1NURA

Crystal structure of human cytosolic nmn/namn adenylyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nurA00
2QUJA 1O0CA 4HJXA 3KFLA 3H9CA 1WXGA 1WXHA 4YP7A 3PRHA 2CUZA 1JZSA 1U3DA 1NUSA 4KPUA 2B7LA 3N2YA 4MUEA 1JIIA 3P0IA 1MAWA 1J70A 1GTSA 2X3FA 4MVYA 2WSIA 4DDKA 4G6ZA 1VL2A 2A86A 3CVWA 1JIKA 1QQTA 4UZFA 3MXTA 4ZT6A 2AZXA 4EG5A 3DLAA 1R6TA 4MUKA 2BTEA 2A84A 4MW5A 4CQNA 2C5SA 3A4IA 1OWLA 4EG1A 2CYAA 3IMEA 2R5WA 1T6ZA 1Q15A 1KAQA 1MOPA 4MVXA 4ARIA 3GMIA 1T6XA 3E27A 1M1ZA 2GOYA 5BNZA 3S3TA 4DDMA 1M8FA 1QRUA 3N8HA 2H2AA 3FETA 1NUUA 2Z09A 3FH0A 2DPLA 1WXFA 4MW9A 5H7XA 2PFSA 1IQUA 1OWPA 4EGAA 4ND7A 2D54A 4QREA 3MLAA 1JHDA 2E0IA 3H05A 5EKDA 4OJMX 1JEEA 2IJGX 4MW2A 1D2RA 1KQOA 1HYBA 2O8VA 3CLUD 3COZA 4EG4A 4E1AA 1GN8A 4HPWA 4JXZA 3KT3A 2CV0A 1H3FA 2Z08A 2IP1A 4PBRA 1N2JA 4Q16A 4R2LA 2WQ6A 1O96B 2E89A 3N9IA 1J20A 1VLHA 4MUHA 5DK4A 1MC1A 2OQ2A 4ZCQA 1XJQA 2G36A 5KCMA 1MRZA 4YBRA 1NP7A 1H3NA 4H3SA 3GUZA 2CV2A 2QUKA 1VBNA 3N05A 1H3EA 2X1MA 3Q12A 5JBNA 1WZ2A 2EL7A 4GU5A 4Q93A 4MQ6A 3TQIA 1KQNA 1QU3A 4I6GA 4UZEA 2VXOA 1MB2A 2NZ2A 4MUJA 1O95D 3P0JA 1RQGA 1M8GA 1N75A 1EFVA 4MW7A 4MUGA 2DUMA 1QTQA 1YULA 1LI5A 1PFYA 1DNPA 3H97A 3ND6A 2A1UA 4JFAA 2PZBA 1U7XA 4DNXA 4EFKA 1PFUA 1TYBE 4MLPA 5LLTA 3FNRA 5IHXA 1OWMA 3COVA 1KKUA 4L2IB 3D6VA 1H1TA 1X6VA 2ZUEA 1ULHA 3CA8A 2V0CA 1MAUA 3CLTD 5TS2A 1EFPA 1M8JA 3VRHA 2DETA 4JXXA 3ELBA 1TFUA 3CR8A 3G59A 3MUEA 2VTBB 1KORA 4ZCRA 5LM3A 1NYLA 4MWDA 2QJFA 4ZT5A 3IVGA 3BL5A 4WNYA 1K4MA 3G6KA 3HFJA 4NAHA 3H9BA 1JECA 1WXEA 3FDXA 1WOYA 3ZUGA 1J21A 2A1TR 1R6UA 2DLCX 3CLTC 5K0TA 4MW0A 2QJOA 3UMVA 4U7JA 3FHJA 1GLNA 4DDHA 1JMVA 2O5RA 1J1UA 3K32A 1F9AA 1UFVA 3IUEA 3TNJA 3IMGA 3LE8A 1NUQA 3NBAA 2PG3A 2J4DA 2J5BA 4NX2A 4JYZA 4F3RA 2CFOA 1GZUA 1MB9A 4NAUA 3ZGZA 4MWCA 4XFJA 2J09A 3D6UA 1O94D 4ND6A 3DV2A 4MW6A 1WKBA 4MWBA 3P0HA 2OV4A 2ZP1A 3SZ3A 3IOBA 2PIDA 3VGJA 1F7UA 3CVUA 4CDNA 5TEWA 1XNGA 1OD6A 1O97D 3RBAA 1O94C 1I6MA 1WXIA 1G8FA 1JEDA 3QE4A 4QBTA 4QRDA 2PXHA 1NUTA 1TYDE 5H16A 3A05A 3IVXA 1KH3A 4U63A 4KPUB 1KH2A 2DERA 1G8HA 3L93A 5DASA 3AG6A 3FWKA 4WSOA 1KH1A 3IOCA 3FI0A 4YP6A 1J1ZA 1OBHA 4EG6A 3G5AA 1WQ4A 4R2MA 1O96A 2QUHA 3UY4A 1LW7A 2HMAA 3HZRA 4RUKA 2QUIA 1QRSA 4RPIA 2JA2A 1M83A 5KWVA 3TZLA 1N3LA 1YIAA 3GLVA 1QJCA 1NUPA 3HL4A 3PNBA 3ZJVA 1ILEA 4G5FA 3FY4A 3OP1A 4PBSA 3CLUC 2GM3A 4ZT2A 3CLSD 2CYBA 4MWEA 2D5BA 5KHAA 1I6KA 3HV0A 1JILA 3RHSA 2JAXA 3AIIA 3MMXA 1CT9A 4MAFA 1O6BA 1FFYA 1COZA 2H29A 2DR2A 5TEVA 4ZT7A 3ZJTA 1K4KA 2A1TS 1JGTA 2XRYA 3UOWA 1JZQA 5K0SA 3SYTA 1I6LA 3DPIA 3FG9A 4GRIA 4P2BA 3QTBA 1YUMA 3CLRD 1GPMA 1Q11A 1GTRA 2DXIA 1M8KA 1N78A 5FNZA 4NATA 4MUNA 3HMQA 1KQPA 1O95C 2E21A 4OUDA 4YMIA 5TGTA 3TS1A 3SEQA 3PNVA 2X0KA 1MJHA 3ND7A 3LCJA 1IQRA 3Q4GA 2HGZA 5J59A 1PG2A 3CLRC 1WQ3A 3UC5A 3LOQA 4KR7A 5AHWA 1EXDA 3KT0A 3RK0A 2AKEA 1IFXA 1I2DA 4NZPA 3X1JA 3HGMA 1TEZA 4MW1A 3COYA 2TS1A 4TS1A 2Z3VA 2QTNA 3A2KA 1N2HA 1FYDA 2CV1A 3CVVA 1NI5A 4PBTA 4S1OA 1O5TA 2CYCA 5HUHA 4MW4A 2QJTA 4JZYA 3ILVA 3NBKA 2BYTA 1WY5A 2DEUA 4I6EA 4HJRA 3IOEA 3X1MA 1KP2A 1QU2A 1EFPB 4NDAA 1R6XA 3SZGA 4ZCTA 1F4LA 3TQOA 2ZUFA 2A88A 5J5AA 5J58A 1KR2A 1Q19A 1N2BA 2D13A 1IQ0A 4EG7A 1U7DA 1PFVA 1TYAE 1Y42X 4ZCPA 2CSXA 4MULA 1NURA 4DE5A 4MVCA 2J08A 1N77A 1XNHA 1MBZA 1PFWA 3VU8A 4MUFA 4F4HA 2V0GA 4YP5A 2WQ7A 2I1LA 3IMCA 3JXEA 5IJXA 4K03A 3U1VA 1YUNA 4FZJA 3ZXIA 1KAMA 4MVWA 1N2GA 4G5YA 5LFAA 3CVXA 4AS1A 3IUBA 2PZAA 1O97C 2A7XA 4AQ7A 1VBMA 3FOCA 1K97A 1QRTA 2IELA 1T9GR 1ZH6A 3ISJA 1M8PA 1YIDA 3H99A 1PG0A 3OTWA 3AFHA 3INNA 4ZT3A 3I05A 1WJGA 1QNFA 4R0NA 1NZJA 5FO0A 5HUJA 1ZJWA 1N2OA 1TQ8A 1BS2A 5HG0A 1EUYA 2GKSA 3PXUA 1S4MA 1V8FA 1G59A 2A4MA 2YY5A 4K0RA 1TYCA 1V47A 1LI7A 3KT8A 4XSVA 3A04A 3SEZA 2YXNA 3ZXSA 3CVYA 1N1DA 1P7PA 1EJ2A 4ARCA 1OWOA 1ZH0A 3ZJUA 4J76A 3IH5A 1OWNA 1NSYA 1EE1A 1F7VA 1Q77A 2RE8A 1A8HA 4DLPA 3SDBA 1X8XA 3CLSC 3MLBA 1ZUNA 4CDMA 4L2IA 3RK1A 4X0EA 1IRXA 1EUQA 2CT8A 1O0BA 1IVSA 3P52A 2VTBA 4XFDA 5DB4A 3RFFA 4EG8A 1SURA 3TZEA 2QTRA 1VBKA 3M5WA 4CT0A 1U3CA 2EJCA 2RD2A 3X1KA 3AG5A 4EF6A 3COWA 2YWCA 3L92A 2WB2A 1KP3A 2HZ7A 4EG3A 4HK4A 3AKZA 5FO1A 1XNJA 5DEOA 2NSYA 4ZT4A 3K9WA 4I6JA 3FIUA 3IDFA 4U8HA 3ND5A 1K92A 4KKVA 1EFVB 1OBCA 1N2IA 4BWVA 4KR6A 4MUIA 3ZIUA 3Q10A 1GAXA 4J75A 1B6TA 2A1UB 1G8GA 1U0BB 2YWBA 4A91A 1IH8A 1J09A 3IODA 2XRZA 3NV7A 3IVCA 1N2EA 3AL0C 3DO8A 2J07A 4DJAA 4OUDB 1YI8A 2AG6A 5F23A 2JANA 3F3MA 1IHOA 3SP1A 2X1LA 4PY2A 1JIJA 4KR9A 2PZ8A 3RJZA 1T6YA 4ZCSA 1T9GS 2QTMA 3KT6A 3C8ZA 3UK2A 3QTTA 3PNYA 2E18A
chains in the Genus database with same CATH superfamily
