2VXBA

Structure of the crb2-brct2 domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
225
Chain Sequence
LIFDDCVFAFSGPVHEDAYDRSALETVVQDHGGLVLDTGLRPLFNDPFKKLRHLKPQKRSKSWNQAFVVSDTFSRKVKYLEALAFNIPCVHPQFIKQCLKMNRVVDFSPYLLASGYSHRLDCTLSQRIEPFDTTDSLYDRLLARKGPLFGKKILFIIPEQGQKALAHVYHALALGADVEIRPNVAHLECDLILTMDGNIVDETNCPVVDPEWIVECLISQSDIST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DNA REPAIR PROTEIN RHP9
publication title Structural and Functional Analysis of the Crb2-Brct2 Domain Reveals Distinct Roles in Checkpoint Signaling and DNA Damage Repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 57
structure length 225
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2vxbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2vxbA01
2D8MA 1OQAA 1Y98A 2COKA 3JVEA 2AZMA 3KTFA 3FA2A 4BU1A 3PC8C 3HUFA 1WF6A 3I0MA 3QVGB 5ECGC 3L40A 2E2WA 4IGKA 3PXEA 3U3ZA 2COUA 2ETXA 2EBUA 3SQDA 1IMOA 1L0BA 3HUEA 3K05A 3AL2A 2VXBA 4U4AA 3AL3A 2EP8A 3SZMA 4BMDA 4N40A 3K15A 3PXDA 1KZYC 3T7IA 1T29A 3PC8A 3T1NA 1L7BA 2LE0A 3OLCX 4BU0A 2NTEA 3K0HA 4JLUA 2JW5A 2K6GA 3PC7A 3PXAA 2ADOA 2DUNA 1T2VA 2INGX 2L42A 3II6X 3K16A 3L41A 4Y2GA 3T7JA 2HTFA 3K0KA 2XNKA 2COEA 4BMCA 3QVGA 1GZHB 4Y18A 2VXCA 3EF1A 3PD7A 4IFIA 1Z56C 3PXBA 3PXCX 2R1ZA 1N5OX 1T2UA 1JNXX 3T7KA 3UEOA 3UENA 2XNHA 3PC6A 2K7FA 4ID3A 4XQ0A 4XPZA 2M2IA 1T15A 3L46A 2EBWA 1IN1A 3I0NA 3EF0A 3SHTA 4OFBA 3PA6A 3SHVA 1CDZA 2WT8A 3COJA
chains in the Genus database with same CATH superfamily
2NVWA 1TJ5A 4M2LA 1R4AA 2GVNA 2ALJA 4EB8A 1V8OA 3RV3A 4ZT5A 2P62A 2H9IA 1C1DB 4RSGA 1DBPA 2FTKE 5CDYA 2J0VA 3AKYA 2G1PA 4R2IA 2O1XA 2IQIA 4DUGD 2ZIWB 2EATA 3LO5A 3EB9A 2NTNA 2Z8YM 3K7EA 4EQ6B 2ZTLA 1SOWA 3JQPA 3MMXA 1E0AA 3BCRA 5LWHA 1N5MA 3U49A 1PFWA 4EW6A 1UJNA 1SMKA 4YGYA 3I0MA 4ZVUA 5KIAA 3IESA 4FJ2A 2B3TA 4JJAA 1KDPA 1I6LA 2B4KA 2ZI4A 3DT8A 4B3RB 1K3UB 4TKUA 1JHXA 1LD3A 4OHBA 3BILA 1Y4SA 2QRMA 1CNMA 3UJDA 4O4JB 1NUUA 5ECDA 3VJLA 6LDHA 3HPQA 4E3WA 1L5KA 2ZIXA 4NP6A 1RE1A 4LHEA 4PLPA 5BURA 3HLTA 2FY8A 2XQVA 4OFWA 2ZB2A 3EZ7A 5K3FB 3K0CA 4ILKA 4MS4A 3T06B 3VPAA 3H1BA 2H00A 5DWQA 3KSZO 5LIRA 2Z30A 2FFHA 3ELWA 4K26A 4NFYA 3PGXA 1RIFA 4K9OA 4FR0A 5EUCA 3U2QA 4HLDA 4TMVA 1RHJA 3FPLA 3D2AA 2V6GA 2MWMA 2NTEA 1YZGA 2DGDA 2ASVA 4ZT4A 3WLAA 1JFFB 5FQOA 1GFSA 5IARA 3L0DA 5GOTA 2AOTB 2QG9A 1PR3A 4RXTA 2Q99A 4BFWA 3DCYA 1KFJB 2Y0PA 3A3YA 1QQAA 2OV6A 4RMIA 5FUXA 4AJNA 2I66A 5LZ9A 1ULBA 4BFZA 1ZCBA 2W2MA 3FNRA 5FI3A 1Z5NA 4ZOLB 4ZTZB 1ILEA 5J4LA 3U44B 3PLRA 1GUZA 1S3GA 4DB4A 3D7SA 4B6GA 4IJWA 5E3IA 1RWQA 2W70A 1U0EA 3M9LA 5DBGA 3RWBA 5I8WA 1CV2A 2WSYB 3NWBA 2GPTA 1KKUA 2HJRA 4JQYA 4TRRA 1J70A 2YJNA 3DP7A 3O21A 4C2UA 3ORFA 3TXAA 4DLWA 1GO2A 3IT0A 3ZWQA 5FEUA 2FN7A 4TROA 2BMFA 2REQB 2JLCA 3F3KA 1G21A 1NONA 4UHEA 4DUYB 1FLDA 3TLXA 3R6DA 3UAOA 5DLQC 4OKSA 2ZUFA 2BC9A 3LPMA 3RIYA 4KQHA 4RLFA 2HR1A 2CNBA 1IN7A 2XYVA 3IQDB 2VN8A 4CDNA 3ZD6A 4JLAA 4R83A 1W93A 1KQ3A 3AU8A 4NCHA 2QN3A 1MX1A 1ZXBA 5HOEA 3MD9A 5B2ZA 5HIIA 2H1OA 4LF4B 1C4XA 1X7GA 2C2HA 2Q3CA 3RUDA 3T1TA 1QRSA 2EARA 5A9SB 2CD7A 1CC1S 3OE4A 4GOOD 3WKDA 4D0SA 4B45A 3BB4A 3AL0C 2X14A 2YZ7A 3OSUA 3M49A 4EG0A 2WTAA 3DONA 1E1RA 4JYMA 3N2EA 5FCDA 3PSHA 3NBQA 5THQA 4BUJA 3G1TA 1I7SB 1P74A 2HA7A 4IRUB 2OCDA 1RHKA 1PSZA 1XL1A 3D8NA 4DT1B 4NHOA 4CM4A 1MC4A 2ETVA 4GDMA 4WZ6A 4EJSB 1GPUA 3L1IA 4Q18A 4DSNA 4F6CA 5LOVA 4DV2B 4C3UA 5ALIA 1M67A 3DPUA 2OZKA 4DV3B 2COKA 2LZ0A 1E4EA 3ANNA 3JQDA 1AM4D 1NW3A 2OG2A 4FYKA 4UAVA 3NOQA 3FA2A 3BMQA 4YRFA 3E2PA 1Z0JA 4B7UA 3G5MA 1R6BX 3KJXA 3HUFA 4WFQA 2Q6VA 3AI1A 3OIGA 2IHUA 4TM8A 1GUFA 1XQXA 3B5EA 5ECGC 3RK0A 1MX9A 3PWKA 3AGPA 2R6HA 3IUBA 2EHDA 2HTEA 3ZTYA 4R2XA 3IR6A 5AJWA 3ROEA 3VNVA 4RX1A 1XU4A 4NF2A 3LY7A 5B1YA 2J4DA 1ZC4A 4I1SA 4OY3A 1LZLA 2FEKA 5J43A 1OH5A 2VWQA 2E18A 1O97D 4UW9A 4OFXA 3F6PA 3DOCA 1G41A 4US2R 1Q50A 4LQ4A 5JARA 3HB1A 3K9CA 4MR7A 3W5HA 4XGIA 2RGGA 4C0BA 5EKDA 1TZCA 2PSHA 4O4LA 2BP7B 2Y3IA 3SC3A 2B4YA 4F3CA 1PEKE 1RLUA 3S70A 1J2TA 2PX4A 5GQSA 3B3QA 2BOVA 4BKUA 2I29A 4KK3A 3UC5A 3B1JA 3H2GA 4JR1A 4UDNA 1HDCA 3FZYA 4CUKA 1ZVKA 2ID7A 4EFDA 1P4HA 2QMEA 4FC6A 1VGQA 4Q1FA 1V41E 2CLIB 3HZHA 3JD2A 5EXDA 1X19A 3OPMA 3USCS 1ORTA 1XHFA 2FCAA 3H9GA 1FSPA 2BUAA 3TRJA 4MW5A 4ZEWA 3HU3A 1GPLA 2NVUB 1P8JA 4D98A 2G0NA 1ADCA 1X3LA 4OQNA 1DVRA 4RJIA 5E4JA 2UAGA 4L5JA 2DJIA 3JD1A 4QXMA 4B85A 1B2RA 1DNPA 2PWAA 2PZGA 3O84A 4HGRA 4JSYA 4M7OA 1NVKA 3ZGLA 4JR0A 2QB5A 4G4GA 1C3EA 1CJUC 1U2RA 5JE8A 3QOXA 3S1LA 3STVA 2JCSA 1Y1TA 4YK7A 4MJLA 5LZ4A 1WUKS 2BFBB 3NDIA 1UADA 4NMWA 4WZAE 5JUWA 3BRSA 1QFMA 5EAIA 1CXZA 1L3IA 5AKYA 3TCKA 4D4LA 2PJRA 4C4OA 3NWPA 1IHDA 3I9KA 3T9DA 4C05A 1BCRA 3H17A 2EZ4A 2VI5A 4Y2HA 2C5AA 3BJEA 1H2BA 2AMJA 2F9FA 4UAUA 4L9WA 3GH1A 4D4KA 2ID9A 4BO5A 2D7JA 2F9LA 2ZRNA 5CYFA 4HBGA 2G63A 3OUTA 4CIWA 5K0BA 5KJ1A 3DR5A 3ZDBA 1YDGA 1WSDA 3D43A 1DAIA 3PDWA 2C92A 2HF2A 3W8RA 3PIRA 2WWXA 3PFWO 1E5LA 2OG1A 1SNYA 4TYPA 4F3TA 1CDDA 4OAQA 3IR7A 1TIBA 2D2XA 3KAPA 2H4ZA 4AMZA 1PFUA 3PEEA 5A4KA 2GASA 2QVXX 1EEHA 2AN3A 3DKPA 3F7MA 3QLUC 1B0AA 2ODBA 1OZAA 4PQYA 1PT9A 3GDGA 2DUJA 