2NA 4RTRA 1FFDA 4E6EA 3KVVA 4JJKA 3OF3A 1J2EA 1QRAA 3GIDA 4PINA 5BW5A 2HA4A 3CONA 2QUAA 1JIXA 2WJHA 2J0EA 5HGJA 5CD1A 2H08A 1AO0A 1PHRA 1PQUA 5D01A 2W2KA 4U2KA 2CJXA 2FSSA 4ZREA 4YP0A 3G17A 5JSYA 1PT5A 4PQEA 4V0ME 1JWAB 2IP1A 1G20B 3AJAA 3PQCA 1UR5A 4X44A 4LCJA 1F5NA 4DTCA 1ZVKA 1RYBA 2W6NA 1ZC4A 4JBGA 1Z56C 2OO5C 5E6RB 4B4UA 4LOKA 4GDMA 3O03A 2AEMA 2P6PA 4RY8A 4GMKA 1KI2A 3BMQA 1BMTA 3E27A 5HX7A 5K3FA 5DM2A 4F9TA 3GJRA 1EM8A 4R68A 3ZH2A 1GEEA 2AGVA 4OP3A 5LP6A 2QLFA 2XV1A 3O4GA 4GO1A 4IDFA 4UW9A 1C7FA 2YXEA 3AF4A 4RF4A 3W79A 4BVJA 3EGCA 3QKWA 1NLYA 3OLVA 1Z6XA 2IXFA 2Z5GA 3QVOA 5ALGA 4OIMA 3L8ZA 4ZVPA 5L3QB 2WFLB 4GMDA 4L2IB 3SC2B 3H65A 4IYJA 3FHCB 1SVLA 3LP6A 5H1YA 4DB4A 1RRMA 2ZB3A 3O5AA 4ZK6A 5CD9A 1VBNA 1XU9A 3C8DA 3LUAA 4MPPA 1ZD3A 4C4OA 3QSGA 4UHCA 3PC4A 5JCZA 1EGQA 4LFAB 5LUBA 4HDRA 4XUEA 4FQ8A 1DBVO 1L5GB 4QPNA 4FHFA 4MR7B 2B4YA 4DQVA 5LZ5A 1XXLA 3T0GA 2H4XA 4YLGA 3S1LA 4LNAA 4BLWA 1Z0UA 4CL8A 1AQUA 3E9NA 3ESZA 5IPFA 1HNXB 3H19A 3OJOA 2Y66A 1Z82A 4G5QA 2QJWA 4CCSA 2GM3A 1QCYA 3M1YA 1I7QB 1IDOA 1QP8A 3GGSA 1S1CA 1U5BB 1RP7A 2K7ZA 3MVEA 3S55A 3N6XA 3WWYA 4MQEA 3SQMA 3PVZA 1YFKA 2ETVA 3KE8A 1J0DA 1RRFA 4PCLA 4WK2B 1UJ2A 1NP7A 1WUJS 5CIWA 4NLLA 2GFQA 2PYZA 5ALLA 4D4JA 4US2R 1GLVA 1NI4A 4D9MA 3PC8C 4YXWA 2P9CA 5A4MS 4ML3A 4WJLA 1P0IA 4K9PA 3TG2A 2X3YA 4CLDA 1KF0A 2MR6A 4HQ0A 4YRPA 2H2WA 1IXZA 4K6HA 1ZJJA 4LC9A 3NDBB 1I6LA 1ABFA 1MGPA 5I9NA 1PJCA 2G07A 4NYIQ 2O8EB 1W1WA 2KMLA 4UTZA 3H9JA 4GPTA 4PYNA 3OHPA 1VG1A 3SHVA 4E5UA 3OFSA 1BDMA 1G8YA 1Z2OX 2OLJA 4AM8A 2EXXA 3SC6A 4DDHA 1U0GA 5MFZA 3NEAA 3M2TA 1R0LA 2BBOA 3H8JA 4COOA 5L53A 3D4OA 4OQLA 4N54A 4WZAE 2PSFA 1GQOA 4FI3C 2HSJA 4YPFA 4EVQA 2RGWA 4DQUA 4UVHA 3IB6A 3U4CA 1AA6A 3MTGA 3NEYA 2O06A 2ZVDA 3B82A 4BNLA 5EIOA 4EYKA 3HDVA 4PTZA 3S8MA 4DR3B 2DKFA 2OO5A 4N40A 4C6HA 5JVDA 2VZLA 2NW6A 3FNRA 1HG1A 4F8EA 2YHSA 1TJPB 1JTFA 4ZV4A 5A1JA 2BFFB 5ETJA 4CKWA 2D1YA 2ZE7A 1M9NA 3ILHA 1QH9A 3F46A 4GPD1 2QZZA 2Q28A 4RJJA 4C2BA 4IIJB 1W34A 4RJ2A 2BGWA 2RGAA 2WJIA 5CVEA 4D26A 1LZLA 4EI7A 3EX7C 1YI1A 1ZI9A 1GPH1 2Q0HA 4HI0E 3GJ5A 3OCCA 5HIKA 1VHTA 5TGTA 2ZJ7A 3M1LA 