1NURA

Crystal structure of human cytosolic nmn/namn adenylyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nurA00
2PXHA 5AHWA 1V47A 4ZCSA 1A8HA 3DPIA 5HUHA 2DERA 3AFHA 1EFPA 4NZPA 4PY2A 4U8HA 3A05A 3TZLA 2DETA 4I6EA 4ZCPA 3HFJA 5TS2A 1QJCA 2DUMA 3IOCA 4GU5A 4DNXA 3QTBA 4KKVA 1JECA 3FOCA 5IJXA 4DJAA 1G8HA 1WXEA 4Q16A 3JXEA 4EF6A 3CVYA 4HJRA 4HJXA 3UMVA 1ILEA 1J1ZA 3H9CA 3FNRA 3SDBA 3IODA 3LCJA 3AG5A 5DASA 1EFPB 3CR8A 4EG3A 4EG8A 1VL2A 1WQ3A 1FFYA 4EG4A 3N8HA 2VXOA 2CUZA 1MJHA 3ZXIA 4KR6A 2A1TR 4MW5A 1JZSA 3COWA 1U7DA 1HYBA 4MUKA 3COYA 4MLPA 4MUEA 1MB9A 5H7XA 2D5BA 3Q4GA 3IMCA 2QTRA 2IJGX 3CLSC 2YY5A 3ZUGA 1J21A 2DPLA 1OWLA 4XFJA 1WZ2A 2A84A 1NZJA 2IELA 5J5AA 1PG2A 4ZT3A 3FH0A 1TYAE 1WKBA 5IHXA 3SZGA 1QNFA 2GKSA 1G8GA 3CVXA 2ZUFA 1U7XA 3UK2A 3TS1A 1YUMA 1KQPA 2AKEA 1NUPA 2A86A 1R6UA 3CLUD 3IOEA 2JA2A 1P7PA 3CVVA 1CT9A 3RBAA 4EG1A 1ZH0A 4MW0A 1TQ8A 4MWCA 1EE1A 1X6VA 3HV0A 1Q19A 4MW4A 4ND6A 4CQNA 2X1MA 1U3DA 3G6KA 1WJGA 1QRUA 1OWPA 5HG0A 2RD2A 2CYCA 5LM3A 1H3EA 4NX2A 2HMAA 2YXNA 5LLTA 3LE8A 1LI7A 1WXGA 4Q93A 2R5WA 3ISJA 4KR9A 1ZUNA 1MOPA 3RHSA 3KT3A 2YWBA 4CT0A 3ILVA 1K4MA 3AL0C 1IQUA 1FYDA 3N9IA 4QREA 1GN8A 1N2BA 5FNZA 1T9GR 2PZ8A 1KP2A 1O5TA 1YULA 4GRIA 1ULHA 3MLAA 3SYTA 2WB2A 1PFUA 3D6VA 2IP1A 1O0BA 2EJCA 2CV0A 1VBKA 1MC1A 4R2LA 3OTWA 4U63A 5J59A 3TNJA 1GTSA 1M1ZA 1SURA 1QRSA 4MW7A 3SEZA 4R0NA 4DDKA 2XRZA 1N75A 1GAXA 1I6KA 1M8PA 1N2IA 4J75A 4YP5A 2A1TS 2QUJA 3K32A 2B7LA 2AG6A 2J08A 2Z3VA 3VGJA 1JILA 4HK4A 3P0JA 3CLTD 3X1MA 4TS1A 1OWOA 3QE4A 3G5AA 4R2MA 2J5BA 4F3RA 2CT8A 2YWCA 4P2BA 2V0CA 4EFKA 1O97D 1N2EA 1KORA 3K9WA 4EG7A 3HMQA 3GMIA 2PFSA 1F4LA 4NDAA 3MMXA 4OJMX 1JMVA 1YIAA 4MULA 3L93A 1EFVA 3CLRC 3CLUC 1KH2A 1KR2A 2TS1A 2J4DA 3ND7A 3TQIA 4CDNA 5KHAA 4NATA 3TQOA 5TEVA 1U0BB 1OWMA 2X1LA 3G59A 3ELBA 1KH1A 3UC5A 1JZQA 4FZJA 4ZT5A 4F4HA 1WXHA 1G8FA 1M8GA 1KH3A 3X1KA 4MVWA 1G59A 1NUUA 1D2RA 4WNYA 2O5RA 2OQ2A 1WXFA 5LFAA 1VBNA 1M8FA 3X1JA 1GZUA 1O94C 3IDFA 1R6TA 1TYDE 3Q10A 4K0RA 3PRHA 1XNHA 3GLVA 2CV2A 3IVGA 1MBZA 1MB2A 3OP1A 1KKUA 1Y42X 2H29A 3SEQA 3CA8A 1WOYA 4JZYA 1O0CA 4MUFA 1T9GS 4MUNA 5DB4A 3PXUA 1O95C 3IVXA 4ZT7A 5FO0A 3E27A 3CLRD 3TZEA 1EUYA 1NSYA 1KAMA 2PG3A 3HZRA 2C5SA 2CYBA 1XNGA 1M8KA 4X0EA 1I6MA 1XNJA 3H99A 2E18A 3P52A 2WQ7A 2A4MA 1Q11A 1V8FA 1PG0A 3ZJTA 1OWNA 1NUSA 1B6TA 5TEWA 1J1UA 3H05A 4AS1A 1S4MA 3CLTC 5K0TA 3COVA 1QU2A 1F7UA 4NAHA 1O94D 1NI5A 4CDMA 3FI0A 1PFYA 3A2KA 3RK0A 1O97C 3IUBA 3HL4A 1YI8A 1RQGA 1PFVA 4EGAA 3PNVA 2X0KA 1R6XA 1T6ZA 3IVCA 3FHJA 1JEDA 1KQNA 1KAQA 3H9BA 3AG6A 4XFDA 1O96A 4YMIA 2D54A 4MQ6A 3VU8A 1IRXA 1WQ4A 4UZEA 1O95D 3DO8A 3RJZA 4J76A 3D6UA 4PBSA 1IFXA 1VBMA 3VRHA 1KQOA 3L92A 2ZP1A 4ZT2A 2CFOA 3S3TA 4ARCA 2PZBA 4WSOA 1NYLA 4L2IA 4JXXA 2DLCX 3NV7A 2DEUA 3FETA 4DE5A 1N3LA 3M5WA 4OUDA 3NBAA 4UZFA 1Q15A 3IOBA 2A88A 3NBKA 4MVCA 2J07A 3C8ZA 4DDHA 2CYAA 4RUKA 1IQ0A 3GUZA 1F9AA 3KFLA 1O96B 4ZT4A 3LOQA 4EG6A 4JFAA 3ND6A 4MWEA 1K92A 2I1LA 1GLNA 2HZ7A 4ZCRA 2QUHA 3FY4A 1MAWA 4NAUA 2NZ2A 1BS2A 1X8XA 3N2YA 3MUEA 4MAFA 1N2GA 1IQRA 3PNYA 3MLBA 4ND7A 1N77A 3A4IA 1M8JA 4KPUA 4OUDB 4S1OA 4KR7A 1WY5A 4EG5A 1H3NA 2A1UA 3KT8A 1TYBE 1LI5A 1OD6A 2QJFA 2PZAA 2VTBA 1IHOA 1OBCA 2QUKA 3FG9A 3N05A 3IUEA 5TGTA 3U1VA 3ZGZA 2X3FA 4YBRA 2QUIA 3CVUA 4U7JA 1J09A 3INNA 4MW2A 1NURA 5EKDA 1QU3A 4G5YA 5DEOA 3IH5A 1ZJWA 1EJ2A 1ZH6A 4K03A 5HUJA 2NSYA 1PFWA 5K0SA 1T6XA 5F23A 4KPUB 5H16A 1QTQA 4G5FA 3UY4A 1T6YA 2A1UB 2AZXA 2E21A 3DV2A 1EFVB 3P0HA 2GOYA 2VTBB 2EL7A 4ZCQA 1GPMA 3ZIUA 3BL5A 1KP3A 1UFVA 2E89A 4MUIA 2E0IA 1N2HA 4MVXA 1TFUA 1MRZA 4A91A 4DDMA 2J09A 2O8VA 4HPWA 4ARIA 1F7VA 2A7XA 2RE8A 1WXIA 2CSXA 4I6JA 2WQ6A 2QTNA 2CV1A 4MVYA 4XSVA 1H3FA 1LW7A 1NUTA 1K4KA 1TYCA 3I05A 1I6LA 3H97A 1N78A 1JIJA 1EUQA 5JBNA 3Q12A 1TEZA 3FDXA 1JGTA 4JYZA 4ZT6A 1J20A 2PIDA 2HGZA 4MUHA 1N2OA 3KT6A 4MUJA 4MUGA 3CVWA 1U3CA 4YP6A 3F3MA 4MW6A 2Z09A 2G36A 1JEEA 1IH8A 1I2DA 2D13A 3KT0A 3RK1A 1YUNA 1NUQA 2WSIA 4BWVA 2OV4A 1J70A 1H1TA 3ZXSA 3P0IA 2QTMA 2Z08A 3RFFA 3SZ3A 2BYTA 2DR2A 1M83A 2JANA 4G6ZA 4PBRA 5FO1A 1IVSA 3A04A 2DXIA 3AIIA 2QJTA 1Q77A 3PNBA 3QTTA 2XRYA 1N2JA 1DNPA 3CLSD 3IMEA 2QJOA 3MXTA 2JAXA 1OBHA 1N1DA 4AQ7A 1QQTA 4JXZA 1VLHA 2GM3A 3UOWA 1K97A 2ZUEA 3FIUA 1YIDA 2H2AA 3ZJUA 3SP1A 1O6BA 2V0GA 1EXDA 3ZJVA 3IMGA 5DK4A 3DLAA 3ND5A 3FWKA 4DLPA 4H3SA 4QBTA 3AKZA 4YP7A 1JHDA 5KWVA 4QRDA 5J58A 1QRTA 4ZCTA 5KCMA 1COZA 1NP7A 3COZA 3HGMA 1JIIA 4RPIA 5BNZA 2BTEA 4E1AA 4PBTA 4L2IB 4I6GA 1MAUA 1GTRA 1JIKA 1XJQA 4MW9A 4MW1A 4MWBA 4MWDA
chains in the Genus database with same CATH superfamily