3QQPA 2CUKA 3M6IA 4IEIA 4S12A 1U0BB 2AFIA 3BRWD 2GBCA 3B1XA 2IYRA 5GJWC 1E6KA 1C3LA 2EKLA 4CXMA 3AZPA 4MV5A 4XWOA 3C3BA 4NEQA 1JYEA 1ZHOA 2Z6AA 4GI2A 1QCCA 1Z3IX 3PU6A 1G1AA 3CGWA 3LYUA 3CSUA 1RWWA 2JGAA 3C8DA 1DQYA 1LBIA 2FMXA 2NQ8A 1IIBA 2DKOA 2ZBDA 1IE3A 2OENG 2O52A 2JEZA 1PR0A 3D54D 3IOYA 4RLQA 1GZDA 4IM7A 4PRLA 4TTRA 4MROA 3SNKA 4FWTA 1CE8A 5BWLA 1N36B 1IC6A 3QIAA 4G9EA 2FW6A 1DEHA 1IEVA 1IXSB 4TTTS 1NZJA 1NFQA 2ZB4A 5HM6A 2LCFA 1RM0A 3N1UA 1BWSA 4QOFA 3G6KA 4BRSA 3N0VA 3OZXA 2Y1KA 5D5QA 3HGTA 3ZDYB 5KSWB 4DLAA 4KFUA 3NC1C 3AKCA 4Q12A 1ZZGA 1UZAA 4OGWA 4GXTA 2PA0A 1VXOA 3FF1A 3Q5GA 3AL3A 4LDRA 4DUPA 2O0HA 4YLGA 2QSYA 3TLKA 3V5NA 3UHOA 1G5IA 1MEOA 1A9ZA 1NYLA 3PXDA 4F4FA 3TX6A 2VTBB 1T29A 4FD3A 4HNRA 1PU2A 4C5BA 3G0HA 4UHKA 4RGBA 4IHJF 1N6HA 2YL2A 3N8HA 1XCLA 3R0VA 3CU5A 2VRCA 3U6BA 3CX7A 3E48A 4QOJA 1X1CA 3V7WA 2C04A 3QXHA 2QXTA 3M2TA 1Z7GA 1GV1A 5KSYA 1V8DA 5IAOA 3K9FC 3KYJB 2GPBA 4UMDA 4DJAA 3EZ2A 4QUKA 3R74A 1YQXA 4L08A 1QYVA 4COOA 1ZM3A 1MFZA 3BBLA 4HUJA 3AINA 2PYDA 2TMKA 3OJOA 3PFNA 3PQCA 3ZTTA 4CI9A 2AGVA 3PQ5A 3H8WA 5KNDH 2BPOA 4QXRA 2H65A 1FRNA 1VE3A 3KQYA 3EZFA 4JP8A 3G2PA 5HE8A 2ISCA 4ATNA 4D56A 5KNBA 2XZLA 4BKQA 1GGVA 1Z0IA 2WWVD 1JAZA 1M1ZA 4D26A 1IIRA 1Q77A 1WPRA 3IAAA 3SHFA 3OWOA 2DE0X 3VZRA 1ONBA 3RHZA 4DY6A 4WZBA 5DK4A 1IBLB 4EK9A 1QUFA 2VF8A 1U9CA 2PKWA 4NBUA 2QYTA 3ORQA 1EZZA 1I7PA 3AW8A 4J0JA 1U7WA 2AJDA 3HYTA 5MN4A 5C8YF 4MV3A 4PC1A 4IQ0A 3GXBA 3RAPR 4C22A 5JIBA 2H2IA 1U3FA 3UXEA 3OFSA 2O2GA 1QQ5A 1R8SA 2GYUA 2J31A 5BVGA 3UA3A 3N86A 1EXDA 2W6IA 1DS6A 4YMHA 2D74A 1T2UA 1UKBA 1C1XB 1NXVA 1IEXA 2EVWX 3JQ7B 3QH4A 4OHXA 3W1WA 3ZWDA 1J07A 3TZ6A 4KQIA 3A06A 2K7FA 3HJUA 3CH5A 2H2DA 3ENZA 3TSCA 2DHEA 1CERA 1KAMA 1RP7A 4RQAA 2A92A 4D44A 3CUUA 1SBCA 3IR5A 2JGKA 1DJOA 4NBNA 4L16A 4RETA 5L9AA 5HMMA 5CFRA 1IY1A 1ZP6A 2J9FA 3BTUA 4S1TA 1W30A 4HNAA 4PLWA 1GNPA 2VRBA 2VL7A 4RGQA 3OQJA 4M8IA 1EX1A 2O0KA 2FVXA 3KX2A 4ZOBA 5LP6A 1OZFA 2Z9CA 4NYIR 4URXR 1RZRA 1HYHA 4HB0A 1JI3A 3AEQA 1CUVA 1NHGA 2BD0A 4Z4IA 2ZEJA 5T6MA 1DO8A 3AUKA 1ZBQA 4EAAA 3FHTA 1SBTA 3KKZA 2ZJ5A 1M1NA 2J32A 3SX0A 2VF2A 2HHAA 3AV0B 3CF2A 4KR2A 2NTYC 3H9EO 4QQFA 1OTHA 5ADVA 5IAAA 1XRSB 1FVHA 2GPAA 4DW8A 1O57A 1EWYA 4JWKA 4N6NA 3V8RA 5H16A 1X0XA 2O2XA 4NBWA 3Q4GA 4O0LA 4QUDA 4GM4A 1KP3A 2ZE8A 3BEOA 3FGZA 1HE4A 3SF8A 1T36A 1QGDA 1VE9A 3BYZA 2G71A 1WVMA 1CUSA 4MQFA 1NVTA 1BN6A 4PTYA 1F6WA 1KXJA 2YVLA 2RH9B 3FSRA 4HH0A 4HO1X 3U19A 3VOAA 5B53A 3TW8A 3LKBA 1WCIA 3GJYA 5ALVA 3F8WA 2X0EA 2YN4A 1I4EB 1G8AA 1I7NA 1U28A 1RQRA 2YW9A 2HHJA 2ZW9A 3AF4A 3QEMB 1COWA 4M1SA 4TLMB 4DSTA 1L8LA 3LPDA 1D03A 1DWQA 1QSGA 2J8ZA 2Q1YA 3DAHA 5LYJA 1NU8A 1II9A 1ID1A 5DXAA 4KR9A 1R74A 1NZFA 2J1LA 5FBZA 4DNFA 3KYCA 4DQKA 4O2AA 5E1BA 3URMA 2I4MA 4NQZA 5FHRA 3E9ZA 3N2KA 1Y5NA 4BO3A 1N92A 2Z2JA 4PLFA 2H85A 4BEWA 4UTNA 4LGMA 1GG8A 3VKHA 1OTYA 3KZ1E 4JLUA 5JATA 1H5QA 3IGFA 3LZDA 3DTYA 3ZHRA 3ELYA 4NBLA 2V5AA 2OUKA 1RPAA 1AXRA 1B8OA 3DMTA 1DDIA 1OI3A 1T8WA 1UDWA 2OP1A 3IULA 2E4AA 3KEGA 3FBGA 4MUNA 1Q0SA 3IOMA 2ESRA 2FPIA 4IVRA 2WI8A 2ZETA 4GLLA 1K5GA 4LTNA 4U00A 3OZEA 4FYMA 1B16A 4B75A 1T0UA 5CUQA 1MRNA 1ABEA 4Y2GA 3RC2A 2I7VA 2O5EA 1QQ7A 1ZU4A 3Q3HA 4YIKA 2B92A 2HRRA 2P2YA 4CETA 3RUHA 3GJ6A 4KFSA 3Q2KA 5E38A 5JDIA 1QPBA 4S3MA 5FUVA 4KE6A 2O4UX 2DU8A 2RI6A 2I0FA 3NBYC 1EP1B 4UHHA 5TQVA 1YJAA 4HYQA 4LTMA 1TW2A 2EKDA 5K3SA 1XEAA 3TZLA 3UKJA 4L5AA 1OPXA 1J1IA 1E2QA 2ZM5A 3SP1A 1QX3A 2CL0X 1XZGA 3LP5A 4WLNA 2NXJA 3DW1X 1BXGA 1J0BA 4BNDB 1M8KA 2H2WA 1LDNA 2I4LA 3IAS1 2GN2A 3JATA 5AI9A 1Y34E 1GL7A 1W4ZA 2XTNA 3S99A 5F2NA 2IHKA 1H4VB 3R24A 4ZJYA 2OQVA 3FMFA 1VJGA 3EDCA 5JS7A 2GDZA 2IYAA 4KUHA 3VYRB 1GPMA 4BLPA 3KE9A 4XCQA 2X4LA 3F1KA 3ML1A 4HC4A 5FLEX 2HBZA 1T43A 3TGWA 4XDYA 4X66B 1G6OA 3BN3A 2ZZMA 2GEUA 1CVRA 4MQBA 1CKEA 1PS8A 3KSMA 3KD3A 2RIRA 3OJEA 4YRKA 1VLLA 4AYXA 4XVHA 4KDFA 5A5DA 4GMFA 1AA6A 4CIDA 2I1WA 2E4WA 2PMDA 3G0IA 3HI6A 3KOUA 4EY3A 1IN5A 2XOKA 3DZGA 3GB9A 1NVGA 4OLJA 4P0TA 5HEKA 3AWDA 3TR0A 4D8XA 1XLWA 3JSAA 3COZA 3WLSA 4EDFA 2R7MA 2KX7A 3BSSA 3FRHA 3SOPA 3RVQA 2BBWA 5TPWB 3ZN2A 4GZ3A 5KWSA 1EUCA 1HETA 3BTSA 4OUDB 4LCBA 2GHIA 1P5HA 1XCBA 4E51A 2H2FA 2YHBA 3TR6A 1UXIA 1PBNA 1XJ5A 1ECGA 1Y9EA 1BXZA 1FRFS 3ELDA 4CG2A 3UTDA 4EB6B 4DTCA 4WEOA 5DBEX 4G4JA 4OU4A 3VTFA 5JH7B 3TAHA 1G20A 1RJ9A 3ANMA 4MDHA 4PFKA 3X1ZA 1RAEA 1WG8A 4R7TA 1ZIPA 4UVDA 4UVEA 4WINA 1C7IA 3G85A 2O2YA 1Z0UA 1EGVB 2GPSA 4K0RA 4ETNA 5BW8A 2ACWA 1U63A 1IHUA 5K0NA 3TQCA 3NETA 2MYNA 3WLKX 5FEMA 1RQGA 3WL3A 2X6TA 2PE5A 4IEFB 3X1JA 3NDPA 2VDPB 3B36A 4DBZA 3SFVA 4NOMA 3ABZA 2YY6A 3HM9A 2ZTMA 1EG7A 2JASA 2Q50A 4UEWA 1BRMA 1YFJA 4JJ7A 3R9IA 1U0GA 1A9SA 1VDMA 2HMUA 2JFUA 1GZSA 4LWOA 1P17A 4UZFA 4WJZA 4H7JA 4LN1A 1CJVC 1K7CA 5CJJA 3O3NB 3G2MA 3I04M 2FYTA 1KOGA 3MOIA 4CM9D 3JAWB 1GR1A 3C3XA 1J23A 5G40A 1D8TA 3QVWA 3OZDA 2PL1A 4BO4A 1GKYA 3SBDA 4DRXB 1T2VA 1MPXA 2GAAA 2L42A 1N5DA 3NKVA 1UK6A 4IQGA 4MRNA 3BD9A 4HB4A 5ULLA 4D41A 5K0GA 4QUHA 4TZTA 4BX2A 4JBGA 5EHGA 4IHJB 2M32A 2B78A 2BFFA 1BOFA 5EJIA 4EKGA 4G5YA 2ODAA 2YOFA 4BQFA 3L41A 4M1TA 3AF5A 5KAPA 1Y5RA 