4DADA

Crystal structure of a putative pilus assembly-related protein (bpss2195) from burkholderia pseudomallei k96243 at 2.50 a resolution (psi community target, shapiro l.)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
134
structure length
134
Chain Sequence
ENLYFQGMINILVASEDASRLAHLARLVGDAGRYRVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDASSQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pilus assembly-related protein
publication title Crystal structure of a Putative pilus assembly-related protein (BPSS2195) from Burkholderia pseudomallei K96243 at 2.50 A resolution (PSI Community Target, Shapiro L.)
rcsb
source organism Burkholderia pseudomallei
molecule tags Signaling protein, signal transduction
total genus 38
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dadA01
2FQYA 1KMIY 2QZJA 3KTOA 3OLXA 1LJUA 1IIBA 2YHBA 2H0AA 3NNDA 3R0JA 5CNJA 4MS4B 1VLZA 2ID7A 4O5AA 3URMA 4IILA 4KFCA 3T6KA 2GWRA 5CHYA 3H5LA 2PUDA 2F8SA 3HDGA 2I6FA 1YIOA 3NNNA 5EWLB 1QO0D 3OQNA 4OLAA 3Q15C 2LUOA 2MSWA 2CHEA 3KCNA 3SNKA 1QPZA 3DLHA 2FMHA 2PLNA 2FMIA 1ZHHA 4TN5A 1RXIA 3Q7RA 3LMKA 2NZVG 3CRNA 2JB9A 3D8UA 4MYRA 4G0OA 5DLEA 3H1EA 1FFGA 5FWYB 3CS3A 4EVSA 2PUCA 1PEYA 1H9CA 3QX8A 4WZZA 2PUFA 5E3JA 3HO1A 2RJOA 3F73A 1QQBA 2PAFA 2RDMA 4PEVA 2PUEA 4YS6A 5JS1A 1JDNA 4XASA 1M2FA 5IEBA 3EQ2A 2VK2A 1KGSA 3LKBA 3OO1A 4IGAA 1DRKA 3EQZA 3FFTA 4MS1A 2E4YA 4PE5B 4RDCA 1D2AA 1DZ3A 3T8YA 4DADA 2LIVA 4IRXA 4HNRA 3QK7A 1CYEA 3MYYA 4KRFA 2FXIA 1JL3A 5PNTA 2R48A 3RVLA 3KYJB 2PJUA 4RU1A 2JK1A 1SD5A 3CG0A 4NQRA 2MYPA 3H5VA 3FGZA 2FEPA 1EHCA 3UUGA 3HV2A 1EWTA 4E7PA 1GUBA 2FN8A 2XDYA 1JFSA 2JBAB 3HUTA 1FFSA 3KLNA 1NXWA 5KQLA 1Z13A 2GKGA 2R25B 1DRJA 2FKAA 2L2QA 2AYZA 3C3WA 2O20A 1AB5A 3OMWA 3I09A 1KRXA 5FBKA 4WUTA 2M98A 2IKSA 3LUCA 5TQ2B 3TB6A 2KYRA 3H5OA 3K4HA 1VRVA 4KV7A 4F12A 2JRLA 3DLBA 4LRQA 4NICA 3RVSA 3JPYA 3SM9A 3IP9A 3CLKA 5T7BA 2QVGA 3GYBA 2WB4A 4ETIA 3W9SA 3BILA 4ZMRA 2GBPA 4RK7A 1D1QA 3L49A 4MQFA 2Q5CA 3BRQA 5ABPA 4TLMB 1BDIA 4QYWA 1Y1LA 3LUDA 2AYXA 3KHTA 4MRMA 1ZITA 4KQ9A 4WXMA 2QU7A 3KS9A 1M5TA 4YR7A 3JY6A 4FE4A 3C6QA 3VNBA 2PUGA 1NXTA 4XAQA 1VPWA 3ILHA 4KPYA 3TD9A 5KC8A 4JB0A 2OENG 1SXGA 3EGCA 1U8TA 3M6MD 4RK4A 4G0QA 5GOTA 4Q6WA 2IDMA 3KLOA 1Z25A 2FLKA 2HQRA 3RVPA 4RY8A 1DJMA 5C5EA 1MB0A 3OLZA 4N76A 2W42A 3H5WA 4MS1B 1QP7A 1LK0A 1BA2A 5HM6A 1B00A 3N0XA 4JAVC 1YS7A 3RVRA 4P98A 1YK1A 4Q7EA 4KZKA 3QEMA 5GQSA 3LUJA 3I5AA 3LUHA 4DN6A 5FWXB 5B3JA 1F51E 3QLUA 6CHYA 1QNLA 1CEYA 2VYCA 3DBIA 3H5TA 1PHRA 4YCSA 5KWSA 3Q41A 4RV5A 1D1PA 1E6MA 4KVFA 3A0RB 4MR7A 5I4CA 1JYEA 1YK0A 4JP1A 5TQJA 4FB4A 4YRZA 5B3JC 3H1FA 3QLUC 1WETA 4M88A 3IP6A 3IPCA 5IBQA 3H6HA 3HJFA 3MM4A 3HCWA 4IMJB 3ROFA 5JNVA 4N41A 1ZN2A 5C5CA 3O1JC 2L18A 1YS6A 2J48A 4EYKA 1BAPA 2FN9A 4PICA 4RK6A 1FSPA 3SG0A 1JLKA 4MR9B 9ABPA 4RK5A 2V0NA 4W5NA 4Z0NA 2HQOA 1C4WA 3D02A 5JNUA 2IYNA 2FQXA 5CNIA 3SY8A 1DCMA 2YHAA 3OM1A 4MLCA 3DGFC 5HKOA 5KQMA 4D74A 3E3MA 3FFWA 2WY2D 4YLEA 5TPZD 4NCBA 3TO5A 2A9QA 4HNQA 2QSJA 1XWWA 4MRMB 2FSPA 1FFWA 2VUIB 1U04A 3OLVA 3T95A 4ZYLA 2MSLA 3HDVA 4F3TA 1JX6A 4Y9TA 4GNRA 2X7XA 1LBHA 2QVCA 4RWEA 4RXTA 1DCKA 4RK1A 4TLLB 1UDRA 1ZH2A 1BDJA 2L17A 5TQ0A 4PZ0A 4H3KB 3MF4A 5KQGA 3JTEA 5TPWA 3B2NA 3H1GA 3H5IA 3NHMA 2FMKA 3Q7SA 4EVQA 4Z4CA 4GPAA 2IPAB 3HS3A 2E4UA 4YP9A 1U0SY 2P9HA 3SQNA 4EYOA 1RPJA 1PNTA 4RXMA 1GLGA 4RY9A 5BR1A 3HZHA 4YGXB 4EYQA 2E4WA 3G1WA 3GT7A 3F6CA 1MVOA 4LDZA 1NXOA 5JNWA 1FQWA 2FEKA 3CZ5A 4H3HB 1QP0A 3F6PA 4XXHA 1RZRD 4IMIB 1GUDA 2PKXA 2PL1A 3CZCA 4N03A 3CNBA 2WJAA 4W5TA 2CD7A 3I45A 4JOQA 4E7OA 2IOYA 2NUBA 2FVYA 2E4VA 1USIA 5EWMA 1F4VA 3FFXA 3G85A 1ZY2A 3KG2A 2ID9A 3QEKA 3QEMB 1DC7A 1Z12A 3QLVA 3HM9A 4EYGA 4WWHA 4D6XA 1L5YA 1P8AA 3N53A 1KRWA 2GX6A 4MAAA 2MYTA 1ZAYA 4OLBA 2OQRA 3H6GA 3K9CA 4KK3A 3BBLA 4QICA 5EWLA 3HXMA 3QLVC 4RY0A 5ED4A 4MQEA 4MR7B 4WXEA 5TE9A 4LDAA 3C3MA 1HEYA 1L5ZA 3O74A 3JVDA 3O2SB 3RH0A 3IDOA 3LUFA 2HSGA 3O1IC 1ABEA 2LPMA 1NXSA 5HQJA 3GWGA 3RVOA 2P4UA 1APBA 1Z26A 2PL9A 3A10A 3CKMA 4L4UA 3C3KA 3M9WA 1D5WA 7ABPA 3LKVA 1VKRA 1J56A 1DG9A 4Z4IA 1BVHA 2ZAYA 1QO0A 2FEWB 5HSGA 1GCGA 4F8JA 4O1IA 1EFAA 2RJNA 3OQMA 3TX6A 2L19A 3OM0A 1DBPA 2QR3A 3EJWA 3N0WA 2IPNA 1MB3A 2B4AA 1YVUA 3CFYA 3KKEA 1JBEA 1QKKA 1NXPA 2H3HA 3O1HB 1A04A 4IF4A 1Z16A 2NZUG 4L85A 4RZSA 4Z4GA 4OBBA 1SXHA 3O2JA 4G0PA 3LUAA 5BQ3A 3MIZA 2ZWMA 5DGCA 5TQ0B 1DBWA 1TVMA 1W25A 4KREA 5TPWB 1PUXA 3M9XA 1URPA 1A0OA 4LZLA 1DC8A 5D2CA 3RVKA 5TPZA 1LJLA 1DCFA 3NHZA 4B09A 3GA5A 3C97A 4OG2A 1USGA 1A2OA 2MYUA 5KQPA 3CG4A 2PMCA 5EWJA 4Z4HA 1R8JA 3OMXA 4S05A 4UHJA 3OO0A 1JWLA 3SAJA 2FTKE 1EWKA 3P9YA 4NV3A 3E61A 3JS5A 1E6KA 4ML3A 3H75A 2QXYA 1OXKB 3HEBA 4MS3A 1K68A 1U2PA 1Z2EA 4G0MA 5EWMB 1YTUA 4N0PA 4S04A 1TJYA 4DQDA 3HUUA 4MR8A 2JVKA 3LOPA 2BGGA 1QMPA 2PE5A 5DCLA 1C0EA 3IP7A 5KC9A 2WJWA 2IPMA 4G97A 4H60A 1DBQA 4EGSA 4KQCA 1NXXA 4G0ZA 3OLYA 2FW0A 4RXUA 5FBHA 1TLFA 1XHFA 5JNSA 1ZH4A 3CHYA 4KMRA 1USKA 3O2QB 1RZRA 4MQEB 4MQFB 1Z17A 2JVJA 4W5OA 4FE7A 4ZJPA 2JVIA 4QYMA 4RSMA 4Z9AA 1ZDMA 4LE0A 3CTPA 1Z15A 3OQOA 3QX9A 4OATA 4LE2A 4EVRA 4Z4FA 