1L8OA 1KK1A 2AJ8A 3QYJA 3SXJA 1L7DA 1WF6A 2BHTA 3U6BA 2A5YB 3AY3A 3KSZO 3IT0A 1QCCA 2DG2A 2ZKLA 3JAKA 5EJMA 4G9GA 2V03A 5B4VA 2F3SA 2FEOA 3R40A 4X7BA 1Q50A 2CCJA 4OQ4A 2DPXA 2R66A 2BFOA 1MP0A 2FPXA 3ROPA 4IW3B 5CD9A 2VUHB 4C08A 1F6DA 1U8UA 1VE7A 2R86A 1JQEA 1U1FA 1JLSA 4D4GA 5FFFA 2OG2A 3ZVRA 4Y6GB 3BRWA 4F38A 3GMDA 1H4SA 3WYDA 1QNLA 1MU0A 1P6XA 2XWBF 4BV2A 4CG2A 1ILEA 4GL4A 4RLQA 3KAQA 3G2LA 3S68A 1EFTA 1JFFA 1RYHA 2LGJA 2YR0A 2C2BA 3B3AA 4N6OA 1T1GA 4MVJD 1FLDA 1GNTA 2IXAA 1HPLA 3MGAA 4FC7A 4KAAA 1HRDA 3GGPA 1FZQA 5CIQA 1VL2A 5LB4A 3AXSA 3OF5A 4Y6RA 4X44A 1LS1A 2ZIXB 5F5XA 3F4KA 5KNLA 1T9DA 5A5GA 5KNCA 4YFYA 2ONZA 1S7GA 4KB5A 1W96A 4OHOA 2H1LA 1XWFA 4F1JA 5ILOA 3QVGB 5BSTA 1M34A 2XUPA 4DA7A 4LOLA 4LXQA 3WNBA 1E2KA 1JR3D 3IB3A 3IVMA 2FFJA 4MLZA 4YMUA 1G5QA 4O0MA 4MW5A 2VT3A 4GFDA 5KMGA 5JMTA 4HGPA 2ACKA 5I8WA 3S8EA 1R8JA 2QAGC 4TL7A 3T7SA 3EASA 3R0ZA 4MDFA 1LDMA 3CRMA 1LNZA 1R4NB 4HWTA 3HLTA 5EKUA 5BOSB 3AFGA 5H4GA 3KYCA 5IAOA 3SJBA 5KJ6A 4P4NA 3UKJA 1XWIA 3NTUA 1MIOB 3WRYC 4YV0A 1ZM3A 5AKXA 1D9ZA 1X70A 3KSRA 4OD0A 4N7MA 4UTPA 3NCTA 1L9KA 1EDDA 2RGGA 2C2MA 4FDVA 4Q3BA 9LDTA 2C2ZA 4R2IA 5FD8A 1PR0A 2B69A 1ODLA 2D8MA 2GTIA 2P11A 2Y1DA 4UBNA 4H15A 4K0KB 2Q1YA 3PJRA 2UZ3A 2LE0A 1XYYA 3MTBA 3EQ8A 2FE1A 1QANA 1VG1A 3IXMA 1QC5B 2GKSA 2ZUFA 3T5MA 4L73A 1U7XA 1PT5A 3EY9A 3Q5GA 1SBZA 5IKXA 1MXHA 3VNRA 2PUWA 1NUPA 1DIRA 2HV8A 3OCCA 2OHXA 1TA0A 2X1HA 3WYEA 3QUAA 3KSMA 3Q3EA 5AW7A 3V4OA 4F56A 2C9MA 3BH0A 1XO1A 3KZVA 3SF8B 2ZU6A 3KV1A 1SU6A 2CD7A 3JD0A 1SCUB 4KQJA 2Q8PA 4K6CA 2VBIA 4FDAA 4WOKA 1GUAA 4AJHA 5B36A 3L1KA 4A4DA 2P1RA 3WE7A 3VA7A 1G5HA 1L7PA 1YKFA 2D0OB 1JSXA 2QMHA 3OA2A 5BV7A 3ICPA 3I6YA 4NY1A 1XQ9A 1EESA 3D5QA 2RKOA 3AXTA 4OTZA 3WLQA 5FWAA 1WQ1R 1RZ3A 3C4QA 2EZ9A 3PICA 4NX2A 5AESA 1JS1X 3SQDA 3I8OA 3QBJA 1MO2A 2VTVA 3PUZA 4PQFA 5BQOA 3SAJA 4CF3A 1KI8A 3HYRA 4TTRA 3ISJA 3WAGA 2O20A 4Y7CA 2GO1A 3WTCA 1E1LA 4CT0A 3ILVA 2VBCA 3NT2A 3OCZA 5L6MB 1U8ZA 4WACA 3LVFO 1FFEA 1NXWA 5SY4A 3PQEA 5E1MA 2LCQA 3U7JA 3UT0A 5HTOA 4YRTA 2D7CA 3IHWA 4Q24A 4ZPJA 1Z62A 3W5DA 1U7ZA 2BJHA 2BR3A 1PFUA 2QRKA 2XOXA 1LCIA 5CIWA 5FPKA 1N32B 4JI8B 1Y3CE 2C2OA 3C5EA 1CDDA 4K2HA 1DJPA 1YONA 2RCNA 4JNKA 5ECGC 3FYSA 1PWXA 1W1UA 3SK0A 3Q8LA 4TKLA 1SA0B 3WP1B 2AZMA 4EMTA 1MDBA 3V9AA 3FYCA 3V1UA 1PKEA 1GZ6A 4URVR 2IYXA 4XTRA 1WB4A 3L0IB 4MUAA 1UQTA 1KRHA 2Q1WA 2RIPA 2VJAA 2DYKA 2YCLA 3OZCA 4JGIA 2SNIE 4Q3EA 2YX1A 2DWUA 3E6AA 1GL3A 4F4IA 1L4YA 2B7LA 4HQ6A 5ALIA 1CYEA 1KBOA 2Q07A 1ML3A 1OZ0A 3DJFA 5DTRA 3PNQA 2HA2A 4U0JA 1HO3A 3N0WA 3MS2A 3VGJA 3H86A 3JQBA 3SDZA 5M34A 1ZESA 3OWHA 1RADA 2H3EA 3HY3A 1X74A 2LIPA 1QOPB 1OBOA 4B46A 5JXJA 1N2SA 1YZUA 1GFZA 2PBRA 3M33A 5E9WA 1W88B 1CFJA 4YCMA 4AJPA 5FBHA 5FPQA 3H65A 5AOVA 5FT9A 4IDPA 3H2ZA 4TMXA 3SFZA 4BB6A 4EG7A 3K70B 4TZ6A 1VPEA 5JD4A 2F59A 1HG0A 1F4LA 1XD8A 5LDDC 3MA0A 3NAGA 1UBOS 1OTHA 2P2SA 4NESA 2XE8A 3OPNA 1QBKC 4GWGA 4CKBB 2H1IA 5H83A 1EB8A 1QK4A 5TB5A 1HE3A 2UVQA 4E5SA 2D1TA 1P2BA 3FPFA 2G1JA 3JAKB 1PLJA 1VPLA 3EPJA 3IAS6 2IPOA 3HN7A 1R6VA 2WP0A 5LWQA 3HA2A 3ZQJA 4OJKA 3EB9A 1IZYA 4KIJA 1U2ZA 4LZOA 1E3SA 2BHSA 2I6GA 3AL3A 3UATA 3O82A 3H42B 1W5FA 1EQUA 4JKYA 1JIXA 3OWXA 1NW7A 2OG1A 4JUCA 2W8ZA 4HQLA 1WDMA 1P5RA 3KD2A 3KOXA 4FHEA 4M22A 1TZBA 2HXSA 4IHKA 1MT3A 4LYJA 4WOJA 1WXFA 5DT9A 3EZ9A 3RW9A 5BSVA 1PT9A 2NO1A 1AB6A 1ZHFA 2Y1FA 1P62B 3PVSA 3CF2A 1QYXA 1KZ7B 3BE5A 4FQ8A 4BLTA 4C7OA 3KR2A 1FEZA 1RYDA 4P0PB 1WHTA 3R0XA 5TQJA 1CSEE 5I7AA 6NULA 3KKQA 1PLKA 3GLVA 3OECA 9LDBA 5ALZA 4Z2YA 2P6RA 2W2LA 5FLYA 3LV8A 1AKWA 4W5OA 3F2VA 4J0GA 4F4CA 2GJSA 1GFSA 3I4FA 2B30A 3VFDA 3UTDA 3W5UA 3QA3E 4EK9A 3W5AA 5M5BA 5K51A 4ZODA 3NYIA 3F47A 1CS0A 2IQIA 4IGEA 2P3OA 3PUIA 1M34B 1X1BA 3QSYA 1NBOA 3CLHA 3OF3A 1IUKA 3QF4A 8MHTA 5K9ZA 3VR3D 4LZPA 1BEZA 3CZQA 5H3CA 2GYYA 5KMGB 2O0JA 4DABA 2IUTA 5KVAA 1C7QA 2PKWA 2O05A 1UR5A 3O38A 4IZ6A 1ULZA 3A0UA 4F93B 1VSVA 3CUVA 1G9TA 3AZQA 4PM4A 1T6BY 3AEZA 4RETA 5K3CA 4DMCA 3KYCB 1GVNB 3NHSA 1JB1A 1UT6A 3I28A 4CZ2A 5IZCA 1CWUA 1L8LA 3N2KB 1REQB 2X23A 1AGPA 1W4AA 2WBLC 3HRKA 4JKOA 5DBEX 2IS1A 4AJ4A 2H52A 2QYTA 4JLOA 1N92A 1QFYA 4AJKA 4AVYA 3W8RA 3URKA 1NYQA 3N7TA 4GZ5A 1CQIB 2WUWE 1Y8CA 2NZ8A 5B1HA 2BKEA 2I2FA 3NTQA 2EF1A 5T64A 1BWRA 3IGFA 4GPD1 5ARDA 1L1FA 1RWBA 1ECPA 2FN7A 4A73A 1F7UA 1N33B 4COKA 2OO7A 1O94D 5HIIA 4ARVA 5KJEA 4RIHA 1IC6A 1Z06A 4LECA 4LSZA 5IFLA 4R9NA 2XB4A 3X0DA 2N46A 5LIPA 3IUBA 2IV7A 4NV0A 2VSNA 1NLYA 1NP6A 2TECE 2VP2A 1F2TA 3PNVA 4KXMA 4K88A 1T6ZA 3FHJA 3A3KA 3TJZA 4CQLA 2NU7A 4Q9HA 1XEAA 3QHAA 2JAUA 1C7RA 2VNKA 4C2AA 4J0HA 5JSFA 1O96A 2LKDA 1SHUX 4DMFA 3BTUA 4LQLA 3BGSA 3E22B 3AEYA 4OQQA 3WB9A 1MAHA 4J76A 4W5TA 3QWFA 2NYRA 2ZWOA 4EITA 2D0PB 4GYWA 1KI6B 4II2A 3ETEA 4UDOA 3TD2A 1POXA 1YQEA 2QVCA 4LZLA 4LJ7A 3S1AB 1DARA 3PXXA 1NYLA 3WLNA 4FCVA 3LUBA 5LU8A 2ZE5A 3MSXA 1E20A 1SEVA 2FSIA 3K9BA 4G01B 5LN1A 3IVRA 3NBAA 4JD5A 4DG8A 1ZM4A 4CM9A 3ANNA 2WUFA 3OZBA 1H1DA 3DZIA 1SC1A 3R8CA 4XIGS 3HCOA 4YRCA 2I4MA 1U2DA 5LKAA 4CL2A 4ZT4A 2QTGA 2QXTA 2EW2A 3V8EA 5KTRA 4I0WB 4IGFA 4NWIA 2Y68A 4UMFA 2YVQA 3FOBA 3O3OB 2A3RA 2CDAA 2XYPA 4IGIA 3C3CA 2CVFA 4R1NA 3H3JA 4AT1A 3ZE2B 5BMVA 4UM9B 3I9NA 4P53A 2HIHA 5JNSA 3KJNA 3WLMA 5E8RA 1GG9A 1TXGA 2PEZA 1YBMA 3OA0A 2HNAA 3QFTA 4OUDB 1V39A 2NUPA 5JS1A 4D74A 2QLTA 1G5IA 4L74A 1E1YA 2HRRA 3SF0A 1BJTA 4BCCA 1E4YA 1SXJE 3TUJC 4EA7A 4KO2S 2XMRA 3TZQA 1W30A 1WMSA 3T95A 1PTJA 1W6UA 4C1NA 4B85A 2JCXA 2TSYB 4IINA 2AGVA 