4DADA

Crystal structure of a putative pilus assembly-related protein (bpss2195) from burkholderia pseudomallei k96243 at 2.50 a resolution (psi community target, shapiro l.)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
134
structure length
134
Chain Sequence
b'ENLYFQGMINILVASEDASRLAHLARLVGDAGRYRVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDASSQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pilus assembly-related protein
molecule tags Signaling protein, signal transduction
source organism Burkholderia pseudomallei
publication title Crystal structure of a Putative pilus assembly-related protein (BPSS2195) from Burkholderia pseudomallei K96243 at 2.50 A resolution (PSI Community Target, Shapiro L.)
rcsb
total genus 38
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dadA01
1BVHA 3SAJA 3DGFC 1JHZA 3LUDA 1EAYA 2NT4A 3HV2A 1PNRA 2FQXA 3H1FA 1JYFA 2IPMA 3QX8A 4Y9TA 4WUTA 2PMCA 3KJXA 1FFGA 1Z2EA 2H0AA 3NNNA 4LE2A 1Z18A 2FEPA 3JVIA 2A9PA 2KYRA 1SXHA 3C3MA 3HDGA 4MR7B 4RXUA 2ZAYA 2QW1A 3O1IC 1F4VA 5DCLA 4N76A 2ID7A 3A0RB 3Q9SA 2JK1A 1GCGA 2L18A 2NT3A 4P1ZA 1YIOA 5EWLA 4Z99A 4KVFA 5KC9A 1JFVA 1ZY2A 2RJNA 3EQZA 4D74A 4GNRA 1M5UA 2GKGA 1J56A 5D2CA 4PEVA 3N0XA 4O5AA 1YS6A 1SXGA 4MS3B 5E3JA 5HQJA 1C0EA 4YRZA 2WJAA 2CWDA 2QV0A 4ZJPA 3LMKA 3RVQA 4MAAA 4TMYA 1PNTA 2WWVD 4WXMA 1D1QA 2MYNA 1ZVVA 4N41A 5DLEA 4MR9B 4RZSA 1D2AA 3NHZA 3EJWA 2P4UA 3QLUC 2PAFA 2L2QA 4MQFA 1NXTA 4NCBA 4WXEA 2MSWA 4E7PA 2PJUA 1U2PA 4TLMB 3RVLA 1USKA 4PE5B 3LOPA 4B09A 2IKSA 1BDIA 1D5WA 1LBIA 1NXPA 3Q15C 1EFAA 5DGCA 3JY6A 1UDRA 4F12A 5ABPA 3MF4A 1APBA 4MR8B 1DJMA 2CD7A 2R48A 1EWTA 4G0YA 1GCAA 5IULC 3DGEC 4LZLA 4Z4GA 4RXMA 5F64A 2WJWA 4G0PA 1ZESA 1B00A 2WRZA 1P2FA 4DQDA 5TPZA 4KMRA 4D6XA 4UHKA 4MS4A 2ID9A 2VYCA 4H3HB 2JVIA 1USGA 1AB6A 3OLZA 5I4CA 2IYNA 3HZHA 2PL9A 5FBKA 3UUGA 5CNKA 5T3YA 4Z4CA 1ZGGA 3F6CA 4W5OA 4F11A 7ABPA 4KV7A 3HDVA 2E4WA 3OM0A 1W25A 5KC8A 2X7XA 3Q41A 3HVRA 3A3KA 1EHCA 4KNYA 2R47A 4S04A 3LUAA 1YK1A 4G0QA 2FLKA 2FLWA 4PICA 3N0WA 4KQCA 4DADA 3OQMA 4MR7A 2AYXA 1K66A 4GPAA 4EYGA 2I6FA 5JS1A 1CHNA 3OMWA 2J48A 3GV0A 3CU5A 5EWJA 5GOTA 4MQFB 2HSGA 5EWMB 3LKVA 1MB3A 4TN5A 1GUBA 4W5TA 3D8UA 1JWLA 1L5ZA 4KFCA 4KK3A 5IX8A 5IEBA 3NBMA 3EDCA 3KYIB 4F06A 2FSPA 4YV7A 1USIA 5TQJA 2P9HA 1NY5A 1QO0A 2JRLA 1BAPA 2FQYA 4RY0A 3FDFA 4WT7A 4KREA 2YHAA 4G0ZA 1VRVA 1ISSA 1DCKA 3IP6A 3QEKA 5TPWB 3T6KA 2AYZA 1I3CA 1TJYA 2JBAB 1NXSA 3RVJA 4Z0NA 1NXOA 3RVKA 2WB4A 1FFWA 3SQNA 4RS3A 4YR7A 1K68A 2PUGA 5JS2A 3LKBA 2M98A 1E6KA 4XFKA 2PUFA 4OG2A 3HSYA 5B3JC 4MLCA 4O1IA 2LUOA 3TMYA 3C97A 1P6UA 1GLGA 1YS7A 4DN6A 3F6PA 1SXIA 1DRJA 3QEMA 4CBVA 4LDAA 5KQLA 5KQGA 1EWKA 2LP4Y 1QO0D 3C3WA 3TB6A 3RH0A 4YO7A 3JPYA 3W9SA 1ZN2A 5TQ0A 4JB0A 1FQWA 4RK5A 3E3MA 3NNDA 4Q6BA 3ILYA 1A04A 3O2SB 3Q7SA 4L85A 8ABPA 1DC7A 1C4WA 1VKRA 2R25B 4RK6A 5BR1A 4MS1A 1KRWA 3URMA 3T8YA 4RY8A 4YWHA 4XLTA 1U04A 4G0XA 4W5RA 4HNSA 1P6QA 1U8TA 3R0JA 4E7OA 5JNTA 2CHEA 1MVOA 3OLVA 2QZJA 3MMNA 3MYYA 3OMXA 3SM9A 2FEKA 3I09A 4OBBA 3NNSA 5EWLB 2MYUA 3BRSA 2RDMA 3SG0A 3HS3A 2IDMA 4D6YA 3GYBA 1Z12A 4FE7A 4PYRA 3N53A 2HPHA 4YP9A 4EVSA 4RSMA 4NV3A 4RV5A 1E6MA 4YCSA 1MB0A 3DLBA 3N6VA 3NHMA 2E4YA 3MM4A 1U0SY 1DCFA 2JCGA 4ML3A 4Q6WA 4QPJC 4ETNA 1CYEA 2FMHA 4RY9A 2GWRA 3N8IA 5EWJB 3L49A 2TMYA 4JP1A 3QLVA 4MQEA 1JH9A 1JLKA 1XHEA 1DCMA 3OQNA 3CRNA 3OLWA 1YMVA 4NCAA 3IP7A 3O2QB 5TQ2B 4OLBA 1QKKA 4MLDA 2LIVA 5IC5A 3RQIA 3OLXA 3QK7A 2PUAA 1U2QA 2NZVG 3IPAA 3VNBA 4NQRA 3GL9A 4TLLB 1JF8A 1URPA 3JVDA 2MYTA 3H75A 4IILA 1DRKA 4ZPJA 1MIHA 2LBPA 3GA5A 4Q7EA 1VLZA 3F73A 4IF4A 3LUCA 3A10A 2A9OA 4Z4HA 3CG0A 2M1ZA 1MAVA 3OO1A 3EODA 2MSKA 2MYPA 4WWHA 5HM6A 1QMPA 1T34A 3OM1A 2A9QA 1Z2DA 3N75A 4XXHA 2QU7A 3CKMA 5IEJA 3BILA 4JA2A 3BBLA 2IOYA 4XARA 5HKOA 2VUHB 3KKEA 4LRQA 5KQMA 1IIBA 3BREA 3KCNA 1ABFA 4PZ0A 5IUJC 3SY8A 5KWSA 3CLKA 3CZCA 4JB2A 1M2EA 3H6GA 3C6QA 4UHJA 3FFTA 1FFSA 3IDOA 1BA2A 1YK0A 3F7NA 5FBHA 4ETMA 4KZKA 3DLHA 1LJUA 3H1GA 3H5IA 6CHYA 3HXMA 3Q7TA 4WZZA 4QYMA 3EAFA 4ETIA 1ABEA 1RPJA 1JL3A 3RVSA 4JAVC 3O2JA 4EUKA 2HQBA 3KLOA 2H3HA 1F51E 3A0UA 1ZDMA 2E4XA 1PHRA 4H3KB 1YVUA 4N0PA 1CEYA 4OTZA 3GBVA 4MR9A 1ZH4A 4FB4A 4RK0A 3ILHA 2A9RA 5T7BA 4ZYLA 3H1EA 1JX6A 1DC8A 5TPZD 3P9YA 3MQ4A 3EULA 3RVMA 4FE4A 1E2BA 1EWVA 2QXYA 2QR3A 4RK1A 3ROTA 5JNWA 3G85A 2E4UA 5FWXB 3RVNA 1Z17A 3EQ2A 3JPWA 5CNIA 5IUKC 3HK2A 3IPCA 1XHFA 1Z26A 2PUCA 4W5NA 1AB5A 1BDHA 3OQOA 5IUNC 4EY3A 1NXVA 3I45A 3IP5A 4EGSA 2L17A 2HQOA 4OLAA 1H9CA 3TO5A 1DZ3A 1ZGZA 5GQSA 3H5VA 4LX8A 4IMJB 4EYOA 2FN8A 3RVRA 3UK0A 3GBPA 4Z9BA 3TD9A 3VNAA 1DBPA 4L4UA 2GBPA 1M5TA 1LBHA 3Q7RA 1D4ZA 2L19A 2Q5CA 4KRFA 2QVCA 4RWEA 2JBAA 1SRRA 4O1HA 2B4AA 2IPLA 3EGCA 3L6UA 3QLTA 4YLEA 1A0OA 1JDNA 4N03A 1RXEA 1KGSA 4OATA 5HSGA 1R8JA 1TMYA 2FN9A 4XAQA 2JVKA 4KQ9A 4H60A 5DTEA 4EYQA 1XWWA 1VPWA 3I42A 1ZITA 4Z9AA 4EVRA 1PEYA 3S99A 4MQEB 1KMIY 2QSJA 2NUBA 4G86A 3TX6A 3HJFA 1D1PA 4MGEA 5C5CA 5EWMA 2FTKE 4KK4A 5FWXA 2PE5A 2HJ9A 4MRMA 2PLNA 3K4HA 4RKRA 3T95A 4MR8A 3E61A 1E6LA 1ZH2A 2FQWA 4G97A 4LE0A 4JOQA 1QP7A 3ROFA 3KHTA 4HNQA 1JFSA 1S8NA 2RJOA 