4ANFA 2VSFA 3V80A 4JVSB 5TS3A 2QY6A 4L4UA 1CW2B 4LXGA 2BM1A 4QLBA 3AUFA 3IO3A 1HL7A 2PKRA 4HNTA 2IYVA 1A3CA 4N8EA 4BNJA 3SIPA 2HC9A 1R64A 3H2BA 3LUJA 4QXAA 3ZYCA 3AOEA 2IZ0A 1Q6YA 4N8SA 1J22A 2GEVA 3EMVA 2G1KA 3LPLA 1ONOA 1SUPA 2VP4A 3CUWA 1BQEA 1E0JA 1E1LA 3CZ4A 3OICA 1SVKA 3HWRA 4IDOA 3MUNA 3SK0A 1SEPA 3IAUA 5JR3A 1X7YB 3QX3A 4PRZA 3NM6B 3DEAA 4KTTE 1CZOA 2PQ2A 1YBFA 5AXAA 3D6TB 3UEOA 4XXHA 3VR2D 4B82A 4K9SA 1YCDA 2RD2A 1HKHA 5J2UF 1ZI8A 2VDKB 4L28A 1TD1A 1T9KA 2NXCA 2VHWA 3WWEA 2BHNA 1BE0A 1LKZA 2HIHA 4KVZA 4RORA 1KQNA 4EA7A 3IQGX 4WCFB 4AZWA 4NK4A 2ISQA 2V7TA 1W4BA 3KFLA 1RMYA 2QGZA 1CNEA 4QDTA 2RHTA 4IFEA 4QGBA 2RHBA 1J8YF 4Y2YA 2WHXA 4KE8A 2W0SA 3QE3A 1H66A 3ASVA 1KXZA 3ROFA 3PHLA 2BKLA 3D2CA 4J1TA 2RHRA 4XSVA 4BBAA 2NTJA 4OX9B 3K0CC 2QTRA 1U2SA 3F4KA 2ZBEA 5G0TA 5EJMA 3FZNA 4F2DA 1NVFA 3WICA 5EHQA 4UNQA 5A03A 4AP6A 1AKVA 1P5JA 5D3KA 2OLEA 4BFTA 1ZXLA 4G81A 2DT8A 5EG5A 4F97A 1Y1SA 3NAGA 5JEEA 3NEJA 1FTWA 4DMLA 4MLDA 5C34B 2WD8A 5GONF 3NXSA 2I6GA 1YKSA 2XZDA 4HRXA 3R7LA 3TF5A 4R2JA 1TF2A 3U61B 1G19A 3I9V1 2NUAB 5HTOA 1HEUA 1R27A 3RB8A 5FO0A 3C3CA 3QE9Y 3F97A 2OHFA 5D5PA 3RLIA 3MUEA 2ZJ7A 2YFQA 3WMGA 2W2KB 4LXHA 2I7TA 4D1YA 1U5CA 1VIVA 3FBTA 5JZ9A 1JKJA 2K2QB 4OJNA 1K8RA 2X4DA 3TRHA 4F46A 2NNLD 3A4TA 1XAGA 4HYYA 2D5CA 2QRLA 4LXQA 3K15A 4KBFA 5IX8A 1F8UA 1Z5PA 2D2IA 2FZWA 3T5PA 2EIXA 4KBYA 1KVQA 3FH0A 1ZJ5A 4URYR 2ZTHA 2OKCA 1Z4MA 4ZYVA 3L0OA 4NPCA 2ZDQA 3TBKA 1BNCA 2F3SA 1DOAA 1HEYA 2OZEA 2QTCA 2UYQA 3D3JA 4IUYA 4HJXA 3HJTA 3FHLA 4GMKA 3H11A 5FBHA 1M83A 3SXUA 3TZHA 5BUSA 4YGXB 4A8JB 2YY7A 1E59A 4ZDJA 3CRQA 3K0AA 3HXMA 2QRUA 1ADJA 4O3FA 2H06A 1UBOS 3L7DA 4YV0A 4G2TA 2ZREA 4CLXA 4AF6A 3G02A 2HLNA 2ZKLA 2H5LA 2Q8PA 3IDQA 4Z7NB 1BWPA 1GKKA 3GBVA 4TWJA 2C8KA 2FWPA 2HRCA 1X70A 3AERA 3QTLA 4XA8A 1U1GA 1PT6A 1GGNA 3VPGA 1CEQA 1GWNA 1PNOA 1QWOA 3NOVA 5IK2A 4AUEA 4GI7A 3HKDB 3F3YA 4C0QC 1U04A 5C5DA 3KV3O 3E2IA 4P5DA 2EXXA 3HJCA 3CPEA 3I9JA 4FIDA 4JNCA 2QAGB 4JVOA 3HMQA 2O19A 1DB3A 1XB2A 3DE0X 1GVNB 3S44A 1OI4A 3LBAA 1SA0A 4LZNA 4EGAA 3BWXA 5ER9A 3DV9A 5DI3B 5K51A 3FWNA 4QOEA 4D4MA 4D4JA 4BL5A 1P1FA 2BRUA 4NG5A 4PYJA 5I8PA 3HG7A 2O7VA 5JG7A 3A6DA 4LRYA 1UWKA 1TL7C 2L82A 2QMHA 2B6HA 5HCIA 3AI2A 1X1BA 1FMCA 1YWGO 1RYMA 3IMFA 1DFHA 4NENA 5KEIA 4Y9SA 1JAIA 2B2XA 3GUUA 3VMFA 1VKRA 3SQNA 4DLNA 3LIPA 2E6KA 4TYWA 1XMSA 2H4XA 1M2NA 3MJTA 5E4FA 4CMIB 3IBCA 4D9CA 4G8JA 1W34A 1F0PA 3F5MA 2WQ6A 4OHUA 3ZQJA 1M1YA 4WBNA 2RIPA 2J4FA 1G8MA 3QEOA 4REOA 2E5LB 1GPWB 2YRXA 3VTZA 4HV4A 2RCNA 3OM0A 2V5VA 4FNOA 2XCRB 1L8OA 1WUYA 1PNVA 5JJCA 1XXLA 3W5UA 1E18A 4FVTA 2IXTA 2RHGB 1DQRA 1SULA 2ORYA 2EERA 2JIZD 2ZIXB 3C74A 3KZVA 5F52A 3VOTA 1OFTA 2O7RA 2D0PB 2RKOA 1HDRA 2ZQZA 2QL5A 2NMVA 3QY9A 1Z6QA 3H1TA 3WMXA 3I2JA 1RKVA 4MUEA 5ENDA 5ITVA 2XCQA 2X0IA 2G9ZA 1U0SY 1FFAA 2X9NA 3K31A 4UMVA 4XQ9A 2O4CA 5BR1A 5FL3A 4TTIA 5KTPA 5F3RA 5KDDA 3OPYA 3OZBA 2PTGA 4IJMA 1AS2A 1LBHA 3LVRE 3HVKA 5BN4B 2FSIA 4R7GA 5BVHA 2BKAA 1IJKA 4GKJB 2I54A 1P7PA 3BMOB 2I6QA 1AKRA 3IO5A 1I1QB 1RKQA 1RXIA 3BSWA 4C78A 2ADMA 1J8MF 4D3XA 3AR9A 1H94A 3R77A 1GTG1 4U7WA 3MELA 1Y4DE 4C2BA 4JHLA 2E85A 3RS7A 3RKSA 5FLKA 3WGYA 4RIIA 5F9HA 3KU4A 5JROA 1G64A 2D5BA 4MWTA 3KJHA 1S2LA 2G9VA 4UVIA 3KQTA 4ARVA 4RD2A 3GGSA 2PT5A 1OC2A 4WHMA 4H2DA 4QBTA 3HLKA 1TO2E 3VYVA 4BKPA 4NJEA 4Q1CA 2F1JA 4B71A 3QU7A 5J4VA 3K9GA 3NTQA 5IVPA 2NU6B 4BV8A 2XXBA 1OBHA 2FW8A 2YXEA 3LWBA 4ZAWA 1LVHA 3SKVA 3KDAA 2GZMA 4DQ0A 2GNAA 4I1RA 5DTQA 1JB1A 5ALHA 1KOFA 1L8QA 2WPNA 3WV5A 1SRRA 3W2EA 4XFKA 1PWXA 2IZOA 3M33A 3W8EA 1W4RA 1CR4A 1M2VA 1AS0A 3OESA 2RAUA 1QXSA 3OD5A 3LUFA 1UMCB 3Q3JB 2MSDB 4FMCF 2FG5A 2OHGA 1U2TA 1IY8A 1B0ZA 2QLFA 3M4YA 3NBXX 3NKLA 1EBUA 1SRQA 2AFHB 3O75A 4JELA 4L8VA 2ZB8A 5CHYA 5CA1A 3KEOA 3JQGB 1YIDA 2PRYA 2BJVA 4R1LA 1B4DA 2GM9A 3EW7A 2NAPA 3ZGVA 3BGOS 3QVGA 5COAA 4ZQBA 4EUFA 5FX2A 5FPSA 3V34A 4D9IA 1W6RA 1N7JA 3VPDA 4PG5A 4IIBA 3RT7A 2PGLA 3PTZA 4MI6A 1OZ0A 2GI4A 3ISTA 3LDGA 3HCDA 4RZHA 3GO4A 2IH4A 3P9KA 3RBAA 1SCUA 2Q1SA 4LECA 3AIOA 4QJBA 1SIBE 2C9BA 4WGFA 4B31A 5IPFA 3H5LA 2X6QA 2H9YA 2HNBA 2CB9A 2ZYRA 4ARCA 4WBSA 2WJGA 3OCZA 2QENA 1CUUA 1PG5A 1P2VA 2OVBA 2X5JO 3PDIA 2VHEA 1IDOA 2M1XA 1OD6A 1OYOA 3BHJA 1E9CA 2I7XA 4E1BA 1O95A 3Q8LA 5KTNA 1TUGA 3AR3A 2ZAIA 2Y71A 1G2PA 1XZPA 1MQ8B 1P4GA 1ZIYA 4JUDX 2X0KA 1II8A 1T6NA 3Q8XB 3ROTA 1PW7A 3AEUA 3H4VA 1L4GA 1EGMB 1PT8A 3IT1A 3QBVA 4PICA 1TCVA 3RNLA 5I47A 1WMBA 3GQVA 2R84A 4NPAA 5TQJA 1K92A 2O8VA 1BROA 3D4OA 3UT6A 4ZODA 4EVRA 4IGIA 1OSNA 3KR9A 4TS4A 4UU1A 2GEJA 2QMOA 5G3ZA 1M9NA 5BR8B 1E98A 3ZNPA 2RGNA 5BT8A 3QU4A 2Q9UA 4O4LB 2BDEA 4I66A 1W8IA 4NJMA 2JFQA 2A5YB 4M99A 3WLLA 3FFBA 4MYRA 1O6CA 4BCDA 1AG9A 3TQOA 1PR4A 3H84A 1U0OC 1KJYA 1N2EA 3M3PA 2DBRA 5C5IA 4E12A 2VYVA 3BE6A 3U7EB 5LLTA 3T9BA 7REQA 1G4UR 3WK7A 1NVXQ 1T9GS 3DV2A 3VR6D 3U4MA 1ZGZA 2JBAA 1E1YA 4OP2A 4F5DA 1AT1A 5LQSA 3QVTA 1TPZA 3A0UA 3N74A 4Y2VA 5DCUA 1NF2A 1RE0A 3NP7A 1NJ2A 1VLQA 4JUFA 4LOLA 1D1SA 3FTNA 5EUQB 3ZY6A 4LOJA 3K2IA 3M34A 1F2UA 1K7SN 1X42A 2GBIA 3IEPA 4OQEA 2AE2A 2JRCA 4M1YA 5LUBA 4B09A 3V4LA 2WFZA 5HXAA 1YR9A 5KHOC 1VRVA 