1SOWA 1L2TA 4B17A 1YJ8A 3B5JA 1XTBA 5CLQA 1I51A 2RGEA 4EL5A 2DQSA 1ZJ4A 2BFNA 4XASA 3D2LA 4XJVA 3IHLA 2BEKA 1GEGA 4P0QB 2YZ7A 3EXFB 3NEAA 3LGAA 4IEEA 3AIKA 5FV7A 5B2FA 3C24A 3Q0TA 3QLEA 4YO7A 4D56A 1ZWKA 4DCOA 4YDQA 1QPZA 3UY4A 3R0JA 1Y1SA 4NTZA 5FI3A 1T2FA 2XMQA 4BZXA 5I8ZA 2PAAA 3BAZA 2ZT8A 1N6LA 3J81k 1K6XA 3A10A 1TCUA 1Y8QA 2OD2A 3OFVA 4RK6A 2I7VA 1Z5UA 3ZWMA 3A6KA 1BE0A 4BQRA 2BHLA 3NP9A 4MWSA 4RK0A 5C46F 2YOFA 1I80A 3S7TA 3TZBA 4MA5A 1OW3B 1VHTA 2OZLB 4CQMD 3QUBA 2GGSA 5PNTA 1NDHA 2OPBA 3FSJX 1V5GA 4DVJA 3GFGA 3DL7A 1M6EX 4CHTA 4DUYB 3ESYA 3P2YA 1VJTA 2E48A 2VS1A 1RI1A 3T7EA 2ADMA 2B4QA 5LU9A 1UCFA 1PQ4A 2O2DA 2V4MA 1NVMB 3MINB 3LVBA 2QDKA 3NLLA 1B3BA 4GPEA 4P3OA 1IJEA 4EY4A 3T7TA 4G8CA 1NQXA 3SYKA 1DAFA 1I4OA 4LYDA 4R5MA 1BU5A 1FFWA 1GN9A 3EF1A 3ST7A 3H4TA 3HXLA 4C7OB 1NU6A 1VYUA 3EDCA 2J5XA 2FSGA 3VKWA 4I14A 3WKAA 4OP2A 1EWVA 2EJTA 4IXTA 5CVDA 2IUUA 2QLFA 2BRUC 1TVMA 4W1SA 2X9QA 4TSRA 1H0KA 4JOCA 5AK6A 5JY1A 3ZV5A 1EUQA 4ZV4A 2PPVA 3KE9A 4NFLA 3RUAA 4UTXA 1WPGA 1CS0B 1X94A 4EKYA 4NMWA 1S1MA 3WIEA 4LOKA 4PICA 1MHTA 2UUAB 2QY9A 3LDHA 3F7NA 1N2OA 3QF4B 2JI7A 4G4GA 4BEVA 4D3FA 1KEVA 3GW8A 1QE0A 1NR5A 3PLNA 4IG4A 3ZGVA 1DBQA 3KX2A 3USZA 3MYYA 3SXPA 5NULA 1AS2A 4N49A 1GZDA 5HBGA 1D03A 2ALJA 1NQOA 2CBZA 5GONA 2CL6X 1QE5A 2ZUBA 4JB8A 5FULA 4UUAA 1HY3A 4DV4B 3AJ9A 5C37A 1P5JA 1Y34E 2RAFA 2V9CA 3M4ZA 4UHDA 3IIEA 4E3WA 3A6GA 3OWOA 4FEGA 3LQFA 4YROA 4UOZA 4IDEA 4FN5A 1OE0A 3KZKA 4AECA 2GT1A 2ZZMA 3GHYA 3GMSA 4AXXA 1XHEA 5KCZA 3JYQA 1B7GO 4TWRA 1NJFA 3FDJA 1KETA 3AIIA 3HVHA 4JJKA 5T57A 3WJ7A 1J5PA 1Q83A 3MOIA 4NR0A 2E1RA 4H31A 4OJQA 5KREA 4A15A 4M37A 4YRZA 3E8XA 4UM7A 3BCSA 1VMIA 3ZU2A 1SKUA 1IUOA 2UV8A 2PXAA 4BC1A 2XMSA 3DKPA 5F2EA 4JASB 4BLWA 3GEBA 4NRDA 4LX0A 4QL3A 5FRDA 4B83A 2B94A 2VRCD 3F5FA 3FOWA 4PGGA 4G3XA 4TZ0A 1U8EA 2YIDA 4PS1A 4RY9A 4UM8B 4L3VA 2H2AA 1AK9A 4FYWA 4YALA 1AUXA 4CQLB 1EXDA 2NU7B 4HGNA 4OYYA 3ZIAA 4H4EA 3T99A 1GYRA 3OKAA 1BD3A 1C50A 2H65A 4PZYA 2C3OA 1JA9A 2ZETA 4GOLD 4RD0A 1IHDA 2JAQA 5JIBA 3PQ4A 1HFKA 3W2GA 1J97A 16PKA 4RPIA 4JS0A 3AR9A 4E1AA 1GPDG 2UDPA 1M1YE 1VLLA 2PAFA 4BGVA 1I1HA 3GRKA 3S5UA 4N12A 3TD9A 5JT1A 1NX6A 1LLQA 4GMDA 3GPDG 1TKRA 4V0KA 2VXBA 3ZWOA 1P7YA 4FMCB 1PJCA 4DF3A 2YQ4A 4GXNA 1SUFA 5JD6A 2DP4E 1YH3A 5HCIA 3SQWA 3RSHA 2F48A 2YNMD 5P21A 3HKDA 2BP7A 4GSLA 2Y71A 1MO6A 3KPVA 4UUPA 5KNDA 1Y82A 4XM2A 2JAHA 3PGVA 4OXRA 4RACA 3UK0A 1P9OA 3ZCXA 3CTMA 1A7JA 4X8MA 5KI6A 1JECA 4DGSA 2C29D 4PG4A 5JI3E 3TCXB 4J0IA 3DEFA 3K35A 4NK4A 4ZC1A 3K6RA 4HQ0A 2IQ5A 5BYKA 2R1UA 3HJRA 5LXTF 4NZ9A 2B5WA 1U3VA 1MUUA 1RXEA 2NUPB 3B9BA 3UBMA 3D3NA 4TUYF 2WFLA 3AHGA 2CFTA 1S9DA 3VSAA 3SQXA 2ISSD 5CFPA 1KOGA 1UPBA 2HA3A 2CNOA 3HA7A 4YCLA 4GBED 3CR8A 1JDBC 1OLSB 1E94E 3D81A 3AMVA 3A11A 4DNQA 5CX4A 3NM5A 4Q7KA 1QO0A 3DEYX 3BQ9A 1SBYA 2LR0A 3LZDA 3QEKA 1NBWB 1EP9A 1POWA 2X5JO 4HNSA 1D7OA 1CUUA 5JSYA 3H1TA 3WKCA 3U1BA 3LDAA 4FUTA 3SS7X 3N2EA 4M83A 2F1KA 4B3TB 1CVIA 3B82A 2AFIB 2HMVA 1A88A 3HHPA 3W9SA 2D5BA 3TLGA 1L5YA 2XVXA 3LY8A 4L4ZA 3UF0A 1NVGA 4F1KA 5M7EA 1ZUIA 5LQAA 5AI5A 1Y8QB 2OO3A 1ZPDA 2B92A 2NT3A 3WA6A 3CSUA 4IDGA 5B3AA 1JG4A 1GARA 1SBCA 2A84A 4N18A 2IA5A 4DKJA 5DYWA 4DIKA 2G5PA 4QVKA 3R4CA 3AM5A 5DSTA 4ZZIA 1VSBA 4KN8A 3BRQA 4M1EA 4MIEA 2HHAA 1ZINA 4QECA 4RA6B 4IIBA 4U7TB 1UBRS 5FTJA 1ZHHA 3L77A 1KY2A 3SM9A 4AN4A 1MXFA 1V8DA 3C6ZA 2Q27A 4EMBA 1ANKA 2RCYA 1V3QE 3QA9A 4BEBA 2XIJA 4YGXB 2FMFA 1HFJA 4YRMA 2H00A 1MB3A 2Q3DA 2Q6KA 4CFYA 5JPCA 4DPKA 2HSDA 1YNSA 4B81A 3IKJA 1ZHOA 2QORA 2B3DA 1TO2E 2GM4A 4JP8A 1EE1A 4YQFA 2ERXA 3N53A 1WCYA 1Z08A 1Y9JA 2YWDA 1TT5A 3WK9A 5F1PA 3TJRA 4P22A 3DFUA 3IPCA 3Q88A 5E0OA 3O8OB 1R8XA 3VUEA 2XJ4A 2YWEA 2AW3A 4M1OA 3QSGA 4YRSA 2I6UA 4Q3LA 4DIBA 3SZRA 1H3EA 3CVOA 1Z15A 2HU7A 4JLUA 2WHQA 4X64B 4IFTA 2VC2B 4KBFA 1DEOA 1FE8A 4G2NA 3OIYA 4MYHA 2R6DA 2VCEA 5AKLA 2VQ3A 5JJIA 3A4NA 1OT5A 5IP5A 3HXKA 5JS2A 5DCUA 3PRJA 5GONB 1URPA 2BFBB 3TRHA 2Z4RA 2QU7A 2R7MA 1N2BA 2QT9A 2Y1KA 1IZZA 3NI2A 4TYMA 1W1IA 3MJDA 3ZCVA 1YRYE 1TJYA 4JLSA 3MD9A 5DYYA 4AMBA 5LC1A 1QIKA 3D6VA 5K03A 1S9HA 3GEMA 5E1BA 3SC4A 4L7VA 2DTDA 4RBNA 1SURA 4L15A 1AKNA 2ZAIA 3TYXA 1S02A 4YT4A 5IAKA 4KRGA 4MGZR 4PZ0A 3I2JA 2HU8A 3EPPA 1B00A 1JG1A 2X3UA 4NMMA 4UXIA 3TW6A 3INGA 4CL0A 5IFKA 1BG6A 1HZJA 4C05A 5JMOA 1FFDA 1X3LA 4JMPA 4LIPD 5CTAA 4BZPA 4E1BA 3DOFA 3TAHA 4A03A 4Y0NA 3EFHA 2F1JA 3PHGA 4OI1A 4LJYA 1YZTA 4Q5IA 4A9AA 2FUEA 3AVVA 4KG7A 1RQNA 1PYGA 2ATCA 1F3OA 5FBRB 4F3RA 3MC1A 3DC2A 4XGQA 4IOJA 2O2EA 4CCYA 1SJ9A 3AFMA 3B9PA 2P27A 2XRFA 2V6BA 4GM1A 5EE9A 4F3YA 3HL0A 5EA2A 3PNMA 1H65A 1XWWA 5D3MA 1ZJ5A 3EXIA 2PFSA 1DUIA 1F1JA 2Y93A 3MELA 5FFMA 3UMGA 4BHTA 1NBMA 5CFOA 1X1AA 4E2ZA 3EFOB 1CEQA 3MD0A 4V0OA 4XAQA 5K3BA 2AZDA 3CLRC 421PA 2XLCA 2QAIA 3RRNA 5KQGA 1UAAA 1FNBA 3ICVA 4FGZA 3MF4A 4L0CA 3HKDB 1GSOA 2BP7B 2VBGA 4ID9A 2X1LA 2GJ8A 1SU4A 2XYGA 3MM4A 4S0ZA 3WICA 5BVHA 5K8IA 1YVDA 3UUEA 3N2IA 4KK3A 1RC8A 1RAAA 5KC9A 1TUGA 4XJXA 3LYUA 1UIMA 5EP4A 3ZHBA 5IU6A 2EHJA 2HCJB 2GN1A 4CI9A 