2GCEA 2H18A 5TSDA 1ZW1A 4K7JA 4EJSC 3KKPA 2QMUA 5C7LO 4FMDB 4NAUA 3G8BA 4TMKA 4E30A 1E0DA 2ADOA 4UDXX 5ECYA 2QN8A 4PZLA 1NWHA 3NAGA 3SE7A 1DPFA 3NR2A 4UVEA 1C30A 2BJWA 2RCNA 4L4RA 2VATA 1E1DA 3C6XA 5DXJA 1MKYA 4BQSA 3ADCA 1VIYA 1P7ZA 2CZCA 4JR2A 2ET6A 4FCTA 4WNYA 2NUAA 4RTQA 2CVQA 2EGHA 2BBSA 1Y8QB 4IIGA 4R5HA 3DHNA 4ZVRA 3V00A 4EATA 3U31A 2EJUA 2XZLA 2IOYA 3ZWAA 3H1BA 1S2DA 1VZ2A 4I99A 5AVQA 4JCCA 4LMPA 2Q3LA 4QJ5A 5DZSA 5KI6A 4EKDA 4Q1BA 1B8OA 2VTBB 2J0SA 3ZV4A 1RKXA 4UBIA 3HG7A 1NZJA 2XGSA 4GWGA 1VBKA 3BTOA 4HYTA 1TVCA 3STHA 5ARDA 1ADYA 2YQZA 3CZ5A 3PL1A 5EJ7A 1QQAA 1PNQA 1EP3B 2ID4A 4MA0A 5I5GA 3WZLA 4RTNA 1G5HA 3I6ZA 4AP6A 2HT1A 4UMVA 4RZ2A 4BGEA 3BSWA 1AY0A 4HLCA 1GXSA 4TMWA 4ZZ3A 3OCUA 2WPDD 1OI7A 3TVDA 2Q0QA 4GW3A 4PY2A 2G70A 2W6MA 3TQOA 4ZYVA 3PX2A 4B79A 1T5SA 1Z5VA 1U2ZA 3AHDA 3SYLA 1DRJA 4A8TA 2PQMA 1S9DA 2HMWA 5HK8A 1O8CA 1OH7A 1HT1E 4D0NA 4PFJA 5HUHA 2VP2A 1HZJA 4KWTA 3UAXA 3D64A 2GLUA 1SBQA 4J6EA 1H85A 4CETA 3EOAI 1SNYA 4W6QA 3GMSA 1NVXQ 3AXTA 1R66A 3IDAA 3R5SA 5LP1A 5AVRA 4Q3CA 4IFIA 1X7GA 7ABPA 1R0WA 1KP2A 3BM5A 5KC9A 1VPVA 5H3HA 5BN4B 1Z9BA 2GVNA 4JWKA 1QYIA 1H93A 2JK0A 4JJZA 2N0SA 1QTNA 2G8LA 2Z2KA 3HNRA 3O8BA 3CEAA 3LWNA 1U7WA 2CHFA 4RJKA 4OUDB 3ZWDA 3AVVA 4CM9D 4Q82A 1M8FA 4DDKA 1ODIA 2WUVA 2XTJA 4FS3A 1LPBB 1T4CB 4MIOA 1SZPA 3GUZA 2D3TA 2BCEA 1RAHA 4EO7A 2UUAB 3THXB 1BHQ1 4LBYA 2PZAA 4WKCA 5HEKA 3EGXA 4ZOLB 4DUPA 2BMAA 1J0XO 5JPCA 4HS9A 5CIQA 5K0NA 4D8XA 1I3LA 4OREX 3J80A 1P17A 4REOA 2GTPA 1YQDA 4ZC8A 4OHXA 5FA5A 3A1VA 1XHLA 3ZHOA 1HPLA 3N7TA 2AVNA 4KAAA 2QRZA 2CYAA 1M34E 5JBIA 1Z2CA 1FA9A 3O2SB 3JYPA 5BR8B 2WTXA 3QG5A 5IC5A 4Z2YA 4MPTA 2HDWA 3G7NA 3RIEA 4JYZA 1IMJA 2HQRA 2OO3A 3LSYA 5KTTA 5DYNA 5K3FB 1LJUA 3I5XA 1T3GA 3ZDDA 3IESA 3PUVA 4UHKA 4LI0A 1R0RE 5FBZA 5BXQC 5EJAA 3NMUF 2EL9A 2Q5LA 4QTXA 1X19A 1CG6A 1OZGA 4BS9A 4LDNA 5E6RA 4JX8A 4ETMA 5AJVB 2WJPA 2VP3A 3ENKA 4DCMA 4FWTA 3VFDA 3EUEA 1U5AA 2C1XA 1EAMA 1E1QD 1S3IA 2WU3A 2WWRA 2QD4A 3K3PA 1R16A 4Y2PA 4B45A 5JSQA 5TLSA 4O29A 4QG7A 4LKOA 5KYTA 3B60A 3ZIDA 3G9ZA 4TGLA 1EKXA 1PE0A 1Q1EA 4FMPA 2NU8B 3A05A 2WDZA 3FMVA 3KT0A 1TKRA 