1NURA

Crystal structure of human cytosolic nmn/namn adenylyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nurA00
2CYAA 4ZCTA 2AG6A 4I6EA 1K97A 1OWNA 1KR2A 4K0RA 2WSIA 3DV2A 1NZJA 3COVA 1ZH6A 1TYBE 3GMIA 3DLAA 4G6ZA 1O94C 2R5WA 5J5AA 5LM3A 1K4MA 2PG3A 2EJCA 1T6ZA 1N2JA 3E27A 4UZEA 1WQ3A 4XFJA 1WKBA 4MWEA 3UK2A 4MW0A 1COZA 3ZJTA 1R6TA 3ZGZA 2QTNA 3CLTD 1OD6A 2QUHA 3C8ZA 2WQ7A 2A1TS 1NUSA 3FY4A 3H97A 4AQ7A 3ND5A 4OJMX 1I6MA 4G5FA 3Q4GA 1YI8A 4HPWA 2E0IA 1N78A 1NUPA 3GUZA 4ZCQA 4K03A 2ZUEA 1N2IA 5K0TA 4DDKA 5LFAA 4J76A 2D54A 2ZUFA 2CV2A 3AG6A 3HFJA 3SP1A 1EFVB 1PFVA 1O0CA 4EG3A 2IJGX 1J20A 4MUJA 1Y42X 2PIDA 1EFVA 3X1KA 4QBTA 1YIDA 1SURA 4R2MA 4YP5A 1ILEA 1IH8A 3ELBA 2V0CA 1JIIA 2DERA 3LOQA 3Q10A 3CVUA 1U7XA 4MW9A 3QE4A 1XNGA 4MUKA 1F7VA 4XFDA 1MAUA 1ULHA 2QUKA 1OBCA 1XNJA 3CVVA 1WXIA 2X1LA 1EFPB 1NUUA 3PRHA 4KPUA 1TQ8A 4XSVA 4ZT2A 1EFPA 2CT8A 4A91A 3HMQA 3OTWA 5DK4A 4YMIA 3LCJA 4ZT4A 1K92A 2J4DA 3A2KA 1R6XA 4KKVA 3ZJVA 2HGZA 2Z08A 4P2BA 1O0BA 4MUHA 1JEEA 4X0EA 1U3DA 1LI7A 4MW4A 5TEVA 1QJCA 1OBHA 4PBRA 1JECA 1GLNA 3CR8A 2BYTA 3IMGA 4DDHA 3IMEA 4MW7A 4Q93A 3X1JA 4KR9A 1PG2A 2V0GA 3L93A 1M8KA 1GTSA 3N2YA 1VLHA 3ZUGA 1VL2A 4ZCSA 2AKEA 1Q15A 3DO8A 3VU8A 5J58A 2JAXA 3H05A 3JXEA 2A84A 2JANA 3FETA 1U0BB 1FFYA 2TS1A 3NBAA 1O94D 1GAXA 1QRSA 3H99A 3IVCA 3SYTA 3F3MA 4MWCA 5TGTA 3PNYA 4MVCA 1MJHA 1WXGA 5AHWA 4JXZA 4ZT6A 4MVWA 1GTRA 3P0HA 5FO1A 3HGMA 3FHJA 3NV7A 3AIIA 4R0NA 4DLPA 3PXUA 2D13A 3MXTA 4ARIA 1T9GR 2PFSA 4QRDA 1JEDA 3TQOA 5KHAA 1M1ZA 3K32A 2GM3A 1QRUA 1PFYA 1JMVA 4ZCRA 1KAQA 2D5BA 3IMCA 1BS2A 2GOYA 3CA8A 3G5AA 1MB9A 1PFUA 4MW2A 1J09A 3TZLA 1IFXA 1J1UA 3ND7A 2DEUA 4MULA 1ZH0A 1R6UA 1U3CA 2J5BA 2NZ2A 2CFOA 1MBZA 3HZRA 1TYCA 2E21A 1O95C 5KWVA 5DB4A 4TS1A 1YIAA 1PFWA 4JFAA 2QJOA 1NURA 5LLTA 3FWKA 4NAHA 3RK0A 5KCMA 2HZ7A 3GLVA 2DXIA 1N75A 1X8XA 4QREA 2PZ8A 2O5RA 3P0IA 2H29A 1O97C 1NSYA 1WXFA 2Z3VA 4MUIA 1I6LA 1WZ2A 1IQ0A 1GPMA 5H7XA 1KH1A 1JIJA 4ZT7A 1TFUA 3RFFA 3IDFA 4MW6A 1GN8A 4UZFA 3HL4A 4DJAA 1KH3A 2PZBA 5HG0A 4RPIA 5DASA 4R2LA 2A1UB 3A4IA 2YY5A 1N2BA 4MVYA 1IRXA 2DPLA 4MQ6A 2A1UA 3CLUC 3IUEA 4I6JA 1QU3A 1N2EA 4PBTA 1B6TA 2OQ2A 1O96B 2RE8A 4EF6A 4GRIA 1TYDE 1H3EA 3KT6A 1V8FA 1O96A 3IOBA 2DUMA 4ARCA 4YP7A 3VGJA 4BWVA 2NSYA 4GU5A 4J75A 4E1AA 3FG9A 1PG0A 4WNYA 1WJGA 4ND6A 2EL7A 4MWBA 4HJRA 4MUGA 1NYLA 3CLSC 3ILVA 1A8HA 4Q16A 1Q19A 4FZJA 4NZPA 3VRHA 4YBRA 1J70A 1QQTA 2QTMA 2BTEA 3LE8A 3ISJA 2AZXA 1EUQA 3UC5A 1VBKA 3IVGA 3N05A 4U7JA 3N8HA 3D6UA 2A7XA 1ZUNA 4CT0A 1FYDA 3AG5A 3COWA 4EG4A 3TQIA 1YUNA 3COZA 3MLBA 3CVYA 1ZJWA 3UOWA 2QUJA 4U8HA 3I05A 1LI5A 3PNVA 4EG1A 3ZXSA 1NUQA 4ZT3A 3SEQA 4MUEA 1IQUA 1NI5A 2G36A 1QNFA 1OWLA 3BL5A 3KT3A 4G5YA 3UY4A 1O6BA 2Z09A 3ZJUA 1I6KA 2IELA 1KQOA 1KQPA 1WXEA 4I6GA 1YUMA 1OWPA 4ZCPA 1N2GA 1EJ2A 3L92A 3OP1A 4RUKA 2YWCA 3COYA 1G8GA 1U7DA 5TS2A 1TEZA 4KR6A 4PY2A 1XJQA 3FDXA 3INNA 5BNZA 1VBMA 2VTBB 2QJFA 2B7LA 3M5WA 3IOEA 3HV0A 3AL0C 3ZIUA 1O95D 1N3LA 2C5SA 3FH0A 3AFHA 2VTBA 1Q77A 4S1OA 1JZQA 3H9CA 3KT8A 3A05A 5EKDA 3MMXA 1J21A 5HUHA 2CV1A 1WOYA 4U63A 1EE1A 1VBNA 1T9GS 3FOCA 5H16A 3CLRC 1O97D 3ZXIA 4KR7A 4WSOA 4EGAA 3FIUA 3TS1A 2WB2A 2J07A 3TNJA 5K0SA 3DPIA 3N9IA 1OWMA 1OWOA 1IQRA 4HK4A 1CT9A 1MOPA 5FNZA 2CUZA 1H1TA 3CVWA 3ND6A 3KT0A 3CLUD 1IVSA 2QJTA 3RK1A 4PBSA 3Q12A 1T6XA 1KP2A 1X6VA 3IOCA 3RHSA 1WXHA 4NAUA 1M8FA 4NDAA 1IHOA 5JBNA 3KFLA 4F4HA 5DEOA 1K4KA 2A1TR 3MLAA 3CLSD 4NATA 2CYBA 2A4MA 1GZUA 2YWBA 2ZP1A 5F23A 1YULA 1MB2A 1JIKA 4YP6A 2PXHA 4MAFA 1JGTA 4MUNA 4EG5A 2QUIA 3IODA 1JHDA 3D6VA 1EUYA 4CDNA 2GKSA 1P7PA 2VXOA 3H9BA 4MWDA 1H3FA 2A88A 4EG7A 1F9AA 4MLPA 5FO0A 2XRZA 1N2OA 1M8PA 4HJXA 1QTQA 3SDBA 2X1MA 1LW7A 3A04A 3UMVA 4EFKA 4EG8A 4MUFA 3S3TA 2YXNA 1RQGA 1TYAE 1N77A 3MUEA 3TZEA 4F3RA 4JXXA 5J59A 1I2DA 1QRTA 1JZSA 3SZ3A 3CLTC 1M83A 2CSXA 1J1ZA 3X1MA 2OV4A 1KKUA 1KH2A 5HUJA 2PZAA 2X0KA 4H3SA 1T6YA 1D2RA 4KPUB 5IHXA 1M8GA 3NBKA 2XRYA 1MC1A 1WQ4A 4MVXA 2H2AA 1EXDA 1V47A 3RBAA 3G59A 4JYZA 4MW1A 3IVXA 3SEZA 4AS1A 1G8HA 4ND7A 5IJXA 1KAMA 3PNBA 2WQ6A 2RD2A 2DR2A 3SZGA 2CYCA 1JILA 2JA2A 1WY5A 3U1VA 4DNXA 2CV0A 2DETA 3K9WA 3CLRD 4CDMA 4MW5A 4OUDB 2E89A 1N1DA 3QTBA 3IUBA 3CVXA 4EG6A 4OUDA 4DDMA 1QU2A 1MRZA 4ZT5A 1NP7A 4DE5A 4CQNA 1G8FA 1S4MA 2I1LA 3AKZA 3FI0A 2X3FA 3RJZA 1XNHA 1F7UA 1NUTA 1Q11A 1KQNA 2J09A 4NX2A 1KORA 4L2IB 1M8JA 5TEWA 3IH5A 2A86A 3QTTA 1DNPA 2DLCX 4L2IA 4JZYA 1KP3A 1O5TA 2J08A 1MAWA 3P52A 1F4LA 1H3NA 1HYBA 2IP1A 3G6KA 1G59A 3P0JA 3FNRA 1UFVA 2O8VA 1N2HA 2QTRA 2E18A 2HMAA
chains in the Genus database with same CATH superfamily