1M2FA 2WMYA 1Z25A 2FEWB 4JASB 1Z13A 3KS9A 3RVPA 1PEAA 2FMKA 1FSPA 1Z15A 3QEMB 3M9WA 1OXBB 2FMIA 4Z4FA 3LTEA 4Z4IA 2PUDA 1DG9A 5DKFA 3QELA 4KPYA 4N0QA 5JNVA 5B3JA 2FW0A 2IPNA 4RKQA 2WY2D 3IP9A 3O74A 4RK7A 1SD5A 2PL1A 4IMIB 1QPZA 4YS6A 1W9HA 3CNBA 1PUXA 1DP4A 4RK4A 4W5QA 1JDPA 1NTRA 1BDJA 2RGYA 5TE9A 1RNLA 1RZRA 1RZRD 5TQ2A 6ABPA 3LUJA 4HNRA 3O1JC 4MPTA 1KRXA 3MIZA 2DRIA 5FWYA 1HEYA 2NZUG 3QLUA 4MS4B 4RU1A 3HCWA 1JBEA 4RXTA 3O1HB 3K9CA 1TLFA 5TQ0B 3BRQA 4NICA 2FXIA 3SNKA 5JNSA 3H5LA 2PUEA 3H6HA 4G0MA 2YHBA 5BRAA 3GT7A 3N0RA 1JYEA 3H5WA 4QICA 4QYWA 5CNJA 2O20A 1LJLA 5CHYA 3HUUA 2GI4A 5KI6A 1Y1LA 3FFWA 3HM9A 3GWGA 3LUHA 4EVQA 2N9UA 1Z16A 3KSMA 3LUGA 2LPMA 4M88A 2W42A 3DBIA 3DZDA 1NXXA 2GX6A 4IGAA 4Z4EA 4ZMSA 2HQRA 2F8SA 1TVMA 1QP0A 2JVJA 4IRXA 3GRCA 4RDCA 4N47A 1OXKB 2E4ZA 5JNRA 1ZAYA 1YTUA 3QX9A 4F8JA 1GUDA 2E4VA 3OO0A 3CTPA 5KQPA 3CHYA 1QQBA 1NXWA 3QLVC 4G0OA 4YGXB 3HO1A 2IPAB 4S05A 1DBWA 2CHFA 3CS3A 4LDZA 4ZMRA 2QVGA 3FMVA 3H5TA 1A2OA 2VUIB 2FVYA 3KYJB 5JNUA 1QP4A 1ISRA 3QELB 4HYEA 3UKJA 2V0NA 2XDYA 9ABPA 1DBQA 3LFTA 3G1WA 3CFYA 2MSLA 1JFTA 1L5YA 3B2NA 3LUKA 3KG2A 3C3KA 5ED4A 3OLYA 2R4QA 4EYKA 3FFXA 5IBQA 1LK0A 3T38A 4P98A 4XASA 4MYRA 2BGGA 2JB9A 1ZHHA 5CNMA 4F3TA 2ZWMA 3HEBA 3FGZA 2OENG 1WETA 2PUBA 1QNLA 5TPWA 2PKXA 3H5OA 5FWYB 3CZ5A 3KTOA 4MRMB 3LUFA 3KLNA 3M9XA 2F8TA 2FMFA 2FKAA 4MS1B 1YMUA 3D02A 2B1JA 3JTEA 5PNTA 3CG4A 3JS5A 3M6MD 3O21A 1P8AA 4MS3A 1QQAA 5BRJA 2OQRA 1NATA 3RVOA 5C5EA 1RXIA 3HUTA 4LE1A 2VK2A 3I5AA 5BQ3A 3O75A 1TM2A 3MA0A
chains in the Genus database with same CATH superfamily
1BVHA 2Z6QA 1KP2A 2CNLA 3TKYA 2Z3VA 4IXTA 1COWA 4ZEVA 2AOXA 2GEJA 2VSFA 4WXHA 5E95A 2J33A 2ZIFA 1CR4A 4OAPA 5A02A 4QDXA 2GLXA 1FUEA 3V1YA 3BL5A 1JBQA 3I8XA 1KDZA 4C6SA 2XW6A 3FHTA 1JDZA 1ZSYA 2WUGA 1TZKA 4LZPA 5FULA 4FQ8A 4MUIA 4WKGA 4DA9A 2QXUA 3H4MA 3H3JA 1XTRA 1TA4A 3RYCA 3DBHA 2GM9A 5I01A 3G5MA 4DR7B 4JI3B 3MZ0A 1KVUA 3AVYA 4BFUA 3PYXA 1NOIA 5CJPA 1L6IA 1A9XB 3MUNA 4KFTA 3LDHA 3A0RB 1E3TA 5D00A 5AVXA 5FOSA 1FP6A 1HURA 5C4GB 2PWPA 4Q9DA 3PF9A 1F1JA 5SYNA 5CLQA 5FLKA 3NVMB 2FGKA 1P8JA 3AJ8A 5A06A 3CBGA 5D2CA 2QI9C 4JGBA 5ECWA 4YCDA 1P9NA 3LFHA 3D4LA 3PGMA 1FNDA 4LKRA 3LJKA 5JIBA 1W94A 1EX6A 1S2IA 3OPYA 4BC0A 2P0YA 3K0SA 1BHO1 2BI4A 1C7FA 4PNPA 5HF6A 1K5PA 5B6PA 4ND7A 3L79A 1RQXA 5BWOA 2DBYA 4LRXA 4NV1A 3SDZA 3NOQA 2CKMA 4MKXA 3U7HB 1AH2A 2OHVA 2G9NA 3A1SA 3A36A 3DVAB 2Q4EA 3NORA 4TQAA 5EG5A 3UAXA 1B4DA 2EQAA 2PWZA 3O03A 2P4EA 1YDMA 3IAS6 3I23A 3GQBA 3PHBE 1UXJA 2WM8A 1VJ0A 1VI2A 1L5VA 1IN8A 3AG5A 2XAAA 5LJLA 5CDFE 3MILA 1A7JA 1MB9A 3F90A 2XOXA 3PIDA 3WLNA 4P8RA 3QOYA 4F12A 5H5JA 4DG9A 2H2IA 3N6RA 2ZPAA 5TJHA 3SLKA 4QUJA 4DUGA 2R48A 2XDAA 1PJ4A 1JSLA 5IXJA 3LV8A 1C9MA 2BFCA 4RXMA 5HJ7A 2O54A 1Y1RA 3PICA 4FDVA 3BCRA 4RL4A 5L51A 1RTKA 1B00A 1YDGA 5C7LO 1BWSA 1F4LA 3G23A 4IGFA 3K0AB 4NZNA 4WW0A 4WN9A 4Y6SA 9LDTA 1IY8A 5AHOA 1ATZA 5C81A 3D6VA 4L16A 2YHUA 1GUFA 1I4WA 2IYNA 3VDQA 2REOA 3U0VA 4O2AB 1C8VB 4O63O 5FBKA 3GLRA 5DIFA 1X2BA 2EIXA 4RANA 1X7WA 5FHRA 1ZR4A 1M0TA 1WNFA 4RTSA 4O08A 2FMUA 4X1KB 1E8NA 1EWYA 1QTQA 1LU9A 1W5SA 2I6SA 2NU9A 3MCTA 2NYUA 4Y9SA 4HK4A 4M1YA 4CMJA 1XTZA 2I67A 4TV8A 2Q5IA 4KNYA 1SKUA 1UJMA 2SICE 5JV5A 1QGUA 3IA2A 2B4QA 2ZVQX 1ZVMA 2FLKA 3KQNA 1EVQA 3U5TA 1WEKA 2FGJA 1K4YA 5TRTA 5EI5A 1NBHA 3T5TA 4G41A 4IY1A 4YRBA 4KXXA 1GCOA 2CJWA 5TMDA 4K0KB 4EIWA 1KQPA 3H2IA 3QUTA 3ABIA 2HSGA 3I37X 3VPFA 1U2DC 2BHTA 3H5NA 4GKAA 1TJ3A 2O2EA 1GUBA 3IX7A 4PHGA 3I12A 3I4FA 2C2YA 1N5KA 2KJQA 2X76A 4XCXA 5BR8B 3RARA 2D06A 2ERXA 1T2FA 2Z83A 2D74A 5K3FB 2HJVA 3REQB 4YV7A 4OJQA 4YMSA 5ENVA 2P9BA 2VR1A 4FFBB 2XUDA 4L73A 2GD0A 3HFSA 1EVKA 5E38A 3G0HA 5JCZA 1QHIA 3Q7EA 3H7IA 5T6BA 5FA6A 5AJVB 4FCVA 3ZE9A 1WCIA 3ZWKA 5TS2A 2P9JA 1QX3A 4MW2A 3W3ZB 2QV7A 1XZFA 2OUKA 5CCEA 1Q0HA 3GMDA 5F33A 3UAZA 3OIUA 1DOHA 1XU7A 4B74A 2R6DA 3UG6A 1UBMS 3ZZ0A 1ECJA 2Q3CA 1Y5IA 2Q4RA 4ZCLA 2IHTA 3ES9A 1W30A 3HG7A 4PXYA 5EEGA 2Y9MB 1EDEA 1N5JA 3JYNA 4RKFA 4DTIA 2YMQA 4KN8A 1GYPA 2WMDA 3KQUA 3NAQA 3UICA 4MWGA 3MJ4A 3J80A 1DRJA 2WK1A 3NONA 1YBHA 2IY9A 4MVJH 1A1SA 5COAA 3LPCA 4ARBA 1WY7A 3EDMA 1IZ7A 2LP4Y 4HDCA 4UJ3A 2MINB 4ZKEA 4ZVKA 5CLFA 2PKWA 1TVCA 1VLVA 4LDQA 5D6NA 3WGUA 4YO7A 1U4SA 1UP4A 4TV9B 4D02A 4JWKA 1Y6GA 4DMUB 1NJ1A 1OU0A 1RQLA 4QNMA 3B1KA 2QN6A 3BN3A 4DPKA 2V45A 2AOTA 4NOJA 1HT0A 3ZTWA 2V7WA 3BMOB 3UV3A 3OA2A 3O92A 1KJWA 1O97D 1QK5A 5CDUA 2XB2A 1VIYA 3P45A 5IJZA 4ITUA 4U00A 2AN4A 4YWHA 4YRTA 4G09A 1R3DA 2WFAA 2ZAMA 1HSOA 3DOUA 3ET4A 3LG2A 5C5IA 4ZCMA 4D9MA 3RWOA 2ZJZA 4MV8A 2OB2A 4GQIA 1V8DA 1KDTA 3SM9A 2PNFA 1WBDA 1GZ5A 2PTHA 1DNPA 3ITDA 2BPOA 3JZMA 2OCDA 2VQDA 1ADGA 1OV6A 4R1UA 4FE7A 1X14A 3N74A 3CXRA 3T7IA 4B83A 3OCWA 3GGGA 2JLWA 2FSVA 1XROA 3D54D 1WTAA 4KMOA 1QGAA 2JHFA 4UDXX 3CYFA 1N2JA 1JG1A 2WVAA 3CLUC 1XVLA 3GZNB 5DMXA 1YUNA 4YJKA 1NQXA 1I36A 1G3IA 3DP9A 2C4HA 5TC4A 4ZVLA 3ZQ4A 1CYEA 4JLNA 4IYRA 2GWRA 3N8IA 3VC2A 1AUVA 3E03A 3SOZA 3OE1A 3BYZA 2MOKA 5K6RA 4PWZA 5C9ZA 3Q2IA 3OQNA 3GLGA 4I1IA 3ZWMA 2IDKA 4QBGB 1LI4A 2HHJA 1OA0A 4ZGWA 4HDKA 3ITNA 1AO3A 1A5SB 4E5SA 4Q7LA 2NZVG 3B53X 4X84A 