1NURA

Crystal structure of human cytosolic nmn/namn adenylyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FKSG76
total genus 72
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nurA00
1P7PA 3IOBA 2YWCA 4GU5A 4ZT2A 4EG6A 3G5AA 5DEOA 2C5SA 1JECA 5TEVA 2G36A 3COYA 4MWDA 1JZSA 1OD6A 5KWVA 1DNPA 1ULHA 1F7UA 1N3LA 3IMGA 1QU2A 2BTEA 1VBNA 3AIIA 3I05A 3M5WA 3G6KA 3DLAA 4U63A 4DDHA 3CVYA 4P2BA 1X6VA 4YP7A 1XNGA 2J4DA 4ZCPA 3SEQA 1XNHA 4EG8A 1NSYA 2CFOA 1TYBE 4R2MA 4UZEA 5DB4A 5K0SA 3KT8A 4EFKA 1PFUA 3MMXA 1BS2A 3TQIA 1PFVA 4ZT4A 3IH5A 4ZCTA 4JYZA 3F3MA 1EFVA 1GTSA 1EFVB 3DPIA 1O95C 3DV2A 1Q19A 3LE8A 3N2YA 5EKDA 1JEEA 1JZQA 5DK4A 3L92A 3COZA 1S4MA 1COZA 2V0CA 4JFAA 3KT0A 4EGAA 2H29A 5J58A 3CLRC 1IRXA 4DDKA 1JHDA 1N75A 3A04A 1H1TA 3IVGA 4EG4A 1KR2A 2PFSA 1WXEA 1KAMA 1XJQA 3H97A 4UZFA 2OV4A 4KPUA 3GLVA 1VL2A 4L2IA 2WQ6A 4S1OA 3CLTD 1KQOA 3N9IA 2CUZA 1T6XA 3PNBA 5H7XA 1EE1A 4MW4A 3IOCA 4R2LA 3TNJA 4HJXA 1JILA 1WXFA 3P0JA 3NBKA 4H3SA 4NDAA 3IDFA 3SYTA 1JIIA 3X1KA 3H99A 1FYDA 1CT9A 2E18A 1O95D 3TZEA 4OJMX 1O0BA 1N77A 2A4MA 2H2AA 2AKEA 1J1UA 1J70A 3K9WA 1N1DA 4DLPA 2J07A 1K4KA 1QQTA 1N2EA 2JA2A 1O97C 3H9BA 1Q77A 2VTBA 3PNVA 2AG6A 3MUEA 1WOYA 5HG0A 2QTMA 3MLBA 2D13A 1R6UA 2X1MA 1GAXA 1MBZA 3RBAA 1V8FA 4G5FA 4J76A 4K03A 4XSVA 3RK0A 2NZ2A 2O5RA 1NUSA 4XFJA 2CV1A 5BNZA 5H16A 4OUDB 3GMIA 1ZUNA 1O0CA 2PXHA 2EL7A 3FH0A 1MOPA 2QTRA 2VXOA 1OWPA 2RE8A 1X8XA 5JBNA 1J1ZA 2HMAA 3G59A 1QNFA 3P0IA 3ND7A 1MRZA 4MQ6A 1QTQA 2J5BA 1IQ0A 4QBTA 1J09A 4NAHA 4R0NA 1VBKA 2WQ7A 1GN8A 1I6KA 1I6LA 3ILVA 4TS1A 3A2KA 4MUNA 1EJ2A 5F23A 3ND6A 3N8HA 2QJTA 1RQGA 2PIDA 2IJGX 3CLUD 4U8HA 4NATA 4G5YA 1JGTA 1Y42X 3IODA 1QU3A 3COVA 1PG0A 2A1UB 1H3EA 3PNYA 4MW9A 3IVCA 4NX2A 1NUQA 1T9GS 3AFHA 3FETA 1GLNA 2CSXA 4MW1A 3IOEA 4MVYA 1QJCA 3RK1A 1ILEA 1VBMA 2A1TR 4KKVA 2DR2A 1F9AA 1YUMA 3ZXSA 2HGZA 1U0BB 3CLUC 4PBTA 3UOWA 4F3RA 5FNZA 4CT0A 3ZXIA 3CLSC 4MW7A 1M8PA 2CT8A 3VGJA 4GRIA 3FG9A 5AHWA 1N2OA 1T6YA 4F4HA 2E21A 2A7XA 3FY4A 1O96A 1UFVA 1EUYA 1G8GA 4ARIA 4MAFA 1D2RA 5HUJA 4X0EA 5TS2A 4ZCRA 2CV2A 3CR8A 4JXXA 3S3TA 1KQPA 2J08A 1KP2A 3QTBA 2WSIA 1F7VA 4MVCA 3UMVA 1K92A 3MXTA 1WXIA 2PG3A 4KPUB 3ND5A 1NZJA 2CYCA 3AKZA 3HFJA 3ZUGA 1G59A 1A8HA 3FHJA 4ZT5A 5J59A 3CLTC 3LCJA 3AL0C 2PZ8A 2DERA 3HGMA 3UC5A 1KH2A 1EFPA 1MC1A 2E0IA 3RHSA 1EUQA 4YP5A 3NV7A 1F4LA 2GM3A 1YI8A 5TEWA 3IMEA 1TEZA 5KHAA 1IVSA 3ZJUA 3GUZA 2DUMA 3CVUA 1HYBA 1JMVA 4ZT6A 5FO1A 2I1LA 3HL4A 2CYAA 1N2BA 2A1TS 2DEUA 3RFFA 1Q11A 3IMCA 3QTTA 4PY2A 3UK2A 3LOQA 4MVWA 2J09A 5J5AA 4YP6A 3KT3A 3NBAA 4MWEA 4I6GA 1IFXA 5K0TA 1MB2A 3CVWA 3INNA 4I6EA 1U7XA 3N05A 4MUFA 1KKUA 4MUJA 4MW6A 4MW2A 3FOCA 4ZCSA 1EFPB 2IP1A 4XFDA 3RJZA 4MUGA 2X1LA 3PXUA 4Q93A 4JZYA 3OP1A 1NURA 3VRHA 1G8HA 4J75A 1YIDA 4DDMA 1NUUA 4EF6A 4HJRA 4I6JA 4MW0A 1B6TA 4EG1A 4DJAA 1JIKA 2VTBB 4U7JA 4MW5A 4EG3A 3FWKA 2DPLA 1H3NA 1WKBA 4K0RA 4OUDA 1YUNA 1N2JA 1J20A 1MB9A 2A84A 1LI7A 4JXZA 3X1MA 4HPWA 1LW7A 1VLHA 1TQ8A 1TYAE 3K32A 2A1UA 4DE5A 4NZPA 2GOYA 4A91A 1KH1A 1LI5A 2A86A 2D5BA 3ZIUA 4RPIA 1R6XA 2QJFA 1T9GR 3HV0A 4PBRA 3Q4GA 2X0KA 3SEZA 2A88A 2DLCX 4MUEA 1IQRA 1G8FA 1WXHA 2YWBA 5HUHA 3ZJVA 4MWCA 4MWBA 3E27A 4WNYA 1GPMA 1JIJA 1OWMA 3A4IA 1O6BA 2QUKA 2RD2A 3JXEA 1IHOA 3H9CA 1WJGA 1O97D 1U3DA 1N2HA 1PFWA 1M8GA 1ZH0A 3OTWA 5KCMA 3QE4A 1QRTA 4QRDA 2Z3VA 1KAQA 4E1AA 1KORA 3COWA 1OBCA 2BYTA 1M8KA 3L93A 2JAXA 5LFAA 3MLAA 3CLRD 1U7DA 4EG7A 4MUHA 1PG2A 2GKSA 4EG5A 1KP3A 1NI5A 1IQUA 3H05A 1QRUA 2XRYA 3BL5A 1YULA 1OWNA 2JANA 2DETA 1WY5A 2CYBA 3X1JA 3ZJTA 1O94D 1TFUA 3U1VA 1Q15A 5IHXA 1M8JA 3SZ3A 4ZT7A 1O96B 2Z09A 3KFLA 1NYLA 2PZBA 1XNJA 4ND7A 1EXDA 4ZCQA 5IJXA 3CA8A 1NUTA 1MJHA 1GTRA 1ZJWA 4AS1A 1H3FA 2QTNA 5FO0A 4FZJA 2EJCA 1T6ZA 1M83A 1J21A 3ZGZA 1QRSA 2X3FA 3TZLA 3FDXA 1MAUA 4CDMA 4DNXA 2XRZA 1PFYA 4CDNA 3VU8A 4HK4A 3SDBA 2QUHA 3IUEA 1V47A 3FNRA 4WSOA 3P52A 1GZUA 3CLSD 3CVXA 5LM3A 4Q16A 1WXGA 1SURA 1IH8A 3FIUA 2O8VA 4YBRA 3TQOA 2D54A 5DASA 4MUKA 1M8FA 2TS1A 3UY4A 3SP1A 2E89A 4KR7A 1N2IA 1I2DA 1K4MA 3AG6A 1I6MA 1WQ3A 2V0GA 4KR6A 3D6VA 2NSYA 1N2GA 3IVXA 1NUPA 1O5TA 2YY5A 1OWLA 1U3CA 4BWVA 4MLPA 3P0HA 4PBSA 2QUIA 3DO8A 3FI0A 3IUBA 4G6ZA 2ZUFA 2DXIA 4L2IB 1MAWA 1KQNA 4MUIA 3HZRA 1OBHA 4ND6A 2OQ2A 1O94C 1JEDA 2QUJA 3TS1A 4MVXA 2B7LA 1YIAA 4ZT3A 1WZ2A 2Z08A 3ELBA 2YXNA 2IELA 3D6UA 3Q10A 4YMIA 1OWOA 3CVVA 1ZH6A 4CQNA 1N78A 2CV0A 3SZGA 4QREA 3KT6A 2HZ7A 3A05A 4ARCA 4AQ7A 1K97A 3ISJA 3AG5A 2QJOA 3PRHA 1WQ4A 4NAUA 1FFYA 1NP7A 4MULA 5TGTA 4RUKA 1TYCA 4KR9A 2AZXA 2ZP1A 3HMQA 3C8ZA 1M1ZA 1KH3A 5LLTA 1TYDE 2PZAA 2R5WA 3Q12A 2WB2A 1R6TA 2ZUEA
chains in the Genus database with same CATH superfamily