1R27A 4L08A 2RKBA 1PWZA 3L1IA 1BRTA 2Q7OE 1X80A 4H7IA 4RM2A 1M6WA 1PGQA 2CD9A 4HAWA 1E6MA 1DELA 3LM8A 3W2FA 4YJHA 1DC7A 1EFKA 4G67A 1ORIA 1V37A 2QHXA 3PHBE 1YOVA 3P0IA 1J70A 2O3SA 4S04A 1IVYA 2QN9A 1CC1S 2OKCA 3DV9A 4E88A 2C5LA 3GLTA 5FA8A 1QGUB 4XVRA 4P92A 2PR7A 3SC6A 1R0YA 4WZBA 4PN3A 4NBSA 3OQNA 2W4QA 3LWBA 1CVRA 4ZO4A 2OPBA 2D1TA 4D80A 2EDAA 2R1VA 3ZH2A 1E2QA 2JBWA 1X7WA 2J30A 3D5TA 3SKXA 2APJA 1BTOA 2IQ5A 2HLDD 1FDIA 4P3OA 3R75A 3W34A 1PX2A 1H1LB 2G1UA 1T6ZA 1VPEA 2RDMA 3K6RA 3RBVA 4BX9A 2OXFA 3I2KA 4WXHA 2AQHA 3V1UA 4AQDA 2FRDC 4IHJB 3BILA 4NBNA 4RH3A 4KMMA 3RAPR 5A9TA 5CFRA 3K2IA 4MW9A 1UMDA 1U94A 4ZVOA 1OWPA 4B80A 3ZIDA 3CEMA 1T4DA 1MJFA 5FJJA 5AJZA 5JPCA 3Q9LA 2BFAA 2FWMX 4IZIA 1BQ3A 4MUBA 4BFSA 2WVJA 1M2GA 1OILA 1E6EA 4IXDA 2IX9A 1JRLA 5DGIA 1LXCA 1UFOA 2X5XA 2NXEA 4BJHB 4M46A 1CQWA 1UT6A 2Y2UA 2O8VA 4H7KA 4MRPA 4GUDA 4EHJA 1GILA 3TI7A 2PT6A 4PHCA 2NVUB 4YT4A 1VG8A 1PW7A 3IEVA 4FDTA 3TW8A 1HX7A 1CD5A 2AXQA 1AZTA 1G3MA 3EW9A 5FR1A 1MCZA 4X3CA 2VWHA 1IXYA 3MN1A 1VJRA 2X9LA 1ZKMA 4BJ6A 1CFZA 1VLHA 2FZWA 1ESNA 2BWJA 3DWFA 4ENWA 4UFNA 1T9AA 2B3TA 2LGJA 2RB4A 2ZETA 2VDJA 1GRQA 4P98A 5BV8A 4CT4B 3K7EA 1E4VA 1SKQA 2FVXA 3O1HB 3WDLA 5I9NA 5AW6A 1DAMA 3KKZA 4E4RA 4FNMA 4EMSA 2XUZA 1BA3A 2H4FA 5EQFA 1CIVA 2VI5A 2HXGA 4M1ZA 3LUKA 3PC7A 4A2WA 1AV7A 4B76A 1G2QA 2YOGA 3EVZA 3O84A 4PN7A 5LLDA 1N3IA 3MAJA 5J9FA 3DBLA 1N9KA 3P9NA 1SUBA 3TEFA 5G0UA 1WBBA 1TLTA 3UPDA 2GXUA 2WB4A 1U7UA 3AR6A 4NYIQ 3VR6A 1I5RA 1M2HA 4OG2A 1K7EB 4Z0HO 3KKQA 3A7DA 2HNKA 3BJZA 1N3YA 4RJIA 3VU3A 5DNYB 2FPXA 4FOLA 5JDIA 3L06A 2RMKA 5IULC 2QJWA 5TIIA 5TQ2B 4K5QA 2X8JA 5AHRA 4ZQFA 5GPBA 4PQEA 4COOA 5EE9A 3HKEA 2MSNA 1C1DB 2GPWA 1M1YB 2GMWA 2R4UA 2P6OA 2RGXA 1NBME 3G0DA 4TWZA 5FPKA 5INTA 2CXHA 3D6VA 1C2TA 3K0BA 2O8BA 1SQSA 1GADO 1NXPA 2JB9A 5ALIA 4BTVA 4IQFA 3CEPB 4BVFA 1SCJA 5KOHA 1M8JA 1G0OA 1K8QA 2AEJA 3CR8A 1N0HA 3ANSA 4MV7A 3ZV5A 2QR3A 3DAOA 4HVCA 3WRYC 1Z4PX 1EK6A 3D0RA 3ZY4A 1E7YA 3A1DA 2H16A 3G7NA 2YDXA 3IVGA 5DPMA 1E2JA 3RREA 2X6RA 4D4HA 3AB3A 4CQLA 2UUCB 1CUJA 4KXQA 3TQHA 2XKJE 1CJUC 3EH1A 3DDSA 5JS1A 3MA0A 2O8NA 4U3JB 5KJ6A 4TMXA 1ZD3A 3D6NB 4BX2A 1P1RA 1GLNA 3HCAA 2J48A 3EPPA 4TM7A 1WL8A 4HUJA 3IP3A 2ZS7A 1E89A 1PYDA 3K20A 4US0R 5A9SA 5KSWB 5BRNA 1G291 1N1GA 2HREA 4H7DA 3LE8A 1IC6A 4EBFA 5A2QA 2BGGA 4FZVA 1JI3A 1ADGA 1GG9A 3NBMA 4AKSA 4CE6A 13PKA 2AI3A 4TGLA 3ET4A 4LE0A 1R16A 4G26A 1GVNB 3FVVA 1DV1A 3CLHA 3E5HA 3KKOA 4ZEVA 5A5VA 3ZDBA 4YFYA 1FP7A 2H31A 5ALGA 3UEOA 4UULA 2JIQA 2Q5IA 3EWSA 3DV2A 1Y5NA 1KS2A 2HDHA 2JRLA 4EO7A 4MA0A 2IEDA 3U4DA 5DNVA 4ER0A 2FFJA 4ZANA 5KCZA 1GAQA 4MWBA 2AKAB 1BO6A 3NEAA 3PHLA 3T35A 4GZLA 5BSFA 2E5LB 5AYVA 2CJPA 4BMYA 2RK3A 5JAMA 3MRSA 3OKFA 4Q7KA 1IHXA 2FYTA 5AH0A 5D7BA 3TZKA 4A10A 4E1VA 3KDAA 4HEQA 3UG7A 2GUGA 1NHGA 3EIXA 4DMUB 5I4IA 1XZLA 1ZHFA 3IPAA 2HU7A 1QIKA 2FF5A 1D0SA 4FDAA 2PX4A 3PQFA 2Y27A 4MRSA 4YRBA 3RWBA 3V4ZA 5BRJA 4WXYB 3F5DA 4CM7A 1S2NA 4GOXA 4D4LA 4DIUA 1WEKA 1KH3A 1F4PA 3OA0A 3N28A 3LFHA 4ISBA 2OWDA 1KBZA 3AHIA 1SCIA 4OATA 3WQQA 4WJLA 4AN0A 2CJWA 4WY8A 4EHDA 3LQFA 4HAZA 1H22A 4RM3A 3ZNQA 4PINA 4WMLA 2GYWA 4EPWA 1YQTA 1TKCA 4GBED 1QK4A 4PAQA 3PP8A 3VZBA 1FX0A 1KEWA 1LLDA 3GFOA 1KI3A 3W2EA 1A4UA 3CG4A 1KYYA 3G5AA 1WQ4A 3Q85A 2R7LA 4LDPA 5HRAA 2FN3A 1DDIA 4FFSA 2PWBA 3WIOA 3CR7A 3GJ6A 1G19A 5L3SB 1IN4A 1CDDA 4DLXA 2WA1A 4LKRA 5BYBA 1A88A 1Y8RB 4Q4AB 2R3SA 5CX1A 5FX2A 5GV8A 1DCMA 3LKZA 3FDZA 4YJGA 4YLGA 3ZE1B 3CHYA 3DZBA 2J5XA 2Q6TA 4TWJA 2QTWB 2HR1A 1M1UA 4LDQA 1JUDA 5J4KA 1QJCA 5AXAA 4EHBA 1JX6A 3AI3A 2ZIWB 1TJNA 1JU4A 1UBCA 1LY1A 4NPCA 3SY8A 5F7JA 4PLZA 3ER9A 2GCEA 4QT4A 1C8KA 4WFJA 1YZFA 5JARA 3EUWA 2O3UA 4QBIA 1XCJA 1XVVA 1BXGA 3G2PA 2LE0A 4BKUA 3TIFA 3BHJA 1PIWA 4F4UA 1C1YA 1P80A 4RVOA 5CR9A 1S01A 3DBHB 5JRJA 2FB9A 3H5AA 4IO1A 4EGFA 2OD9A 3KXIA 4I1SA 3JATA 3ASUA 2WWVD 5TT0A 2VS1A 3QEOA 1K8XB 3CE9A 1XJ5A 5BQPA 3BZUA 5IM4A 1T24A 4R8KA 5KQLA 4DLSA 2FHPA 2O2HA 3OJCA 1THZA 5G1NA 4BMDA 1CQXA 1R9MA 1ZUNB 3SFVA 5CDYA 5AMXA 1PF7E 4I4TA 3FCXA 1U5BB 3QW4B 3M1AA 4BXOA 3U4QB 4BJ3A 3GP3A 4HLDA 2AJLI 3GLHE 2F9LA 1XZPA 2YIMA 2XW6A 2FEXA 1EWRA 3LGSA 3GNSA 4D43A 5ALVA 3F6YA 4K8OA 2PK3A 4V2IA 2OO7A 1NI4B 5C1OA 4OHVA 1EXDA 3RS2A 4JU8A 2HMYB 2B99A 3TLKA 4P32A 1O5OA 3I3SR 3O1IC 2WU3A 1WZCA 5DYWA 4B17A 3E3NA 3OIGA 4KDCA 3IDAA 4YAKA 1K6EA 5LZ9A 1FYWA 2C54A 1KC1A 4F93B 1R5BA 4LOAA 1QNLA 4E5NA 1T8SA 1AT1A 3N8NA 1X74A 1C3OB 2DHQA 2IH5A 1QKIA 1QS0A 1EZ4A 2EEZA 2HLNA 4FR5A 3ZCRA 2ORED 1GGJA 1QGUA 1PI3A 4JYCA 3AXTA 4R7GA 3B85A 3M81A 4FFLA 1JJVA 3I5UA 2JAQA 1UAYA 4AY6A 4ALLA 3IAS6 1MO2A 3RAGA 4ZKDA 1VC2A 4OVKA 4QSHA 5U1PA 1C9DB 3GPCA 1ZNZA 1S5PA 4HJRA 2G1JA 5JE8A 1S4QA 1NMYA 1GUYA 1LS6A 1P17A 1OTHA 2GD0A 1QFZA 1XEWX 4YVFA 3GGDA 3ROEA 3SYRA 1H1LA 3HCWA 3C3XA 4NBVA 3LH5A 1KJWA 4QOIA 4HLQB 4ONEA 1CJBA 3HB5X 2TMGA 3LWNA 2QTCA 4BZXA 4F2HA 2OY0A 3IE1A 1I7QB 2H11A 2A5JA 1U7DA 1I3OA 2GRAA 3E4CA 4OXRA 4ER3A 1QIFA 5IJ0A 3G2NA 1NURA 1U8ZA 3LCCA 5C3UA 1GCIA 2G3YA 5EE5B 4BC1A 1E4YA 1HLPA 5G41A 1N77A 1XF1A 4H4DA 1E9EA 4FEEA 4UAJA 4N5NA 3K8QA 3RVKA 4M9RA 1HSZA 2F43A 1PDVA 3P9KA 4GC5A 2ZOSA 4G3XA 3CLKA 1GA1A 2GB4A 2IV7A 3FNEA 4ALKA 5LWHA 4HLNA 2P0AA 1O08A 3TD6A 5LFAA 1EDOA 3F6EX 3ZWNA 2I2BA 3BICA 5FBQB 4Z49A 3FPAA 1C50A 1JXOA 3QJ5A 1LRJA 1DAPA 3RC1A 3E9ZA 2HBRA 1T9GR 3R0QA 1S9DA 1VA4A 2PQ2A 3ORYA 1M8PA 4YP9A 1PT9A 3OEWA 3QFHA 5KYYB 5GV7A 2P9JA 3AFHA 1CU1A 4E70A 2EJUA 3K94A 4M0KA 4R0NA 1W29A 4JROA 3GYGA 1ZJWA 