4BNNA 2RAPA 3H19A 4L22A 2BM1A 4KWCA 1Q7CA 4GT1A 4U7FA 3Q1LA 3L1HA 5JVDA 2PQMA 2A6PA 4C89A 4F4IA 4OV6B 4BVBA 4S12A 1GARA 3ZIUA 4EGJA 5I8WA 1SULA 5A0TA 3L46A 2UU9B 4BFYA 1R88A 3T1TA 2FDRA 5HPYB 2HMUA 1QFZA 4ND3A 1M2VA 2VQ3A 2Z9BA 4C4OA 3TNJA 1BROA 3E9YA 5LWQA 2P7IA 2VUHB 3ER9A 4TVSA 1YKGA 3Q72A 4UHBA 5I7OA 4PFSA 2YIMA 4PZ0A 5JCOA 3FRJA 4L8WB 4JOBA 4AL4A 1MC4A 3GGCA 2IOFK 2JFUA 1XMQB 4QRHA 2QEQA 1CRLA 1E7RA 4K05A 3BD7A 2H4FA 3H97A 1NFFA 4OI2A 4YUVA 3RJTA 4GWLA 5LNK6 1RQ2A 3EXHA 3L77A 1MH9A 1UKZA 2OM2A 5I48A 5K4GA 1EE2A 3G3EA 2J9XB 5EJIA 4ETIA 1OBCA 4QXAA 4LVOA 1AGYA 4HBGA 2AMLA 4UU0A 3UAYA 2HQBA 3ZEAA 2D5BA 3M2TA 2JH9A 4IXDA 3DZHA 3OUUA 3NXSA 5IT5A 1AU9A 1JHMA 1N4AA 3VX4A 4WVLA 4FB4A 4HR7A 4M0DA 2IYTA 4L9SA 2AJLI 1PT9A 3TLAA 4BYGA 1SVKA 3OF5A 3RBZA 2J4FA 4YLGA 1OYOA 3ZY4A 4BKRA 4DUPA 9ATCA 4LN1A 3QF4B 1AD2A 3K9LA 4XRRA 5K2OA 1K06A 3BXGA 4CKCA 2NO7A 1BDMA 5JI2E 1G60A 5KOHA 2GPYA 3D2AA 3GT4A 4FE4A 4JC8A 1IY2A 2YC4C 1M76A 3MQ2A 3L8FA 4RE5A 3STHA 3CR7A 1DQRA 1PLKA 5A3JA 1BEEA 4QJ4A 2DHQA 3DWEX 4K6MA 4LXUA 2CGEA 3VXKA 3WMFA 1H2BA 1QJ4A 2XXBA 4BFCA 4OX9B 2IELA 1XHFA 3BICA 4QLOA 3Q98A 2IYWA 2Q9UA 3K8QA 4URUR 3F3MA 2L17A 2CLLB 4LDPA 4WERA 4EKDA 1Z63A 2PX4A 4YCCA 5GQSA 1ITZA 2EVWX 1WUIS 1ZQ1A 4G1UC 4IMJB 1M6WA 1BXKA 4UFOA 4JVOA 3L92A 4FZ5A 3LRXA 5FFNA 1MJHA 3WSWA 2X3YA 1TQHA 5JH7B 3CSUA 2XKJE 2R84A 5TX7A 5JROA 2JHGA 4NIMA 2FHSA 4BJ6A 4M1TA 3FOEC 3D8RA 3M4XA 3VU9B 1TJ4A 1M5RA 2WAXA 1ILWA 1WMDA 5FV4A 3S5JA 4ACAA 5KJFA 1V39A 4PY2A 4BJ1A 1IDN1 4IFTA 4BVAA 2D4HA 2Y1FA 3E27A 2IEZA 5FOQA 2NXCA 2VZLA 3JD0A 3P2EA 1FW8A 3PC7A 4NBRA 1IU9A 3AF6A 1QPGA 1N6RA 1U6KA 2JHPA 4OFXA 3HYNA 3LF2A 4RD3A 5A9TA 4IIVA 3TLGB 4G2NA 3TQRA 2Y1LA 3QTLA 2QTHA 3ZX4A 2P5SA 3K1YA 2C7BA 4G5SA 1SWWA 1KR5A 1GP2A 3CLTD 2NXEA 5EZYF 3T95A 1NJ2A 1EJ0A 1ZMRA 3VSBA 5I7UA 3IOEA 2IHYA 3O3CA 1ZP6A 3D6MA 2FG5A 4G97A 5KINB 4WZ6A 4CM5A 2OCKA 3B36A 2C88A 3RKRA 3ROFA 3BSSA 3R77A 5FJJA 2ADOA 4B6GA 5L3SB 2HK8A 2DWQA 3V3TA 1E6CA 3WGIA 3Q3EA 3KV3O 1U0EA 2AFVA 3IAXA 4ODIA 3IMFA 1T4DA 1FSPA 3EEIA 1DKMA 3E8MA 5FB3A 1TK3A 3VPCA 4AXXA 5JFOA 2VWGA 1R0CA 1TT5A 1UZNA 1XPUA 3WXMA 4L3VA 1NYQA 1IWBB 3SXJA 1K0FA 2J1LA 2N42A 3QEOA 4D80A 2QM3A 4MEAA 1DKUA 1GOTA 3GVHA 4YJ3B 3T12A 1PGOA 1RDFA 3FWNA 3KKZA 2GZSA 1TLTA 4I19A 1RFLA 4MROA 4LJ4A 4QFDA 5LP6C 4E14A 1O8BA 1YZNA 4K8RB 4X97A 1C0IA 1SH7A 5AJHA 4RK7A 3ZR4B 1GYRA 4EENA 2PL1A 2ZLBA 1G64A 1QIGA 3MSCA 2V65A 3KZVA 4PU0A 4TKZA 1TZ2A 5KTRA 3I4CA 1F0KA 3H5AA 3LX6A 1K7EB 2G77B 3NIBA 3VUFA 3W4JA 2WM3A 2GT1A 2I7VA 2ZUWA 1LPPA 4TL8A 3VHXB 4AIIA 4Z8XA 4BFTA 2OHFA 2PCJA 2TRSB 4MPTA 2DRIA 4URVR 1A8UA 1PK9A 3DTVB 3ORHA 3UA3A 2WTUA 1WV0A 1DOAA 3Q0IA 3EIQA 3RABA 1M73E 5JU6A 5GY7A 4Q00A 3ZKAA 2B69A 4GKKB 4ZVRA 3O8DA 1D03A 4BNIA 2P9QA 5E6SA 3X2SA 1GL3A 3ZQUA 5HKAA 1RJ9B 2A86A 1FRFS 2GI4A 3IYLW 4HLQB 4E2XA 3HDHA 3P7MA 5E6RB 1ZIDA 4K03A 1ZR2A 1H8HD 1UBRS 2J9YB 3NTOA 1P91A 3HCAA 1THTA 2IYOA 3HZOA 2KWIA 5FHQA 2VJAA 1H2AS 4JT9A 4MIYA 1EA7A 4P31A 1K6IA 1N0UA 2K4MA 4GYWA 2YVUA 3DEJA 4X94A 3WHPA 2AFIA 1Y1TA 2RMKA 2WQZA 3T1NA 4N6NA 3H9BA 4J7AA 1YDWA 2WR8A 4RY2A 1ZD1A 4IRXA 1O95D 2AA3A 5L7YA 1NYRA 4O2AF 4DVJA 4ZPXA 4DNPA 1Q3HA 2CMHA 4ZI5A 4CG2A 3PNYA 2R66A 1GUDA 3HRIA 3KJNA 2WD7B 1J00A 3OP1A 5HCNA 4JJEA 4DWWA 3UFXB 3VZBA 1P3JA 4G0OA 1I4EB 4X6LA 4QM7A 3BXEA 2CL7X 3V4PB 2EW2A 1M0WA 1MJGM 3IBSA 2Y92A 4ZMRA 2AVNA 1U2GC 3BWDD 2FVYA 4PZAA 1HY3A 1RXCA 4S1PA 3E48A 4DNQA 3WRWA 1G2IA 4D7AA 3O4RA 4KLNA 3B3JA 3DZFA 1DBQA 1D7AA 5JT1A 2IYPA 4IX9A 2D59A 2ZROA 4DJEC 4K6FA 1ZSVA 2XYRA 1SKAA 1UJBA 1ZSNA 3JQPA 1E79D 1H4TA 2HA2A 3IP8A 2CVQA 4DDMA 1EEXB 4GM1A 2A1UB 2OZLB 3NBYC 4EDHA 2VOJA 3EGXA 4ZTBA 5LZ7A 2XKBA 1GPYA 3PGA1 4B81A 3CISA 1T25A 5EXDA 1N3IA 2JZOA 2ZJ7A 4GU5A 4H15A 4U9UA 3R9IA 5CEJA 4KQ6A 1WETA 4XQGA 3I39X 1GU7A 3PFHA 1DC6A 1Q3KA 5HJ2A 3KTOA 1DLJA 1N6PA 1PWZA 2X9VA 2FY8A 4JBGA 2OSVA 5TR9A 4KUGA 2X58A 2B1JA 3JTEA 3MJFA 4E22A 3JQAB 3BTSA 3IMGA 4MWCA 4ZAYA 4JB8A 3O3NB 3VC3A 1YR9A 2WUDA 1DKPA 5HUQA 3P0HA 2H00A 2J9GA 2B1GA 4BGUA 4YAUA 4PWYA 1P2DA 4Q7QA 1BN6A 1TM2A 2DPYA 2QYTA 1P62B 3FNFA 3MA0A 5LC1A 2IIVA 1F6WA 3THXA 2G06A 1F8YA 1S7CA 2G09A 5LYJF 3CONA 1BSVA 2H11A 3X1KA 2P41A 4GDFA 3FJ1A 1I7LA 3A9VA 5BWMA 3ROMA 1WHTB 4CR8A 5BV2P 2B8NA 1ZICA 3I2HA 4WEQA 4AZ0B 1JU4A 5LBUA 3QX8A 1E2GA 3NRJA 2IV3A 4Y9TA 4G0VA 4JKIA 1TQ4A 4FIDA 3VSCA 3F5QA 4M0MA 3IE2A 2WZDA 4P5DA 1EB9A 1U90A 3O4JA 4F97A 1UT5A 3HDGA 5IWAB 3IOBA 4NMWA 3DPIA 4X8LA 1QE5A 5CVVA 4INOA 1PRYA 3EGIA 4X6YA 3K8ZA 4OAOA 1D07A 1FLAA 4LOKA 1WU8A 2G1JA 3CW2A 4F1JA 4IDNA 3ZHCA 3ISVA 2GN2A 1KZGB 3BAFA 2ZBFA 2ZI4A 5LZ4A 1YOBA 4XKJA 5D87A 2CXHA 3F3KA 4YMHA 1NP7A 1NURA 2PT9A 1NQUA 4JJ6A 1E2PA 1RYBA 3QKWA 4YALA 2A7QA 2IIPA 1DPGA 1I13A 3I0ZA 3DBRA 2VPQA 1SXGA 2J0VA 3QUCA 4HSGA 3UCEA 2I1LA 1P4AA 1MA3A 4PBTA 2CNOA 2PRYA 3LMKA 2I80A 4UC0A 3RVQA 3SEAA 1PNTA 1U7WA 1ISPA 3ZGOA 2WNIA 1MN6A 1H2XA 3A11A 1QAQA 3E0QA 2JFVA 3C7AA 1HM5A 4QJ5A 1K97A 1SOMA 4Z8YA 2V54A 2BE9A 3P2OA 3QVJA 3KXLA 4IHJA 4TGLA 4BO8A 3NHKA 4LMRA 3MYRA 3RYIA 3A4NA 1B1AA 3L7DA 2ZRPA 1DAHA 2HK9A 3A05A 2FFBA 4KE7A 2E48A 2MDTA 5DLPA 2RB5A 5THKA 