4B3DA 3RVKA 2CHUA 1SUPA 2CMHA 3PP8A 2UZIR 3NGLA 4EJ0A 2V5AA 4V3CA 2PWPA 4EP1A 3L0CA 5FQNA 1UFRA 4S35A 1FZQA 4ACBA 3WWCA 2Q5LA 4UFPA 3R23A 3GL9A 1DAPA 3FNEA 4J4HA 4J7UA 3ENWA 4ARBA 1VP3A 4UD6A 1KF0A 1LFAA 3SFZA 4AZVA 3E84A 5BR1A 3ACDA 1JHRA 3W2FA 1NRIA 4Y6LA 1G5PA 5LXTB 1NXSA 1PSZA 1TMGE 5H4GA 4R9NA 2FH5B 2QTNA 4V2UA 4AO8A 1HEIA 1SXPA 1A95A 2QSYA 3UXYA 2WQ7A 3KLBA 4HWRA 3QMWA 1P19A 4CMCA 1ZS9A 3BK1A 1JEAA 1VPVA 4AQ7A 4HLQB 1ZHOA 1I6MA 4Y98A 2PUBA 1ABEA 4UUBA 5DBGA 3WXMA 3H16A 5IWCA 4B4OA 1M2NA 2VXBA 1NKSA 3VDNB 4BRZA 4YRTA 3T1TA 4PTYA 4WKCA 1N2IA 2PQ0A 4DDKA 4J1NA 9MHTA 2D54A 1M7HA 2PRZA 3MERA 1DKUA 3O8QA 1NQOA 1DXYA 3IV9A 5B3JC 1RAFA 1THMA 1QYDA 2HXYA 2WA2A 2XQFA 3G17A 4TYPA 5D7NA 2EG5A 4Y2RA 1LU9A 1UC8A 3PQ7A 2FFRA 3IDZA 5KNCH 3TR0A 9LDBA 1AB6A 3ER9A 1P5HA 1R6VA 4IRXA 2OLEA 2H51A 2JCGA 3DOJA 4UTNA 1HE2A 3RTCA 2W48A 3ELBA 3FVWA 3ZE8A 5BN4A 4QWWA 4I55A 2GRAA 4LWPA 4DPMA 2JB9A 1F0YA 3DF7A 4GZ3A 5DYTA 2CC2A 3PQDA 4JQZA 5FOXA 2ZJOA 4UBIA 4BBPA 4FM9A 1R9MA 3GJ8A 2UYCA 1XNGA 3GPDG 1KEEA 2JLSA 3S68A 5AVOA 1AKMA 6CHYA 2F4NA 3CVVA 2BMWA 2B2NA 4LOJA 4EHLA 3WFJA 4NY1A 5HS4A 4CTKA 3DDOA 4I9FA 2ROQA 3IB3A 4ZOAA 2G1PA 2VR1A 1N6IA 1XRRA 4PW0A 4A91A 3VR4D 1BCRA 2BKLA 3WQQA 1HK7A 1P9RA 4ZT4A 1OOEA 3G5MA 2BDTA 5CVDA 2WIJA 1JG6A 3CVOA 1RAIA 1R74A 2G09A 1R6XA 4LVNA 3MCAA 4MI3A 4Z9FA 3ZJVA 4P31A 2O8EB 2WUDA 1QIJA 1UAGA 4Y6PA 4HAIA 3HGTA 5JOQA 1DELA 2C8LA 4UHHA 5CG1A 1FRZA 4M21A 3ZTTA 1KZ4A 3KSMA 3NBMA 4BBAA 3NM6B 3D8RA 3MIZA 4JUAA 3QA3E 1XCMA 3U3DA 2PXAA 1ICIA 2A5GA 3MM4A 1K86A 3EDQA 4I1VA 4O1MA 4G63A 4ZREA 4E7PA 5DH9A 2HCBA 4RPCA 1FYEA 1LBTA 1ONOA 3VVBA 5LD2B 1MG0A 4LUCA 3R5XA 1JQKA 3DEYX 4QGBA 2AKEA 4Z4HA 5BPFA 3F5DA 3ZV5A 1ZJZA 3ETDA 1BN6A 1G4HA 3GDGA 3MUFA 1T5TA 4OGGA 3GFVA 1TMOA 3ENQA 2I66A 1QBKC 3LY8A 4IX9A 2GA9A 2JBHA 4WLOA 3NX4A 4P98A 4CG1A 1MHTA 2I1QA 3IJEB 4REQB 1G63A 2PQ2A 1X94A 2I34A 4KXVA 5BSKA 2G1KA 1J4AA 5JYEA 4PZCA 4HVAA 4R41A 1LK7A 3MWEA 2FMUA 1AS0A 2VK8A 2VXYA 1RQPA 2WP0A 4FNGA 3TG2A 1LK5A 3GT0A 3WB9A 1JHOA 5IASA 2ZUWA 4ZI3A 2WUWE 5FBKA 1W4LA 2AFHE 4EY4A 3PE3A 2PVPA 2BFCA 2QR5A 4QRDA 4LXUA 3VC2A 3DDNA 3PFNA 2CL0X 4JA2A 1R5BA 1D6JA 3VTFA 1EK5A 4QE3A 6ABPA 1NW4A 1UJ4A 2DPHA 4G0WA 4LVCA 2QUAA 4OSOA 3K2BA 1XYGA 2D5BA 5T64A 1Z33A 1JF8A 5JANA 2GBLA 3RVLA 4EEZA 4RVSA 1MC8A 1WWKA 3QG1A 3T7JA 1B76A 3FCAA 5AVUA 3KV3O 4EZEA 3B36A 3EYWA 2WT9A 3HNRA 4OLHA 3N2EA 4FLFA 5AJVB 5G4KA 3WRYA 3ZYCA 4BKMA 4RSGA 3S81A 1J1UA 4N12A 2ZE7A 4P6VF 4O02B 2ZWAA 4D4GA 4DBVO 5JZMA 1I2CA 3AQ4A 1E2EA 3GH3A 4AULA 3QLVC 2HBRA 3DMTA 3L0YA 1HG0A 1DPFA 1GUDA 1FDIA 1SULA 2NG1A 3EQ7A 1O95C 4IIHA 2J3KA 4P7KA 3SMVA 3V3KA 4K9MA 2AXQA 1CUSA 2DKOA 1U8UA 1SUIA 1XMXA 1YHNA 3U3RA 3WAKA 1JR3E 4MB2A 2JJQA 2YV2A 4BEBA 1OX6A 2Z95A 1B6GA 1O0SA 3GRVA 3R8CA 3ICOA 1SFRA 4LXTA 2HLDA 2UYGA 4PGAA 5ALHA 4XPIA 1T5SA 4FGKA 2M6SA 3FBGA 1XXHE 3C87A 2DCUA 3FA2A 1GXSB 1WNFA 4QU9A 4RHEA 3EGXA 1RFLA 2FDRA 3SBOA 3CO0S 1Z6ZA 2ZWPA 4M49A 2Z58A 1K63A 3L8FA 4E5SA 3TQCA 2Z5VA 3ET5A 3WA7A 2CNWA 3TVTA 1CJMA 1OPXA 2AQKA 1QOPB 4D9FA 2DTEA 4KO4S 1E2LA 1M6EX 2LDBA 3GJZA 2OFOA 1B8VA 2HV8A 4KOAA 2WE8A 4DS3A 4JT8A 1TYZA 3QPWA 2JFNA 2HBQA 3QY0A 3FB1A 2DMRA 4MR8B 1OXXK 1BG6A 2OM6A 2Z2KA 3OKCA 4PAGA 1S2NA 1ZGHA 1QU3A 3ZYZA 1I4WA 3CJQA 5DW3A 3RGGA 2PZLA 1YNOA 2C9YA 4BFWA 1TE2A 1DFGA 2GCIA 1V16B 2GJKA 2VJBA 3DQQA 1SBIA 1KMMA 3A4TA 5H3LA 3DWIA 4URUR 4H16A 3ZJYA 4R1NA 3K6RA 2XXAB 5JCJD 5TVGA 1NJFA 1OI3A 1P80A 2PJUA 1E2MA 2BHRA 2Q0HA 3H7IA 1Q44A 4F93B 1TIPA 3AB3A 1VE1A 1IVYA 2AEMA 4ZXPA 1HNZB 1K06A 1E1RD 5A0VA 4Q16A 3NDIA 4C0QC 4HV4A 1R37A 4K6GA 2ZVJA 2C7PA 2QTMA 4X65B 1EDZA 1JIVA 3GRUA 1EUQA 5HF9A 1Q2XA 2WU1A 3CUWA 3I9MA 5JMPA 3R3VA 3M4ZA 5IF3A 1DJMA 1GGMA 1JR3D 3WBJA 1ISGA 1CDZA 2KBEA 1UBTS 1Z7GA 3D8BA 1BHO1 3P9KA 5A03A 2A7XA 4PZAA 2EEZA 3OI7A 1C7FA 1I7DA 4OI0A 3WTCA 4CVNA 1GL7A 5C0OE 4QXAA 3RCBA 1VDZA 1W88B 2DPGA 3VPHA 3VDXA 1XTSA 5CEFA 1N3IA 3I76A 4ZK2A 2ZYDA 4FCWA 4P84A 5HBGA 4HHEA 3W7AA 2B82A 4J0DA 3AFOA 3QW4B 1NUQA 1D0SA 2FPUA 2R7AA 3PHCA 1CEEA 2PZMA 2JIBA 2RHGB 4QDUA 5BSUA 4MUEA 2GILA 3L8CA 1YCFA 2J1LA 3LYHA 5CFMA 1YBMA 3HM2A 1FU7A 5AOAA 4WJLA 1V1MB 2AN4A 3B7WA 1T2CA 1ULSA 1F51E 4ZOCA 4JB3A 1Z2CA 2FWIA 5C31A 5TS3A 2G83A 1CR0A 1KWGA 1CLEA 5F1YA 2YWCA 1PYDA 1IC6A 3NUZA 4MUMA 2R84A 3JVUA 1W1IA 1CF2O 4HS4A 4KFUA 4U0KA 1W36B 3CKLA 2Q1WA 4M0DA 5IN4A 4HDRA 5JVDA 3K71B 3PTAA 4PR0A 5TE9A 5J43A 2P78A 5F3WB 3ASYA 3RVDA 2B4AA 1Z4OA 2X4LA 4MPRA 3AV3A 2JARA 3J81A 1AUXA 1M2VB 4PTLA 5MGNA 1DO0A 3KK0A 4N18A 1UCFA 2BFBB 1QFYA 3AFNA 3LUKA 4FZ3A 2ZSDA 4BB9A 4PZLA 2NADA 2XQVA 5KJ6A 2DKNA 4E11A 2XVAA 5DCWA 4PC7A 2KJQA 3OPNA 3IAHA 1F8YA 1JRLA 1OXVA 3P4UA 4G41A 4GXRA 5DN6D 1KAOA 5AP9A 3UGQA 2ZU6A 1ESZA 4EGAA 4YY3B 1V7PC 4FLMA 4R69A 5CLFA 3QEAZ 1N5IA 1FXSA 3I6QA 3HG7A 1SR8A 3I34X 2VAXA 4W1RA 3EXIB 4UTZA 1WEKA 4AWAA 1EWYA 2INGX 4MMYB 3PZRA 5F78A 4AP9A 4DBLE 4DMHA 5B53A 4XB6B 3HCWA 2ERXA 3FGZA 1H1TA 2ZANA 3VMMA 3E3NA 1A3CA 4FKZA 5KHLB 1FYFA 1II8B 3L18A 4B6JA 5KU1A 1GPNA 4H7FA 3ZV3A 3E1GA 5B58C 1IVSA 1Z3CA 1WSWA 2ACEA 4KPFC 1EVZA 2NXCA 4H31A 3QYPA 4MKHA 4ZEVA 4DLAA 3F3SA 2P2YA 2O0MA 3ZDAA 5DRYA 3G85A 2GAFA 2VC2B 5LQUA 4RF5A 4TOIA 5LNK6 2P7IA 2VK2A 1A71A 2R7NA 4H1TA 4J1TC 3UFXB 2X7JA 3DWFA 4GF5A 5CPFA 4ZDIA 2JGIA 3KFLA 5A1TA 2GZ2A 5HSGA 1NXPA 1V25A 2KQUA 3SC4A 3QKWA 4Q4HB 4ND5A 4RIGA 2GWRA 3GLSA 1NJGA 2QZ9A 4TWRA 2ZTMA 4UMEA 1ZN8A 4XWKA 4TKUA 1DTEA 5FUMA 1QX4A 5AKKA 1UBNA 1P6XA 2JIZD 3RSCA 1D6SA 2ZWIA 