2OO7A 4C4YA 5B57C 5CLGA 3H4TA 4EG8A 2HRQA 4DW8A 5G0SA 3RQIA 5C35A 1PEKE 2Q1UA 3G59A 3LUKA 4FZRA 3H5IA 5AW2A 2QSJA 4ZKDA 4D44A 4R83A 3TRJA 3NRBA 2FZCA 2XAUA 4KIUA 1KPHA 2ADFA 1UKAA 2BEUA 1ISMA 2CLOB 2QA5A 1ZSNA 3BXOA 2I4IA 3HUDA 3MWEA 1C8LA 1I5OA 3V97A 4IUYA 4AROA 4FFBB 4JC0A 4TZTA 4YAGA 5C8YB 4MUEA 5K3DA 1PL7A 2VUTA 1W4LA 2JFPA 2N46A 4BJ3A 4JYCA 2OPHA 4IFBA 4DCNA 1C4KA 4ARSA 2C4VA 4KG7A 3H87A 3U1TA 3HACA 2L82A 4UCQA 1DDIA 4N5DA 4C6SA 2B8NA 4XZ3A 2B36A 4GM1A 4NE9A 1EHYA 1U2DA 2GILA 3MTIA 4YA6A 5F2OA 5FXMA 3AUSA 1Y81A 4BAGA 5EIBC 4MVJE 3DAPA 2WYOA 10MHA 3AERB 1YI0A 2R48A 5KSZA 1PV4A 4Q4HB 3AEKA 1N9ZA 5J4KA 2FEOA 2YFKA 1QWSA 2AKYA 2V6BA 3Q3VA 4NE2A 2BMDA 2QXTA 3FI9A 3HEMA 5D3ZA 3RFVA 5AW9A 1FIUA 1XWWA 2FOLA 2IUUA 5JE8A 1I7PA 2QUBA 2ZTLA 2J46A 1B0UA 1DC4A 4MYUA 3OX4A 4LYFA 4S3MA 1AURA 2O2JA 4I3FA 3H2IA 1P1HA 4GHWA 3U56A 2NSJA 5JXHA 4I5EA 4LYDA 3LUHA 5BSEA 5F73A 3UMYA 5BSMA 2ZUBA 3W8FA 2HA2A 4Q18A 5A2GA 1NAHA 4NEHB 1DX4A 3ADOA 3T0IA 3GPBA 2P30A 2NO4A 5B6PA 1V1MB 2XLCA 2UXBB 4KN5A 4M4SA 4R1TA 5B53A 4C4TA 2H9IA 3U60B 4FMCF 3PFGA 3WNCA 1PDOA 2OCIA 2WIDA 4BFVA 3KOWA 4YLYA 4X85A 4M9ZA 1XD9A 3KYCA 1JJAA 3ENZA 1N5IA 3LUBA 4FGLA 4G24A 1T9BA 1QVZA 4MCIA 4R8RA 1BFUA 2RB5A 3RREA 5L4SA 4ND2A 1R0SA 1C7QA 1FZQA 1VYHA 4ILEA 4LZOA 4QJ4A 3ZDXB 1E2MA 1QU2A 2O8BA 3KKZA 3SDBA 4CLOB 3CINA 5DCUA 3ZOKA 4B48A 1KPIA 3DNMA 4X1KA 3ZS8A 4YUYA 3ZGOA 3QXCA 1E69A 2W0MA 3FUCA 1OYWA 4WHMA 4LI3X 1YNSA 3FH0A 4N7MA 2AN9A 5G4KA 1LXCA 1T3TA 2XKAA 3OQJA 2RJNA 4I4TB 3W1VA 1WETA 3AM1A 3PEEA 1FX1A 5A5FA 3K4PA 5IJZA 2A8YA 2PTHA 2PJRA 2WPDA 1Z26A 2C4WA 4UU8A 4CODB 4ER5A 1LUAA 1OV6A 1XU7A 5EQDA 1FC0A 4QC2A 3OZ7A 3A70A 1HNNA 1MJGM 3LTEA 3RKSA 4PC7A 3UWOA 3SVTA 1TEZA 4Q7JB 4R41A 2VWQA 3AY7A 2XYRA 1FUEA 1D1SA 4K8RB 1I32A 5G0VA 4NHEA 3NHFA 2YXLA 4YALA 2QUZA 4RHEA 4IRMA 1LBTA 5GZ1A 5JALA 3JD4A 5CM9C 5I9MA 3JXEA 2P2CA 1XZAA 4ND7A 3N2GB 4HLQB 3UWPA 3FCSB 2L42A 4QYXA 3O0DA 1VE6A 4UDNA 1P31A 1VMIA 4LJ8A 4LY9A 4P4NA 3ZQUA 1VE5A 3MLBA 2F8MA 5F2EA 2HPZA 1HDIA 4JUFA 4JUDX 4MRRA 3GOQA 2CB9A 2Q1TA 3BMQB 1G66A 3FLBA 3PDIB 3Q12A 3R09A 1AC5A 2PSEA 4WW0A 5J1TB 4JI7B 