4XSHA 2H54A 3AESB 2C9CA 3A4MA 3M5PA 3HSSA 3K2BA 1I0IA 2W6QA 2G67A 4KVZA 4RYDA 4E33A 4GBMA 3U16A 2GJ8A 1E99A 1OGIA 2VF5X 4PS0A 2NXJA 4QBHA 2XH8A 3WJ7A 3OQIA 2FSPA 1UBFA 4CRWB 4EDHA 4AY2A 1ULHA 2UDPA 5CG1A 5DSXA 1F7UA 1SVMA 1LBQA 1N3LA 2Y05A 3JY6A 4YAFA 2QOEA 3VZPA 3G5LA 4D9IA 1KTIA 2XUGA 1EUZA 1JR4A 1UBLS 1KFBB 4ICIA 1HETA 1YKFA 4ZCPA 2CDAA 3WKEA 2VNKA 2GO1A 1TYBE 3NO4A 5IEJA 4L1KA 4O4LA 3PC2A 1YK0A 4YDQA 1JJ7A 3EXFA 4E4YA 3VH1A 3MMXA 1H2FA 3G1UA 1NXWA 5JRJA 3I9LA 1MR3F 4KO8A 2PLAA 2ZUSA 4P7GA 4E2WA 4LHXA 1C8LA 1TUEA 3NHPA 4N5IX 2IU0A 5ILGA 3DDCA 3EWIA 4K9MA 1QS0B 2H5IA 1Q19A 1W4BA 3HCRA 4FLFA 5JAOA 4KFCA 3MF4A 1RAIA 4UCFA 1QIHA 3ZH2A 1R4NB 1GUFA 3FOEC 4FE4A 3S4YA 2C58A 3SE7A 3SN6A 5CM2Z 5TT0A 1W581 4BXOA 5J58A 4L75A 4S2UA 1EUCB 2SKDA 1A9XA 1DI0A 1IRXA 1M1NA 4IIVA 1JHDA 4MV9A 1B3RA 4PZPA 4AP9A 3U81A 2I78A 1ZGCA 1OLXA 3SLKA 2PS0A 2VJBA 1C5KA 4PRYA 1RCTE 3RUPA 1XEFA 3DTVA 3HCFA 3QHQA 4G81A 3SEFA 4E3ZA 4DR6B 4PWYA 2BRUC 5KSYA 3CEPB 4PQFA 3DQQA 3KAKA 3KQTA 3J7AC 1B2RA 1KI3A 1EGAA 3K0CC 1D8TA 2EL9A 2ZR9A 2CK3A 2EJWA 2ZT7A 3BXEA 4N0PA 4RS4A 1KJ9A 4EMTA 1AKUA 1JA9A 3A9SA 3QSYA 5E1MA 4C2TA 3EZYA 4IH9A 4TTRA 1LF5A 1CEEA 1LPAB 2VNHA 4R2LA 4XRGA 1YB2A 2XWBF 4XX1A 3NS7A 1A9YA 3E82A 2VHCA 2ATEA 1JSZA 4K6CA 2X8BA 3C7AA 3KHSA 3B89A 5L40A 1JYSA 4IXMA 1H6DA 1NV8A 2EFGA 2W4MA 2WA1A 4KWCA 1ZVJA 3RKUA 4RD1A 3VR1A 3T4EA 4YRPA 3H99A 3PXBA 3LK6A 4JLPA 2A0UA 2XNHA 1I4DD 4KSCA 3OHPA 3ZWMA 3VNUA 5CIWA 2GVDC 2HF7A 4BQFA 2YW2A 1GNVA 3NTVA 5KSPA 3SMVA 2ZS7A 2QP4A 1WS6A 2NVOA 3T99A 3MAGA 4XXHA 3PPYA 1SVLA 4QXMA 2VCEA 2V6BA 2YYSA 4MVJA 1YS4A 2HXGA 3V4ZA 3ZVNA 4B3MB 4GZ6A 2FPKA 4JSTA 3ID6C 3QBDA 2X1MA 1FQOA 4UHEA 5E38A 2AN3A 2EJUA 3VU9B 1Y9JA 4QYMA 3HH8A 4P38A 4CMGA 3KKKA 1WMSA 2WJGA 4LYYA 4B71A 5FYQA 4AY5A 3LM8A 5BWOA 4IO0A 4PAMA 1IE3A 2ZS8A 1KZYC 4Z54A 4L72A 4OUDB 4JLBA 4TXJA 4BTEA 4H60A 4H1HA 3J7TA 5J5AA 5ECYA 1NAHA 2ZJ2A 1R6AA 5FWNA 2ZKIA 3MRSA 5K51A 1HE2A 1PN3A 2VXOA 3WSTA 3FSGD 1DDOA 1M2JA 4RZUA 2Q4OA 3AOGA 2IF2A 4H08A 3UICA 5JBNA 3LPLA 3M1LA 5DNWA 1CJCA 4Y1RA 4ONEA 2PUHA 2QW1A 3U3XA 1RHMA 3WGOA 1NE7A 3OF5A 3PF8A 3WGMA 4QBTA 3NBMA 2ZSDA 1U28A 1WF3A 1O2DA 1PDWA 4MUYA 5EVCA 3R9XB 4B6EA 2FPRA 4WVLA 1CR6A 2YL2A 3CC8A 2I6GA 2O2ZA 4P33A 4F9TA 1M7GA 3ABOB 2R4QA 3BQMB 4PLVA 3HBJA 3IHTA 4BNWA 4DUYB 1L2TA 1ZI6A 3SFVA 2VRCD 4JEMA 4RKRA 5DF1A 1KS2A 3KR9A 4IUBS 3HB9A 1BKYA 1ZIDA 1M34B 3PNYA 4WMLA 5B7NA 2ZCUA 3HGQA 3GNLA 3ZGNA 4PNEA 1ATZA 1GLNA 1KDYA 1SC9A 3F78A 1QORA 1XMQB 4F06A 5CCEA 5FTMA 1DAMA 3UWSA 5K3CA 4EAQA 5PGMA 4E1BA 2BKVA 1N7GA 4OA8A 1AQNA 3E70C 2R00C 3CQ9A 3KZOA 1BXRA 4M0LA 4RD2A 4IMRA 5HOEA 4BZZA 3UA4A 2NTVA 3IE2A 4FUQA 3WLPA 2ZXFA 2SNIE 4RVGA 5CYFA 3IKTA 1WVIA 1ZM4A 1DJOA 1JU3A 3B2QA 3IJPA 3IR5A 3CPHA 1L5HB 1M1UA 3FY4A 4MGIR 1O9HA 1ORHA 1QGUB 1SHJA 3E03A 4B8ZA 4BYGA 4DYVA 5FUMA 2CXSA 1UT5A 5KNBA 3GEGA 4G5QA 3UTCA 2CV2A 4MV3A 3BZUA 1CTQA 1S2OA 4I55F 3TQCA 5DMXA 4DL9A 2YQZA 1KQPA 2J08A 2Z3WA 4NFLA 4TRMA 3HADA 1MD9A 1N2CB 3HE3A 3EEIA 4WKPA 3TLGB 1YZTA 5C35A 1LW6E 2ZB8A 3SIWA 3QFSA 2YJNA 3U7JA 3ZJ5A 5DV9A 4DSAA 3OA0A 3SZRA 3O6VA 2R66A 2GZDA 1L6RA 3ACDA 1Z5UA 3W7VA 3ZPXA 3G5MA 2GEJA 2OCAA 2XMRA 4FDLA 1SQSA 2R00A 2Q2WA 4LFCB 1UAAA 1PR6A 3EUFA 4YLEA 3TMYA 2HU5A 2VPPA 2JHAA 4MNTA 4UD2A 1ZD8A 2H8KA 2UZ3A 3K1ZA 3MBOA 4GOMD 1F9EA 3HLKA 5B57C 2NYAA 3G23A 5K03A 2VSFA 1AMOA 2EIHA 3HGMA 1I2CA 4KQ1A 2PKEA 4EUEA 1W29A 1JTVA 2H7XA 2R6ZA 3WP1B 1JKJA 1A7AA 1URPA 3B38A 2FPUA 1D6NA 3LVFO 2XYHA 1G9XA 1E8NA 4FZRA 1I7SB 3O8LA 1XTZA 2BCJQ 1C1XB 2BHTA 3F6EX 5J43A 1J7KA 3D02A 2IDJA 1QFXA 4M88A 4Z9AA 1ISMA 3F5SA 4X92A 1P81A 2R79A 5TJ9A 5FFFA 2WV7A 5L3RA 2GZSA 3QYPA 1TOAA 1MENA 4QBFA 1R5OA 4P08A 1QKKA 2LV8A 3IBCA 2V7EA 3JASA 1FLAA 4WOBA 3B7WA 1FYXA 4RE5A 4AT1A 1EAYA 1Y4SA 3GYBA 1KPGA 2GLUA 4P93A 3ZGVA 4EI8A 1W8DA 1X38A 2ZJYA 5L4NA 3QG1A 3NMUF 2LDXA 4D41A 1P44A 1MC8A 4DCCA 3CF4A 1LXCA 2C7GA 3C16C 2JATA 2ZSEA 2H9AA 1DQRA 1ODLA 2R85A 3F9RA 2A58A 4Q9JA 3SFZA 3S7ZA 1N57A 5D00A 3O03A 5LL6P 4YAOA 4C78A 4HQ6A 3DVAA 4IH4A 4ZEVA 1Z68A 2V58A 3BD6A 5BUZA 4OYHA 2ERYA 2ODQA 4P5DA 1FVXA 5JCZA 3UMMA 5I9BA 3ECCA 3LZDA 1PWEA 1VPEA 2ORED 3VVLA 4KGZA 2WKQA 4FE7A 4Q3DA 1K5PA 1WMBA 2WJJA 2ZBFA 2P78A 5JDIA 2O7QA 3OE7A 1Y4AE 2AZXA 5IEBA 2QE7D 1F8XA 2ODNA 2O7VA 3SZLA 2WNHA 3N7AA 4Q4AB 1SJ9A 2IYQA 2RHDA 3NBYC 3WV4A 1QH8A 1JBKA 2E49A 4LJYA 3NKLA 1SZDA 3DHNA 2PNFA 4CI0B 2GD6A 1KJZA 3PTZA 3LDFA 1UPCA 2QXTA 2PDAA 2BM0A 5IUNC 2P1ZA 3KO8A 2EBWA 4HUQA 3N7UA 1CP3A 1EU1A 1LLQA 3HGTA 1WB6A 4ILEA 3PCXA 4YQEA 2EKZA 3S2ZA 3TPCA 2IY9A 2FFRA 1XEXA 4QOSA 4L9WA 3PXDA 3V5NA 1PV1A 1XMVA 4LXUA 1Q2XA 3E4DA 2HA3A 4Z7JA 1AE1A 1PV4A 1BMFD 2IPMA 3O8OB 5C4GB 3TBHA 2ODEA 5KX5A 4U7DA 3NVMB 1TXGA 3D1VA 3W2EA 1HL3A 1BCSA 1H0KA 2VPTA 1OGYA 3ZBQA 4E15A 1KOGA 1SIUA 4MIOA 1Y4ZA 4IOLA 4JUDX 2P4HX 4K9KA 4W9RA 1SELA 4XIYA 4XLZA 1P7ZA 2QIPA 5ITZB 3QEKA 1Q21A 3NGMA 4MUMA 4P36A 4RJJA 2VJPA 4BNHA 3C3CA 3SE0A 3LW7A 4Q5IA 1C4XA 2Z2ZA 4B4OA 3DXYA 5ULLA 4UM9D 3QY9A 4WNYA 3P4YA 3Q7IA 4N39A 1HQKA 3M7IA 2V6JA 2EFJA 2YYYA 4OVKA 3DBLA 3I04M 2PE5A 3OD1A 2WNSA 1F2VA 1YZFA 2V8OA 4CKCA 2VJQA 1GYQA 1PEDA 4PNHA 5DN6A 1NXSA 1CQJB 4O5OA 1J2TA 1QFYA 3WJ2A 1M10A 4ZANA 1JHQA 3JQQA 3NPMA 4QRDA 5KUTA 3BORA 5F78A 1K6XA 1KAQA 2FFQA 4JXKA 3WLAA 4KQ2A 1NMYA 3FOZA 1E32A 3VU3A 3KCNA 1IDOA 1JU4A 1M8KA 3K94A 3QV1A 3A28A 2PUWA 2ZT5A 1WXDA 5JS2A 1F4VA 3K4QA 5DM60 5D7NA 1I94B 1HURA 