2PQ6A 3PGXA 2SKCA 2I4MA 3OECA 4FUTA 5LLTA 2P41A 3QVJA 2NUAA 1BSVA 1NAIA 1U3VA 2X5KO 1T3SA 4R2IA 3RIHA 2HU5A 3ZIDA 4WE3A 4A8HA 3L1JA 1TJPB 1J8MF 1HH4A 5LP6F 2WKRA 3N2KA 3GVHA 1YGPA 3VKHA 3DM9B 4UBMA 4FVTA 3N76A 2NMVA 3K0AB 1Z7YA 3SDBA 4Y2HA 1AGPA 3A04A 3AVTA 2JKZA 4JJ4A 4IV8A 4EFKA 3QEKA 1W2GA 4H7JA 4F5DA 4QUEA 3CIFA 3PUVA 4A7PA 5G2OA 1FP2A 4YROA 5FBVB 3KB8A 1V2GA 3HJNA 1CX9B 4ITUA 1IXSB 3TZEA 5EHXA 3RS3A 2Z2XA 1YCGA 3W5SA 2I6UA 2BCEA 2ACVA 2B30A 3LFTA 1IVNA 1R10A 2CUNA 3GPIA 4GXNA 1LDEA 1P5FA 1J1ZA 4ZPJA 4D8TA 3EJ6A 1FFWA 1YH3A 4IVRA 1D1TA 1TB4A 2BFWA 2PUJA 4TS9A 4E46A 1QH1B 5JWRA 4QO8A 2WR8A 4V02A 1Y8QA 3NC4A 1T9BA 5AT1A 2B0CA 2VDMB 2YN4A 2G08A 3ASVA 4EHNA 4RBNA 1V4BA 2H85A 4ZARA 3DFZA 4MRMB 4MVXA 1WUJS 4IHJF 5BR4A 1BFUA 1K8QA 1VKHA 5JNUA 1W94A 2ZJZA 3MB5A 5JATA 3IVXA 1FTQA 2RG1A 5ADUS 4RTJA 4NF2A 5E3IA 5B1IA 2G67A 2CL7X 3F8WA 3MJFA 5IJXA 2P62A 4NLLA 4NZYA 4KQGA 3DM5A 3QF7A 5FWXB 4QUGA 4HXGA 5JFTA 5IXJA 1WKCA 4XX0B 2Q3EA 2OFPA 2NUBA 1SZCA 2ZR0A 4BL5A 2I6SA 1Q91A 5IG2A 2YXDA 3LKVA 3V7WA 1X7XA 1B74A 1UKAA 1V37A 1OT3A 2K6GA 3MYYA 5TXGA 3VI3B 1PJBA 4OUDA 3ZU4A 1MRZA 3VR4A 3R0IA 4B6QA 2PFKA 4NBUA 4K6CA 4DE5A 4FBMA 4B3MB 4YQFA 1AKWA 4QIHA 1GKYA 4NICA 3F0TA 2R1TA 2VF5X 1NQXA 4KQIA 4IS3A 2WJVA 4N82A 1AV6A 5DYYA 1OFTA 3DE4X 3F7OA 5GADl 4L73A 4GQBA 5H68A 2BEWA 1H0KA 3LC1O 2O3JA 2GEFA 3LLUA 1F7UA 2OC9A 1V35A 1UR5A 5GQSA 4PZ0A 5HF8A 2BKAA 3F1KA 4S04A 2I62A 4GLJA 1HDZA 1U0NA 2FUG1 3I12A 4MI9A 2WMDA 4P0QB 3H5NA 1RR6A 1U8FO 3IVAA 2HPZA 1D7OA 4FPXA 3T3PB 1DIHA 2R97A 3H84A 4KXNA 4BU0A 1FLAA 4B7ZA 1AKRA 4HX9A 4UAGA 3VXKA 1U7PA 1ZI9A 1M10A 3ZQ4A 3DFUA 2X5JO 3G0DA 1E4YA 4ND3A 4CUZA 3C6ZA 4REOA 2ZB7A 1ISPA 3KHKA 3BMOA 4XWOA 4L9SA 3WWEA 1N2HA 3AHJA 5U9CA 4JKIA 3ZWBA 4FR2A 4BFXA 2FPLA 1MENA 2VWHA 2VBCA 1KRXA 2VQ6A 1YSCA 3IQFA 4JI8B 1Z88A 2AG6A 2PKEA 3RW9A 5D1NA 4RPKA 1X87A 4FI3F 2B2CA 4IJMA 4HVTA 5GJWC 1WBDA 3PQEA 3IPAA 3O8OB 3QE3A 2CLKB 2HV9A 2R86A 1X1QA 4WVLA 5HFJA 4JR0A 4K6MA 3RQIA 1UK8A 3OOEA 2W6ZA 4A0SA 3OZUA 4YCDA 4YUXA 1W5AA 2FSGA 5FAKA 3NDJA 5CH5A 3B6IA 1Z73A 1J5PA 4P3KA 1Y5LA 4ECEA 1YFZA 5K0JA 5C1DA 3QPCA 1YZTA 3BA1A 4K86A 4RVDA 5CH3A 3DP7A 3H04A 1VHQA 2IH5A 3U44A 1E7YA 2D1FA 3KQTA 5E4FA 4YUZA 5LLSA 4NPHA 3EQ9A 4YRPA 3BFPA 3L8YA 4RACA 3FPSA 2PV7A 2RHMA 2KM1A 3HU5A 3WLNA 3V9AA 5EKXA 1K98A 3H17A 3TZ6A 1HL3A 3QUQA 1TD9A 1VCHA 4GW3A 2VHWA 4HPWA 1EFLA 2YZKA 1BA2A 4IKOA 4M6WB 3GQVA 5LP1A 2XGJA 3GD5A 4QBKA 1FSSA 2ZUEA 1WW2A 1Z2NX 2I3GA 3NKVA 4GEKA 1NBWB 1V3TA 2ATEA 2CNBA 1BXRA 1R3UA 2JGDA 4JQOA 4OP1A 1LZLA 5C5CA 3HFJA 1RRGA 4BMPB 3N86A 3TPCA 1JJIA 3H9JA 3X3HA 1G4UR 1KK3A 1NXTA 2G5PA 2VSYA 3CSSA 4M37A 3EZ9A 3TMAA 4WLVA 5B6JA 5DTJA 3DWEX 1ACLA 5AM0A 1D04A 4FDUA 2PHZA 4ZDWA 3H83A 1WCIB 2VPPA 1QXSA 4OHUA 3AI1A 4G5HA 5KYUB 1K8XB 3Q87B 5KMGB 1HT1E 1KSHA 2V55B 4YRQA 3K8ZA 3ETHA 1GPKA 4TMKA 4WGFA 1L9XA 2AX4A 1ZXBA 3LA8A 5CFNA 3AY6A 4K9LA 1NW8A 1XPOA 2QMYA 2FGJA 3RSLA 1I1OA 2VAMA 3OOSA 4C6RA 1XTIA 2UUPA 1UT6A 5COAA 1GZ7A 1ZVVA 2C4UA 2FLVA 4LF8B 3GUVA 4IIVA 1G2IA 3ULKA 3PBKA 2QYHA 1VG0B 2GSWA 1UKVY 1E66A 1UKBA 1J9EA 1CJSA 3E3MA 3FMVA 4WDRA 4YAUA 5IDXA 3H13A 3FZNA 3M6LA 2B4TO 2WUFA 4J1QA 2HCTA 2AVDA 4K9PA 3A9WA 3NTUA 4AMYA 2YHUA 3R3WA 3AJ9A 4AJKA 1H2YA 4RAQA 5ECWA 2C42A 2YN2A 3BCHA 2CNNA 2VUUA 2BFMA 1SELA 5K1ZA 4JZKA 3KZCA 2MMCA 3ISVA 3QWHA 4QXPA 2WW8A 5JCJA 5T57A 4BN5A 3L07A 4MKGA 1ZJ4A 3ZUPA 2R6FA 2MSDB 3ICCA 3KQWA 5TEVA 1NN3A 2P9YA 5JJ5A 3CR8A 3I42A 1E1RA 2VBFA 3UYKA 1GQOA 4CODB 4JP1A 5FBLB 1W75A 1XDDA 2LD4A 3P26A 2VPIA 3L93A 4C1BA 3CF6R 3FNGA 4MXDA 4UULA 3SU8A 1JR3A 4BZXA 1ZJYA 2GHIA 2O4CA 3S0JA 1MX3A 5GTDA 2UU9B 1BHJA 1QBGA 2FOXA 3ZZUA 2DQSA 3LGSA 3NO4A 4WKNA 4Y30A 4L76A 1A7JA 5TT0A 4ZAWA 2VAVA 2XRFA 3DOUA 3WK8A 3Q2IA 4NZ9A 2TMGA 4QJ3A 3VR4H 2A9OA 2A84A 4II7A 5ED4A 4UXJA 2PX6A 2X5OA 5J2TF 4H27A 1Z5WA 1EM6A 3DE0X 3EEQA 3FBTA 1VG9B 2RJNA 3AF2A 3EIWA 4HOYA 4Y8VA 3NGXA 4A2WA 4B7AA 2B98A 2C1ZA 2YFHA 4AZTA 2V3CC 2P2LA 3QOFA 3BCSA 4K9DA 4PLZA 1KOLA 4B8WA 4PYNA 1GRCA 2OFWA 4EOGA 2PUWA 4G9BA 1JR6A 1K4YA 3FHJA 4GWGA 1UPCA 3BWDD 3JVEA 3A1WA 2Y1KA 3R9KA 3II6X 3QX7A 1LBHA 5A9SB 5KX5F 1GLVA 4G4SO 4FYMA 4CKCA 3J7TA 1SB9A 4CM4B 3GLHA 3N2IA 5EQJB 3D3WB 5KHAA 3BD8A 4R2WA 3H1GA 5KTKA 1S8NA 3LT4A 1C9JA 1XU4A 2FMXA 1AXRA 3D1JA 3E5MA 3AB7A 3UHOA 3KQLA 4HQ0A 3IR6A 4C0AC 3QP9A 5JXGA 2GEKA 3S8MA 3A1DA 1EX1A 4M8SA 3T7DA 2CLMB 4GVLA 3QOYA 1PR5A 3SX0A 1Y1TA 2I1VB 4GMGA 5HRCA 2NUTB 1IFXA 3EG9A 2QKYA 3BXHA 2H7YA 1DE0A 3ND7A 1AK9A 4R84A 4HFJA 2DEUA 2Y1OA 3DLCA 3PNQA 2BL4A 3ZZNA 1Q5PA 5I7FA 4N7BA 3BERA 3LLCA 1GT91 1YU6A 3QEMA 2DKFA 1Z63A 2BFFA 2CB0A 1P7ZA 2SKEA 1XTVA 2JK0A 3I52A 2FG6C 2PO7A 2C5LA 2QLTA 4AW9A 5FH9A 5TJHA 3UFBA 1ZI6A 2CNDA 5A4FS 3FLEA 2CMDA 4OQNA 2WHEA 3E82A 3T3DA 3P9NA 4R1PA 3ADBA 2OLJA 1W4ZA 3CH7A 1QCYA 1WEHA 3O47A 3SE7A 4LOAA 1JQJC 2Q99A 1GL3A 1U2EA 2CLHB 5DM1A 2FP4B 4JLOA 1D09A 1GRRA 2OCAA 1QVVA 4DMMA 3T3GA 3X1WA 2JFOA 4NOLA 5F12A 3OF5A 5ALUA 4E1BA 4ZICA 5F2NA 3T06B 2FHSA 3VH3A 3K6SB 3UT0A 3U31A 4U00A 1UIMA 