2C4UA 1R50A 1ZUD1 3A14A 3PKZA 1ZRSA 1RJDA 2NVWA 4K9OA 3LBNA 5EIAA 1YL5A 1ADFA 3CX3A 1FBTA 3NGXA 3QVVA 4L4XA 3INRA 3HKCB 1K7YA 2DVMA 2QD3A 3LUGA 1DAOA 2UDPA 1GPUA 3FI0A 4I2NA 1Z5ZA 5ALXA 5HXAA 5CW1A 4YPVA 4QTYA 5KTYA 1T2AA 3DZ8A 2IYLD 1RXUA 1X7YB 3OZWA 3LFHA 4G0PA 4M0KA 4WA7A 4DIOA 2ID9A 1KMNA 2BUBA 1E2QA 3KOXA 3UYKA 2DCUA 1GGHA 2QL6A 5B6JA 3ZKWA 4CMGA 1LDNA 1KNXA 2OAP1 5KYYB 1QB7A 4BUCA 2JCSA 4ND8B 4XJTA 1KQNA 3VPFA 3W0LB 3LX5A 4ZOEA 3N05A 5T4BA 4BMXA 1NVTA 1MH9A 4Z0PA 4UVDA 2DAPA 5IRCD 3K2IA 4LWOA 4E2WA 1K27A 3NBKA 4EKNB 1TUIA 3WV5A 1F51E 3QE2A 4BO7A 2PRSA 3UXYA 3A3OA 3TUZC 1WPQA 2GBGA 3ILYA 1OI3A 5FR2A 4PFSA 3VPSA 1W5SA 4YJ2F 5KHOC 4NCNA 1Z18A 1PJ4A 3AWIA 1K98A 3FYUC 4OY3A 4RVGA 5GY7A 2FFHA 3LXMA 3M5PA 1F9AA 4ER7A 1XVUA 1K5PA 1KC3A 1BE6A 1K06A 3U4DA 4B2LA 1NQ5A 3BJEA 1FZTA 2XZPA 2QTLA 2WJ3A 3SMQA 2FZWA 1DIHA 4OHOA 5K0FA 2JZCA 3E9YA 1YD7A 5ADUS 1U2PA 1WY5A 2Q4RA 4MS3A 4YEDA 3E8SA 1M2JA 1T9HA 4JT2A 1E58A 1PVVA 3RT9A 1HOTA 1PKEA 4DPMA 3KHTA 5CA1F 3C3PA 1HNWB 1TEHA 1I4OA 1XZGA 4Y67A 4YNBA 2GD1O 2GDJA 1OB2A 2H9YA 4NATA 1Q20A 1U6IA 4YV2A 3QFCA 1PU2A 2E5WA 2JG3A 4ZQEA 1Z15A 4RVCA 4AKGA 1HI9A 4NV1A 1CE8A 1OJLA 3I2YX 2VP6A 1Z39A 2GBCA 2C9YA 4E5PA 2VTDA 2WZBA 3OMLA 5HOEA 5ICGA 2IYUA 1WJGA 4LN1A 1EA7A 2VJLA 3W5SA 4MV7A 1RXWA 1KFKB 2H7VA 4OGGA 2ZRCA 1P18A 4D8WA 1USGA 2VHUA 3D0QA 3I01A 4DLVA 4MR8B 4KOAA 4HGQA 1G6HA 2QRNA 4XD2A 2K2WA 4PYOA 3JQAA 1GQRA 3IPRA 3BC1A 3RAPR 2Q3FA 2YMQA 4PGHA 3D8RA 1WZ2A 4BV8A 2JI4A 3UCXA 1PSDA 4HDMA 4G0VA 5KAMA 1SQ6A 3V9AA 4BMNA 2NZJA 3QUAA 3C2QA 4KZPA 1X80B 3ER9A 3R7DA 5ALJA 3EXIB 1FXSA 4IUCS 3PXAA 3TFWA 2OZPA 1AHPA 8ABPA 3CNNA 5K8LA 2PUEA 4C43A 1BEEA 3R4CA 1LRKA 3ESCA 5DOVA 1PYGA 3FYTA 3K8YA 3L1KA 3P9IA 4O59O 3H5OA 2ZXEA 2C98A 1UJNA 2X22A 1JFVA 1SVWA 1SRRA 1TIKA 2QTRA 1Z4OA 3N6RA 5P8WA 3SEFA 2BZ0A 2G5CA 1V8PA 1LH0A 3G2IA 4TMVA 5T41A 3UBMA 4DJTA 3FTPA 3NOXA 4RKRA 2PD4A 5H81A 5DLPA 1Z3CA 3DCYA 3SOPA 4X8OA 4D46A 2BONA 2R60A 3HVKA 4JWTA 4UPVA 1E9RA 3BXFA 3H9GA 3W8EA 3MAGA 5AOAA 3VTAA 4BP8A 2WA1A 1LS1A 2OV3A 5HOQA 2WUEA 3SM3A 3NHUA 4OB7A 4WLOA 1H2YA 1UBRS 2PUGA 1M6NA 1M8KA 2DJIA 4BRWA 2VQEB 