2FF7A 5A5VA 4DJFC 1DQSA 3JQ6A 5DBHX 4HVCA 4ZJPA 3K6RA 1NPYA 1E92A 1U0TA 4LCEA 5AJVB 1T26A 1KBZA 4LHYA 3PXAA 1IN8A 3PNOA 3K53A 3S55A 4MEAA 1KMHA 1PSWA 1VE7A 1YRBA 3LKDA 3ORSA 4PHCA 2ATCA 1CULC 2C42A 4I3HA 4EUNA 1K86A 2C9YA 3AC0A 4KB5A 3KEFA 2A86A 3CT6A 5FJJA 3DVAB 2YVAA 1QH9A 3FD8A 3L5KA 1ZSNA 3RVKA 3UOWA 3HCAA 3RTGA 2PZMA 4UU8A 3BCSA 3FVTA 2FQQA 3VKVA 5CW2A 4IH4A 2Z9DA 3P52A 5CDTA 1ESMA 3K8YA 3UHFA 4X8MA 4UZSA 4DDMA 4B3TB 3THXB 1JGTA 5E7MA 3M5WA 1Q5PA 2FW9A 1CHDA 2GH1A 1ZYUA 2HXYA 2HDHA 3DA8A 1E79D 3I6IA 4PYRA 5LP6C 1US8A 2AFIB 2ZRFA 3BX1A 2QTWB 2ZUTA 3EIQA 1UDCA 3QELB 1UBSB 2B36A 3OZVA 4NG4A 3EGXA 1C0EA 4AUNA 4GICA 3FGPA 5EWLA 1GPNA 1KNXA 5DTIA 1R16A 2IIPA 5KKNB 1E1NA 4I08A 1DC7A 4DREA 4X85A 3OI7A 3EEYA 5IKOA 2B4RO 3V48A 4Q82A 3X1DA 4G0ZA 4DLYA 4H60A 3WIOA 4QDZA 4A82A 4BFYA 1E2GA 4PLHA 2AK3A 3R5KA 2WKQA 4M7PA 3FYUA 2D4AA 4Y30A 5B58T 3W7AA 4DE5A 3OQVA 1EJ6A 3GJSA 4ABTA 4ZIRA 4F11A 4DR7B 4ITVA 1XF9A 2UVPA 3HN7A 3L02A 4FP9A 4NH0A 4QTTB 4AP5A 3TRFA 1IEWA 1NN3A 1R5OA 5EKUA 1W59A 3TLGA 4A23A 1M76A 3G7SA 10MHA 4HX5A 1UJBA 2C77A 2X1LA 4RJJA 5EIFA 3RVOA 1G6HA 3WZLA 1E1CB 3F6CA 1SCKA 3QYJA 4Q19A 5BWNA 1U28C 2FUG1 3M1LA 2NO1A 3EK2A 4J0IA 1E20A 2REXB 4M0FA 4QJ3A 1HXHA 5GVSA 3FFWA 3HE3A 1Y1QA 4MDYA 3VKFA 2BWJA 3H2KA 4JY7A 5CIQA 3BQ9A 1I36A 1CQIA 3MNFA 4L75A 1AMOA 1KY3A 1LWNA 4U6NA 5H9WA 3GPCA 3CLKA 4FQ7A 4PC2A 1BX3A 3S40A 1TZ2A 1TRKA 4OYHA 5CM8B 3AVTA 2AQ8A 1B43A 3KJQA 1ODIA 1XXHB 3D3EA 3THRA 1LPNA 3FTPA 1X8KA 5TV2A 1J06A 4LWZA 2VSXA 2ZI6A 3HFSA 1F38A 1XZCA 1TA9A 4OI1A 1IYZA 3EVAA 5DW0A 1TXGA 3TFOA 1W47A 3M8KA 3DMTC 3PR3A 4P9NA 3VR4D 3PNYA 1NNUA 1NI4B 1KDTA 2H1WA 3C39A 1EP3B 2BFDB 2H8KA 3PG5A 1UKVY 4HPJB 4W7IA 5DIFA 2IP4A 3BGSA 4Y1RB 4CEIB 3LOQA 5JCJA 3W3ZB 1CK4A 4NCAA 3IV6A 2CNOA 1ZVMA 2CVZA 5KYVA 4CQNA 2D1RA 1BC5A 3WV4A 4L1KA 3FB4A 4NOLA 2I2BA 5E0OA 3RRXA 5JCOA 4LC9A 2R5FA 3N28A 4BZZA 1ENYA 1UT8A 2Z8XA 1BMFA 1I2DA 3WMWA 2PSSA 5JDIC 1DIOB 3P4YA 3RTBA 4E2WA 2WPDA 3PL5A 4C6SA 3ROGA 3M3DA 4JJ4A 1WW2A 3ET5A 1G291 3D6MA 3HA3A 3A1CA 3PC7A 4CM3A 3IURA 3V9AA 4MYHA 2H8GA 3LU1A 1OA1A 4M55A 3F46A 1HGXA 3VR5H 5KTOA 5BN3B 3PI6A 4IDEA 3QRWA 4Q15A 4ARIA 1JHOA 1VP9A 4DCJA 3KSUA 1SK8A 4ZRNA 1MCZA 5EXTA 2ZRPA 4XM2A 4EHFA 2E4XA 5B7NA 2BEWB 5C37A 1O3YA 1IY2A 1RWKA 3LCRA 4K40A 3JV7A 1K9VF 4FINA 3MEQA 1Z06A 2ZT6A 3O8QA 4IP0A 2OVFA 2X5NA 1S96A 3DHVA 4KIJA 4DJEC 1FFYA 1YR7A 2WTNA 1Z12A 3FGOA 1UMBB 1YDEA 3RCBA 2C82A 1KI6A 3LF2A 2KW5A 1Q7RA 1ZA1A 3S1AA 4JT9A 4ABYA 2QLNA 3OECA 2FRDA 1JFTA 5DHQA 1HNZB 2WW8A 4GGOA 3VDXA 4LXXA 4PX5A 2A0KA 1TT5A 4Z3OA 3M3HA 3CRNA 4EOGA 2X0JA 1S3SA 2JLZA 2QAJA 1AQLA 4FMCB 4B4OA 3WMFA 1IOLA 2Q29A 4YUXA 4S1WA 5LB4A 4D3ZA 1LFAA 1W0JD 2AX3A 2VJLA 4PV7A 4XIYA 1M1NB 1T24A 1B7GO 2VSYA 4ZQFA 3K8ZA 5HZKA 4YBRA 1YD7A 4LNAA 5EQJB 4EGQA 4JENA 3F4LA 2OILA 2HJWA 1ZZEA 2I76A 3D8TA 3G7UA 4JJKA 1YDFA 2AKEA 3F49S 2V6IA 3KQQA 1ND6A 1XD2B 4TLLB 1NMQA 5AO9A 4F06A 2IS2A 2EJUA 2IUFA 4D82A 3PTLA 4OBWA 2OCPA 4MQFB 3K1ZA 2ZSUA 4FYWA 4OMDA 3V1UA 1T3ZA 2VDWB 4EW2A 2WIKA 2MU1A 4E1VA 1RC8A 2XI4A 5IBCA 1J21A 1ZICA 1Q17A 1CP2A 1SKYB 4TRJA 4KH0A 4DS3A 1TCAA 2JZNA 2R86A 1YS9A 5CDHA 4JV5B 5FA6A 4Q4DA 3ME5A 4J3NA 4CEHB 5GZ1A 1ZCJA 4HWPA 1W88A 3N87A 1B93A 4PHHA 5CT6A 5LYJB 1QZTA 3D5TA 3HRHA 4Q48A 3ZQ6A 1WMDA 5FP0A 4MICA 5BWMA 2AF4C 2YWBA 3KYCB 4M89A 4O2AB 3ZY2A 2D59A 4CTOA 3ZU5A 3N2KB 3SJUA 3X43A 1E0DA 3LS2A 2NU9A 4W63A 5CAEA 3A2MA 3TSOA 3RFVA 3WGKA 3Q7IA 3U16A 4EG5A 3PFHA 4FYYA 4LX0A 2JI8A 4IIFA 2A8YA 1KA9H 1UCFA 1ZUHA 1SQ5A 3PJGA 4V2UA 2HV9A 1TQ8A 3PPIA 4YROA 4ZYTA 1M8PA 2HCTA 1WV1A 3IOEA 4GC5A 4FNGA 4QYMA 2CKDA 1ISIA 4J9UE 4EVQA 3MOGA 2YV2A 4Q4JA 5BOVA 4CT5A 3CVVA 4ZOEA 3RYHA 3T1HB 2CEAA 2D3WA 1XEXB 3SEQA 4LZWA 4BNHA 5T67A 4P31A 1SXIA 1XYVA 2CNWA 5DH9A 4IIJF 1VHWA 3CE9A 3C85A 4Z9BA 1FX0A 4ZHQA 7ABPA 5JS2A 5L6LB 5KQRA 4QSMA 1GNLA 1ZVJA 1E9AA 2RHCA 4MEBA 3CNOA 3EXEB 4UEJA 1UFVA 1RSZA 1HTWA 2JIMA 4K6KA 3GROA 5B6PA 2F1HA 3PUVA 3FCCA 1NBIA 3AOEC 5BXQC 5KNDD 2LUOA 3MTBA 1H2AS 2WM2A 3F5SA 1JVNA 4G0QA 4D8YA 1XWWA 1QDEA 3EGIA 5EJ2A 3DAPA 1ONPA 1SU8A 5CYOA 1AUOA 2XMCA 2O23A 4GQBA 1E58A 3AH8A 4ZTBA 3EVNA 3EAFA 1AX9A 5KO2A 4WCVA 3D8RA 4PLVA 3KCNA 4BVBA 3UB4A 1P0PA 2VP2A 3QUQA 4RJTA 4UQOA 3DB2A 3H4IA 4JEMA 5D3MA 2Z8ZA 5E2IA 1H1LA 5K3BA 4M9QA 1CCWA 1UDBA 1WZNA 2C1EA 1SCBA 1TI7A 1TYAE 1E1RD 1V43A 2C8LA 3E1SA 3O7MA 4IDGA 1ZH0A 4PPFA 4X3CA 4QYTA 4WLFA 5JDCC 4CHTA 4Y0VA 4RTNA 2IX9A 3MG9A 4UNNA 1ESCA 1Z7WA 4KH1A 3ZZ1A 5LMCA 1OVGA 4TTVA 1DQZA 2IP2A 4ZXFA 2Z43A 4R81A 5HFNA 5CLFA 1ESNA 3GAMA 1GDTA 1KETA 4F60A 4J1TC 2J6IA 3OLVA 4CGYA 1P31A 1WLSA 2GLXA 4Y6RA 1SUIA 5F23A 4PGGA 5C7IO 4I1UA 5HPYB 5HCUA 4N41A 1EBBA 4EWLA 4RKEA 1I3LA 1ZH4A 2V7XA 3WLIA 4AWAA 3GJ5A 5CFLA 4AC9A 3P97A 5FD8A 5I7RA 1BDHA 1C9KA 3FN4A 6ADHA 3TNFA 1RJ9B 1QAQA 1C81A 1VLVA 3GRFA 1JSXA 4NYMR 4GVLA 1A88A 1R0LA 4I2NA 4JLNA 3VX3A 4TPKA 3NI2A 4OMUA 3GJ4A 4QATA 3ETGA 4ETMA 4B32A 1BFKA 3H86A 1U9JA 4HTAA 2CEKA 4N5MA 2OGWA 2X0DA 4EY5A 2UYHA 1QR2A 3OOJA 4WXMA 4RVNA 1MJ5A 1CSEE 3N6VA 1VMEA 1P6UA 2OFXA 4IDQA 4KPEC 2RAFA 2CLLB 2W2QA 4Y0NA 4ZVRA 4AMVA 4Q7KA 1JZQA 