2O2HA 4DJAA 2PYIA 1TK3A 2ENWA 3ZGOA 3P0EA 2XEXA 1OLXA 1K75A 5DASA 4V0NA 2F8TA 2M1ZA 2ZVPX 2A35A 1DWOA 3GROA 3HCCA 4P82A 4NCJA 2HUNA 2CLFB 1FMJA 1R3DA 2K2QB 3D81A 1DI0A 3DB2A 1QAOA 4JYBA 3SR3A 4YJHB 4JROA 4E70A 4ZGWA 5TY0A 4PBTA 2QPTA 3FPBA 4B44A 3LBIA 5LSAA 2H00A 1URPA 1UOEA 1GPBA 2RHHA 1CY6A 3T4XA 3TDMA 1O5IA 1RBQA 5CLLA 1I1HA 4DEXA 3I73A 3BREA 3P0FA 1YT5A 2AR9A 2JIZA 3LLSA 2PSHA 3OAAD 5D3ZA 3UCXA 4D9JA 2JLVA 5TGZA 4WNIA 1DPGA 3FYUC 3QHAA 5CXUA 1RRVA 4F8JA 3EY9A 3BMQA 5AHRA 2QQFA 2XQGA 4LOKA 3UHPA 1YQQA 1YZNA 2DHRA 1ZI8A 3VRHA 4AF6A 1C30A 2PLFA 2UVPA 3FTQA 2O2CA 3AERA 1OIXA 3LYLA 3TIXB 1LBEA 2A57A 3AT1A 3L46A 3A9VA 3PIIA 5F52A 4ZMRA 3GNTA 3UAGA 1ZUNA 2K7ZA 1UP4A 2W6PA 3COWA 4CLEA 1E3IA 2P4QA 3ZWQA 4JLJA 4EG4A 5EE5B 1FU8A 4UTPA 1NVBA 3TB4A 2WM2A 3K9QO 2REBA 4FMPA 1DTSA 4RYDA 4F6LA 1XRSB 4IHKA 4Q47A 3PJFA 3OP4A 3HJRA 1NBOA 4Q01A 2LIPA 3I05A 4B80A 4NE2A 2IGBA 2Z1NA 3A06A 3KJIA 1H85A 4ZU6X 1X80B 3X2SA 3KQQA 4MQFA 4MYSA 2G9ZA 4CIDA 4YUVA 4IIDA 3RJ5A 1IQUA 1K5HA 4LTDA 1VMDA 1OY1A 4BE9A 2Z09A 4PX5A 5LMNB 5A0TA 1XRLA 2IELA 1YL7A 2VWGA 2O3TA 3IQEA 1Y8ZA 3IR7A 2WILA 3SSOA 1ZM4A 3NIWA 5C8XA 1DQPA 1U8XX 1UBKS 2J3MA 2PZKA 1NJ1A 3ZI7A 1E1CB 1OIWA 1NQTA 3HDJA 4N8SA 1ZOOA 3L7OA 1HFEL 1ULAA 1U0GA 3PFCA 5TVKA 4BTEA 4C07A 2YMLA 2Z9CA 3GLFB 3C1AA 2WUVA 3TLCA 1IU9A 2FN3A 1VI5A 2HWXA 3OCXA 1FQOA 3R3SA 4H15A 4JBHA 4RDHA 4KN8A 4DDTA 4JCCA 3O74A 2R7KA 3IOEA 3PCRB 4JELA 4ZVNA 5BSRA 2AG5A 1M0WA 3ET4A 2FX2A 5K6AA 1XRMA 4N0DA 4GMXA 2YJ3A 1EDDA 4M9ZA 4P7GA 3GJQA 2ODWA 2G1AA 1N2ZA 2PLNA 1ZC3A 3T3NA 1PDOA 3BL8A 1HL7A 2GXQA 2WHXA 3GEBA 1DCFA 2AOTB 3MMXA 4OGFA 3RO7A 5A7GA 1XROA 2OHFA 3NT2A 4MLCA 3FMGA 2W90A 1TZKA 5AHXA 4ARAA 3HTXA 1QJ4A 3NALA 5CX1B 2DBYA 1XLVA 1ZG3A 5KTYA 4NYMR 4H6XA 4YQYA 3U16A 3OPVA 1E89A 1OGIA 2J45A 2Q4OA 5K99A 5F64A 4WK6A 3S44A 5DSZA 2XECA 4B3HA 4G23A 2BE7A 1NOKA 2RK6A 3HNOA 3V2UA 3WO1A 1OWOA 1IQRA 3IP5A 3TF5A 3UANA 1OX4A 5FNZA 1KHTA 4C9BA 4O08A 3GEGA 3I1YA 5FPYA 5HIAA 2ISQA 2OO3A 1UKCA 3CLUD 4I4NA 4EECA 3I4CA 4P7FA 2JJ8A 3UJDA 4KDEA 2V6JA 1S0UA 4WLFA 3R8FA 4GUDA 1DQNA 4B09A 4FE3A 4EKGA 2QQ5A 2JATA 1DJPA 3B12A 5F7ZA 4QBIA 5LP6A 4HMQA 1FX0A 1VJGA 1JA9A 1G3RA 4FHGA 4NAUA 4BNJA 2HO5A 3RV4A 3LY5A 3STTA 3DE5X 4TVOA 2OMKA 3FDFA 1PHRA 3BWYA 1ISJA 4MWGA 1WSAA 1RYDA 2BM8A 3HJAA 5EIAA 1QRDA 2R3SA 4DNOA 1C9DB 1PS9A 2VH2A 3R6GA 3V8VA 4J6EA 2JBAB 3VBCA 4IGEA 2ZSKA 3MGKA 1K08A 3ORFA 1L1RA 5FJJA 5KWSA 3UK1A 1E64A 3HXOA 3FUWA 4MINA 3PUXA 3WL8A 4DVJA 1GA1A 1HEUA 2VXOA 3SNKA 1YVRA 4KPEC 3QE9Y 1JXQA 4PG7A 4OBWA 1T2FA 1PR6A 1JH8A 1F9AA 1L4GA 3AI7A 5I4CA 2POQX 2Z5GA 1P81A 1WB9A 2YXEA 2J0SA 1RAHA 3HU3A 4J07A 5C32A 1LW7A 4AKHA 3SFVA 2CJXA 2WJYA 4MQBA 4GI2A 1ZCFA 2IYAA 1V16A 4IHJA 4WV3A 4C3OB 2RH8A 4J3FA 2ZS8A 4QEDA 4EHDA 4OIMA 3RRZA 3HM9A 2XWPA 4Q3KA 3Q8WA 1A8IA 1Z06A 1XV5A 3PXEA 2FPRA 2XZLA 2HJGA 2HEGA 3O94A 3OMLA 4DM7A 2HDWA 1M3SA 2CW5A 5JAIA 1CR4A 4LXXA 4YDQA 2W2QA 2YX1A 2OG1A 2HSJA 1KIMA 3STYA 1UMBA 4KYVA 3O1LA 3JQEA 1ZNWA 3S27A 4HS9A 2R4UA 2X0KA 3LJKA 1YS2X 1YQXA 2HBYA 2OT3B 4L0DA 4HATA 5F2KA 5F2EA 2XEDA 4KO1S 1HX7A 2PSSA 5A2GA 2I2XB 3EOAI 1ADBA 3ETGA 4QYTA 1Y3CE 2OOSA 5LQKA 4ER3A 3PVZA 4L9AA 4OAOA 4BCCA 4EUHA 3NJ4A 3WLAA 5A9TA 1C80A 2FDCA 4P5DA 1M6VB 1OFUX 3I5AA 4L3WA 4NFSA 4DLVA 3E9QA 4MCIA 2M1XA 4I5GA 4UUMA 3ZCXA 4P4SA 5GONB 1EK1A 3U17A 3O93A 3RSSA 1UXKA 1JHPA 1PP4A 3BICA 3HHEA 4OA5A 5EWMB 5B1YA 2DETA 3NWPA 3B70A 3L2OB 3MJEA 1NNLA 2HR1A 1L4HA 1KXZA 1VE3A 2QVBA 2UXDB 5IBCA 3LFUA 4QFMA 3ZD8A 5TLSA 1D1PA 3NHRA 2JD0A 3K05A 1UPBA 4X1YB 3UH1A 2R1VB 1A2BA 3JWGA 1BDBA 4TX1A 1WKVA 2C5EA 2WYWA 1O0BA 3AY7A 2YWJA 3EZXA 1OMOA 4XW2A 3BWMA 4WERA 3UXEA 4BIIA 4BLPA 1M2GA 1PJ4A 3CRMA 5ICCA 1GUYA 3EDMA 2NQ8A 5C7LO 3SEFA 5AW0A 4BQEA 1JPJA 2A3NA 2J09A 4GZMA 4GKKB 4K8OA 1CUZA 3JWJA 3LC2O 3RVRA 3RUCA 4B4KA 4MCHA 4PAWA 1A8QA 2ZDGA 1A8SA 3VPCA 5B36A 3ZBUA 1FYVA 5AXAA 5BMOA 5THQA 4ITRC 2B9VA 5KCZA 3L0OA 5A4AA 4GP6A 2VYND 4ZU3A 4N7RA 3TR5A 2ZZMA 1PD0A 1C5KA 1GIAA 3PD1A 1P39A 4V1CA 4NIMA 1NW6A 3T94A 1Y8RB 2JI4A 4W9MC 1JQAA 2YWDA 2GAJA 1UFVA 3EAGA 2PJRA 1OAKA 3SDZA 1XKLA 3N0WA 3OPQA 10MHA 4WZAE 2D8MA 3UG6A 4RANA 4CM6A 2W8ZA 1RDFA 1DBSA 2I2CA 2YY7A 3GFOA 3NHAA 4IDNA 4NKRA 1WSDA 2BTOA 2FE4A 3ABRB 3FPKA 3LO5A 4MRRA 3TGLA 3L4JA 3COVA 1K7YA 3TXXA 5KKCA 3OUTA 4HN4B 2PZGA 3UA3A 3WYDA 4QM7A 5EP1A 5BQ3A 1A04A 1KY3A 2CXXA 3GU3A 3K0EA 4LXQA 2OCPA 4CF3A 3TQSA 4UZEA 1XRQA 3VNVA 1E63A 5TMDA 3GJ0A 2CZQA 2QRUA 1CZRA 1BQ4A 1YTUA 1U5BA 1DFHA 1KPIA 1NF2A 7ABPA 4EB6B 2JDID 2D5CA 2UUAB 3T41A 5E7QA 2OORA 4AXBA 4LNUB 1ECBA 4EY5A 4RY0A 1O6FA 3LD9A 5IVHA 2GZRA 1UAYA 2PJDA 1C50A 4J0HA 2WEKA 4OJMX 4C06A 3GLFE 4LGVA 1UJ2A 1OAOC 3R6WA 1IE3A 1SOUA 5G0UA 3ZGYA 2IWRA 3CBGA 1DRKA 1QKKA 5BWCA 2PMCA 1E4VA 5A1JA 5JD4A 3PLAE 3S2GA 4MZXA 1BE8A 4DLZA 4BVLA 5BMVB 1DMRA 3MNFA 2KPOA 4FFVA 4YJFA 3ZNQA 2W4QA 5DIFA 1IZ0A 4JKOA 4BWYA 1Q2UA 1VXOA 3H5RA 2EAUA 1Q0ZA 2EJTA 2FAXA 2REQB 4HNSA 4R2MA 3NOQA 4KI7A 4IM7A 1YDWA 2VT7A 4DOMA 3RS2A 2BH9A 2ODPA 2OQIA 3UUWA 2NU7B 1ILEA 1DAOA 