5FTMA 4AB1A 1P2GA 2XI4A 4HI0E 2P6PA 2JGRA 1OLXA 5EJ5A 2ECPA 1G9SA 5FBZA 1M8FA 2WT4A 4I19A 3FB4A 1R6TA 1TYDE 4CQMB 3MWEA 2JGEA 3FOAA 1ORIA 2P9GA 3KPJA 3MGBA 4LJAA 2DFLA 2NUAB 4YJFA 1Z2DA 5AO9A 3HZOA 2D2IA 1ZGZA 4QEDA 3OEHA 2R00C 4HDRA 5EZYF 1F9EA 1KF0A 4B2IA 2ON6A 3OT4A 4WRRA 4F6RA 4Z7OB 3L7IA 3SY8A 5K4HA 1Y3BE 2Q46A 1L4KA 3GRUA 3LUDA 4LDRA 3MPOA 1E7WA 4ND3A 2G09A 3ABZA 3ETNA 4UHEA 3TFWA 3FX2A 5K20A 2BF4A 4GGOA 4YYZA 1H5QA 5A6SA 2XUZA 2ZSEA 1C3XA 4L7QA 4TM8A 2AJCA 3L8MA 1DTWA 2EHDA 5CDSA 4ABTA 1OX6A 1NLUA 2B78A 4ZVKA 5LL6P 1EUYA 3EVTA 1R50A 5AVJA 3ZCSA 2VDRB 2AN4A 5JZMA 3TLGB 2V7QD 3AJEA 4NE7A 2ZVJA 4B40A 4JX9A 1N5JA 5DBIA 4WXYB 3ESDA 5IVDA 2C2XA 3A9WA 4AKSA 3MMPA 2Y6UA 1NJ2A 3N58A 2P3LA 1YRLA 1E2GA 4K9PA 3ZCUA 5AVVA 2W6OA 1PRYA 3I23A 3L7DA 3B36A 3FLBA 1OXXK 4MR8A 1RE1A 3DZDA 3E3NA 3QU5A 3MCWA 2BUCA 4MMXB 4NQZA 4QOSA 3H04A 4M9SA 1MABA 2PWAA 3L4EA 1XROA 2FDRA 3ZNNA 5BUCA 2ZI3A 4N9QA 1Z56C 4AD8A 5K0TA 2EKDA 3COVA 1KMNA 1U2TA 3HU1A 2QQEA 1QS0A 4BO6A 1AKUA 4TKMA 1O0SA 1XRRA 4DV2B 1ND6A 2F9LA 4Z1OA 3A2KA 2ACEA 5JFOA 3NYWA 4GXQA 1YR6A 3EW9A 3OETA 2DXIA 4RHTA 5FBWB 1CS4C 1ZOSA 1UFQA 1YI8A 2AK3A 3KTOA 4UFNA 4C4TA 1WSAA 1IOVA 2HGSA 5LMNB 2QW0X 2WSYB 4FFBA 4GPZA 1KQNA 1IRIA 1MH1A 2XTMA 3BWDD 1Q21A 3D3EA 3S0JA 1TT5B 221PA 2PZKA 3AG6A 3DCJA 1RAFA 3DUWA 2CNWA 1W36C 2PXXA 1AT1A 4QPDA 3BMNB 3QVSA 3HVUA 4MZXA 1NXQA 1VJRA 521PA 1KQOA 1X3SA 1E63A 3WTBA 3WDLA 4BDSA 3RHZA 2G04A 3A70A 1AUPA 2YJTD 4BUJA 4YUZA 2ZUUA 4LISA 2J0UA 4DDUA 4ZYYA 1K7EB 1PJ2A 4URWR 4OLBA 1Q3TA 1FTYA 3IOBA 4C07A 2FN4A 3THXA 5T8KC 5AW1A 2JCBA 4RWEA 4DDHA 4ZK6A 2YHIA 2CYAA 1TLLA 1Z37A 2NACA 1KJQA 3NRJA 5K99A 1T9BA 4KR2A 1I4TD 4NMXB 4HAZA 5EQJB 3V7WA 4MKRA 3NDBB 3UMMA 2CMKA 3RU2A 1UFRA 3B1XA 4KIFA 4WADA 3TRDA 3WMEA 5KYXA 1N2ZA 4RK7A 3O47A 3MJEA 2WK1A 1VRWA 1YB6A 5F1OA 1F51E 2NZ2A 1X8XA 1U4OA 1VE3A 2G4CA 4YV7A 1UXKA 5C4MA 3AETB 2FA9A 2ZM5A 3NANA 4YRJA 3CZPA 5IT4A 1A5ZA 2H5EA 4ZTZB 2BEUA 2AMJA 2GJAA 3NVMB 4E5UA 4I4LA 1PSWA 3D7KA 2GYWA 1H3NA 5BWLA 3WHLA 3FMIA 5KQSA 1TYBE 2XOKD 4Z86A 3KB2A 3WOHA 1N7IA 4LF4B 4ZVRA 5A7GA 3D64A 2J7PA 4NMHA 1RQLA 1CUGA 2YJ3A 3B3GA 3CBQA 4HEQA 4NOKA 1QQ6A 5TJ9A 4KLAA 1EX7A 2JEYA 3ANXA 4K26A 2DOKA 3ROTA 4DUGD 5JRDS 3R7SA 1A04A 3CVUA 1EX6A 3ZHTA 2ZXUA 4NU8X 2CLEB 4PAOA 4ISBA 5A3VA 1Z4JA 1CZKA 1A95A 1L5LA 3UENA 2ZIZA 1TQ4A 4L02A 1EA5A 2CE2X 3E2PA 2VWHA 3RVRA 2P1DA 4IQFA 2R97A 1KS9A 1VL8A 2O3SA 3DE3X 4WL0A 1KDOA 1JP7A 4KPUB 4IO0A 2HPZA 4WA8A 4EW2A 4TX1A 1YRBA 3WKBA 3E9YA 1W25A 3DTNA 3MLEA 2ZUTA 3TZHA 4D46A 3HU2A 2X0RA 4I8IA 5KS2A 1Q91A 4M7OA 5I7FA 2WHYA 2C61A 3QXHA 4LK2A 1HE5A 1XL0A 3HI6A 2IUYA 3PDCA 1NONA 4G36A 4QRIA 3TKLA 3OC6A 1KP3A 1N1EA 3AI7A 5JEEA 1FU8A 1CZUA 1LPOA 3U4IA 1E2HA 4I50A 4X7MA 3V8NA 5BVHB 3AQIA 1T0UA 1L5NA 4I08A 1KSHA 3C43A 5BSMA 4AWBA 5JTUA 1ECJA 2Q49A 4XRGA 2VL7A 3L7KA 4BNYA 1S01A 1IDOA 1V1RA 1XN4A 3K1TA 3NAQA 5DOVA 1DC5A 2EKZA 4HPWA 3WLLA 3UGKA 4WTOA 3FTCA 4XW2A 2C59A 3G1WA 3I76A 2HMYB 2JLBA 2K6GA 1R0SA 3H11A 3PQDA 4TUYA 1IG3A 3VTKA 3OQPA 4XB6B 3VC3A 4DSUA 1CQXA 3EVZA 3SBOA 1RTKA 2PZEA 2VP3A 1JVNA 2WRZA 4B4UA 4YJFB 2AA3A 3A58B 1DXYA 4HP8A 4HDRB 3H97A 3K9CA 5JAHA 1N78A 1LDNA 4MR9A 3SC3A 3DG9A 4F6RB 1MRNA 1PQUA 1VCNA 2PMCA 3M1AA 3MWKA 3NH9A 5GTDA 2ZIVB 2WIBA 2WD7B 3FYHA 2APJA 3ESXA 5A6SB 4NJEB 1XMIA 4IRXA 2AEEA 4K9QA 2QMOA 2HGZA 3W2EA 1XMXA 4EZIA 3PQ6A 2AXQA 1M1NA 3SKVA 3GEGA 2IP4A 4G84A 2OEPA 2RBGA 1K8YB 1H2XA 1NI4B 3ICCA 2FFQA 3EDOA 4R40A 3ZJYA 1OYYA 2PR2A 1I1NA 1HNXB 4FSXA 4RK5A 4QSHA 2GPYA 3C15C 1YUNA 4WOPA 1Y7LA 4HFRA 3T7DA 2V5VA 3MUFA 2ANBA 4FCWA 3TKAA 4MR8B 2C7VA 3NDPA 3K94A 4M0CA 3UMCA 1KDPA 2IU0A 1H2YA 3VTZA 3ONWA 1MABB 4RADA 3O8BA 2D8AA 3BGWA 3LPAA 3FPCA 2ZWMA 1QCYA 1I1OA 1TC2A 2E6UX 1U0SY 3DMRA 4ZVLA 3R3VA 4KJZA 4UPDA 4Y1EA 4D5GA 5A4FS 1GTG1 3UPTA 2HFKA 4G85A 1QS0B 4UNNA 3RRXA 4MDEA 2DFNA 4MX8A 2J59A 2RHMA 1JAXA 2RG7A 2X8LA 1Y8AA 3DXFA 4R3UC 3ZC3A 4XD7D 2H7XA 2FTKE 2GNOA 1T34A 2UZIR 3GVHA 3TR0A 5CLFA 2YBEA 2Q0XA 2Z2XA 1FDRA 1C29B 4CGYA 3B1JA 4CIXA 4OQFA 4YMWA 4FFBB 1TDJA 1C30A 3ORFA 5DK4A 4Z49A 1WKVA 3FRJA 3I6BA 4QPPA 1GQ2A 4WPGA 5DMXA 5DRTA 4RY8A 4LJRA 4BMZA 1EWKA 2RGBA 1CXZA 3RUEA 2ZI7A 1XFAA 3K0AA 2H51A 4H0CA 5HDQA 1D2HA 5KCMA 3VSDA 1XTKA 1NP7A 3COZA 1NOJA 1OJLA 2WWGA 3O8DA 4Q7LA 1YAHA 2X9VA 5DHAA 4N3NA 1CJUC 3UGJA 5F7OA 5LCXA 4P33A 2H08A 4Z1MA 1AUQA 2ZOSA 3UO8B 4RPLA 2P9YA 3KYDA 1K7FB 1DX9A 2GARA 2VT6A 2W6PA 3F4BA 4QGBA 1DBRA 1GTRA 3C0KA 5ICMA 4MW9A 2Z5GA 2IZ5A 3THXB 2PK3A 4N41A 2IXFA 2Y77A 4OFXA 1MHPA 5IEJA 4ZYZA 1NFQA 3DPIA 3JQFA 5CT6A 4B7AA 2XE7A 2GN6A 2HBZA 3ETGA 4I6EA 3RVPA 4EG0A 1YZKA 1E1CA 4KYVA 5HRAA 4G8DA 4NH0A 2DC1A 1TLFA 5KYXB 2QSZA 1YFZA 4NU0A 1TKAA 4FOPA 5COAA 2G0NA 3DVRX 4P2GA 3BZBA 5K3DA 3O93A 1PHPA 1NX9A 1T5OA 1W49A 2G76A 5G3ZA 3RIHA 3QWIA 1IXKA 3JXEA 3VNAA 3FPKA 1E98A 2XCRB 2HK9A 1PK9A 1U4NA 4F5WA 1RRFA 1SOAA 2WTAA 3I01A 3L6DA 4G56A 1J1ZA 4UD6A 3DV9A 4C87A 1AMUA 2FPRA 3GLFE 1QRDA 1HE1C 2C3YA 1SG9A 4BXOA 2J0QA 3MMNA 2FEAA 5AVRA 2GRUA 4CM1A 1MO5A 1CPYA 4WV3A 