3KSMA 4RKRA 4Z9BA 1M5UA 3LTEA 2R47A 4N47A 3RVJA 3Q9SA 1OXBB 1P6UA 1DP4A 3LFTA 4RS3A 3O21A 2FQWA 4MGEA 2HQBA 5CNKA 1E2BA 2FLWA 1JDPA 3F7NA 4JASB 5IC5A 2WWVD 3DGEC 3EODA 1S8NA 2M1ZA 3EAFA 5IX8A 5IUKC 3Q7TA 3S99A 1SRRA 5DKFA 4D6YA 2PUAA 3GV0A 1I3CA 1RXEA 2QV0A 3EULA 3UK0A 4W5RA 5DTEA 4CBVA 3N6VA 3IP5A 5JS2A 1MAVA 3L6UA 3A0UA 1U2QA 3N8IA 3QELA 2LP4Y 3RVMA 2RGYA 5IUJC 5CNMA 2A9OA 3FMVA 5IEJA 4G86A 4NCAA 3MA0A 5IULC 2R4QA 4HNSA 4ETMA 4EY3A 3HK2A 3HVRA 1T34A 4Z4EA 3JVIA 3KYIB 4LX8A 5FWXA 4MLDA 1PEAA 3EDCA 4MS4A 2MSKA 1BDHA 1LBIA 2CWDA 4YO7A 1SXIA 4XARA 4G0YA 2GI4A 4ETNA 1QP4A 4N0QA 3GRCA 1D4ZA 1Z2DA 1EWVA 5EWJB 2VUHB 4YWHA 3LUGA 5JNRA 3HSYA 2QW1A 1XHEA 2DRIA 4KK4A 4WT7A 1PNRA 4G0XA 3NNSA 1W9HA 1ZESA 2A9PA 2E4ZA 5F64A 1JYFA 3I42A 4ZPJA 5T3YA 4MS3B 3MQ4A 1M2EA 4JA2A 3VNAA 1TM2A 5FWYA 1Z18A 4MR9A 4F06A 8ABPA 1JHZA 2HJ9A 4MR8B 2E4XA 3A3KA 3GL9A 3QLTA 6ABPA 2NT4A 1P6QA 4W5QA 4KNYA 1P2FA 3O75A 1NTRA 1NY5A 2JCGA 1YMVA 4YV7A 3GBVA 1QQAA 3RVQA 2CHFA 3ILYA 1E6LA 1CHNA 1JFVA 3N0RA 4JB2A 3UKJA 3NBMA 4EUKA 1ISSA 1JF8A 2WMYA 2MYNA 4UHKA 3GBPA 4P1ZA 1AB6A 3TMYA 2WRZA 4O1HA 4PYRA 3T38A 2B1JA 5BRJA 3FDFA 1RNLA 1NATA 4ZMSA 4XFKA 2A9RA 3IPAA 4TMYA 1ISRA 4Z99A 3DZDA 1JFTA 5KI6A 1JH9A 3BREA 1GCAA 1MIHA 4Q6BA 4RK0A 2IPLA 4XLTA 1K66A 3OLWA 2JBAA 3JPWA 1ZVVA 3CU5A 4HYEA 4F11A 2PUBA 3N75A 4RKQA 3KJXA 3ROTA 3RQIA 5BRAA 2FMFA 3BRSA 5IUNC 2N9UA 2NT3A 4OTZA 4QPJC 2TMYA 4MPTA 3MMNA 1ABFA 1EAYA 1TMYA 3QELB 2F8TA 5TQ2A 3RVNA 2LBPA 1ZGGA 1YMUA 2HPHA 3LUKA 5JNTA 1ZGZA 1NXVA 4LE1A
chains in the Genus database with same CATH superfamily
5KYYB 4DAOA 3ITKA 1DG1G 3RIXA 3S4YA 2O8VA 4NFSA 2N46A 2ZIXA 3Q6MA 1LJUA 3SSNA 3U1TA 4DR2B 3DVLA 3JV7A 5IXYA 3OP1A 3WDLA 1CY2A 1Q1AA 1LPNA 1QWOA 2XNDD 3DBOB 4IJ5A 3L77A 3N8GA 4TYPA 3ICEA 4BDSA 3WMEA 1DIOB 1HT0A 3SYMA 3MVEA 4RSRA 3WBBA 1WSAA 3MJRA 4A15A 3DLTA 3HDGA 4JMLA 1M2OA 1AUPA 4BNTA 2MSWA 1UBEA 3WK6A 3TB4A 1YNSA 1HX7A 1WCV1 4P7FA 1UBLS 4FFBA 4DMGA 5EHIA 4M9UA 1V39A 4JR1A 3TI7A 5CHEA 3Q5GA 2AN3A 4L8GA 2DWPA 2IYAA 2XMPA 3ZDYB 1CUGA 4M7RA 3LWDA 4J6EA 2NSDA 4B71A 3WB9A 4Z8YA 1Q1NA 3D59A 3R3YA 2E48A 3R5TA 4LOLA 4E5MA 1A7UA 4CIXA 4C6HA 5FD8A 1NVXQ 2JC3A 2P6PA 3D4BA 1LZLA 2JIRA 1N1EA 1PNOA 1CR4A 2IQIA 3ENKA 3EVNA 3K30A 4LXXA 4X65B 3F73A 3AZOA 1LLCA 4DEXA 1Q0HA 3EC1A 2B20A 1MEJA 1YR7A 1WOYA 5HDBB 3T99A 5BOSA 4LDPA 1E9AA 5CW2A 1M0TA 1LPPA 1SUSA 3GF4A 3ORRA 4OYYA 3NQ41 1N25A 4IGAA 1MU0A 4G56A 4KZPA 3VR6D 3HJUA 3OQNA 2ATCA 4YMTA 3E8MA 3R7WB 1MA3A 4ND1A 3AUKA 4QNMA 2Y77A 1ZJYA 3CO0S 3D7LA 3KZCA 4XIFA 2PGDA 4KQ6A 5JO9A 4H18A 2ISQA 1KJ9A 3KJHA 3KYJB 1HOXA 3N2YA 1FDSA 3CG0A 4OKIA 4YB8A 1US8A 2F43A 2G1UA 1KYVA 2ZRHA 3N7UA 1WLYA 3RRBA 2GA8A 3TAUA 4YI3A 4EPVA 1XQYA 4LJ4A 5BR8B 3MPOA 3FLEA 3QBTA 1EWTA 2GEVA 5AKGA 4C1BA 4CL2A 3AVUA 1FSZA 2K6GA 1CFJA 3SN6A 4L8VA 4J0EA 3K32A 4H9GA 1RQRA 1TE2A 3KD2A 1P9WA 1Z13A 2RGXA 3B1YA 4E6EA 5EMHA 3WO0A 4JJFA 4LYGA 2CB0A 1YHYA 3USZA 3CVXA 3QHPA 2WTUA 2WWRA 4TMFA 4LF4B 1KMCA 3LUCA 4X20A 3TB6A 4DUGD 3OSUA 5EJ6A 2AXQA 4XJTA 2C99A 3BXEA 5D3ZA 4ERXA 2CLIB 1J70A 1VKZA 3CBQA 1UT8A 2Z9DA 3G5TA 5AW1A 3IIKA 1DKRA 4OUKX 5J9FA 2OYRA 3HGQA 1R27A 1PFWA 2VP4A 3EH2A 1PF7E 3KLBA 5H4GA 1E9RA 2P6RA 4XW2A 1E2QA 3SZRA 3U61B 5B7PA 1PGQA 4DIKA 4C6TA 1U5CA 3KFLA 5G41A 1Z6ZA 1MN6A 2C54A 2GBPA 4AMGA 3IL2A 3AV3A 5GM2A 1NQXA 4IDBA 2GTPA 3VZBA 1Z33A 2GD2A 3ORQA 2IZ1A 1VIVA 3R77A 4KGDA 1N3IA 2F3UA 4QYWA 1GYQA 2EYQA 3INNA 1GDHA 1T8WA 4L9WA 1CW2B 2X9QA 2ZSFA 1KH3A 2O3SA 2ATXA 4JR0A 4PQYA 4U2GA 3ORHA 4C7JA 3MRSA 4TV9F 2OZPA 2PQ2A 3VNBA 5TMEA 3RVBA 2FX5A 4INZA 2BJWA 1GCIA 2BMFA 2Z5FA 4LQLA 4A5SA 2CXOA 4WL0A 3ONNA 2A1TR 3BH6A 4HAUA 1K6MA 3ASVA 1YVDA 3DOFA 2I4RA 5A6SA 5JC8A 1H42A 1VE7A 4DSTA 1N5RA 1K8QA 2KI5A 4KX3A 5JMPA 5HHTA 4ZAYA 3PR3A 3IAS6 2Q3DA 3TQQA 4Q6WA 3HFJA 4UOZA 4PAOA 4B5KA 4JNKA 3DWEX 5EJ7A 1DIGA 4EFMA 1Q91A 4JUBA 4OI2A 1M1UA 1KP3A 3R7BA 2F1IA 4MS1B 4MVJM 1ZM7A 3JW8A 2QJWA 2W6JD 1NF3A 2XTMA 1V47A 3K31A 2PLFA 1R12A 4DA9A 1YS7A 1GL7A 3ENNA 4OMDA 3SS7X 1EEHA 1ZMXA 3U4DA 3VO2A 1ZLYA 1TIKA 2V9PA 3UXEA 3U5ZB 1IZ9A 1J5XA 3ADKA 3KBOA 5IABA 1EA7A 3BWDD 1GP2A 4ENWA 3DL7A 5C1BA 2VYCA 2HXYA 4UCFA 3I9V1 4EELA 4HEHA 3NBAA 1AM4D 2AXNA 1NMQA 3DE0X 1YULA 4ARSA 4JP1A 2C2BA 3Q2IA 1LH0A 2G6TA 1KHHA 2JD0A 4ZU1X 3ZGZA 3MWKA 2WW8A 5FL7D 4OUDB 1N5OX 2PNFA 4LAFA 5B3KA 2GVDC 3DE2X 2E89A 4DRZA 2L18A 1PTJA 2GPAA 2WICA 1W8IA 2Q1UA 4UVGA 4W9RA 2OHJA 1RZ3A 1QVVA 3L79A 4UNQA 4URUR 4V0MA 3OX1A 1DAMA 2R5WA 3SG0A 3KWFA 4J94A 5REQB 4U9HS 2GCNA 1H85A 1FRVA 4PIPA 1UC5B 2A78A 4R81A 2Z5GA 3RG2A 3DLPX 3KYCB 3HMKA 3CH4B 4WEQA 5HKOA 1ZJWA 3HFRA 1ZGHA 1J0XO 1GPYA 3DG9A 3R09A 2XBUA 3DAOA 3L92A 3DE5X 3X1JA 5HYVA 3ZXYA 2CYAA 5JECA 4DMMA 3PUKA 4JI6B 3TO5A 4OFBA 3RYFA 3SLKA 5JLAA 1U6KA 4YV1A 3EX7C 2XSZD 5CT8A 2D1FA 1JP7A 3PFHA 1KAGA 3NEYA 1INLA 1NBOA 4INJA 2W4IA 5AVKA 3T7DA 1BOFA 2GBGA 4JEMA 1N4AA 2Q3JA 2H54A 4RK1A 5AKLA 1NFRA 1H6CA 2FK7A 3HKBB 3TNYA 3C70A 2CL0X 4YRLA 3ZQ6A 1T6XA 3JTEA 4XVHA 5EP2A 5ELLA 4NXNB 3C7TA 2GPYA 3U4QA 1T9DA 1GTZA 3LVFO 2IEZA 5HCUA 3HS3A 5KHAA 3KQQA 3WYDA 4YP9A 1U0SY 3CLUC 1RI4A 5K2MA 1LDMA 2H18A 5CYPA 3L02A 