The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
134
|
structure length |
134
|
Chain Sequence |
ENLYFQGMINILVASEDASRLAHLARLVGDAGRYRVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDASSQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a Putative pilus assembly-related protein (BPSS2195) from Burkholderia pseudomallei K96243 at 2.50 A resolution (PSI Community Target, Shapiro L.)
rcsb |
| molecule tags |
Signaling protein, signal transduction
|
| source organism |
Burkholderia pseudomallei
|
| molecule keywords |
Putative pilus assembly-related protein
|
| total genus |
38
|
| structure length |
134
|
| sequence length |
134
|
| ec nomenclature | |
| pdb deposition date | 2012-01-12 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