1YQTA 2O1WA 4LNUA 4EG3A 1X39A 2ILTA 4NBUA 4OM7A 4LGCA 3N0TA 4ZDKA 5TRTA 5KQLA 1KZ1A 1W9MA 3G2IA 4DQUA 5LMZA 1M5UA 2WFMA 2B4TO 3COSA 2CUZA 3MJVA 2FEKA 3UHOA 3SE0A 4AJLA 1NC1A 4WD3A 1OAKA 1ZW1A 1GL6A 4X3CA 1JAHA 1FVXA 2A9VA 2ZPTX 5IUKC 3VR6H 2MYPA 4QXAA 4P7KA 2BAGA 4BX8A 5DO9A 2QD1A 3EUAA 1AKYA 4MUEA 5D51S 3QW2A 3C3BA 5CCDA 4DLBA 3D1VA 4HDCA 1UK8A 4OKIA 3ETDA 1G4HA 1LA2A 2EV9A 2HSZA 2QTRA 3MOGA 2O06A 1Q1NA 1SELA 3ICWA 4HWSA 1EB9A 4KXLA 2HQRA 2R8EA 3OT1A 3DAYA 3H3XA 5D8DA 4C0XA 4JN6B 1HLGA 4DV6B 1ADJA 4XWWA 2QL7A 2QT1A 4N47A 3ZKAA 2B1RA 4WKPA 3WZ2A 5A4DA 4DV5B 4Q1VA 1MQ9A 2W2TA 3EA0A 4X1IB 4B6JA 2A9KA 4QKQA 3OQNA 1RM3A 1QF9A 3QM1A 1Z74A 1E9DA 5KX5A 1XRMA 1NVWQ 1SPXA 1JFTA 1C2YA 3CIOA 5ES4B 3ONVA 4ARSA 1MW8X 4RV9A 2OO5A 3ILSA 4NYMQ 3UFXA 1YUMA 2QWXA 1RRCA 5LXTB 1GPAA 1XGKA 1P0PA 1T0PA 1ODFA 1RSZA 2HN9A 4IDDA 4WK4B 3H11B 1DZIA 3BJEA 3KKLA 4TUYB 4X1KA 5JSZA 1ZNQO 3UHPA 3ROKA 2JGLA 3PB3A 4KHZA 1FDIA 1O95A 2A58A 1G7RA 2EG9A 2FPMA 4NZNA 3PP8A 4KSCA 3EVFA 3RC3A 1U5BA 2IGBA 1RKXA 5G0TA 4ZAYA 3DNMA 2G9VA 4UHHA 4WX2B 4MR9B 4MVJP 1DO2A 1U5CA 4UOQA 3FIJA 1O5OA 2Y1GA 3A6JA 1LB1B 3AEKA 1VLZA 3O31A 4FLEA 4D8YA 3F73A 1RQ7A 2AR9A 5F9HA 3EQZA 3QPDA 1FU4A 1YJ5A 2P35A 1NVVQ 2QX4A 1YB2A 2WT8A 5I7VA 1NATA 4ZI5A 2AE1A 3I58A 1M1NB 4JLMA 4Q93A 1TK2A 1GJRA 4YRRA 1ECGA 2BGNA 2GB4A 2ZT6A 1SCDA 1JG6A 4RD6A 3IQGX 3AR2A 1QO9A 2ODWA 3LRXA 1XF9A 3KJGA 5DTJA 1U2RA 1ZVKA 2YJ4A 3EJWA 1OYVA 4GI2A 3T4EA 3OJEA 4QXMA 4CI0B 1YKSA 4QARA 4WZAE 4FI3C 1KP2A 4GRIA 1AD2A 1YULA 3EGDA 4JT8A 1XZDA 2E55A 3MLAA 1IPFA 4LY6A 5JH7A 4EIWA 1VBKA 1MC1A 2DY1A 2ZJ3A 3TNJA 4RTJA 1W2GA 4G25A 3FA2A 4QG7A 2W70A 2DLDA 1QRSA 4M9XA 3AR6A 1YR9A 4FD3A 3D8RA 4FW9A 4MW7A 2Q2OA 3HDVA 5HE9A 5LPNA 1JNYA 4DA6A 5BSEA 1PT6A 1O9GA 3EXHC 1N9KA 4OKNA 4UZSA 2VYQA 1E60A 1KDZA 4BN0A 4Q4AA 4YJHA 3LKVA 2XCTB 2YHSA 3LL7A 3L7MA 4OHKA 4XVRA 2O5CA 1U7OA 1Q1ZA 1IHYA 4BAGA 5JYDA 1Y9DA 1YQWA 4HK4A 4L1KA 3R7AA 2RAUA 3ZHZA 1VG0B 1QGYA 4GIBA 5D6NA 2EBHX 1SK8A 1SUEA 1YQ9A 2FRXA 2FX2A 2I1WA 4JYMA 4LXIA 4ZGWA 5L7TA 4B3SB 4B4VA 3K0AB 1XPUA 4PLFA 4AO6A 1HDZA 5TJHA 3IO5A 3KXLA 4K9RA 4TROA 5KYGA 1E69A 2JGIA 1AKRA 1KMIY 3DSRA 1O97D 1RR6A 3R3UA 1KORA 4FZ5A 5H81A 5AQEA 3T94A 2AXNA 1PDWA 1DIHA 4JKIA 3N59A 4A82A 4C7BA 1PEAA 1C0IA 3KYDB 1SHLA 5DIZA 3C97A 2B25A 1PJSA 4DMUB 4L6AA 3U7GA 3MCAA 1I7PA 2GILA 3UJHA 1HF3A 2XUAA 4NHEA 3E2IA 4WXRA 2P90A 2TS1A 4YDHB 4YMSA 3O8CA 4CDNA 1FTWA 1OFUA 1GT91 1L7NA 2A0YA 2YFHA 4GH5A 3L43A 2P5TB 3N0VA 1E1CB 3Q40A 4LY0A 1FJHA 2FEMA 4I5IA 1TQDA 3TK1A 2BR5A 5JOQA 5EXTA 3KUUA 1CQJA 3QFRA 4XUGB 3OKFA 4QJ4A 2OQRA 1XLTC 2DTXA 3KJIA 2WJYA 4M1KA 4PYLA 5K45A 1G59A 5MN5A 3CV3A 1RMTA 3PJGA 3U19A 1CEEA 2QA5A 1WPRA 4L27A 4BCDA 4HH3C 5IXSA 4ESVA 1U8XX 4WKBA 1IQPA 2ZSFA 2QZPA 5FHRA 2C5EA 3LT4A 5CYPA 1VKOA 1FMJA 1QHGA 2H4YA 2IYRA 3K8QA 4QSMA 5FPPA 5FP0A 1SKYE 4BXOB 3QHPA 2FOXA 4KWTA 5LP6C 2Y05A 5BY2A 1QSGA 5COBA 1WTAA 2WYIA 4LNUB 1GFIA 5G02A 2TRSB 4P36A 2XQKA 2XHEA 3HBFA 4JSRA 4D9NA 4CEJB 1PO7A 4J6EA 1KBQA 2EZUA 1WOYA 1E6MA 4L9AA 3VR6D 2I5PO 1IJFA 2TMKA 3U4DA 1C9YA 2W7TA 1O0CA 3HVIA 3WHPA 5A62A 3R9XA 1PGOA 5E6UB 2IPXA 4O3MA 2Q5IA 4IOLA 1UWLA 2POCA 1ID1A 3OLCX 4U7DA 4KHPB 4NNOA 1A9PA 5JSQA 2E9SA 3CLRD 3I4LA 1YCGA 1KY3A 2WAAA 3M6AA 2B61A 5J3JA 4DEVA 1E2MA 4V0QA 1LV7A 1ECCA 4NU5A 5K05A 3K1AA 3L1VA 1AQUA 4ZVOA 2PLRA 1QIHA 2OM2A 3NC0C 4JBNA 4J0DA 4ZK2A 5EPUA 1E2DA 4BYMA 2ZRPA 1NPTO 2A4MA 1FFCA 1WNFA 2JGAA 1PG0A 1A1SA 2W2KA 3JQ6A 3LVRE 3WLJA 5JV5A 2HKIA 5COQA 3DE5X 4CQJA 2IDZA 3L5OA 4QUHA 2B9VA 1A8QA 2ZAMA 4KFTA 4OI2A 3V8PA 4KKXB 1PVOA 4MYRA 4YCSA 5HR5A 3QU4A 4AS1A 1XDGA 3G0CA 4ZOLF 2QN9A 3I64A 1QU2A 4KN6A 3RTGA 1SXJA 4L75A 1ZKDA 2PX0A 3IEVA 4JQOA 1XZJA 3UFXB 1SPBS 3L84A 3DTVB 5SYMA 2WA2A 4P4GA 3E5HA 4HMPA 3RK0A 3DMPA 4J3FA 4X1KB 4RKYA 4KPFC 1QFMA 1WB5A 2OAGA 3BS4A 5JSHA 1DOHA 3ZE0B 4CG1A 4GP6A 1NW9B 2AQHA 3FF4A 4QOHA 5EZYB 1BO6A 1U5BB 3T1VA 1Z7BA 5A02A 3H9BA 1C9EA 1KKMA 1N9ZA 1GTZA 1IRXA 3CEAA 2H17A 4FEEA 1GG8A 2GN0A 4F9FA 2MT9A 2NVBA 1ONPA 5KOHA 3GJ5A 4PBSA 5GM1A 4QLOA 3WS7A 4WNCA 1RWOA 3AEKB 4S2UA 2Q8QA 2REOA 3HB5X 3M2PA 1GAQA 1SKQA 2HLDA 2QE7A 3V80A 2O2ZA 1UBFA 2PZBA 3CNNA 3CW9A 3IP6A 3T7KA 4E22A 5A7HA 2NZJA 4FQ7A 5LNK1 4UAVA 4D9JA 3J81A 3TXXA 2QI9C 2OZEA 5DYTA 2E87A 2I3DA 2EKQA 2CHEA 1N34B 4X65B 3NBKA 4B7XA 1JQBA 2JVKA 2Q2NA 4HDQB 2WI8A 4KQMA 4MP6A 3RU7A 4ZHSA 1D4OA 4L4SA 1IQ0A 4YS6A 3D8SA 4DM3A 3BWYA 3IR6A 5TARA 1LRJA 4RTKA 3D6MA 3EGDB 3IS3A 5JG7A 5JAIA 3MBOA 2ZSAA 3SYLA 4JI2B 3ND6A 4GM4A 5EFOA 3OLWA 3H4VA 4LF5B 1H6AA 4G24A 5J1SB 5BT9A 3RRYA 4AI6A 2ZYWX 1O87A 2O8EA 2HD4A 2I80A 3UWPA 3A6PC 1B8OA 3CGWA 2DFKB 5JAUA 1XCBA 4N5NA 4US2R 5CA0A 4CMIA 1DAEA 3OE7D 4TWJA 1NW6A 5CH5A 4Q4AB 1ZYUA 4YJHB 4JJIA 5CRIA 2XUOA 3D3KA 3M2TA 1PFQA 5HJEA 5KTNA 3N3BC 3FFAA 1EK0A 1RVV1 1Y1PA 2P9TA 2VRWA 1NY5A 1W2WB 1OBCA 2N1BA 3FG9A 3PFGA 1J07A 3SZLA 5KTTA 1V1MA 4UHFA 4O4LF 3PGKA 3QF7A 4P4UA 2Q7OE 1OXVA 1AS0A 3TSWA 4M9ZA 2P41A 3RJ9A 3E4CA 3J7TA 4Z7JA 2NSYA 3T7IA 1XMSA 5CYGA 3Q41A 4PGHA 3OZ7A 5CB8A 