4WN9B 2DH5A 2OHJA 2QP4A 5EWLB 3GG2A 1OAAA 2AZTA 3H1EA 3IMEA 2BFFA 1A4UA 4QGGA 3PT9A 1FNNA 2DTXA 1XQVA 3JD1A 1YVDA 2BW0A 1GM5A 1JSXA 3VTKA 4AC9A 3CZAA 1WE2A 2GJSA 4J0GA 1D6MA 1F4VA 4RAOA 2W2PA 1NHGA 1OF1A 2JAXA 5DBIA 1RXSA 5JXJA 2YINC 4H7HA 1CW2B 1N32B 2K4MA 1YBHA 4FYJA 1NW9B 3C70A 3UWKA 4D45A 5C8YF 2NUPB 2UYOA 3OZGA 5BQ5A 1M1YB 5KJ6A 1FSPA 1A9YA 3G5UA 2K5UA 3BRWA 2OZEA 1N1DA 3O8LA 5DULA 3L6DA 5FWYB 4UFNA 1NUHA 3QTBA 1AUXA 1IQUA 4XWYA 2JH3A 1ZIPA 1OFGA 4PRZA 1XL0A 1SG0A 1FP4A 2IBSA 3L7NA 2H54A 4C6TB 5LQUA 4Z8XA 3DR3A 4YMWA 1NVKA 5IW8A 3NHZA 4L5JA 3UJHA 5GVSA 3JZAA 5INTA 1AQJA 1K8RA 2BBWA 2B1IA 3WFIA 2JLYA 4GOXA 3ZPXA 3AVTA 3C98A 4LMBA 4MCJA 1SXIA 5E2AA 3AEUB 3ZHSA 2O14A 4HGNA 3E18A 1YZNA 1W30A 1IBMB 4DT1B 3VUFA 2CY0A 4DRYA 2ZWIA 4LFBB 2AFHB 3UAYA 4DY6A 4CLRA 2CFRA 3O8QA 2DFNA 2JLCA 2QW0X 4XE5A 2G6TA 4WKBA 4E2XA 1PNRA 4H7DA 1YQGA 1GCAA 1RQNA 7AT1A 4AJJA 5JCPA 4ZVMA 5ICCA 3PD7A 4RH3A 3UWMA 2H1WA 1UM9A 2PL1A 3O4RA 4HRAA 1O95D 3C6QA 3FWNA 5JD4A 2JAHA 3T06B 3JVDA 2AFIE 1I4EB 2O3QA 3MWJA 4JNCA 4LKRA 1EK6A 1X38A 3NGLA 4L8VA 4LXUA 4O0LA 4JC4A 4KI7A 3RS3A 2D1RA 4Q4LA 4INAA 4Y0AA 1HT2E 1QV9A 2AFVA 4LYYA 5CAEB 3KSUA 2IS4A 4JLJA 1LBEA 1QJCA 4EYQA 2FW8A 2Z8YA 2PIAA 4OLBA 3OZUA 2DY1A 1K5HA 5LWQA 1XR3A 4K9DA 3ZY2A 4LRSB 1YQ9A 2BTQB 5EXSA 4CLEA 4A15A 3F78A 2VDVE 2J0VA 3FHLA 1PJSA 2I87A 2NSDA 4W63A 3K05A 3V3TA 3FBWA 2GASA 2IHUA 3FDJA 4QARA 1F0NA 3KB1A 4IXDA 2XF2A 4IIDA 4LIPD 2WYVA 4PXSA 2CVOA 1P0CA 2YN2A 5HTKA 1R27A 1H6BA 2ZJFA 3R20A 4UHHA 1F06A 4OVKA 1J8QA 5TQ2B 4CG1A 1OH6A 2CNLA 2LIVA 4WEQA 3ZHYA 4RVNA 5CFRA 4GD3Q 2BTEA 3PK0A 4C0QC 4JC8A 4GBMA 4AZ3B 1V0JA 1V4NA 5FPYA 3TTYA 3T5AA 4QFCA 4HTAA 3PEFA 4RF2A 1A5TA 2HSZA 1OHHD 1BMFA 4MVXA 1E9VA 1JS1X 2BKUA 4HNHA 5LJLA 3PE3A 3UPTA 3H11A 4MV8A 5CB4A 1SWWA 2R8EA 3RVSA 4EHHA 3LO5A 4AN4A 4OATA 3U17A 3NBAA 1ZH8A 2AI2A 3JD3A 3COYA 3D6FA 3PXXA 2ZCUA 4LGYA 2NGRA 1V96A 4NYJQ 5D3QA 5BOSA 1DKNA 1XFDA 1UBNA 2Y0DA 1C3XA 2C31A 3ZQ4A 2CLHB 1KFBB 3OZTA 1IM8A 2FB9A 4KE6A 4NFSA 5AP9A 3A2LA 4AMUA 1JG1A 3E48A 3G0HA 7MHTA 4Q9JA 5C1PA 1RE0A 3TUJC 1S2OA 1NUPA 5FLYA 2R2AA 1V1JA 5FL7A 3TM5A 1IRIA 