2H0AA 1O96A 3M4JA 3FHJA 2O2EA 4I5DA 4MUJA 4NZZA 4BMXA 2CNNA 4G9BA 1FUYB 1R10A 3KLMX 4OMFG 4YLEA 5B3JA 2R87A 4KPUB 4R0NA 4D42A 3J80A 2ODEA 2QTBA 1U7DA 5FPKA 4OHZA 1TQ6A 1ZK2A 1PVVA 3OUUA 1LVUA 1U2PA 3RYTC 2WUDA 1AXEA 1KIAA 3FNBA 2ODWA 4FFBA 4HGQA 4ZTUB 1G8KA 1OAAA 3DEJA 1IBSA 2QBYA 1MR3F 5F7ZA 4BNVA 2OE2A 4HXFB 4GZ6A 2YN0A 4M54A 3CV3A 4I81A 3HKEB 2WWWA 1ULZA 3FKSD 4GXRA 1JDPA 4NX2A 4LSZA 5LBTA 3B51X 5LUAA 4XB6B 4RSHA 5IU6A 2W37A 3O1HB 5AUPB 1L7BA 2QQ0A 4L6AA 4BRZA 1FTNA 4DCVA 2QN8A 2IYFA 2EP7A 4Z7QB 1T4GA 2H7VA 3FIUA 4KDRA 2ZSJA 3DE5X 2Z2ZA 3VZSA 1I3CA 4MRPA 4WL0A 3OE5A 2IUEA 5KMGA 5HYVA 1XVLA 4WOBA 2IV7A 5AVXA 2BRUC 3DC2A 3BXOA 5BMVA 1I24A 1ZH6A 2ZP1A 2L2QA 2GFQA 4RTSA 2OTCA 3EFEA 1C0PA 3L9XA 5JQWA 1WHTB 3UB3A 4KAFA 1QRTA 4TT8A 3NS7A 2YVQA 1T10A 3A7EA 2FFAA 3N0TA 3SMQA 2BEKA 3O31A 2AMFA 1E64A 1OV6A 4Z0PA 4RJKA 1KK2A 1VLJA 2XGJA 2WA2A 4PCAA 2ERCA 4QX6A 4OGKA 5ALPA 4DRZA 1J56A 2GXSA 3SYTA 1N8KA 3PHIA 4BLVA 1XTRA 1RPTA 2XUKA 3TIXB 3GLHA 1S6YA 2NZJA 2QY9A 3IAFA 3AQ4A 3WGVA 1U8AA 1DT5A 3A4MA 2Q3JA 3VYUB 1YOBA 4I3GA 1KORA 1FMLA 4AULA 4L3WA 2VDVE 4MRMA 4N5DA 3DV0A 3LXXA 4RPHA 5TQ0B 4OOFA 1D0IA 1GADO 2Q2VA 4B3FX 1NPTO 1CNFA 3V8QA 1BD4A 1XEWX 1Y7HA 2IIVA 3CCFA 1L4BA 2D4HA 4XUGB 3G17A 3HCPA 4YJ3F 2Y0DA 4YJFB 2G06A 3LNTA 5E6RA 4AURA 1LLFA 2HO5A 2ZIEA 5C31A 4YCBA 2FMFA 1N5LA 1EFPA 3KTAB 1SKAA 1N34B 3BB1A 1DT3A 4IKPA 1UP4A 1WEHA 2P65A 4OJTA 3DLCA 4OQQA 5ISMA 4OKNA 3GP8A 2D7DA 1JXMA 5K8VA 4JYAB 2C9OA 3GPIA 1BU8A 2X1VA 4XFDA 1QGZA 1XMIA 3OJ0A 1VGRA 1ZUNA 3FDFA 1EK0A 3P0FA 4RACA 3W1VA 4XTRA 2F59A 1C1YA 4FFDA 4L07A 1N5IA 1PN3A 2PT9A 2AG8A 3QUBA 1M0EA 1DL5A 2AFVA 4HAZA 4RQBA 4J0FA 4LV8B 4PHTA 3JCZA 3RUCA 1WDTA 4LFCB 2RK4A 2JK1A 1VLZA 4CKCB 1PX0A 4F5WA 2QD4A 5LMZA 4QEDA 3OPQA 1KEEB 4ZQEA 3CT4A 2JANA 3MUFA 1NLUA 4WOJA 4EO9A 4S04A 1BXRA 4GL4A 1JMVA 2Y9PB 2ORWA 3GLVA 1ZKDA 2J9ZB 4JCOA 4MUBA 5JMPA 3SS9X 4YR9A 2YNMD 4M0KA 2IRWA 4GLOA 4O2RA 2L0XA 3CX4A 2FWBA 5D7NA 5JC8A 3CZMA 1DKMA 2ZR0A 5IC6A 2C83A 4DNXA 2H07A 3DGEC 5BSKA 4CZ2A 3I2IA 2Q1XA 2HGZA 2WVAA 3BWEA 5F78A 3G89A 2P3LA 1VJDA 1WJGA 2HF8A 3L8DA 4LE0A 4B5KA 2HO4A 4N40A 5BNZA 3ZJYA 5KNBD 2JARA 1AS3A 1XV5A 2FWAA 3PHCA 4UJ5A 1SUDA 1B3BA 4CQMB 2FE1A 4KLCA 5EP2A 3NHJA 1EE9A 2VF5X 4MUKA 3QW4B 3RANA 1HRDA 4AN1A 3WRYA 2GZSA 2NO5A 1DBQA 3HBLA 1FE8A 1ICIA 4ZXPA 3UXYA 1VXRA 4QFDA 1QVAA 1RQ2A 2YMMA 1K08A 3D8BA 2ZB7A 1AHPA 1FP1D 3NGLA 3B9PA 1JSZA 1B2LA 1UPUA 2Q9AA 3DL2A 3AUTA 4IIJB 1WHSA 1TYBE 4OA8A 5B4VA 1UZNA 2GRJA 4NENB 1NW6A 3UC9A 3RK1A 4EY4A 1QG2A 3I6BA 4ICIA 4CMCA 4HG2A 1PZGA 1ZJ6A 2ACVA 1T0IA 2AG6A 2C2MA 3ONVA 4G07A 4J2OA 4K88A 3ZDQA 2QWXA 3JARB 4O5AA 3E3LA 1XBTA 5DM70 3K35A 4WBNB 2Q0HA 4NMMA 3RLFA 4JL6A 1O95C 4L2IA 4UPEA 5JAOA 1YA4A 4EHKA 1Q12A 1YR1A 3ELBA 1WF3A 1ODSA 3E27A 3EWSA 2JH9A 2RJNA 4M0LA 4X92A 3NHKA 5JRZA 1XQ6A 2NG1A 3ND5A 1RZRD 4N5NA 2W90A 4BE4A 2RBGA 5K1ZA 1DEAA 3G9ZA 3PKIA 5J4KA 3NEYA 5K3OA 2NZXA 4BKOA 1M6NA 5H68A 3HDHA 3SZLA 1NMYA 1NULA 2OSVA 3UXMA 5JVDB 4BJ3A 1HLDA 4ZQIA 4C14A 3C6BA 4GR9A 2G0AA 2RGNC 3T1YB 2Y1EA 1AJEA 2N1MA 3MT7A 5DHUA 2FAXA 4BASA 1PSDA 5EYPB 2X7XA 2AUTA 1DUIA 3KLBA 4WY2A 2VAMA 2M2IA 2NUTB 5D5HA 2VK8A 4FCVA 4TRMA 4DGQA 2V7VA 2Z5GA 1ULTA 4HB3A 4MKFA 3WVNA 5BVHB 1KY2A 3O26A 5CYGA 1Z6PA 4K9QA 4YT2A 3OO1A 3PNQA 5EIBD 5EJ7A 4LE2A 3H05A 3SHVA 2OL4A 4GWGA 2KMLA 3KO8A 4A5SA 5LVAA 2HY7A 1H2FA 4BMNA 1URPA 5CFMA 3L0PA 5B1IA 5HK9A 2J5QA 3DMNA 3ZJVA 4W82A 2FPGA 5JZVA 2OBXA 2XJ9A 3X44A 1OWOA 2WD7B 1RQNA 4C7OB 3ZIDA 3TVTA 1OU4A 1MHTA 1COWD 4IICA 4K2AA 1LPOA 3EEIA 3FMVA 1BEUB 2XF2A 1SBNE 2BR4A 1SURA 2AOVA 3B3JA 1Q0PA 3EFBA 3WFZA 3C3PA 1G5RA 4NKRA 5JNWA 1GFIA 1QOPB 4GR5A 1CJTC 3VX4A 3KWJA 1YJCA 3ODGA 3G1WA 4QODA 4FWIB 4E70A 1CQJA 1W4CA 3KVNA 5E9QA 3QKRA 5CGZA 1KYYA 4M83A 1IM2A 3NTOA 2NSHA 2WMDA 1JKMA 1Q92A 3R0IA 4AM8A 3IE1A 1L5NA 3MGGA 1LA2A 1SHUX 2OP0A 1CPYA 1YZLA 2PCJA 3MYRA 4ENWA 4HLQB 1JEAA 4S0XA 5I7FA 4G4SO 1SUCA 4EPYA 2FEPA 1JEOA 2QTLA 4I9NA 4Y1EA 4XIFA 3PRKE 5FOTA 1BE8A 2DJ5A 3AL2A 2HNAA 3N75A 5I45A 1KMIY 2JLXA 4ROTA 3A1DA 2G25A 2GZ1A 3VKUA 4TTAA 2VJKA 3GFVA 5FPYA 2KB0A 2PRZA 5BSUA 3T38A 5AXBA 3U26A 2R66A 3GEBA 3JPWA 1MEEA 4L73A 1PJLA 2AF3C 3T41A 1QIGA 1QVZA 5CGQB 3TZCA 4WLUA 2QU7A 3D6JA 1R4MB 3IP8A 1DAPA 2C7BA 2V97A 3F6SA 4K3UA 1E2KA 3DBVO 4Q05A 1WL8A 4EJMA 1YRQA 2DF8A 1SQSA 3SYMA 4JLOA 4J0KA 1YBMA 4NRDA 1Y6ZA 2GDJA 2WDPA 1M0WA 5A3SA 4DA4A 5DYWA 4TV9F 1SCUB 3I1IA 4X1YA 3QY0A 5T5QA 3T3HA 5BSHA 3MS4A 5IEBA 2C9CA 3STWA 3MTQA 1OLXA 2P9YA 4HMOA 4QZVA 1Q7BA 2O59A 2JATA 3IDAA 3PDIB 4FYXA 5IDVA 3VKWA 4GI1A 3USZA 3E1GA 3INTA 2ET6A 3QWIA 3I0ZA 3N7AA 4RKYA 5EP4A 1WUJS 3U9SA 4BLRA 1EMDA 4EMBA 5IEJA 3FYUC 2XBMA 4WK6A 1AA9A 2DY1A 3FBWA 4Z8XA 4C30A 2H9AA 3GUVA 3ZE2B 4EF5A 3R9XA 4CKBA 4Z8YA 1II8B 4RY0A 1RD4A 2Q62A 1DPFA 2YQ4A 1U6IA 2W6JD 3MMPA 4H27A 4BFCA 4KRXA 4QUIA 2BUBA 2V6FA 2HUNA 1J2JA 3DE6X 2A9KA 1BFUA 1NMSA 4XM0A 4IO1A 2R11A 1O6ZA 1F4LA 2XH8A 2IIQA 2XOKD 4YV7A 5CFOA 1M2JA 3FTFA 1HMPA 5FQNA 4LFBB 3CB2A 3RVDA 2B9VA 2QZJA 1GPAA 1MNQA 1KY5A 3KZXA 4FFSA 3RU3A 1GN9A 3LZ6A 2VF7A 1PDWA 2P0AA 4NJMB 1WZIA 1XNRB 4JBXA 2DR3A 4DQLA 