1G6KA 2IEAA 5HWSA 1YDGA 3KM0A 5HBGA 5AKKA 2GKSA 1W36D 5COQA 2PMFA 3DDZX 4WT7A 5AJVB 3H05A 1IQUA 1DDGA 3MYRA 4UMVA 3JPYA 5K05A 1R6BX 3OZIA 4FMDF 2H7CA 4LOHA 3RS0A 3WGJA 1THZA 1Q6ZA 1XR3A 4AZ0B 2CYBA 1QAOA 1O94D 2I8AA 1TFUA 1MG5A 2ODTX 3B9PA 5BQ5A 3W6NA 3N87A 1PKEA 4PSAA 1XKXA 1U2RA 4I50F 3FPGA 2XB2A 2Q28A 4ENSA 4HL6A 2WWFA 1OB5A 1BFDA 2B1IA 2WT4A 4H3VA 1MPTA 2OEPA 2WPDD 1W9MA 2A3NA 1AC5A 5T8KA 1UUFA 2YJ5A 2QUBA 1VI6A 4X60A 4YDRA 3RANA 3U0BA 1ZD3A 5KKCA 3F6SA 2KX7A 3JWHA 1ZMRA 2JIMA 4NJEA 1U2EA 1U9IC 1PI3A 3AINA 4US0R 3PNPA 5JD5A 1PK7A 1VECA 4WLOA 5EWLA 2XAAA 3I32A 4EG0A 3W79A 5DLEA 3TX6A 4DCNA 3V32A 2ZJ6A 2RKOA 1QQ6A 2PMEA 5FUQA 3MHTA 2WLSA 3R7FA 1ZM7A 3QELA 4MHSA 5LD2C 1UXOA 1V1MB 1AUPA 5DK6A 1E64A 3VU8A 1U7TA 3O4RA 4RDIA 3TRFA 3Q7EA 4LYJA 4EPXA 4LJ9A 1A5AB 3I28A 5L51A 3KQHA 1FFWA 3QFRA 4YMLA 2H0RA 4IJUA 3L02A 4JYPA 1IZYA 1J8MF 3NWBA 2ZB4A 2ZQ5A 3QNWA 5CFPA 2UVPA 4C7XA 4LOLA 3VTAA 3AX6A 4XGIA 3VUEA 4DG8A 3DVAB 4YBRA 1PWHA 2Z5LA 5KYXA 4FGSA 1WETA 1QZUA 1NN3A 2QL6A 2R3SA 4IFEA 5DASA 3S6JA 1ADJA 4FDAA 1YA6A 3RC8A 1XDUA 1YS7A 1QIDA 2ZIZA 5JC1A 4INZA 1FX0B 4UREA 1CUEA 1KNXA 2X9GA 2ZATA 3BC1A 3HN2A 3PNSA 1VHWA 1NYQA 1PZEA 4ZU6X 3RC1A 4RXUA 5DCLA 1E5XA 1KQGA 3E9MA 2I7VA 2BKEA 3T3IA 4QDTA 5KPJA 1HLPA 5BNWA 2RI6A 1ZC4A 1S8FA 1XZLA 1NBAA 2JFWA 2VSNA 1I7PA 3DZGA 4BVGA 2NSYA 2FF5A 2JI8A 1E2NA 5LU8A 1W2GA 1PBTA 5EJFA 1NW9B 1ENPA 3PHLA 3ZW8A 2VYCA 2FA9A 2QXYA 3E1SA 5CVVA 5FJJA 3TSAA 3VC2A 3E5NA 3Q5DA 2YC4C 2G4LA 3TSZA 2RIRA 3T54A 5B1YA 3C6ZA 2PA0A 3OC6A 1X39A 2XMQA 5KIAA 3QNMA 3FGZA 4DA7A 2PR2A 5CCXA 4MKHA 1HFEL 3E3AA 4Y30A 3OLXA 5H82A 2ZU0C 1BDHA 1J9ZA 3MOIA 4P22A 3VR4H 5LR6A 1RTTA 5ALFA 1WP9A 4GX5A 2WU1A 1ZINA 1E8MA 2PBRA 3GCXA 2CLCX 3PHIA 1TI7A 1U1IA 2JEZA 3Q10A 2IBSA 4YREA 3T7EA 1FFAA 4ENQA 2GTIA 1GUBA 2DWQA 4ETIA 4TMWA 5E9JA 2UXDB 1QGOA 4FHGA 5EJ8A 3HR7A 1Z2OX 4JLKA 1K89A 3QQPA 1C9JA 3FPCA 3V6MA 1NBOA 1V4BA 4O2RA 3D2BA 2O2XA 1E3JA 1Z36A 2FEAA 1ZJ6A 4DRXB 4JBYA 4DPMA 1P61B 2J5RA 2WR8A 4R1TA 1XPUA 3AI7A 3L01A 1FJHA 1TYDE 1DE0A 2WB2A 2I8CA 1HE3A 2G9UA 5JXHA 1GG8A 2CEKA 3HI4A 3OIDA 1PZGA 1VJRA 1R3UA 3CNHA 4B3HA 1YDMA 1GZ7A 1GGNA 3WBJA 1VL0A 2YOGA 1JFFB 1SPBS 4YBZA 4QUGA 4JI5B 3TIVA 1REQB 1QU2A 4G1CA 1E2PA 1WDKA 4D8XA 5EXSA 5IAEA 4Q82A 4BZWA 2BEKA 3LBNA 1A0OA 1WWKA 4YP7A 3HCCA 2YN2A 1ZRMA 5BORA 3Q9NA 5K3DA 4DJTA 1U1FA 3IOMA 1OT3A 2BKLA 2H18A 3ZLVA 4DLXA 5K0SA 2CLDX 3BZBA 5EIHA 5LB2A 5EY5B 1JWBB 4N7BA 4N7JA 2V7PA 2MCFA 1CUVA 4UPEA 2IEDA 4W9NC 1N8NA 1LBEA 1M2GA 1VRVA 2W0SA 4AN0A 3FYDA 3GCZA 2XMBA 4RZSA 5JNWA 3N2YA 3RFUA 3PL1A 4QJBA 3FVVA 2EFDB 5AUPB 3U5ZB 5IKOA 4GPIB 1U0FA 5KVAA 3QNUA 1YU6A 5CJPA 5ENZA 1P3Y1 4ASUD 1KI8A 2OXCA 5IP5A 4UU7A 5DTEA 4EFMA 4IZIA 4P7JA 1RXEA 4UTXA 1CJTC 1PZHA 2JFYA 3B3FA 4C43A 2PX3A 3UC9A 4E21A 3QX3A 2VKQA 4O2AB 2EOAA 5DNCA 5IFKA 1H1TA 4DAOA 1P2VA 1SCJA 3DKVA 4RHFA 3ZCTA 1RHRA 1TJ5A 1WMAA 2P5YA 4RVHA 5TPWA 4LYEA 5M29A 4L08A 1REQA 3F5FA 3FZYA 1SBHA 4F2HA 5IDWA 1UBOS 1NC3A 1IJFA 3A11A 4LCJA 4RVNA 4XW2A 5JFGA 4FFBB 4DMCA 2QK4A 3TSCA 5C8YF 4X1OA 1QB8A 2BKAA 1BXRB 3WGHA 3WICA 2IEIA 4DCVA 1JBEA 4F93B 4QNMA 1XP8A 2VDUE 2OXFA 3DGFC 2GTHA 1WABA 3RVSA 1H2WA 2FMUA 2Y0BA 3I9OA 4JN6B 2P6PA 1PQ4A 3DV0A 4IJVA 3D8HA 2X22A 1FSSA 4W1RA 4AO8A 2NPIA 1RE1A 3PEEA 2J7PD 2GJ4A 1UINA 4R3NA 3PEVA 2ZAYA 4L76A 3HY3A 3I01A 2PCLA 1ZAKA 2QF7A 3P5BA 1SU6A 3NM5A 1ZIYA 2E18A 3RC7A 4PYMA 3BCRA 1KFKB 3U7QB 1NV9A 1IB0A 1ZMXA 2BGNA 4ND8B 3A6DA 4DCMA 1N1DA 1CSEE 3G85A 3HI6A 1BGVA 1QYDA 3HRIA 4F4UA 1SVKA 1PTJA 2Q5JA 4R6XA 4YCDA 5EXDA 4GR9A 4RL6A 4HGNA 4AWXA 5ARCA 1D1QA 5JVDB 1FNBA 2ZIWB 3KYBA 4MV7A 3D3WB 2VP6A 1EFRD 4QUBA 4R8KA 3QUQA 4UHCA 4CTKA 3A6FA 3H86A 4ZOLF 5K0LA 3JSAA 2GHIA 5C7YA 3MELA 1G8AA 3E3LA 4M87A 5A9TA 1TCAA 1U0HC 2IEGA 1NXTA 2ZT6A 3PXAA 4JLDA 3RK0A 1XXHB 3WOHA 2ZXEA 1ZH8A 4GI3A 1JG1A 5LDHA 2HUPA 2PJDA 5AWFC 5B3KA 5FNVB 3STVA 4FS3A 4DLAA 5HQJA 2O3SA 2OKCA 4CZ2A 2H52A 4RF2A 2N46A 5EN4A 4CF7A 1HDEA 2BDUA 1PR1A 2RGBA 1L7DA 5KREA 3KQPA 3LFTA 3FH0A 4ALNA 1R4MB 4D02A 5AW9A 1Z4OA 3RF7A 2FUEA 2BMFA 5HCIA 2YXLA 4QYSA 3B85A 3QV2A 3D54D 1JA0A 2QTWB 2ZRMA 3TOSA 2W11A 4RHYA 1F2TA 1P0PA 1TA0A 3OP4A 3QPUA 1LPNA 1ZQ1A 2D5AA 2I3DA 3MT7A 2FR1A 3H1FA 3Q40A 5DPMA 1JV2B 5AI9A 5C1DA 3COSA 4EKIA 2J67A 4TS1A 1NM5A 4CG2A 5FPKA 5IF3A 2LCQA 2NU8B 3DNMA 3RAFC 2PQ6A 1B6GA 2CZGA 2LIVA 2HADA 1J8YF 1GDHA 1LH0A 5NULA 3ANLA 3J81A 4GYWA 4GOOD 1QTRA 5I5GA 4WZBA 2C7VA 3I2IA 4YTEA 2ISSD 3PHJA 2TECE 3VX3A 4WOJA 1ZDMA 3JQEA 3UUWA 5C8ZA 3R7SA 3L0OA 4NL4H 4RJTA 3ENZA 4UKDA 5BW6B 3PVSA 1XQ1A 4M0MA 4HNTA 5EMHA 3KK0A 4IDFA 4AF7A 1RZRA 4JJ6A 1TM5E 5JQGA 3DO6A 1CQWA 3MAJA 1M6HA 2PD4A 3UG6A 2VHEA 2ZAOA 2FKAA 3LKZA 3W0LB 3EIWA 5DWVA 1T9BA 2BSAA 2OHOA 5I7AA 1ZNWA 4UEJA 2Z5VA 5EIBD 5LQDA 1UKEA 3JQ8A 1JEQA 3F6YA 3IKJA 1VE6A 3QXGA 4YY3B 4CLRB 1E2HA 2OV3A 1LV7A 2K2QB 3GN1A 4RULA 3A3PA 3PNLA 3KOOA 4DEVA 4H31A 1B0UA 3R4VA 3QLUA 4XPZA 3DOIA 3V9PA 1TPZA 2IS6A 3SDZA 4QBGB 2I65A 3NQ41 1OLOA 3MUOA 5TRTA 1DG9A 3EVGA 2RBGA 2AC2A 2AKYA 3H8VA 3HYTA 1X77A 5K3FB 3RAGA 