4JBNA 3JWGA 4L0CA 2JGLA 3F98A 5EHGA 4DPLA 3ELBA 4LYHA 3OT5A 1CFZA 1JB9A 1VECA 3DT8A 3HZOA 3JQBA 4IGEA 1VCOA 4U2CA 4DA8A 3R9XB 3UHOA 3WLQA 1DQPA 1IZ7A 2IJGX 1ORDA 2TMKA 4RADA 3VYSB 1TTPB 3ZW8A 4FD3A 4MWEA 4W4TA 2FFAA 3EAGA 4JOQA 5KBYA 3KTFA 3LQYA 3IEVA 1DFHA 3AESB 1S3GA 2PBZA 2ZVDA 4OGKA 5EUMA 1JHOA 1KQPA 1PJCA 4XWGA 3UANA 2NU6B 1ODLA 4OM7A 3QLVA 4I1RA 2C7VA 4R31A 1NM5C 2ANCA 4D5EA 1PZHA 1VPDA 2QWXA 4H15A 4DV0B 1GD1O 1KRWA 3QA9A 4N5HX 1E3IA 4U2EA 2MYTA 5KKNB 2D8MA 4BO7A 3GVHA 2X8JB 1DBRA 3MB5A 5T6BA 1XQ1A 3MQFA 1Z6GA 3ZY4A 3WV5A 1KNQA 3JZAA 3WRWA 3NC1C 2E21A 1NU6A 4Z51A 1YF3A 2J3HA 2P2DA 5JCOA 3DKPA 4Q4HA 5JXIA 4AXBA 3BXFA 4R5HA 4M83A 4MWCA 4CT5A 1M33A 3FJYA 4Q9NA 5L4SA 3O3NB 3QKIA 4A82A 2QYTA 1VA5A 1KVSA 4UAJA 2FR8C 1KSGA 2A14A 4KGVA 4MO2A 4O2LA 5CIWA 3P97A 3WGGA 1RRKA 2IYWA 5CEJA 1ATZA 5HZGA 2I8CA 3UJ6A 3BMCA 5AVSA 3M9WA 2HHLA 1VDZA 3FNGA 4YMVA 2BKVA 4ARAA 4I2VA 4MNTA 2W98A 4BVEA 1YFKA 4P4SA 5FRDA 1GFIA 2OXTA 2ZWVA 5K1ZA 4ENQA 1U9JA 1QG4A 2COEA 3KAKA 4P7GA 1O2DA 1X7WB 3K8OE 2CLCX 3OM0A 4OD0A 2QR3A 1IPEA 1CUSA 1ENZA 2RIRA 3S2EA 4WGGA 1QB7A 3KL2A 4DCCA 5AT1A 3ZVRA 2XD4A 2YZ7A 3JYOA 5L3QA 2C7RA 4WN3A 4KDEA 2BBWA 4MPRA 4G0PA 4A03A 2CZGA 5ALTA 3VR1A 4EG3A 2FQQA 2ZWMA 4KODA 3F3MA 2VDQB 3MNFA 5JWOA 1EI9A 3EYAA 1M1NB 2FHPA 4MJXA 4POAA 3WAKA 5JS8A 1GSOA 4ZIRA 1XTUA 2CLSA 4DXDA 3QSYA 4ARBA 1XZNA 3N2EA 3RWBA 5ENDA 4EYSA 3UN1A 2WQZA 4CKZA 5IHXA 3LD9A 1V37A 5IVDA 3OECA 1UBOS 3TJZA 2XUHA 1NKTA 2H06A 1VPEA 4GDMA 2QQEA 4IOJA 4TTQA 3LXMA 4J29A 3NC0C 2NQ2C 1ZK4A 3M8KA 1ISGA 4IW3B 3NDBB 4U9IS 1XRPA 2ONZA 1WCIA 2Q6LA 1J2TA 1UP7A 3EXHA 4FYIA 4ISCA 1EK1A 3THOA 5DN6A 1MT0A 3JAWB 2ODTX 1JR3A 3JS5A 3J80A 2H2FA 3GHYA 1OXKB 4E2XA 4YCLA 3LH5A 4DR6B 3HEBA 4UBIA 3E9YA 3MMSA 2BDUA 1EDEA 3OCVA 4OQLA 1NJSA 2QTZA 1GGHA 1KYQA 4GE3A 3W2TA 3ZH9B 3HLKA 2XDAA 4OEHA 2RG7A 2XNKA 4IIBA 2ON6A 3OOHA 3R24A 4JI7B 2HT1A 3PGJA 1AO0A 2OCLA 2J4DA 5TR9A 2XWJI 1UOOA 2J85A 2V55B 4AS3A 2WD7A 3MWEB 4C4PA 3OWOA 1L5NA 3T7RA 3U9TA 3AEQB 1Y0BA 4Z2YA 1P0QA 1VYTA 2ERXA 2F1HA 4RSMA 1JLLB 3BTOA 3GDHA 4PIVA 5T67A 3SQWA 4RJJA 1I32A 3A6PC 5JEEA 3AOEA 5A9TA 3UA4A 1D1TA 2EKZA 4YALA 4E4YA 3E05A 4J0IA 4ACAA 1K4YA 2HJVA 1X8LA 2EL7A 2NUAA 3A6GA 1XXLA 4M1WA 2LD4A 5IJAA 1CNMA 1X42A 3NTXA 1NUPA 1Z47A 1AURA 3ONEA 4QWWA 5ITWA 1H9AA 2FUG1 3GIDA 4DNQA 1X70A 5AM5A 2J07A 5JTUA 1TDJA 2KB0A 1U5BB 4X5OA 3FOBA 5ILGA 5CA0B 1GGEA 2BWJA 3KNZA 1IXRC 4N3GA 3ET4A 3H2ZA 4HXFB 4KP7A 1QIKA 3CLRC 3OEWA 2B8JA 5I47A 5CT5A 3EZ2A 3N6VA 2YOGA 3IP5A 4JLAA 4X24A 5IFLA 5JZMA 1ID8A 2QEQA 5F21A 2DFKB 3D5QA 4LK2A 3F5QA 3OCUA 2ZJBA 3E82A 3RC7A 3U48A 2Y2VA 3ZD8A 2PMFA 3BMQA 3LWBA 2W83A 5DBIA 4DMKA 2DXIA 4CEJB 4HY3A 3TQCA 5JZVA 3CQ9A 1JEOA 2RBEA 4UNRA 4YJ3A 4YAKA 1FSFA 4CMIB 1FX0A 3F71A 1RRGA 1U8FO 3HVRA 1FPQA 3BCSA 5SYNA 3PIRA 1X19A 4KR3A 3DV9A 3ITEA 3WGJA 2OCXA 1G5IA 1CR2A 4MLDA 1IMOA 1NAHA 3OF3A 3ENQA 4OJKA 1KOFA 3NB0A 4J4BA 2EEPA 4UC0A 3WRXA 3PD1A 3THRA 4D4HA 3FZYA 4LF5B 4DRXB 2XXAB 2A6PA 1HYGA 4PZZA 1EWVA 1XN4A 3M5CA 5PGMA 4CM7A 2QX9A 3PT5A 5MN6A 3O4JA 1RVV1 2AHRA 3D6AA 4Y2TA 4WT7A 5HS4A 3MUFA 1S3IA 1G6Q1 1CY1A 1Y5RA 2Q8PA 3QYPA 2W6QA 2C3OA 1FFCA 4N40A 3MBKA 1TM2A 2C2MA 2OSBA 1Z18A 4RACA 3OICA 2FR1A 4IDGA 1OBCA 4P5PA 3GRUA 3MCAA 3C85A 5LXTF 8ABPA 4KOAA 2Q7DA 2VSFA 1X7ZB 4IV8A 1VM6A 1XLWA 1SR8A 4DA4A 1I3OA 3E9ZA 4KB5A 5EE5B 4KNYA 4QEKA 1COZA 4GMDA 5MFZA 3EQ9A 3BCHA 1OXUA 3M34A 1T36B 1Z8HA 2EERA 4PG8A 1XPRA 3KSUA 4FZ3A 1JFVA 1E4VA 3OU6A 2MWMA 3OUZA 1CUJA 2WZDA 1NP6A 4IXDA 4UUMA 4Y7CA 3UFXA 1T6YA 1ZWKA 1AS2A 2QP3A 1A5TA 3E48A 3VQTA 4B3IA 4HT3B 1ZJ5A 4HN4B 4BEBA 3ST7A 5C4MA 2IWRA 2G0AA 1OPRA 1U2DA 4EY8A 2ZZNA 1FOEB 4C0LA 1G5FA 3S55A 1J8YF 2CGEA 5A1JA 3ZJTA 2KJQA 2D0PB 2RAPA 4M1KA 3EWIA 4XFKA 4J75A 2I4OA 1FNNA 2OMKA 1GG9A 4FGJA 1Q74A 2G80A 4EQ6B 1FYDA 5DMHA 1C0PA 4A7PA 3GXBA 4X7PA 4BUCA 2UU9B 4WLOA 5AKIA 4DMLA 4HUQB 5CB0A 3UPUA 2V4MA 3HJCA 2JBAA 2M2IA 4RYDA 5IT0A 3P71T 4JYAB 3F4LA 1UJNA 3QBVA 4PRZA 3OE1A 5IJXA 1DEXA 4EUSA 1J7JA 4JP3A 4DM4A 1GJRA 3IBFA 3ETJA 4JLKA 4UHEA 1P1RA 4UD6A 1K8YB 2VJYA 3MMNA 3P0HA 3VR4D 4HF7A 4NL4H 4A0FA 2NVBA 5EP4A 2P35A 3L6CA 3PGXA 3PBKA 3ZCQA 5EIEA 1VE6A 2NZ2A 3SU8A 3HTXA 3OFND 2D6FA 3I1YA 4BLRA 3ZLTA 5CD9A 1GPNA 2PH3A 2A4MA 1L5HB 1NJ6A 3A1WA 4B73A 3VNUA 2IXTA 1W0JA 3EFOB 5HOQA 2E85A 2BFEA 1E8NA 4K88A 3T9FA 3LYAA 3ZX4A 2Z1NA 4Y2PA 4A8PA 3UXMA 1HDCA 1CQWA 1ZW1A 3Q15C 4RL4A 4XSGA 5C52B 3R0XA 2ZVPX 3V6LA 1NOJA 1XRRA 2IKQA 5DISB 4RSHA 4WE3A 3KTAA 1ZNZA 3T3GA 5BYKA 1NW8A 1ZM3A 3TTYA 1N2IA 1T1SA 4NH0A 3WLKX 1Z3IX 2OKCA 5JSKA 1DAKA 2AOTA 4HVTA 4RCZA 4ODIA 2VEOA 2WTNA 3KCQA 1AGXA 3AIOA 1AQNA 2GH1A 4MYRA 4HUTA 1E3JA 1JDUA 1H1LB 1FMLA 2D59A 2F8LA 2K7ZA 1O94A 1RQLA 2Q2WA 3GMIA 3V34A 3ZYZA 5K6AC 1MAHA 3ELWA 2MIIA 4IJMA 2RJOA 3NMUF 1CUIA 4TKUA 4BWYA 3FCCA 1VLLA 2V7PA 3H19A 4Y6OA 3TVTA 1FNMA 3Q8XB 1CUEA 4KO2S 4M55A 5LZ9A 3B6MA 4KLCA 3R75A 4C20A 2QRKA 1KPGA 1M1XB 3FPJA 4Z5XA 3B60A 3OTOB 3RYTC 2OHXA 1D2AA 3KYDA 4ZRMA 1SBNE 2AI2A 4AM8A 4BN4A 2I54A 3M6LA 4PSKA 1VA4A 4UM9B 3EW9A 1JXMA 1TMKA 1DBVO 4HI0E 2WAAA 3H0KA 5H9WA 1N9ZA 1WR8A 2J6BA 5FIUA 1FMCA 2R6FA 2XTJA 