2QSZA 4BOYA 5BYKA 1A8QA 1PNRA 1KTVA 1MEJA 3S8YA 1P61B 4JVLA 4N65A 3Q8WA 1A98A 4NBRA 2BCGY 4L15A 1KF0A 1VCOA 2CLFB 2XB8A 2OO5A 1LCIA 1VSUA 1CY1A 1XZIA 3IUSA 3L4SO 4FX2A 3W5DA 3SHTA 1VG1A 3PXGA 1AUQA 3RRZA 7REQB 2QF7A 1SPBS 2UZ1A 3VPBA 1ZG3A 2F43A 3N05A 4WY8A 5AHOA 5ADUS 2IZ7A 5LZ2A 2XVYA 2JBAB 2V98A 4YJ3B 3TPCA 3UMFA 1ISSA 3LHSA 4JJEA 3KUXA 4E30A 2AOUB 3HCCA 4FT4A 1EI9A 3FYHA 5T4BA 4G4IA 3WP0A 1XX6A 4DIBA 1EWTA 3LWDA 1EFAA 1WAMA 2BMDA 2A0FA 3AUUA 3OQ1A 1UUFA 3RVLA 4IHKA 4UM9B 3QJ5A 2O9JA 1AZLA 2CXRA 2YJ3A 1YC2A 2FEOA 2J5XA 2VDLB 3HXPA 2FPUA 3JXEA 3KOZA 1CR0A 4NS4A 3MGKA 4TSFA 5CR9A 4DLXA 5I7VA 5KNCH 1P2BA 4OK3A 5C2JB 2FDRA 1G8HA 3WGQA 1AUPA 5J9FA 2AJBA 4A7PA 1NVMB 4FZJA 1T4CA 4POAA 2PGOA 4BKRA 2WYUA 4Z4QA 4MP6A 2G7MC 2HK7A 2GXUA 4R0VA 3A9TA 2YWEA 3ONEA 1N1GA 2H51A 3I2KA 1Y4UA 5CRIA 2IKQA 1XZBA 4BLSA 1ZM4A 4PLTA 4UEKA 1NVUQ 5EESA 4CUZA 2WMOB 1DIAA 3DBHB 1S01A 2X8JA 3LX8A 3V2UA 3ENQA 3VC7A 3KQPA 3W90A 4QGFA 4OX9Y 3AVYA 3QSGA 4GC9A 2O5RA 3TJMA 1GTSA 3DO5A 2Y2UA 2O0LA 3H6HA 3OE7A 1NVEA 4U7PB 5J1TB 3O8RA 1VG9B 3ABIA 1AZWA 5HNKA 2IYUA 2YHUA 3LHKA 1WZ2A 4OHFA 5DO9A 3MWFA 3EIWA 4DCUA 1ELOA 1KZYC 4O2BF 1IATA 1ULSA 3BH6A 3TD6A 2WP8J 1YCGA 3EXG2 3AFMA 5CDUA 1TTTA 4M46A 1RADA 2WINI 4WNAB 1ZDMA 2FRDC 4K6MA 1U6KA 4CIXA 1YZKA 3HH8A 4UTXA 1MOPA 4UHCA 1E62A 2H92A 4EBBA 1THZA 5DISB 4F38A 3PUZA 3NG1A 4OP3A 4KITB 1E9SA 1EVZA 2E1PA 5JISA 4QT0A 1MFPA 3QPDA 4UUQA 4O3MA 1GPKA 2II6A 1YV9A 2DQYA 2GEFA 3T9AA 1UIRA 1FDSA 4IDNA 3JALA 3D81A 5FPQA 3TL2A 4DZZA 3GCDA 1SUWA 4JYPA 2BLNA 3VNQA 1F8FA 1NRWA 2G5GX 5IC5A 1T5OA 5G1NA 3Q3EA 4QO7A 2YH2A 3L0IB 2P6MA 3AXTA 3UM9A 4KXWA 2MSCB 1AGNA 1MX3A 2BGUA 4PSDA 4B2PA 2YXBA 2OMKA 3RTCA 1QTNA 4M8NE 4W5WA 1V35A 4HMQA 2JAWA 2G1JA 1GZHB 4ONEA 1JHZA 5JBQA 4WESA 2IVFA 1XSEA 4B6QA 1EJ2A 5A4MS 2PQ0A 1TEXA 3GIDA 4TL9A 3AP1A 3OETA 2NU7A 3C7TA 3OAAD 1ENOA 2FSVA 4HSGA 4E2XA 1N6NA 1UPBA 1UT5A 2QMUA 3HKCB 2FV8A 3LC7O 4M8SA 1PQ4A 3LCUA 4QNRA 4BB9A 1NJ5A 1YS2X 2QR5A 4Y2RA 4TMFA 1W1WA 1EFDN 1Y6JA 1CQIB 2Z08A 1OU0A 4JUAA 4M6WB 1XJQA 1FP7A 2PDAA 3RG2A 4IDCA 2X2OA 3LBHA 4DBLC 1J8VA 5JH7F 3V8EA 2JFNA 4XB2A 4RJLA 1LDEA 4MPJA 1P2UA 1KEZA 3ZW9A 5KVCA 3CVYA 2EW2A 3AVXA 1YQTA 1V1MB 2C4HA 3JY6A 3PNPA 4GZ5A 1R8QA 5CTAA 3ZVRA 5CFQA 2FPPA 3UV6A 2HMSA 1P2FA 2ZYUX 4X3OA 4GMDA 3OZGA 1V11B 1O8CA 2JF0A 4PZPA 4ZVOA 3S4YA 8ADHA 3RSCA 3W5IA 3ONFA 1I1NA 1QGED 3IDOA 1AC5A 1IUKA 4Y6QA 4NDAA 4AWXA 1U7UA 2JA2A 4TMXA 4OOEA 2BFPA 1JQBA 3P26A 1O0CA 4JK3A 3FCEA 2GMWA 3PX2A 3VVBA 4J0EA 4CW7A 1E3WA 1G17A 3ZOKA 4IRMA 1U0JA 4TVSA 4M86A 3HS3A 1P1IA 1VPTA 2QD2A 2YC2C 2JI7A 3CLUC 4B3MB 3O0DA 1YQWA 1DTWB 5FA8A 4PCLA 2P90A 1NNI1 1ZGCA 4RDHA 4LNUB 3OF3A 4B0PA 4K7JA 5K45A 3H5OA 4HEHA 1RBZA 3E9NA 3G82C 5AXCA 2BH9A 2Z58A 5H59A 4INZA 2P27A 2XZOA 4CIYA 4EO7A 5IM4F 2DPMA 3IIEA 4BTLA 1NRIA 4A2PA 2D54A 4G8BA 1QP4A 3G2KA 3NQ41 1SPXA 2MINB 3ROMA 5TPZA 4OF4A 4BHTA 4HNQA 1RU3A 3O8QB 1W19A 1QHHA 3JYHA 3GRPA 3HJAA 4UE3S 2Q49A 1XE3A 2LE0A 4GM0A 3V4FA 1KI8A 3U4IA 2CXSA 1YVEI 3MTAA 1QM5A 3AHHA 1U90A 2E4UA 3MT0A 4LRWA 5CW1A 2Y2VA 1E2IA 2ATIA 1Q1GA 1UP7A 4KAJA 1KYVA 3N07A 2X3FA 4R68A 1UM8A 4KWIA 3WWZA 1CQWA 2VP9A 4ZGWA 2WF8A 1K5DA 1MZVA 2I2DA 1BJTA 1PFYA 2HMWA 1PYGA 2VPXA 5CNJA 5HM8A 1M2OA 4H1VA 2IGTA 1GTMA 3KKEA 1CUYA 3NUQA 5KC9A 2ZSAA 4GP7A 1VIYA 1IMJA 1GQQA 1XMPA 4A73A 1CUZA 2DCUA 3QA3E 2DTXA 3UXHA 2ANBA 3PT5A 3ZZ0A 1I3OA 4X8OA 3LOUA 3EH1A 2G3YA 2GKOA 3H8JA 3L06A 4P33A 5IN5A 3IC5A 3QV1A 4M36A 1ECPA 1PWYE 2XVZA 3E5HA 5A5EA 1A27A 4UFNA 2PUCA 2ZCVA 3RRJA 3QFFA 2J33A 1POWA 4Z51A 3D6FA 3RVMA 3PHGA 4DQUA 1VL6A 2GPYA 1BE6A 1JB9A 1GA6A 3D8HA 3MFQA 5BRAA 3SVLA 2Y99A 3LLCA 1R8XA 1L3CA 4EELA 2BJHA 3V9PA 4CIBA 3GLFA 1SG9A 1X86B 1E0KA 2J5BA 3E22B 3OHMA 2P7HA 2PM8A 1M73E 1JQ5A 1TIPA 4BFXA 1CRPA 4B47A 1ZQ1A 2CXQA 2ZUDA 1YQEA 1O7JA 2GXQA 5L4SA 2ZSEA 3MXOA 3ZLUA 1GU0A 2NQ2C 2B94A 3UGQA 5JD6A 5IVKA 5SY9A 3RF7A 4TUYF 4TVKA 1AURA 1W88B 1AKYA 1DIRA 3QF4B 5HW0A 5F51A 1NBMA 1RRPA 1PG2A 3RRFA 2NSJA 3GDOA 4YLYA 4KV7A 4M9XA 1UPFA 2ZTUA 4G1UC 4U7FA 1GTJ1 3TLBA 3U4GA 4CU2A 4A8HA 1QHXA 4HCJA 4JJZA 4OM7A 3UFXA 5KX5F 4H7PA 3EQ8A 3GDHA 4KQ1A 3FUUA 3BWYA 4Q24A 1NX9A 5B3JC 4R1PA 1KAQA 4KIWA 5B1HA 3UMCA 4MZXA 3GUYA 5ILGA 2FRXA 1K6MA 2JK0A 1EK1A 5DK6A 4BJ5A 2E5WA 1JS1X 3ND9A 4JQOA 3OFNA 4TXLA 4CDMA 1C8VB 1OW3B 3AESA 4CLHA 4Y67A 4MJXA 4L8GA 5I4KA 2XZTA 2WYWA 4Q4JB 4CL2A 2NP6A 2LDXA 4TQ9A 2LDBA 1F6BA 2PUBA 1PQPA 4BV2A 5KYNA 4UFOA 3TLYA 1Z73A 3ZHSA 1GPDG 1HQKA 4ILEA 3SC4A 1PVOA 2EL7A 3D0QA 1Y8AA 5CXUA 1FBTA 4JX9A 1T8UA 2GZDA 1GYRA 2EJBA 3CX8A 4V0NA 3K8OE 4MDEA 2A33A 2NUPA 4G0YA 1XC7A 3VAYA 3C4JA 3TRDA 1GN8A 3Q0EA 3UJ3X 3PQ8A 3WLRA 3D0RA 5BT9A 4M60A 4H59A 4EGJA 3VGPA 3S27A 3IP5A 1E89A 3LC2O 2W0MA 3A6LA 4I4IA 2FUKA 2ZWAA 1EESA 2KYRA 1C30B 1JXQA 1N6IA 1SC1A 1J7JA 4FPXA 2CXHA 3GZNB 5TXGA 3VSEA 2KM1A 4DGSA 3CH4B 1KJWA 3C7AA 1QHYA 1XJCA 5FBVB 2G36A 5K0JA 1MV5A 1CZHA 2C2GA 2N1BA 3VR5D 1H22A 1PR9A 3AIKA 3GEDA 1R66A 4WOPA 4V1CA 5LZ5A 3RGWS 1Z5GA 3R3WA 2VUUA 4LFAB 1JJIA 4N5HX 2CL6X 2JW5A 2OV2A 4KQWA 4IGAA 4HVLA 2C4VA 3H1AA 4NZ9A 4ENTA 4G1MB 5K3DA 4A15A 4WW0A 3EEBA 1S2MA 