3QNWA

Caspase-6 in complex with z-vad-fmk inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human caspase-6 in complex with Z-VAD-FMK: New peptide binding mode observed for the non-canonical caspase conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 42
structure length 134
sequence length 134
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qnwA00
1RHJA 3KJNA 1QTNA 3H11B 2J31A 4QU8A 5I9BA 2J33A 2P2CA 3R5KA 1I3OA 4IEFB 4QUHA 1RHUA 3P45A 4EHDA 1F1JA 2H5IA 5IC6A 3DEJA 4FGUA 4HQRA 4HVAA 3BIJA 1RHKA 1RWKA 4N6NA 4JR1A 4EJFA 3V6MA 5LU8A 4QUDA 5IASA 1ICEA 2QLBA 1RHRA 2XYHA 3D6MA 2H65A 4NBKA 1CP3A 3V3KA 2WDPA 1RWOA 4JR0A 2FUNB 1RWWA 3NS7A 4ZVOA 3V55A 4QULA 4AW9A 4QUAA 2H54A 3OD5A 5IBPA 1RWPA 1RE1A 4D3ZA 4I1PA 2C2MA 5LU9A 2H4WA 4JR2A 3R6LA 4EHLA 4N5DA 1JXQA 4EHAA 4FXOA 3NKFA 5IAGA 3IBCA 3PD0A 1QX3A 2XYGA 3DEIA 4QU5A 2QL5A 4I1RA 1SHLA 1K86A 2K7ZA 4JJ7A 3SIPA 4QTXA 2J30A 3UOAB 4PRYA 3DEHA 3H0EA 1IBCA 1NMEA 4QU9A 4QUIA 4FEAA 1I4OA 4HQ0A 4JB8A 3E4CA 1PAUA 1RHQA 1SHJA 2CNLA 3GJSA 4PS1A 2H5JA 3UO8B 4EHFA 2J32A 4QUJA 2HBRA 1SC3A 4DCOA 3P4UA 2AR9A 4NBNA 2NN3C 4EHHA 4AWAA 4D3XA 5IABA 5K20A 3R7NA 1RWXA 2CNOA 3SIRA 4D3YA 2C1EA 4N6GA 4JQZA 4PS0A 2QLFA 4NBLA 2XYPA 3V6LA 5IC4A 2H51A 3NR2A 4ZVQA 5H0IA 3K7EA 1KMCA 4N7JA 4EHNA 3R6GA 2CJYA 3RJMA 4LSZA 4QUEA 3GJTA 1F9EA 1QDUA 1BMQA 3KJFA 4DCPA 2HBYA 2FP3A 2QLJA 1RHMA 1PYOA 4QUGA 5LUBA 2QL9A 3S70A 3V4LA 1I4EB 3ITNA 1GFWA 1SC1A 2Y0BA 3DEKA 3EDRA 3QNWA 4JJEA 4ZVRA 4ZVPA 5IAKA 3S8EA 1SC4A 2Y1LA 4NOKA 3R7BA 2FQQA 1NMQA 2H48A 2QL7A 4PRZA 2C2KA 4DCJA 4JQYA 4NOJA 4M9RA 3D6HA 4NOMA 5IBRA 1K88A 3IBFA 5IARA 3GJRA 4FDLA 1M72A 3V4OA 3PCXA 2XZTA 2DKOA 1I51A 1NW9B 1GQFA 2CNNA 4JJ8A 2CDRA 4N7MA 4NOLA 4QU0A 4ZVTA 2H4YA 4ZVUA 5IAJA 3KJQA 5LUAA 2C2OA 2CNKA 4EHKA 4QTYA 5IAEA 3H1PA 4IYRA 3EDQA 4N6OA 1CVRA 3D6FA 4ZVSA 3H13A 5I9TA 2HBQA 5JFTA 1RWMA 3R7SA 3H11A 3R5JA 2HBZA 1RWNA 1RWVA 1NMSA 4AWBA 5IANA 3PD1A 5IBCA 2XZDA 2C2ZA 3GJQA 4QUBA 2CJXA
chains in the Genus database with same CATH superfamily
2MYPA 3HHPA 4ECAA 2M9MA 5DGTA 2GFQA 3R6DA 3Q10A 5HKKD 4D4IA 5C1IA 4F3YA 3GLTA 4TTVA 4KE6A 4HLUA 4ZI7F 1V25A 2EFCB 1D3AA 1DO0A 3UMMA 1F3LA 4N40A 3H1EA 1TGVA 3FOCA 1JWAB 3K20A 2ZRNA 3IAXA 4G4SO 4I4CA 4QARA 1I80A 2YTZA 4IDCA 2A1IA 5TT1A 3VFDA 4CKBA 1IVSA 3ZOKA 2PPVA 1QFSA 4JUIA 3RSOA 2OORA 1EGAA 2D5IA 4C0JA 1X80B 1MHPA 2Y3IA 2KBEA 3BEOA 4X3CA 3SSNA 2O1XA 1ZGZA 1E2GA 4XB6B 2FPMA 5JT1A 2WUWE 3OX4A 4JBXA 5LC1A 2YCBA 4D7AA 4J3FA 1MDBA 4C4YA 1MT0A 1P4AA 3VSBA 2OVBA 1EZ4A 3KOMA 1CF4A 2OL4A 3U1TA 4NHOA 2I6QA 4OB7A 4A5SA 3FYHA 1PJ4A 3MUNA 4P86A 2IXEA 4E22A 3KQYA 4C21A 4CCWA 3NETA 1YUMA 3HL4A 3B1FA 1ZOPA 4ZOLA 1LSUA 4JL6A 2AZXA 1MNQA 4IF4A 2A94A 3TBKA 4YCLA 2O8DB 2ZPUA 1W73A 3EVAA 2ACKA 3I5MA 3B5IA 