3L93A 2C9MA 2F64A 3KPUA 4M54A 4O4LB 1NNI1 4C4TA 2Z95A 3H9GA 2XB6A 1S0UA 1U0JA 2R6DA 4GXNA 1EVKA 3AUFA 4BB9A 3R40A 2WLSA 3S1LA 5GONB 4O5OA 4E7PA 4TKZA 1P5HA 2IOFK 4P9NA 4YT2A 2W93A 1L5SA 2FA9A 3K8ZA 4EO7A 1ZCBA 2DC1A 3D7SA 3S2UA 4CKBA 3MT7A 3DMTC 1SKYB 1FFXB 4WK0B 4EUKA 2A0XA 2OGUA 2XF8A 5CFPA 2MINA 3WHKA 1RWNA 1MBZA 1NJ5A 2RHJA 2VJNA 4IGIA 3LQQA 3VPFA 4L8WB 3BWBA 3L6EA 4ER6A 3R9WA 1R4AA 4AP5A 2YH2A 2FF5A 4L5IA 4UEOA 3LOUA 3FPCA 3KPWA 5E1MA 3LC1O 5CDSA 2E6UX 3TGWA 3GAFA 3TM5A 4AROA 2I0FA 1O96A 3WJAA 2KBFA 4AS2A 1ZCJA 1X92A 4TWBA 2PJRA 1KEWA 4CM4A 2H9IA 2HY7A 4X6LA 1FJ2A 1KK3A 5DHPA 1P2UA 5DT2A 4RK7A 1D1QA 4MP8A 5IT9A 4DDMA 3E9DA 4G5RA 2JAOA 3P0EA 5A05A 1WBBA 2WMOB 4AKSA 3WV4A 3OIDA 1GQOA 2XGSA 3F6YA 4RELA 5KZMB 2ZDGA 5ALUA 2AZXA 1T0BA 3C6QA 4DCSA 1AS0A 1T3TA 2ODBA 5LP6C 3SIWA 3V1YA 4U39A 4E4TA 5AW0A 3K70C 2J59A 3GPCA 1E2FA 2ABWA 3GN1A 4FOSA 2HWYA 3WC4A 4CNBA 4G2NA 1U8AA 1ZXLA 2PANA 2XNDA 3BIXA 3HP7A 5DCUA 4BVKA 3G79A 2OC4A 5EC8A 3CH5A 5AK3A 1SXGA 2QGFA 3EGCA 4HVAA 1E4EA 1IC6A 1K6XA 1SHKA 2X0NA 2JFUA 4G0QA 3M3DA 1S9DA 2JZOA 2QV7A 3WS7A 2H65A 2JIOA 4V0NA 4DLPA 2ZJ3A 4D44A 2WKSA 2G1PA 3OPXA 2PR7A 4L2IA 2JDID 5L3VA 1T2AA 3MYRA 1U7WA 4O4HA 4B7ZA 2B36A 2H7CA 4J9VA 4DLZA 2DZDA 3HB7A 3WOHA 4N76A 4JXZA 4DGQA 3RFTA 4NMHA 4NBLA 4IIDA 4RHCA 4LVOA 2EGUA 3I6BA 4DSNA 3GNLA 4CIDA 4URWR 1U0GA 2I9PA 4KV9A 4EMUA 2OLJA 1GY8A 3CVUA 2H51A 3CW9A 2WVHA 4JXKA 4TXHA 3I8SA 2PD3A 3BJRA 3RV4A 3HJHA 4L7QA 4EECA 4B2LA 3UOAB 2O54A 3HUDA 3NX4A 2R751 2ZT8A 3EFEA 3LUJA 2OZLB 3R0VA 5H59A 5BV7A 4WMLA 3NHLA 1SXPA 2FSIA 3M33A 4DN6A 3U7GA 5AM0A 3ER6A 4JFRA 4HNVA 1I2DA 1UANA 1MCZA 3PGVA 3VR6A 2GCOA 4HH4A 1XDSA 2YFHA 3L7AA 3Q41A 4G23A 1H5NA 1IVSA 2ECPA 3L1VA 2D0OB 2ISCA 4JLDA 1KDZA 5LZ4A 2QRMA 2JGNA 1D2GA 1CSEE 4K3UA 3S5JA 3T9EA 1NDQA 2ZK7A 4O4JB 1JZTA 1HFJA 3ROFA 3PXAA 2O8FB 3GZJA 1L1FA 1ZN2A 5C5CA 1Z4OA 3ZDZB 1HDEA 1YA4A 3AOGA 2JLYA 4UM9D 4M38A 1DAGA 4F5EA 2LR0A 1GSAA 1ZFNA 1ZLXA 2OL4A 1L4KA 3E8SA 4RK6A 4Y6SA 3S40A 4EKGA 5B5SA 4KE8A 1QC5A 3WADA 3MGGA 1ZQ9A 4EHKA 2HZBA 2CJXA 4IDDA 5AJWA 5FBRB 2O2EA 4E32A 2JCBA 4V1CA 1FQJA 4FIDA 4EUNA 1C7RA 1HDOA 3BTSA 5F5XA 1NKSA 4HFMA 3TPCA 1OFGA 5DLQC 3DV0B 4ZGBA 4AU1A 5DNAA 2G71A 1Q0RA 3FCEA 3L4BA 1Z2AA 2JIBA 1E2UA 2VBCA 4BKPA 3Q0EA 2EFJA 4F91B 1I4WA 1ZK0A 4LJ7A 2HJWA 2G17A 3BGDA 3SQDA 3BIWA 4I7EA 4ND5A 3V1TC 4PQGA 4F6LA 4HDOB 2WIGA 4B6EA 1V35A 4HZGA 2AR0A 2V7BA 2CFSA 5LQDA 2DYKA 4J16A 4OHRA 5KYNA 4CF7A 3E9CA 1VKHA 1QJCA 1J06A 4UHBA 3UW1A 4BGDA 4YCDA 2P9HA 2GDJA 2O6HA 2WSYB 4EJSC 5BR1A 3AG5A 4EYQA 1H23A 2CLKB 4YPOA 1R9JA 3OZTA 5IDVA 2Q9UA 2J87A 4OSPA 3DYVA 3OA2A 3CZ5A 3OEHD 4P3XA 3VR6H 2AEJA 3F6PA 1HM5A 1RAHA 3LYHA 4Y30A 4DEYA 2G5TA 5IW8A 4MV5A 5BWCA 4KKVA 3Q3IA 4O25A 4EITA 4DV3B 2PV0A 1FY2A 2XUFA 1HF3A 3TEFA 3U3DA 5E95A 2YV5A 2ZSHA 1IWPB 3MT8A 4EHFA 1I94B 3F74A 4DXAA 1D2EA 1QJ4A 1SJ9A 1Y89A 2RK3A 4IG4A 1ORWA 1D9XA 1VHTA 2CLOB 3EEOA 2IHVA 1C9MA 4YIHA 2FG7C 4LF8B 1TFUA 3WL6A 1L1EA 3UWMA 2PX6A 3AEXA 4XYEA 5K8LA 1Z3CA 2QQ0A 2Z2YA 3RS0A 4CQJA 5JAPA 3R1IA 1DPGA 1FDOA 4MR7B 3VAYA 4F3KA 2XUAA 2W6JA 4CCSA 2OXRA 4JJ6A 4L4RA 3SD7A 1PEKE 2VNSA 5L53A 2PZLA 2R7AA 1XSEA 1V4BA 4DV6B 5U9CA 3BVPA 3ZCVA 2Y1DA 2DUNA 1RWKA 3DOJA 4A3SA 1AT1A 3HGMA 2W5UA 1QGAA 2IP4A 1YUMA 1V6SA 3CKMA 1B6TA 1GZ6A 1XU7A 4ENPA 4HB4A 1QDEA 3KWLA 2ASVA 4L50A 1DAHA 1SUFA 4TL7A 3A6LA 4XFDA 1IQPA 2QRQA 2GF9A 3IB3A 4KQ2A 4UU7A 5B7NA 3KT8A 4PYQA 1T2CA 4N6GA 3TR6A 4FUTA 4X61A 1BVHA 3BWEA 3C3AA 1GITA 2QMZA 2YR0A 4HX5A 4NOMA 5IZCA 3TBKA 4F3NA 4OQQA 1IG0A 3ESXA 4PTZA 3TX6A 2VAWA 2HIHA 2RHHA 5LQMA 3TPZA 1NW3A 4RABA 5FL7A 2DQYA 2UVDA 2I3AA 2Q07A 1DHRA 4YAJA 1MP0A 4B4DA 1QKKA 4MUNA 4U3JA 3VU0A 4E46A 5IAEA 1FW6A 4OXRA 4FZ5A 1EYZA 4EEKA 4C43A 2EBUA 2XCSB 4FC6A 1ECPA 3LUAA 4G4IA 2G9VA 1V1JA 4G89A 1NP3A 1DUVG 5E8JA 4YREA 5KTTA 4HADA 2BUBA 3GDWA 3HLTA 4BNJA 2ZZMA 1O6FA 4YX9A 3VV2A 1ZJZA 1EU1A 3HZZA 3L8YA 1JWBB 3GOQA 5J1SB 2G4VA 4Q3AA 3Q9UA 3RVKA 2ONYA 2ZUDA 4CG2A 1NRXA 2HX1A 1ONNA 3TCXB 3CVWA 1Y7LA 4GM1A 1OVMA 4F21A 1VHLA 3W2HA 3RS5A 2XSZA 2DP4E 1QXSA 4WJKB 2DHCA 1YDWA 1SVIA 3C5CA 1JQ3A 4GPBA 3AHGA 3EYWA 4IO1A 4MARA 4WV3A 3ASZA 4EZEA 3H75A 4Y3UA 4RD1A 1T8PA 2JI4A 3IAHA 3THXB 4OMUA 1J42A 1V6CA 1UBNA 4NBKA 3RAJA 2O8BA 1L7XA 3GD7A 3NHFA 1NY6A 4ZDJA 1VL6A 3EG5A 1GADO 2H16A 4FE3A 4KQJA 3W5CA 1RLIA 2PT6A 2CVFA 4P0PB 4NBUA 5DGDA 2O07A 4H7HA 1SB8A 4ARZA 4LYJA 1GKIA 2X5XA 3FZEA 3LW7A 1TLFA 1GKYA 4FMDB 3WZMA 3M4XA 1SHUX 2NNLD 4BYGA 3ETDA 2NYRA 4W5OA 4FW8A 2HNBA 3HKCA 1K7EB 3O8DA 2IFTA 3MLBA 3CTPA 4YAEA 5B1SA 4G1VA 5HRAA 3OJWA 4PU0A 5A71A 4K9DA 1Y4ZA 2DVMA 4LE2A 3VDMA 4QT4A 5FPKA 5LQNA 3O6VA 1WB6A 3ZJUA 3NHAA 1DTEA 1QCZA 1OT5A 3RVJA 5HXAA 3MJCA 3V1UA 4DW8A 1OFUA 4P7KA 2P4QA 3A37A 4MGEA 2GZ3A 5CNKA 2Q6IA 2HWWA 2POCA 1XALA 1TM4E 5HUJA 2GXSA 2BFCA 3L7LA 1OAKA 3U7QB 5KYXA 3QI7A 4UQLA 2QMEA 1W44A 3KWJA 4WNYA 5IX8A 3P9ZA 2BZ0A 1YUNA 1PGJA 1SRRA 2P9FA 2EQBA 4URYR 5ALOA 5FOVA 2QV0A 1QAMA 4FOTA 2ZZKA 4TWAA 4TYWA 1ARZA 3ETGA 1U3TA 2CVOA 3M6WA 3QW2A 2LP4Y 5TT1A 2RGYA 3EDMA 1VPTA 4TSRA 4R7ZA 1IBKB 1DIAA 3O4RA 1DKPA 1JHPA 2B7LA 3ZE2B 2B83A 4HMPA 1FNBA 4QE3A 