4DNPA 5HKOA 4LZNA 1W5TA 5KYXB 2OK7A 5LIPA 4J43A 5HUJA 3UBTA 4QOEA 3WTCA 1XTKA 2AG8A 1DQPA 1KPIA 1R16A 1C7ZA 1R4AA 2GF2A 2PEYA 5DI3A 1J99A 3VBCA 1PJ3A 1VL5A 2X4DA 3C0KA 3UZUA 4ARZB 1VPTA 3WIUA 1JKIA 4RANA 1HPLA 2EZ8A 3VOAA 4AYTA 2D5IA 1OXKB 1XRJA 3RU9A 2BF4A 2P2DA 2Z6QA 2QTAA 1K5HA 2AFIA 5GGYA 1KYWA 1ZN2A 2AQIA 4YGYA 1DEHA 3RT9A 3AUYA 4J9UE 1GNPA 5CR9A 2DJ5A 1C50A 2CHUA 3CRNA 5TPWB 1G59A 4ZOCA 1WLSA 1J90A 3LZ6A 2GXSA 3ZWNA 5LQJA 4DA0A 3VO1A 4ZHQB 3C5EA 3V3TA 1PP4A 4IUDS 1OI7A 1AV6A 4EECA 1NF8A 3A4VA 5JAHA 3RHSA 3KHTA 3IEUA 4IDAA 3QEOA 3KEFA 3WKDA 5AIAA 1EK6A 4LJ6A 5BYKA 2C7BA 4NS4A 1RZRD 3NOXA 4FWTA 1KC3A 3HP1A 1RSZA 1P29A 4OA5A 4I4TB 1F4LA 2GM3A 1VJ0A 3SSAA 4HYTA 4IXNA 4TYPA 3BE4A 4PNPA 4RL4A 3C3DA 4DV5B 2B20A 3D7RA 2VF8A 4CTOA 1AZWA 1B7GO 5DM2A 1HZZC 4IJ5A 4QDJA 2HLDA 5E2IA 5F2KA 3RG8A 4DMMA 1LZLA 4C3UA 2AMYA 1JHZA 4DQDA 1EVKA 2ZYUX 2EP7A 4DNQA 1A9QA 1DIHA 2C5EA 1CQXA 4LK2A 4EL0A 1A2BA 2DEUA 3H5RA 3MSCA 1IXRC 3LTEA 3R5XA 4LDPA 1HRKA 2Y67A 2A33A 1GGJA 4EP1A 1HO3A 2XUHA 1FK8A 3LSYA 1EQUA 1KKLA 2RAFA 3R09A 3AERA 1Z0FA 3KVNA 3KQKA 3FTQA 3SOZA 4OFWA 1U5AA 4I6EA 1NVEA 4D9EA 5BR8B 1M73E 2O14A 1SHLA 3R1IA 2MOKA 2RHCA 2CLFB 2QENA 1Y8RA 2G40A 4C4XA 5EGSA 1DJNA 3A3KA 2NU7A 4NCAA 1SUPA 5JJIA 3FFXA 1XE3A 1KY2A 1Y63A 4N5DA 1RJWA 3T1OA 4Q34A 2RHTA 2A9FA 2VTKA 4BL5A 2PUAA 1XLVA 4BIMA 2X40A 2P8SA 2NUTA 2HA0A 4RD4A 5J4LA 2FPPB 3V2IA 4K3VA 3WGTA 1X1CA 4N3GA 4PR3A 2JLZA 5FAXA 1E2DA 1MABA 4KR0A 4FFNA 3UVEA 3PCRB 4Q9IA 2VXCA 4XOIA 4KDRA 1HE1C 2GM9A 2J59A 2O2EA 4RKWA 5ALYA 4ER7A 4ENUA 4ENPA 5LJLA 4EO9A 3U26A 2BRUA 4LA4A 1DAFA 4M1MA 4WHMA 5IVIA 1VFNA 4R41A 2AD5A 3NFRA 4IUCS 3JQ7A 2OA0A 2CD7A 4FS8A 3F3YA 2NUPA 4IQGA 3PQEA 3W5UA 1HBJA 1O0SA 2IEBA 4MW5A 3E3OA 3HY6A 5DYGA 3ZGOA 5HJ7A 5KMGA 4GUDA 5AQ1A 1H3NA 4Z4IA 3OFSA 4YJDA 5DTMA 3E5RA 1UXIA 4CQMA 2R2GA 3QPBA 5HVNA 3ZR4B 2QMYA 3F4KA 2I2WA 4FLMA 3HHEA 3VOTA 4URYR 2CMFA 2EBHX 4XOUA 1VLHA 4JBHA 2K7FA 4BVEA 2A1UA 4GLJA 3OJXA 4RKYA 1L7OA 3QFFA 1LRKA 3L40A 4UULA 1ZD4A 1ZNXA 4RKQA 2VYFA 2GEDA 3O47A 3DVSX 1Z5ZA 5HCUA 2V1UA 1RI2A 2VBGA 1VJTA 2I7CA 5A7HA 1M0WA 5JQGF 4GXRA 5LBUA 3M89A 3MERA 4NICA 3L7IA 4XIGS 1LS6A 4B8WA 1GPKA 2YRXA 3TTXA 4LF4B 4RPGA 1YA4A 2XZOA 1V41E 1WXWA 5CB4B 1EVQA 3A9UA 1F6WA 4B46A 1IDN1 1O6BA 1BFUA 2QUKA 3DM9B 2OO7A 2ILVA 3ILYA 3RRYA 4Z4CA 2WYUA 4S1TA 1GU7A 2VZEA 4RZ2A 1DVRA 3FTPA 3WLKX 2VAVA 2W0MA 3WHLA 4YT2A 5GWXA 3IQWA 1LPPA 4R1SA 4OXNA 2JKVA 1R8QA 1RVV1 4DC9A 2ZUTA 1QVRA 1GZHB 1QRTA 2VS1A 3NH9A 4ZZ1A 1Z63A 3R5JA 2NW6A 3VPHA 1KMHA 4CIVA 4E1AA 2A4KA 3UTDA 1OBCA 4EB8A 4ZZ0A 1GZ6A 3L93A 2HDWA 4LGCA 4US1R 1EFUA 3MLAA 5F21A 5C3UA 4LRTB 4QWWA 3HJTA 2NV6A 4JP2A 1K8YB 2RGYA 4KQXA 3ZOZA 4CKWB 2GAAA 1RHUA 2EATA 2WWXA 3H2HA 3W6OA 1E7SA 1XV5A 3H2GA 1E9VA 1HYQA 2DFKB 2MDTA 3K0BA 1C80A 4CKBB 3Q2OA 3OCZA 3QOWA 3NOVA 2QN9A 3CUWA 4DLUA 5H3HA 2NXEA 3PBKA 4KGDA 4JK3A 2GAJA 4GWGA 1OFTA 2I3ZA 1L7PA 2SCUB 3V4RA 4RZ3A 3CKMA 1KAHA 1Z08A 1I14A 1Z17A 5DHSA 1WCXA 4LYDA 3GGGA 3THRA 1T2CA 3OZTA 1FCJA 1IIBA 4JX8A 2YASA 2NU9B 2B69A 3RE1A 2RHLA 3JQFA 5CPBA 1P1BA 4KN8A 4N6OA 1CIPA 1WW8A 2VK4A 4G07A 4OEHA 4U7PB 1V5IA 2OCIA 4ARZA 3O8RA 4DSUA 2CJWB 3DAHA 1X70A 4MPPA 1D4OA 2P9FA 2NO7A 4H7FA 4G0VA 1UOPA 1Z5OA 3RV3A 2DHDA 4BFTA 4D9FA 1O87A 4KXLA 2DOKA 1NJGA 3BXFA 1W2WB 2AZMA 2OCPA 2R62A 5KYGA 4A6DA 4MR7A 1M66A 1FP2A 3BFKA 4AYXA 5JQWA 2XA1A 2WUDA 3IIKA 4Q3OA 3T35A 1GT91 3ORQA 1IN8A 1XL0A 1KZHA 2I0FA 4COKA 2I1VB 4J16C 2QRHA 3EFOA 2CNNA 4NSNA 1RYMA 2QX9A 4K0KB 3BYZA 4DBLC 2JLCA 2E48A 4UFOA 2C82A 1RRPA 5BMVB 1K7FB 5J4KA 1J5EB 3L0SA 1FW6A 4RTQA 3C3BA 4BO4A 5KTKA 2D3TA 3BE5A 2E5FA 2QROA 5C8YA 2QYHA 3O1HB 1RYNA 1T0JB 3H9JA 3IHLA 4TOIA 1BWRA 1I01A 3DP9A 4BPBA 2SKCA 2D54A 1C8BA 1HL7A 3O1LA 4UUOA 5I4KA 3GRUA 2F90A 5BYJA 3VDNB 3Q88A 4M4SA 4OHBA 4F4CA 1Z83A 2Y2UA 4N7RA 5DGCA 3QX7A 4HZIA 3M4YA 1H2HA 2FZWA 1LX7A 2JAUA 4CBVA 1N7IA 4W5QA 4L5BA 1U2TA 2WT9A 1RM3A 2L18A 2WM3A 3GRFA 4KRXA 3HUEA 4J4HA 4R1MA 3W1VA 2XEXA 3T7SA 4ZZIA 3D3KA 1PX0A 3PDJA 1QHSA 4FOOA 4CMBA 4R84A 4L9SA 1FXUA 2C61A 2W00A 1O5TA 4PLWA 4LWZA 5E1BA 5B3JC 1L5YA 5LUAA 4BNYA 1P0CA 1AKEA 1L4HA 4RKEA 3RADC 5AYVA 3ME5A 3IULA 5EP3A 2ZK7A 2FF7A 1GR0A 4DM3A 1FTSA 4EPTA 4AN1A 4BVHA 2ZUFA 2QMEA 2VFAA 2P65A 4UBJA 4NU0A 1MHTA 1HSZA 3A4LA 4WERA 2NXCA 2B34A 2W6NA 4AUEA 2C31A 3K0CA 5AP9A 1MQAA 1PS0A 2WA2A 1TW3A 1BA3A 4NTZA 3AHCA 3WXMA 4B35A 1ENYA 4HDQB 1K3FA 1FW8A 1PT6A 2ZOSA 1R64A 3DV0B 1XRSB 1DBRA 1ZY2A 3DD1A 3PQ4A 4LQLA 4Q7KA 1CKEA 1G63A 3DTNA 4BBJA 2IELA 3MRTA 1JEQB 4PC7A 1TT5A 4RFSB 4U7HA 4BO1A 1ZH6A 2QX6A 2D2IA 2VDPB 3SQWA 1AUOA 4KQFA 1SULA 2NYRA 3RUAA 3TI9A 1UKAA 2JFQA 2O3QA 2Q7DA 5CNMA 3QUAA 2XWQA 3GEIA 1A7JA 5KJFA 3FCYA 4MV5A 3VO9A 3SIPA 4TUYA 5CA0F 3N3BC 3DE2X 2X9VA 1E79D 1KMCA 3BT7A 1CPYA 2GRUA 3F49S 1XCLA 3D4LA 1S2NA 2I66A 3COPA 2PS1A 4DKXA 3OMXA 4DIUA 2AQKA 4Q15A 2G0AA 4RA6A 3BS4A 1XO1A 4QXOA 1Q50A 1EAMA 1I0ZA 3WB9A 4TLLB 3G2JA 3IOBA 4DDVA 1GG2A 2CXNA 4NFYA 3RR2A 5LLDA 3T06B 1LNSA 2OV2A 1J1IA 2FSVA 5DEOA 5TQ2B 4B32A 4C4SA 3JVVA 1VG0B 