3AY3A 1QWSA 2QW0X 4TWIA 4PTYA 4EUHA 3G2MA 4EEXA 3CFYA 5B3AA 1H22A 3E7PA 3RYHA 1JR2A 2FLVA 7ADHA 1N1GA 3IA7A 3L18A 1JZQA 4PBTA 3PXUA 3A3NA 1LH0A 1Z6AA 1RI4A 2CEKA 2FHPA 2GAJA 3FPKA 2G06A 4J0EA 5IDXA 1QCDA 1AU9A 5DN9A 2XKJE 5FKJA 5BN5B 5CPBA 3BL8A 2FSSA 2XDYA 3LP8A 1SVMA 4A0QA 4UVDA 3LPNA 2GDZA 1P6UA 2H0RA 1NVTA 3BAZA 4M0CA 2V0NA 1X7WB 1TYCA 2BEJA 4U63A 3WYBA 3T7EA 3WBBA 1Q0HA 3QBJA 4IDQA 4JBWA 1L5MA 4KFUA 5GJWC 4UEWA 3V4RA 1TRHA 4FKBA 2VYVA 3WSVA 3KVVA 3IOMA 4CIBA 1EGQA 3AUJB 4TMXA 4OGKA 3ADCA 5L7YA 1O6FA 1YRYE 2CXPA 3LY8A 2VDQB 3OJOA 1P0MA 1PJLA 4U9UA 5DZSA 1UAYA 5IM5A 1I9GA 5JCZA 2P4QA 2VJCA 3T1VA 3Q8LA 1ZM9A 4Y6SA 1ZVMA 5J63A 4BC1A 4L5JA 1XZLA 1YACA 4Q4CA 2ANCA 2WMDA 4ZFNA 4MUBA 1WCWA 1NP7A 5E4YA 4QDUA 3UY4A 1YFKA 1CVIA 1VMDA 2PVSA 3KPVA 1LTKA 3A27A 3P1JA 3AUXA 4JB0A 1V8PA 5JADA 4BWYA 1YBAA 2IH4A 2VP9A 4AC9A 5K3AA 5CYOA 1GG5A 4LV6A 2Q9CA 3LF1A 3LXRA 1ARZA 1CVRA 4IZHA 3CVYA 1J70A 1R5NA 4EMUA 2ONYA 2BTEA 4YR7A 1S3GA 1NW3A 3MQ4A 4FLEA 2FPSA 4LOKA 1E6MA 1RR6A 2DOKA 2DLDA 4B4OA 1MB9A 1NDHA 1TK9A 1TLLA 1UIRA 1PJAA 3NHKA 4FUTA 1N7IA 4WERA 4CW7A 5I01A 3T5AA 4PV7A 4NE9A 1YHYA 1UF9A 2XWBF 3VSCA 2IDZA 3ZBTA 5ALNA 2XTAA 1ESMA 2Q1UA 3FAKA 1JEAA 2Y8EA 3TH5A 4KIWA 1K3UB 4KN5A 4Y98A 3DF9A 3T7RA 4LF8B 1ST2A 2XCTB 3V4ZA 3RDPA 4M49A 2IIQA 1OBVA 3BS4A 5FOXA 2G6TA 2FZKA 3SR3A 3OZWA 4JLVA 4Y18A 3RUFA 3AR8A 4R2MA 1L4BA 5D01A 5IZCA 1XK7A 4BNWA 3EOZA 3A25A 1NA5A 4PX2A 4G2NA 5HEKA 2GPWA 2OLJA 1GNSA 4H7JA 4RC9A 1TM2A 2I7CA 2H63A 4OHZA 3THOA 3RBXA 2GLXA 3I5AA 3ZHCA 1MAVA 3ZVRA 4EG1A 3PL1A 3WXMA 1ACMA 1BIFA 1DHTA 1LCIA 2AV6A 1LPOA 3G6WA 1Z6TA 4PYIA 3L6OO 4QTXA 4RVNA 2R1TB 2WM8A 4OI4A 5I9LA 5KIAA 1FZQA 2A0KA 5FOVA 3EGWA 2B37A 5EP1A 4BX2A 3FSEA 4TTPA 4UTZA 5C4GB 4BV9A 1OFIA 2QT9A 3GAAA 4FYXA 4WZAA 4PAWA 2V6MA 3X2FA 1HNZB 1E4VA 2AL7A 3NXKA 2RGWA 1BTOA 3CMMA 1OU0A 4M1YA 4IUCS 3M2TA 1FTGA 4YMGA 5DMXA 4K86A 1V3TA 4A82A 2CNOA 1S3FA 1SBQA 1VYTA 3CO5A 4PQRA 1ABFA 4MS3A 5DHSA 3HADA 3FRJA 3VR5A 4BQQA 3FSRA 4CM7A 3L82B 1J4AA 2RHDA 5A9TA 3CF6R 1U7WA 5HF5A 5EPEA 2AQIA 3NV9A 1KQFA 1BSVA 4CETA 3LX8A 2VYND 1AMUA 1QDUA 5KS2A 4AROA 1IHPA 4QE3A 1YJBA 3NX4A 4NZZA 4F06A 2WVGA 2Z5FA 2I55A 3ZQ4A 5JNSA 1FJGB 1CDOA 1R66A 2XUKA 2AJCA 4LXXA 5B53A 5A9RA 1NAIA 4I1VA 4G9EA 5HF8A 1ZI9A 3FNHA 2XGMA 2OBFA 2PWZA 1RLOA 4JI0B 2YCLA 4CT5A 2AUNA 1YA8A 5EHQA 1KEPA 3HJBA 2H48A 5HE8A 2FPUA 3KD3A 1GP2A 1BMTA 1QH8A 1T36A 1U8ZA 2EJVA 2PQ2A 4FS3A 3REQA 3UK2A 1XXHB 2PGJA 2VYQA 2YUTA 4GM0A 1M1YE 1CERA 1XBTA 1K88A 1KOFA 3Q6MA 4J4TA 3UC5A 3VO8A 5BWOA 4YT2A 1GCOA 2Q2OA 3FPLA 4BMOB 2QAIA 2ORWA 3UW3A 1AGXA 1JBKA 1A2BA 1XRQA 3JQFA 1XCPA 4MDFA 4QKQA 4HYEA 4F8JA 1B23P 1D6JA 3K3PA 1U63A 2DH5A 1JXMA 1A27A 1KH1A 2VAVA 3ANNA 1FYVA 1THGA 3D6FA 3E9MA 3I9MA 3KLNA 1V11A 3NHRA 1S8AA 4MW5A 