2XAAA 1E9AA 3NGXA 1QTQA 1KVUA 3A6HA 4G5FA 4DRZA 4BKRA 3R9WA 1P7WA 3QEBZ 1SUAA 1G8YA 4HAWA 2QLNA 4ERNA 2P5UA 4XRRA 3OIVA 4CMHA 1JT9A 4QO8A 1G21E 4RL4A 3VO1A 3S8YA 4FX5A 3BDIA 2FUKA 3O4JA 4Y2JA 4U6NA 4UXJA 4G4SP 1SKBA 4BJ1A 2AJLI 5KKNB 4Z9BA 2O8FA 2YJZA 4B8ZA 2PU5A 2FMIA 3U7QA 5ALEA 4E46A 4ESHA 4LJLA 4U2KA 4Y2RA 4D8WA 3I72A 4H3VA 3MTIA 3S2IA 3OIWA 1CQJB 2AFRA 1C0KA 2JW5A 2QTLA 5FBKA 4C4XA 4DY4A 1FDSA 5BW6B 4YT2A 3K4HA 1BA3A 2Q29A 3C8DA 4M0LA 1K3UB 3RAPR 3HWWA 4ARIA 4G0UA 1VCHA 2PWPA 3VDRA 1ZH8A 2CV1A 1PZMA 1I36A 1MJGA 1VFPA 4G1EB 5HF9A 2IPMA 4IDCA 3ZD7A 1U3TA 2XECA 1YL6A 3C5WP 2VWQA 4ZU6X 3CWCA 4I66A 3I05A 1C9MA 4F4UA 4ALKA 3BJMA 2G6BA 1OH6A 2DY0A 1N5KA 5BWOA 4E13A 2EQ5A 1WKCA 4MV7A 1Z29A 1YDGA 3KQMA 1PZFA 5DCYA 2H9AA 1FRVA 1M1YA 3FXAA 4D80A 4KRFA 1JJVA 3DM9B 4J9VA 1EJBA 3JASA 1XCLA 4DMGA 3N74A 2YXLA 1OXUA 2JAWA 2ZRAA 4OHWA 5E7MA 3WO0A 4E32A 2JCYA 2QD4A 2WM8A 3FPEA 3GQBB 3TPZA 4CTMA 1OBFO 4UHBA 3FNHA 3DDZX 2WAOA 2YV4A 3I83A 2NYAA 4PZUA 621PA 1XDSA 2ZTUA 3IMFA 4GP7A 3UT6A 3I2FA 1PGNA 3EIEA 1WE2A 3NUZA 4Q9NA 4B44A 1JEEA 1X7ZB 1O8CA 2R7AA 4JBWA 5I8PA 2B8EA 2P7IA 3N1UA 1I2DA 1U2SA 2H8GA 1M73E 1OA0A 3L0SA 3PDIA 4NG5A 4MVJG 4Y2XA 4P31A 2LZ0A 3TRIA 5GJCA 3ADBA 2WAXA 4BWVA 3GNSA 1KU0A 2IXDA 2HCFA 5JISA 3H7AA 1H1TA 4JB0A 2W2KB 3M5PA 3KE8A 4GRAA 2X19A 2VAXA 3PUYA 1RYEA 3QXXA 5DYNA 3F6CA 2ZBUA 4HRYA 4MP8A 1BMQA 1W44A 2ZRHA 3PNBA 1HKUA 4Q3AA 3THSA 4ENQA 2XRYA 1Z5VA 4QTZA 4FI3F 1GWNA 2UAGA 2ZRBA 3E7XA 3K2IA 4F8JA 3WL3A 1NGSA 1TYEB 1JFLA 4QDJA 1CZRA 3RLIA 5D84A 2NQ8A 3U4AA 4BLUA 2GM3A 2K87A 3DLTA 4GS5A 1HQYE 4P3PA 4UEJA 5DU2A 2ZUEA 2D5AA 2D7DA 2C4KA 4UMVA 1JQ5A 5E1OA 4D82A 4OIFA 2HA5A 1IM8A 2PMEA 3FFTA 1N1GA 2IHZA 3KL4A 5F9MA 1VI6A 1YJXA 1CR0A 3KQNA 3OLZA 6LDHA 2R1ZA 1D04A 4M46A 5KU7A 1YJCA 1GKUB 1OY1A 2DSTA 3MMZA 2HF9A 5TNXA 1QYWA 4CIWA 3ICEA 1YFKA 3H5AA 5C3UA 3PA8A 4XTCS 1XRQA 4HYQA 2AYYA 3JD3A 4G5QA 5CFMA 5JAZA 2JIMA 2WJIA 2O6LA 2YDXA 4X5OA 4E09A 5EJ2A 1MB4A 4P3NA 2A0WA 3AW8A 1IZ8A 3GOQA 4TKUA 4C29A 2CNNA 5IH7A 1T5SA 2V54A 1DDOA 1PJBA 2FWIA 2QQ5A 3KEOA 3GU3A 1A8HA 3FUWA 4B6EA 1W0JA 2AQ8A 2JLAA 4MJXA 2QM7A 4G26A 1IN5A 4U8HA 2DR3A 5AUPB 1ZLYA 3HKEA 3ENNA 1N5DA 3EWNA 4MS3A 4MQMA 3C6KA 4F2WA 4CMEC 3EX7C 1U11A 1AKEA 1XCGB 1ZUWA 3FVVA 3NOXA 2O8EB 4ISCA 5C31A 1VKHA 1WXEA 3GB9A 1UXGA 4MKZA 3M8KA 1JDTA 2LD4A 2RARA 4R05A 1NM5C 4Y2GA 5AVZA 4CMIB 5GOZA 3AUTA 4FEYA 5AWFC 1MO4A 4X20A 4ZQBA 2IE0A 1DKPA 4FKBA 2AR0A 3EG9B 4LTMA 4TMFA 2BH2A 2VF7A 3SDBA 3FN4A 4WWHA 3ABRB 2D5CA 5DASA 4LVOA 3N5CA 4RX1A 3PDJA 1EFPB 2OHGA 3RJ5A 2W6IA 3DMFA 3A32A 1A4UA 4MHSA 1A9ZA 1Z88A 1SC9A 2C5HA 3WIVA 4PQRA 2ZYUX 2O8CB 5HIMA 1XKQA 2JCSA 4Q7EA 3F6BX 1JBEA 3BB4A 1BN6A 2ENUA 2QV7A 3BIXA 5C81A 1SOVA 5LP6F 5LZ2A 1Y8RA 2G63A 3PUVA 4BFWA 4IEIA 5DNUA 3NZEA 4PXAA 5EE5B 5B57C 1VSTA 4PYMA 2IOFA 5FKJA 1YDFA 2HTEA 3RABA 3IMCA 2M98A 5E6RA 1O58A 2IJGX 3NWEA 4YXWA 1VPVA 1PUJA 1U7UA 2X7XA 4Y7DA 3E8MA 1W85A 1BDMA 3OY2A 3REOA 3DMTC 3JRNA 2O8DA 2IELA 2QZSA 3K05A 1SFRA 4BVGA 3EZYA 4PR0A 4HFJA 1CJTC 4ZT3A 2O8FB 3IEKA 5DHTA 1TAHA 1USGA 5LIRA 1ZW6A 3U7QB 1GZ4A 1YK1A 4WZ6A 5KTPA 1CP3A 2YFQA 3OQVA 1U1EA 3R3HA 3PXGA 3CF4G 3W2HA 4FM9A 3HWX1 1LVGA 2VO1A 4IFIA 5TMBA 5K8TA 2ANCA 2WWHA 5KDLA 5TPZA 3GLIE 2P2YA 1CNEA 1YRQA 4AJ2A 5B2EA 1MEOA 3AESB 3TS1A 4ITRC 1FXWA 2B7CA 1T9KA 4BE9A 2QP4A 1CUSA 1QHHA 2JA2A 2PSDA 3E0XA 3CT4A 2C99A 1YKGA 2IU4A 2PUVA 4R1SA 5DW3A 2I2BA 2WUDA 3WQRA 3CB4A 1TQ8A 2ETXA 2GYVA 2JFUA 2C1ZA 2ZLBA 3HP4A 3HV0A 4GWKA 4YP1A 2G82A 1I4WA 5FUYA 5KZMB 3SYMA 4HLUA 4TQAA 4GKVA 3FNIA 4QNMA 4UDNA 3K2EA 1M1YB 3DAPA 3O83A 4YHBA 3II6X 4D9GA 4HX9A 4EUNA 3P9YA 4B4OA 2Y76A 2ZRDA 5E3HA 3TIXB 2YC4C 3N2ZB 3VX4A 1WXDA 4ASUA 3A3NA 2DKOA 1Q12A 4Q4HA 4BQPA 3Q0IA 4YJDA 1HQKA 4CU2A 1IHUA 3VVCA 4DA0A 3CNHA 4N8SA 2FP3A 2GZDA 4WLOA 3R75A 1UPAA 3G5TA 1RPZA 1MQ8B 2CL7X 5I3ZA 3E23A 3KQKA 5K3AA 3AKYA 3IAHA 2O2GA 4WK6A 3D5EA 1KZ4A 2B0CA 4GSYA 2Y2VA 4XJSA 3N86A 1SVNA 5JNRA 3ETHA 4R7ZA 3TAXA 3NV9A 1EGAA 1L3CA 3FCYA 2Q5OA 3CNLA 3DXYA 4X94A 2QI9F 4HOYA 4XE5A 4WESB 1KZ9A 3T3IA 1DKRA 1YR1A 2QYSA 2YZNA 3LCMA 3AZPA 1H8EA 4OGFA 2VCHA 1MW9X 4ZOLA 5DBHX 4UFOA 3T5BA 3U80A 4F5DA 1JX6A 3UN1A 2AHRA 1ULAA 1M75A 4YJ2A 3AUXA 3DNFA 4HGYA 4OQEA 1F8UA 2V7EA 2KBFA 3MJFA 1PCXA 4S1TA 3SEZA 3UWKA 3CNBA 3G9UA 3IKMB 1JDUA 2DT5A 2WF9A 2DFDA 3L7YA 3L9WA 3IEIA 4PEVA 1P29A 3RHTA 4B6PA 1T9ZA 4HAXA 3T5TA 3UAWA 1TECE 4KAFA 5CXXA 1TW2A 5FTNA 2WUEA 4M4SA 1KO4A 1ZUD1 2PL1A 3OJOA 2IZ0A 5CYOA 2DPYA 2J08A 4A23A 1SHZA 3DVSX 4DV3B 2FVXA 1GAEO 2FR8A 5EINA 5BR1A 2WWIA 3VU1A 1IB0A 3DBHA 2FKNA 1ETUA 2QRZA 3LT5A 3TPCA 1AHPA 5BRAA 3KLOA 5EMJA 3WLHA 2XNJA 2R4QA 3I37X 1KMHA 3IUMA 4LHZA 2YIMA 5ALOA 5A1TA 4QHSA 2M9MA 1O08A 3FF1A 1W36B 3WK4A 4JI4B 2BUBA 1HETA 3N8NA 4A8HA 5JZSA 1TYZA 1ISRA 2ZJZA 3C16C 4LZWA 3WX0A 4YAGA 5K8CA 4K6MA 1GOTA 3GUVA 5AHRA 1JYSA 3CM0A 2OWDA 1D4AA 1AC5A 4WJZA 2QGFA 1CYDA 1KK3A 1XEXA 2Q5JA 2QNRA 2RBKA 2I76A 3BH6A 4LJ8A 1BU8A 2X4DA 4PTLA 5BN4B 5TEVA 1FYVA 3DD5A 2BM8A 2UZAA 3HKEB 2I2AA 4MS3B 5ALVA 2AN3A 