1L7OA 2OWEA 1W85B 3BDVA 1KDOA 1U5AA 1H8HD 2BEVA 1B3RA 2POCA 1VHQA 5F73A 4YAKA 2BFCB 2X2PA 4MAAA 1KJ9A 1VL0A 1I1OA 4G25A 4QDXA 1XVIA 1H6DA 5BSWA 4MLZA 4IKOA 2NNWB 5U1PA 2MR6A 5ANRB 1P5RA 1O95D 2WUGA 4R8KA 2YWGA 5KVSA 2Y1WA 4CTNA 5JASA 3TEFA 4X62B 3FTEA 3DE4X 4Q9LA 3MINA 4NECA 5GP1A 1P4RA 1FU7A 3JRXA 3VM6A 4EQZA 2VYFA 1A5BB 2IS6A 1JALA 1Y80A 4TXNA 4Q9IA 3BIWA 2CMKA 3HSYA 4ARZA 4OHCA 4Y2PA 2IEIA 5TLSA 4FT2A 2POQX 1MB9A 2HMTA 3GEEA 1FLNA 1AO0A 2YJZA 3W4IA 2BZ0A 1SN7A 5ALUA 4R5HA 1X7WA 3LT0A 3PNVA 4BLQA 1VMDA 3LL4A 4US1R 4B4DA 3L46A 3F1LA 1MIOA 3QXGA 5F5NA 1UT6A 1X0VA 3EBOA 5HRCA 1L4NA 3HU1A 4D9EA 4ZCPA 2FKNA 3PCRB 5D00A 1KPIA 4FFBB 1NDHA 3KAKA 2D00A 3MMZA 1BS1A 3SSMA 3UCFA 3A3OA 4NC9A 5AKZA 3PDUA 1WW8A 2Q9BA 2DBVO 4QBIA 2R5WA 2WWYA 1KMCA 4FYPA 1RJDA 2PD6A 1Q0RA 2A0WA 1JG7A 3H99A 4PWZA 1T9AA 3C7DB 1E96A 4PXYA 1ISHA 2CK3A 4LXUA 4LXYA 1U8EA 3WGUA 3Q8MA 3GEMA 2QRGA 3Q6IA 2PIDA 3QE0A 4G8DA 4KODA 4A0SA 4LDNA 3WRYC 1Z2OX 1JR4A 2IITA 5A6SB 4D5GA 3F9CA 4WVLA 4YBZA 4HFNA 4RVCA 1A5TA 5HKBA 2FMIA 1MO3A 3CCBA 3T4UA 3VDRA 3W2FA 3THWB 1M3SA 5K20A 2D0IA 2VXYA 1W35A 4YPVA 2ZATA 1J49A 4I46A 3EDQA 1HT0A 2H1VA 3L4JA 3GC6A 2QRKA 4JOCA 2WOJA 1VMAA 3QEKA 2C61A 3K5HA 1GPYA 2JFGA 4LQLA 5E6UA 1XU7A 2Q2NA 4GYWA 3O4IA 2WD9A 2OV8A 4RPLA 5G53C 3D6UA 3KHKA 2EZUA 3SZMA 1B0UA 1G7RA 3WQBA 2B1IA 1A69A 3WK5A 3PCXA 2IYWA 3WXBA 4EA6A 3UICA 2V7QA 2HEIA 4ZT2A 4JHXA 2DKNA 2ON6A 2PT7A 2PWZA 4Y2JA 3T3IA 2ZCJA 2DPLA 3HYCA 4QC2A 3ZE6A 1H0SA 2VOEA 1EQAA 2Y9MB 3G2HA 2QRHA 3ED5A 3G2QA 2GZ3A 1JDUA 3KV1A 2CDRA 3HV2A 1I4LD 3H5VA 4NBSA 4EHAA 1W1UA 3DZCA 2VZ9A 4XGRA 4DHWA 3WNCA 5L3VA 3UHAA 4G3XA 3HEBA 1P7WA 1NBEA 3F6RA 4X95A 4BUCA 3BMNB 4GSYA 3AJEA 3WDSA 4DANA 2RGWA 1TAUA 5L51A 1NXPA 1OR8A 2O5VA 1JIJA 2XKBA 2XE8A 3O92A 5IYZF 4TV9B 3SQLA 2PUTA 5I4IA 3TO5A 3ZGZA 2R8XA 4JJIA 3VYSB 5JZOA 4LW8A 2FX3A 2E48A 2JFPA 2QNIA 3DZDA 1B15A 4ZI3A 1ISGA 5DYGA 1QC5B 1Z5ZA 4GOJA 4CE6A 5CVEA 1LJLA 3R6GA 2XTJA 4EX7A 4EPTA 1G55A 2X6RA 5JTUA 2C84A 3B9RA 2FQYA 1G3IA 1JQEA 1R0KA 1UR5A 1OKKA 1ZJJA 2DH5A 3I01A 3MERA 4N6GA 1OYVA 5E1DA 1H6BA 1OREA 1OHHA 5DFAA 5GGXA 4YVFA 4KWTA 3MWLA 4U6QA 1E2HA 4YCNA 3AW9A 3A1EA 1FVOA 4HKTA 5CTJA 2YX1A 1ZK4A 3QFTA 1X13A 2QZSA 3CEAA 3QWFA 3WGZA 2WZDA 5L7TA 1I3KA 1TK2A 1Y6FA 5EE5B 4MOWA 3V55A 1A77A 1YAHA 1Y8CA 2H2GA 1S1MA 2WHPA 1QIKA 4IYRA 2V6MA 5J2TF 2PZKA 4LBWA 2BFAA 1F3OA 1P1BA 3Q15C 3TQRA 3NBAA 4CKEA 2JBWA 3ZNOA 4I5GA 3VZBA 1BTOA 4ZOQI 3TB6A 1NQTA 1ZN8A 2JLUA 3DYBA 3CIFA 5LQNA 1NVAA 4TUYB 1ZD8A 4D9BA 4E4TA 1IUOA 1BN7A 1CDZA 4OPMA 3RVNA 2O48X 4RA6B 1EVYA 1WNTA 1ZD2P 1FZTA 5AW5A 5B3LA 3RKUA 1SBYA 4QJ4A 3EZ6A 3T3GA 3HJRA 1CY7A 3DZIA 5I3ZA 1UKCA 3K6KA 4R6WA 2N47A 3GNQA 1Q1NA 1RQPA 3DGFC 5ADWA 3T3OA 2NZVG 3EIFA 5IJXA 3PKJA 1P0QA 1YTUA 1GT6A 5ABPA 1FJGB 4D9NA 4RHFA 1ZUD1 5JT1A 3R3UA 4C04A 1KYIA 2GJKA 4JT4A 5C53B 4JQSA 4JI3B 3QLEA 4GBGA 1W36B 4RWEA 1BMFD 1Z3CA 9LDBA 1I7QB 4DYVA 5IMSA 3HJHA 1KQGA 4W5TA 4MIEA 2V96A 1Z0FA 2QX4A 3AUYA 3L6BA 3R75A 3WZ2A 1UPXA 3ICPA 2YHIB 3MWJA 3DDSA 4XD7A 4BNUA 3DUFB 1QH8B 2XE6A 3KBBA 3VZCA 3TG8A 2C20A 3P0HA 5F2EA 2UU9B 4XRGA 2C4TA 1FYFA 2OECA 3U48A 3BWDD 2O8EB 3OM8A 4ALLA 3Q7PA 4E3ZA 2AVNA 4PW0A 4HUQB 2CLKB 1Q21A 2J0SA 3UJ6A 4JBWA 1QHIA 3EASA 3OC0A 4FB5A 4YMVA 3NP9A 3QXXA 1LEHA 3I6YA 1DC5A 1PLLA 1PX2A 5BSRA 1N3YA 2WJZB 1JKXA 4L2IB 1FS5A 1N0WA 2P2NA 1AB5A 4RPGA 4KN5A 5A05A 3PDJA 4QXQA 4EKIA 2A5LA 3F90A 4C7JA 2LVBA 4DNQA 1R0BA 3B89A 3RSHA 4YRAA 4S0ZA 5E1OA 4GX1A 3M6FA 1E5TA 1YBHA 2HRDA 3NX4A 5IMBA 5CCEA 1NHWA 1A9XA 5FPPA 2PH1A 2R9VA 4I8IA 1CEEA 5L45A 1H6CA 3OMLA 3ICWA 1JJFA 1O0SA 2QS9A 5JAPA 3EARA 4X24A 4OV6B 5EWJA 3TUZC 2PUVA 1A8UA 3KZCA 5GOZA 1CJSA 3T1QA 6REQB 5J47A 2GWHA 1J8DA 4TGLA 4NXNB 4FR5A 5CNMA 1IG0A 1Z39A 5L4NA 4AUKA 4CCWA 1SWWA 2HT1A 4ZAFA 1PUXA 2IOFK 3DOHA 3IVMA 3KWFA 1DKUA 1WUHS 2G08A 2XUHA 1BVYF 1YE5A 3OEEA 3PV0A 2OO5C 3G5UA 4H1HA 4L72A 5DMXA 5DNAA 3LUGA 3WI7A 1T9BA 1TVCA 3AHJA 5DIZA 1T3HA 1HOTA 1XEFA 3U40A 4F6LA 621PA 1HYBA 3PHJA 4GF5A 1YF3A 1X9HA 2OQIA 5LLDA 4WK0B 2YCBA 3ITNA 2RHWA 5EHIA 3EN0A 4OHRA 1ZOIA 4HN9A 3KT0A 3DW3X 5AVRA 5JSHA 4AKIA 1MORA 3X2EA 3TVYA 4KGXA 5E3JA 1I94B 1T1JA 1RKUA 1RXEA 4NE2A 5B37A 1MQ9A 4NNPA 3O5AA 4F04A 3OIUA 5AKIA 1VPEA 3UZUA 5ALOA 2JDIA 5DASA 1PE0A 4N82A 1CQJB 1IQUA 3J7TA 4QBGB 2VZ8A 4A0QA 5LU9A 1EK6A 2RHJA 1N9GB 3IPAA 5CB0A 4DNOA 2PUJA 3DKVA 3EF0A 3JQAB 4MVJI 4UJ3A 4W1RA 1VHLA 3H87A 5DYYA 3RPEA 3ORHA 1P62B 1KJNA 3LJKA 4F4JA 5A5FA 4DKJA 1N9ZA 4QG7A 4ZO8A 5EJAA 3GLUA 5TGDA 4QRDA 2VA8A 4ODIA 5G2OA 5FHQA 3ZJ5A 5A6SA 4LYJA 2XD9A 3DMFA 5I9MA 3BKWA 3EGDA 3QFHA 4Q3EA 5JAZA 3SGLA 4DR4B 1FYVA 2QP4A 3G6WA 2Z1NA 3OZAA 2CNWD 2WR8A 4QBKA 3EDMA 3MAJA 1IXZA 4TLDA 2J59A 4ZK6A 2BMWA 2C57A 3CLUD 5FBWB 2GPWA 4DAEA 3ZD9A 1W46A 3RRBA 3L8FA 3GFGA 5ERGB 1FNNA 1MT0A 4GVPA 2KE5A 4KWHA 4F86A 1ZVVA 1A5ZA 2COUA 1SHJA 4GPEA 1N4DA 1GJRA 2C7OA 3R3VA 3WWPA 2FZGA 4IH9A 1RI3A 3ZHQA 1P39A 2KSQA 4ESHA 3CH6A 1RAIA 3A9RA 3ZK7A 3AM1A 1SU6A 3IP7A 2C96A 3KVRA 1PFGA 4MW2A 1YB4A 1NRJB 2Y77A 4MGIR 1JG3A 3QSYA 3GVCA 2BEJA 2YV1A 4CBVA 5G4KB 3ILSA 2V4MA 4PPNA 2CSUA 5D8DA 1XG5A 3WQSB 