3KD2A 4PLCA 4AO8A 1FYXA 1JFSA 4JXKA 3ZY5A 4NECA 2B30A 2HBZA 3OLWA 5KU1A 1RJ9B 2HT1A 4EY3A 5LA6F 3SN6A 1U8XX 3AERA 1ECJA 2PAAA 4ZU3A 3L4SO 3A6KA 4FOLA 4JJ4A 3I0MA 2HT6A 4ZQEA 4AKEA 5I7RA 1GQSA 3TQOA 2ATXA 4DM7A 4ACAA 5JNTA 3AIKA 4Z9XA 2SECE 2FQXA 1K4YA 4OXRA 2O6HA 4ZZ2A 2XYHA 1E5QA 1QV9A 2QN6A 3MMXA 2Z56A 3OY2A 5CEJA 2G5GX 2HDHA 4QBHA 1GR0A 3RLFA 4KXQA 4B6PA 1JLRA 2ETXA 2ZBGA 3H8SA 3L7DA 3S44A 5T41A 2NX2A 2HUPA 1HE3A 1ICIA 5D5HA 5AUNB 3PQEA 1M9NA 1NG9A 2GZMA 2OQRA 4U9IS 1VBNA 4FGWA 1P9NA 2GK4A 1Q0LA 2PKQO 2WFZA 3PFNA 1L7PA 1NI5A 3OM0A 3PD0A 3KZOA 3W8DA 3V4FA 2XPCA 1HLFA 4TTRA 1XZMA 4QHSA 4EQ6A 2PJZA 3AHCA 2RMKA 1X14A 1JDBC 3CIFA 1II0A 1CFZA 5FL3A 1G4AE 4D3FA 4KFCA 4HDCA 4QU9A 3AC0A 1BKSB 4AZ0A 1X1BA 3NTOA 3DT9A 5A9SA 4RTQA 1NKVA 3RYCB 4XB1A 2H92A 1HETA 3OCYA 1NWHA 1ONPA 3AF0A 2Y0EA 2FOXA 4BWGA 3E53A 2NU8B 1IAQA 5ALMA 1VL0A 3IEUA 3KUCA 5DM60 4E2ZA 3QLTA 4PCUA 2ECQA 2FE1A 5HIJA 1MXHA 2C9OA 4A6DA 4EYQA 1EX9A 2X5KO 4G0UA 1PJQA 3GEIA 2HQ1A 4DM3A 4S1PA 4NI5A 1EVZA 3LCRA 4HMQA 5CUQA 1X0VA 3VR3D 1UEJA 4ARIA 1EHYA 4XIGS 5GV8A 2IDJA 2CLLB 2IZ7A 3M6FA 1JKMA 1KORA 1ZP6A 3OQBA 5AJYA 1W6UA 3F7OA 2EJTA 1P8AA 1AE1A 2VTBA 1YQEA 4HUQB 2DHRA 2ZUDA 5MN6A 4GKKB 3KE9A 1RLIA 2FDRA 1XDDA 1G7TA 3SOZA 1SKYB 1EE1A 2UXBB 1GV0A 2AN3A 2O0KA 3WAJA 1C29B 1D4OA 2HA5A 5DM4A 3WZ2A 1MT3A 4J3JA 4TSRA 1IYZA 2Q8QA 2F62A 3A7DA 1F14A 2GM9A 4LYFA 5HPYB 2FFRA 1VHTA 2X0JA 3DZGA 3RVRA 4ZK6A 2WIFA 3GLFE 3KEFA 1OSNA 1GPDG 1QH1A 2VZ0A 1YZGA 3O26A 4DCJA 5EJ9A 2FPPA 3ANYB 4C07A 5JYEA 2XUPA 1H2BA 1IIRA 2VH2A 3J7TA 5FFFA 2HO5A 1S2GA 3L8CA 5IARA 2FWIA 3KR9A 4HX9A 2ZJ2A 1UL1X 1USWA 2ZYSA 3LX6A 2AN4A 1WDMA 4OYHA 4BOYA 5JFGA 1NW9B 1ZS9A 2GYVA 4NAHA 1KZ4A 4MQFB 3V1MA 3IMFA 1TC1A 3L0OA 5ARCA 2FF5A 3L4EA 5SY6A 3PJEA 2NXJA 2AI1A 2OKGA 5FPKA 2GJKA 5K3FA 1L4NA 2NVUB 3UJ8A 2VKQA 2G0AA 4HTAA 3L43A 1ZU5A 3GELA 3ENQA 1KMHB 4PZYA 4QXOA 4Q3AA 4R8LA 1T4CA 4MUFA 2QRHA 4J16C 2WIAA 3R5JA 2NQ8A 3A04A 1LXCA 4LE1A 2RGRA 2CF5A 4HZUA 3ZWNA 2O2DA 4W5JA 4PLYA 1O87A 3FYUB 4N3CA 5HFJA 3PUHA 4M7WA 1Q57A 2IF0A 3HRIA 5JW6A 3QU4A 3S2IA 2C4KA 1ZRNA 1EFLA 3CGGA 4F9GA 1PEAA 1T9GR 2E4YA 1BS9A 5FWAA 1XZCA 3PNOA 3K1JA 2KBFA 4G5GA 4RIHA 2UZAA 1V3QE 2IXDA 3PIIA 4KIUA 1J0AA 4A5OA 1M6NA 1XZKA 1K7CA 1ISGA 1TM7E 5JHGB 2Y4OA 5EKTA 1PW5A 3AZPA 1L6RA 4MCHA 3L01A 3WKCA 3X44A 1JHVA 3M2PA 3LJKA 1VPLA 2XMDA 3HO6A 4YUAA 4HAXA 5ITVA 1QH1B 4BVAA 4RZHA 1KI6A 3QVWA 4I9HA 3OIDA 4Q3EA 4XVHA 1FJXA 4XWYA 5CMLA 2QPTA 1XNHA 5E1DA 2OE2A 2LPMA 4WXMA 3SFTA 4TYQA 2EWWA 1CFJA 4TZTA 5IJXA 4DLKA 2DFTA 2WYIA 5EXXA 3GT4A 3MAJA 4HDRB 3DH0A 3ECAA 3RTBA 4AN4A 1UJ2A 1SCBA 1VP9A 2B78A 5G3ZA 4DC9A 1E60A 1PEKE 1M5TA 2BTQA 4WOCA 5ITWA 2EFYA 3BPSA 4RD0A 1Z3IX 3E5HA 3P0IA 1W2HA 4AS3A 1DB3A 1X92A 2R00A 3C1UA 3CC8A 3RODA 1FIUA 