2QM8A 1EIWA 3CN9A 4F21A 2VUIB 1Q20A 3GMDA 4O1HA 1HORA 4P4SA 5DBEX 4YMUA 3QVJA 1RRVA 1LLCA 2C4KA 5IEBA 1PJZA 5JXWA 3GLIB 5HVNA 1YVPA 3H2SA 3NS7A 3N0WA 4KXUA 3W5JA 1AZLA 1FFEA 1TXGA 2AOTA 2R7MA 1TTHA 2WUGA 3MCTA 2XWJI 3MTDA 2JFUA 4B6PA 1XHEA 4IUCS 4XSVA 1ZM4A 2VSNA 3FVTA 3PXBA 4H1HA 1A5AB 3ZWKA 5I7WA 5KOYA 3RAEC 4B3SB 2AI2A 1BFKA 3U48A 3HJGA 3DVSX 2NQ8A 4URWR 4HNVA 3THSA 3AW8A 3RF7A 4KPYA 4KW7A 2YXNA 4BO5A 1Q3HA 1V39A 2ID7A 2EWMA 4KFSA 1YZUA 3AY6A 1N2XA 5IFKA 4WESA 3BHMA 5C7YA 1W88B 1KO7A 2IPXA 4H3HB 5C81A 5CX4A 2PGJA 1TO1E 1A27A 5CFNA 4DBLC 2OTCA 2PYIA 1U0GA 4MIOA 2DBQA 1C1DA 1M67A 1LVHA 1S2MA 4J0IA 5FD8A 3U4CA 2YBDA 2CXNA 3NOQA 2ZJ8A 4NYMQ 4ZO9A 3H3JA 2P4HX 2RIPA 4O02B 1EUQA 2W2LD 2BMEA 1P1FA 3UHPA 3BL8A 1ZJ6A 3HVUA 1NX9A 1XHFA 4GI1A 4O4IA 4HVTA 1VSBA 1OBVA 1MAVA 2QG9A 3HBAA 5KYVA 5E4JA 4NULA 3LA8A 2RHMA 3O7MA 3VR5D 5KTPA 3V4RA 1USUA 5D00A 3DMFA 1T9BA 4QTTB 3FWNA 4OI0A 2AFVA 5D86A 1GITA 3A2NA 3QLEA 3V7UA 1PVVA 2ZM5A 4RA6B 1TTTA 4LXTA 2INGX 3ZWPA 3I9LA 5JXGA 4ZOLB 1DAEA 1M5TA 1U5AA 1SC1A 2ZBRA 3E2PA 1UOEA 4N0DA 1V48A 5F35A 2FR8C 5JU6A 1PWYE 2F3RA 2NNWB 1XDUA 1D8AA 1Z34A 2XQVA 2ZSIA 3VJMA 4BFXA 1CQIB 4J6FA 4YDQA 1XZEA 2PUAA 5G1OA 4Y2XA 4KR6A 4QRIA 3RHTA 3GAZA 2GVNA 4PZUA 3SM3A 1N7GA 4IV8A 3GPLA 2BGWA 1VMDA 3UAYA 1Y7IA 4CMCA 2PSSA 3D2LA 3GA7A 1BDJA 1IY2A 1GU0A 1T4BA 2IY7A 1T6BY 4F3YA 3AL0C 4GLOA 4PYJA 4BVEA 4WZAA 1C0IA 4PXYA 5EUCA 3UTCA 1HKUA 4NECA 2Q1TA 1OFGA 2A4KA 2NPIA 5IEJA 1OYOA 4DJEC 2UYHA 4DCOA 5KDLA 4RTRA 1UXJA 3NT5A 3ZGLA 1G63A 4ZCSA 4D97A 2SCUA 2WJ4A 2Q8NA 4DV4B 1E0KA 1J2UA 3JQ6A 2QTGA 1KSJA 2ZI7A 5FLKA 5G3YA 2JPDA 1LDNA 4ETIA 3RARA 1PR4A 3G9ZA 3QU2A 1PCXA 2QBYB 3GJQA 5ICCA 2ZRGA 2GETA 2YWDA 3N2YA 2JA1A 3L77A 4NCAA 1OKKD 1GG5A 3TVTA 3FTNA 4MJXA 1KI2A 3QYFA 4CM8B 5B3KA 1PT6A 4P0PB 4QASA 2QAJA 3PPYA 2OO3A 5DW0A 5M34A 3URKA 4N12A 4RTNA 2QVLA 1QQTA 2OQIA 1CUCA 4O08A 4UZFA 2FOIA 1UUFA 5JJKA 1H8ED 4ODIA 4LS3A 5C32A 3QU7A 3GRZA 1IN8A 3KB2A 1P0MA 1WPGA 2GHQA 1JU9A 4JCOA 4LE2A 4LZNA 1JG4A 4M21A 4CLDA 1G98A 1OXSC 4EL0A 4EG1A 4FYKA 3O8NA 1U3TA 3N7UA 2PA3A 2ZWPA 2V8OA 1MOPA 2IHTA 2V7QA 2ZRCA 4H59A 4XDZA 5DLQC 4YHHB 3QWAA 5F73A 3BGSA 1V2HE 1YQQA 4OLJA 3UH1A 4ZA2A 1CUAA 2QX7A 1SC4A 3GG9A 4MRRA 4DSUA 1JALA 3D54D 4FT2A 4ZV7A 4BMSA 5A3QA 3IE0A 1G2IA 2FGKA 4JWKA 5EPEA 3N2GA 3BDAA 5IUJC 4DUZB 2R47A 4FYPA 3L1KA 1WF6A 4M0EA 4YWHA 3SQXA 2WLSA 3FGPA 2ZTUA 3QPDA 4QREA 5AM4A 2Q50A 6Q21A 2AD1A 3KZ1E 3THRA 5BV0A 1C7FA 1YCDA 4ESEA 3KEFA 3R3HA 1SM4A 2W6OA 2YFYA 3P20A 5EXPA 1E99A 3CTMA 1X0XA 2GZ2A 3Q88A 2JLYA 1U8FO 3OEHD 4JI2B 3OX3A 2X8BA 3ZGXA 1QGDA 5I7UA 4MDYA 1AQJA 1PQWA 3I04A 4KGVA 4XSHA 1G8PA 2CMDA 1ZIDA 3EVCA 4YLYA 1EHYA 4E09A 3UBTA 3OE7A 3V3TA 4QTYA 1KEKA 1MZVA 4AW9A 2HLHA 4GNRA 5J4YA 4N49A 2Q99A 3NHSA 1HT3A 2ENUA 1WE2A 2A5FA 3DBRB 4QOJA 3FUUA 2C4WA 1FP2A 2OA0A 1U2TA 2UZ1A 4ZEWA 2YXDA 1KPHA 5BNFA 1VP3A 3E1SA 4FFRA 1NRJB 4L7VA 3N05A 1VE3A 1KNQA 1NI4A 2EBUA 3R7LA 5AI0A 3TYXA 3CZCA 3ZWVA 1NVMB 3C7AA 1VMKA 1RYYA 4OKSA 2NZ2A 4X54A 1FVOA 1UDWA 2CL7X 2EAUA 2X19A 1V5GA 2BJHA 2H2GA 4GX0A 3MINA 3SHTA 1L4FA 1N75A 4DCSA 3OFNA 3TRKA 3AFIA 4KQ9A 1N7IA 5DTIA 1DNPA 1JDSA 1NFFA 4ZV9A 3RH0A 3VX4A 1SXIA 3ZE6A 2WNSA 2P5TB 1JIUA 1ZM3A 2I7TA 3AHCA 3CMMA 4FZ3A 2YQ5A 5DRTA 3TRIA 1XMVA 1QG4A 4GM0A 4AZWA 3AYZB 1SXJA 5EKTA 3BD7A 1DOAA 3FOFC 3EHEA 1PTKA 3RD5A 3O8RA 3FFAA 1KYQA 4HAYA 4X5OA 4AURA 4RD1A 4P7KA 4BGEA 4L2IB 2CZCA 4R16A 5WRFA 4MTCA 4ZYZA 1QHSA 2FDXA 2V0CA 4QULA 2F7SA 4X20A 4OSEA 1ID8A 2QRGA 3EQ7A 5DHRA 1XZFA 2Q9BA 2JVIA 3SQWA 2D5LA 1XTVA 2J0QA 3BL5A 5I7OA 3HKCA 5B7NA 2ID8A 3FR7A 3JZFA 4N40A 3JRNA 3IHTA 1M73E 4JI3B 1V8BA 4F9TA 1OOEA 3RC9A 4ILEA 3TCXB 4C1BA 2IF2A 2B1JA 4XEHA 4BUJA 4DM3A 3AR9A 3JD0A 1KY5A 1Y9JA 1CSEE 5C8YA 4KAXA 1YS2X 2XUIA 1NN0A 1RKQA 4UUPA 1PR2A 3BQ9A 2Z1NA 1FC0A 1RLIA 3C5VA 3ETDA 2C3YA 4PC7A 3H9QA 1HYGA 1YZGA 1P9LA 3IT1A 5B57C 3WSWA 4JBNA 3FMGA 3ZDDA 1VJ1A 2NQTA 3NT4A 4FN4A 3V7NA 3KJEA 1DAKA 2VJDA 4WOKA 1NJSA 4FBMA 3QHQA 5ISMA 1MABB 4Q7EA 5EAIA 5JEEA 4ND6A 2VZEA 1YRWA 5DV9A 4IIUA 5LMCA 1S3GA 2GJ4A 1J06A 3LW7A 1YO6A 1VP9A 1PDWA 1YAHA 3E7WA 3CS3A 2DB3A 3N74A 4NIMA 2DWCA 4WAUA 3F2IA 2XSZD 4RLQA 5KYYA 3HK2A 1S1MA 4ARAA 1VKNA 2P2CA 4C0KA 4YUYA 4K9RA 5F1OA 4RK6A 4OHOA 4D79A 4NMWA 1CJTC 1GTZA 4IFIA 4YGYA 4COKA 4LOJA 1O97D 2NUPA 2ZSEA 4XX1A 1BKSB 4A2QA 3U7FB 3DZKA 3IIMA 5A5FA 2AYYA 3TTXA 3GLIA 1JDJA 1Y4SA 1XYGA 5ICSA 1RFGE 2ZPAA 3OZFA 2ORIA 3GFGA 1IDOA 3TW6A 4XVQA 7AT1A 2GNAA 2IEZA 2B94A 4XM1A 1UOPA 3NORA 2B5VA 2GZHA 3ABSB 1TU3A 2ZWVA 3QMPA 1MGPA 3R4CA 5ALKA 3S2IA 1TF5A 3PGA1 4U8GA 2OYCA 1KO8A 2P9QA 3CPSA 3IPXA 4B2IA 5JBQA 3FWKA 1ZK2A 3PUJA 1ECGA 1YE8A 2PGOA 1RYBA 4PAOA 2P6RA 3RS9A 4UTXA 4BBZA 4BO1A 3FPEA 1RLOA 3WJ1A 3L6UA 2VNJA 4IIFA 4MWGA 1GT91 1CYEA 3BWBA 3NIDB 4GBMA 1FSGA 2J3MA 1KGDA 4AUNA 5AVXA 3A36A 1M6EX 2HT6A 1E7SA 3O83A 2W6MA 3ED1A 4LC1A 5KWVA 4WLVA 2PQ6A 3TZLA 5B37A 1AK9A 1T4CB 2XX3A 5BV7A 2AZ4A 2RH5A 2R8BA 2ZJ3A 4LHZA 5DWDA 3PHCA 4EA8A 4CKWB 1U1IA 4DCTA 1ILEA 1MTZA 1GPUA 1LSJA 2NTVA 