5L9AA 2CMGA 5AM4A 5ERYA 5FWXA 5FHRA 3LXUX 5LMUB 1VDZA 1Y6FA 4KXMA 1JZSA 5C8XA 4D5EA 3N59A 2PL5A 2VL7A 4H6WA 4QARA 1R0BA 3RYIB 4UDYX 1N9ZA 3OOEA 1OLXB 2XNDA 5C5DA 2IX9A 5EXPA 3IP1A 1KXZA 2DKNA 2GN8A 3W3AH 1X6VA 3G2NA 2BGTA 5D2CA 5I4BA 4H1UA 4UZEA 3VR3A 2ATIA 1WEKA 3K2QA 5CT6A 3G8DA 1DRKA 2Z5FA 3D59A 4PR0A 5KYUA 3IEIA 3W1WA 4J8PA 3B3AA 1P5JA 1AGRA 1FS4A 4BX0A 1Y89A 3NM4A 4EGJA 1NI4A 4KFTA 4RHUA 5WRFA 3V46A 5A5EA 3QYJA 3P9ZA 3HBFA 5A02A 4OAPA 1WPGA 3AM3A 3R3HA 1GTMA 1EX9A 1XU7A 1ZS9A 1MDFA 1SPXA 1BCRB 1F48A 2JAOA 2WFLA 5CLLA 4IVRA 1T6NA 4RVOA 3ZHRA 2PMWB 4HRYA 5H4HA 4DR5B 3ZNPA 2Y9MB 3ZH9B 4DJJA 3TW4A 2V0CA 4WZAE 3EAFA 2I29A 1M2FA 2WSMA 3BD9A 5B12A 1R0LA 4BB5A 1H4VB 1OJ7A 2PX2A 3PFNA 4DDKA 1HEUA 3HUUA 4HDOB 1Z2AA 5C32A 5IASA 3TG8A 3C3AA 4X20B 5HOQA 1E94E 4GD3Q 2ZRCA 1VE3A 2QL7A 3LBAA 4R1PA 4LK3A 1KAMA 3HCPA 2XGMA 2FZGA 3EJ6A 3LA8A 3QA9A 1U7HA 1XJQA 2QNRA 4YP9A 1GRRA 1J0BA 4DA9A 1SK9A 3L8EA 3UQYS 5C2JB 4NOJA 1N8KA 4WUVA 3ZE2B 1M0SA 4CL0A 4HQLA 2QAIA 5JAZA 2RJNA 4KDEA 4O0LA 1DXHA 4JKIA 3EIFA 1BS1A 1GYRA 3N9IA 3V4OA 4DCOA 2VHXA 2JLQA 3C74A 3KYJB 2GNOA 4QT4A 2JGIA 1ODKA 3HR8A 4BAZA 1A04A 1J0CA 2DTXA 2R11A 2GFIA 5A0TA 2BHSA 2R1TB 3I5AA 1N25A 3I53A 1PS9A 3K0HA 3OSZA 4MPTA 3TQFA 1MHPA 2R97A 3I8OA 5BSKA 5CK5A 1XPJA 3CEHA 4TQ9A 1JR2A 5EI5A 1CNFA 3KVVA 3D4IA 3W8FA 5JEEA 1JKMA 2AJCA 5A3QA 4OUKX 4EW2A 3PQDA 4WKOA 4HDRB 3S40A 1J1UA 1ESEA 3VZRA 1KQ3A 5KVSA 3R3XA 2ZUDA 5BT8A 4LNHA 3K0AB 2JA2A 3OQHA 4RSHA 3BWXA 2Q5HA 3QX8A 4GMGA 5FIUA 4HBGA 4P8RA 1EJBA 5CFZA 2HHAA 1E7RA 1BHQ1 4JGGA 4N65A 4G5FA 3AIMA 4CM3A 3KQNA 1GGHA 2BV3A 1N6OA 2ORYA 1X1TA 1T9CA 3HJCA 1HTWA 4TYYA 4YJ3B 3K4HA 3OZGA 5A1JA 2CE2X 1M34A 5H16A 1UZAA 1CR0A 4MZDA 3ZNNA 1ZH4A 4FDTA 4LZAA 3EZXA 1GNRA 4QLOA 3V4PB 1MOPA 4WFKA 5KC8A 7AT1A 2JBAB 4REQA 4G01B 1YD7A 3ZXUB 3PFGA 3UFXB 1QKIA 4L5YA 5FI1B 5KTMA 1EVLA 2X1HA 3HZOA 3OG9A 3ZY4A 2CLLB 2Q1WA 4OI4A 1Z34A 5ER9A 4GPTA 1U8ZA 5BRAA 4AF8A 4OQEA 5JWHA 3VJMA 1V96A 1CHDA 5LQRA 1MABB 2Y1WA 3O92A 1AB6A 4E3WA 4TKVA 1EZZA 3RFXA 2WQ7A 4RPJA 2V4ZA 1JHUA 2FWRA 1CFZA 1UBKS 1T8PA 3LDUA 3BSSA 1JFLA 2QJTA 4E03A 4IWNA 3L6OO 4MA4A 4NIMA 3QIAA 1MF7A 2ISCA 1FSGA 3ZHUA 2YN4A 1KYYA 1Y1QA 3EFEA 3GBPA 3VSEA 1CETA 1PT8A 2A1UB 2I6TA 2PKYX 2ZBVA 1W30A 2LNDA 1A98A 3GVPA 3PENA 4GR4A 4HAYA 4MSUA 3USES 4NYIR 1FLVA 4RK7A 2PWYA 2X2PA 4TL9A 3F7NA 1AM4D 1L7VC 3IOEA 2CNWA 1QRAA 3SYRA 1OHHD 4J0FA 4L28A 1BN7A 2D1RA 2PGLA 1JVSA 2GD1O 1D04A 3L7LA 3QLJA 4AWBA 1PNQA 1A5TA 4HQRA 3L06A 3HSKA 2ZBEA 3L8CA 4DNFA 2CCJA 3PFFA 3ZGLA 3EVEA 4OP2A 1FVHA 1Z4NA 3UBMA 2AJ8A 2BR3A 1DV2A 1FYVA 2QLFA 2VOJA 2RDMA 1XHLA 1K9SA 1YB4A 3LY8A 4I4LA 4JT9A 2ZYSA 4GRIA 1VFPA 4G1VA 1AF7A 3HN6A 1E1RA 3BRSA 1MEJA 2WJAA 1DIGA 1SBIA 2ZRAA 3AF0A 2W93A 3AV3A 3OJEA 3PFWO 2RHHA 3WG9A 2A7XA 2HLPA 3K8YA 1F60A 2GNPA 3BRWA 3U13A 4YP1A 3RH0A 1IYZA 3NTQA 4PM4A 5TS2A 3VU1A 3ASZA 5K3AA 2I54A 4DUPA 3MOGA 4ZCRA 3MWEA 3CZAA 4JIMA 1QAQA 1USVA 5IXYA 4LF5B 3LMKA 2YS6A 4DV2B 4PZAA 1BXGA 1LDGA 1MAHA 5IJAA 1G5IA 3OFVA 3H7IA 3GL9A 1L5ZA 1D7OA 5GIPE 4K81B 3LLUA 1ZN9A 1ISSA 2J9RA 3OQIB 3TD6A 1KO5A 2O1XA 3DZDA 3K35A 3KWLA 5A4MS 3U7FB 1I3MA 3KRTA 2A67A 4AJHA 4LISA 1JAYA 4YONB 5IANA 3I1JA 3QP9A 5JC8A 3FCUB 1U4OA 4CL8A 2WKPA 3OD5A 4DFDA 1PAUA 3PUVA 3HB1A 4CLEA 1O6CA 3E6AA 1SZPA 4JA2A 5IAGA 1SG0A 2GD0A 4HXGA 1G2PA 3PNQA 1A9OA 1OROA 4PZUA 5KWSA 3NETA 3NVKI 3KAPA 1RPJA 1SQ5A 2J41A 3ZW7A 3L4JA 2X2FA 1TM7E 1Z4QA 2ECQA 1Q1GA 2IYVA 2JGNA 3I83A 3RSCA 2BI7A 5EZSA 3DEZA 5REQB 3S81A 2G5GX 3OIYA 3NHBA 5JROA 1FDWA 1H1LA 1O7JA 1UMDA 3EF0A 4P4TA 1PUIA 3G2MA 5LZ8A 2UKDA 3K0AA 4ZT6A 3O2QB 4EFDA 3DMFA 1LVUA 4E2FA 4EKGA 5A4JA 2HPHA 4QQRA 2BDTA 1R9JA 1QQBA 4K7JA 4Y2XA 1H2AS 3QU9A 3AY7A 4ZVLA 1CVRA 1F6DA 1MCZA 4PX3A 3RRJA 4MRAA 5CLIA 3LY7A 4PYRA 2AVNA 2EKBA 1XROA 1EVEA 1IATA 1GTG1 5F51A 3RJ9A 1W6UA 3EDMA 4CODB 4DBZA 2UYQA 3NP7A 1U7XA 2CB0A 1FQJA 4OGLA 1OXSC 3VUFA 4B7XA 3JZMA 4K8RB 3TZQA 3URMA 2NMVA 1F38A 1KXJA 1OKKA 3P9RA 1XZCA 1SCUA 1XQYA 5JLJA 1OCEA 2ZW9A 4MEAA 1Y6QA 4AMZA 1XZFA 3O0DA 3UH0A 5C7LO 1DPFA 4I81A 1TVKA 2RG7A 3NRJA 4RPKA 4OM8A 5B58C 3ZC3A 4F3TA 5AUNB 3VI3B 2FP4B 4AULA 3KB2A 1NJ2A 4KH0A 2PRIA 4TV9B 5DRYA 4UUAA 1EP1B 1ORWA 4J0DA 3OFND 3IAFA 4O5AA 5EZQA 4MRVA 1OC4A 3MJHA 3FDZA 4NP6A 4LEIA 4BUZA 5CLHA 3VM6A 3WGUA 1JHYA 3ZDCA 2ZI6A 2ZU6A 3MW8A 3BKWA 4LBVA 2XY4A 2WMYA 3WNZA 1NYRA 1TPYA 3OWXA 5B64A 3FPBA 3FAZA 3QHAA 2RI0A 4JJEA 3BILA 3V2HA 3ZQKA 5TF0A 4AXXA 3V8PA 2DQKA 3BK1A 3R76A 3KLNA 2X5JO 5K8VA 1SBTA 1N2JA 3G9UA 1CXZA 1RBQA 4MLZA 5JANA 2A84A 1ZJYA 4IRMA 1PQUA 2BKUA 2W2KA 4MVJH 4NCNA 4JXZA 2RK6A 1SXPA 4BJ1A 2HQ1A 2XQFA 3PR2B 1PFKA 1MX5A 2BFDB 2I62A 4A23A 1ECFA 3P45A 1XTUA 2YUTA 2FKNA 4D97A 5A04A 2OCLA 4YT8A 3DJFA 3GW8A 1JLMA 2C9OA 5LP6F 3CX8A 3FPHA 4KAFA 4UAJA 2O2SA 4UCWA 3SPXA 3DH0A 1YZVA 3AU8A 3FVQA 1CJMA 3HV0A 4TVSA 4ZK6A 2DHRA 4JENA 2GETA 3QMPA 5CX1B 4C7BA 2NU8A 1WHTA 3L84A 4RMHA 1EVIA 2C4KA 3RQIA 2MIIA 4EZIA 1JR6A 1SWWA 1JSCA 4XUDA 3MS4A 1I3LA 2FQWA 1KBZA 4BQNA 4B2PA 3SR3A 1XU9A 1OC2A 4N3BA 4DMGA 2H3HA 