2H08A 3Q8XB 1R4ZA 2I2FA 2A30A 4QYTA 1T4CB 2R5NA 1USIA 1IJFA 2OM2A 2PNJA 3LA8A 4QOSA 2EEZA 3WGJA 1TMYA 4B8WA 4CCAA 2R66A 3A8TA 1Y3BE 5DNDA 1BVRA 4I8XA 2J9GA 3KLMX 3L79A 4QDZA 1L6IA 4Z4IA 4YWHA 2ERYA 1GZ4A 3UMVA 1S9HA 5DN6D 2QLTA 3ELWA 3FPGA 4LY6A 3FSGD 1U7UA 1FXWA 1TNDA 5JCOA 1F7VA 2Q6KA 3O8DA 1EWTA 3ROZA 4ZYUA 2IEDA 1HV8A 2FZVA 2B99A 3JU3A 1PTJA 4LJ9A 4URUR 4WLFA 5IVPA 4RPKA 2ENWA 3IBSA 4HI0E 3R09A 1J2YA 3ENNA 4KPUA 2O57A 4B48A 2R48A 5LN1A 3B9BA 2WHRA 3MHTA 1CR2A 3UZUA 3BUSA 4CU5A 4TV8F 1CQZA 2VP5A 3SKVA 4U7DA 3MUEA 1MQAA 4JJZA 1CB7A 4YNBA 4MJXA 1U8AA 3R3VA 4X97A 3A10A 1CUSA 2P6NA 3R4CA 1U9CA 4C04A 4YO8A 3H3FA 1CUEA 3RVLA 4Q7QA 4RZUA 2G1UA 3C0KA 4FP9A 5TC4A 1V4VA 4LRXA 4PHCA 3RG8A 1E2QA 1TK2A 4M9RA 2BTQB 4MR9B 1D4FA 4D1YA 3NHWA 3R75A 1IMOA 1RVDA 1SR8A 4EG3A 4W7SA 4KGXA 3QMPA 4GGMX 1J8YF 4PAQA 3RD5A 3OIWA 3MWJA 2W6NA 4R71A 1QDLB 4LPKA 4R4JA 3A1NA 4EPTA 3UJBA 1D2HA 3MT0A 2EZ8A 1JNYA 1X8XA 5FBZA 1KJZA 2VHXA 4Q6BA 3UGQA 5AKZA 1NI3A 4CTOA 1GTSA 5ICGA 3MELA 1G17A 3ZE0B 4UDXX 1CNEA 1K08A 3G2LA 4S1TA 3LPMA 4YRPA 3EXEB 1E62A 3T7DA 4KXWA 1BYIA 2FEAA 2ZB3A 4K81B 5TPWB 3RABA 4F60A 3T4EA 2P27A 3CUKA 1GQQA 4CT4B 4NEGA 4EZIA 1OH6A 3M5DA 2WI8A 3EPLA 4HLCA 1FDTA 2JCSA 3KUXA 3LGSA 3AUKA 3MT9A 3ITKA 4ZT6A 4LXIA 5GOTA 4UW9A 3IUYA 1EUDA 2H17A 1DEKA 4XRRA 1RFLA 3IUQA 4JOBA 3ABOB 5D8DA 1DQYA 3QUTA 2H9IA 2ZSAA 1DKPA 2YXNA 4MR7B 3TM4A 4H1TA 3WFJA 1O9HA 4EUEA 4MHOA 4CLEA 4P58A 2IYEA 4GZ5A 3TTWA 4JVSB 2VA9A 5ALFA 3W3AH 2VT3A 2JIZD 3RC1A 4X65B 3BDIA 1Y9EA 1XJ5A 5HSGA 3DF7A 3WGLA 1SBIA 4KHZA 3V8PA 3PBKA 1AHIA 2QTWB 3NH9A 4JP3A 4N0DA 4D6YA 2C2MA 4TWZA 3IUSA 3CLSC 1XEWY 1WMAA 3WICA 3OTOB 2IYUA 5CT9A 3KZKA 1DC6A 3MQ2A 4EHLA 1ECFA 3CF0A 2W00A 2R1TA 3DUFB 4L8WB 3ZHYA 4OY3A 3GFFA 2A1UB 3IP7A 4U2GA 8GPBA 3B6EA 3DZDA 1TUGA 3G2QA 3RRNA 4CT0A 2XOEA 5F1PA 2CT8A 2G1PA 3I76A 2C9CA 4JKOA 2VTKA 2JFWA 5G1OA 1RHQA 3D81A 4N18A 3QOYA 4CZ2A 1CZKA 2XDAA 3DZCA 3ON5A 1ZC4A 3GNLA 4PPGA 1KSGA 4ZREA 1OT5A 3B8HA 4W1QA 5JISA 2BFDA 3BTSA 1LZLA 1ATZA 2FPIB 3L0PA 3O3OB 1UFKA 4EGQA 2BYTA 1DDIA 1MCZA 4HN4B 4NC9A 1N8NA 1QORA 4QBGB 2V7EA 2Z0MA 1BQ3A 3RV3A 3T1QA 4DHWA 2R8XA 3KKEA 3MVEA 3OFKA 4NBUA 5BWLA 1CUYA 3FHOA 1NFRA 2Q3CA 2WHXA 2QM8A 4KMOA 1AXEA 2ZCVA 3K9BA 4N03A 1FSSA 5H70A 2ZSEA 1VPTA 2QMUA 1TCVA 1ULHA 3MT8A 1QJ4A 4ZO7A 2HHJA 5B1SA 4WY5A 3A6PC 4XOIA 1J8DA 4CLDA 2H0AA 4DIKA 5L3QB 3H4IA 4OK3A 3A1FA 5AUOB 4NOKA 1YK1A 1BJTA 1CUCA 3NP7A 2V9CA 3TK1A 3DVAB 2CVPA 1SUIA 4F2HA 4CCYB 2V7GA 1CY7A 1BD3A 1I2CA 4TTJA 3RB8A 3RS2A 3E18A 1DAIA 1R0ZA 3LQ4A 4L4RA 4ND3A 2FSFA 1EFPA 5DW3A 2ZI9A 1J90A 3CPEA 3PC4A 4G56A 2WAOA 2V7QD 3G89A 5IEBA 4CL0A 4TXMA 1ZCAA 3EAGA 4R1LA 4PY2A 1EP2B 3T4PA 4XJVA 1VIAA 1VE3A 1NRXA 3PICA 3T9BA 5KVAA 2D54A 2O7VA 3UQYS 4DCMA 2FPIA 1RJ9A 2PX3A 4MOWA 