1OLXB 2PSFA 4EOGA 1I5OA 5H02A 3NHAA 2PWBA 3QMWA 2GYVA 5H0IA 5KYVA 5GZ1A 3RRNA 1NV9A 3TTTA 4OL9A 3ENVA 4JDUA 5BV1A 2YS6A 4Z4GA 1WOYA 4PAOA 2ZBGA 2WJWA 4NOKA 1BJRE 5E8JA 1ONOA 3I83A 3V97A 2ZYTX 5GM1A 1EVJA 4PLWA 2UVQA 1NVGA 3KELA 5IM4F 4YX9A 2DCUA 1O87A 3LCVB 1JR3D 2Y4OA 3SHTA 1JEDA 2C2KA 3H1TA 1G1MA 5CEFA 4QDKA 5IYZA 1HE3A 5I4CA 1TYDE 2VT7A 4XDYA 2OHXA 2ZSAA 1J2EA 3E7DA 2C77A 4D2IA 3DHVA 3FPAA 2OFXA 3UH0A 3LZDA 2COUA 2Z5GA 1EBFA 1Y48E 2WJGA 1UBFA 1VHJA 3WLJA 1HI9A 1V2HE 3A2LA 3M5WA 3ON5A 4J3JA 3WK5A 1W25A 3WYAA 4U0KA 1NT2A 1IHUA 1OI7A 1Y8AA 4CEIB 4QZVA 3ER6A 4YJ3A 1Z83A 5CM9C 1Z7YA 1T5BA 5DBFA 5FUQA 4H6PA 3JATA 4H77A 2QQFA 4GP7A 2X19A 5F35A 2DSTA 3TPFA 4DADA 2W58A 5IG2A 2X0JA 1KYYA 5JS1A 2GAJA 4UDNA 3WIDA 3IPLA 1DQSA 2GK3A 3EC1A 4IEEA 3K5IA 4FGZA 1EK6A 3FPFA 1VL8A 1SCAA 2VXOA 2F3TA 1PYDA 1VTKA 3AIOA 3Q6IA 3F67A 1HYEA 4XJSA 4E2WA 4TMZA 1FPMA 3LO5A 1JWLA 2GRUA 4GGOA 3G9ZA 3GG9A 2PNJA 1QRAA 1U0NA 4BO6A 4EJ2A 4UTXA 4D3ZA 5IX8A 3PQFA 1R9NA 4W4TA 4D9IA 3WQHA 5L3VA 5LDDC 3IIEA 4I4LA 1XVAA 1XCOA 1JIVA 1SCUA 5FLXA 3DH0A 3WOVA 4G5YA 4C4TA 1C3JA 1QRDA 1SRQA 4HH3C 4CUZA 5HQTA 5CCDA 3FDFA 3OD1A 1EQAA 5HNKA 5DLYA 1H1TA 3QEKA 3U44A 1AHIA 2O1EA 1VSVA 1OPXA 4OREX 4UEQA 4ZQIA 4EY7A 4YN3A 3PEUA 1Z5ZA 4HXEB 4E09A 1FFAA 3R9KA 2HCBA 1FZQA 3ESXA 1Z56C 4FZRA 4K9DA 5SYMA 1IMOA 1W75A 4KAJA 4X8HA 4NFYA 1WOMA 5DBHX 2XMRA 2J3KA 2I4IA 4IRMA 2ZTLA 3SEFA 2IYYA 1QYXA 1GPDG 2GETA 2Q6LA 1GLGA 4GPD1 4ANFA 2HV8A 3B3QA 4H7JA 1JW9B 4B4WA 4F9GA 3CUVA 1GAWA 1NC1A 1YHZA 5DHAA 4D8WA 3MRXA 1F6DA 2YUIA 3GXOA 2DH6A 4Q1AA 2JBWA 2WE7A 3RH0A 3RRMA 4K6OA 4OHXA 3V2HA 3ZC3A 1RYYA 4WZBE 5BWLA 2OO5A 1BW9B 4W8HA 4EPTA 4FOSA 1MJGA 4AZTA 4A2PA 1JPNA 4C6RA 4C7JA 2N1BA 4Q0MA 3B1ZA 2WF7A 1JI0A 3UATA 5L8VA 4WA7A 4QVIA 1R5OA 5EIAA 1VKRA 3WWPA 1QFSA 1Y3IA 3D4PA 2ZPTX 4GE3A 4UM5A 3USZA 3QBVA 4AP5A 1AZTA 1BJTA 5KS2A 3VDMA 3K9QO 2GB4A 3P2KA 4XVCA 1RHKA 1QS0B 5JXJA 1SUDA 2AD5A 1GTSA 4ZI7B 2JGMA 1Q15A 1IJEA 1XUOA 3B7PA 5L7WA 4TTAA 3BDIA 2P2GA 3PFWO 3G0IA 1QM5A 2BFFA 1R6BX 3PXEA 2R6HA 3FOAA 5JSQA 3SG0A 2VH1A 3C6BA 4FCCA 1UPCA 4D6YA 3MTQA 4RPIA 1MDBA 1SHKA 3WSVA 1QR2A 2QUIA 2WPDD 3WLTA 4EI8A 3NYRA 4YCSA 5MGNA 4R8VA 5A6SB 2B0JA 1V45E 2EOAA 4FYXA 1FX0B 3FDXA 5I9LA 4DILA 2ODEA 5LP6F 3OTOB 3R44A 3TNLA 5AVWA 2YWEA 4D4JA 2XBMA 2OUIA 3NC1C 4ZFNA 2TMYA 1ZEJA 1X1QA 1DKRA 3DTVD 5AYVA 1XMOB 1ZKDA 2FW6A 1P7WA 2H07A 3D1LA 1W1UA 3EVDA 1W88A 3CRNA 4V2UA 2BMDA 1FNMA 1PJBA 2D62A 3AERB 4OHKA 4FFPA 1E9RA 1BRTA 3QM1A 1FLNA 2YXEA 4N8SA 5KHOC 5KWJA 4P81A 3O2QB 1QKKA 4ZVVA 3OLXA 3ROXA 4DLSA 1P9WA 1L7MA 3VNBA 2B34A 2O7NA 4RZ2A 3MN1A 3Q8KA 1JAHA 1IATA 4QIHA 4R1SA 4RETA 4XOIA 1YVRA 4TT3D 2JH3A 2WZQA 3WYDA 2GA9A 1MIHA 3WDMA 2QE7A 1VLZA 2GM4A 3F98A 3U56A 3LT5A 2UZ3A 1TW2A 2B36A 5DW3A 5A7HA 1QVRA 1SXJE 4WH0A 3OO1A 2X1LA 5JMOA 5EEHA 2COKA 4MI1A 4MK4A 3D0QA 1QMPA 1ODIA 2D2FA 2A9QA 4DCTA 2ZZNA 5ELXA 1Z2OX 1JJFA 1M7GA 3BILA 5EQFA 2C82A 3HJBA 4ZOQI 3ZV4A 1F2DA 3HCBA 3PF8A 1UT8A 4KKVA 4YVFA 4WLUA 3OZGA 1OH6A 1ONBA 1IIBA 1I2CA 3NTVA 4ILEA 4MUEA 3AUYA 2FJPA 1IN7A 1FYDA 2I7DA 3E8XA 3Q8XB 1X2EA 4RPLA 3A7DA 1J07A 3UJ9A 2JBHA 3PFCA 3QKRB 3KWMA 1SB9A 3E15A 4YDHB 3HMKA 3Q3JB 2GD2A 2R3SA 2ODQA 1G20A 3FSRA 5KAMA 4B7UA 1IULA 1ZISA 3BHMA 2HO4A 1W96A 3KLOA 5JXIA 1F51E 2E89A 2GVDC 3HJAA 4H6XA 4OGFA 3ZX5A 3OHMA 3OZVA 2EFGA 1QO7A 4QUKA 1O94D 1TECE 1ZAKA 3GOQA 4RPJA 2A0FA 4M6WA 1FSFA 1GVNB 1T9ZA 3ELYA 1PR2A 1M83A 2X5KO 3JR7A 3QHQA 1H8ED 2JJ1A 5DNVA 1A4XA 1JWAB 2WV9A 1E3WA 2O8BA 1KMCA 1THZA 3BPSA 5SZHB 1OC4A 2VBCA 2V7XA 4QULA 4I46A 3KHKA 4D3FA 2XLCA 1A3CA 2YHIB 3FTCA 1TYEB 1EWVA 1UK6A 2B94A 2QXYA 4TMVA 2ZE7A 2FK7A 4J0DA 5FWXB 1BWRA 3QYAA 3R6GA 4D57A 3AO0B 1NN3A 4OSPA 2ZTVA 4ZU1X 4C43A 2HEIA 2BTOA 1E62A 1KYXA 1XKLA 2VDNB 2XT0A 4NJMA 4A6DA 5K0NA 5KSYA 3ADDA 1FP1D 5B1HA 4WBNB 3UOWA 3V00A 2OMKA 5FOVA 1RCFA 1KSHA 3ZQKA 2FU5C 2XEDA 4MRNA 3AY6A 3ISJA 3N5CA 3RPEA 1CEQA 4DIBA 4M3NA 4RDIA 4BQIA 5BORA 1M5TA 1ODCA 3W4KA 4HLNA 3JVVA 3HDYA 4KGZA 5UKDA 3ZXXA 4BP3A 5EKUA 1O9BA 4ZYXA 4YMLA 2F1OA 1GNLA 3L6UA 4PC3A 3K0FB 5GGYA 1Z4QA 4Y2QA 4MXDA 5G2OA 3MUEA 3E2IA 1AXEA 5EJAA 5KNCH 4PYNA 1RXEA 2ODAA 2EIHA 1BTOA 5HSGA 2FUKA 2PUTA 3SD7A 4Z51A 2GEKA 4MYTA 2WQ6A 1THMA 4TYQA 1G3RA 1LUAA 2NPOA 5FUWA 2OGTA 2PMFA 4FEEA 2XJ4A 3GFFA 4IJ5A 4YJFB 5B7QA 1XRSB 3GH3A 4MQEB 3IP1A 4OHFA 4C03A 1F17A 3DL0A 3NGXA 1BYUA 1OWOA 2NGRA 3EVNA 4RLQA 3KBOA 2YXLA 2OQ2A 4ZCSA 4FC6A 3KB6A 3VGPA 5FWXA 1J0EA 3F6RA 4AZ3A 1ORWA 1CEEA 1JJIA 1T24A 1OBVA 2UZ0A 2HWUA 2W71A 2O8EA 2PZ8A 4J49A 1U2EA 4UUOA 3QUBA 4R5MA 1QH8A 4UCXA 3DZCA 4DM7A 3WLHA 2PLFA 2FEWB 3AFNA 2WPNA 3GEMA 1L9XA 4AJ2A 2GJSA 1T9BA 1G21B 3BK2A 1Z62A 4Y6PA 2EQ5A 1Z15A 3HWWA 1QIJA 1TVKB 1MAHA 2OCPA 2R7MA 1UJ5A 1OXBB 5LCXA 1YDHA 3E3AA 1UANA 2FMIA 3FYSA 4XWYA 5JWOA 1IUNA 1OUMA 2ZETA 3TGWA 4OHVA 3DUFB 1WNTA 4XSVA 2B78A 2E4AA 3EYWA 3GEDA 2Q5EA 2VRNA 4YAJA 3P2JA 4KGVA 3SJUA 3L0DA 3T5GA 4BLPA 5DHTA 4ZCTA 1VG8A 1WB9A 2AG1A 3FNHA 4NK4A 5JWHA 1NBMD 1RC0A 1XR3A 4PQEA 3WWZA 4E88A 2RAFA 3KKKA 3U48A 3OFND 4UARA 1DHTA 5D01A 2WJZB 5DTQA 1RLMA 1T5DX 4MA5A 3B5JA 5F5NA 1BX0A 2CUKA 1QPZA 1PD0A 3WJAA 1IUOA 