4X91A 2GB4A 3IX7A 3AINA 4HLDA 3TDKA 3W4JA 3ITNA 4O2AA 4U0JA 4DRXB 1DRJA 1K3UB 5HTOA 3RJMA 4U3JB 2WG2A 2NXJA 4F45A 3BVPA 1C3OA 1RW4A 3G1WA 5LKAA 3CR3C 1T15A 2H4ZA 4LDPA 4XAQA 1KFBB 2G28A 4UQPA 4A8PA 1ZGGA 4UVGA 3RU2A 4ML3A 3W9BA 4DNPA 2OD9A 1TM2A 2YNMC 4XSVA 4F60A 3O2JA 5FLXA 4BLOA 1N5DA 5JSFA 2XPCA 4C29A 4NH0A 1GAWA 5DHUA 3DNFA 4UHEA 4D81A 3HXPA 2I2FA 4HNAA 2J4DA 4KYTA 5E8RA 1SH7A 4WXMA 3GPBA 4URVR 2Z08A 1LJUA 5ALJA 4J2TA 2NSDA 4F9GA 5FF9A 3OAAA 1WX1A 5J2TA 1G8KA 2W4IA 1WCYA 1Z0DA 3TNLA 4DV1B 1JEEA 4FWTA 1DEKA 1YRWA 4KZPA 2P7HA 4HADA 1CUIA 1AM4D 3GZ4A 3L01A 4J0CA 4FHZA 5IKPA 3Q2OA 1KXJA 3ZBPA 3QWIA 3QBVA 1W5BA 3CRZA 3UM9A 1NUAA 4KI0A 4W5WA 1V96A 5JWHA 1OH8A 1ODLA 1HG1A 1PHPA 1GNLA 5LQSA 2Q1XA 3QFFA 3WLTA 1PG2A 1TCBA 2AB0A 2C2OA 1MH1A 2I33A 1M8KA 4AUNA 3QF4A 4J9VA 4CQMD 3ADDA 2ZGVA 1YRQA 1GTL1 1ZO8A 4OKSA 3K15A 2BBOA 3T15A 5LLDA 3S55A 5KX5A 1P6UA 3FJ1A 2P4EA 2OXFA 3PR3A 1CY7A 2NV2B 1RYEA 3ZDDA 1KJJA 5KWIA 2WU0A 3AY0A 4TL6A 5F3RA 4BE4A 3HXQA 4LBZA 3LQKA 4BLUA 3MT7A 4XYGA 3AKEA 2V7EA 3WP0A 3VZBA 1AKYA 2SCUB 3CX4A 2TMDA 4OP3A 1NN1A 1E3JA 1XPJA 1K89A 1CHDA 2JEYA 3JVDA 3TKLA 5ADWA 1Z7WA 2E4YA 3T38A 5EUBA 1GLGA 3PGMA 3R40A 4FGUA 1N9GB 3DWGA 5EIHA 4YRJA 4MSUA 1ZLXA 4HO1X 4NNOA 4N3CA 5A3VA 1TUBA 1HLFA 1Z08A 2F3SA 3B6JA 2QL5A 3CX3A 4FEGA 3CBQA 3DUWA 1J7KA 4QTUB 4JA0A 3ODPA 4AN0A 5F21A 1EWVA 2CF6A 2D1TA 3SEAA 1A4RA 1FMFA 1ESEA 4XUCA 2FF5A 3KOWA 3KZNA 5IUJC 2XKKA 2QPAA 2C3OA 4QYIA 4DYHA 2R11A 4F1JA 4OHFA 1ZCBA 1U4OA 4UDYX 1JMVA 5I9LA 1RNLA 3V8QA 5IMSA 1JKXA 3U40A 4DLYA 5ELXA 2L17A 1JZTA 1UEJA 3JYQA 4YHHB 2F2TA 2H52A 1TM7E 1KYYA 3R6LA 3ANLA 2Z2YA 3CRW1 1NM5A 5IN5A 4D80A 5JO9A 3AP3A 4TV8B 3OFSA 4OM8A 5CA1F 1W85B 2YDXA 3GX1A 4HPJB 3A2LA 3DE6X 4EF4A 3ZNPA 3CUTA 2QVZX 4C2TA 2BPOA 3QEOA 4LZNA 1MIOB 3UMMA 3DL2A 5KWVA 4HGRA 1OH5A 5K8LA 4JT9A 2O0LA 2HK9A 1YR9A 2V1XA 3RVBA 3WBFA 3IAFA 2ZCVA 2BW0A 2NU6B 4LRUA 3G82C 3WK9A 4LDQA 1P60A 3O73A 4PO1A 3PU6A 2HRZA 3HACA 3N8NA 4G85A 3W6ZA 4ER7A 3A6ZA 4H1HA 4HAOA 3GXOA 2CJWB 3KTAB 4JEHA 3CZPA 2Q0QA 5EZQA 3C3EA 2OD2A 2XLCA 3BMCB 3P0IA 1B8OA 1RQ2A 3ZHBA 3KC2A 5FJIA 2PE5A 3WMRA 4C2UA 3H1TA 3MSCA 3IGFA 1NJSA 2H1OA 2DFLA 4KMOA 5DTIA 1UXJA 4X8MA 1KE2A 2L42A 3IP7A 5KQMA 1L8LA 4FYPA 4UZFA 5E6RB 2GCOB 2RGAA 2QN1A 1PNRA 1QFXA 1YJCA 3V6LA 2R6DA 2DWCA 3FYUB 3VVCA 2WF9A 1QUEA 2OBLA 2Q5EA 3GGOA 3HRHA 3N8IA 4FONA 5HZHA 3M9WA 3TLKA 3UPTA 2V6MA 4FFPA 4JP3A 3EDOA 4Q7EA 4KH0A 2E4VA 1KMIY 2WNSA 3A4LA 3NHYA 3F9IA 2XXBA 1MX5A 1VRVA 3WGQA 4DMFA 1NAHA 1TTHA 2EKZA 4WUTA 1RJ9A 1SIOA 3ZY3A 2RE8A 2I7DA 1WG8A 3NTVA 2ZR9A 3QXCA 3TW8B 4O4LB 3EYAA 5TQVA 1FFXA 1CYDA 2DUMA 1R0ZA 2C2MA 4Q1DA 1DG9A 1VL6A 5IT4A 1JSZA 4EEKA 1VSVA 1REQA 5JHGB 1DG1G 2Q5JA 1TUGA 2AZ4A 5IANA 3V8PA 1IYZA 5IYZA 1PG0A 2NZWA 4FOSA 3ER8A 3CQ9A 3HVRA 2GFHA 4H7IA 3IVRA 1TK9A 4P3PA 1NJ8A 1ZXXA 4YP0A 3WYBA 2XE6A 3FWPA 4FZJA 4H7DA 5EWLB 3ASZA 5AXBA 1PNVA 1QQTA 2PT7A 1OF1A 2PWBA 2BLNA 3NOXA 1IBRA 3RSHA 2XCTB 3EVNA 2AZXA 2BTEA 1ARZA 4JU9A 1J2UA 4OY3A 1GAJA 4TVSA 4U7JA 4TS3A 2CVOA 2QTGA 5LQNA 3PXCX 4QPDA 1BJKA 2Z56A 3K0SA 4IW3B 5DX1A 1ZUWA 2ETVA 1YGYA 1TCUA 3SHOA 4A5SA 3K70D 3ILYA 4C4XA 2WIAA 4JOCA 5CU7A 3VC7A 1AKNA 2GEDA 2P6PA 4RMHA 1E2HA 1U3WA 4XVCA 1T1GA 3K5IA 2AGVA 4TYMA 2QNIA 2IKQA 1ISRA 2X14A 1J9GA 1XZJA 4CFZA 1UK9A 4A0QA 4B2PA 4RGBA 2P35A 4UMDA 1K27A 2JCXA 3FGOA 3IIMA 4LYEA 2Z6AA 4ZHQF 1GG5A 4K28A 2R6R1 1LGYA 2ZETA 3NHBA 1DXHA 2V9PA 4FMCB 1UZLA 2CFTA 2P9FA 3Q7QA 4BPRA 4BNZA 2ST1A 3BL5A 1F2TB 1ZUIA 4UEQA 4ZI5A 4D4IA 3KTFA 1GR0A 1QMGA 2EXXA 5FEMA 4YI3A 1JLKA 3NV9A 1R8XA 1WXEA 2QMQA 4BWFB 4UEOA 4RSMA 3MJDA 3I09A 2XADA 3SHFA 4DV5B 4JC4A 1I01A 2PD3A 4Q3BA 4WZBE 4X1KA 1G8GA 5E0OA 4EZBA 3BEDA 4CEHA 5IMBA 5E3JA 2X58A 1XMVA 5CVTA 1Z37A 2ZJ3A 3LBFA 4PLCA 4JOBA 4FFOA 4MUXA 1P2GA 1PUJA 1U9IC 4W7IA 4HUTA 3NONA 4YV2A 2QJFA 3HZOA 1P44A 4NMHA 3TEFA 3QYFA 3HV0A 4BMDA 2CDAA 1FFDA 3NR2A 1K8ZB 5DI3B 3ROZA 1JE1A 3LWBA 1D5CA 3I9OA 1VYHA 5EVCA 3HZZA 1LF5A 1HYEA 4QDXA 5I7HA 3HCRA 2NO7A 1EKXA 5JASA 1M54A 3G2KA 3IESA 3ZK9A 1CETA 1N7GA 1QOQB 1P91A 4ZQBA 1L4YA 1SCBA 4UNRA 3GLGB 3AETB 1KGDA 1QZXA 2Z2ZA 3LC7O 1EE1A 1XDGA 1EG7A 2O48X 1QIIA 3FYSA 1YE5A 1MTZA 1Y5MA 5NLLA 2AOWA 2YIDA 1QHFA 2WF5A 4L4UA 1Y48E 2LVBA 3FVQA 2C1EA 1OXKB 2PKQO 3IJRA 5AKEA 1N5OX 1R50A 1XAIA 2QG9A 3FPCA 4KE8A 2EZUA 4DR2B 5JJLA 5KOIA 4RD1A 2NO5A 4ZEOA 2IOHA 4HRAA 4CLRB 3BFKA 5KBYA 2CXPA 2MINB 3X2FA 1PSDA 3ZDZB 4NU0A 2WMNB 4Y9TA 3ST7A 4F46A 2BE9A 1E1DA 1QG4A 1V26A 5A4MS 2VAPA 3UMYA 4E4YA 2FSSA 2N9UA 2ZRNA 2VNKA 2GZ3A 3KVRA 2WJ3A 1E9FA 1PYOA 1TGVA 3N3AC 3RPEA 4KITB 2QJTA 3PPIA 2G5TA 2VYNA 3W78A 3IPXA 2A9PA 4QC2A 2QRGA 5BT9A 1KBQA 1OTHA 3U13A 5GIPE 4ZKEA 1DAEA 1YBFA 2BEVB 2H31A 2YZ2A 3GRYA 3HB1A 4MKIA 1Z7EA 3ITEA 3I9V1 4CCYB 5L3QA 2BT4A 1Y6QA 1XP8A 1RZ3A 2JCBA 5A4DA 4EBBA 1W8IA 1DEAA 3AKYA 1E3DA 2JG3A 1X1DA 4C3UA 3HVKA 2HZBA 4XDZA 1Z35A 1J49A 2B78A 2E7ZA 2RDMA 1AHNA 1IBSA 2ADMA 4U4AA 1ZVJA 2NPIA 5AW1A 4D97A 1QB8A 3C5VA 2XMCA 4RV4A 2BD0A 2QU7A 4IFIA 3VZCA 1ZHHA 4O2BF 4HEA6 3R3XA 3L05A 