1IWBB 2XMSA 3GAZA 3GQVA 4IHAA 4C4YA 3DSRA 5EP1A 3ICPA 1M7HA 1TTQB 1RPAA 2J3JA 2COKA 5KSZA 4XTCS 2M6SA 5KZMB 1U3DA 3KKNA 1FYWA 4PYOA 3TLGA 1BW9B 2AG1A 1UDWA 1VXRA 3DOFA 3LIPA 5DHPA 3DBHB 5F98A 1WX1A 2UVQA 3HDGA 2G5TA 1AKNA 3N75A 5F5NA 3SKVA 2Z3VA 2HYIC 3AR9A 4GWLA 1DAKA 2SECE 3CTPA 3BTSA 4BNUA 4EKDA 4EATA 1XMXA 3FPEA 3COWA 1QMGA 5GVSA 5D1HA 1G8MA 3UO8B 1CUDA 2ZSJA 1E4VA 3I0ZA 3KOZA 3T41A 4IIJF 2FRDA 1WE2A 5L4LA 4KXFB 4LRYA 2OENG 5GIOE 1KOLA 4PCVA 4EG7A 1E69A 3H83A 4X7BA 2DR0A 1LV8A 4QATA 3CTMA 1CP2A 4X45A 3ZE1B 4AF6A 2F9FA 3GGSA 3QW2A 1E0SA 2OVFA 3HBNA 4C0JA 3BN3A 3Q6NA 4B84A 2Z8ZA 3JQAB 1E9AA 4ESEA 5HZMA 1YS6A 2IZZA 3N0RA 4J7AA 1X8KA 1IK6A 1N0UA 2NACA 5EZ5A 1EXWA 2JB9A 3DL7A 3W5HA 1YQDA 1KERA 1HEIA 4ND7A 4I4TA 5G1NA 4AECA 1V9CA 3NHZA 4MVJI 1D5WA 2AW3A 3GZJA 2YXBA 3C48A 3DAGA 3F47A 5CDUA 1A9XB 4X6UA 1EUCA 3EEYA 3ZU4A 1C30B 3GELA 1CQIA 1GTJ1 2IIBA 2X2EA 2ZZNA 3TTWA 1AZSC 1VG9B 2DBYA 2MJLA 2AIRA 3AJEA 3O4IA 3Q0IA 4K9LA 4ZO7A 3U62A 2EQAA 2J3DA 3AHGA 1NXOA 3GN2A 4PYIA 4CIAA 3H5AA 1YBVA 3MJRA 5C18A 3BAFA 2HB6A 2VP0A 3PKZA 4XZ3A 3OHSX 5DLYA 2C04A 3L7BA 3CWZA 4OPMA 1DRWA 3FCEA 1N6KA 2FETA 2VDQB 3QKIA 3VPAA 1DADA 4CCWA 3WAGA 4WXRA 3OWOA 3MQFA 1L4YA 2VHYA 1RBZA 4DVGA 1J5PA 2X5OA 5HF8A 4RHXA 1YS1X 2X8LA 2ZJ7A 5HTKA 4BX8A 3M0EA 3KX2A 2GNAA 5CT4A 5DRTA 1MW9X 3L04A 4Y2QA 3WIOA 5EEGA 2ADOA 2R9VA 5JSFA 3OTIA 1E0JA 4FBMA 1L8XA 3PFKA 5F4BA 1A69A 3TR6A 5IKMA 3LP5A 3N39C 4MYHA 2E4YA 3CR7A 3UWKA 8MHTA 2Q50A 4URFA 3EQ9A 1S3IA 2EQBA 5HQTA 5MHTA 1X74A 3LT0A 1OX4B 5A05A 5LXTA 3RRFA 1UBGA 3N2EA 4N82A 4AW9A 3AG6A 5THQA 1WQ3A 2DFVA 1R10A 2V0GA 1R00A 3D6VA 4C06A 5AK3A 4EIWA 1Z16A 2GCOA 3EF1A 3V4VB 1UKBA 1PJSA 4I1SA 2AJBA 1NN5A 1DAGA 4AMBA 4PBSA 1OHHA 4OXXA 1AHNA 2HNBA 3DO8A 4MKZA 2FUNB 1BX0A 3RD5A 4B74A 4NRDA 2PZGA 1TU4A 5TQ0A 2FPSA 3HB5X 2YS7A 1CEXA 1I5EA 1Z7EA 2FK8A 2XWPA 5EE3A 3H8JA 4MV4A 4UXJA 3PNOA 5TDHA 1L9KA 3PXGA 2ZBRA 2XD9A 4UFNA 1ULZA 2OUKA 1U28C 2P90A 1RKUA 3TWOA 3BEDA 3BHMA 1JG6A 1FU4A 3OCYA 4OH1A 4JQYA 4URHA 4Y2RA 5HF9A 5ALTA 2VAMA 2X0EA 3RIMA 2CE7A 1ZN7A 1NPTO 5A4AA 4QREA 1RTKA 1JFRA 2XI4A 3GRKA 3INTA 3LDAA 1FFEA 1Z22A 2F8MA 2WJ3A 1L7RA 5CP8A 4CUJA 4EPRA 5GONA 2G9QA 3M82A 2P3LA 4OKIA 3GVIA 1KYZA 3MJTA 4F2DA 4KR9A 1II8B 1F06A 2EDCA 1RLMA 3LQKA 1J39A 1SKYB 4I99A 1R3DA 2R8BA 4H0NA 4W6QA 3NLLA 1KH3A 5KU7A 1R1DA 3RYCB 1XCOA 4TXMA 3E9EA 1PSZA 4R68A 4Y6PA 4DR2B 3IV7A 1T4CA 1UT8A 1IOLA 1L4EA 1DLJA 4O4HF 5DEIA 4Z9YA 4N8EA 4J49A 3M4NA 3QYFA 3UA3A 1C9DB 13PKA 1R4NA 1X9GA 4HB2A 3QWBA 4WA7A 4UMEA 1QANA 1P74A 1KJ8A 2GF0A 2DF8A 2H59A 5EZYA 2XCOA 4H3KB 2IHYA 3KWFA 3NHUA 5TMDA 5ESRA 1VM6A 4A3SA 4GLFA 1BGXT 2OFOA 4RJLA 4Y6RA 3IT1A 4HNAA 4KQ9A 1KBQA 2D2XA 3U49A 2FZKA 2Y1EA 2Z30A 3I2HA 4JA0A 4DDHA 1N6HA 3O5AA 3SEQA 2JFFA 1K86A 4ZVOA 1LKZA 1GL3A 3QI2A 1NWHA 4QU5A 2PD3A 3SXUA 1FMFA 4LXTA 3ZV5A 2PWAA 3PE4A 5HSGA 4JKOA 4XPIB 4LC1A 2AFHB 5ERXA 4YRCA 2IK8A 4MOWA 3RU3A 5AVVA 4G0WA 5BWLA 4MKIA 3UHAA 1NN1A 2AN4A 1VIYA 4TKVB 3KNZA 3KPVA 4PC3A 1W7AA 1KO1A 2BSXA 4KV9A 2ZJBA 5A3JA 4MMZB 8OHMA 4BKMA 5I7OA 2MSKA 5K4AA 2HWWA 4B7CA 1PVOA 1VKZA 4D9MA 3MIZA 4NENA 1J8FA 2AXQA 2NO4A 3K8QA 2C84A 4GP7A 1KF0A 4U4AA 3MAAC 2A9QA 3RUCA 2DP4E 2FYTA 2IRWA 1N75A 1DCMA 2L82A 2ZJ3A 4TMVA 3QGMA 4IDEA 1SUBA 2C0CA 3OJLA 1NBEA 3Q7PA 3AQ4A 1MGOA 2A0WA 4K6GA 2F8TA 1N0WA 4FM9A 1DG3A 2EERA 2LKCA 4B45A 5KYYA 4EY6A 1DC7A 1NFQA 3IAM1 1UMBB 1YK1A 2BFFB 2BGJA 3U9SA 3P9KA 4EW1A 4UAVA 5LQNA 1CZRA 1ZICA 2OG2A 3KJFA 3GRYA 4UEQA 1XMJA 3OOWA 2F3TA 4R7ZA 16PKA 3LGXA 1NOIA 3L0BA 4IV8A 4LCEA 3ADKA 1T6XA 2NU7B 4DLSA 1VA4A 4MW4A 1DWOA 5LA6A 4F4DA 2VC2B 4K5QA 4OP1A 1D3AA 4WH0A 3T5CA 3KBOA 3ULKA 5I7VA 3R3UA 1G2QA 4URVR 3ZNOA 2I6UA 2FJUA 3G49A 4PNZA 2PGAA 5JCJA 2KYRA 1WXFA 1Z6QA 2FG5A 3P0JA 5J2UF 3ZZTA 3C4QA 1YV9A 3LC1O 3VV2A 1LSJA 2WFAA 5B6PA 1IBKB 3LUKA 4HBZA 8LDHA 5J4YA 5E2BA 1T4MA 3GMTA 1PS8A 3K9WA 4TT8A 5AJTA 3ZWVA 3K7EA 5GM1A 2GJAA 2DAPA 4RGQA 3BB4A 3CH5A 1Y5MA 3IXQA 5BNIA 4CKZA 1O97C 1FYFA 3LYUA 5HIJA 4A92A 4NH0A 3GLIB 1P31A 3ZQUA 1IN1A 4IQFA 1JPNA 3PX2A 2Q6KA 5AXBA 5FKJA 5JDCC 4B82A 3IFSA 4LKOA 4XDHA 3UB3A 4NCBA 1LSUA 1R9MA 1Z4MA 3DE6X 2B5WA 3I9V6 2VDMB 4U2FA 3VZBA 4C3VA 4XI9A 3T9EA 4AKEA 1HLDA 1M54A 2ZVQX 4Q0MA 4TMFA 3TUJC 3ZW9A 4EZBA 1MV5A 3DL0A 2HWXA 4P3NA 1V7CA 1RZUA 1XEXB 3GVHA 4HMPA 1QZXA 4XFJA 1JFFA 2CV1A 3B6MA 2EW1A 5C8VA 1JW9B 5FUXA 4Q3NA 4V0RA 1DKMA 2JGAA 2OBFA 2R25B 3KJNA 5BW4A 4IGKA 2GZHA 5CX4A 5JS8A 4Z51A 1HF3A 3DCYA 3ZHZA 7ABPA 2YFKA 3ESZA 1YE5A 2RGCA 1SD2A 2ZBUA 4GZMA 4MCAA 4BV2A 1F51E 1NVBA 2IZOA 1ZVQA 3CCFA 4L73A 1DFIA 2KWIA 2F1KA 4NAHA 1U3FA 4BFZA 4O2LA 1YASA 1N0IA 1VIVA 1GZ4A 5KU1A 4OH7A 3VAZA 1MIOB 1I5RA 1WDTA 5CH8A 5BR1A 3HJFA 1V0JA 5CBPB 5FI5A 1SM4A 1VXOA 4FEGA 2HMYB 3CCCA 4PRZA 1VLZA 2RCNA 3IUNA 4G5YA 4G9EA 4MO2A 1U6JA 2W2XA 1Z4KA 3LTNC 4BLTA 2PX6A 2AOUA 3TINA 2OFFA 3GLSA 4BJ5A 3E9ZA 4QU8A 2QRJA 1HV8A 3ZQ4A 3KWMA 1HI9A 4C4RA 1DRJA 5JYDA 4N0MA 2HTFA 5CVUA 4YJ2B 2I6QA 3DZIA 1QG4A 1EDBA 3GHYA 2QN3A 4W82A 4ARVA 4RNDB 5UKDA 3KV1A 1LBSA 3EULA 3IRVA 3NBXX 