3EQZA 3G5UA 1Y3FE 1I1QB 1LJUA 1R0WA 1TI7A 2YW9A 3HYSA 2GS9A 3ENZA 3MWDA 5JIBA 3LCUA 3I4CA 3C5EA 3L8ZA 5A03A 3LW8A 4GLOA 1NN5A 1M8KA 3QBVA 1Z82A 2PX5A 1TF5A 3NAMA 5DDIP 3GMIA 5FO1A 5ILGA 3ZD9A 4DIMA 4QU8A 4BO9A 1NE7A 1DC7A 1UWLA 1DJLA 3L7CA 2IA5A 2PGIA 1KZ6A 1YJQA 2FRDA 2H5IA 2PZGA 2YV5A 3B85A 4H15A 3ZGXA 1LKZA 4EIWA 5EQTA 1ES9A 1WXHA 4ER0A 1CQJA 2BMVA 3DQZA 4MB6A 1QGUB 2DPLA 2J3MA 2NZ8A 3G68A 3VH4A 1T2EA 3NHPA 1FQJA 1MA3A 4ZTUB 3L8YA 4HAZA 5D84A 1KQPA 3HU1A 3H1TA 1ST3A 5CFRA 3LQYA 3TB6A 1W85B 2FEMA 5DLPA 2XUQA 2J5BA 4LIPD 2NSYA 1AF7A 2DPYA 2O3JA 4GL4A 4AYTA 1FFHA 2PH3A 5EN4A 4R9VA 2XBLA 4MVJF 5KYYA 1TQ4A 3EULA 4PM4A 2PKEA 3L0BA 4OHRA 4B8YA 1DXHA 1MB4A 5FLKA 3MJHA 4ZZ3A 3E4DA 4JJ7A 4O2BF 4RJTA 2JA2A 1JQBA 3D1VA 4ZVMA 2BOVA 1BAPA 1QHXA 3UWMA 4BAZA 4CM9D 2ZUSA 3QLUC 1YE5A 3NKLA 4WADA 3R9WA 4ZZIA 2JLRA 4HAIA 1SHJA 2R79A 3G9UA 5ALWA 2NU8A 4TM8A 2WYUA 5IWAB 3KB2A 1T0BA 4H1HA 4ZOLB 1DJNA 2BI4A 3P9CA 1P3Y1 4Y7CA 1PLLA 1CQWA 2F2TA 2WWFA 2A0WA 2JDIA 1JLLA 2FQWA 2HEGA 5FADA 1SXJD 1TX4B 3L6UA 3QEBZ 3ETEA 2VHWA 1AM4D 1S3IA 5CCEA 4CTNA 1E6WA 2W6MA 3QVVA 1MGPA 3EZLA 5JMWA 4KPGA 4RZSA 5G1NA 2OKCA 4NH0A 2BHRA 4M22A 3WADA 3HY6A 4GE3A 5EWMB 1PHPA 1ZZEA 1HZZA 3WDMA 1WPGA 1G7CA 4FZ3A 3UJNA 5GONB 4QXRA 5LPNA 3OZDA 1EUYA 4IDEA 3C3AA 3G0OA 1M6HA 1L9XA 3FJOA 5G0WA 3EGXA 5FTMA 2QTNA 1V7QA 1G4UR 1WCIA 3MCAA 5T4EA 4ZN6A 2B0JA 3P9SA 2BGUA 1VI2A 1Y63A 3INGA 4GGPA 1ZO8A 4R8VA 4V2UA 2VF5X 5CVJA 4CU2A 2FMTA 3HWSA 4HFNA 3DE1X 2NZVG 4HH1A 1BNCA 3T1YB 3CRW1 1UT6A 3LO5A 4BN0A 2PUBA 1J33A 5F5XA 1GRQA 3F2VA 1TEZA 1V4BA 4PC3A 4DJEC 4HWTA 4CIYA 1S4QA 3I12A 3ZVLA 3PDHA 2XD9A 4W8HA 1HL7A 5KCMA 2IZ1A 4DMUB 1VB3A 1W36D 2VWQA 2P9CA 1SBCA 3BFJA 3MSXA 1WU7A 2ZRCA 4GMKA 1PZEA 2CHUA 2GLTA 2H4FA 5E6RB 4ZVUA 4ER7A 2ZZNA 3P0FA 5IZ4A 3OZGA 3H1PA 4GGOA 2C7GA 1QG0A 3HSKA 3JQEA 1M2HA 1BS2A 1T9ZA 3H1GA 1DUVG 1JAYA 2YY7A 4K0RA 4M37A 3AONB 3QPCA 1V71A 4R2XA 3A11A 2PX6A 1QZTA 1XEXB 1WHTA 1US8A 2GO7A 3LUFA 4WKBA 1Z4KA 5IANA 1A8PA 3QW4B 4DGSA 1ZD1A 2ALJA 5AJUA 1YDHA 1XCLA 5CB4B 2R8PA 3E2PA 4RV9A 3C3JA 4ZRDA 1SURA 3JATA 3TLXA 3GUZA 3NBMA 1OTXA 1O08A 3WJAA 5TQ0A 3TL6A 4DJFC 3OOHA 3KOWA 3SDSA 1JZTA 3MILA 5J4VA 4PFQA 1RXSA 1N77A 3GUCA 4YJFA 2C04A 1KOJA 2JZNA 4RNDB 1KAMA 5GZ6A 2UYYA 3U7EB 1ZWLA 1GXSA 4EDHA 4GAEA 4FT2A 3CUWA 3W0LB 3QE3A 4NEQA 4YCCA 1FUYB 4B83A 3PQ3A 1M2KA 5F9FA 2QZZA 4AW9A 3P5BA 1CZNA 3IYLW 4Y7DA 1N0VC 1TCAA 3ORYA 3QE2A 4XD7A 1LSOA 3W6NA 4NICA 3O8QA 5CYPA 3SX0A 3PWTA 4IFIA 3TVDA 4OI0A 2QUHA 1D2EA 3W1WA 4B0PA 1Q15A 3WIVA 2QDKA 4WA7A 3O95A 3BHIA 3EXIB 3JVDA 4KLCA 4DMLA 3GRRA 2XYGA 2G4VA 1GKYA 2ORED 4KDCA 4ZDJA 1YMQA 1QAOA 3IULA 3G2HA 1NVEA 1TXGA 2OQIA 2IVZA 3AZOA 3CWZA 3H75A 2ARKA 4L8GA 1V7CA 4PGAA 4XQCA 1V6CA 1FTYA 2EEPA 1YO6A 5CK4A 1AD2A 1HYGA 