5A0FA 2RGEA 2F9MA 3BQNB 3IODA 1T9AA 4WECA 3IEPA 3MCUA 2XE4A 1XZMA 3FDZA 4MUYA 2W6JD 3ZS9A 1QZTA 2NXWA 3DZJA 1PU2A 2R8XA 3M6UA 3PNMA 3UWOA 3EXG1 3CKMA 1U3TA 2JDIA 3O8DA 3AWIA 3PKZA 1Y7HA 1VLJA 2VHVA 3LNCA 1G2QA 4NK4A 5EHNA 3SXPA 3GLKA 3A10A 4E2YA 4LF9B 1FTNA 1VMIA 5G0VA 5ERYA 1FRQA 2E4XA 3I1IA 2H7XA 4UNPA 4D8UA 4MJ3A 1JYEA 1VGQA 3U09A 2Q2NA 3FMPB 1ZUD1 4WGGA 3UT6A 1E9AA 1P1KA 1QRTA 3Q15C 1L6RA 3BIOA 2F4VB 3D6MA 4CEJA 1TOAA 1H4SA 3VAYA 4J90A 5I9SA 3E05A 3OICA 4L78A 3HCAA 3G88A 2J5KA 1KH2A 3O4JA 3WO0A 1BJTA 1V8PA 2GPAA 2P6OA 2VXCA 4YCCA 2E82A 4JLVA 3T9DA 2R6AA 2XRYA 3PR1A 5FEUA 1MC1A 1WQ4A 3I01M 4FCVA 2K2WA 4GPTA 4EENA 4U9IS 4JL8A 3A7DA 4WZAA 2OCXA 4HGQA 5HK9A 5EIBD 3DHWC 4AX4A 5JJBA 3QKRA 4CKYA 4PLWA 1QG0A 2FB9A 2Z83A 4CTNA 1TW3A 3AFMA 3MAAC 4PWYA 4AS1A 1SVLA 3BS4A 4FFWA 4KHZA 5HM8A 3LDAA 4XEUA 3LOPA 4I1UA 1O4VA 2HF8A 5HIJA 3T7CA 2MWMA 2B1QA 4Y2SA 1XELA 2ZAYA 2PZJA 4BEVA 2H18A 2X8BA 1DUIA 3PD0A 1U0OC 3CLRD 1EVKA 1SCKA 3WGGA 2OAP1 1KU0A 3RTAA 1FOEB 3OQJA 2ONCA 1H69A 2Y4NA 2XQJA 3KEOA 1XD2B 2CLOB 1IZ9A 4ZT5A 4S12A 4AG6A 3EGCA 4YWHA 4N41A 5JYDA 3HEAA 2OHIA 2ZIZA 3R77A 4U7WA 2PT6A 1MNAA 4PTZA 1TQ2A 4BNNA 1S4MA 4N6OA 5DYGA 4YO7A 3P9QA 4ZYXA 2G6TA 2VF8A 1PL7A 4PO9A 3FOFC 4G8JA 3FHCB 1Q11A 3KEGA 4FYXA 4GXQA 5DMHA 4ZEWA 2V4MA 5TEWA 4FMCF 3T54A 1OZGA 1GY8A 3IVMA 5D5QA 2BR5A 2AN3A 4L2IA 5IFLA 4C7MA 1KDVA 2FN9A 1N6HA 4HN2A 4I2NA 3ENKA 4CLDA 4CQMA 5HMMA 1CQIA 3OM8A 1GQYA 1OI4A 4U2DA 4Q19A 2WVJA 1X3LA 3UHFA 4UUNA 4AMUA 3N2ZB 1MEJA 2CVHA 4DIUA 4MV6A 1MNQA 2X6RA 1QIGA 2BJVA 3G8AA 4L02A 4N0MA 5ER6A 1WCV1 5F35A 4YRGA 4DR7B 2UXBB 3FNRA 1CJKC 3GA5A 4LZOA 4PZUA 3ZOZA 2BP7A 3QXSA 4CKBB 1PJAA 4J0JA 3D3NA 4RHTA 8GPBA 2WAOA 3KAKA 4PGGA 4GICA 5HNKA 1JDBC 2PH1A 2H2WA 2XODA 1FMLA 5BY2A 1A77A 4H7PA 1V7QA 5IDQA 5JTTA 4UTRA 4R1OA 1SU6A 4Z9XA 3DQPA 3V48A 1PJLA 2GASA 5KTOA 1Z22A 2H0RA 2XNDD 5AKJA 3NTXA 5KUTA 4DWWA 1KMNA 1NDUA 2D1YA 3GMIA 4HZUB 3WLQA 4Q4AA 4DT1B 1GL6A 1SOVA 1JFFA 1K4MA 2WAYA 3FDJA 1MHPA 1L5YA 3Q6IA 2Z43A 5I5GA 5KDOA 3S2ZA 2XNHA 4WWHA 4XEHA 3QKUA 3EXEB 4CF5A 3ZHVA 3ZJTA 4A0GA 2ZRIA 2WJJA 4Z8XA 1GNRA 3TM4A 3LGXA 4E88A 2EEPA 3FUTA 3K94A 3U4IA 1D6MA 2JAOA 2YBDA 3W3AD 521PA 2O2YA 2C9DA 2R5NA 4G01B 3VKGA 1Q1AA 2ZYWX 3ABSB 1IJBA 3N53A 3NVDA 3PGA1 3Q4GA 2B5VA 4FD3A 5CXXA 3K0HA 5DO9A 2NU8A 1OYOA 3UJAA 4EI9A 3KDSE 4OHYA 4BLQA 5CDGA 2ZBFA 4MWSA 5LOVF 4ADSG 4EH1A 2VEDA 1MTOA 2QL9A 3QW2A 2OAEA 2I65A 3BD6A 3OF2A 3LK6A 4J4TA 4K3UA 1PDWA 1RRMA 2I71A 2OO5C 3L8HA 3SP1A 4D44A 3GLGE 2QN7A 4MGZR 5K2MA 1PJTA 5KNBD 4OUKX 5AVWA 1I3LA 1QE0A 3L6UA 1C8KA 3OLVA 3RC1A 1E0KA 4JX8A 2GPJA 1AO0A 1FCJA 1ZMTA 1Q20A 4KWIA 4TTTS 2XGGA 3BMNB 3QVXA 5NULA 3PHGA 5E6UB 4M0UA 5AM1A 4ZO7A 1NMEA 3JAWA 1GU0A 2PUEA 2B83A 5CDTA 2ZBUA 4RXUA 1RXIA 1SB8A 2OCGA 5TPWB 1S3IA 2VJCA 2XI4A 4R68A 4BO4A 2VKTA 4GOLD 1W52X 3JQCA 3QE4A 4MV5A 2PU5A 4BNVA 1UFOA 3WSTA 1B8PA 1JG7A 3H9QA 4MJLA 1OHHD 3LRTA 1T0HB 5E9JA 2YKGA 4N3AA 3HI6A 2RAVA 3GEPA 4G56A 2H1CA 2OCBA 3BRSA 1UKYA 3DUFA 1BVUA 2H5EA 3SN6A 4E5NA 3J7AC 1P73A 4O0LA 4NJEB 1NR7A 5TMPA 4HFMA 3B48A 3K73O 1AH2A 2DQKA 2ZIVB 3LCJA 4MARA 4PAMA 5FFMA 1NVXQ 5ARDA 4M0CA 4ZJZA 4F2GA 1PJSA 1PT5A 3L0SA 3MK31 2R1ZA 2GF2A 2MYUA 1UINA 4LWQA 2I4LA 4RFVA 3WDSA 4IQFA 3DW1X 4PBRA 4G24A 4FFBB 2ASEA 5KJEA 2VTEA 4UBNA 1N4AA 1JB9A 1ANKA 3PNOA 4LHSA 2Y05A 1E3MA 4F6RB 4QOJA 4ZEMA 3GBPA 4W5RA 2VPYA 2VYVD 2EWWA 1G55A 2YICA 4YPFA 4BKRA 4EI8A 5C8ZA 4F12A 5JPDA 3BWEA 2AW3A 2FFQA 3W7BA 3PRKE 1KK1A 2JW5A 4A03A 1N8KA 1OTXA 2CN1A 3NFYA 2JAXA 3H05A 3BGWA 3RNLA 4GM0A 4LXYA 2BBWA 2YUTA 4YAJA 1SBNE 1G3MA 2E4ZA 3OLXA 4NU6A 2FSHA 3IIEA 3M4NA 1USWA 5GZ6A 4BASA 2VS1A 3NNSA 121PA 1RABA 2H4JA 3OZFA 5DE3A 3IAAA 1YB6A 4FT2A 5EVJA 2OXTA 5F4ZA 4LY3A 4OHOA 2I6FA 4XI9A 5CA1A 3HGMA 2XNKA 2I9KA 3AIIA 5D3MA 3E8MA 3PXUA 1ECJA 3JWEA 3PPXA 1VHTA 4YAEA 1MJGA 3ID6C 3N87A 3W6UA 1Y8RA 3U19A 3MXTA 4QUDA 2H57A 2VJLA 3IAEA 3QFCA 1U0TA 4P3NA 3IV7A 2GM3A 1NONA 4Y2VA 3WDKA 3GCZA 5EKTA 4EATA 4C7OB 1AUOA 1XZPA 1F12A 4N03A 3IULA 4AYXA 2P4UA 3P9YA 1QHSA 1T4GA 3R9XA 5K4AA 1QZ3A 1R64A 2BCGY 2HJ9A 3AILA 1OW3B 4P86A 2ZG6A 3OZCA 2QGFA 1JWAB 1AQUA 1OXMA 4OMCA 2FHPA 4MW2A 3PF8A 4F4JA 4UDOA 3URMA 4RESA 3C45A 3PI7A 1XYVA 4MULA 4NMXB 2AH5A 1XLWA 4FWIB 4AWXA 2B5OA 2FFHA 2NZ2A 3IEVA 2V5VA 4NMWA 2QD2A 5L3VA 1CQWA 1VECA 3G9QA 1X2EA 3W5HA 4DREA 1ZD1A 1PK9A 3LHDA 1PFWA 3OCCA 1Z68A 2HIAA 2DFPA 4HH0A 4LNUA 1H5NA 3HYSA 3WGOA 1DO2A 3HCDA 4KW7A 6PFKA 3KDPA 4WXEA 2XBUA 5P21A 2ILTA 1SQ0A 3SF8B 4G97A 3DR5A 2DG2A 2GN0A 2ZTUA 4D9NA 2P79A 1P3DA 4NONA 1JAXA 1P61B 2QAGA 1NLFA 1WY7A 3FUXA 3KE9A 1GVNB 4PLGA 2J3JA 4RNCA 3PC4A 4L5YA 3FUCA 3UOAB 2JLWA 1TFUA 4RS4A 2WM9B 3Q3EA 1Z0UA 1Z6AA 2WFAA 4B79A 4RTLA 5C4MA 1RAAA 1K6EA 3QU9A 4BMSA 4U7GA 4BE7B 2QUZA 1GUFA 5KYNA 3F46A 2A1UB 4IJ5A 2YY5A 4WZBA 2FRXA 4G26A 2R00C 2VZ9A 2VPZA 1E9RA 5LIRA 4HVCA 4C0JA 2YIVX 4LHXA 4GOXA 1IXYA 3IXQA 3B2QA 1SCNE 3TZBA 1B6TA 1TKRA 4UJ3A 4XR4A 4DUGD 3JTEA 1O96B 5EUMA 1Y3FE 3I6BA 4G4JA 3IDAA 4HQLA 5HRUA 1J0DA 4M1QA 2GS9A 3N5KA 3PSAA 