2BEJA 3N5KA 4M1WA 5JADA 4BNNA 1J42A 4IF6A 4LVUA 1VL8A 4Q1DA 2JGJA 3FNBA 4F3RA 5LMZA 1GLVA 1V95A 2WSSD 4XEHA 3TNYA 5E9QA 1VTKA 2E1PA 5TS3A 3UT5A 4E88A 3EQ8A 2GPTA 5I3CA 3AB7A 3LKVA 3SBEA 4JJGA 3LA6A 4D80A 3ZWCA 1APBA 3K6SB 3M1YA 1FFXA 4Y2HA 3RNLA 4OSPA 5DH9A 1X9HA 2HK8A 3BBPA 3DE1X 2CLSA 3O8BA 4R2XA 3WFJA 3NKVA 4ZKDA 3IQFA 4AUKA 2ZQYA 2HMVA 2Q5LA 5FWDA 3TQTA 5J2TA 1YCHA 3PV0A 1D2RA 2HQRA 5GONF 4NV0A 5CLJA 3LNCA 2QYSA 2FFHA 3LT1A 5LOVB 3KTFA 4LUCA 4XLTA 3EBPA 2QTFA 1G5PA 2XD4A 3ITNA 4V3CA 4D96A 1SVSA 2JHGA 2P0YA 5L3VA 3DL2A 2ZANA 1TUBB 2MSWA 2VDWB 4TSFA 2FZVA 3RHTA 3BB3A 4DBLE 2C07A 2Q5EA 5FBKA 2PG3A 1NVVR 1TUBA 2VDWA 3ICVA 4MRMA 3H42B 3QY0A 3W2HA 4A8HA 1GARA 1WU8A 2BFAA 3KZXA 3TYXA 3VPFA 1PR5A 1RAGA 5JD6A 4P4NA 4G8CA 4ZALA 1S3GA 3LOUA 1R5NA 4DDTA 1JNYA 1LRJA 3MFQA 4BLRA 3RSOA 4WJLA 2NIPA 2Q9UA 2VRCA 3LBIA 4LYAA 2AFHA 1L3CA 2PS3A 1UJMA 2CL7X 3BIFA 4BLUA 1P1CA 1QO0D 1XLTA 1Y34E 4L3OA 5EC8A 2V9ZA 1DMSA 1NJ5A 1QS0A 3TOVA 5LQSA 4KW7A 5DCWA 1H2BA 4YP5A 3FDIA 5F12A 1DXQA 4UE3S 4A73A 3V8EA 1E3QA 3P94A 3OZXA 3ZKAA 2G06A 2H1RA 3K8ZA 4A0HA 2FW0A 2VSXA 4KFSA 1ND5A 3PUHA 3ZJUA 4HNQA 3W05A 4QDUA 1B93A 4P54A 3ENKA 3QVXA 2HT1A 3HL4A 1N2BA 3TL3A 4GZ3A 5A6SA 1SC4A 3ANMA 1XBTA 3QTTA 4I36A 4ND8A 4NPHA 5EHIA 1U1CA 3TTVA 2V96A 4XM0A 4AZ3A 1II9A 4MVWA 4AK9A 3NATA 4F6RA 4NCHA 4DCUA 1I1NA 4KR3A 1G2IA 4E2XA 2BGUA 4M55A 4CU2A 1ONOA 2ZRBA 4NK5A 4TTVA 3TM5A 2CNWD 4U3JA 1Q2UA 3L8YA 3CVWA 1L8AA 1QGAA 4CIYA 1JLLA 4LRUA 4E5KA 5C7IO 1GCOA 1LZKA 1HYGA 2NG1A 3AESA 1AURA 2FR0A 3UAYA 2GGSA 2Y0PA 1XA3A 3GAMA 5CURA 3R7NA 4MITA 2RSLA 3ESXA 4HWOA 5BVHA 3K1JA 4I3HA 2G82A 2QNBA 4CM4B 1L9XA 2H3EA 1QX4A 4BP8A 4BIIA 3D7NA 4EB6B 4AZSA 2WTBA 3QXXA 3AEQA 5KDLA 3U56A 4R51A 2W2TA 3UK7A 2XUOA 4BFCA 3OLYA 1V6SA 2QRGA 3NHRA 2XKBA 4HX2A 4RH1A 5AI4A 1GKYA 5L3QB 4ZEMA 2C4MA 4DDMA 1Z88A 5IT0A 2BD0A 1YL6A 1UIRA 3P2EA 4Y1RB 3GGOA 4QHTA 3WYBA 2PZJA 3WAJA 1DQSA 1EBFA 1KWGA 4EG1A 1N33B 1YBHA 2JGMA 3CO5A 3GFVA 8ADHA 4HXEB 2D1YA 4TV8A 5EPOA 3VNRA 1BMTA 4OAQA 3ACCA 5DHAA 4KQKA 2HC9A 4LNUA 1R6VA 3F0TA 3W8NA 3AO0B 3FPAA 3PC8A 3ANTA 3OPXA 3AGQA 3ZLUA 1I13A 4AKSA 1PJ2A 5AHOA 121PA 5JXGA 1CUIA 8ATCA 3PEWA 2IKQA 3TMAA 5TPZD 1LW7A 4TS4A 1NT2A 1N6IA 3F67A 3JQ9C 3U6KA 1W0CA 3D8SA 4PZCA 2GOYA 2QUZA 4IHJF 3F90A 3CZCA 3QBTA 3VXKA 1KDZA 2O1EA 3SAJA 3QVGB 3TRDA 2D5BA 2C5BA 3UYKA 3FRHA 2OHFA 3QXSA 4FPXA 2VH2A 1H23A 4Z53A 3U7IA 4MQBA 3UQZA 3AKEA 1L5OA 4CM5A 1TFRA 1P7YA 1G2OA 2C00A 1Z5PA 2UYGA 4MUEA 3QVSA 1WAMA 3QOXA 3LV8A 2XNJA 1VL1A 2XIQA 4GIBA 3PRKE 2ECPA 1FRZA 1XJ0A 4I5EA 4CM9D 1ORVA 3O3NB 5FRDA 2Q7OE 4Z6KA 4E31A 5JAIA 1KY3A 3R44A 2C2KA 1CUAA 1FUYB 1H8ED 1IHOA 2JHFA 2Y6UA 2Q8QA 1BWQA 3TOXA 5HX7A 4N0QA 3SHWA 4ZJYA 5KCMA 1V3VA 2YTZA 1RM4A 5FA8A 1PZNA 2I3GA 2QTVA 3GLGE 2ISQA 4PFSA 5K8JB 1EFHA 1D1PA 2MSCB 2YZ7A 2VDVE 2EKPA 4GDFA 4TKLA 4MIKA 4BCCA 4ZD6A 1KORA 4IIXA 4B4DA 4GL4A 1P2DA 5HTOA 1DCKA 3VYSB 2BTOA 2Q5FA 5FTJA 1SC6A 1WPQA 4RMNA 4WBSA 2BF7A 3DMNA 3ROZA 2FOXA 4MUHA 2R8OA 1X94A 7REQB 2AR7A 2FZCA 3OPVA 3UMYA 4F7DA 4RBNA 5D85A 1COWA 5I7HA 3MPOA 5ISMA 1UPXA 1EHYA 1OOEA 5KNDH 1YQQA 2VK1A 1UBCA 2ZE7A 3C14C 3IPXA 3LPMA 3CU5A 3S1SA 3ZBPA 5CFMA 2AEEA 5BWNA 1IIRA 4DR3B 1F1BA 1M8JA 3I6QA 1JQBA 1PWXA 3GR6A 3H19A 5GZ6A 1M2KA 2VK8A 3E8SA 3M9XA 3N74A 1RWMA 1U65A 2G6BA 3OJOA 4MI6A 5SZHB 1K88A 4XRRA 3SJUA 5BSTA 4BQQA 3WYAA 1WPRA 1DX6A 2XECA 4PPQA 4Q1BA 3CA8A 1MJHA 4LTMA 1GTRA 5JFTA 3NJRA 4ND4A 4P86A 5C51B 2W42A 1HH4A 4MWGA 2HDNB 3HFGA 3UEOA 3L1IA 5BUCA 2O8DA 2H4FA 2QAGA 1EM8A 3ZCXA 2I99A 1MT3A 3DUWA 2ZXUA 5T4BA 1Y9EA 5ALHA 1YVDA 1U6KA 3WLFA 2YZ2A 4IVPA 4J1NA 1VLJA 3KXPA 3PVZA 4OFXA 3NXKA 2XE6A 3QIVA 4QVGA 4UM5A 4BNXA 3NWPA 2J3HA 2EKQA 3QWAA 1V47A 2A9KA 3RKSA 2Y0DA 2QTLA 3W8RA 3N8IA 2OCBA 1DWQA 5HGXA 1KHHA 3VHQA 1K3UB 3N28A 2VN8A 5LM3A 1H2EA 2O5CA 1WXGA 3SQNA 4RA9A 1SOAA 2F7SA 1WUYA 2PO7A 5HDQA 5IBPA 3VAYA 2W71A 2VP2A 5I3ZA 4A16A 3CKLA 4ECAA 1ND6A 3O75A 2I34A 1C3XA 1U0RA 1WZEA 1IOZA 2GYVA 3RVQA 1TJNA 1HMYA 2TS1A 1XLUA 2KW5A 2J48A 2W6ID 4Q7EA 1K5GA 2JGKA 3W5DA 1R2QA 2ZJ4A 5LD2B 4S12A 3FB4A 3D8RA 3I8SA 3IDQA 5L53A 4I1PA 2ZIVB 1PGNA 1WU7A 1ZSYA 2H1CA 2NT3A 2OZKA 2QT1A 3DOHA 3NCTA 3NM6B 4F9GA 1AK1A 2FTKE 4KMMA 1AOXA 4RPHA 4ZI7F 1BJKA 4KR6A 4EMBA 3IDSA 2JJ2A 1MFPA 4L0QA 3FUTA 3TPZA 3LJKA 3RASA 2RFLA 5C4IA 5CB8A 2ZTSA 1K2VN 1T0IA 4YCCA 1RR6A 3VPXA 3PB3A 2DBVO 3MTEA 1ZXBA 2B35A 3EFBA 1GV1A 1U3CA 4RENA 4X5OA 1OA0A 2I1WA 4HOYA 5K3BA 4EVIA 1ADBA 3PPIA 5T67A 2ZZKA 5CJJA 4OI1A 3ROTA 3BKXA 3V2GA 4RJKA 4CQJA 4I5IA 3NXSA 3DTVD 2FVXA 4CF4A 1QHFA 3LCUA 3U4IA 4NZ9A 3QXJA 1Z7BA 5F1KA 2A5DA 3VPSA 2V0NA 4DIEA 4E0BA 4YQZA 1KJWA 3NORA 4AJJA 3ZCRA 4CUZA 3LQRA 3VV3A 4LDNA 3EZ6A 5A5GA 2FU5C 2A2ZA 3OZWA 1NMQA 4M0EA 4EKNB 1HDCA 1WMDA 2YXNA 3EUWA 3FUCA 3GUUA 2QW8A 4JC8A 4JBNA 1W1WA 2JFGA 2YIMA 2BZ0A 3HEAA 4JJFA 2I8LA 3DT6A 2QV0A 4G84A 2YICA 4HSGA 4J3NA 1KEEB 3HABA 4O3FA 2QD4A 5DX1A 1XZPA 4PIPA 3SIXA 5KNBH 4CI9A 3C43A 4BMXA 5M2QA 1NF3A 1QO0A 4MULA 2BBTA 4FZ5A 2W90A 4UUBA 4OGGA 1CS0A 1K27A 2ZP1A 3QVJA 4CMAA 