1ZY2A 2C92A 1U1IA 1ZSYA 3FNRA 3H5TA 3P71T 3QTLA 3R0VA 3QYPA 1W581 4CKZA 1PV2A 1T0JB 1D1QA 3H8JA 4J0JA 5BNWA 3NHAA 4GM4A 2VF2A 4FHFA 1VYHA 4X92A 3WAKA 4RCZA 2ECPA 2H3EA 2O2YA 3PKZA 5A3RA 1MX9A 2W6OA 3HJTA 3MG9A 2PIAA 3Q3HA 5J2TB 4X71A 4N5HX 2DX7A 2AHOA 2W4IA 1GVNB 2FMFA 4V0LA 3OCVA 5BN1A 1RBYA 1YR6A 2YOGA 3W06A 2XY4A 5BV8A 2X3UA 5DNUA 3V9AA 2VPIA 3FTFA 1G21B 1HFEL 2PMFA 1IHOA 3KJFA 4AKSA 4BJ6A 1KFJB 2Q5FA 1JIQA 1Y98A 2VWGA 1T0IA 3NT5A 3R5TA 1PYOA 1WVMA 4PC6A 2C5HA 1CX9B 2D8AA 3I4LA 4Q7MB 4R1NA 1CEEA 2CYCA 3TXYA 1ZJZA 4N49A 4UOZA 5I7VA 2GRUA 1B8VA 2RHWA 1QS0A 2Y1DA 3K0BA 3SZRA 1Z62A 3T4UA 3MMSA 4UNSA 5CTJA 3G8CA 5EIHA 4ZQGA 1L5GB 2DXIA 4V0QA 1DRVA 2NADA 5DT2A 1RM5A 3GUVA 3T9FA 1XROA 2AWOA 3CLHA 5KNCA 3F7MA 3RS7A 5HRAA 1W87A 3GEHA 5JZVA 2YH2A 2DKFA 2KSQA 2WZDA 5D2CA 3RTCA 5FOQA 2EGUA 4EJSC 3UAGA 5AW3A 1WO8A 2EV9A 1HI9A 3TLGA 5FNVA 1U5AA 1BGWA 1ZD2P 2WF9A 4B3JA 4Z2YA 2WAXA 4Z3KA 4JP5A 3C74A 3ED5A 2J0VA 1H2YA 3EVDA 3CZCA 4GX2A 2ZTSA 4U0JA 2Q5QA 2GKOA 2OB1A 2Y1KA 3GO4A 3ZWMA 3H13A 3IP5A 4M7PA 2RCYA 3R7SA 5HIAA 3QA3E 3I6MA 3KYIB 1N2CA 4MUJA 4WACA 4C43A 1AS0A 5A7HA 1M34E 1P0PA 2BDTA 1JU9A 1P7VA 2YWJA 2TMKA 4IXWA 4JUAA 2A4KA 4EZBA 1TTHA 1VBFA 1WPRA 5JQGA 1U1GA 1GPMA 3BL6A 3KT3A 5ITZB 3PHJA 2NO6A 3AVPA 2ZSKA 1Q95A 4IEEA 1OB5A 2JHPA 2H00A 1QAQA 3KAPA 3UYLA 2FJPA 5HM6A 3ET5A 3FJ1A 4EJFA 3QFFA 2DPXA 4WL0A 1N8TA 3P2JA 5HM8A 3ZVMA 5IM4A 4B82A 1NVMB 4ZAFA 4K8OA 4MZXA 4G41A 3H05A 3G49A 3G2KA 2QTZA 2WG0A 5NULA 4FINA 4TSFD 3LC1O 4P08A 3ZE9A 3ZU6A 3GLGB 4F1KA 4ANFA 5BSHA 3QPVA 3BRWA 3HL0A 2NU9B 3A4LA 2VUIB 2EJUA 5A6VA 5BNFA 4ZYYA 4R83A 3HEBA 2HH9A 1K7YA 3WRXC 1CE8A 5EUQB 1VPWA 2CSXA 4CKEA 1Z3CA 3AKDA 1Z45A 2FPGA 3CYFA 4IMPA 4FW8A 4PO8A 2B6NA 1YJ5A 1CHNA 2PUJA 3OT1A 5BMVB 2VDVE 5CJJA 5CG1A 6CHYA 3PX7A 3C45A 1I33A 1EFKA 2FTKE 1FFEA 2V03A 3K6SB 5JS8A 5EE0A 3Q1LA 2QYHA 4XJSA 4W5OA 5KYKA 2AUTA 2OV2A 2X0DA 1PAUA 4DM4A 1N57A 1D6MA 2UDPA 4ND8B 3T5MA 4EG6A 1XRMA 2VUUA 2Z04A 2ATVA 4DCOA 4EUSA 5AOCA 5J2UF 2EIHA 1EG2A 2JAHA 4ER6A 3U4DA 3RYCA 3AUUA 3HCWA 4YWJA 3R7NA 3W3AA 1ODSA 3PYMA 3GFRA 1II8B 2IZ0A 3L7OA 4JBHA 4A8JB 4ECEA 4XRGA 4ZGWA 2WF6A 1EINA 1PNTA 5KPDA 1WQ3A 4Z3DA 3LGAA 3QFRA 3L02A 4TLAA 4B71A 4X61A 3U3RA 3IJRA 1XWFA 4BXOA 1K9VF 1E64A 3UJ9A 1T9DA 1WA5A 2HMUA 2IYAA 1QHIA 1GNTA 1SIUA 3MOSA 3KQVA 1ZIPA 4XPZA 1FXWF 3R8FA 3DTNA 3GBPA 4MAMA 1J07A 3VR1A 1ZL2A 3DNMA 1EZ1A 4HDKA 1LWNA 2VP2A 3P0EA 2FYTA 2HIGA 4OXYA 2Y0BA 2ZAMA 4MKXA 4S05A 5JTUA 2D5CA 1N6NA 1RRVA 1NONA 2Q2VA 2B21A 1P7PA 3HYCA 3OIFA 1Y4UA 4WN9A 3WFZA 1RQXA 5DNCA 1KMMA 5BV2P 1BKYA 2JD0A 2PD4A 2Q8NA 3IP1A 3L93A 2PANA 4UTOA 5EKSA 1KEEB 4DLAA 3A9UA 3TDKA 2JNWA 2GA9A 3E22B 4JQYA 1DIRA 4ETNA 4YGYA 1KRHA 2JCGA 5AXAA 3FHLA 3C39A 1CS4C 1FS4A 1USVA 4KVFA 1U0FA 2VVTA 2P9BA 1ZPDA 