1X6VA 4KNVA 4RMHA 1YE5A 3SJ7A 3SHFA 3O5AA 1I0LA 1J8YF 1SD1A 1O4VA 3R9XB 4QOHA 3DZ8A 5BQ5A 1P0PA 4BVHA 3ZHVA 3A9WA 1JQEA 2O4CA 3I2GA 3ZD6A 1RI5A 3NI2A 3TPCA 3G59A 3FVQA 2FLVA 3W6UA 3B3AA 1IY9A 1S1MA 2W4IA 3VVLA 4LWOA 2NAPA 4DCMA 5DI3A 2FWPA 1FNBA 3HCRA 4BQOA 2PPVA 2YHBA 3EBOA 5BRAA 2HPZA 3CE9A 3KO8A 1S96A 1P45A 2YQZA 3H5WA 3R0IA 5FTJA 5HFAA 3AUSA 3U16A 2PLRA 2VEOA 3IUEA 3TLZA 1AKWA 3MUOA 1L8OA 5D8DA 2C07A 4DB4A 4FXOA 1RIFA 2RHMA 4QDZA 4ZD6A 1FC0A 2VHVA 2P6PA 4G0WA 1FSZA 1NXXA 1ZCAA 1QF9A 3C3BA 3OQIB 2J0UB 1KAOA 4WBXC 1M33A 3LM8A 4PS1A 5D84A 2J09A 2QUAA 2J7PA 2QMUA 4R54A 3EISA 4QGHA 3BMOA 2I2FA 2BEVB 1HSZA 1VMEA 3GLIB 4UAVA 1Y63A 3F8TA 5BMOA 2A35A 1KOJA 3GROA 3ASVA 3BTVA 3CTPA 3JVUA 4XCQA 3IB6A 4LDNA 1D6JA 1UK8A 5HUJA 5CLHA 2VQEB 2C2WA 2FRVA 2IPAB 3DE7X 1L4MA 1GN8A 1M2WA 1WPRA 1RRVA 4EHBA 2IYQA 3PDUA 3H5TA 2J3EA 1QHFA 5G1NA 5CEEA 2G9RA 2GN4A 3V9AA 1ISRA 5A6SA 2RGGA 1C1YA 2DPMA 4FGSA 2RD2A 3HU2A 1FTSA 3BIFA 2IP1A 1AVTA 4FGJA 1RHRA 3GA7A 2J3JA 3C3KA 1XMVA 1V9LA 2PKYX 3RRBA 1AJEA 1R1DA 3T38A 2PH1A 1Z9BA 5ALVA 3HGQA 2G3YA 3PUJA 2IV7A 3UM9A 1I6LA 2QBYB 4BCDA 1DJOA 2B92A 1IJKA 1JZTA 3FLMA 5FUBA 4CEJA 4UBMA 1ES9A 3H5OA 2Q50A 2ZRCA 2PD6A 1EB8A 2OCGA 4NECA 3D43A 3UGQA 2MMCA 3CVUA 4MS1B 3RYIB 2ZR9A 3D02A 3D3NA 5IW8A 1J9EA 3CEJA 4DLLA 5K45A 1D3AA 4O02B 2Z04A 4JMLA 2AJCA 3DZIA 3WWCA 1FLDA 4IIFA 4Q01A 2BDEA 1ORIA 1NATA 2H7YA 4IUBS 3RGGA 5HZMA 1TOAA 5DFAA 4MP8A 2VXYA 3M0EA 3MOGA 3ORFA 5HM8A 4K9QA 4URZR 3ZJUA 4CKWB 2ZYRA 9MHTA 2VHZA 1NV8A 4JJGA 4R7TA 5ALHA 3HJRA 1ZRHA 3OX2A 1UJNA 2FSUA 4GZ6A 3ID6C 1UXHA 2W8BA 5C51B 3G5TA 1EAYA 2NT4A 2QQ0A 2RGAA 2FQXA 3HV2A 4JBIA 4C5AA 3LLCA 4RELA 4EHFA 1N25A 1X1CA 1BXGA 1BEZA 2BFMA 2FW9A 3NETA 4PLVA 5B3AA 5TT1A 2OK7A 3THWB 1HDIA 3L7YA 1SXJB 4PM4A 2ONKA 2NG1A 2C8VA 4JH0A 2A5FA 4LSMA 3I9FA 4HBZA 1D9XA 1K7YA 1HFEL 5J2TA 4UAJA 2FF5A 1DEHA 2QX6A 3NH9A 5AHKA 4RGYA 4UM9D 4RA9A 1WG8A 2GXSA 3IOMA 3K0HA 3NH6A 3SHWA 1GKKA 5CK4A 3UVEA 2YJZA 3F3YA 3IFSA 1ZY2A 3KSZO 3ONDA 2ASVA 3L05A 4L2IB 4MPPA 2QE7D 3NW9A 4PEVA 4ND2A 3N0XA 4WK6A 4A6PA 4BRWA 2EBHX 1TK2A 2J3MA 2DPGA 4DQUA 3BL6A 4C2AA 1OHHA 3PVCA 3CLVA 3A14A 1V3VA 1G98A 2BISA 1O7JA 2FRXA 1IHOA 4LJLA 5FT9A 4X7MA 2C1ZA 1PR1A 4UTPA 4EECA 4YMUA 1Y80A 4JXKA 4NL4H 3OCVA 4MR9B 1G8GA 1QG6A 4WQMA 4BQRA 1DZIA 1KI9A 1HE5A 2C2HA 2ZFUA 4LRUA 1ZUD1 1QUEA 3NQ41 5EE5B 3R1IA 1E98A 5GJVC 2R87A 1RI4A 4O5OA 3EFOB 1PSDA 3H86A 4HB2A 4DZRA 2VLBA 3K70C 5LMCA 3PGKA 3FMGA 5FPKA 2PIAA 4PANA 4F71A 3U7QA 1HPLA 4FW9A 3GLUA 1W5BA 3M6XA 3E2PA 3F4BA 2BHNA 1GUAA 1JPJA 2BFDB 3T3GA 1JKIA 2UZ1A 1SC6A 4QU0A 1IFXA 1MB2A 1T35A 4O4IB 2LDBA 4YRLA 2PYDA 4OP1A 1EK1A 1IQPA 4R1TA 3KJIA 2J7KA 3CZ4A 4GWGA 3T3EA 4WMLA 2G1KA 4X7BA 1EAMA 2BRUA 2OBNA 5TV2A 1CE8A 1MFZA 2JVIA 5KYXB 4J4HA 4HNAB 4ETWA 2EGGA 2PGNA 3U3JA 3Q3IA 2OD2A 3FZNA 4KB5A 4N82A 4QQNA 4HAXA 4OU4A 1GKUB 1V7ZA 5T3YA 4A0QA 1NI5A 1JIQA 3QBEA 4NYIQ 3SLGA 2D2IA 1AURA 3HDVA 1J22A 3U09A 4M1QA 4URFA 2FWRA 3I28A 3W1WA 3WLIA 2EBFX 3QYJA 1YQGA 4Z7OB 1KA9H 1NMEA 4R7ZA 4KAFA 4B9AA 4EELA 2QI9F 3OOJA 1FXWA 2UYQA 1EEHA 3BAZA 1K92A 3UJ3X 3ET5A 5BN5B 1NJ5A 2XF2A 3RK4A 4CMBA 4DJFC 1GY8A 2AG0A 4DDTA 1JG2A 3P19A 1DWQA 1ZM3A 4YGYA 2PRJA 1HTBA 2OAQ1 3IURA 3O8OA 4AI6A 1W36D 1PJ2A 4JN6B 3C5EA 3OF2A 5DRYA 1KVRA 2HQSA 1MENA 1KEZA 3GCWA 3PNKA 4R8MA 1R15A 5C1PA 4L8VA 3G0CA 5DISB 1FLVA 3Q6MA 2E87A 5G41A 3MG9A 5C37A 3GT3A 1YCGA 4EHIA 4Y18A 1QO0A 1P0MA 2JRLA 2M9MA 1B8UA 3ZCPA 5EJ6A 2GTIA 3O0DA 3DOCA 3ACBA 1B2LA 2UYGA 2CLKB 3BEOA 3FDZA 3NATA 3A1FA 3T6KA 5CFPA 4P80A 2AWNA 2WFLB 5HBGA 1K75A 5KYWA 2CWWA 3WV5A 1PD1A 1SHTX 4B7ZA 1X7YB 1X9HA 3L41A 3TZLA 4AULA 3HB4X 2VZEA 3CN7A 3IVMA 2CV2A 3BQ9A 3LI2A 4GQBA 1GFZA 2P78A 3WL4A 4WKBA 2Z57A 3LGSA 2W6MA 1Y9DA 4LV6A 2SCUA 2AK3A 5KB3A 4XR4A 2UUAB 4W9NA 2Q5QA 4ZVSA 4PZZA 5CTJA 4BVFA 3OT1B 4CBVA 2OMEA 5HJ5A 4J1TA 1GQRA 5DWQA 3RAFC 4D8YA 2PJZA 2O8DB 1RWWA 5F78A 4I3HA 3OZUA 3EPRA 3TZCA 2GZ3A 4QTZA 3WGZA 1D2EA 1GPNA 2IKQA 2C95A 8ATCA 2JAOA 4JB0A 4XEUA 5F7OA 1C7QA 4TT8A 1V4VA 4MIKA 1TKCA 1S3IA 1G21E 2F17A 1N6OA 4L8LA 5DHQA 3VOTA 2XUHA 3TLGA 1E9DA 3AGPA 3NO4A 3BD6A 4HNAA 2DOKA 4NONA 1UOEA 3T8YA 3DCNA 1B1CA 4IICA 4NEHB 5A4KA 1YZFA 4C87A 4A7PA 3MMZA 1K08A 4BJ5A 3FX2A 5ELMA 1Z6QA 5MGBA 4M1KA 1Y6FA 1JDVA 3OMXA 4ENUA 2WUVA 1VG9B 1Z39A 3OBIA 1AZSC 3FOWA 2K2WA 5IJ0B 2XQVA 1NG9A 2CV0A 3AONB 1AV6A 3A4YA 4KQ1A 2PKCA 1VJGA 3QE9Y 2FFJA 2G72A 1ULAA 4G89A 2CLHB 3G8AA 4RHXA 3U1TA 3ZLUA 2HWWA 2PR7A 4E12A 5EXXA 3DKVA 2CCJA 1KFBB 5U1PA 3T99A 5LL6P 4AQYB 3TGLA 1WU7A 4OYHA 3ANYB 1FXUA 2EEZA 4YECA 5LSAA 4F46A 1DCMA 1Q74A 1QFMA 1OROA 1YZUA 1ZK0A 2HRCA 2ZS8A 2Q3EA 4XFDA 4M46A 1DBSA 1RABA 5HILA 5ICSA 4YT4A 1R4MB 1ZCZA 3VMMA 3AVOA 3QK7A 3ZOKA 4EUSA 4QD3A 4ZO9A 3S2IA 4R05A 3AU9A 1N4DA 1J25A 2R6AA 1URPA 1XJ5A 3FZGA 3IHLA 3OTWA 4IILA 1RYZA 2ZYGA 2P3QA 2YZNA 2DH5A 3EXHC 1FYWA 1TFRA 1VRCA 2LBPA 2R6FA 3BHNA 1R6TA 4K81B 3W8FA 4EK9A 4IF4A 4KPFC 2MMGA 4BLSA 2WNSA 2GGSA 2J8ZA 4ZCIA 4BRZA 3CG0A 4G24A 2A1IA 2L42A 5CJJA 1Z0DA 5JH7F 3U4QA 3I0NA 4B3HA 4EH1A 3TOCA 4FI3F 2WDPA 4M0EA 4P36A 4Q1BA 3GLHA 3PQEA 3RFTA 5HM6A 5KYYA 2LNDA 1XA0A 4NV0A 1XZKA 