1ZGGA 2GQ0A 2FZEA 4JJ4A 4A6PA 3EXFB 3GMSA 4ZCIA 1PL0A 4W8GA 1P1HA 2XPCA 4IXWA 2OAEA 4HHEA 2XCIA 3IB6A 3NNNA 2ST1A 1X7YB 5EQJB 4ZT2A 5K45A 5IBRA 4GKAA 3IAM6 3IAUA 3LLCA 3OETA 4G0OA 3DLCA 4G37A 4X90A 1JJFA 4BLQA 3FYUB 4LCBA 2FHSA 4MQMA 2I33A 5DMHA 3ZCPA 4EI7A 2JLVA 3I45A 3V7UA 3IERA 1P7WA 3GFGA 2HBYA 3KR2A 3KJXA 4RPCA 3GJ4A 3HRKA 3IA2A 3H9QA 3U4AA 5IAJA 2WJIA 4XASA 1A76A 4CN8A 4OHXA 4C6TB 3VA7A 4HRXA 3ONDA 4ZCLA 5C81A 3BJZA 1NXVA 3A6EA 4M9SA 1NSYA 1IAQA 3A10A 1PT7A 2FQ1A 2QG9A 2WVJA 3BERA 4PSCA 5C31A 1YI0A 3SYKA 4E07A 3LOPA 3RS2A 3K6RA 3N0VA 4QULA 1GP2A 4Q4DA 4TZTA 4BMDA 4ZEOA 1YMQA 1HT3A 2EF0A 5KQMA 3Q8MA 2QRMA 4QG7A 1KJJA 3JD0A 1A4IA 3C3EA 1LC3A 2EARA 2WZQA 4B6RA 2Z43A 5G3YA 3OVMA 4LI0A 5AW5A 4P53A 1QPBA 4XR4A 3ZCQA 5T7BA 5KYVA 1ZUWA 1E6MA 4H4DA 3RT7A 4UEWA 1B43A 2M9MA 4Q3CA 1PEAA 2VQDA 1SUIA 2Z4SA 4EF4A 4K86A 2GK7A 5TB5A 1JB9A 3A04A 1T9KA 2DHCA 1PJCA 4HDNB 3PIRA 3W7BA 1XC7A 4FFWA 4JC0A 1ZMOA 4R9VA 5KTPA 2JDID 4BMSA 2XOKA 2G88A 2IEYA 4LF9B 4KMSA 4KUEA 1W0KA 5G3ZA 1GJRA 2AQ8A 1WDWB 2OV4A 1XXHA 3EDYA 1AQUA 1RKQA 3P2OA 5DSTA 4L2IA 4ZVPA 1D2HA 3THYB 4NMXB 2WQ6A 4KR2A 1KFJB 1B76A 2HMTA 3O4FA 1JKJB 3LWDA 3FJYA 4PLYA 1YCFA 5FBZA 2C83A 2XCUA 1EQ2A 1ABEA 3BIXA 4B6OA 1CUSA 3EASA 1WDLA 1DBWA 2MSDB 3IOCA 4M1OA 4GH5A 5F7JA 3SF8A 5DE3A 5B4UA 4XGKA 1M2HA 1GQOA 3I4LA 3THOA 3TQRA 4U2CA 4K05A 4RVUA 1RKVA 3GZ4A 4JJ8A 1UXHA 4XWGA 2FPGB 5TY0A 1AZLA 3U7QA 3PUYA 4Q21A 3ZHYA 4ESOA 1FYDA 4FDMA 4RJ2A 4Q9AA 4WL0A 4HC4A 3T0IA 1TQ2A 1O0BA 3BJIC 4DZTA 1PK9A 3BXZA 3JASB 2PEZA 4QFMA 1OPXA 1X8JA 2B1RA 2NUTB 2P2YA 4MB2A 1HNZB 1K4KA 3GP5A 2IH5A 4YR7A 1VI5A 3OEEA 3ZTWA 1WV1A 5B6IA 5I7EA 1W5BA 3PNVA 5FQOA 2WZDA 1GA1A 3OPYB 2ZI4A 4U6QA 4BCBA 4LI3X 3K05A 1BNCA 3EMBA 1KMNA 5AQEA 3TPFA 4O02B 1YBAA 3TTYA 1KI6B 1E63A 4CMJA 2N42A 4Z9BA 5ADVA 4MA0A 1W5AA 4YPFA 3H5WA 1ES9A 1BU8A 1E3IA 3QA3E 2CC2A 5KC9A 5K2OA 3WLNA 3ZJYA 5HIKA 2WUGA 4BAGA 3M6WA 4LY3A 3L6CA 4IJWA 4YUXA 3NUGA 4R9UC 3I1FA 2HDHA 3T34A 2ONCA 2Z6UA 1XA4A 4GXQA 2JBAA 2FSFA 1XZQA 4REQB 3H11A 2WF6A 4UUNA 4FFMA 1J1ZA 1UWCA 1V1JA 4IG9A 3F9IA 3A6PC 4F4JA 1NR5A 3FMPB 3WADA 4BKPA 3HWSA 3ESCA 2YRWA 2QVCA 2QSZA 1IQ0A 2WIBA 4MCHA 3JD3A 3NBUA 1KK0A 2W2VA 4H1VA 1G8JA 4O4HB 1E7QA 3R7AA 3JYQA 5IX8A 4LF7B 4IIYA 3D43A 2VDOB 5K2MA 4ZGBA 2AOTA 3IBYA 1NAIA 1XGKA 4R40A 1OMOA 4EY5A 4Z1OA 3G1WA 4KZPA 3FX2A 1B26A 4ZVSA 1CUCA 2JIZD 1YTLA 4YX9A 1QU3A 2J8ZA 3KQWA 3LD9A 1GDDA 2JLYA 2QQGA 2B2NA 4LX0A 1XD8A 3X0DA 1H3EA 1IZ0A 1E3DA 1ICIA 4JLNA 4WCFB 2H00A 3WZ2A 4BU1A 4JU8A 3LECA 3VU0A 2Z57A 5DBFA 3A9RA 5TGZA 3WO0A 3ZU2A 4E08A 2I67A 4IHJB 1QGED 5E7JA 3GJ8A 1TTPB 1HQDA 2NO0A 2BY4A 2WD9A 3DDOA 3TUZC 1S2GA 2EFEB 1NULA 2FMFA 3GGCA 3VYVA 1KRWA 4TYMA 1IUPA 2MSEB 3PA6A 3OO1A 2HGZA 2OMKA 4WE3A 1BVHA 5EWMB 3S29A 5EVJA 3KE9A 1QYCA 1RYHA 1UDCA 2WI8A 2Y6VA 5L4SA 3AIKA 3M1IA 4FKMA 4KE6A 1KU6A 4N03A 4WKCA 3CLSC 4NZMA 1D07A 1U8XX 3EDQA 1M8PA 1A97A 2ADFA 3DVRX 1T6YA 1Z7YA 2G7ZA 2JIBA 3A14A 2AHOA 2GEUA 3A1EA 5INTA 1E4EA 4N76A 1HYEA 4BEBA 2DCUA 2P1RA 3AZQA 3G3EA 5FBRB 1EUYA 1CJBA 1I4TD 1WPXA 1HWYA 1ZLYA 4M7RA 4NV1A 4F5EA 2LIPA 4TUYF 4F5WA 2MSNA 1RQRA 4IEEA 4DCTA 1HT0A 3TFOA 2X7HA 1S8AA 3DEJA 4DADA 1DU4A 2BGGA 1XCGB 5E6SA 2W2QA 3DFIA 2VCYA 3E2MA 3UMVA 2IHKA 1PL8A 4BQSA 1FOEB 2FDCA 1PWYE 4AKTA 4Q4LA 1YONA 3HY4A 1L7EA 4WXHA 2H5LA 1ZM9A 3ES9A 4Z49A 3ZCUA 5TPZA 4KPUB 4NESA 3FN4A 5CNIA 3T5PA 4AMVA 3P9XA 1YRQA 1FJGB 5JSUA 4EJ2A 1A8HA 4EHBA 4ZGGA 1X7GA 3AR3A 4MZXA 2PS9A 3T3DA 5CFNA 1WL8A 2POQX 3GJ3A 2IOQA 4HWSA 1JB1A 3AWIA 3DF7A 3JPWA 4A0GA 1Y7IA 2CJFA 3QE9Y 3OPNA 1X1EA 4WTOA 2RHWA 5KTRA 3K9GA 2R87A 1UKVY 1F0YA 3BG5A 2HCTA 1CLEA 3EWAA 5ITWA 1YA8A 4A4DA 2ARKA 5I8WA 5AM1A 5DM4A 1KYVA 3AFNA 4CL2A 1VGVA 4LBZA 2FGJA 3OJ0A 5KHAA 3KQYA 3JRWA 1ML3A 3CZ4A 5FTLA 4HR7A 3BZWA 3IS3A 4HAWA 4HWTA 3VR3D 1USKA 3UJHA 3P27A 3FFTA 1LJLA 2ZI5A 1NMEA 3GROA 3QBVA 4EUHA 3MINA 4OK5A 2OFXA 2WPDA 4YAEA 3NHLA 2XNDD 2A3RA 2I2DA 2ZS9A 5FOSA 3R5SA 2C5FA 3NBAA 4HMQA 3X1DA 2BGRA 2D2FA 2NAFA 4KYIB 1F2UA 3M9LA 1VE1A 2JI6A 4P0PB 2BEVB 2OBNA 2UVDA 1IN4A 3P1JA 4HZUB 1VLQA 4L6IA 4OQXA 1QF6A 1DAIA 1YMVA 1DIRA 1G6HA 2PSJA 4X8MA 1QLHA 5K6RA 3BMCB 4FCCA 3GAFA 2H4WA 4RPLA 4BE9A 3LWBA 4FCTA 1TK2A 4KUGA 1QFJA 2JFHA 4OK3A 3GEBA 2DTEA 4RV4A 1NOJA 3FHCB 5H80A 2FSGA 1FB5A 1YZKA 1US8A 3URKA 2WV9A 4I9FA 3WIVA 4OQLA 2BKXA 3DLPX 6CHYA 4GECA 3MGKA 4IIBA 3U7RA 5AI5A 2ZWAA 4RXMA 1WW3A 4EPYA 1EHIA 2YHBA 2OSVA 5ALNA 3SBXA 4BC0A 5SY9A 4YAIA 5AK4A 1NURA 2IZ0A 2OKGA 3Q5GA 2PTHA 4BJ6A 3F6BX 2AYYA 5ECWA 2PH5A 1E6WA 4AJ2A 3A37A 3N86A 5JXWA 4FGZA 3PIIA 4OG2A 1V7ZA 3OCJA 2WE7A 2V03A 4PGAA 2JLUA 4D4LA 3EQ7A 5E6RA 5FX2A 4OQMA 5FD8A 5AVYA 1YBMA 3D6HA 3I5MA 1JUDA 3BGIA 4RACA 5CU7A 1C3EA 4DA6A 1YZ3A 3MGAA 4JELA 3THSA 2PN1A 4IZ6A 4M1KA 1MXFA 3GUHA 4K0RA 3FPKA 3RIYA 1B41A 1H22A 3JYHA 4EF5A 3WK9A 3LPNA 2VTDA 3INRA 4JD5A 3GZNA 2AUMA 2BFOA 2ODWA 3DO5A 2PKRA 4J7CA 3PZBA 4NCKA 4EELA 5LKRA 5IYZA 1G4UR 5IVDA 4BO3A 5LVAA 2FPMA 1PVDA 2Y4NA 1YJ5A 2I7DA 3R7DA 1QYRA 4GZLA 1UBRS 5GY7A 1LI5A 2QI9F 3TRKA 2B99A 2PZKA