4ETMA 1JEQB 3NP7A 1JDSA 1FLNA 1PQUA 1PEDA 1L3IA 3EMVA 4H6VA 4JT4A 1I36A 1SURA 3UT5A 2ZJ4A 1QV7A 4ALIA 4EWLA 4XLLA 3EIEA 1SXIA 4OM8A 4DZTA 1T4MA 5HVNA 2GI4A 3KXLA 5EGNA 5F33A 1LPSA 3GRCA 4X90A 4N7MA 3HBFA 3C1AA 4IDAA 2VJAA 2GMWA 4Q16A 4X63A 4RD4A 4WZAB 1GG2A 1E2NA 3RNOA 5I51A 2O1XA 4QO7A 1Q17A 4I55B 1CS0B 1NJ2A 3DHWC 3M6UA 4OUDA 2CB9A 3UHJA 3T5AA 3EEYA 3GBSA 2CUKA 2E4ZA 2P75A 2Q0QA 3LS2A 4OQ4A 5CW1A 3I6MA 2BP7A 3RUPA 3M5PA 1FMFA 1SY7A 1PJ8A 3QWIA 2FWBA 1TUBA 3EOBI 4HWKA 2IS2A 4HDAA 2VZ9A 4K26A 2HA6A 5FWYA 4LJRA 4TQGA 5JMWA 4XYBA 3OETA 4A2QA 4WCFC 1JHVA 4ZVKA 3ECCA 5K0TA 4RIFA 1XGKA 2ET6A 3QE3A 3IH5A 4PRYA 1U9IA 1MPXA 4DT1A 3O91A 3CN7A 3NTVA 2SCUB 3PA6A 4GEKA 3VC1A 1W34A 3ANNA 1WE2A 1Y3FE 2C2OA 3H42B 1N8KA 2EAUA 2Q3CA 4M89A 1W5FA 2XQJA 4Q0MA 1WMSA 1AB6A 5KVQA 4Z49A 3X0DA 1XRJA 4UE6A 3WHPA 2WRZA 1E66A 1SWWA 4U63A 3TSZA 4PZUA 3T38A 4PX5A 5FLKA 3IEKA 2OGWA 1YZHA 5E0OA 5T8KA 4QTXA 2WIBA 2A88A 2G63A 2EJBA 1B2RA 1RE1A 1H22A 2GYVA 5E3HA 3FTFA 2OP0A 4N39A 3S44A 1XLTC 3ZVLA 5H5JA 1ST3A 1YS2X 5FV4A 2ZR8A 2OD7A 4NPHA 2EZ9A 2R6R1 3BH7A 3CGWA 1SOAA 1NQWA 2DOKA 2QOEA 1KJNA 3A06A 1XTPA 1QH1A 3L7MA 4L8YA 5J2UB 5JANA 4AWAA 3A9VA 2C0PA 1NUUA 1WZCA 2C9BA 3RV3A 3QUTA 4XI9A 4BECA 5KOHB 1AF7A 2OILA 4K9RA 3VYUB 4ZJYA 1M2WA 2D5CA 3VNRA 1P5ZB 4KO8A 4PZPA 1KAOA 2LBPA 2VIIA 1OGIA 3LBNA 2B4TO 3RC8A 4KN6A 2C2ZA 1ZGZA 1IIRA 4F3YA 4ANFA 2AQ8A 2CHGA 3VKUA 2RK6A 3CH6A 3K6JA 1KNXA 5EKSA 1CJVC 1I4EB 2H85A 3TQRA 3JATA 3UXHA 2BKEA 2GGSA 1ZNYA 3GUHA 3O3OB 3OC6A 2HUNA 1OLSB 5EJ2A 1GLVA 2H07A 3URMA 4IJVA 3ZGLA 3QW4B 3OTHA 2X8BA 4DJEC 4DKJA 4S3MA 2ATEA 3K0FA 3B3JA 3VYVA 3NNNA 3ZTWA 1HNXB 1TPYA 2WFZA 3BL8A 3DCNA 2OEPA 4I99A 3JD1A 3LSYA 4QEZA 4MI9A 5EIWA 5JOQA 3C6KA 5LQCA 1XZFA 1DJPA 1XPOA 4QBKA 5CT6A 1N77A 1D3AA 2JLAA 1UDWA 2NO5A 1N2CA 4TN5A 2D3TA 2RHGB 2VJMB 1KPHA 1HDGO 1Z2PX 4JP8A 2V7TA 3UOWA 1RBMA 3TMAA 1CJUC 3EZ9A 4EI8A 1ODFA 2EIXA 3U9SA 2BFDA 2GN4A 3FPEA 4DV1B 2QTMA 1CY7A 3B5JA 3OPNA 2QL9A 4MICA 4QTYA 2ZCJA 3ASYA 2RSLA 3INGA 1QAOA 4ZT3A 1E7MA 3K96A 2CJWB 4WH0A 1WXXA 4YS6A 3GMTA 2XUOA 3LHSA 3ZDRA 4AIIA 5JS1A 1UMBB 3QVSA 4IJWA 4HK4A 1G17A 5BT8A 2PVCA 3IAM1 4HXEB 3NALA 2ZBQA 3C0KA 4N1AA 3O4IA 2C59A 3NP9A 3QLJA 4UQPA 4UU0A 4XVCA 4GYKA 3TNLA 5AW4A 1LV8A 2ERCA 2YNMD 1ZKMA 4JLWA 1TIBA 2LXNA 1CEQA 3ILVA 3VYTB 3WAGA 8OHMA 4GI2A 2JJQA 3V4SA 9LDTA 3TF5A 2WUEA 4BVLA 1ICEA 1ETHA 2YIMA 4Q9IA 5FADA 1ZOLA 1P0PA 1X7YB 1WPRA 2YV3A 4IFEA 4JJ7A 5HCNA 4J0QA 4ESHA 1N0VC 2A92A 2GJKA 4ZQCB 3G5AA 4DNFA 1XXHA 4MUYA 1L9XA 1FVHA 4BMZA 4YAGA 4TSFD 1NPTO 3SMVA 1LKZA 1P80A 1CB7A 8ADHA 5CA1A 1UQUA 2NQ8A 2J0UB 2XGMA 1Y4UA 3ZW7A 5KSWB 4HN2A 4EJMA 4LQ4A 2JI9A 2O20A 5TVGA 5TGTA 2BE7A 2LKDA 1OA1A 1P61B 2QZ9A 4HNAB 4HYTA 5K3FB 4MUAA 1ULZA 2IZ0A 2KYRA 3L0SA 4OQXA 3V1NA 1FVOA 1BXRB 1CZNA 3V1LA 1W59A 4RPJA 1CK4A 1CR0A 5E9JA 3MGKA 1L8AA 1TT5A 1KDVA 4YMSA 2QL7A 3KUDA 1ZD4A 2IZOA 4FJ2A 3ZCUA 4YASA 1MOPA 3IQXA 4DMFA 4KSBA 5K45A 2X22A 4JCOA 4CMCA 1S4QA 4ZCMA 5KYGA 1PDVA 4EW1A 3M5DA 3NANA 4P2BA 3K92A 2B6NA 4CTNA 2PZ8A 2YN4A 3VR4A 2BGJA 2C5LA 3IAUA 4TLMB 4BAZA 5LFAA 5LNK1 1KY5A 2PL5A 2HKIA 5FYQA 4AZ3B 1QIEA 1PRYA 4RVOA 2Y1EA 1PJRA 2M32A 4G37A 2ZIFA 3OFNA 1ZMOA 1C2YA 4F2GA 5KQRA 2REXB 4Y2VA 1SOVA 3RHTA 1N92A 1UQTA 1QFJA 3AJRA 1NXTA 1QP8A 4S2UA 4N3NA 4LG1A 4KR2A 2QTFA 1ZVMA 4QUKA 4R05A 1VGQA 4B84A 3MMPA 1V11A 3FWPA 3UHFA 2FEXA 3SC3A 4Z4QA 3PQFA 1ENYA 4DIFA 1G98A 1NIJA 1FYFA 2FAXA 3KJZA 4F71A 1U0EA 5CCDA 4ZU6X 3QQ5A 4ZV4A 5AUPB 2NP6A 3DC7A 4OIFA 4W6ZA 3I3SR 1UBRS 2PZFA 2DT8A 4I4LA 3CZPA 3E9EA 4K0RA 5JC1A 1MB0A 1VFPA 2OV4A 3VZCA 1PJQA 2BKXA 3GK3A 3BULA 4BFZA 1H2BA 3TAXA 1BEZA 1BFUA 3E58A 5ALJA 4YV2A 1FP4B 1X1DA 3CXUA 1XE3A 3IT2A 4JAVC 4MDYA 3EEIA 2JLRA 2QTHA 2X3YA 4URZR 3N2ZB 3T1TA 3KSAC 4J6FA 2PPVA 3PVCA 3DE1X 2I3ZA 1KYIA 3MB8A 1CUHA 4K2AA 5IM5A 3TJRA 4A16A 5DASA 1G291 1KFJB 1HPLA 2VDOB 5SZKB 5HP4A 4H4EA 1O08A 3QLUA 1WF3A 2DPYA 3FUUA 2B37A 4FMPA 4UATA 5G0UA 4URFA 3FM9A 4BC0A 4XRRA 4B85A 4OQFA 3THYA 1RJ9A 4JEUA 1E6MA 3SZGA 5AO9A 4ZC8A 1R6DA 1VJRA 2NO7A 3V2GA 4W63A 1T26A 2YQ4A 3KC2A 4TOIA 1WETA 2FP4B 2V7VA 3L0BA 4K6CA 3P20A 3RSCA 4C6SA 2I9KA 1T1GA 5EKXA 5FFFA 3VR4H 1RIFA 3QOXA 3URKA 5JY6A 1O6BA 3VU9B 4KG7A 3NVAA 5EVJA 1K88A 1U7ZA 4HG2A 3LG2A 2J41A 2Q50A 3I6ZA 2OGZA 4DJ5X 5CBPB 1IMJA 1DADA 1XA3A 2QLNA 2WKWA 5A7GA 5IHPA 4JXJA 4FYMA 4HQKA 3DBLA 5FNVB 4ZVOA 4GSLA 1UMCA 1Z8DA 3D02A 1IY9A 3PQ2A 1SG0A 4JBHA 3HNPA 3DWFA 4QBTA 4EGCB 5HPYB 4Y1RA 3SY8A 3B78A 4IRMA 3W5JA 1PE0A 1ZGJA 4UE3S 5LDDC 1DIRA 3AYZB 2AOVA 1E2EA 4CMJA 2NXEA 4EJ6A 1Q1QA 4FBMA 3VPCA 4JL8A 1QGOA 2XOKD 5DHRA 2GPBA 3HEMA 2RB4A 3HJAA 3T95A 1YR9A 2WG0A 4HH3C 5JPIA 3RUEA 2H3EA 3MCTA 4FNOA 4KDCA 5GMOA 3TRFA 1QIJA 1XAJA 3GJ7A 2XF2A 3FLMA 1U0NA 4WLNA 1N2XA 2KE5A 4PZ0A 1VIMA 1P75A 5KQGA 3AI2A 4I1VA 1NYLA 5DHTA 4EY7A 1T9BA 1WP4A 2A84A 3FCOA 1CLUA 4KPEC 3I39X 4P5DA 1I0LA 4QGHA 1TJ3A 1K6JA 1RPJA 2BBSA 3F4KA 4RXMA 1N3LA 1DELA 3N2KB 3FI9A 4QVGA 2JKZA 3O7WA 4XGNA 3ZE7A 2E4WA 5KTPA 5F3WB 5CLHA 1UK7A 2AZMA 1MVOA 2PBFA 4QDTA 3HXPA 1I6MA 1U4SA 2HEGA 3BXXA 4IS2A 1TYEB 4TM7A 1PZEA 3AYXB 3CZCA 1IN4A 2PL1A 5E4YA 4JENA 3WYFA 