3ZKWA 4CF6A 3G68A 1G7TA 1NFRA 1L5FA 3A14A 4FI3F 4H3SA 4RKFA 3RABA 3N7TA 3FWZA 1KI9A 3ZK8A 2AEJA 2EV9A 4AJOA 2KBFA 1NQOA 1H2RS 1E60A 3RDPA 2ZM6B 4HP8A 4X20A 2GEBA 3JZIA 3OX4A 1G8FA 1PJRA 3H65A 3AVWA 1YB7A 4MWBA 1OFGA 1YS6A 4WLEA 2AEMA 3IKLA 2FSVC 3VVLA 1MAUA 1K9SA 1SVWA 4IDHA 1Z6TA 5DB4A 1AGPA 1Z2CA 1HDIA 3A26A 5FNVA 1TCUA 2JGDB 5T4HA 2WJ4A 4BTVA 1X14A 1VBFA 3IA2A 2C2YA 1J0CA 2YQZA 3CRVA 1V3TA 2QTFA 2WJHA 4BAZA 2CC2A 5BV7A 2ZJ0A 3OPYI 3CFYA 3T7EA 4U2DA 3MB5A 1C80A 4Y1GA 5LA6F 1T35A 3H97A 5G1OA 3BM5A 2B4QA 4ERNA 5B5SA 2LGJA 2WU3A 4O4HF 5DCYA 4UDXX 2XW6A 3A4YA 3P45A 2V8BA 5IYZB 4KTVE 2IY8A 2FJ0A 2UZ1B 2ZJ6A 4MRSA 1JJAA 3W5AA 3A4IA 4U5QA 5DOVA 1J42A 1DO2A 4P7KA 3C5HA 4Q7JB 1C8LA 1MW9X 2GJSA 2WJ3A 2QE7D 3DMYA 4YJKA 5TF0A 3Q8KA 2ATXA 4WN3A 2IHTA 4XPIA 2QTTA 1KSJA 3IQFA 4QEZA 1QORA 2HB6A 4HBZA 2E0IA 1U7XA 3LUPA 1M33A 5LKRA 3L7AA 5JY1A 3KQMA 3O91A 1ISPA 4MPDA 4P1ZA 4DMUB 5C18A 4KHPB 4ARSA 4AU1A 1NL3A 3EWAA 3FTQA 2EBFX 4MR9B 3RBVA 4F9TA 2X7JA 4RDIA 2ZJ8A 1Z2PX 4F5EA 1YI0A 2R1VA 1YUBA 4E33A 4QREA 1K1EA 1DC6A 2ZJOA 4G4SP 4O6VA 5LCXA 1DXOA 4MTCA 4DVJA 4AS1A 3WDLA 3IMEA 2CCGA 2WSSA 4G5XA 1ECFA 3QQ5A 4Q7EA 5J2TB 5FL7D 2H5JA 3ZTWA 3C43A 1OUMA 1HKUA 1QG0A 3E0QA 4I5IA 3NU1A 4YS6A 5F7JA 2ILVA 3TKLA 1LUAA 3BAFA 4LI3X 4LF6B 3CVUA 2WWFA 1R00A 3B6JA 1NNLA 5I4BA 5EJ9A 1E2EA 4RZQA 4YXWD 1I14A 5DXFA 3AEXA 1E7QA 3BDIA 1SZPA 3W4JA 1MVOA 3C5CA 1I51A 4LYHA 3ZGOA 4P3OA 2RHMA 3H9JA 4WH0A 1B6TA 2LKDA 1GAXA 5JMTA 1R5JA 3QUAA 2BSQA 3AFHA 1JHQA 2XRFA 5BQFA 1IM8A 4K03A 4RH3A 2XDQA 3IEIA 1GXSB 2XDWA 4JLDA 2GHRA 4ZJUA 2DFLA 5C32A 4MW1A 3GF4A 2V9ZA 2YIJA 2IYQA 2ZS8A 3D02A 1TMKA 3A31A 3ENWA 2JGLA 4MUXA 1UXHA 3PK0A 4PC6A 3T5AA 2IBSA 1J8QA 2ISSD 3JWPA 1MB2A 4XTCS 3HSSA 4PIVA 3O94A 3MQFA 4JIGA 2MOKA 1ZK3A 4X94A 5LXTA 1QH0A 1EX7A 4Q6WA 2N75A 1P4JA 4OGFA 4NMHA 4JOBA 4XGQA 3HWSA 2GO7A 4RL6A 2G67A 4FLFA 3AY3A 4IOLA 1DXYA 4J91A 5EIHA 2Y92A 4EA9A 4EJ6A 3HU5A 3QPAA 1ZPDA 3DAGA 4RGVA 1QMGA 2WABA 3IIJA 4HGOA 3DB1A 2XGSA 2OV1A 1LZKA 4Z4GA 2NU7B 1LWOA 3EZNA 2W6PA 3IIMA 3ASUA 5E6SB 3UMJA 1CIPA 1ORDA 3E61A 1QS0A 2FR0A 3BFPA 2QI9F 1Q3HA 1GLGA 4AICA 4DDHA 3AR4A 5B4TA 1VYHA 2XCSB 2NWQA 4P8RA 5JD4A 1O5OA 5DPMA 1XTIA 4URFA 3TJRA 3Q2IA 4LBZA 3VPSA 4X7RA 4Z4CA 3HXQA 1PR2A 5IXSA 1KO1A 3GELA 1XTQA 1IBKB 5HK8A 5BN1A 2FWJA 4UASA 1AH2A 2WU1A 3MTEA 1GV0A 4EHNA 2IYLD 2OYCA 3RJ5A 1FNSA 2PL5A 2B4TO 3EVZA 3TMYA 1UC9A 1SUSA 3A1UA 3P5BA 4U7TB 2J5RA 6CHYA 3LKZA 1RR6A 5F4BA 4D8TA 3RUAA 2ANCA 2EW1A 4JUCA 5J2UA 1M8FA 1EWVA 4KQEA 3H9QA 5CT8A 5EMJA 1QO0A 3BF8A 4QYIB 4NE7A 2QLJA 4QOHA 4XIIA 3BMXA 4BQRA 1NUPA 4D46A 5AP9A 2HWYA 4IHAA 3NWJA 1ZOOA 2QJOA 1YR6A 1Z5VA 3IP6A 3KM0A 1SCNE 5GGYA 3VH1A 1MLDA 4DLZA 5BNWA 4PGAA 2H18A 1FPQA 5FOWA 2D7CA 2GSWA 1XRLA 13PKA 5K8LA 2YIMA 2ZVJA 5TVKA 3P1JA 3LM8A 2OXIA 3RVPA 1Z36A 3PVSA 3ZZNA 1RJGA 3VUFA 4EUSA 4EX6A 1QG4A 2NZUG 3OZIA 4UEOA 3WYDA 4ZYWA 4N7JA 1ODJA 1TJ3A 4KJXA 3EDOA 3K2EA 3DEKA 1E9FA 4LHZA 5B2EA 5JNUA 3DM5A 4WXPA 4GHWA 1NY5A 3G5LA 2W2PA 3NVKI 5DHSA 3W5VA 4XQEA 4M0CA 2VDUE 3DQQA 1JBQA 1JNYA 4ZI7A 3Q1LA 3QM1A 5BQ5A 3ZLBA 1MIHA 3D5QA 2A1UB 4MB2A 4B80A 2HCRA 5KNCD 3K94A 2QTVB 4FKMA 5HS4A 1UEJA 3PQFA 1Q15A 3DEIA 1CYDA 2GR9A 1W0KA 1XP8A 2UDPA 4NOKA 4RZXA 1B8PA 4C7BA 1KI7A 3C1OA 1EFTA 4P54A 5C8VA 3CBGA 2Q8QA 3N0XA 3WLOA 8ATCA 5JXWA 4KRYA 5GIPE 2H7YA 3BBPA 4AS3A 2Y27A 3OSZA 2NSLA 2QE6A 2FEXA 3SEAA 1YZ3A 1JIQA 4FDTA 4NFLA 4PANA 2I8AA 2X5KO 3AHIA 1A50B 5IVDA 3TLEA 5DNCA 3GLGB 4AYTA 4GVXA 3BTVA 5BPFA 2IEYA 1H2XA 3IMKA 1CDEA 1FNCA 5A9RA 4KR3A 4CLEA 2PT6A 2DUMA 2V6JA 4KE9A 3T1OA 1J0AA 2PS3A 1CUBA 3FSJX 2CGEA 2NOAA 1FS4A 4HX2A 3EIEA 4KFRA 4RA9A 4HRVA 4O2BA 5EL0A 1M0SA 3CZPA 4AIRA 5EMKA 3PGVA 1VE6A 4R1OA 3WTBA 3A04A 3MRSA 3ZLVA 5JY6A 1OLUB 1R0ZA 3BQNB 4PLGA 1Z29A 1K75A 1OFUX 4K6OA 4Q47A 3T7SA 1G6Q1 2PBFA 3B2QA 3QOWA 1JMYA 3H2HA 1WCV1 2DHRA 3EXHA 4IIVA 5ARDA 2PMKA 5FPTA 4ES6A 2RONA 4R4JA 1E6CA 1RI2A 1YFZA 2CXTA 4DRYA 3HK2A 5KTMA 5LQMA 1LLCA 3AKDA 4J4HA 3PFFA 3H1FA 4N9QA 3BMCA 2XTAA 4J7XA 2A5GA 5I9TA 4E88A 3PITA 4XM1A 3FHCB 4A6DA 3GMTA 3KXPA 4RK1A 2J87A 3UGKA 1V1RA 1I33A 2J41A 3FDZA 3T5MA 3VPHA 1EAMA 3STXA 4FFRA 1DLIA 2P68A 1U94A 3FOZA 3UQYS 5I9SA 4LZZA 4CNQA 5BQOA 3PFGA 2NT3A 4TWAA 3SQMA 2R79A 1Y7LA 4I0WB 1VQ1A 3ZU4A 1O6BA 1JT9A 5BR7A 3GIWA 1F2VA 1QKIA 2FGJA 5DX0A 2PXAA 3URKA 2HK8A 1HWYA 2W8ZA 3DVLA 1WM1A 1SGWA 4FCCA 1ADYA 3JAKA 4ZYXA 1XCOA 2PUFA 1MAVA 1ML4A 1JU9A 2Y6VA 1LRJA 2E1RA 3EPPA 4AG5A 3B6MA 5CLQA 1XZHA 4YJHB 1PGPA 4NONA 2ZYTX 1QF9A 3H2JA 3WSTA 3ET4A 1UINA 1TO6A 2ZS7A 3AESB 4ZCQA 3BS4A 4IFIA 5ARBA 1SIWA 2P9ZA 3I58A 1JU3A 5LA6B 1QB7A 2ZKIA 4D3YA 2W4MA 2B8JA 4JS0A 2R6R1 1R0YA 1WOYA 5JH7A 3FW1A 2ZSFA 1E7WA 2WLTA 1P73A 3L6UA 5LP1A 1BE1A 2NZYA 2I7DA 1U8XX 5K01A 3STUA 5A1JA 2IZ1A 3MXTA 2Q3BA 1MT3A 1QYCA 2OKGA 3CF6R 4R2KA 2PKYX 3H7IA 2GFIA 1YVRA 2Z2YA 1LPAB 2E21A 3GEIA 4PXSA 3MCZA 3U4CA 4Z5XA 1DAOA 5M29A 2NVBA 4OLBA 1CQPA 1ZEJA 2F90A 3R6LA 3DSRA 2ZYAA 3JQAD 3LQQA 4C29A 2BM8A 2ILTA 2OFPA 4CQJA 1X38A 2ZWVA 3PUKA 4P7JA 5GZ3A 3L7IA 4B8WA 2VNKA 2CJFA 4UU0A 1L7XA 3OPVA 4H18A 5CPFA 5E7JA 4MDFA 4MGYR 1OV4A 1Q91A 2V59