1TYZA 2VPWA 3B2EA 2PZEA 5BT8A 4MO2A 5FNZA 1OKKD 3WL6A 1QBGA 1P3Y1 1KAGA 1PD0A 1UBCA 2GN6A 3FYUB 1OIXA 3G5MA 3GFPA 3HP4A 1FPQA 3IAUA 2O07A 2B2NA 3JQBC 4LC0A 4URVR 1EAYA 1RLTA 5KPJA 1PZNA 4EPTA 3P0FA 4BE9A 1GR0A 3A1TA 3IEXA 3NTXA 2NU9B 3ZXUB 2AW5A 4HYEA 4R9NA 3CO0S 4ZVQA 1JPJA 5FKJA 3IUBA 1W88A 4DB2A 2V74B 3NGMA 3MJCA 4L9SA 4WZ6A 3SS7X 3H3JA 3RD5A 3VNQA 1Q0SA 1S8AA 1IJBA 2IU6A 1CLEA 3P2JA 3BB4A 1BX3A 2VNHA 3G5LA 2LBPA 4X1YA 1KQGA 5LIRA 1LTKA 3N8IA 4PVCA 1U9JA 1Z0ZA 1DT5A 1XZKA 3K5HA 1A76A 1JG3A 1FNBA 4TMFA 3Q2KA 4LXGA 4UEKA 3ESDA 4I6JA 2CV2A 1PK8A 4KXYA 3P27A 4X71A 4XIIA 4V39A 1UK6A 1E5XA 2AEJA 2CUKA 4MPRA 2B4RO 3D8NA 4AURA 5ADHA 4NOJA 1L5MA 1P1JA 3U09A 2YWXA 1HE4A 3RHTA 4MI6A 4D0GA 1X13A 2OVBA 3LY7A 5BN5B 4LZJA 1XZ8A 2RBKA 3JV7A 1U80A 4ZYZA 1T25A 1WB6A 4BB9A 2O2YA 5BSRA 3UMFA 3PUYA 3MRVA 4A36A 3AF3A 4IGIA 5CGZA 4U7WA 4Z86A 3LHFA 3BWVA 3QMPA 1KEKA 2R8RA 1RVV1 3AU9A 5LD2C 5KO2A 5AKXA 4AO7A 4E5VA 3AILA 1JX6A 2XEDA 4QUIA 1S96A 3ABQB 5FB3A 3II6X 2VH5R 3DTVA 3FVRA 1P1IA 2ZWMA 3HV0A 2HJGA 5CT9A 3UB4A 5JPIA 3UHPA 4P54A 3M5CA 4H18A 4BCCA 2JEOA 4LPKA 3AHJA 3H1FA 3G2NA 1JDBC 2FMIA 1BNCA 1ZICA 2AR9A 4IHKA 5JQGB 3K35A 5E0KB 5K0TA 3OJFA 2HHHB 3H8SA 3F6EX 4ZEOA 2JGFA 1IWPB 2C3YA 4QL3A 4Q3NA 2QTFA 1CFJA 2XVYA 3BTUA 3FXAA 3PWSA 3Q41A 1BS1A 1V47A 3HHPA 2W5UA 3W5VA 4KVZA 4EBFA 4Q9NA 3D6MA 4KNVA 3BERA 1PZMA 1C7RA 2IYQA 4CKZA 1KDOA 4U7FA 1NOIA 1X7YA 1PL8A 3MJVA 4XB2A 2I9KA 1Z5GA 1NE2A 1N77A 3I0ZA 4XA8A 3IE0A 4ZO6A 1J5XA 5FBHA 2NTEA 3ZLUA 3F4KA 1KQFA 2C29D 2II6A 1K8XB 1TC2A 2FX2A 4G4SP 4RNDB 4BNKA 3UT0A 1V1RB 2LCQA 3QPBA 3W6OA 5BUCA 3I9NA 3DOFA 2QJRA 1FSFA 5DASA 4DKXA 5LQCA 1ZD4A 1MJNA 4GPIB 3FVVA 3STTA 1JIJA 3Q3IA 4BNHA 4W9NC 4ZA2A 4FYYA 5B1YA 2ZZMA 4QSMA 2R96A 2GD6A 5DDIP 1QRRA 2KJQA 1CNFA 2XVZA 3NXSA 4UNPA 5LU8A 3N86A 1Q14A 3Q85A 5DI3A 2XA9A 4JB8A 3OQOA 3PPXA 3AUFA 1RXCA 1TLLA 2GAFA 3KJGA 3HJTA 1BU8A 5AW5A 2H48A 3OOYA 3BS4A 3ZIUA 3EK2A 3OTGA 4B7ZA 2XMBA 3ORFA 4L9WA 5EXDA 5GONA 2GT1A 2JLQA 1ML4A 3IO3A 3USCS 3QG1A 2B8WA 2O8BB 2ZRQA 3RPEA 3R9XA 1MJGA 1SCAA 2J9XB 1TYCA 3RT1A 4PTYA 1WHSB 4I0WB 4OXNA 4S0ZA 2ZSBA 5AT1A 1UC5B 