3NBQA 4YV7A 4BO8A 5DCWA 4K9DA 2J5QA 4N54A 1UAAA 4UHDA 2C8VA 4TRRA 3QE2A 1UBNA 2G28A 4DA6A 2ODPA 5BSTA 2GKOA 3T1OA 3GOHA 4DARA 3ZWQA 4YRIA 5KHAA 2BF7A 1VPLA 4BN4A 4CBVA 1TK9A 4F1WA 1S8FA 3QKUA 5J1SB 4OAQA 3L7LA 3RHSA 1JW9B 4Q12A 4Y9UA 3AR8A 4U0KA 5JSFA 4PF1A 1JBKA 3PT5A 3NUZA 2PMKA 4M36A 4MAFA 2G17A 3CXRA 1H6AA 5ADHA 5ED4A 1ZR2A 4IDNA 3H8WA 1CQIA 2V8BA 3PS9A 4XPIA 2I3DA 1K9SA 2AX4A 1GGMA 1UEJA 4RKYA 2AE2A 3ELDA 3QPUA 1NBMD 4L1KA 2CE7A 5HFNA 4D0RA 4G1EB 4CQMD 1FLAA 3SYTA 3GP8A 2O8CA 8GPBA 2X8WA 4LZJA 4R1PA 1GTRA 4E7OA 1Z7WA 1VBFA 2C78A 4L7QA 4Q6WA 5G02A 3T7CA 1WSBA 2HRZA 2VCHA 3QLVC 4HZIA 4AZ3B 2BMWA 4CEHB 1ZRSA 5DNUA 4BZZA 3Q7EA 2CSUA 4LV5B 4V0RA 2Y67A 1ECCA 2PUHA 1IHDA 5A71A 5TSDA 3NEYA 4POOA 4CMIB 3ETNA 4RJLA 5LB2A 1SUCA 3MJSA 3ZS9A 4F4JA 4RF5A 4WOCA 2C9DA 2ZSKA 1BKDR 3EEBA 3IULA 2O4CA 1IMOA 2YTZA 2XTJA 4UPEA 1O89A 3PQ2A 1HGXA 2VDQB 2WKWA 2FPUA 4NCKA 3U7QB 1ZESA 2HHJA 1C30B 2P77A 1VCMA 1E62A 3FMVA 3IO5A 1X7YA 1M0TA 1B2LA 2ZDHA 3CPJB 1FP1D 3MWYW 1A82A 3OE4A 4JT4A 4KL8S 3W4IA 2VZ8A 3SBOA 3DL0A 3KQWA 1Q1NA 1SCDA 4TS1A 4XQGA 4UU1A 4QXQA 1KRWA 1E4EB 2NYVA 2JLUA 4CEIB 1ZCBA 2LRHA 5LVAA 3GRPA 5AOAA 5HMMA 3HVRA 4FOPA 1QVRA 4NOJA 1UADA 5CLHA 2GK4A 4H0CA 4EHAA 1GRNA 1TZJA 1D4AA 3SZRA 3CRW1 1D2GA 1P4GA 1YZLA 2WF9A 4L9RA 4J4HA 1I5EA 1Y5RA 4LYGA 4UVHA 4W9RA 5IKMA 4L4XA 4NHOA 5DSZA 3WGGA 4LNHA 2W4IA 4NYJR 1TM5E 1YWGO 3MS2A 1BXRB 1TQ2A 4D6YA 1IZYA 1S8NA 2H4ZA 5JSYA 2QSUA 4QO7A 4BNMA 2O0LA 1PJ3A 4GX5A 4UPDA 4QDXA 3W5SA 1CQJB 4EFMA 3L7BA 4IDCA 1M7HA 3GPDG 4KU4A 3TRFA 4KVZA 1D1QA 2ODNA 3PXGA 2BFBB 4TSKA 2HA6A 5FB3A 2YJ5A 4JGBA 1Z22A 3UATA 2KPOA 3KAJA 4CKBB 4CR8A 2VBIA 4ZOBA 4C7VA 5IC6A 5F4BA 5LWQA 1YHNA 2CNKA 1KQ3A 2CVHA 3AIOA 5ESRA 5ARCA 3SOPA 2FN4A 4GKJB 1J23A 4MUFA 5FQOA 3L4EA 3I92A 4ID3A 4UW9A 1W49A 3OIUA 3H4IA 3IP5A 3QLUA 3EY4A 1HT0A 2Z3ZA 1M2OB 4DR7B 1XT6A 1E6CA 2R68A 1T2DA 4BAZA 3UB4A 4XIFA 5BW5A 3DKIA 2I2WA 3HCPA 4C7JA 4X1KA 4JC5A 4BO7A 1TB4A 4B6QA 2G80A 2WWYA 2HOQA 1EYZA 3CW8X 2GPSA 2HMVA 1PVOA 2I6UA 1U6JA 2IU4A 3CZAA 3NDJA 3OOJA 4QPJC 1YFJA 1PEAA 4X6XA 2GZSA 3WMEA 2OB1A 1JEQB 4I81A 3R5SA 1XMPA 5A1JA 3ONFA 3H6GA 3AEUB 3DTVB 5U9CA 1XL0A 4QWMA 5KU1A 2PD3A 4G5GA 2GPNA 4NJMB 4BATA 1TVEA 4DV5B 5KVVA 3V42A 2RJNA 4BVAA 2QN3A 2XCTB 3EA0A 1GSAA 2JFNA 1DIHA 3UA3A 1NXVA 2ZT8A 1SQ0A 1UJ6A 3KSRA 3NHPA 5CT6A 4BB5A 5CDFE 2AB0A 3CY6A 1MFZA 4H6WA 4KOAA 4IIYA 1SUDA 3L6OO 4P22A 8ATCA 4IGFA 1I4WA 2X14A 3VU9B 2FPLA 2Q2WA 2X9QA 5EFOA 1Z25A 1A9OA 1CP2A 1MB0A 1RIIA 3A04A 2W00A 2EQAA 3SEZA 1KDZA 3O8CA 1AUVA 5GJVC 1WABA 3V80A 4C06A 5LNK1 1N1DA 1XTZA 3ZK8A 1V5WA 2DT8A 3S4YA 5DCLA 2IXGA 4M1EA 3FFWA 3I12A 1LQUA 1OWNA 2HO5A 5JW6A 2QZZA 2E4AA 1GD1O 2PM8A 2WDZA 1CS4C 1X8XA 2ET6A 1K5GA 1YR6A 2H57A 2QRZA 3AGQA 3DAPA 5AVZA 2WG1A 1Y37A 3EXIA 4RELA 4L2IA 1HETA 3REFA 1I4LD 1RT9A 1IZ8A 1U99A 5LP6C 4CGYA 1Q83A 3PFHA 3GFPA 3GEMA 3NXKA 1KO1A 1P61B 3C6ZA 1SXQA 4ARZB 1E1LA 1G41A 4LCEA 1V35A 3BSSA 3CEHA 3I09A 4H6XA 5G2OA 3ZCQA 1Z4NA 2EJVA 1DFIA 4HQLA 2CNWA 3D6FA 5JS2A 1AA6A 4M98A 5K8JB 2XB2A 3WAKA 1G4HA 1E58A 2EJCA 4HUQB 2OO5C 3TR6A 3X1KA 2FDCA 1LF5A 2QE6A 5IVKA 1GZ5A 4DSTA 2X0DA 4URUR 4BNYA 4INJA 2H6EA 4LXXA 4JLDA 2HUNA 1MLDA 1IJBA 3TKLA 5HTOA 3FLEA 1PGNA 4JOQA 1H9CA 4KWHA 3OOHA 1CX9B 3LBAA 2O14A 3H6HA 4I08A 4BKQA 2AOVA 2WTUA 4BLTA 1H4VB 3WLRA 2YZKA 4BNGA 2IYPA 1K27A 2VP5A 3L7YA 4XW2A 4DMCA 3GA0A 1W48A 3WFIA 1Q0QA 1IM5A 2HZBA 4MUIA 3TF5A 3ZE8A 3MXOA 1PZNA 2KWIA 2ESRA 2OV6A 1LQTA 3P0EA 5BOVA 3K9NA 1B14A 1B8PA 1TIPA 2QMYA 4GSKA 5JPIA 2UZ4A 1T5IA 1OZHA 3HVHA 2HQBA 3DVRX 1A7UA 1HFWA 2Z56A 4IX9A 1UBOS 4V0ME 3WGLA 1F4VA 2Q3BA 1BDMA 2N1MA 2QX6A 4MV3A 5CEFA 1S3IA 1XXHE 2ZB8A 3SP1A 4CCAA 4ND1A 3PQDA 4QNRA 3THWB 2CZGA 4KHZA 4WCVA 3K0HA 3WDKA 2JLZA 4KYIB 4F12A 1FZTA 1DI0A 2RAVA 1T9GS 4DMKA 1P2FA 3CEJA 1CEQA 3QTTA 3STHA 5LMNB 3CW9A 5HK9A 2QUJA 5F9MA 3IBGA 2XT0A 4Z4EA 4Q1FA 3JYNA 1R50A 3GRKA 3LQQA 4RXUA 1NOIA 4EB8A 3WL3A 3GJYA 3AFMA 4RLFA 5EP1A 1AX9A 5BR1A 3H04A 4JJEA 1ZN7A 2ZUBA 3G13A 1VHJA 2BEVA 3H1EA 3K0KA 2EX0A 4X93A 4PXAA 4ABTA 1MO4A 3DMHA 5DWQA 3RTBA 5L6LB 1HBJA 2GR9A 3QKSB 2IS4A 4RESA 5BUSA 1SKYE 2OB2A 4A16A 3VR4D 3K9FC 5IVPA 3OD1A 1USVA 4I5IA 4OIFA 4PNZA 4R5MA 4X9XA 4DXDA 5LUAA 1P1JA 2R6CA 4MUKA 3E8XA 3WK4A 1E1YA 1I7PA 1KI4A 4H6VA 2WWGA 2DWUA 1DIOB 4DCMA 4LXQA 1D2MA 2I9PA 1MHPA 2NO6A 1W59A 4MW5A 3AIMA 2YS6A 3GU3A 2VWGA 5ALYA 4Q21A 1JHZA 3TD9A 3T8YA 2RG1A 1NQUA 2R5WA 1W8IA 4ME6A 1NLYA 3CJRA 3FGZA 3LBHA 3RVJA 3P26A 1T4CA 2PFGA 3KUUA 4Q4CA 1GRCA 4BFVA 3E27A 1QP8A 4CKWA 1B6GA 1U2DA 4ZTUB 1G7TA 5GINE 3N70A 2V5VA 3OZRA 3QV1A 4RYDA 5DI3B 4BCCA 5CLLA 1C3LA 2HLPA 1XTPA 1BZYA 4UD2A 4G56A 1NXWA 4K1LA 4UU0A 4D3FA 1VB3A 3RFCA 4EGAA 3P2IA 1TDJA 2ZB4A 4IQ8A 1Y33E 1ZPDA 4F96A 4G4IA 1P31A 4GP9A 1MOQA 1VGVA 1YH3A 4L16A 5FPQA 1KFJB 4Y1FA 3OPYI 4WZZA 5JI3E 2OESA 4JHXA 3W6NA 3LUFA 5KNCH 2A35A 1PJLA 1NMSA 3G1UA 1HDZA 1WMBA 4I55B 1U7OA 4WKBA 2UXBB 3SPXA 4MB2A 1IL0A 2FWBA 4A6EA 5BP7A 5EQJB 5HFAA 1W52X 4CUKA 1GN8A 3BEDA 3KT3A 1MGOA 1FLNA 2QEQA 1NVTA 3OF3A 