3I1IA 5ICEA 3MG9A 3TLEA 3KV3O 2R7LA 1ZU5A 2V9ZA 3X1KA 1PD1A 1X42A 4M8IA 2XJ9A 4JJ8A 5CCBA 1NUUA 2ZUCA 4ZHQF 1ZR2A 5JR3A 4G65A 5JSUA 5LFAA 1L1QA 1K6IA 5ADWA 1SZDA 4BIIA 2A0UA 2VXYA 1VHLA 5KC8A 1RM4A 2PUCA 2FRDA 2GXSA 5GOTA 1GFWA 2IY8A 3PT5A 1MBZA 3NHFA 4TRMA 1H6CA 4X91A 4BV9A 1FMCA 2JS7A 3BN3A 2Y67A 2H29A 1PZHA 5I9TA 3KQOA 4CUKA 3GCZA 4G0ZA 4JZYA 1UJBA 2AJTA 3WLIA 1Z63A 3WNZA 2GASA 1Q84A 2HMTA 4ZVMA 1U94A 4YB8A 3OZUA 1DEHA 4NYJQ 2LIVA 2F43B 3LS2A 5E4TA 2W2XA 1K2WA 4P54A 4F0JA 3C6XA 1OI3A 1VQ1A 1A3CA 1DG3A 1EXNA 1G64A 2I9PA 3CF0A 4FDTA 3UQYS 1Y4AE 1BDBA 2FZ5A 1SH7A 4G97A 5DRYA 5FA6A 5IDVA 3W3AH 4PN3A 2RHGB 1NHGA 1W85B 4QYIB 2O8DB 4BFLA 1LZLA 3H99A 5DTEA 4WNIA 3G9XA 1G3IA 4KE6A 4RM3A 4YRKA 1RRVA 1T36A 4P84A 2YW9A 4E4YA 1ZITA 4KXFB 1I3KA 4ZOCA 2IYYA 5LBTA 3OMXA 4V3BA 3CRZA 3HPRA 4KQ2A 2ES4A 3IKTA 2CVOA 1WNTA 4U2EA 2CB9A 1DAIA 4PLYA 5CLHA 4O4JF 1Q1AA 3ROGA 1FX1A 4YACA 5AHXA 4C43A 3Q8KA 1JWAB 4G0YA 1QHHB 4Z9XA 2XGMA 1UJ2A 3F9RA 4Q9KA 4MI1A 4ZMRA 1Q0HA 4OXIA 3KOWA 1X7DA 1B0ZA 1FBTA 2WTXA 1IYZA 3MTEA 5BW8A 1ID8A 1GYPA 3TDKA 1GQFA 4ACAA 2DECA 4KQ9A 5AVQA 2CMFA 5F51A 5LZ8A 3OESA 1TMYA 4MQ6A 2ZJ1A 4EUKA 2QPAA 2GZMA 1XTQA 3NAZA 4G63A 2XSZD 3QH4A 1O4VA 1MFZA 3VI3B 5A9SB 3BFVA 3SLRA 3JV7A 4DSOA 5A5VA 5KWEA 4Q4HB 4GICA 4PYJA 2G9RA 3GUCA 2J32A 1BX1A 3UYKA 4Q03A 3ZQ6A 4AW9A 5AOCA 2G70A 1VJ1A 2HF7A 3AV3A 3V8VA 3L8YA 3WNQA 2PRIA 1LJUA 3GO4A 5IVIA 1NI3A 1VA5A 1SHJA 2R4TA 3GARA 3PA6A 1S3SA 3TFQA 1O9BA 2WEKA 2OQIA 3MAJA 4BO7A 1FSSA 2CZGA 1D5CA 1VMDA 3NQ41 5ICSA 5J4VA 1N0WA 3GFVA 1NN0A 3RSLA 1TE2A 2C00A 2XWJI 4FFNA 1TCVA 2QSUA 4LNAA 2FMHA 1Y9ZA 1PE0A 1GLNA 4ZOLB 4BNMA 5AVYA 5BYBA 4MYSA 1SWVA 2QUHA 2VJCA 3HDQA 2Z8YA 3N6XA 3T12A 4NAUA 1GA4A 1QB8A 1A98A 4ZAZA 3BK1A 1T8TA 1C8KA 3AU8A 1ES9A 4QU5A 1U9YA 5F3RA 4DSNA 4H08A 3OMWA 4F21A 4LFAB 2YFYA 3OX3A 4ZYVA 1MGOA 1XC7A 2SECE 4ZO4A 4TV9F 1UAGA 1XCMA 4IHJF 4YI5A 1RABA 1IZ7A 1WDWB 5A3JA 2QN6A 3G9TA 2ZCUA 2FLKA 2O3QA 3IAAA 4R8MA 3MBKA 1WP4A 4AP9A 3MGGA 3ABOB 4JV5B 2CHFA 2CLKB 2PH1A 3MJRA 3Q8MA 1IHPA 5K0FA 4EI9A 2IYZA 2XWPA 1T2CA 2DWOA 4N4AA 5JY6A 3KL2A 3AH8A 4D81A 1C3EA 2ODQA 3GJYA 3ZTTA 3UUWA 4BC0A 1JPJA 1RNLA 5JAMA 3L7OA 1C9JA 1GPUA 3PWZA 1T24A 1YE3A 3E5NA 3LPCA 3JQ7A 3DD1A 1T6YA 1TJ4A 2ZSJA 3HB4X 3PENA 4BMNA 4DDVA 4IJVA 3VNVA 3Q7RA 4G2TA 2W2VA 1DCKA 2PKCA 4LI0A 4BNDB 5HVNA 2DBZA 1TI7A 1ZK0A 3HDJA 1ICIA 1C8LA 3I4CA 4IXMA 1VIAA 4MRNA 4DLXA 4I55F 1MNQA 4LVUA 1I4LD 4C7KA 1T5LA 1DXOA 2H5JA 4UAJA 1CD5A 3OCUA 2W37A 2VI5A 3BYZA 4HEHA 4B47A 2A9PA 1CP2A 2BM0A 2QG6A 3QX7A 4FGJA 3KYJB 4QPJC 2KB0A 3LUAA 2OESA 4LYYA 1UK7A 5ALHA 5C8DA 1J7KA 1XHLA 2JJ2D 4ZREA 2X0DA 2QTWB 3DDWA 4MYDA 2Z1NA 3ITKA 3EVEA 1GG5A 2JI8A 3HBMA 3Q1KA 4J29A 4DG5A 4D0RA 1V7QA 2BKUA 1M2EA 1Q7RA 5C5CA 2QTNA 1R0CA 1WM1A 2WWWA 1XLTA 5B1SA 5AW0A 1O57A 1PR2A 1ZRNA 1EXWA 3R23A 4M8NE 1E8MA 4EDFA 4O4LB 3A1SA 2A4KA 4J49A 4C0JA 4HLQB 3IPYA 3U3XA 4YP0A 2PKEA 5AVOA 4G4SO 1SB8A 3TEJA 1GQOA 3P0EA 4HX2A 2VNSA 4BFVA 1M2VB 1GSIA 5BSWA 2YZ2A 1WL8A 2XGJA 1JHUA 4ONEA 4RXTA 2NPIA 1B23P 4UUOA 3RFVA 3DLBA 3W1VA 4MTCA 1PUIA 1E4EA 4Y9TA 5EQDA 4E14A 4BOYA 4C2UA 5BUZA 4DRYA 4RKWA 1VCOA 2G36A 3FWNA 4IJMA 2WJHA 4R51A 2ZJ5A 3I1YA 1B15A 3TOSA 5JTTA 4XWTA 1DCFA 3GYBA 2HO4A 2WLSA 1XD2B 4TWBA 3OSUA 4GWLA 5HJ5A 4HYTA 2X5XA 3GOHA 3A3YA 4HBZA 1N4DA 3HYNA 3O3NB 4QU9A 3NXSA 5ELMA 3Q7EA 2Z4SA 3KLMX 4R3NA 1QFSA 1T36B 2J3JA 3IVAA 3OUZA 4IIDA 5EPOA 4DMHA 4EYEA 1T10A 1YZYA 5D86A 1C7ZA 5B6IA 3MN1A 2ZIEA 1XJ0A 3X44A 1LW6E 2X6RA 2C03A 3FFWA 1XRJA 1M7GA 3WGOA 3HWSA 1FNSA 2XYQA 3GLFA 3FCOA 1N2JA 1F1BA 1K7YA 4JL6A 1AF7A 1JEOA 3NUQA 4HXYA 2CLLB 4LA4A 3UAOA 1IUPA 1UP4A 2BBTA 2VHXA 1CF2O 2DR0A 4B79A 3QVUA 4AX4A 3TLXA 1ZI6A 1RLTA 4F6LA 5MN4A 1Z07A 3KZMA 4MPRA 2YUIA 3I3OA 2I7CA 2W2MA 4FYKA 3FOEC 5I4KA 3MMSA 4K8RB 4BUZA 3W6UA 2PNFA 1XEWX 4KVAA 2XMDA 1I2MA 2ID7A 1R4AA 2WE8A 5KWVA 5TVKA 5FHQA 3U39A 3CVXA 1X7WB 1XVTA 4IVQA 1BJKA 1IVNA 5I01A 3S2SA 3L7CA 5G1OA 1MQAA 3D31A 1U0TA 1QCDA 2W9XA 5D7BA 3LPDA 1HEUA 1VP9A 1O6ZA 4M1MA 3PF8A 1UKBA 2GM9A 2XYHA 5CJJA 4ZZ3A 1FFSA 1H2HA 4V0RA 5F78A 3HNRA 1GRCA 3A7DA 4LHYA 4ZWNA 5IJZA 3R7LA 3RADC 4HXEB 4CV3A 1ZCZA 2HB6A 4U2BA 4F4FA 2VJMA 1OBVA 1DUVG 2B3TA 1P4JA 1GGVA 1S2OA 5SY9A 2RGUA 1SZCA 2ZQ5A 4XM0A 3TI9A 2HU2A 3FMPB 3WDSA 3WLEA 2HIAA 1FNMA 1QTRA 3ZPXA 1NF2A 4HR7A 3H16A 4PAGA 3JAMA 3N07A 1JSLA 1DJMA 2GNPA 5AXCA 3SQMA 4N3BA 1YC2A 1XQVA 3OM8A 5IK2A 3DT8A 1HM5A 1ZOLA 1FW8A 2XCIA 1CY7A 1J8YF 3BE6A 3L02A 2GZ2A 4G23A 4NABA 3WL4A 4RJKA 2AG1A 5ALYA 3V2GA 4GHWA 3W05A 5KYYA 1DV1A 1EM8A 3IBYA 3V4RA 4JI7B 3OPYI 2WUVA 4GG1A 1UPCA 5I4BA 4KGDA 5DYGA 1HL7A 2FSUA 2XTJA 5EHGA 1P1CA 1ZA1A 2W00A 3VPBA 1EFRD 5JDCC 3PVCA 2BFCA 3F3SA 4LWOA 3EXHB 1QDEA 4TMYA 2VHTA 4AKGA 1J9EA 1DRJA 1RFLA 2OK8A 5LVAA 1EPUA 1A4RA 1N5LA 5KWSA 2CJYA 2BMFA 2ZDQA 4EUFA 3N3AC 3ZXIA 1IZ9A 5DK6A 5G4LA 1FQOA 1AXRA 2WM2A 2GQ0A 2H4JA 3AUYA 3EIQA 3KYBA 3FWZA 3MGCA 3QE0A 4FINA 3UV6A 3WO1A 2Q9AA 1EDBA 2CNLA 2K2QB 3ZU6A 4EF4A 4X84A 5JD5A 3QPVA 2Y1CA 1GHTA 1T1SA 5C8YA 3I6QA 2LDBA 