1DV1A 5CEJA 4YUAA 5GP1A 4G4SP 3OTOB 1U7HA 1FS4A 2IITA 3KJZA 4NBVA 5SICE 4D4HA 3JATB 1U2GA 4LJKA 2NSYA 3BN3A 4DRYA 5TDHA 2HA3A 1MV8A 5K5EA 4K5QA 4MQLA 2RHRA 1V48A 1QH9A 1F60A 2H07A 2QTZA 3ILVA 4J94A 2W6JA 1F2UA 1A8HA 4P4TA 1JJ7A 5FTJA 3DQZA 4R3NA 3VDMA 3LHIA 1TJ3A 1QVWA 1XX6A 5J5CA 3LE8A 2JIDA 3A11A 4HMPA 2RBKA 1PFGA 1QVZA 1RHUA 5CK5A 3SPXA 1NYQA 5BYBA 4KACA 3NIFB 1RI5A 2MIIA 4Q9NA 1KK2A 3UOGA 1XJCA 2O8CA 4UVHA 1QIEA 1QS0A 1BWSA 1N6KA 5G0TA 2OSBA 4M36A 3WLSA 4MAAA 4DCGA 5KYWA 3JQ7B 5L9AA 1CF4A 3V7YA 2C5GA 4MHOA 1DDIA 5JV5A 1FLVA 3X1DA 3UOWA 3EULA 3I2KA 3T5CA 4W5OA 3L1KA 4FQ7A 1ADYA 1A8UA 3PUWA 1FJXA 4KMRA 1NBHA 1IK4A 2EZ9A 1D9ZA 4WBSA 3VR1A 2Z1DA 5MF6A 5K8UA 4ZT3A 4AIRA 1A9TA 2ANBA 4PS1A 3P96A 2O19A 5AW7A 4MDFA 5DNUA 4A16A 1NDHA 2IZ6A 1ONBA 4PO3X 4AYWA 1S96A 3O90A 5JC1A 1NGSA 3QPDA 2FG5A 2IUFA 2O8BB 2BISA 1EJ2A 5DYWA 4WXYB 4AJ2A 4UHCA 1IONA 2IU6A 5LUBA 2XYPA 1NIPA 3EC7A 4G07A 2C8VA 1S8FA 1L5GB 3ZWKA 4C6TB 3FVRA 2HHJA 5CCEA 3DAHA 1WM1A 4OMDA 2IDJA 1NXXA 1VBMA 2AQHA 4R8LA 1PQUA 3TUZC 3HBMA 4BDTA 1G0NA 1PR0A 5GINE 1Q14A 4S1VA 1SXHA 1W59A 1C3JA 5IZ4A 4O3MA 2KHZA 4QECA 3GD7A 1QQAA 4NPAA 4QXQA 2C5SA 4ZZ2A 1UJBA 4W5QA 5E1DA 1Q77A 1ZK3A 3DZCA 2IHVA 4LQCA 4Z86A 2X8JA 3LECA 4G8BA 3I2IA 5DSXA 1T6BY 1X7GA 2HX1A 3OJ0A 4QL3A 4BNDA 1QQBA 4EA7A 3P8ZA 2A92A 4WK4B 5K3DA 2X0DA 2QMUA 3STUA 4CM3A 1II9A 2QRMA 1DO8A 3KKOA 3C1TA 3DAPA 3U81A 3O21A 1EZZA 1LXCA 1OFGA 3JQBC 1UDXA 4Q1FA 2E6UX 4WCDA 1K1EA 5CMLA 2PK3A 3KKQA 3MYRA 4YMSA 1A5BB 3U4DA 3DF9A 3TNJA 1L4LA 1RLIA 1JQBA 3KO8A 2ODQA 1TCCA 4JB0A 1IHPA 1U28C 2NU9B 4FZRA 3GJ7A 2B61A 2FWMX 4ZANA 3GRAA 2EFJA 5ALMA 3UWKA 2DUWA 3OQVA 2W2KB 1QP8A 5C7OO 1PN3A 2JVIA 3Q0IA 4O2BA 2VO1A 2QYOA 2Y6UA 1V8OA 4C4SA 1MIOA 2VWPA 4QKQA 3OQMA 4F5WA 5BVHB 2VSNA 4FXOA 3FCYA 3TXYA 3QXJA 2HH9A 3IT0A 4KBFA 1EWRA 3RYFB 5K4HA 4BZZA 1ODTC 5E4YA 1FFSA 1OBOA 2P5SA 4GZ6A 2BI4A 4JN6B 1VPDA 2VZEA 4LJYA 4DUYB 4CV2A 2GA8A 5DM2A 3ORYA 5SYNA 5AW6A 4GQAA 1J24A 2XOKD 3NCTA 1K4KA 2F90A 2A1TR 5IC6A 4L5IA 4PZYA 1EI9A 1Y80A 3G0GA 2XCSB 3DVRX 2Z57A 1Z8NA 4WOPA 4J0FA 2QTFA 3CF4G 2XNDA 4Z4FA 5IVKA 3WB2A 1L1EA 2RH4A 2VDOB 2W6MA 1E4EB 3IBYA 3S6JA 2QP9X 3THXA 1R0XA 1JIKA 4KQMA 4RMJA 3ZV7A 1BGWA 1P4SA 3MF4A 3UGKA 1XZKA 2QAGC 2CNOA 4CDNA 3M70A 4JODA 4TTPA 2Z30A 3DLHA 2V7WA 4OYHA 1AKQA 3CHYA 1KR5A 1CJVC 2QN3A 3A9SA 4G89A 3AQIA 4RYLA 5FPPA 4LSMA 1QFMA 4XQGA 1PS0A 2AOUB 4HJXA 1QHIA 1QZZA 3ZCRA 4QNNA 2H1WA 2VTDA 5H80A 4D4LA 5C8DA 4IXNA 4BNYA 6Q21A 2EFDB 4YMVA 4HX2A 3W3AA 2QM8A 2AJTA 1E8DA 2YXNA 2BEUA 2J0EA 5I9MA 1RQGA 4Q4CA 3T7EA 3AEUB 5C46F 4H1UA 1FNCA 3M6XA 3P2YA 3NPMA 3C3YA 8AT1A 1ZWKA 1E6MA 3OJFA 1NFQA 5AVJA 1I30A 1JZSA 1NVTA 4ETNA 4MK4A 3SGLA 2GYUA 1Y1QA 4NENA 2Z5FA 3F3KA 3KV1A 4D3YA 2BGIA 2HJSA 2Y1WA 3PQ8A 3VKWA 3GP3A 3LUAA 1LH0A 1XAJA 3MOGA 4AG5A 4BX9A 2R25B 4OXNA 5KNBA 2RONA 1T6YA 3KOUA 5JTUA 4LG1A 2A6PA 2XX3A 4Z51A 1FK8A 1ZCJA 3CT4A 4DLXA 1E0JA 3FN4A 1PX2A 3F74A 5I7UA 4GLBA 5I3ZA 4HH4A 4JWKA 2DCMA 5FOUA 3V97A 3VSAA 2GTPA 2C94A 1L7OA 1VC2A 3WL3A 2BUAA 5J9FA 4RH0A 4GPZA 3SEZA 3RUAA 2A0XA 4FMDB 3SSNA 3WJ1A 3COJA 4YJ2F 4INJA 4FOOA 1VL8A 2YHBA 4WJZA 3RT9A 2I8CA 1KETA 2CYCA 4OQ4A 3QUSA 5CVVA 5GJVC 1SXJB 5HKAA 2IQIA 3C6XA 3ADOA 3CO5A 1OHHA 3CNOA 3U1VA 3S8EA 1J00A 3K9WA 1FW6A 1L4KA 3KR0A 3SAJA 1N1DA 3QTBA 3IUBA 4R0VA 5CD1A 3LDFA 3M1IA 4OHBA 5JYBA 3Q8KA 5KDDA 4FNMA 4GMHA 2ZB2A 3HRIA 1NFFA 1R16A 1VQ1A 2PX5A 1JIXA 2NUPA 3PPYA 3WWDA 3O1HB 3DHYA 1BE0A 3DVLA 2BMFA 4CQNA 1P1IA 4YMUA 5A04A 2QB5A 4IXWA 2XA2A 4M7WA 1YJXA 1I3MA 5B64A 4C76A 1JMKC 5HGJA 4X1OA 2D5IA 3U7JA 4ZJYA 1CERA 3REGA 5EEGA 2FPGA 3RJZA 1L5WA 2FV8A 5EIBC 4JI6B 2O5CA 2EP8A 3A3YA 1ZIYA 5JD6A 5I7EA 4F7WA 1F06A 2MHCA 1J6UA 2CVFA 3G6WA 3GZTB 4P38A 1UQTA 4WACA 1I33A 3GLGA 5AVYA 1JDBB 2GPBA 1ULZA 3GT7A 1N8TA 2VYVA 3CH5A 1UJ6A 3P52A 4KR3A 1SVWA 1RXYA 2VQSA 1WU7A 1I4OA 5AVVA 4GLOA 1CJBA 1NVWQ 5I6DA 2J3DA 1Q1QA 4DRZA 3DT8A 2ON6A 3EK2A 1PGJA 3LKBA 3PC8C 4A6DA 1OTYA 1P18A 3OBBA 5EIEA 1KPGA 5CYFA 1E6KA 2OHJA 1YRBA 4GWKA 5FFFA 3KPYA 1AUQA 4AICA 4EG3A 5CAEA 1NVGA 5L4NA 1DIRA 2O06A 1EB8A 2G9UA 4NABA 1U94A 3I01A 1RRKA 1NNUA 4KEAA 2WUEA 4N40A 3U61B 4Q4DA 3ZX5A 5BWNA 4CKWA 2F00A 1JXOA 2QZSA 3KWFA 4IDQA 5M34A 1THZA 3ABOB 3HNPA 4Q66C 3DGFC 2N1MA 3PT5A 5BN3B 2BZSA 1K5GA 1MJNA 1NMSA 2GCNA 3W77A 5LOVA 2HPVA 1RPZA 1XTZA 2NWQA 1U0JA 3PHBE 1UXIA 2QQGA 5EMMA 2AMJA 1C7ZA 2JAHA 3CIOA 5C5EA 1I2MA 4MOWA 3IUPA 1T9DA 4CNBA 3GOQA 4ZVMA 4L28A 2JHCA 5E38A 4AP5A 1UMDA 3Q1KA 2GXUA 3BX1A 5CFOA 3TD6A 2C3PA 1G5TA 1N0UA 4I4TB 2IW1A 3WK5A 1A9XA 1ZL0A 5AUQA 3E8XA 2POCA 2FJUA 3TIFA 4QZVA 4AG3A 2HNBA 4DV0B 3L0BA 1ZSYA 2NO6A 4G5FA 5BSTA 3JSXA 4AQDA 4BXOB 3U7QB 4JAVC 1PGOA 2VRWA 3ETEA 3LYUA 4UAUA 5ELLA 1D9XA 1KI7A 1CZOA 2IHZA 5EA2A 3AOEC 4TMYA 5JJCA 1CVIA 1S9DA 2FR8C 3O6VA 5AKYA 5BWLA 2QN2A 5KIAA 5TIIA 1ZJ5A 2C9BA 1KI1A 5GOTA 1LNQA 1DT3A 1W8DA 4MQEA 4JVOA 3OY2A 1Z38A 3OTHA 1LEHA 3LWNA 1HYQA 4BVEA 5L40A 2C2ZA 3IMKA 1PFVA 2WPDD 3SKVA 1GQQA 4CJXA 2O2EA 3ES9A 4AKSA 4Z3OA 1EFVA 4D92A 5JDCC 3H4TA 1P74A 