3W90A 4BNDA 1V16B 2JASA 2PZJA 3C14C 1CR0A 3NBZC 3SYKA 3FR8A 6ADHA 5AI8A 3AF2A 1Y8ZA 1YBAA 3B5JA 4R5HA 4TMFA 4CEHA 1J8QA 2F55A 2VQ3A 4QBHA 3UMBA 3HLKA 3HRHA 1UC5B 4RF3A 1XZQA 4BN5A 1P9NA 4YBRA 4CHTA 1XDWA 3PDIB 5E7QA 4CMIA 5FWXA 4UOEA 4YR7A 1UBLS 4M9SA 3A10A 4IWXA 2GM9A 3BERA 1V7PC 4B74A 1RWNA 2NOAA 3LFUA 4EYQA 1QWOA 3FPBA 3UYLA 1B16A 3LP6A 3GEIA 4D9EA 3ASYA 1OASA 2BI8A 4DIEA 5JDIC 5K5EA 3U7QA 5LQMA 1C30A 3JQGB 2I4RA 4W9NC 5ADVA 4M1MA 4U7TB 2B3DA 5SY4A 3K6JA 1WCWA 3U7EB 4US2R 4RQBA 2PSEA 4IQ0A 1I7SB 3SAJA 2RARA 3OIWA 5JDCA 1J0EA 4B7CA 1ZGCA 4FQ8A 4YUVA 1RBQA 4CL8A 4QUIA 3W5UA 3T4XA 4BB6A 3F1LA 1BGWA 3FB4A 1H6DA 3LUAA 3HBFA 1Z3CA 4GE0A 5KQMA 1DO0A 1G42A 1R3UA 2N46A 2Q45A 1A9XB 4EENA 1Y7LA 1X42A 3F0TA 4YRNA 4TYQA 3Q9SA 3QNUA 5LD2C 1X6VA 3L43A 1ULHA 3E9EA 1RC0A 1LJLA 3OPYA 1VMAA 4RY8A 4PC6A 4UZSA 4BB9A 4ZVVA 1GO2A 2VRCA 3PGKA 3WQHA 4JXXA 2DETA 4KP7A 4KUHA 1ESZA 4UEWA 2C9YA 1MW8X 1T13A 4IAOA 3IQFA 1T9HA 4YV0A 3U80A 1FDTA 4JKOA 3KJHA 5L7YA 2Y0CA 3F9RA 3JRXA 3VR2A 1EUCB 1JMYA 1ZU4A 3PC3A 3LTNC 2JAHA 4NTZA 4AO7A 4KAJA 4LRSB 1JDPA 2BFBA 4IJVA 4XGRA 2CNLA 4PIPA 4BX0A 1A7JA 4UTNA 1J21A 3BX1A 4WI1A 1SUIA 2VRNA 3LBNA 2XIJA 3LRTA 5NLLA 1NW7A 3TFWA 3GARA 2O52A 5LIPA 4PIVA 3LQ2A 2JLBA 4IOLA 5B58T 1QGED 1HLGA 4UARA 4AXXA 1YBVA 4F04A 1I3CA 1QO9A 3C3WA 2N42A 4HEA1 5EYPA 3TNJA 3ZXXA 4UBMA 1M2OA 1JQDA 3EFOB 1OXMA 3RAFC 4NMLA 1PZFA 5D01A 2YDYA 3PQ7A 3SKYA 5ICEA 2XCIA 3GJSA 2HQOA 4RA9A 2A33A 3RUDA 2VT7A 4MDHA 3U7HB 1GGNA 1O94D 1GTG1 2CHUA 2FNAA 2P9FA 2IPOA 1O0SA 1T5SA 4HPJB 5UKDA 4ZYXA 1XKLA 5JI2E 1GZ6A 1V8OA 5EWJA 3SNKA 4OJNA 4XWWA 2FZLA 3JQPA 3UHJA 3ZC3A 3IHKA 1C1HA 1F20A 1IOZA 3E3LA 4RHFA 4A26A 1HWYA 2WWIA 2WHRA 1QYDA 1PJAA 3DTVA 3IOBA 1DXQA 4G1BA 4OL9A 1GSOA 2GNPA 2JGMA 1HRDA 3CJQA 4KH0A 2XYPA 4NJMA 5I7RA 4E5SA 5ES4B 3WGHA 1AHHA 1NSTA 2WSBA 2OHIA 2Z2XA 3G1WA 3PR2B 4QBTA 2LD4A 2ZSDA 3DTNA 4YPOA 4ZJUA 1U90A 5ESXA 2O7QA 3K5WA 2PX3A 3B7WA 4K8RB 4KQ2A 3WWZA 4E94A 3WKAA 3B5EA 3OX2A 4Q9AA 4M0CA 1SA0B 2RGUA 1LPMA 4KPUB 1TGYA 3LT4A 3K71B 3UHOA 4L9AA 3RLFA 2OBYA 2QI9C 1IOLA 1GDDA 4I1RA 3F6PA 2I4IA 3DDZX 5ARDA 2QD2A 3WFZA 1D2EA 1XD2A 4W9MC 4KN9S 4BWGA 5L4NA 2VP2A 1CDEA 2XEXA 3I2GA 3DAHA 4A0GA 1V41E 4TLAA 4PPQA 1GTL1 4DA0A 4W5TA 2WYHA 4XUEA 1DJMA 3DEFA 5CPBA 4YQZA 3A1UA 1XQYA 4FGUA 2AWNA 2X0IA 1BCRA 4MEBA 4RLHA 2V7BA 1C9NA 3TKAA 5CLGA 3P7MA 4Q3CA 2EFJA 1SK8A 4L28A 4MKIA 1EQUA 1QTRA 5HQTA 3CV3A 2C2WA 4GMDA 2F3SA 4WADA 1WX1A 4W63A 3H6KA 2HIHA 5EPOA 4ARZA 3V8QA 3C6QA 3JYHA 1RJFA 1T3HA 3A25A 4QICA 3A4TA 3TQFA 4UTVA 1Y6GA 2P75A 3EVNA 2ZXUA 2AC4A 4ABYA 3N6XA 4YRCA 5JAQA 3U0BA 4D0NA 3NEJA 3LQRA 2EJTA 2FLVA 2R85A 3AZOA 5DX8A 2QXTA 1ZK1A 1RXEA 4XWKA 2CCGA 3W9BA 4WA8A 1CULC 4DLYA 4QPPA 1ZH4A 4B3HA 2AVNA 5FUVA 2ZULA 3ZE2B 2WJJA 4NR0A 4EYGA 1GM5A 2UYGA 2WUFA 5FNVB 1IWBB 3IX7A 4V39A 5HP4A 1AGXA 2OHXA 2E87A 5AM0A 4EPVA 3AWIA 4F2PA 3ERCA 4X92A 2NO0A 3ANYB 1TQ6A 3M6LA 2V7PA 2R6GA 2WT9A 4DGSA 1J90A 1A7AA 1T36A 2ANBA 2HV9A 2QXUA 3LUPA 4MQ5A 2PWPA 3WE7A 1V11B 2QDXA 4E03A 3HCRA 3LHIA 4OD0A 2ERXA 3NWOA 3FGOA 2HM7A 4MR7A 2C99A 3RQSA 2Y9MB 1LA2A 3G8YA 3OPXA 3OKPA 2GAOA 3HI6A 1BVRA 4JUIA 4O59O 1BFDA 1SWVA 4PR0A 3TIXB 3ZR4B 4KBFA 4YMIA 3KZMA 3H4VA 3HR7A 2Q3CA 4RW0A 4IBOA 1I51A 3OCCA 4QOEA 3VH2A 1XWWA 1D6JA 3Q4GA 5J59A 1PG2A 3EZLA 3GWGA 4XLTA 3MGKA 2BHTA 3NH6A 4WLEA 3FNFA 2J33A 3K6SB 1BDIA 2B30A 4Q3EA 2ZR9A 3KT0A 1BRMA 1TD1A 3OCZA 5BORA 5F2NA 3A1FA 5BSRA 2C58A 2M6LA 3RK0A 3S2SA 4F4CA 2H0QA 3D0KA 5CLIA 1Z0ZA 3I73A 3RUAA 3T52A 1JNYA 1TUBA 5EEHA 5DU2A 3S27A 4V24A 1TEZA 1HA3A 5SY9A 4J7UA 4RTOA 2GK7A 2AF4C 3ESXA 3IUSA 5F3RA 4BEBA 3IAHA 3NM4A 4CKCB 1EWKA 3NGXA 2QGZA 3ZW7A 4G8CA 3DEHA 4WOBA 3TLXA 2IWHA 2DM6A 2QMQA 3CRMA 1E9FA 3QKSA 1BU8A 5G1PA 2NU9B 3OTHA 1G7CA 2P4SA 2X23A 2COUA 3O75A 5DOZA 4MVJG 2NPFA 3MD0A 2A14A 3ZV6A 1I1OA 2AH5A 2WV7A 5CA1F 1SCKA 4GNKA 2F59A 1PFGA 2FEPA 2D7DA 4LJ7A 4JASB 4V02A 3OJFA 4W8HA 4X6UA 3F2VA 1B7GO 4HAVA 4LC9A 4N6NA 3BXXA 1F2DA 3K1JA 5LBUA 4OAPA 4QGHA 2VOEA 1HFKA 5HKOA 3PHGA 3ADPA 2NYRA 4S24A 2E5FA 4WLOA 2ZVJA 3AESB 1Y9DA 3TSYA 4MWSA 4PQFA 4DRXB 1MR3F 2W8BB 4R8VA 1XNHA 1MBZA 1PFWA 4NJEA 3GT4A 2XOKA 3C1TA 3IDOA 1UBHS 1N5IA 1JHXA 1JLKA 3CIOA 1M34E 4PZDA 3BFXA 3WB2A 3KV3O 2WQ7A 4Z7OB 5FUBA 4Q3DA 3DZHA 4HWOA 1T8RA 1MX1A 3HN6A 1A5TA 1PR5A 2PSJA 5E6RA 2ZYTX 2VSQA 2CBZA 3U1VA 3QA9A 5CA0F 1B1CA 3GCXA 2HRDA 2G88A 3WGJA 2XDAA 4KZPA 4OHUA 2ZUCA 1FDSA 3PTZA 1KZ4A 1N4DA 1LNQA 2AW3A 2QP4A 2W98A 3BMCB 3LXXA 4BLOA 3HXLA 4LWOA 5JJIA 4H18A 2VHCA 4EFLA 1GUAA 3I5YA 4GRAA 1IOVA 4GYJA 1Y8QB 3VZRA 2QP9X 3H99A 2O1SA 4JKIA 4GXQA 4DB4A 4FOSA 2NZWA 1UBJS 3I05A 4IJWA 4S1PA 1IZZA 3LRXA 3O9ZA 4BUZA 5AQ1A 2BDUA 2J6BA 4L0CA 4AP6A 1H94A 3QUQA 2CFRA 4RVGA 2XDQB 5E95A 3FPFA 4NK5A 1Z38A 4RHCA 5IXJA 1BS2A 4KDEA 2FSPA 3PXUA 2ZI6A 3LBFA 4YMHA 3AHFA 4DC9A 3I1FA 2QTFA 3KOUA 2CE2X 4K0RA 1NBIA 4L4UA 3CF4A 4FLFA 3FMIA 1EBFA 4AVYA 4GBGA 2QK4A 2FRXA 3NHLA 2ZYAA 3PUXA 3NBFA 1PX0A 4DA4A 1XTKA 2O1EA 3JYLA 1UJ5A 2V6FA 2CXSA 2J0UB 2X7XA 4R4JA 2JFFA 2WY2D 2ZVDA 