4ZI7A 2WJ3A 2XBLA 3SVLA 4WZAA 3JQ7B 3OAAA 4JR0A 3K0KA 2PZFA 3CHYA 3Q4GA 3UQZA 3DV0A 4KO4S 4AKEA 3RSFA 3PXCX 1P2VA 4OQXA 4YRPA 1U63A 3ZUGA 2WQZA 3P94A 5IAGA 4GM0A 1E1QD 1VLJA 3D2AA 1Q5PA 2P2CA 2ZBGA 4J8PA 3KJEA 3W8EA 3R1IA 2D6FA 1XZNA 2PUDA 2ID8A 4DCNA 2G0TA 5M04A 3LLMA 2JD2A 4XYGA 4CLDA 1VLVA 1UKYA 2HHJA 4MUMA 2IX3A 2BZ0A 5JNUA 3LGSA 3W3AA 4LY9A 4GLLA 4YJGA 4XLZA 1KZ6A 3VZDA 2DHCA 1VIYA 3DVAA 4MYCA 3THYA 1FDWA 2O1EA 1EVKA 5EJ4A 4XPIA 2G9QA 3OSZA 1UXHA 3DUFA 4NDZA 3QNMA 3INRA 2QTVA 3MWGA 3ZHVA 1SQ6A 3CN7A 4OREX 1QKIA 2V7VA 4C6HA 1GCUA 1ZA2A 2GERA 5D5HA 3WFJA 2IUEA 4LZNA 1P18A 4QT0A 2JK0A 2CXOA 2DX7A 2F4NA 9ATCA 2J9FA 2PXCA 2GN8A 2EJVA 3OJCA 4JVMA 2OLKA 3V1TC 4YY3B 2FFHA 3GELA 1R0BA 4FVTA 3ISTA 5IKMA 2FHPA 2YHAA 2VDWA 3DB1A 3IBSA 4B87A 1YZVA 2VSFA 2JDIA 3ESAA 1R3UA 4OQPA 5LP6B 1K88A 1NKSA 1U2EA 2VG8A 3MJHA 1E4EB 1AZTA 3ZLJA 2Z5LA 2B1JA 3RANA 3V2IA 1MOZA 3QQ5A 3BG5A 1V2GA 2V3WA 2XMBA 1G8KA 1KA9H 4IRUB 5BV2P 3KCQA 4NFHA 1COWA 1GN8A 2XGSA 3O4FA 4CLRB 1EWYA 1RCTE 1EVQA 2ZSUA 1T9GR 4KO1S 4ER0A 2JHCA 1CQZA 3HBLA 3OEED 4LWQA 3ZLVA 2GJKA 2PFKA 4E5DA 2VF2A 4OHYA 3OCVA 3PVZA 4E4RA 3NHLA 3V8MA 4ZPXA 3HJFA 2H7VA 2OPHA 1IXZA 2PT7A 1ZOOA 3B8HA 3CT6A 4GMGA 4QO7A 4U5QA 4WERA 1KZHA 4O4JA 1TQ6A 1Z9BA 3L6CA 1K4YA 1HDYA 3F8SA 4HBGA 3ZWCA 2VTBB 1E58A 2X22A 3C5CA 3PX2A 1ZUNB 2VH1A 1XQ6A 3ICOA 2VPWA 3LCVB 5EPEA 1HNWB 3SR0A 3CLVA 4GR5A 1H2EA 2EEPA 1KEZA 3ECAA 1H4VB 2FHSA 1K5GA 1XZAA 2IODA 3RJMA 5CEFA 1OOEA 3WQBA 4KIUA 3F8TA 1S2DA 2VJOA 4Q01A 4AUMA 4PHTA 5EIWA 3H9GA 3D3WB 1BDIA 1NMEA 2B8JA 3NTXA 3T5DA 5A9RA 3GFPA 1M2WA 3TQFA 1P4AA 4S12A 5DNCA 2RHOA 4Q3NA 4KX5A 3OUTA 2IHBA 1FW6A 3GD7A 2EP8A 4HS9A 2PA3A 4PHFA 1Z3IX 2C9DA 1XTZA 3UH0A 2OK7A 4II7A 4LC9A 3FROA 4B43A 3GFRA 3L8DA 3KOYA 1CQWA 1GUBA 2EYQA 2OBBA 2ID9A 3Q7TA 1LPNA 3FE2A 3PHIA 3BWVA 4A27A 3BD8A 3LECA 2QN2A 1RYMA 1D07A 2HA4A 4L72A 1SVWA 1QZ3A 3RU3A 3HXMA 5DNEA 4DVGA 1ORTA 1AHHA 4N01A 2VJMB 5AXAA 5L3VA 2W0SA 3ANYB 3WLAA 5ITSA 3S27A 3ZNPA 3DP9A 4UAGA 1DFHA 2AH5A 2F67A 3RTDA 4XQCA 3UAGA 4DARA 4HCJA 2Z3WA 4FT4A 4QA9A 1Z73A 1H4TA 3PHCA 1G8FA 1M8GA 2OQVA 1R4MA 2OBFA 2ZBEA 3EGOA 5HFAA 5BOVA 1LXCA 1T1EA 1CRZA 1E1DA 2JGNA 1NJ5A 4A0QA 2UUPA 1OV6A 1N6OA 3EGEA 4R1QA 2E4XA 3RSGA 1T4BA 2EZ4A 2GXQA 3AOEA 3F78A 3LO8A 1G55A 4REOA 1XKLA 3M49A 4H0FA 4R2HA 4TV9A 1EM8B 1LBIA 3OPMA 5KYYB 3FCAA 2PD3A 4IHJA 4WCFA 1OQAA 4LV8B 4O4HA 2FX3A 4WHMA 1DTSA 4WI1A 3VZCA 3DOHA 3B78A 3I5YA 2NTVA 3LH5A 2SBTA 4RPKA 3VPFA 5LOVA 2FSSA 4XZ3A 5BN5B 1CRLA 1P1KA 2OCPA 4NICA 1HLDA 2G0AA 4XIFA 4DTCA 2GA9A 1NFRA 1DBPA 3CX4A 4DB4A 1G9XA 3O4VA 2EVWX 4R5HA 5JQGA 1XU4A 4F5EA 3EIWA 2UU9B 1T9GS 3I9MA 4JWTA 3NMUF 3GX1A 1IK4A 2XXJA 2E4ZA 4GZ6A 3ZTYA 2Q3LA 5C8YB 1S6YA 1N0VC 1ZFNA 3OOSA 1H23A 3EGXA 2WIGA 3K0HA 4LRQA 4ZVQA 4BNJA 1WOMA 2CLHB 3GLRA 4LV5B 2P67A 2ZRJA 3QY0A 4X0EA 2W6NA 2Y0DA 3MBIA 4DDTA 1MGPA 2MTBA 2VJQA 2IL1A 3A7EA 3K1JA 3OLVA 4D9BA 4TT3A 1GR0A 3FBGA 3JW8A 3O4HA 1MRSA 5JU6A 3W1EA 2HRBA 3Q2KA 1V8FA 1HYEA 3TF5A 3FDFA 4O2AA 2C0CA 1YE8A 3AR8A 2LCIA 3EIUA 2COKA 1S4MA 1E7SA 2JRCA 4QOEA 3VGPA 3DMTA 2G5GX 5HIJA 5KVVA 2I0FA 4ZHQB 1NKTA 3CZAA 3FNBA 5JXWA 3THYB 3ZGOA 4PHCA 5T4HA 4PNEA 5KOJA 1EVJA 3W7VA 2VYND 4XPIB 1U98A 4DR5B 4J2TA 1P72A 3DEHA 1OH8A 5CT4A 1NF3A 2QTVB 4RTRA 2Y4OA 5EERA 1JEQA 3QJYA 5E95A 4L4UA 3Q8XB 4FQ5A 1FUIA 1SQ0A 1USUA 3AHEA 1NNUA 3B38A 2FZKA 2J9FB 4RGBA 4BVLA 4CTNA 1HBJA 2XB9A 1KVSA 4KE9A 1SIUA 4A1OA 1R0LA 3NNSA 5EP3A 3CEPB 1Y0BA 2CHVA 2VDWB 1LX7A 2Y0EA 4U7PB 4OQMA 1YB4A 3QMPA 1C80A 5EY5B 4E6PA 5SYNA 5HX7A 4HTFA 5KOYA 4AJIA 3ZDBA 2ECKA 3JTEA 1G21A 3FETA 2I9KA 2C77A 2LKCA 3LD9A 5JPDA 3KVYA 4OLFA 2HYIC 1O6GA 2Y1LA 3V4VB 4H7DA 3R5SA 2ZR0A 4TQUS 5J47A 3C8ZA 3E82A 4NBRA 3ITEA 3T3PB 2AR7A 2AT1A 3BCHA 3LUKA 1E89A 1J5XA 2FX5A 2JGDB 3JQRA 4R69A 4X54A 5JFGA 1HFWA 1U28C 4E2FA 4UEOA 2OFWA 5IKEA 1ZN2A 1GTJ1 1ZNZA 2BGMA 3A1CA 5KVSA 4IDAA 1NOKA 1Q1QA 3G0OA 3HV2A 5F21A 3OIUA 2Z57A 3R0IA 1GEEA 4G8JA 4NOLA 3DXZA 4I3HA 4QOGA 2ZSKA 4S1VA 4ZCRA 1F5SA 4WBNA 2X9NA 2VQEB 1FP7A 2PJUA 3DMNA 4O4JB 1YAJA 1YZGA 5D1NA 1ZQ9A 3ITNA 1KAEA 4K6HA 1SKYB 1QV7A 3A4IA 4LRWA 1D6SA 3BHIA 4RVDA 4WDRA 4CW7A 4N7BA 3LC0A 1H2WA 3GIWA 4EI8A 3BX1A 4YRBA 2QN7A 2QL5A 1EHIA 1YOBA 3B6JA 4XQ9A 1E2EA 4XFKA 1XDZA 1P80A 3WWPA 3QLTA 2C07A 2OHHA 2VK4A 1CUVA 4U7JA 4KLNA 4DSAA 1J09A 3F3KA 3A4YA 2OAEA 2JHGA 4J16A 5EKDA 2UUOA 1K6JA 5F4BA 2R7NA 1ZJWA 2DMRA 4AN0A 4CIYA 5SICE 3V4PB 1NVVR 2MSLA 2V7TA 3OP4A 1R0WA 4K03A 4UXHA 3WFZA 3I45A 4A36A 2VQSA 1DG1G 5JS6A 2XDWA 4JU9A 3TW8B 1T6XA 1V3TA 4JUIA 3TVDA 2X7HA 4KXNA 3AUFA 1T3GA 1AO3A 1JG3A 3ZY2A 1WEKA 3P9PA 4UATA 4B6QA 3FB1A 5FEMA 5EIHA 5HILA 3U6KA 4QHYA 4BFSA 1YB5A 1GNRA 4BCBA 2ZYSA 3BSWA 2ONKA 4GVXA 4AZTA 1E3QA 1AG9A 3MRXA 4EEKA 2VAMA 4K1XA 3ZK8A 2G1KA 3AVOA 4NBSA 1SCQA 4HQRA 3B13B 3U62A 4O2RA 4CV2A 4O08A 3AF5A 3VH1A 4LHEA 2G28A 3I0MA 1H8HA 3HBAA 4ZVNA 1DP4A 4BKUA 3JRXA 1Z8HA 3X3HA 1QG4A 1O03A 1WUIS 4M0EA 4NVRA 4D3YA 3AILA 1DS6A 1EGHA 2RC6A 1MJ5A 4TWIA 5TPWA 3ABIA 3GFBA 3UPUA 5D3KA 1CUBA 1TM1E 1WPQA