3BBLA 4DVGA 2IOYA 2IYEA 2ERCA 2IYLD 3TW8B 1BW9A 1X7GA 2XMPA 1SXJA 1UDAA 5EP4A 2QX8A 2CLFB 3RSHA 4PRLA 4J0JA 4W6ZA 1NMSA 2HR1A 1XELA 1W4RA 1PJRA 1RYFA 2AE1A 5JEEA 2YN4A 3R5JA 2C03A 2HGSA 3W5UA 1EVIA 2QVLA 1RXSA 3IEVA 2OHHA 3H1GA 1YL7A 3C6KA 5K0TA 4JJIA 3RVDA 1Z5UA 3UXMA 1ZL0A 1R7RA 4BGIA 5KTNA 3K6KA 3A9CA 1C3OA 2Q1YA 2Q7DA 1HNWB 4R1PA 3RC1A 3DE3X 1H94A 4RVCA 1C14A 2BFAA 2JGEA 5TB5A 5FR1A 5AVYA 4MUHA 2JEZA 1XOIA 3BB1A 4UTNA 4N5HX 4YI3A 3K2EA 3LU1A 3MB8A 4JL8A 1JLSA 1TUGA 1GZ7A 2FZLA 3AR2A 2CLEB 1SCNE 2D1YA 3DO5A 2WG2A 4LJKA 3ZTTA 3D2CA 3HRHA 3HO8A 4U2EA 1FDVA 2C57A 1RC1A 5EE0A 5F73A 5K51A 3RDPA 3RRYA 3VYWA 5JJLA 4B45A 1DRUA 1PEKE 1S2MA 2ZTUA 2QTBA 3BUSA 3F2VA 2DG2A 3NIWA 1P60A 3D1VA 3JQEA 2HWKA 1E2DA 1XT6A 1JVSA 1TCUA 1YQXA 2IEGA 1S3SA 4FDMA 4KSCA 3V32A 3AOGA 1R00A 3EWIA 1JRLA 1ZIOA 2OKGA 3CEMA 3QBJA 3G85A 1FMTA 4YASA 1G3UA 1USVA 5G3YA 3W5BA 4C20A 1Z17A 5TXGA 2WU3A 2ZK7A 5IUKC 1P2SA 3FVTA 4ZHQF 1E0KA 3FHLA 5JS8A 1BEUB 3CH5A 3K9BA 2QMQA 4FZVA 3JW8A 2FPSA 4MV7A 2DP4E 1VM6A 5IUNC 2VF4X 3LPAA 4CLEA 5J40A 5AVZA 5C52B 2G04A 3COYA 4CWAA 4XE5A 2H5IA 2O7QA 4HX9A 5IABA 4QXPA 4D25A 4EY4A 4H9GA 4ZV7A 1UDXA 4G25A 1E9FA 2BHSA 1ETUA 1QIMA 2R1ZA 2PBRA 4KJZA 1LPBB 1GQQA 2I5PO 2NUAB 2PEZA 1GEEA 1RZ3A 4Q4LA 3VH1A 4GYKA 4I14A 2F7SA 1WUHS 1IVSA 4O1HA 4ZT3A 2D5LA 3JD1A 3QLTA 5LVAA 1CUFA 1QCDA 2HU8A 5JPCA 1XQXA 1TRHA 1BO6A 3QPBA 4MWSA 3MOIA 2GHTA 1OVGA 1JEQA 1HETA 3QPUA 2D00A 2GCOB 5C8YA 2VN8A 4CL0A 3ZWOA 3U1BA 4ZV4A 3JQ9C 2PMBA 3I42A 1VPWA 2Q1WA 3WYGA 3ADOA 5E4FA 4F85A 1WMEA 3BX1A 4DANA 3ILXA 1W8DA 3Q88A 4IP0A 3UYLA 4RTPA 1PQYA 2QS9A 1CUZA 3PXDA 4HQ0A 5H81A 1NZFA 1DX9A 5DJ5A 2ZYWX 5JXHA 1C0LA 3C6ZA 5EWMA 2Z8YM 2O2ZA 4EFLA 1GGEA 1YO6A 3QG5A 3ORSA 2CVOA 3E61A 2F9MA 1BHQ1 3GGSA 1KTVA 2ACEA 2JHCA 1S8NA 3JAWA 1MPXA 3NBQA 3ZD7A 1TDJA 1VSBA 1IN6A 1EG2A 2SKDA 1JXQA 2C59A 3BWYA 3R8CA 2QG9A 3ZCUA 2QQ5A 1V8BA 1C3LA 1NF9A 1ZI8A 3GI1A 3JQAD 4JKOA 1ODJA 1A5BB 1K6XA 2CBGA 2XHEA 4KU4A 4UEOA 4ENQA 5JCJA 3Q8MA 2D1QA 3UOAB 4IHJB 4PX3A 5F9HA 4Q1DA 2Z5VA 3HDJA 2WDZA 1SURA 2YW9A 2JCSA 4IHQA 2C5EA 4WY8A 1TZCA 3BTUA 1LSJA 1XZGA 2JFWA 3AY3A 1U4NA 3AKCA 4MVXA 4TRMA 5TEWA 4B6FA 1RQNA 1MX5A 4DXHA 1GPBA 3MVEA 3G7SA 1T9GS 2X1VA 4L0CA 1XKXA 4N01A 1DIOB 3HU1A 2VHCA 2XVXA 1E0JA 4EI7A 3QGMA 1KYVA 1X7XB 4RVSA 1S1CA 4OXYA 5MN6A 4B7CA 2OL4A 4MB6A 3RU3A 2Z3ZA 1L1RA 5GTDA 5H3HA 1MRSA 3P2IA 1RKQA 3N9IA 4K1LA 1JILA 1BMFA 2SCUB 2XMSA 1MOQA 3DSRA 3L2OB 4LIPD 3SDBA 4D4LA 5C8ZA 3QJGA 2GFHA 4OXXA 2O07A 2YJTD 1ZMOA 3UUWA 1CDOA 2CJWB 5FPSA 1S2DA 1X80A 1NQWA 4RVFA 4WHMA 3PQ2A 1Z2NX 2E18A 2C4VA 4FN5A 3L84A 1DDGA 2CJYA 5TNXA 1J4AA 1SAYA 4AIRA 5LFAA 4CL3A 1SR8A 2NO1A 2CXPA 2BDTA 2QAGB 2E1PA 3V48A 1ZGHA 4GFDA 5TS3A 4CEHB 2Q62A 1YVDA 1RYHA 1LQ2A 5DHRA 3U31A 1U0FA 2E4ZA 1E64A 2Y6UA 2GFIA 1ZK4A 2ZBEA 3FIUA 1AQJA 5LD2C 2VDPB 5BQOA 3SYTA 4D56A 1WD7A 4Y30A 3PC4A 1VL2A 1E2NA 1JE1A 4FW8A 4JQYA 5EIOA 2I22A 1U8YA 4RZUA 1XTIA 2VAVA 4NEGA 2XPCA 1EYZA 2NO6A 1J0BA 3NYWA 2A0KA 4KH0A 1E94E 5T4FA 1U9JA 2D2VA 2RC5A 1Z7WA 3PI6A 4M54A 3K6SB 1NLMA 2EDAA 5F1OA 1T1SA 3TRIA 3H84A 4TVKA 2JLYA 7MDHA 5IDWA 6ADHA 1RWKA 3ZIAA 2UXCB 3RS4A 4RMIA 2GO1A 1H23A 4GECA 4IEIA 2CNBA 2YHIA 2FG6C 4AJNA 1T2CA 3FBTA 4GX2A 5CNMA 3RAJA 2H1LA 1Y37A 1F38A 3CRVA 3FGZA 2OENG 2ZRNA 4HQKA 4O2BB 3PD7A 1J7KA 2QVBA 1G2OA 3FYTA 4KXLA 2PUBA 3VJMA 5LQMA 3GN2A 4AJEA 1OXVA 3VOBA 3WRYA 4Y9UA 5FNZA 1XTVA 3JQ8A 1QYWA 3M9XA 3SSOA 3AP3A 5L6LB 3OMLA 1CC1S 4QT0A 5PNTA 3RCBA 5CFRA 2IEYA 2YZKA 1JMVA 2F3RA 4FE3A 3U6KA 2H1VA 3LHIA 3IHWA 5EJ7A 5BRJA 1G8YA 1VXRA 2OQRA 2YFQA 4QQFA 1KXZA 1D2CA 4N0MA 3WSTA 1HQDA 1YFZA 3LXUX 2VDVE 3CCFA 3KETA 2BHRA 3ANTA 3RIXA 1EP1B 1E0SA 2YFHA 1HA3A 3G9XA 5HTOA 4A91A 1NU6A 4Q3KA 5DH9A 4UASA 1YB7A 5A1TA 4QYXA 4BKOA 4BNJA 4RULA 1SBTA 2AFIB 5IBRA 1WUKS 2Z08A 1YZGA 1CS4C 3NV9A 1IM5A 1JYFA 3QNUA 1PNRA 4D42A 1XNGA 1MD9A 1ZL2A 1IEVA 2NAFA 3B6KA 1PVDA 4MQMA 1L5FA 1QGDA 1Y9ZA 3LCRA 4S2UA 2CLIB 1Z8HA 5LYJA 4JUDX 1OX5A 3SVLA 4ZT5A 3C16C 3HLKA 5C1DA 3OKCA 4AZWA 1O94A 1H2WA 3A1TA 4IJWA 1T2UA 4GM4A 4MVWA 5DN6A 5HMLA 1ZJWA 4RH3A 3NKLA 1OXXK 3ZWYA 1RPZA 1QB7A 3T35A 2W0MA 2TMDA 1MRZA 2V6BA 5T57A 1GGMA 2X2PA 3G0BA 1FYVA 1S4MA 2CFTA 3O8QB 1M5UA 4R8LA 3TLJA 2NP7A 3EOAI 5LQUA 4KXWA 1DTWA 1CUVA 2C7VA 3VR5A 2AWOA 4FFBA 4HN9A 1C8LA 3RUCA 3V7FA 1YS6A 5IJAA 4AS2A 1Y8CA 2J3DA 3RS2A 2HB6A 1UKVY 1C0EA 3UXEA 3TCNA 5EIHA 3VYSB 2RK3A 1SBZA 1TCVA 3GC6A 4Q93A 1KK3A 2I34A 4P4NA 3HL4A 4AKHA 1C1XA 1WDTA 2IW1A 3D6JA 4QYIB 3TJRA 2AVDA 4C78A 3FSGD 1YAJA 1W88B 1JA0A 1GFIA 4ZEOA 3ZGNA 1ZVVA 1B0UA 5L4NA 1NNSA 4G9EA 4R3UC 2WU8A 2IZ1A 4BFZA 2HCTA 4ESOA 1K4MA 4Q3OA 2IX3A 1TIBA 3H4IA 2DB3A 4MQFA 4H7DA 1AX9A 1G16A 2JD0A 2QM0A 2ZDGA 3KZ1E 5ESXA 2QJTA 1UPTA 4PFJA 3QY0A 4CEJB 3NPMA 3PQ4A 121PA 1QIEA 5CRIA 3WGJA 1LBIA 3NIDB 4P34A 3I92A 3P26A 2G4LA 1RQPA 3PRHA 1V6CA 2X8AA 1UDRA 1XCBA 1QC5A 3PHJA 3IOYA 1C0KA 2AEMA 2OCIA 1AG9A 3MF4A 4AMGA 1Y3HA 3F6YA 1PR9A 4KQXA 4M0CA 3DR3A 2CL5A 1COZA 4QO7A 4O2AA 3RUPA 4GP6A 4AWBA 1YQTA 4C0AC 3HB7A 1DBRA 2V7EA 3IR7A 2BC9A 1B0PA 3P97A 4DQDA 4XR9A 5EIXA 4BNUA 4HY3A 1NNI1 1A9OA 3FKJA 4QTYA 2N75A 4XM2A 