2F4NA 3RJ9A 5IVHA 1AV6A 2HPAA 3R7BA 2AD5A 4U7GA 3T34A 5KB3A 2QAIA 3KUDA 3WTBA 4J76A 4ZU6X 1PLLA 3SFZA 2GLXA 1AB5A 2IU3A 1NMZA 1FUYB 2ZB7A 4DNFA 1QO7A 5DGCA 2HQSA 1PQUA 1MNQA 2IHYA 1E1NA 3TIGA 3T5AA 2B4KA 2BUBA 4FWTA 3ENQA 4I9NA 5JS8A 4HNGA 1LTHR 5HE9A 2BMVA 1QH0A 2ZI3A 2AWOA 1PD0A 5GONF 3F9IA 1J97A 1MT3A 3U3RA 4CKEB 1GQ2A 3H2IA 4Q37A 3JSXA 1RQ7A 1RZ3A 3GIWA 3VDQA 2MSLA 4U9UA 3LBIA 3EMDA 2QTZA 2ECFA 1T5OA 1JHQA 2C88A 1L4GA 3L92A 3UUWA 2HD4A 2DWQA 1NVXQ 3N0VA 1U02A 4TN1A 3J7TA 3I1JA 2DFTA 1KC3A 1QGZA 3BRCA 3G1TA 1HNNA 4HO1X 3ZLBA 4V0SA 1D07A 3EOZA 3F6SA 3NAMA 1MB3A 1XTTA 5T5QA 4AJHA 4EARA 1EVLA 1R6VA 3ZUPA 3K9WA 3GC6A 3B8EA 3I9MA 3PNPA 2NT4A 3G7UA 4B81A 4BKRA 1OBCA 3EFOA 3RT9A 1WSDA 3Q10A 3VOTA 4KC0A 2G0TA 3FPCA 1W8DA 3FWHA 3K70C 1LC0A 1JPUA 1IVNA 3KCQA 2ZR0A 3OMXA 2WSSD 2QN7A 1WWKA 4LHSA 3KLOA 3T5GA 421PA 5B3AA 3CSUA 3TVDA 4E5MA 4TSFD 2GJKA 4TTPA 2GD6A 5DTQA 3ESDA 5EJ4A 2E4YA 3DZFA 3TNYA 1CY0A 2AG6A 2FE4A 2DJ5A 2JANA 2JKVA 2OCKA 3F3MA 3UKDA 5H9WA 1RAAA 1JIJA 2GNOA 2QROA 3TZCA 3A70A 3RYCA 1O6CA 3KZXA 2JW5A 5FF9A 2Q4BA 2NU6B 1ZAKA 1G3IA 4QPNA 3V8PA 2AR0A 3CTPA 3GNQA 1T5DX 3KVRA 4GMKA 2FMIA 2PUGA 2E18A 1Z2PX 4B3RB 2JCYA 4H9GA 4RF4A 1Y3CE 4QYXA 1EJBA 4ILKA 4UQOA 1QANA 1VXOA 5I9MA 3VJLA 4B75A 3VPHA 1OC4A 4PCAA 3PFGA 3DOJA 1CUZA 4AZSA 3VNVA 5KYXB 1SA0A 2WVAA 5P8WA 4KPUA 3SU8A 3KX2A 5DYYA 1TA4A 1XU9A 2XIQA 3UICA 4HQFA 1KYXA 4D98A 4DNOA 4YQYA 2IPMA 2BKVA 2BRUA 4KITB 2AUMA 3GFBA 5HE8A 4FFBB 4LBYA 4R8LA 1YE3A 2PWYA 4YJFB 5K8VA 2QW1A 4WFQA 3IBTA 4V0NA 2YN0A 3R3YA 4OK3A 3ZWDA 2AGVA 1OV4A 4DS3A 3PEUA 4ZT6A 4RGBA 5F51A 4EG5A 3WLQA 4Z3OA 2EKPA 3HACA 2A57A 4C07A 3UGJA 1EU1A 2A84A 3DHWC 4RU1A 3G2MA 2NXWA 2G1AA 1C7ZA 1QHXA 4A0RA 5LJIA 1NVWQ 1N6IA 5B1YA 3TRHA 2C7PA 3DEJA 2XGSA 4R1SA 5GADl 3QVGB 4PIMA 5B7GA 1JIXA 3VR6H 3KHSA 2GOYA 2HCTA 3WLEA 3OWXA 1H0KA 1SC3A 2RHWA 2VPPA 3EG9A 3OCWA 2VATA 3FH0A 2I3GA 1KMIY 1WXFA 3KV1A 3B1VA 3DOCA 1CUDA 1IJEA 1K7SN 4XD2A 3Q3IA 5IC4A 1Z6TA 2JH8A 2PUTA 2WVGA 1OU0A 3IPYA 3IQGX 3E23A 3OZWA 4J2OA 3A1WA 2PQMA 1ORDA 3HM2A 4MUMA 5FPPA 2P9TA 2IXFA 1W4AA 1ZGAA 1NC3A 2DGDA 2Q5LA 1TW3A 4X1IA 4QHYA 3CLUD 1V3TA 3E9NA 5FNVA 5FEUA 1XLUA 3CJTA 1SJ9A 4DXAA 5BUCA 4EG4A 4A8PA 4L3WA 5EWMB 4WDRA 1M72A 2XA9A 3QFCA 1EBBA 3HCFA 5DIZA 3U3JA 3DF9A 3V9PA 4HMPA 4LZPA 5TB5A 4C89A 3DW1X 3QVOA 4Q16A 5F78A 2IXBA 3DF7A 3N9IA 3VOAA 3WNDA 3U3MA 4CG3A 1P77A 4MZXA 2Q29A 5KYTA 3LLMA 5BOSA 1IPHA 2IITA 1DPFA 4L57A 2GGSA 4D9HA 4DC1A 5AW3A 3EQ9A 4UEKA 2GAAA 2Y1OA 3VAYA 3RM3A 4BAGA 4BY9E 3WL8A 4KLAA 2O1WA 3AHEA 4H3SA 4C3VA 5CPFA 2I4TA 3A3OA 1GCAA 1I2AA 4V3BA 2G9NA 1X9HA 4FDUA 1MVOA 2ACEA 3LDFA 4C5BA 1KEVA 1S02A 3D81A 1U7ZA 1IAVA 1T0HB 1UEIA 2DOKA 4GU5A 5AM5A 3VHXB 5GMOA 4DA7A 2UVPB 4KYTA 5G4KA 1SXJC 2Q5HA 4TV9B 3ZBUA 5K2OA 4L3OA 1N6OA 4WNCA 1XDBA 5HKKD 4MW7A 1P5FA 1JHRA 4L5IA 3ELUA 4QATA 3EIQA 2B1QA 3H97A 3LI2A 1P1IA 2RKWA 1E1RD 1G9XA 4AK9A 3UJ7A 2WIJA 5IDXA 3L7OA 3K9GA 1YS7A 1QOPB 1RPNA 3FD8A 2NU9A 4HNRA 2PUBA 3K1TA 5H4GA 2P2YA 3Q3CA 2PDAA 3S70A 4YRLA 1SBQA 2EHJA 4MA4A 3MGBA 3IR5A 4WN9B 1OWMA 3COVA 5IBQA 2YW2A 3QA3E 3S40A 2W2LA 4OB8A 4UQLA 5JMOA 3FKJA 2V1UA 5ELMA 4OJKA 3SZLA 4DJFC 2BI7A 3CLTD 3DMDA 3NCHA 1TJ4A 5COBA 4HH1A 4JJZA 4EVQA 3FPHA 4ZCRA 4M38A 4X3PA 3VR5A 5IF3A 3FCSB 3W9UA 2PIAA 5EESA 3SZMA 3DFUA 3L8EA 3N58A 4M1SA 3HVJA 2GM4A 2LP4Y 3JWHA 4RV5A 1M10A 5JV5A 3KUXA 2FZKA 4C05A 4UNRA 3ZVRA 3IUYA 1EI9A 5DYIA 1LPAB 1PBNA 2AW5A 4NBUA 4P80A 2MWMA 1SHUX 4DRXA 2QMZA 1RHQA 3LRPA 4MW0A 3HJTA 1FFCA 3HTXA 1W2WB 5SZHB 2P9CA 3PPIA 2C42A 1F6DA 2XHZA 1HNZB 5F5XA 1UFVA 1RMTA 2AFHA 3B52X 1QYWA 2ZU6A 4I8IA 4CQMB 1GCGA 1ZD1A 1V95A 1SVLA 4HNSA 5BWOA 4ZDJA 2YJTD 2ZZKA 4IXNA 4AIIA 1QV6A 2R6AA 2RIRA 4QU5A 4EUHA 5EZ6B 1ESMA 1JQ3A 4D46A 5D87A 1G38A 3BD9A 3ZV3A 2XH8A 1ZCFA 1DQYA 3FCYA 5CH8A 4PG6A 2D5CA 1YFKA 2A0YA 3IMKA 3K53A 2CK3A 4EHKA 4C4YA 5HEKA 5M29A 1Q84A 3PNQA 3U4MA 1Y8QA 5JAZA 4IWNA 3Q9UA 1QP7A 4P53A 4Y6GB 5T3YA 2EZ9A 4E22A 1DTEA 1PT7A 1YT5A 5EIBC 1TIKA 1NAHA 4ER7A 5EP2A 1OSNA 4NZNA 3O4HA 4N5DA 1E1QD 2XDQA 4IKPA 2D06A 4LDRA 4DCVA 2CDNA 4R1TA 1TJPB 2HJSA 1RM0A 2IEYA 2I8CA 4RCZA 2FFQA 3LT1A 4LHYA 4D9NA 1HPLA 3KQYA 1KY3A 1KK1A 2JLAA 1APBA 2P9BA 2WF8A 4YRSA 4FC6A 1KZHA 3R0ZA 1OKKA 2I6XA 5SY6A 1P0FA 1WXWA 3AUYA 3BF8A 1V3QE 1TAHA 5LC1A 5TLSA 1GQYA 1JR3E 3A9RA 4X60A 2VXYA 3QPCA 4GLFA 3SHFA 8AT1A 3SF8B 2V97A 2C31A 3E1KA 2PTGA 4GL4A 4NAVA 4CLOB 1H8EA 2ZR7A 4TKUA 2VP9A 1KJQA 2DTEA 2VQ6A 4YA6A 1KVSA 2IBSA 4AKGA 2J3EA 3SQLA 1KO4A 3UY4A 2C2ZA 3OC0A 3N2EA 3HZRA 3B9QA 3OOSA 1ORRA 5T41A 5ALMA 4EA6A 3G2QA 5A3SA 2FPGB 3B6ZA 2QRKA 4FU0A 4GGOA 3V32A 5JZBA 1LBTA 1L5SA 1E8NA 1NY5A 4LOHA 3TL6A 3WBKA 3F90A 3AILA 3WWOA 4B8ZA 4HN4B 4CKYA 3IUMA 4PCUA 3WK5A 1Y9EA 4UDXX 2CVZA 3GLVA 2ORWA 2HF2A 1W5SA 5CM2Z 3VI3B 4X8LA 4D8XA 4N47A 3NWPA 2CLFB 2QD4A 3NT2A 3LVBA 1CDOA 2H17A 2P62A 2PH7A 2Z8YM 1HE5A 3QVWA 3R0JA 4O4HB 3HPRA 2C57A 4QAJA 1UKYA 4D44A 3QE9Y 1V9SA 3UWMA 4FOOA 1KOJA 2VUUA 3GDOA 4QBFA 3KSBC 3ANMA 1SULA 3AP3A 2IHVA 2PHZA 1NVBA 3ZCPA 4MJ7A 1HV8A 