2CYCA 4JT8A 4DUGA 4N48A 4QDUA 2CXOA 4FYXA 2OESA 3ZCRA 1EX7A 3LLUA 3P9QA 4AJNA 1XPUA 1GNSA 1E98A 4X6XA 3SJAA 1KEPA 2WOOA 3LC1O 4BHTA 2PT5A 3DE0X 3BQNB 3VISA 3BXPA 4IH4A 3T34A 5FUMA 2IOFA 1X3SA 2HWXA 3CNHA 2F8SA 1XJCA 4ESVA 4D9CA 3P5SA 5KVQA 4B8WA 5EWJA 1AIPA 1FRFS 1H2EA 4GR9A 2IS1A 5HCIA 1I9CA 3TAUA 3K20A 4IDAA 4PRKA 1QCZA 4BO0A 2JW5A 2IOFK 3NRJA 4RD4A 2HIMA 2WUDA 2BEJA 1UINA 3I5YA 3M6XA 3BH6A 2C8VA 1FS5A 3MCZA 3F97A 3FOWA 2VYND 4QPPA 1RI4A 1NF8A 2B98A 3LQKA 3OHSX 2ZU6A 4HAVA 1UJMA 2A9FA 4Y6PA 3UGJA 1JW9B 2ZRIA 2QJOA 1KI6B 4YQEA 1LI5A 1H5NA 5EIEA 2EP8A 3BSSA 2GCNA 2ONKA 1JU3A 1DQRA 2HCFA 1OH5A 1U9YA 1KO8A 4PC6A 4QOJA 4NCBA 3DHYA 3P9NA 4EK9A 5EFZA 4D79A 2Q2OA 1RRKA 3HFSA 3O1IC 1BWSA 3K30A 3V8PA 4HGPA 4WLUA 3M70A 5GONF 3MIZA 1I2AA 3QHQA 3F7TA 2PGDA 4HVAA 3ZCXA 4FDTA 4NU6A 2C5BA 4MRSA 1BXGB 3JPWA 5FPQA 2WJZB 1F8UA 2XEXA 3IP7A 3KAPA 3O9MA 4LF8B 2VZ0A 3IP1A 3FTDA 4CZ2A 4ASUD 2AOUA 5LA6F 3T1VA 2IU3A 3F2VA 4FP9A 1RKVA 3JZDA 1KP9A 1SUFA 1TMYA 3ZZUA 3ZV3A 1QHEA 4NMWA 5HFNA 5TDHA 4F5YA 5ALMA 4D96A 3LBHA 5CURA 4DFDA 1UH5A 4PGAA 3HVHA 3RS0A 3OECA 1RQ7A 2PMWB 1KAQA 4MV0A 2FG5A 2BGUA 5E95A 3OLYA 1MXHA 1N8KA 1T36A 3PEUA 4B4KA 2I2CA 1R6AA 4QBGB 2Q5EA 2EQAA 3EDMA 1DC3A 4WDQA 2EBFX 4DA9A 4FVTA 4TLBA 2QZ4A 1UZNA 2F9LA 3CRVA 1CULC 1K63A 4G2NA 1PF7E 4Q3AA 5DT9A 4F9EA 2X6QA 4IF4A 2XYHA 2AQIA 2YHBA 3JRNA 1CQJB 1B8PA 4RNCA 1D0SA 1M2WA 3NANA 5BVGA 3ZCPA 2C2GA 1NMEA 1O5IA 5ARCA 1LVUA 1XAGA 1DS6A 3K6SA 3T1YB 1RPZA 1YGYA 2QVBA 2PKCA 5IARA 1GADO 1FRVA 2DCMA 2PK3A 1ZN7A 2TECE 1GGJA 1NQVA 3I6QA 3OSZA 1MF7A 3ROXA 3SSNA 2CD7A 1KRHA 2AC7A 4TZ0A 1A88A 3ZGVA 1H65A 4J9VA 1YE8A 1OWLA 2CXTA 3CLRD 4MB6A 2BH9A 4FDUA 1ZVJA 4OL9A 2QJFA 3T5GA 4XSHA 1QZXA 2X19A 4Y2XA 7GPBA 1Y3HA 1V11B 4OHPA 3VVBA 3OAAD 1G3IA 1KIFA 4F38A 1CVLA 3KLMX 2OD9A 1GARA 2RARA 3DM5A 3W06A 1FE8A 4LDPA 1CUYA 4YCAA 1HR0B 1ILWA 2OT3B 1L5YA 4V1CI 5B4VA 2ES4A 5JFGA 3VC2A 2V0GA 1P1CA 2O8FA 4CV2A 2Q4OA 1AOXA 1KERA 1ZIDA 3B6IA 1J56A 2ZBFA 4O4IB 1VHDA 4ZZ2A 2F59A 4O2BB 4BN4A 2OOKA 5HM8A 1PVOA 1B7GO 1Z2NX 2FG7C 1ZUNB 3U40A 3QVUA 2HTFA 3VYVA 3KSAC 2CCGA 4NFLA 1GTZA 1MENA 3HDGA 2EZUA 4L3OA 