3T1NA 3W5VA 4E5UA 3I64A 5G02A 4K6GA 1T8RA 4QFMA 1Y6FA 2VC2B 1J6UA 3B51X 2JZNA 4OKSA 4PG4A 2ZYRA 5EWMA 1X9HA 2X1HA 2YMQA 1KR5A 1WV0A 3SNHA 4JBWA 1RLUA 3AERB 3MBOA 4EYGA 2IH4A 3UAVA 3H2HA 3D3KA 3ZNQA 2GX6A 1OTXA 2W8BA 1N1DA 5IP5A 1P44A 3KT0A 2JDIA 1JIUA 1C9EA 1Z83A 4AY3A 4DIEA 3ZLJA 1Z9BA 3E7XA 1R00A 2VRBA 3EPPA 3IAM6 1JAXA 3JYQA 2YWCA 2ZUTA 1OBOA 3DA8A 2PGLA 4LDAA 4ZOLB 4KMSA 4M1QA 3ZDCA 4DDVA 1H2HA 3I0MA 3JVDA 3CLSC 4QDOA 1VXRA 5KNDD 4UNSA 3RFXA 1E5TA 4J43A 5I8ZA 1WNFA 2D2IA 3M6VA 3VZQA 2GXUA 3LDFA 3R0QA 3VYRB 1G19A 5JQGA 4KSYA 1RC8A 1B8OA 3WWDA 3H9CA 1MD9A 2Q3FA 3I01A 3MSCA 3IHLA 3KSDO 2FX2A 2EJCA 4IM7A 3H2JA 4N0MA 9ATCA 5L95A 2Q3EA 1Z4LA 2PSSA 3DP9A 2YDYA 4YEDA 3HVKA 4EI9A 3G0IA 5LQJA 1QO0A 4DVJA 1TAGA 4MWDA 2WUWE 2BI4A 3BK1A 1PO7A 4XYMA 3N0WA 2Q49A 5DXFA 2HYIC 1BWQA 1EBFA 1MB3A 3RRXA 1P62B 2BONA 4DHWA 5BV1A 2TMDA 5CDUA 1UOQA 1CQIA 3DXXA 4NENA 2BFBB 1U3FA 5BQ3A 3A28A 2VXBA 2DPLA 2H17A 1QGDA 4KFUA 4YJ3F 2QP4A 3SJAA 1W25A 1HQYE 4QPPA 5G4KA 2AV6A 1YQUA 3PD0A 1P2DA 3P2EA 2D00A 2BGTA 2FUNB 3GGCA 4L3OA 2KMLA 4BPBA 3RT1A 1Z06A 2WJHA 5ES4B 1LJLA 2PMDA 1R6UA 3H4TA 4EZIA 3L7YA 4F8EA 1USGA 1FRNA 4FXPA 4PXSA 2BGRA 2XDQA 3VAAA 3BZUA 1TTQB 2CHVA 1NWHA 3EFHA 1ZZEA 1RXVA 1JKMA 4UHJA 4F5YA 4LX0A 4LK3A 1KYZA 4LY9A 1VGVA 5KX5A 3L8HA 3HN7A 1A4RA 3FCAA 4NV3A 3CPJB 1AQ6A 4F92B 1J8DA 2GKSA 4G0MA 1YB7A 3MTIA 3UKDA 1SBHA 1E5DA 3KV1A 1N9GA 1TJYA 3KPVA 3VHXB 1NP7A 4R2KA 5C8YB 3PRYA 4BNDA 2X76A 3SZUA 4ZEMA 2AX4A 2JIDA 4KI0A 4PZDA 1WMBA 1RIIA 5KC9A 1J90A 1I13A 2YUIA 3DTTA 4JR2A 4UVIA 3OQ6A 1AMNA 1DHTA 2A5DA 3OEHA 1T2VA 2I8LA 2REQB 4G8DA 1XP5A 4OAQA 5FBHA 4AP6A 4YMHA 4KMRA 5K3OA 4GUAA 5ALQA 4MQFB 2IHYA 3NKFA 2YDXA 2B21A 2PH1A 2XEDA 2WJ4A 3FOAA 1KI1A 1GV0A 2XZTA 4BJ1A 3NRBA 1NE2A 3ADOA 2GEFA 1JKFA 3HY6A 4J7CA 1H2XA 2FF7A 4IICA 3VSEA 4FYHA 1GAJA 1AKRA 3SM3A 2P9ZA 3DFZA 3ZCTA 2QD2A 5HZMA 4TMWA 1BD3A 3MTBA 1Y37A 1WUYA 1QVRA 5A9SA 2ZJFA 3D0RA 4EI7A 4B2PA 2AMYA 1CWUA 2P7HA 4DKXA 1F8GA 5TGDA 2Z1DA 4D4LA 1RI5A 6YASA 3BZWA 1BKDR 3JZFA 2ZSJA 2ZUBA 1REQA 2CXPA 3WJ7A 1QONA 3G5UA 1P18A 1WMEA 2CFIA 2F3QA 2ZT5A 1RYEA 4NTZA 1I3NA 5H3LA 2A9OA 2BTEA 1Y81A 5I6DA 3WMFA 2G9ZA 3J7TA 4KJZA 1YVPA 4HNSA 1ZIOA 4NPCA 2QLBA 1GAQA 3LW8A 3WYEA 4CKWB 2C7QA 1UOPA 1RI3A 4H7JA 2DQKA 5A02A 3DOOA 3FBGA 1PBTA 1SEPA 1EXDA 1TM7E 1U3CA 4HV4A 1XMVA 3C3YA 2V59A 1V7PC 4L1KA 4JITA 4YO7A 2FE4A 3MS2A 3HRIA 1II9A 3C15C 3VH2A 4O08A 2XOXA 1T9GS 3FBWA 1W0CA 4CMKA 3DF9A 1KFCB 5EWJB 2XUKA 4RMJA 2JA2A 1LBQA 3A9CA 3LA6A 1HYBA 4MPPA 1XHEA 1VP9A 3FVQA 1SBCA 1DARA 4HLUA 1N8NA 4JLNA 2VP3A 5GV8A 1KI3A 2W2TA 1ZESA 3SC6A 3H1BA 1CS4C 2H1CA 1CE8B 1KVTA 2Q5HA 2QN3A 2J32A 3A4YA 2AQKA 1TZJA 3ZVMA 1M2EA 1EESA 4KITB 1ML3A 3BHMA 3HB0A 3ICOA 1JIJA 1GYRA 2VHXA 5BQXA 4TVKA 2VHTA 3BFKA 3Q0IA 3Q5DA 1U2EA 5EJGA 3DR5A 2YJNA 4S1TA 5IAOA 3Q98A 4BV9A 3RT9A 2E4AA 2VRWA 1Q57A 2R7NA 1R8QA 3HO8A 3O75A 2CBZA 1OU4A 1QQAA 1TFRA 2ZREA 4LYEA 1KY3A 3FYUA 5TSDA 4FGSA 3RVQA 5KCMA 1E6LA 5FJIA 1QR6A 2WYUA 3L2OB 1AUXA 3UW3A 1K3UB 1NF9A 5LL6P 4NATA 1P7PA 3OHPA 1C1DA 3SMQA 4CMEC 3NHWA 1XG5A 4R7TA 2QX8A 3OFSA 2IXEA 1YFLA 2BZGA 2YY7A 3P19A 1A69A 1DRUA 3RJ9A 1ENOA 4P35A 3HYCA 4ZXFA 3MWGA 2EFYA 2WM2A 4QWMA 2FSGA 3DBHB 4ZMSA 4OK5A 1AKVA 1E5XA 1QFXA 1UBMS 3DTVD 2AKAB 2EKBA 2KW5A 3QMPA 4R4JA 2G8LA 4OLFA 2XADA 3DVAA 2LZ0A 3EHEA 2GRUA 3NCHA 3P0RA 5AW5A 3CR8A 3LKZA 3BUSA 1C9DB 2H63A 2X7JA 4OP2A 1L4GA 3TZBA 4XQGA 3O7MA 4NMLA 2DSTA 2ODEA 5JAHA 1ZVQA 2WIAA 1F17A 2QN9A 4WY8A 4D82A 5GJWC 1MT3A 2XLCA 3IJRA 1W52X 4ZV7A 2F8TA 1XROA 4B47A 3E3AA 4UNIA 4DIBA 3I62A 1YMUA 5KNLA 1NBHA 4BEVA 3OPQA 4F4DA 1XCJA 1E92A 2HHCA 2NZYA 3AU9A 5H81A 3MFYA 3T06B 1D6NA 4Q4LA 4X1KB 3ZIDA 2B34A 1FDIA 3OM9A 1Q7RA 1EIWA 1AGRA 2ID7A 5DNVA 3OFJA 1FUIA 2EVWX 1YDGA 2CNKA 3CUWA 2D2XA 3EGOA 4LYFA 4U6QA 2PNJA 2JJ2D 3JCZA 4RDHA 2GPTA 2HHAA 4BTVA 1LCIA 4M8IA 4H6PA 1E9CA 4QGFA 4R2MA 5C3MA 4TV8A 1J2UA 2FW8A 1XK6A 2PLNA 2FMIA 3KU1A 4JJEA 4N5NA 3SXPA 3ACCA 5CB4A 1QIMA 2IUTA 3CV3A 3QVVA 3OE5A 5JE8A 5CJPA 4RNDB 2C7GA 4I4TA 3D1JA 2ZRQA 3EGIA 3IMEA 2FN4A 4WBSA 5ESWA 1G9TA 5FULA 4BMOB 4BJ3A 4XYLA 1B42A 1OAAA 2DPHA 2QW0X 2WYIA 3FR7A 5E3JA 4MUEA 3V80A 1R0KA 3F4BA 5JDCA 5KDDA 1PTJC 2XZOA 2YXDA 4NZ9A 5EUCA 1JA0A 2WV9A 4BFTA 3TPFA 4LHXA 5I8WA 4IIUA 1PBNA 5LIPA 4UUPA 3PLRA 4TZ6A 2C3MA 4O4HF 4R2LA 2V97A 1OT3A 5JFTA 4AJKA 1YONA 2DPGA 2LWIA 3JQ7B 4H35A 3ZJVA 1PLLA 1DRKA 3HC7A 3T4PA 4HQRA 4RZHA 2CSUA 2HEIA 3F46A 5LN1A 1WDKA 2HSWA 4MVJD 4A91A 3S2FA 1L1QA 3K5HA 4HDCA 4RTLA 1SCIA 3PXXA 1O57A 1LDBA 5AHXA 4NU0A 1LTHR 2Q28A 2F8MA 3N3BC 4TN1A 3CXRA 3KKMA 4W7HA 5AI6A 3FHTA 4KQKA 3H5VA 4Z2AA 2AFVA 2G09A 1GQSA 3UUGA 3JARB 2TRSB 3U16A 5KWJA 2Q1WA 4DC1A 1HKUA 2BRUC 2XRMA 2XY4A 3GRAA 5F3RA 2NU9A 1EGVB 1PV2A 4MB6A 5DGIA 3NETA 1HORA 1YJCA 4D57A 4M0FA 4IJKA 4EO9A 4YUYA 1Q77A 4WHMA 5CCXA 1T8UA 4C04A 2L2QA 3U3RA 4UKDA 4O2AA 5FTJA 3OMWA 2E0IA 1T2FA 3TLGA 5TQ2B 1B73A 1K7CA 4CDMA 1W4LA 2C5GA 4CTJA 4LBZA 1ZQ1A 2AFHE 1VRVA 3H87A 3OPYB 5ADWA 3IIIA 2RGUA 4FFMA 4JI8B 4P81A 5BY2A 2D7CA 5HOEA 3CLUD 2Z5LA 1IAVA 1XDZA 1HE8B 1AKUA 2HC9A 3NORA 4BFWA 4WFQA 2YIDA 2IYZA 1T2NA 3T5GA 2C5HA 