2GF0A 3AUTA 5JMWA 3UM9A 1Q0TA 1CUBA 3UT0A 1ESDA 3AIIA 3DWIA 1W47A 5AOBA 3LLVA 4E46A 4G0OA 3OEHA 4K28A 1COZA 1Q2XA 1Q7BA 1NL3A 2DBVO 1V1MB 4LNAA 4OA8A 4Q15A 3BXOA 3E22A 3TJRA 4BZWA 2XCLA 3BWXA 4FINA 3VO2A 4KQHA 3OIDA 2OCAA 1JZTA 1T1JA 1EAYA 2J8ZA 4BV9A 5IBCA 4O2AB 1QE3A 4W99A 2HRQA 4J4TA 1WDWB 1YQGA 1FX1A 1GCOA 4P2BA 3DT8A 3QTBA 4KQIA 1RMYA 4E30A 1T5LA 4X45A 4CMJA 4KQGA 4JOCA 1FDUA 3QUSA 2WIAA 1NRIA 1NJFA 1RI1A 4NATA 4ZREA 4X8OA 5H5JA 4DCJA 3UOGA 2GPBA 3HMQA 1KHHA 2PKRA 3VTZA 4J0GA 1NQWA 3HYCA 3TS1A 1ZW6A 4ZI7B 2Y77A 5EUQB 4UVDA 2NZJA 3L4SO 1QRRA 3LCJA 3VOSA 3IKLA 4C7BA 2VK2A 4DVGA 1XRRA 2CXOA 1KKLA 3GH3A 3CLRC 1L4LA 2NU6A 3EZYA 3HSYA 3RV3A 2SECE 3LOQA 4KR7A 2X5OA 1B42A 4EUNA 4ZVMA 2W6JD 3I5MA 4H0NA 4J16A 4DMRA 3E3MA 5EMKA 3WXBA 4C6TA 4Z4CA 3L0IB 2D8MA 3WHKA 2X76A 2A6PA 3TSZA 3T0IA 1X7GA 1IBKB 4K9SA 4TT8A 4WGFA 3FGNA 4HRAA 4UQPA 1XRNA 2QRLA 1J39A 5KYXA 3QOYA 2X5JO 1ZJJA 3OMLA 1ZGGA 1HDYA 2HPVA 2ZYWX 4P82A 3TZQA 1O1YA 3BJEA 4X64B 4AROA 4DIDA 5IX8A 2VT3A 4B43A 4UASA 4BDSA 1HE8B 4FYMA 4FFBA 4IQGA 1D04A 4YJFA 3UJCA 4JYPA 4Z9AA 4MV4A 3IV7A 5LDDC 3GLHB 3QQ5A 1VE5A 1VJCA 2CYCA 3GQVA 3HCCA 3MOIA 1J8DA 3PGLA 4IP0A 4K9OA 1NJGA 1PYOA 2X41A 3OT1A 4U9IS 4XLZA 4CIVA 2X2EA 2FXIA 4A6DA 2KJQA 5HM8A 1YS4A 2HNBA 1DMSA 3FPGA 1JHPA 3FZYA 3MT0A 5F2KA 1WCIB 3BWVA 3C43A 1LPBB 5EJ6A 3WK9A 4FS8A 1YGPA 3HEMA 2H51A 1WHSB 2A88A 3QVGA 4EYSA 2FETA 1J0CA 1V25A 5J2TF 5J58A 2GBFA 2RAUA 3E0XA 1F0PA 3QLUC 1KOLA 4D9BA 1Z75A 4CEJB 2DPXA 1PFVA 1MEJA 1N2ZA 4G25A 2C07A 4TTSA 3TO5A 2JI9A 2RI0A 1CUEA 3EDYA 3EXFB 2HA7A 1C0KA 1NM5A 2ILTA 3FSGD 3VKWA 3VVCA 4QYWA 4MVCA 1OI3A 1W96A 1VG1A 2O5CA 1YNOA 3T7SA 3ONWA 1V5FA 4TWIA 3CXUA 4M6WB 1M6NA 4G89A 2Z9DA 2B61A 3UJ9A 4C08A 1CY7A 2MJLA 2XNCA 1DWQA 4D9FA 3EVTA 1AKMA 2M1XA 2VPIA 4TQ9A 3G8CA 4ACAA 3VQTA 5IAJA 5BQOA 3CT4A 2H7XA 4TQUS 4OYHA 2R1ZA 3ZXIA 1F2TA 3L0OA 2D1QA 4EITA 3KAQA 1N25A 2PZAA 3DM9B 3QXJA 4RSMA 4X66B 1IXSB 1P75A 1NBWB 4KTVE 3G88A 2C7OA 5AW4A 5DNDA 4QZVA 1W0CA 1H4TA 2XSZA 1OW3B 4IINA 2FSIA 2H1LA 2ANCA 3TOVA 3WISA 5CCXA 2QZ9A 4C3ZA 2KS6A 1Y82A 4LGVA 5IKXA 4IXWA 5HKLA 4ZGBA 5A4KA 1IE3A 5A06A 3EGXB 4E13A 3GMSA 3OT4A 1V8DA 1NZJA 5AHOA 4A8JC 3DDOA 2QE7D 3LPNA 2O0KA 3KYJB 2ZSHA 4AJJA 4EZBA 5JAPA 2CD7A 3EXEB 2GKSA 3LSTA 1QG0A 4QGBA 4HGZA 2FUG1 3R77A 2OLKA 3ZCSA 3NRBA 1UPBA 3VHXA 1SOUA 2NZXA 1CUSA 1TFRA 2XMPA 4U2DA 1FFGA 2DC1A 2RC6A 3S7TA 2BKXA 2WPNA 4QRHA 3E2IA 1K7XB 2MINA 1MX5A 1EDBA 3DHVA 5TE9A 2E7ZA 1MO3A 4WIAA 1OAOA 3ZXSA 3KHTA 4D45A 4F1KA 3W3AA 3H2YA 3GGOA 1P7PA 1BWSA 2I5PO 3ML1A 5ILOA 1Y4ZA 1SU8A 3ND9A 1LV8A 4PXSA 3CRRA 1RABA 3MQ4A 3VV3A 5DLDA 2R7KA 1VM6A 4FCVA 4B40A 4CUZA 4HZUB 2ZZNA 3CX4A 4CV0A 4MQEA 1E3IA 1U3WA 4K6CA 4LZWA 1JYEA 2FMTA 2PAFA 2JGKA 5KJEA 4BX3A 4Q19A 2AUTA 4WN9A 5K05A 5BW4A 4YMSA 2K7ZA 3OIVA 3RK1A 2HJVA 3R3JA 2IIPA 4PGFA 3BMNB 1M1YE 1U31A 2O5VA 2DWOA 2BHSA 1PS9A 2XUKA 2ZGVA 4X90A 1O0BA 1QIDA 2HSEA 3AY7A 1A97A 1YOBA 3P52A 3RK4A 3AR7A 1FRZA 4XFDA 3T9EA 4MV0A 4FMDF 2R6DA 3FTFA 3W2TA 4AMVA 4RXMA 1WLSA 3VJRA 1DRUA 1N2SA 1MTOA 2QUBA 1Z17A 3DFKA 3LC2O 4I8XA 4M4SA 3WLNA 1Z8HA 5LZ2A 4B5LA 4XQ9A 4GQAA 4TYPA 3PEVA 4W7SA 1OQAA 3TX6A 3GDWA 2VP4A 4EG3A 4QPCA 1JAXA 2C5EA 3FUVA 3KUCA 3R5KA 1AK2A 2I3ZA 4A0FA 5FCDA 5D6NA 1B6SA 2Q6IA 3BF7A 5ECYA 4RJ2A 2R60A 1JEAA 1NBMA 1P45A 4L15A 3DOIA 3GDHA 2MU1A 1PJTA 4NJOA 2QRQA 2V7UA 4KVFA 2OECA 4CQMA 2H1SA 2FP4B 2WIDA 3SN6A 5DBGA 1BS9A 1D6MA 3LOUA 1RI4A 1C0LA 1JLLB 1SY7A 3DE0X 3PFIA 4KAAA 4MQFB 4TYMA 1CZHA 1GRRA 2CXQA 2V45A 5TV2A 5JROA 4RKEA 1TUGA 3MCAA 5HFJA 2IRWA 3CLVA 3KOWA 5DO9A 4HDNB 3KJGA 2MYPA 5ITWA 2UDPA 2HWUA 2Q3JA 5EIWA 1W36D 1DCTA 1MX9A 2NU7A 5LU8A 5HJ7A 1QH1A 3W8NA 1ZBQA 1CRQA 4ZAXA 2O0JA 2FK7A 4RHTA 5T6BA 1B0AA 2DH6A 5KUTA 4ZQEA 5K51A 2FMFA 3VPFA 5T7BA 2A3NA 3EQZA 4ZGWA 3RVRA 3DCYA 1U1CA 1T6YA 1Z82A 1DKQA 2JEZA 4P86A 1UDBA 1ZGJA 1CR4A 3S81A 4N48A 1Y81A 4PZ0A 3BJRA 3SVLA 1FDWA 2FEKA 3FSRA 2VP0A 1VB5A 4OQPA 4BV2A 1WHTA 4F7WA 4C9BA 5BN3A 3L4KA 2NIPA 2I6SA 2QMOA 3GMTA 3JS5A 1LK5A 5I9TA 3A6ZA 3WK8A 1ZHHA 3FNBA 5KNDA 5BV2P 1P91A 2CXXA 1F3OA 4LJ8A 4TTJA 1A96A 3QVLA 4XKJA 1UOQA 3SF8A 3WDMA 1C5KA 4OX9B 2UVQA 1ZRNA 3MCZA 4DDKA 4CLOA 3L05A 3BMXA 3DL4A 1ZX1A 4G84A 4TPKA 2BFDA 2YY7A 3H5VA 1C0PA 2VRBA 3FLMA 3N0TA 2JK0A 4HB3A 3AP2A 1T3TA 4AG3A 1P6UA 2FPGA 2GFHA 1SUFA 3R5TA 1SVMA 3U9SA 1VKJA 3WIDA 1NXSA 1QF9A 1UKCA 4WKGA 2R11A 3W8FA 4B79A 1NATA 2PUJA 4MVJM 5ALZA 2BR5A 1ZD2P 1UC4B 1XEXB 3CH7A 3TECE 3L8DA 2J9GA 3QP9A 2P5SA 3AM5A 3OI7A 1W581 3UN1A 2O2EA 3UFXB 3VISA 3WLLA 2ZJ0A 2PKYX 3GJXC 1KPGA 1S2DA 2F9FA 3Q15C 4R8RA 1XAIA 2YHIA 3UQYS 2D1SA 2J4FA 4ND8B 4YALA 4XEUA 1Y3DE 3WTCA 4G5QA 4BECA 4D4GA 2DBYA 1RYNA 3LTEA 3CONA 3OAAA 1PJCA 1NTRA 4QX6A 4FDMA 3GLQA 1IY1A 4DAEA 2JHPA 3EHDA 4N9WA 5E0KB 1AS0A 2O3JA 2ZJOA 2XRFA 1D6SA 2FPIB 3EXAA 4PZ9A 1ND6A 1NLMA 2P9GA 2OUKA 3PEFA 4L07A 3NIBA 4MW2A 3V7FA 3UWDA 1INLA 1V1MA 4F60A 1WNFA 3ZHRA 3QMVA 5EVCA 3VKVA 1U9CA 5ELXA 5EXSA 4R40A 1WTCA 2WD8A 3C15C 2HA0A 2Y71A 1J0AA 1UBRS 4K9PA 1OGIA 3JQCA 4W6QA 5DYTA 