4JT2A 4F60A 1MGOA 2YV1A 2XXAB 2AW3A 4GLFA 2C2BA 4MPRA 1CY2A 1W44A 4GNKA 2VEDA 1BU5A 3CW8X 3OPYB 3LQKA 4YEDA 3WMGA 1NMXA 2ZJ5A 1QUFA 5D7BA 1U1EA 4DZTA 3OQ1A 5CNKA 3I8OA 5FOWA 1FXSA 1LWNA 3D7MA 3RGWS 1AA6A 4H1TA 1SA0A 5C7IO 3EEBA 5JO9A 1G6KA 3UKDA 4CJXA 3N2GA 1V41E 4I2NA 3LQ1A 1L7XA 4EJSA 2BM9A 3BXOA 1I7SB 4XSGA 5ALGA 2D0PB 5FIUA 1EE9A 2CZCA 3GQBB 1YS9A 3CZRA 7YASA 1VG0B 1IAQA 3OFSA 4DCNA 1EDZA 1TYCA 3DKKA 4IVNA 4U8HA 1VLQA 2HHCA 1TB4A 5D5PA 3UAWA 4BX9A 4CGZA 4JYZA 1PFVA 3MW8A 5FAXA 3DYVA 4UQPA 4P3OA 1CF9A 1GM5A 2HWYA 2XCRB 1QYIA 4KWEA 2SECE 2GAAA 2Q9BA 4EHNA 4C3VA 2ZBRA 1TMGE 4B47A 2AJTA 5BOSA 4HQOA 2ZREA 4J1TC 1LH0A 1SPBS 2B20A 2HSZA 3R6LA 4WEOA 1BAPA 4C0HA 2FQYA 3BCHA 2QZZA 1KC3A 4WT7A 3JXEA 2XCOA 4UXHA 4QC2A 3N2KB 2EKLA 4RCZA 4D43A 4DMHA 1E2QA 5HP4A 3OESA 4LBWA 1HEIA 1Z4MA 4LQCA 4X20B 3E1GA 3SQNA 2WB4A 3ZUGA 4NTZA 3MEQA 2XH8A 1V1JA 2JAQA 1VE5A 3F7TA 5KAPA 3A31A 4V38A 5HGJA 4XFKA 3W8DA 4ZYTA 4QUDA 2YMLA 4CF4A 4JLBA 1QVVA 4O1IA 1PL8A 3FDJA 4MDHA 3LCMA 1ZH6A 3TLXA 4ER5A 2V4ZA 4DWVA 2X0DA 1H85A 1U5AA 4BNKA 2F43B 4LYAA 5K6TA 3QEMA 4EL0A 5LIPA 3CUYA 1SCDA 1ECFA 4EJ0A 1KY4A 4JLWA 3TTUA 1XPRA 2QD3A 4XUDA 5LDHA 4HWKA 1PVVA 2H29A 3FF4A 4I1SA 1NJGA 4P3NA 4UBJA 5AXCA 1D5CA 3KYBA 3MLBA 4JVMA 4LYYA 3BQMB 1R6XA 1UEIA 3IMKA 2BBOA 3AR5A 4TSFA 2IHKA 2CXUA 1C4WA 2GHQA 2R25B 3L4SO 3B6EA 3EZ9A 4WJLA 2QPOA 1RBYA 3CPJB 4HRYA 4IUYA 1RJDA 4JD5A 3ZQJA 4UHCA 1VCMA 1CG6A 1WF3A 2ZQ5A 2L0XA 3EXFB 1QHEA 4LG1A 1NPYA 1U8TA 4ALIA 3BSWA 2XSZD 5AD1A 1MVOA 4NXMB 1E3QA 3FDZB 1QH0A 5JMPA 3ANMA 2JLCA 4MW9A 4XQ0A 3VBCA 3BJIC 4DLAA 2WJHA 5H4GA 4HZUA 1ZW1A 2VHWA 4UE3S 1IRXA 5K0EA 4TV9F 1XAGA 4MHOA 1MRNA 3ENKA 1U6IA 4G56A 3RWMB 4C3ZA 1AQUA 4OI1A 1ONNA 4YACA 2VAXA 2CFSA 4WBNF 1SVWA 3FNBA 3D0OA 3RBVA 2Q3DA 5LPNA 2ZIUB 4YJHA 4DMMA 3AEQB 3KXKA 1EGAA 4KGDA 3RRFA 3DE1X 3OKPA 2ENUA 4LDRA 2QG4A 1CUUA 5EWJB 2PZMA 2ZSFA 4I4CA 1E6UA 3F7MA 5TF0A 4AF7A 2VBFA 1OPRA 1LBQA 3ML1A 1O6BA 1U98A 3NGMA 5KPDA 4UUPA 4EPYA 1A1VA 1BZYA 4PLZA 4MHTA 3IP7A 1LLUA 4P86A 3UMSA 4MITA 3GFVA 3EUEA 1IVYA 1KWGA 1KMHB 4Q4HA 3PDIB 2IWRA 1M1ZA 4S0XA 2H5LA 2ABWA 5G53C 2EARA 1FUYB 1D4AA 1R0BA 1VIDA 1WMFA 2AK2A 2H6EA 3QVGB 4HATA 2PS3A 3ZW7A 1IOWA 3PE3A 3S8EA 3CGGA 3GA5A 1VQ1A 1EQUA 3HJTA 3EGOA 2JATA 4H4EA 3LUCA 3LYHA 3OUZA 3TOSA 1G8PA 3V8VA 3B3FA 4Q9AA 4X1OA 2M1ZA 1CWUA 3JX9A 1JBKA 1VI6A 2C42A 4MX8A 5AJUA 2MSKA 1YQUA 2MYPA 1Y8RA 2I3DA 4NPAA 1NLUA 4BQQA 3GN1A 4V0LA 1UBNA 4JELA 1GPKA 4HKTA 1C2YA 1RWOA 2BGKA 3OWHA 5JY6A 1XNJA 4YH1A 3H9QA 1T3ZA 1O9GA 4N54A 5AVJA 3W6ZA 1AGNA 3CUSA 3C85A 3GPIA 3AM1A 3DZGA 2WM9B 3HA2A 1YBMA 2XZDA 3HV0A 4OB8A 3SR0A 5J23A 3ZVMA 3EG9A 1PE0A 3ETCA 2C7OA 4LOJA 2Y0DA 3AEQA 2VS1A 2J6HA 4QG7A 1O0BA 1D04A 3PXUA 4YXFA 3F78A 1KU0A 4M1EA 2DTEA 3I30X 4NMXB 1NE2A 5BSVA 1TA9A 2H1RA 1DG1G 4I55A 1JXAA 2Q1SA 5IASA 2NNWB 1JJ7A 4WNYA 5LOVF 1R9GA 1G42A 4DIOA 2QRNA 1VL0A 3EB9A 4JGGA 4NFSA 4C0LA 1OI3A 1RWVA 3IPRA 3LRTA 3PVSA 3LC7O 1OJLA 3OU7A 4C01A 4MZDA 4EL5A 4DR3B 5G4KA 3DZJA 1XVTA 2F4NA 4HOYA 4M6WB 4EPRA 4JNKA 1VHQA 3TQTA 2JASA 4MR9A 4NCHA 4BQEA 3EXFA 1PV4A 1KQOA 3WQSB 5ALSA 4JBNA 3PHLA 3D0KA 2H7VA 4KACA 3K3PA 2IQIA 5LZ8A 1UP6A 1L7VC 1R6UA 5DI9A 3QOWA 3PC3A 4YRCA 3SOPA 5JDCA 3O3OB 3U3RA 1EUZA 1VYTA 3B7GA 3JZAA 1LRLA 2VJLA 2X41A 4GQAA 3FNEA 4KFUA 4PNEA 1M10A 1XQYA 2YJ4A 3C3EA 3I05A 2G0AA 3QKTA 1YR7A 4Q3DA 1KSGA 1VSQA 4JJ4A 3EG9B 3EQ2A 5K1ZA 3TR6A 4YK7A 2ZWIA 3HLTA 4C4SA 3EG5A 2H4WA 2ZM6B 2PUWA 2JL1A 1KO5A 3ESDA 5DLDA 4N9QA 4M9XA 1IOVA 1GFWA 3G0OA 4OP2A 4TL6A 4JI1B 1JU3A 3B1WA 5HKKA 3ZV3A 4GF5A 3W9BA 1GPJA 3ZWXA 4DXAA 4DLXA 4EYOA 2CHGA 1U8CB 4QA9A 2CMKA 1KIMA 4TSFD 5JUWA 2NQTA 1CS0B 1DBPA 2ZUBA 2LGJA 2NX2A 4IIJF 5DT2A 2R7KA 1GFSA 1KH1A 1O6FA 1V1MB 3LT1A 3KU4A 4FHCA 1I6MA 3TW4A 3WDKA 1NLFA 4RWEA 2Y2UA 3E9ZA 3A3OA 2O59A 2GCOA 2HF7A 1JDSA 2X4DA 3GUCA 5BW4A 4KYVA 3FPEA 1XVVA 3EIXA 4UVEA 1KQGA 1STOA 2R97A 1TUBB 1RKXA 1YIDA 4L6CA 3AR9A 2PX2A 4OATA 1NVEA 1Y9AA 2MIIA 3SZOA 1PR6A 3S8YA 1K9SA 2DWPA 2G36A 2JFQA 3JYHA 1V3UA 4HWTA 1YJCA 1MABB 4BO3A 1GT91 2NO5A 2NXNA 5KYNA 1MBZA 3U3XA 2FPXA 1JP7A 2P68A 4FHEA 1P1FA 4K26A 3V1TC 1AS0A 3IIIA 1M9NA 2RE8A 2WFMA 2HMVA 1NN5A 2WLSA 3FBWA 1X8LA 3OOHA 4PLFA 3R3UA 5JAHA 3F97A 3KKMA 3QVXA 1KF0A 2VRCD 4GP9A 3NWPA 4Q16A 1PFKA 4BTVA 4BVJA 1IOLA 3U7GA 4J0CA 4WL0A 2BW0A 2AEEA 3KHTA 2FZWA 1H3NA 2C84A 2ZR7A 3TVDA 1M2FA 3RC8A 4J2TA 1H1DA 2IZZA 4NDZA 5LIRA 4RPKA 1JB9A 1GGJA 2RHTA 3M9WA 4XWKA 5BSTA 1SUPA 2G6TA 3M34A 3GW8A 1IEXA 4N0EA 5DK6A 1GTMA 1TCCA 1TAUA 4C2BA 3K92A 5F7JA 2ZAGA 4NU5A 3SJCA 2Q3LA 4B73A 1Z5WA 1JXOA 1DFGA 4FFVA 3S55A 1YCFA 2YR0A 4GE0A 5CT6A 3WRXA 5JNVA 1VKZA 4W7HA 3N58A 1CJKC 1KO4A 3SFVA 3HZZA 3CPHA 2EGHA 1BDBA 2QMEA 5EINA 4D3SA 4PZLA 3U37A 3W04A 3WLSA 3A4VA 5AKXA 4RD4A 3RR2A 2CDBA 1W9HA 1IK4A 1PUXA 2BUCA 4HUTA 2HEGA 2GF0A 1DSSG 1OY1A 1RAIA 4DQXA 1AS2A 5KVQA 5DPMA 1SIUA 1UUFA 1FVFA 3QYPA 5IVIA 1GCUA 3I6MA 4NBUA 1GNTA 5KKCA 4YP1A 2EFJA 4ZT6A 1TLFA 1XXLA 4RHTA 5DOZA 4Y7DA 4YUZA 3IKJA 5AM4A 1T6NA 2HRRA 5AVVA 4CKYA 2LZ0A 3CUKA 3K4PA 4L74A 3R7DA 4MQ5A 5AVOA 3JWGA 5KI6A 3FFWA 4Y2PA 2WTAA 3CF4A 2Z30A 2ILVA 2VPZA 5TVKA 4CI0B 