1A8HA 4GUAA 1OY1A 2FPPB 5DGIA 2RSLA 2XITA 3PFCA 1CS0A 3OLZA 4JVNA 1R6AA 2A7QA 3KBBA 2YMMA 1R4NA 4R68A 3N7TA 2B35A 1RCFA 4B33A 4YQFA 1V9CA 2QB5A 5AKIA 3MIZA 3RFTA 2VEOA 4Z54A 4ENWA 1M0WA 3U5ZB 2OXTA 1UP7A 2AXPA 2EQ5A 5JCXA 2HF2A 3H9UA 3IP9A 1EMDA 1E1QD 5HF9A 5CA1F 2GK7A 1A4XA 2PH1A 1WHSB 4KAJA 3ESAA 3PL5A 1P45A 2O8EA 3NQ41 5AI6A 3HM2A 1JHPA 1K98A 1WTCA 5H8WA 1PL7A 3CXUA 3CTMA 2M6KA 1WUJS 3PX2A 4JUBA 5JUWA 3RE1A 3ZD6A 3OM8A 5EJ4A 1K97A 2XOXA 2GN4A 1GA6A 1LBIA 5BN5A 3CPHA 4O4HB 2ORVA 3I2HA 2EWMA 3LLVA 4MRVA 4DLSA 1PP4A 5EIFA 1E7MA 1Q1GA 1Y5NA 5IKPA 2UZ3A 5MGBA 4CM4B 1DT3A 2GBPA 3BCSA 3T3PB 2SBTA 3TQSA 3L07A 3WL5A 4DJJA 1PQ4A 3UJHA 3CISA 4UPDA 1PVOA 3UMJA 2KB0A 3G1UA 4PYOA 1KEWA 3K9HA 5I3CA 3ILHA 4RULA 1WB6A 3FWZA 1XUOA 2MR6A 5TQJA 3VNSA 2QYTA 4FCCA 4ZMRA 5H4GA 4UBKA 4QFCA 4F21A 4JR2A 2J0UB 3O73A 1YRLA 1FFBA 2Z8ZA 4R6WA 3KPWA 4TKUA 4XLTA 4EW3A 3RU2A 1S3SA 2BBWA 2I22A 1X15A 3CNEA 3X2EA 5FUVA 3BJEA 3WIDA 5IPFA 2XE7A 1ZH8A 1PRYA 1EM8A 2QJTA 1TKBA 1GCUA 2CNDA 3RIXA 2QD3A 4JDUA 1FMCA 3ONNA 2L17A 4X6XA 1OXKB 1UOEA 1L7AA 4XH9B 2O8NA 5FI0B 3ZW9A 1BQ4A 3WFIA 4R05A 1C3EA 2BKUA 3B6MA 2ZATA 1WD5A 3B82A 4RSRA 2CL7X 3B5JA 2O8EB 1S8OA 3U4CA 4D3YA 1Q1EA 1CUVA 1P5RA 4HR7A 1XA0A 1UBEA 4Q1DA 5ER6A 2DVMA 3GB9A 4TXHA 1OBFO 2OFFA 1ULBA 2NZWA 2O2CA 2HSDA 2VPPA 3CJRA 3IP6A 4XGIA 4Z4HA 2ZEJA 1JHYA 3D5QA 3M82A 4B3BA 2VDJA 1XFAA 1XVTA 3K4HA 3JQQA 1E77A 4NZOA 4UZFA 5DEOA 1E0AA 3H8WA 1U7PA 3BCUA 4AFNA 5HK8A 3ND6A 1T13A 4IDPA 3CW9A 3LX5A 4ON9A 1TD1A 3NB0A 4JCOA 4M4SA 1D6SA 1WSDA 3O83A 5EMHA 4ZHQF 5G40A 3AKZA 3IP3A 1X2BA 2Q5HA 4AMZA 2VKTA 1AB6A 2CK3A 2G08A 1NXPA 1QPBA 2R6HA 2WG2A 2Y66A 1KNQA 1EFRA 1E3IA 1DKUA 3ZEIA 3GPBA 3RRFA 1UBRS 1OASA 1VIDA 3GH1A 4IRXA 5E4FA 2QWXA 1ISHA 4XM2A 5DBHX 5LQKA 3TGLA 4ED9A 1TAUA 4HWRA 4DXHA 1K8YB 4L07A 2NAFA 2ZE7A 5HCUA 4DANA 4G5OA 4DV2B 3VR6A 5KCZA 1GZSA 3BXOA 3PCRB 4REOA 4U02A 1QU2A 1DOAA 2FPRA 5HIIA 1MIOA 2H2WA 3LIIA 5ILOA 2PH7A 2QN1A 1ZRHA 1C1DA 4O5OA 3OFVA 2C3UA 3DBRB 2EX0A 3EZ2A 5F77A 4ZV7A 5EHGA 3ESCA 5TT0A 3IRUA 4DYHA 2PU7A 2V7XA 2NPFA 4IAOA 1U5BB 1V1MB 4BNGA 2PT9A 4AQDA 3TJMA 3TMAA 1YFLA 1A8UA 4WSOA 5C8YF 3WJ1A 4L9WA 1OPXA 4TKZA 1ZKDA 4Y6LA 2ODNA 1L1RA 3RAFC 1JEQA 2XTNA 4U7HA 3V97A 4DWVA 1S2IA 5C5IA 2QRKA 2A5GA 3T54A 1GCIA 3S68A 3UKOA 1FNBA 2PL3A 3I0ZA 4N41A 4N5NA 3PQDA 2P9QA 1F6BA 3ZNOA 1KYIA 2PZBA 3KQQA 3THXB 3TX6A 3MYRA 4FMCF 3SHVA 4FPXA 3SC4A 2OK7A 5IC6A 1NPTO 3FR8A 3PTZA 3WRVA 3ZY3A 2VLBA 3GXOA 2CUTA 3CLUC 2VTDA 1AURA 1YBMA 3B60A 1K4MA 3AR9A 3NHJA 4S1OA 2UUAB 1B0UA 4BO1A 4B6FA 3WRYC 4DIUA 3VHXA 1RU3A 4E09A 1TJ4A 4RA9B 3NBXX 2JFYA 2R84A 1JE1A 3IV7A 4TT8A 1FVFA 2HJRA 2W6JD 3K16A 4KWEA 4P93A 4BZZA 2Q9AA 4II2A 1L7NA 4PQEA 3AF1A 2P2NA 5BNZA 1ZQ1A 2G8NA 4P3OA 4RBNA 4HSGA 1MVOA 4UBOA 3SDBA 