1K88A 2NU6A 3ZW8A 2Q6LA 2AXPA 1KBOA 1XLTA 2VT7A 3EA0A 1SMKA 2IPAB 3IBYA 3WB2A 2NO0A 4IDGA 5J4LA 3FNIA 2V7EA 1P0PA 4Y9TA 3TNDA 3DQPA 3R75A 3L43A 4EPVA 5IMSA 4GBED 3IKJA 2ZSHA 3WFJA 2QVYX 4QYMA 4MV6A 3ZQ6A 3AKCA 3ZH9B 2H5EA 3VGJA 1RC1A 1RC0A 2FLVA 4TSKA 3CW9A 2WT8A 1EPUA 4MWDA 2VAVA 4ZJPA 3FRIA 5DSTA 5K09A 1VXOA 4RDCA 2DQKA 1YAHA 2JJ8A 3I53A 1FP4B 1T34A 1AGPA 2XGGA 2A86A 3LWZA 3T9BA 2Q3JA 2CWWA 3MK31 1U2DC 1UDRA 3EF1A 4NBVA 1T24A 1ODJA 1Y6RA 5JAQA 1ZH4A 3QEKA 1CV2A 1V7CA 1QXSA 2H4FA 3E82A 3FOBA 3NTOA 4J7CA 3SLKA 1AUQA 4HFNA 1E7YA 4GXNA 3C6BA 5LP6B 1E9SA 4A1OA 4LHSA 1DCFA 1MOZA 4JH0A 1H1DA 721PA 4CL2A 4MEBA 2DQYA 1XD2B 1G7SA 4H6WA 2WYHA 4X1IA 5D1NA 4CR6A 4HB2A 4YT2A 3HWX1 4FFNA 2V6JA 2H2AA 4KZKA 3HGTA 4RZQA 2RC5A 5AM1A 3I04A 3WIEA 3ECSA 4QBTA 3LDAA 1WA5A 1J1IA 3Q5EA 2JANA 5BSGA 1Y5LA 6ADHA 3WYBA 1U99A 4CE6A 4EUFA 4I9HA 2IP2A 2N42A 5KWEA 1KORA 2CJPA 3G2LA 2OOSA 1DEAA 1EVJA 2W2KB 4NJEA 1R0CA 3HVIA 4OXYA 3CWQA 1TQHA 2Q6TA 3T5CA 1CUCA 4AKEA 4RADA 1NQUA 5CJPA 1ACMA 2G04A 1RMQA 2P3OA 3BJZA 3P9ZA 4ZO7A 2RI6A 4MZDA 3KV1A 5FLXA 4ALMA 5BVGB 3IV7A 4LQCA 1J2TA 1N6KA 3FKJA 4CEHA 3LIIA 4LYEA 2V3VA 4I8XA 4V0QA 4B0PA 5FA6A 2L0XA 5K0LA 3LY9A 2JB9A 1CUUA 1ZW6A 2RKBA 1U8EA 3F6SA 1IK4A 1TIPA 2FX5A 2VHCA 3S8YA 5CXUA 1ZPDA 4UUNA 1FTYA 2GHTA 3QIAA 4IKPA 4ADSG 2H1RA 1R4ZA 3P97A 4MUJA 3EXFB 2B35A 2WYIA 2QQ5A 5L95A 2JKVA 5E1MA 4CQMB 3VU9A 1KETA 1NONA 2VCYA 3IUJA 1JHMA 5BQOA 3TMYA 3UMSA 4YJFA 1HYEA 2AE1A 2GAAA 2B5WA 4HBGA 2C2MA 4MS4B 3F9CA 3N7AA 3GT0A 4DLAA 2H51A 5CLJA 4RM3A 4TMZA 5IHPA 2P1ZA 4DIUA 2R47A 3R9IA 2IH2A 1PR6A 3DAHA 2V54A 2GRJA 4Z4IA 1OBVA 5K03A 2AR0A 2GPSA 2CLEB 2YV5A 3IJRA 3C8UA 3T7SA 4F1KA 1XALA 2O48X 3EIXA 1JDZA 4Q3EA 5EHZA 3R3VA 4NU8X 3IPCA 5BV2P 3MIIA 5ER9A 2VPPA 3QNMA 1M72A 2VS1A 1RLMA 2VG8A 3IOYA 4C2TA 2QL7A 2VZEA 1QK5A 5ITSA 1UXHA 1ZUNA 2O3JA 3WL5A 4FC7A 3ZHUA 4R16A 2IT1A 3GDWA 2H65A 2VQ3A 2JBWA 4LRYA 4NICA 4D5GA 2CHGA 4DWWA 3DDCA 3L7BA 5EEGA 4CQLB 1BFKA 1PSZA 3WTBA 1HDGO 1COZA 5KBYA 5MFPA 1THGA 2EJBA 4CFZA 2C9DA 3UJNA 2IEZA 2OGWA 2PBZA 3ENWA 3KQOA 4FOTA 4ACBA 5FT9A 4WZAB 1L7VC 3D31A 3Q3EA 5G3ZA 2ZSUA 4P7BA