3ZOKA 4LCJA 1M7HA 1QANA 2HF9A 4CLOA 4M9ZA 2IIBA 3TG2A 3AFMA 3L49A 1OXMA 4GMGA 1XZKA 4GI7A 4IDHA 2WV7A 4JL5A 2IU0A 2PX5A 3EDRA 4UM7A 3LUDA 2P0YA 1ZCFA 5I7UA 4HBZA 1NC3A 4ND8A 4GI1A 4ZEOA 4R6XA 3AM4A 4PLHA 3NWBA 4FE4A 4NABA 3D43A 3OZRA 3S1SA 3PDHA 2WIDA 3T3DA 2Q6KA 2FP3A 3BJMA 3A9RA 4BTLA 1E0KA 1GFSA 4MHSA 3LKDA 2VXYA 2E5WA 1J8MF 3MK31 4LCEA 1OC4A 4J2TA 1YH3A 4OXQA 3TLMA 4PNPA 3OF2A 1H2WA 2D1SA 2GBIA 4L3WA 4QPCA 1MOQA 5GOTA 2VCEA 1BMTA 3BSYA 1HTWA 4AURA 4A92A 1BKYA 3DEZA 4Q1BA 1AIPA 2W43A 1Z8FA 3UMBA 2O7SA 3GPIA 1TKBA 3E2IA 4R0NA 1R6XA 2AVNA 4D0SA 1LQTA 3N2GB 3H5WA 1PYGA 3ZZTA 1G8FA 2YKGA 1AK1A 1XOIA 3UMCA 3AW8A 3REQB 4CR8A 2RH8A 2VEDA 5HM6A 1JQEA 2FPGA 5KREA 1V7QA 3STVA 4P98A 4BE7B 3BTUA 1FC0A 3H5NA 1FFBA 4OB7A 5LZ2A 1CQJA 1EJBA 2OOSA 2FEAA 4C0SA 4Z1MA 5F23A 2F62A 3RS9A 1IZZA 1AE1A 1QZTA 2SBTA 3KU4A 4ZVUA 2QR2A 4JI5B 2P9QA 1N1MA 1NLFA 4YBZA 2EIHA 1WP9A 5FHQA 4FZVA 3DOHA 4MDHA 1G21A 3C14C 1XTBA 1H69A 4MLPA 4PPGA 4QNNA 5D3MB 3ZGVA 4DF3A 4ERNA 1RQNA 1RTTA 1SCUA 1PG2A 2OXIA 2YNMA 1CJBA 3I37X 2YWXA 2NADA 3OT1A 1PSZA 4RYLA 3AP3A 5EFOA 4KBFA 3UWPA 4CM8B 3FRIA 5KOYA 1RWWA 3L6OO 4S0ZA 5K8JB 1I3MA 1ZVKA 1M8PA 4QDKA 3EF0A 3RS4A 1WEHA 4G24A 4HNUA 3U81A 5DMXA 2ODNA 1YNOA 1I1QB 3L7DA 2P2SA 3AQ4A 5HR5A 1P33A 1DQRA 1THZA 1CDZA 3PWSA 4RUKA 2JPDA 1XYYA 4YN3A 4AL4A 3E70C 1PUJA 4D4IA 2V4ZA 1CY6A 3IV7A 2V0NA 4AC9A 5IN4A 5JNUA 4TSFA 1EUZA 3LO5A 2VPWA 4LRSB 3IEXA 1G5QA 1MW9X 3GT0A 2ZYGA 4FHEA 2UUOA 3B2EA 1T5OA 4UXHA 3WMWA 4NECA 4JDPA 5I48A 2QTLA 2KWIA 4WZBA 1M8GA 2OM6A 2JK0A 5A2QA 4MWGA 1BCRA 1K8ZB 4GWGA 4YLYA 1GU0A 1KO5A 1T5BA 1UWKA 3BJZA 2BEVB 3PUXA 4J2OA 3PHLA 4L07A 3ZE8A 1KJYA 4BAGA 4XOIA 3OLVA 4F9TA 3FTEA 4UD2A 4ARVA 1LBHA 4PONA 3PCTA 5CEEA 1D1SA 2RGWA 5JDIA 5MGBA 1GM5A 1MGOA 1CPYA 1DJOA 2PAAA 4XDZA 1HEIA 3D8NA 1Z34A 2WB2A 3Q7SA 5IH3A 1W5AA 2FPKA 4R16A 1QHIA 2O2DA 2XB4A 3EPJA 5CH5A 4LOJA 5C9ZA 1T24A 2TYSB 4F85A 4G2TA 5DGTA 1ZOIA 3GZ4A 3RC2A 3PPVA 2WZQA 4MJ7A 3F6CA 3UF0A 3LX8A 4LDZA 3R8FA 5M04A 2OZEA 2O4UX 3DO8A 3G5MA 3E22B 4ENTA 1I1OA 5HF6A 5K6RA 2AR9A 1NYQA 4DFDA 5KTOA 5L9AA 3I9FA 3LX5A 3UOGA 3GLGA 2ZE8A 2IYVA 4FR5A 2ZG6A 1W88A 3BPSA 3OOYA 2ZWIA 4Z0TA 1RI1A 2E2WA 1U63A 2IOYA 1C3EA 1JG2A 1WVIA 1WY7A 3Q7PA 4LQDA 4BU0A 4F9GA 3S68A 3P2MA 1VBNA 3CUTA 3O83A 3VTZA 2VTBA 4KHPB 1LC0A 4X66B 4GYJA 4IIGA 2Z56A 1FXUA 1XCMA 1MZVA 2AQIA 4J1TC 1KJIA 5DM0A 4ZVSA 4XQEA 3TLCA 1JLMA 1KI4A 3C8ZA 4QAJA 4JI3B 5A3QA 3CLRD 4XH9B 1PGNA 4P7JA 5DTJA 4BWVA 3P52A 4I5EA 2VKTA 3LC2O 3CLTC 1S2DA 1VHWA 2G5GX 4YTEA 1O4WA 5AIBA 1QGUA 4JJ8A 1XQVA 3T5CA 1L4UA 4C4OA 1RYMA 4DB2A 3S70A 3S28A 3FPHA 3GJSA 1TAHA 2Q2OA 4WFIA 5D01A 5JFGA 2HL6A 2IYPA 4D9HA 2R4TA 2FPOA 3PE6A 4L6CA 4DUGA 5INTA 1EFTA 4B3HA 5LQRA 3O90A 1ZOOA 1HSOA 2ZU6A 2NSYA 1XQWA 4PTLA 1MJGM 1BQ4A 1QX3A 1UWVA 2WFLB 2YY5A 3HKEB 3JQCA 2W70A 2YBEA 3I9KA 1E58A 4E5PA 3LKVA 5BXQC 4EB0A 2HRRA 2ZEJA 4P3OA 5IYZA 3VC2A 3CIOA 1CHDA 5EKTA 1LPOA 4YROA 5M34A 1WG8A 1E3DA 2O3RA 1S2NA 4LFAB 4G1MB 4ZQEA 4BQOA 1SD2A 2AK2A 2C42A 4B6JA 3K1TA 4TWRA 2IPXA 1DBPA 1PAUA 3CX7A 3G0OA 3PJEA 4O33A 3X2SA 2VWHA 2VPIA 4XGIA 3RQSA 2B4AA 4OX9Y 1YVUA 3G3EA 1E9DA 1GT6A 2H3HA 1EFVA 1A04A 2X0IA 1JDVA 3BIFA 2VDMB 3H7AA 4IF4A 3PHCA 4YXWD 1M54A 3ONFA 4TV9B 2P3OA 3RSOA 1GNSA 4TLDA 4DLNA 3FZQA 1CUAA 1R0YA 2OSVA 1ZUNB 4Z1OA 3FNHA 4UREA 4OQZA 3I6IA 4V0ME 4JT2A 1KZ9A 2MSEB 4W1PA 3ZK8A 4UUAA 1PDOA 2GAAA 1LLFA 2NUTB 5KVAA 4XDHA 2CNBA 2O0JA 2O2ZA 4Y9UA 4Y2RA 3ZU2A 1PHPA 1THMA 3F67A 3IE1A 1GPAA 1E1KA 1XJ5A 2ZB2A 5CVDA 3FTNA 1VL5A 1LU9A 2QSYA 3EVZA 3QHQA 4OG2A 2XOKA 5KQPA 4JQZA 3MBIA 3VSAA 4NS4A 2CUZA 3TLEA 2VNIA 4RF3A 1FYEA 4Z53A 4BNYA 3O8NA 1IOWA 2PIDA 3F5MA 3KHUA 5K3FA 4FDLA 3C1UA 1QE0A 3PHBE 4B35A 3OPVA 2DQZA 4LXHA 3QSGA 5LBUA 1FCJA 1EP9A 4BQSA 2UZ1A 1JYSA 4YJHA 1P7ZA 5EP3A 4S04A 4XUCA 4GBMA 1RJDA 4C22A 3U7FB 3LOPA 2KPOA 1YGPA 2ZIWB 3MIIA 1BWSA 2JGRA 4OK6A 4QELA 2C4NA 1YZTA 1BX0A 3EZ6A 3VO9A 4BP9A 1G5TA 4O2BA 3WWPA 4ER5A 2JEOA 3OTQA 4KQCA 3VBEA 2IUSA 2PKRA 3W34A 2PX2A 3WDKA 4K81B 4GEGA 3WHIA 1Q1EA 1S1MA 4NE9A 4RXUA 3WOVA 5JNSA 1TCAA 1ZH4A 3ZDQA 3VJLA 3ZWDA 421PA 1MJNA 1STOA 2B61A 3LBIA 1LLDA 5EIOA 2W6PA 2CLMB 2Y8EA 2JGFA 4D98A 4HQ0A 5FXMA 1KK2A 3SS9X 2Y1GA 3WK5A 3PQDA 1NBAA 3RJMA 4HRAA 2GRJA 2BBTA 3CO5A 4P4UA 4ZI5A 5JSFA 2PSDA 4GOND 3TEJA 2XBMA 3OJOA 3LT5A 4N47A 4D1YA 4YRCA 3ZI0A 1O0BA 2AYYA 1P6XA 2RJ3A 1JNYA 1SZDA 4M99A 2YWBA 3IRVA 1E3TA 1WUKS 1WHTB 3JRXA 4LKOA 1JBKA 2VDWB 5IC5A 5HIJA 3SC2B 1N8TA 3JQRA 1PS0A 3T41A 3VUFA 1THTA 2FPLA 2WOJA 3FUCA 1CDDA 3VKHA 2PMWB 5JPCA 5JR3A 1IULA 1GPDG 4UCQA 1R4MB 4M0CA 2PSHA 4WKPA 3QTTA 1YS9A 2P1DA 3H9EO 4BGEA 1R6AA 2NIPA 4NZPA 2OAQ1 3UV7A 4BVJA 3QELA 3V4VB 4B6GA 4DC0A 2O3QA 4N5MA 2W2NA 3MA0A 5LWQA 4KUHA 5CDTA 1C3VA 3AY7A 3NDRA 1Z5WA 5AVXA 4DQKA 3F0TA 1ZRMA 1DTWB 4TT8A 1QRDA 1V4VA 1JT2A 1K5HA 1NVDA 1WW8A 4WY5A 3U3XA 4W7SA 1NYRA 3QVGA 4M60A 4II2A 2BFOA 1KSHA 1YZQA 3H4MA 3VZSA 1AC5A 2A0UA 2A59A 4BP1A 5TXGA 2GS9A 1QHGA 1W96A 2QAIA 3Q3GE 4LDQA 2HADA 3FDZB 4HYQA 4PZLA 1Z0FA 5JSHA 5KYUB 2XHZA 3FJ1A 4O4IA 5F4ZA 5CUQA 1JIIA 3CEPB 3ZDAA 3F8TA 5DX8A 3FYHA 3NNSA 4B80A 1E3QA 2QUBA 4GX5A 4H0FA 