2VTDA 3UJNA 4UVGA 1DAOA 4RHUA 3DTTA 4A26A 4B71A 3EQ8A 3GLHB 1ZXXA 2FJ0A 4BQPA 4IGAA 3K5PA 3KNZA 5A3SA 1Y4ZA 4OJMX 5BPHA 4Z4EA 2O48X 4FFWA 2QRVA 1X1SA 1ULSA 1VMDA 2VO1A 1QRSA 4Y7CA 3O26A 3RTGA 1Y1QA 2XWJI 3KK0A 1L7PA 1YR2A 2ISSD 4I9FA 4F9EA 3HVHA 2ECPA 2OZKA 3L7OA 2PY6A 4P2GA 2H4ZA 3U3MA 4DGSA 2B2NA 3JALA 1CX9B 3IDSA 5AK6A 3JQBA 3SHQA 4AUMA 2IHBA 5LLTA 3ZJTA 3TE6A 2ZRQA 5CR9A 1PT5A 3G8DA 3RT9A 3KP1A 2H1SA 4L5IA 3QVSA 3QXCA 3SQDA 1IXYA 3Q1KA 4NLLA 1N2BA 4KQWA 4N8EA 1MAAA 4CU2A 3COWA 3FD8A 4R7GA 1HFKA 1ZD9A 2P6RA 5DXJA 4YROA 3C39A 3G1WA 1TTTA 3CFYA 5FOTA 3B3GA 1O3YA 1X15A 1C4OA 2P77A 3K0KA 2PZBA 3KHSA 1M0SA 1QONA 1NIPA 3B6ZA 3FFXA 4MPDA 4I55F 4UDOA 3TF5A 4FZJA 2BONA 2ZRIA 4PSCA 4CT4B 2XUOA 4ZVOA 3ZDRA 1CQZA 5ADVA 1OOEA 1IDOA 2VA8A 1EUYA 4CM9D 2BE7A 3B6IA 2IGBA 1F12A 2IVFA 3W05A 1TQ8A 2X9QA 3AGQA 3ETHA 3L8HA 2HH9A 3LUFA 4OM7A 4RYLA 3KKLA 3QX3A 2JGDA 3ESZA 3AKYA 3AEUB 3OZFA 4QHTA 3MWFA 3O21A 3THOA 5KVCA 3UCFA 4JJZA 2Y2VA 3H9JA 1HZZC 2JZNA 3ZJVA 4LWZA 3ND9A 4NAHA 3ZNQA 4M21A 1NC3A 3PDIA 1GLNA 1I6KA 4X1IA 4LYJA 4LZAA 3S1AA 3T7DA 3TSAA 3VZPA 1Z8NA 2HSDA 4U7PB 3X3HA 1Q44A 2XAUA 1V8ZA 5AUQA 3V6LA 1R64A 3NUZA 2X23A 1CR0A 1P1HA 1VYUA 3TL6A 4AYWA 1A9XA 3QWFA 3MTBA 4WIAA 3RUAA 3RJ9A 4BATA 2WOJA 3NCHA 2A5DA 2WE8A 1QIFA 3WRYC 3W2TA 1CUXA 2ECFA 3S3TA 4BFVA 3TUJC 1DG3A 4ZT4A 1O89A 4P6VF 3TI7A 1T9DA 4LOLA 1M2HA 2XY4A 5DHPA 3S2SA 4AJ9A 3A8TA 2VTBA 3EGVA 3AWIA 2AKEA 1ZD3A 2WF9A 2IYSA 2OVBA 3K6SA 5GJBA 1RP1A 5CTAA 3G2OA 3QUAA 1ONSA 4P08A 5KJEA 4GPEA 3AHJA 1UEXC 4FJ0A 3LP8A 4B2PA 1NN0A 2J85A 3R6TA 1DIGA 4JNCA 1GCIA 2TS1A 3VNSA 3U7EB 1NUUA 4LGVA 4QDOA 2JFYA 4GC5A 1F0YA 1LVHA 2TMGA 3ASZA 3NBXX 3I6IA 3MT8A 5NLLA 2YZMA 1S2GA 3ZLJA 5ALDA 5G4KB 2A0WA 5E3JA 5K3CA 3TDKA 4KLAA 2N1MA 3D7LA 4R6WA 2J5QA 5BQFA 4HDKB 5DNUA 1GPLA 1GU1A 4MAAA 2JFNA 4IRUB 1QSGA 4XGKA 5EQJB 2HSEA 3STUA 3TNDA 1XYGA 2WHRA 1Y0BA 3QE4A 3EX7C 2Q9CA 5TY0A 4HEQA 1A9ZA 1E66A 3TSCA 5F2OA 2YN0A 3LT4A 2IYZA 4DJJA 2G9VA 4IGIA 1YU6A 2QOEA 1U2PA 2QPTA 3HMQA 3BWXA 1G8SA 3IULA 3GLKA 2DQ4A 2RHBA 3GJRA 1JR3E 5AVQA 2V97A 1JHQA 1L5NA 4KXNA 1WXEA 2MT9A 1EJ2A 3E70C 2WIFA 3HB5X 3LPLA 4MO2A 2IWHA 1ZI6A 3VAZA 4WCFC 2NV6A 3WAJA 1AN9A 2UXBB 3KZCA 3CT4A 4GC9A 1PSWA 4HPWA 4EB3A 1P1IA 1RQGA 5T8KC 2V5UA 2YIDA 3C6XA 4Q3LA 2FSGA 3KQMA 5JQGA 4REQA 4OHYA 1NYTA 4J7UA 4A3SA 3SEZA 1I14A 2XRFA 2K7ZA 1P7VA 4ZQEA 4MS4A 2Z98A 4CNQA 4HF7A 2D2EA 4HVCA 1XEAA 2X6QA 2EJWA 4Z7NB 4L0QA 2A3RA 4EG7A 1DQPA 2XMGA 5AKHA 1YFLA 2P6UA 1LW7A 3MJCA 5IZCA 4WLNA 3TD2A 2DPHA 2UDPA 2PRKA 3HDQA 3NC4A 4BJ3A 5DM1A 4W5OA 1LNSA 3FB1A 4XM0A 1C1DA 1I9GA 1RJGA 1ABBA 2ECOA 2C3MA 3S7TA 2XYGA 3RANA 5JS7A 1OI2A 1KE1A 2GTHA 4ESEA 5LXTB 5DMHA 4FGWA 3UW3A 1UOPA 4MGIR 1YK1A 2FRDA 2Q28A 3G9QA 3K09C 3T9FA 1ZZGA 4GHWA 4P5EA 1ZG3A 2OBYA 3QI7A 4DF3A 2VYQA 3K72B 2WWRA 4AS1A 3VOAA 3OQMA 2C3OA 3LDGA 2BUAA 5ETJA 5HOEA 3NMUF 3BF7A 2Y66A 3L4BA 3GV0A 3VC1A 4DMFA 1P7ZA 1DAKA 4MW0A 2QW0X 4ZQBA 2WWXA 5EWMB 3WRVA 3W78A 4D92A 2ZTMA 4OHWA 2W7TA 3W79A 5F9MA 3RG2A 1IEQA 2V6IA 3ILSA 3NBZC 2GDJA 4MVJM 5JCJD 3FYCA 1NBOA 3FSJX 4HQNA 3RD5A 1NSFA 4LDJA 2C5SA 2AT1A 2P9HA 3N8DA 4M99A 3PRKE 1N7JA 4LF4B 4IDAA 2ZQYA 3KTAB 3STTA 2XZOA 3AF1A 3QFHA 1WE2A 4JC5A 2IH2A 1QQTA 4KDRA 2XR1A 4KREA 2IHUA 4BS9A 3KOOA 3NHWA 4G0ZA 3MWGA 4ABYA 2IUSA 3PI7A 5F76A 1UXIA 2VUUA 1PYGA 1I3CA 3TS1A 1KI3A 2GNAA 3PXBA 4C4ZA 3E3LA 4H4CA 4A8JC 3O94A 4OQMA 3RVKA 3ADBA 4ZIRA 3DT9A 3MRVA 4BIIA 2PUGA 1UJ2A 2A14A 5ESWA 4OMFG 1FMCA 1E6KA 2C2OA 2QRQA 4BX3A 5FL3A 1GKIA 3AW9A 2C4MA 1L8AA 3BIJA 3GDHA 4LI0A 5H68A 3WLKX 3WWDA 1J0XO 3N8KA 4XRGA 3C97A 2YZ7A 2CUNA 3FUUA 4W9NC 4PXSA 1XTJA 2GZMA 3CUUA 4HFJA 1U94A 4M8KA 4MOWA 4DL9A 4ER3A 5CBKA 4B5LA 2RH4A 1VECA 2QQGA 3BGDA 1IQ0A 1REQB 2VJQA 3FVRA 3LLMA 1AZLA 1MX3A 1NQAO 3RAEC 2K87A 4NQZA 1FSSA 2PQ2A 3CM0A 2ZI3A 4WJKB 1UMBA 4W63A 3H7AA 5I47A 4MQBA 4MDFA 2PS0A 1MX1A 1D2GA 3TSOA 4RC9A 2UYOA 1A04A 3AUUA 3DBLB 3Q7SA 5A9SB 1KY2A 2ZSHA 1I2MA 4G1CA 4MGHA 1SCUB 3LBYA 4RF3A 4WK2B 4DPLA 3X2FA 2R85A 4DLTA 3DAOA 2QRVB 1E3SA 1XQVA 4BDSA 5B2EA 4EX7A 1P5FA 2V6GA 4J9UE 5FBWB 3OCXA 2CYBA 2JJMA 3O8QA 1GRRA 4B0PA 3DYIA 1CVLA 2ADFA 3INNA 1YCHA 2D0DA 3BRSA 3DDWA 4WOKA 2AUTA 2PV0A 3TTYA 1Z73A 3KAQA 3RFVA 1SUEA 3MGGA 3VSAA 3PXXA 4K87A 4S0ZA 4ZHQB 3DUFA 3ITEA 2C61A 4MUXA 4GSLA 1JI3A 5D51S 5IC6A 4YRNA 4DKXA 1LFDB 3A9RA 1MGPA 2OHJA 3B85A 3MT0A 2FQ1A 2P35A 3PJFA 4GVXA 1T4CA 4MAMA 4D0SA 1X3SA 4RTKA 1YR3A 4KDCA 4CMKA 2ATIA 1UIMA 2FMHA 3DNFA 4R68A 5AOVA 3SFTA 4NSNA 2NSJA 4ERXA 4Q9NA 5DX1A 1MQ8B 1QIIA 3ZIDA 1TEVA 4M49A 3OX4A 4CV0A 2G80A 2BJVA 4PSDA 4PTYA 1W4BA 4B44A 1E9AA 4F4DA 2Y1OA 4QUAA 1M34E 2J87A 2ZB4A 2F3PA 3C14C 1VLJA 3L8GA 4UAGA 1BX1A 1EFDN 3GJSA 2IYRA 2ID8A 3AR6A 3A1VA 1PV2A 1V3QE 1W59A 1Z6ZA 1HDGO 2H31A 3DR5A 3R0VA 3WX0A 1TAHA 1UM8A 3JQQA 3RFUA 4UTZA 3EPJA 4ZPJA 2YNMD 1UQRA 2BGTA 3G2QA 2G63A 3ST7A 4ZEMA 3KUKA 3F73A 1WY5A 3P96A 3WK4A 1WKVA 4ZOAA 3IALA 4AY4A 5GJWC 4KE9A 1MAVA 3R7BA 1Z5GA 3UV6A 1TYBE 5L4SA 1DPFA 2M32A 1MC1A 5KCMA 1W4AA 5AI9A 3VDXA 3ZCRA 2WILA 4M0UA 3HR4A 2CK3D 4FJ1A 4JQCA 2OFFA 4DUZB 1KQ3A 3I2IA 4UD2A 3AINA 1NULA 3NPAA 1GKLA 4ZAGA 2IS1A