3ESYA 5BRJA 1SXQA 4EJSC 4LV5B 5E9WA 1P75A 5CG2A 3AHGA 2RIRA 1IH8A 2LWIA 2NSLA 2C0CA 1EG2A 4ESEA 1ZD2P 2GLUA 2LCQA 2ZOSA 3L4BA 5DM4A 5K2OA 5EINA 1G1AA 3MJSA 2Y0BA 4OP2A 2XTNA 4MUKA 3ZW7A 1UMCB 1MAVA 4HQRA 2GBFA 2ORYA 5H3HA 3U0VA 1H5QA 1C7JA 4FW9A 3TQRA 4D9EA 5J4YA 1T24A 3A6LA 3FR8A 2HRCA 4AZ0A 4IDFA 1TEXA 3EGIA 3H2ZA 3EIUA 2DY1A 3ZPXA 1YMUA 2JEZA 4DCTA 5AK6A 3BSSA 4NPCA 4L6IA 1O54A 1DKPA 3HYNA 2G63A 2Q46A 5ABPA 3FOZA 1RJEA 5KNBH 4DUGA 2OZKA 1HQDA 2B0JA 4R9SA 2IXGA 2LRHA 3CU5A 5AKHA 1RZRD 3A2KA 1I3NA 4KKVA 1QDUA 2WAAA 3R75A 4K05A 5SY4A 4P2BA 5JXWA 2QLJA 2GFIA 1A4XA 3RUHA 5AW8A 5EJ2A 2I5PO 3R7SA 3WNDA 5EOVA 1N6RA 3S2SA 4Q21A 1VG1A 1YA4A 2QZJA 1CIJA 1L7QA 5JSZB 3VJKA 2FZVA 1Z5GA 4IIBA 3HP7A 4OSPA 1EUDA 3NP7A 4GOJA 2PEZA 4MW7A 4QU0A 4QUAA 4TLEA 1Z0JA 2ZJBA 2JC3A 4Q9KA 3OUUA 5K09A 3F5QA 4W9NC 3PL5A 4PCLA 1O8BA 3M3PA 3AF5A 4IDGA 3MMPA 1MORA 3SVTA 3EUAA 4HEHA 1IY0A 4D45A 4Q12A 4YAOA 4C7KA 4RVOA 3BE4A 2LP4Y 2FETA 5J58A 1R8QA 3CPHA 3NIGB 2AS0A 2J33A 1MV5A 3KWJA 1JDSA 2WINI 3PWKA 2B4KA 2E1PA 3AR3A 3FETA 1ZK4A 4LS3A 1W76A 2RHCA 3AZOA 3Q3IA 4XE5A 5EN4A 4CQJA 2NYAA 1IATA 3KXKA 1XMPA 4S2UA 1ORHA 1SM4A 2OFXA 2WBLC 2R62A 2ZBGA 4JLAA 3KJXA 1QCCA 1YBAA 3RJTA 2RBGA 2JFFA 1A98A 2AMFA 4MVCA 4TYQA 3MMNA 1E77A 1QF9A 4DYDA 5I3CA 3OURA 3DXFA 4R2HA 5ALTA 4MVWA 2OGTA 3B9PA 2WSLA 5DTMA 1VIYA 1HE8B 3VMFA 1DV2A 1FY2A 5FO1A 1XMQB 2I2BA 4MIOA 4N5MA 4MITA 3TRHA 2VJDA 1QQ7A 2OCYC 1E1KA 2RHOA 4IBOA 2HDNB 4B3SB 2CUKA 3LW7A 3IPRA 2CWWA 1YACA 2NXNA 1IBMB 3EXFA 1W2HA 3HKDA 2GPWA 4KIJA 1GPLA 3GT4A 4XH9B 4US2R 4Z9BA 4LOHA 3A1TA 4O5OA 4H4EA 3M1LA 4EDFA 1BS2A 3SSMA 3ZXUB 2SNIE 3KZOA 2BC9A 3DFFA 2EZTA 2Y77A 2IIVA 3PS9A 2QTAA 3G5AA 1U2RA 3I9FA 1F8GA 2ZUTA 2Y9PB 1SAYA 1SHLA 1SXJE 5AK5A 1NF3A 2YXLA 4Q3EA 4ZZ0A 4FW8A 1W7AA 1DBWA 4BLSA 5HF6A 4S1PA 1L7RA 2J5BA 3N3BC 2D5AA 2H7VA 2VT6A 2WVHA 4L4ZA 3IHWA 1KMQA 1YUBA 4FN5A 4K6FA 5DGTA 1ZP6A 3HZRA 4EJ6A 1VYVA 2IHBA 2J6IA 2PH3A 3F5MA 3LHSA 4X6UA 3I45A 5FFNA 5CJ2A 3DEJA 1RMTA 4OFXA 4XOUA 3WIOA 1USVA 3CR7A 1SCUA 1OA0A 3EQ6A 4MPTA 3WHPA 3FWKA 4LZLA 2YMQA 5KCMA 4ZOBA 2H6EA 3GLVA 4L0CA 3DTVB 2ONKA 3LTEA 4A2CA 2Z6UA 3ZDCA 1MPTA 1KJQA 2H54A 3H2JA 2OZVA 1T43A 3R44A 1NQUA 2MCFA 3GRFA 3SQNA 3RF7A 3UUFA 5IVPA 5K01A 3K2EA 2WF8A 3T4UA 2AXPA 4CL3A 3OOYA 1Z4KA 4PLPA 4LRXA 4NNPA 4B6OA 3HPRA 2UZ1A 1P77A 5CYPA 4CLXA 1XLTA 3IXLA 3RFFA 4JD5A 4Q3LA 3R3HA 4MW6A 1J2RA 3UO8B 1L7PA 1CY1A 5T41A 3UF0A 4KQHA 2O59A 2GARA 2WZBA 2YH2A 2HK6A 1NQVA 4XCVA 5A6SB 4I4TF 3P2EA 4J7XA 1G9TA 3C3AA 4X3CA 4RIHA 3TRIA 3JZIA 4MMXB 5AI5A 4YWJA 1N2EA 1QHHB 2OG2A 1UBRS 1YE8A 1G16A 2QE6A 2XOKA 4KLCA 4CDRA 3OA0A 3KRTA 3VSDA 3R2JA 2VT3A 2FPPB 3LRXA 3N2GA 4CKXA 4DV3B 5D2CA 2PMDA 4XLTA 4OO3A 2WKQA 3SC2A 3UPUA 1JLHA 4LRYA 3EX7C 3VGJA 3RK4A 4LDZA 2V96A 5EPUA 4E1AA 4YCNA 1YR2A 3ABIA 1C4WA 1WHTA 2FW6A 2NAFA 2X77A 3GMTA 1EWKA 4WFIA 2ZT8A 3OHSX 3ZGLA 4YRNA 2ZI5A 3L0DA 4Q48A 4ZO4A 3BH6A 4BV8A 3L6EA 5LA6B 4GL2A 3JRNA 4RO0A 3VDRA 3JAMA 3CF0A 4EARA 1BC5A 1TJ4A 1CUAA 1M6NA 3IBGA 4TXMA 4EY8A 4B6PA 2OHGA 2EFCB 3D1VA 5F2OA 4AXXA 3PXBA 3VV3A 1BX3A 5JNWA 1YV9A 4HZGA 5AD1A 4PQFA 3CISA 5IJ9A 1P0PA 3LKDA 3COZA 1E4OA 3O4FA 3A1FA 1MH9A 2QDKA 1RXVA 3RUPA 1R2QA 1SKAA 3BDIA 4GM4A 4F72A 5JAPA 4CIYA 3A0UA 1K9VF 2SKDA 3QJGA 5CH8A 4JUCA 3SS9X 5JROA 2IC5A 3NQ41 5F5XA 3QFTA 3D59A 3B6KA 1H0RA 4P83A 1H2EA 5EJ5A 3S2EA 4UE2A 1KQGA 5EFZA 4F6RA 3L7KA 2YZ7A 4D3SA 1ZK1A 3O9MA 1GGVA 1H4VB 1H23A 2JZNA 1QFZA 2FW1A 2A67A 1O03A 3KUKA 4C2AA 2AOXA 5HFNA 5B57C 2DHEA 4OQDA 3W8DA 2EBHX 2BAGA 4PNPA 1QO7A 2W11A 2DM6A 1T1EA 3QVLA 4DJ5X 5G3YA 2QTTA 3QUTA 4J0QA 4LJSA 4NG4A 2C5AA 3S2IA 1GSOA 3B52X 4WESA 3C4VA 3VNRA 3ZKWB 4AY5A 3O03A 3U60B 3KSAC 1TT7A 4IJKA 4BBJA 4ZQFA 4DXDA 1MR3F 4Z3DA 1A76A 2EF0A 5BNZA 1S2MA 2VTBB 2LIVA 4JSRA 2CY0A 1W35A 2UKDA 5ALDA 4OJKA 3RADC 5F76A 1C1YA 5LQMA 5MGBA 1E5TA 4RZSA 3ZXYA 3AFHA 4BKQA 1KOGA 4YGXB 1G8PA 3QBJA 3BXGA 3RIMA 3B8EA 3D5TA 3KT8A 3HADA 3IQIX 4B6GA 2RHJA 1TJYA 4BZPA 1FFGA 2AR0A 5D1HA 5KVQA 2PRSA 2ORIA 1N2CB 1VOTA 4JL5A 4Z1OA 4BLVA 3WNCA 5I8ZA 4DIOA 2QJRA 3ELUA 3K5PA 4F8EA 1XKTA 1KEVA 5K45A 3KQHA 4ZPXA 3TZCA 3JASA 1E9SA 2IY9A 3PQCA 1XAGA 4P2GA 1Q1BA 4FEYA 4Y9RA 3FDIA 1FNMA 1Z34A 2Q7DA 1E1LA 4Q1EA 3ZY5A 3EA0A 3TFQA 1NJ2A 1A0OA 1NBAA 3R7WB 5CYGA 3G9XA 1CT9A 1XVUA 2FE1A 2J3IA 2PKXA 3AEYA 1LSOA 3H5AA 2WYHA 3OU2A 3RBVA 3DYIA 3T9BA 3QXHA 4AMGA 3MWJA 4RMIA 1ZMXA 2J4CA 2J9FB 4Q1CA 4A1FA 2ZSJA 1D3AA 3MTQA 3THYB 5BV0A 1EGVB 4OQYA 4BKUA 5E3HA 2COEA 2VDRB 3LV8A 4I1PA 1N2SA 2WSSD 2P65A 2XKBA 3RHSA 3V33A 3B78A 5ITZA 1LDMA 2V7UA 5CHYA 4BQPA 4ENRA 1LQUA 1GZHB 3PEUA 2C57A 4S0ZA 3TGWA 4FE7A 3V80A 4ETWA 3K3PA 4LYGA 4B3TB 2IEYA 1JHYA 2JIQA 3QH4A 4L57A 4Y0VA 4HAWA 3CLSD 4FXPA 2IKSA 1TFRA 5C51B 3FB4A 4B83A 2PD6A 3G2MA 3NORA 3ZY6A 2Q2OA 3P9ZA 2PL1A 1X38A 2Y0CA 4IZHA 1K0UA 3G2QA 4N0QA 5JWOA 4G67A 2CLDX 1Y34E 1N4DA 4KWEA 3OTQA 4NFLA 4RZUA 3TE7A 3WLRA 1T26A 4PZEA 1K5PA 3FIJA 2QUIA 2SECE 1BEUB 4J0EA 3U4GA 4E2WA 1DKRA 3RTDA 2O8NA 4K9OA 3RG8A 3L6CA 5BOSB 5KQRA 4Y7CA 4EG7A 1VE6A <