1BYUA 1OREA 3NU1A 4RQAA 3BSFA 3PF9A 2XMRA 4E0BA 3DHEA 4PGGA 3WHIA 3TOSA 3VXKA 1DJNA 5EE3A 1PGOA 4EA7A 4QODA 3OURA 2QYOA 4Y7CA 1SBHA 2B7BA 2H8KA 1JFVA 1FJ2A 1UANA 4E15A 4EF4A 1FY2A 2QV0A 1K6IA 3LOPA 2Q4DA 3C3EA 3KB1A 1ZD8A 1J1IA 2QA5A 2V4ZA 5EIOA 2IZOA 5LB4A 4H08A 3BC1A 4OO3A 1AE1A 3RRNA 3WNCA 1FMJA 2GYVA 2I33A 2BZ0A 4GWKA 3UQZA 3IOMA 3ZHBA 2D3TA 5DP2A 3F97A 4ENQA 1P3Y1 2W6ID 4PTLA 4P7BA 1LVUA 4UMFA 1M8GA 4C2BA 1Y9ZA 5AI6A 2GEVA 1EUZA 2JIZD 1XRLA 1PFYA 1VLVA 3PC4A 3QPAA 4G85A 3RTCA 4AMZA 4DJDC 1XRJA 3QX7A 4DLKA 5IDYA 3PT9A 1CY6A 2Z4RA 3GUHA 3QLTA 4JVNA 3V8EA 3NFRA 3A3KA 1FFHA 3EAGA 1Z28A 3K0AB 4FNAA 1Y7HA 1GPLA 3KVYA 4DILA 3F73A 5HQJA 1FIUA 4P2GA 1UK9A 2G1KA 1NDUA 4JR0A 2WKSA 5DHUA 2EKBA 3AUJB 1D4OA 1BHO1 1KKUA 2K6GA 1VI5A 2WUWE 4URFA 1M6VB 1KI6B 1ONNA 3V6MA 1E2LA 1SBIA 2B83A 2VHWA 3ORFA 3G0HA 3GEBA 3D4OA 1ZBDA 2LPMA 3FYUA 4J91A 3RU9A 3ELBA 3PCTA 1T5TA 3CPHA 3OQIA 2VTBB 2C03A 2YVAA 2QU8A 3E1GA 5KTMA 2SNIE 4R7TA 3ETLA 3DKRA 5ANRB 4ZT5A 2VXCA 3T3HA 3TRJA 5LKAA 3NHFA 1XCLA 2CUTA 4D9CA 3LL4A 2Q49A 3H9BA 5J4VA 4NZZA 5G53C 2JHFA 3KP1A 3UJBA 1GA6A 1WOYA 4RVSA 2AFRA 3LZDA 4TXJA 3KR0A 4YAEA 4IMJB 4I50B 2LZ0A 1T43A 2HXSA 2AXEA 2I7CA 1VG0B 1WU8A 2GPAA 1K1EA 2O7VA 3IBSA 5THKA 1K7YA 3GRUA 4B87A 3C6YA 2TYSB 3OQBA 3T7DA 2QV7A 1OJ7A 4PR3A 4E5UA 5A7GA 3RC7A 2ZYVX 3U13A 5EXEA 1P3DA 1RRMA 4HEJA 4PYOA 3SIWA 2GESA 2JAUA 1QE5A 4II3A 2CWWA 2CFTA 1DRJA 3ZCUA 4F8EA 1ZFNA 2I62A 1Z5NA 2BFWA 3LGAA 4MRMA 4YP0A 4AY4A 5ED0A 1EEXB 1T91A 4XARA 4GOOD 2Q7DA 3TQTA 1Z2EA 2BTQB 1LX7A 2FEAA 2J09A 3EEIA 4K46A 4Y2SA 3UOAB 2F48A 3TG8A 4BNXA 5KYUB 3LO8A 2V74B 4PO9A 4A5OA 4LF6B 3TNFA 1XPJA 3A14A 4YBZA 5CT5A 4Z0TA 2JIPA 1VPVA 2PQ0A 3NGMA 3TDMA 4P6VF 2ZREA 3D6JA 1ZVJA 1JG1A 3IUJA 3S68A 3F6RA 4CL3A 3WGKA 2RAPA 1O4WA 2EERA 3QXGA 4IDDA 4ZQBA 5JSQA 2PIDA 3BH7A 5I7HA 3EGXA 1KJYA 5TEWA 3L0BA 4IRUB 4XWOA 5GWXA 2QRJA 1DZIA 2FPSA 3O31A 4IV0A 3BB1A 1T3ZA 3ICCA 3QIAA 1NKTA 4JJKA 4A3SA 4XB6B 3WX0A 1JQJC 3MWDA 4IQ4A 1L7XA 2IEIA 3MELA 3JAKA 3W2GA 3NV9A 4C5AA 2PXHA 2JH9A 4Z4FA 1DG9A 2G77B 1PNVA 1R0SA 1M7GA 3DDCA 3IVXA 1ATIA 4Y7DA 4ALNA 1TCUA 4TWRA 4U63A 4F3NA 3RADC 2AVDA 3IAM6 4RZ3A 2H1IA 4UCWA 1SC9A 1KDOA 4JVMA 3ZY3A 4N82A 2R6JA 5K4AA 2VYFA 4W7HA 5MF6A 2KQUA 4RACA 1JEYA 3MJHA 3VR4A 5JSZA 1LWNA 4H7HA 3AVYA 2R25B 3KPVA 5FXMA 3P19A 3S2UA 4Z1OA 5LU9A 4RQUA 3D2BA 4NMHA 2Z6UA 3X1ZA 4I1IA 3OX1A 3NETA 4R2MA 2Q3EA 3TLCA 4JWTA 1B6RA 2H54A 2HMAA 4M76B 4H4CA 5IABA 3L1HA 1WW3A 3DAGA 2Y0DA 1KVRA 3PD0A 1U0FA 1JSZA 4RQTA 2WHXA 5GAJA 5DBHX 4FHCA 2P9YA 5CITA 3BMNA 3EIHA 5EGNA 5U4QA 2CHGA 3ZI0A 5BMVB 3ZJVA 1NKSA 4EGCB 4WACA 4L8LA 3O4IA 4M8SA 1WV0A 5IK2D 1WETA 1OXXK 2E4WA 2O7SA 2DH5A 2C2BA 2QGNA 3E05A 1VFNA 1EXWA 2L69A 3PYLA 1CWUA 3H75A 3I6YA 4KGDA 5EY5B 3Q8MA 1TGVA 2O06A 2VUHB 3IRUA 3OO1A 5AO9A 2GDZA 4M7OA 4X1OA 3VYUB 1XZKA 1VLMA 2R4QA 3LJKA 5DBOA 5CAEB 3W7BA 4LXUA 4FJ0A 4TWBA 3U17A 4BBPA 5IXYA 4K6FA 2VTVA 4LISA 4Q4JB 4YNBA 5L7TA 3I01A 1UJNA 3KB8A 3NFYA 2YZMA 3MJ4A 3NG1A 4N0MA 5JMTA 4W4TA 2O3RA 2OG1A 2DTXA 4HNUA 1WTAA 2PMDA 3VSDA 2J46A 3IQHX 1JG3A 3MMPA 3N59A 4F85A 4LV6A 3U3OA 2DXIA 2JGJA 2XXBA 3IUPA 1R8QA 4D41A 4IIVA 1N78A 4HDNA 1J2TA 2DY1A 3DKVA 5HOQA 4I3HA 1Z88A 4C87A 5KX5F 2B1RA 2IZ0A 3I6IA 4GXRA 1O2DA 3UT6A 1HLDA 3R7AA 1AA9A 2FN8A 2FSFA 1IUNA 2UVDA 2GZDA 3FCEA 1T3SA 1TYEB 2P11A 3BJMA 2H48A 2ZUDA 2FJPA 1GQRA 1M9NA 1YZTA 2HC9A 5FTMA 1CUYA 4C0LA 1FJGB 3BTOA 1VIVA 1WUHS 3H1PA 4AJOA 4JVOA 2YS7A 5EA2A 1UDAA 5LYJB 1RM3A 1E63A 4CLHA 2C2HA 3ROTA 2DHEA 3ZZ0A 4RMNA 4G1VA 1T15A 2ZWOA 4MAMA 4XX0B 3HB7A 2B7CA 2K7FA 3HA2A 4DIKA 4JHLA 4FZRA 2WAOA 3KTAB 2GCIA 3ORSA 1WP4A 2PD4A 4HLUA 4HY3A 4OHFA 2QPAA 4L78A 3ITDA 3TAHA 2GM5A 3UANA 3PGJA 4DQVA 5BURA 1G55A 1G4AE 3M1LA 3DKPA 4R69A 1BN6A 1CJMA 4LHVA 3RFVA 2ZIFA 4Y0AA 4BLWA 2ZZMA 1EMDA 3CVVA 4PBTA 2GCGA 3UMJA 4BVKA 1COWA 4H1WA 1QC5B 3GAMA 1G7RA 2ZR8A 1CR2A 2BYTA 1QTNA 1N32B 4KO1S 4OB7A 1CS0B 2GCPA 2JBHA 2G5GX 2PO5A 3C3JA 4HFJA 4ROSA 1EGQA 4YJKA 3WL6A 3C5EA 4EKIA 1WY7A 2VHVA 4U1RA 1JXQA 3DVLA 1V4VA 2WZCA 2A9RA 3O2NA 3RKSA 3KR9A 4NICA 2OZKA 5EJ8A 4DCCA 1A9QA 3ITEA 2Q4EA 3ZDFA 2NGRA 1N6LA 3GLUA 4AIRA 3CH6A 3UFXA 2GEFA 1FRVA 1N7JA 4DB2A 5CT4A 2WU8A 4RS3A 1YJAA 1ZXLA 1YRBA 3KZCA 1F6BA 2J08A 1EXMA 3AHHA 3G9UA 4MGKR 1BAPA 1JR3D 5B3JA 1RACA 1TVMA 2GBPA 3AF3A 1NVEA 3FMPB 1XZBA 1MXHA 4EL5A 1Z2DA 4EB3A 1WMEA 3QWFA 3GFSA 4RULA 2DFLA 2FPIA 2Q2NA 3WICA 2RGWA 1AZWA 1Z0KA 3B13B 3FPSA 3T3DA 3FROA 5IJ9A 1O94A 1FUKA 2D1FA 2HSJA 4E51A 4NU6A 1ZMOA 2YZ7A 3EVAA 2PUWA 3HDTA 4YXWD 1L7QA 4M8KA 2L82A 4URYR 1YR3A 1MH1A 1LV7A 2WIFA 4EHFA 3KG2A 4GWLA 4WBNB 3ZYCA 3A32A 4EKDA 4JITA 2A9PA 1W6UA 2JAPA 5T8KA 4CIAA 2IH4A 4G0VA 2ONJA 3LBYA 4FW8A 1WUKS 2BEWB 3HP1A 4F8JA 4IHJF 2WHEA 5KYWB 4OHBA 2XUAA 3GFTA 4OL0A 1WJGA 5H80A 1XQ9A 2YWGA 1GSIA 4GPEA 4B6GA 2CXUA 3JZDA 1JLMA 3QUBA 2YFHA 1XR3A 3OLZA 3IAS1 3D4LA 1DARA 1H6CA 1EUYA 3EGIA 1UBKS 1UXIA 3LT2A 1S4MA 3JASA 4HTFA 5I8WA 1DAIA 1DRWA 1YF3A 1W5BA 4AAYA 1E2IA 3ELWA 1YZYA 2Y1CA 1JFRA 2XGMA 3STUA 4IIDA 5K99A 2Q1YA <