2MR6A 4WN9B 4C4ZA 3K1AA 1VPVA 4JKOA 4QC2A 3S2IA 3SX4A 1YIDA 5CDFA 2ZTMA 8GPBA 4TKMA 5A62A 4R84A 2ZYWX 3RUDA 4BBZA 5B6JA 4E88A 5FNVA 1IUPA 3VDXA 4L27A 4DCJA 1YFJA 4ZI7A 3UQYS 2O2IA 3LNTA 2W4MA 1TF2A 3FCXA 3OUTA 4LECA 3DZIA 2NT4A 6ABPA 4X0EA 1N7IA 4R1NA 1LPAB 1Y1PA 3UWSA 4YV7A 3NDIA 5H7XA 3CSDA 1KZ6A 2BAGA 2R3SA 1AV7A 2AG6A 3IT1A 1H0RA 2X3UA 1KU6A 3DPUA 3HCCA 4L9SA 1ONSA 2Q4TA 1KFEB 3C8DA 1QF9A 1EDZA 1MV5A 3HNOA 1OIWA 3F5SA 2GM3A 2W7TA 1YCHA 5KNDH 1JR3E 2Q46A 3Q6NA 4O1HA 3U7IA 5IXJA 1WXEA 3IIJA 2Q4OA 1BGWA 3C74A 4IVPA 5AICA 1FX1A 1J39A 3PLAE 2XQGA 3LRPA 1ZO8A 3TQHA 2OPBA 4DQUA 2JAQA 1OWOA 1CF2O 3NTLA 4KFSA 4EJSB 5B12A 2PN1A 4W9MC 3FX2A 3FGPA 4QLBA 4XX0B 5IAGA 2UZAA 1ZIDA 3GFVA 4S24A 3F9CA 1XCPA 2Z04A 2Z9BA 3BTVA 1AN0A 2XTNA 5EXSA 1K66A 4XSVA 3RF6A 4BWGA 4ZYVA 5C7OO 4DCPA 5JZSA 3FSGD 4GX1A 1SVWA 1LX6A 2GDZA 2XCUA 5CA1F 3RBZA 2EFGA 1K7FB 1UBJS 3GUVA 4UZEA 2BR5A 4DLTA 1UODA 3KJXA 2X4GA 5K0GA 1JFRA 1OAOC 1WDTA 3AR7A 4HSEA 2ZI4A 4EB3A 1RBQA 3ORSA 4G0VA 1ZK3A 5DTMA 3K70D 1DDOA 1RACA 3AWIA 3HCNA 2JLXA 4WCDA 1E99A 3L8CA 5LA6A 2EYUA 5JRJA 3E23A 4J0CA 2FQYA 3CUVA 4MW9A 5A3VA 2V3VA 4AJOA 4BQPA 1T3SA 3H3XA 2JKVA 3QG5A 3BFJA 1IM5A 4ZK2A 1KEPA 3FAZA 4LXQA 1Z5UA 3TZEA 4F4CA 4G4GA 1OB2A 3A27A 3BZBA 4AMZA 5AHWA 4BNVA 4RW0A 2I2DA 2PX8A 4MV9A 1IHUA 2FKNA 4MW6A 1EGAA 2X6QA 2ZS8A 3DEFA 1YGYA 1HMYA 4KMMA 2EZ4A 1U0TA 2GVNA 1YIOA 3EVTA 5EWLB 1VB5A 3FCUB 5E6UB 1Y4SA 4P8RA 4X1YA 5JZ9A 1NVUQ 2JJ1D 3W2GA 4D96A 4EY6A 1EK0A 1C0KA 1U2SA 3EMBA 5DXAA 2F90A 5LLSA 1W0KD 5I01A 3JR7A 5FPQA 5TMDA 3UAGA 3WG9A 4QU5A 1OF1A 1U80A 4WJZA 2DERA 3ED5A 5HKAA 4FWTA 4KACA 3L1KA 4QTZA 3NGXA 1IB6A 2DY1A 2FRXA 2REOA 2R8PA 3EUEA 1KAQA 4JLVA 4LOAA 4U6NA 4WZZA 1GN8A 5FI0B 5KTSA 1JQJC 3ZKAA 4PHHA 3SFVA 2ZSEA 1BHJA 4V0QA 2YXNA 2O7RA 2NVUA 1S6YA 5BSEA 2PUEA 4EAQA 3N8HA 4RENA 5HFNA 3NBXX 4KH0A 2CSXA 3PP8A 1NLYA 2E37A 2XUZA 4GO1A 4FFPA 1JLRA 5F77A 4JELA 4IWYA 5LUAA 1LC3A 4Q66C 2BELA 3DMHA 2LRHA 3MRVA 4MAFA 4C88A 4D9KA 1RWQA 2GPSA 2CDBA 1TF7A 3MYYA 5K4AA 2QZSA 3GLHA 4RKWA 1QOPB 1KYWA 1RJGA 3IOYA 2WU8A 3QPBA 2CXRA 3DOEA 5GY7A 2ONJA 4RU1A 5K3AA 2X4DA 1RP1A 2P0EA 4YPVA 4U4AA 1R9MA 5B7GA 5EL0A 2YZNA 4DG5A 3K9LA 1XVVA 4KXYA 1C4KA 1JMYA 2MR5A 4Y9SA 2W22A 4J16C 3EPRA 3ELUA 1JFFA 2XZPA 4JY7A 1F1JA 1E1NA 3ZNOA 1S8FA 1I7PA 2R25B 2BEUB 2IHNA 1YCFA 3EZFA 2ATVA 4R54A 2WM8A 3JYPA 2Q0XA 4TKLA 3VR3D 4WUTA 3STHA 3UAOA 2O0MA 3DTVA 1VLHA 2C2XA 4GM0A 2TECE 1DUIA 1BXGA 1DKUA 4JS0A 4M9QA 4BJ6A 2V54A 1HFWA 1TI7A 3UV6A 2PY6A 3DLBA 2VJPA 4L0QA 4Y6LA 3WLEA 1TJPB 2B98A 4BNIA 4GP6A 2O0LA 3K7EA 5T7BA 1GRCA 4JBIA 3WISA 4ETIA 3C45A 1BG6A 1VIAA 3OM8A 3A9UA 4D8TA 3SZOA 2BHTA 2V0CA 4L9RA 4MQFA 1XLVA 4UMDA 4PW0A 1QHSA 1RLMA 2W0MA 2ZSBA 3OU2A 3RSQA 3D6VA 3GJ3A 4NXMB 5LU8A 1ID1A 4FHFA 1ZITA 3JYNA 1TYDE 3RFUA 4DV5B 4M0KA 3RJZA 1PJBA 1V7ZA 2LW7A 5AK0A 2PUGA 5BW6B 3OCJA 521PA 3STXA 4XAQA 1K97A 3KO8A 4FX5A 5K8VA 5BPHA 4XB1A 2ZDHA 3IPYA 5G3YA 5JJIA 4EM6A 1M1YA 2YXPX 4JLUA 2VF5X 1EBUA 2XW6A 4GQIA 4A1OA 2C2KA 4CLDA 2Q9AA 3A05A 1Q7BA 5LXTB 3TLJA 1TO1E 1EG2A 3QMWA 1KEZA 4JT9A 4AAYA 5BVHB 4C7OA 2IOQA 2JBWA 2JJ2A 2RHMA 3GGDA 4L08A 1TK3A 2GCEA 5MN5A 4WZ6A 1HT2E 2VRCA 4NS1A 2HQRA 1IHPA 2AOXA 2HMVA 2PKWA 1QFYA 4R1MA 3DD1A 3CE9A 3MMZA 1KL7A 4RY8A 5C5EA 4BRUA 2CFRA 2YWRA 4C4XA 1ZSVA 5GIOE 1VSBA 4AJ1A 3DVRX 3SICE 1KC1A 2FSHA 4D5GA 3U7HB 2XLBA 1KBQA 2DU8A 2FUEA 4L02A 4YECA 4PG5A 2Z6QA 2XYQA 4IBOA 1VJTA 4PV7A 3K3PA 4KZKA 1P9OA 1E1QD 1XR3A 2QM8A 1BSVA 1B93A 3ERCA 5DYIA 1BO6A 3PITA 1XYGA 4IVRA 4BZPA 3H99A 1RRVA 5TB5A 3WE7A 1G8YA 1GZVA 1OKKD 2DFNA 2HDOA 3AUSA 3BMOB 3P4XA 1N9KA 4G8BA 4LMPA 4OJYA 5FWXB 1JVBA 4G0NA 5A4KA 1DAOA 2HCBA 2VYFA 3I2JA 1Z4KA 1PNQA 4GWKA 1ZICA 1PHRA 4LZPA 3UYLA 4W9NC 3F47A 4IXWA 5AM2A 1ACMA 4FGUA 5FEUA 1SU4A 2GETA 4BKUA 13PKA 3A0RB 1XWFA 1F14A 1XKLA 2OBFA 3NONA 3I5MA 4ZV9A 4ZVRA 2AX3A 4HGRA 2RGCA 5GWXA 1HC7A 1ISIA 5ES3A 4MVJA 1OYYA 4KTTE 4CETA 4K7JA 4D81A 1RRMA 2ZT6A 2XB8A 4OHYA 4MVWA 5I9SA 1V5EA 5J3JA 1D04A 4QD3A 1SK8A 1DFIA 5JQGF 4BLOA 4FIZA 5AJHA 3DDOA 1NUSA 1QVZA 1TZCA 5AKYA 2WHPB 3OPYI 4BNGA 1DRWA 4YRMA 4ZICA 4MR9B 3MTEA 5JS7A 3GJTA 3PPYA 4RK5A 5JBQA 1KK0A 4PLFA 3DR3A 4HMQA 3NJ8A 1W1WA 4CV3A 1Y63A 4B76A 5DM70 2J9FB 4MLCA 1JTVA 3EASA 5GM1A 3ZXSA 2QTGA 2VHWA 4YRPA 1MNQA 1V1MA 2Q3MA 2QRNA 3FFWA 3G8YA 3K4PA 4HAYA 4K40A 1Y8CA 5JJLA 2QLMA 3BICA 3HYRA 4HAZA 4DLLA 4QUBA 1ORTA 4HZUA 5L7WA 1Y8RB 3ISVA 1PWYE 3GJRA 4U1RA 1DWOA 1XL0A 2QUHA 1C30A 3DVSX 4FDMA 3DV2A 5IJ0B 4MUKA 1JSRA 2G4CA 2Y9PB 4WA7A 4QKQA 2GEDA 1KZYC 3DBHA 1TU4A 1DCKA 3GHHA 3IP1A 221PA 3D54D 4YAWA 2IYXA 5EPOA 5TQ0A 3R8XA 1T8SA 3U3MA 4M46A 1KEEA 2KQUA 4HDKB 1XDUA 1Q22A 1F5SA 4TVBA 4XQ0A 1TM1E 5CJJA 5TQVA 4PFJA 3D31A 3QFSA 3B1FA 3QNWA 2RH9B 1Z2OX 3SYNA 3A1DA 3IP3A 1FBTA 3QXGA 3T34A 1YA6A 3NAQA 3LLVA 1BE0A 1W85A 4NONA 4ASUD 5A0VA 4YRFA 1UKBA 3AC0A 4C4SA 4E5VA 4PO3X 1ZS9A 2FR0A 1E6WA 1JDBB 2HMYB 2N1MA 3C8UA 3FYDA 1NM5A 3FVTA 1I4OA 1TRKA 3QV1A 3CNBA 4RQUA 3FCSB 5AHOA 1UMDA 1DEOA 3GJ0A 1NUTA 2MOKA 3O8QB 4UVDA 5F1KA 4KDRA 4MVJH 3HHPA 1F4VA 1R4ZA 2QHXA 2D7JA 3W6NA 3QEKA 1O03A 5ITZA 2OQIA 4BMCA 1PJSA 4QU0A 7REQB 4NYJR