5A1TA 4PPFA 3QZUA 3LG2A 3FWHA 1TF2A 3M6VA 4TZ0A 1D2NA 3B8EA 1FOEB 3BMCB 4J2TA 3GRYA 2I7DA 4JMPA 4DSTA 1RRCA 3AF6A 1OWNA 4WKNA 1I32A 3IT2A 3BYZA 5K5EA 3SP1A 4OXQA 3HTXA 2ZSIA 5LIRA 1KK2A 3E4CA 5K2MA 5JEEA 4P5EA 4QECA 5DI3B 2UUBB 5G0SA 3G9TA 1NU6A 2C5LA 2YL2A 4X94A 4V1CA 4TOIA 2X0KA 1CTQA 3TQIA 3W4KA 4B80A 3CKMA 3V33A 3OPQA 3IVMA 3DP9A 2PEZA 4MWZA 4ZRNA 3PI6A 4TS4A 3AESA 2YJTD 4JQZA 4PS0A 4D42A 1X7YB 3I9V1 1COZA 1D07A 3FLEA 4XGQA 1VMEA 2YRXA 3MPOA 1JQEA 3UGJA 5FBVB 4KREA 4ZI7B 3FD8A 1LK0A 4JI1B 2IBMA 2HRQA 4HGOA 2EJBA 5EJ6A 3RVMA 2HCRA 2WINI 3OHPA 1BMQA 4UMFA 5K4AA 3L1IA 3VI4B 5LDDC 2GZ1A 3PQFA 3A05A 3L8GA 4HGYA 3QXCA 3GJ0A 3R0XA 4M0KA 2FR0A 4MYCA 5EIAA 3ESRA 5EYPB 4DGQA 3OICA 3C3KA 3OQVA 4MGZR 4BBJA 3UYKA 1LRJA 1R0YA 4K2HA 1GGFA 4HJRA 2VPQA 2XXAA 3KQMA 2C7RA 4P38A 2NU6A 3IB3A 3HB7A 3N2NA 3M5WA 4O8ZA 1UWCA 1OBCA 1ZMTA 3DW1X 3D5EA 2ORYA 4DBZA 5A4JA 5KO2A 4YXFA 4CMKA 2C07A 5BOVA 4ZO9A 1DEHA 5F1OA 2OBNA 1XTIA 1P0CA 4BATA 3A0UA 3WYCA 5I47A 1NVUQ 4OQNA 5FRDA 1NDUA 1K9SA 4KOEC 1JLSA 1R4MB 3CVVA 4HY3A 3KQTA 1UKBA 1PFWA 2YWBA 4TQGA 2XT9A 4JEUA 1XMQB 5K6AC 3B1VA 2NUTB 1A5TA 1G3UA 3NORA 1C3OA 4O1HA 4XR9A 4Z0HO 3VXKA 4ZZ1A 1MAHA 1UZAA 2GVNA 4LOHA 1IXYA 3ESBA 4DILA 4PYRA 1XJWA 1ABEA 2VATA 1OC2A 2D1QA 1YGPA 1BCRB 2OAEA 1EX6A 1DAFA 5A6SB 2JI6A 3DOIA 1CXZA 4WBXC 5ITZA 3KJIA 1RXYA 4C89A 4MVWA 1X94A 1DG9A 2AN1A 3AOEC 3ONVA 1P7YA 4DZRA 5FD8A 4XWKA 2OVFA 2TECE 5C34B 3IH5A 3K8ZA 5CT5A 4Q01A 1SVWA 1ZNXA 2RGXA 3S2YA 3D4LA 1QM5A 5ITSA 1XHFA 3AFMA 4ME6A 3RKRA 3G5LA 3KR2A 4OOEA 3PUJA 1CEQA 2XNKA 4ZQIA 3IQGX 3R6TA 4A03A 3DKIA 3DAOA 3QLEA 6ABPA 5GJBA 5B1EA 3V3KA 5HA5A 1FX0B 4JLJA 2JRLA 3W8EA 2RGDA 2WKSA 2YJNA 3UNXA 2QE7D 3HLTA 5ISMA 1VE1A 1UJNA 2Z9CA 2RHHA 3SZMA 2FSVA 4L9AA 5FI1B 4RSHA 5AQEA 1Q1ZA 5DLDA 5KTKA 1N25A 2JEZA 1XXLA 2Z9BA 3T3MB 5JRZA 1UJ5A 4FEEA 4PZEA 4XTCS 4WIAA 2ES4A 3VR3A 3W9SA 4DV0B 2QROA 2IHUA 4GPEA 4B9EA 2G83A 3B1JA 1SXJA 3IAEA 3ZIUA 4JI2B 4U1RA 3UOAB 1XRSB 4K5QA 3UB4A 2M98A 3AWDA 4F2WA 4C14A 1RXWA 3G1TA 4B3XA 1G5IA 1Z39A 2FSGA 4QDOA 1ACLA 3RVSA 3CKYA 4RFVA 5HG0A 4MB2A 1KJYA 4LGCA 2AOWA 4JI6B 3ITDA 2AX3A 1LSJA 2UXDB 4KI0A 1LDEA 2HO4A 4FE4A 2IBSA 1NVBA 2C3PA 5IJ9B 1NY5A 5F1YA 1U2RA 1EVKA 4F2GA 1HDYA 2JHGA 1IOZA 1XEWX 5ERXA 4EO7A 1P1BA 1FUKA 2VCYA 1BE0A 3PE6A 2X77A 2WILA 5H68A 3OUUA 5KWSA 2XKKA 1E2PA 3A9WA 1NPYA 5E2BA 5BY2A 5C81A 3WL8A 3QLVC 2O2SA 5YASA 2HSZA 1M2JA 1PLKA 1EJBA 4DLUA 2HKIA 4JBNA 3TRHA 2GASA 5JCJD 2BM0A 2PO7A 4RF4A 2P5SA 3WLKX 3RADC 2W22A 2NACA 3AJ8A 3NFYA 2R2GA 3ABRB 4HATA 4HTFB 3D5TA 4XEHA 2VDLB 2EFGA 5DHPA 3T3IA 3ZHRA 3MGGA 5I7HA 5LQUA 3LTNC 1N0HA 3LQRA 5KWVA 3MFYA 1DP4A 4JLPA 3K2EA 5EJFA 3T35A 2I2XB 5L9AA 4ZANA 4YR9A 3JR7A 1E5DA 1WCIB 4CVNA 4KP7A 3KTAB 3UAZA 5KTOA 2ZPAA 3LI2A 5SYAA 2ADFA 3C4QA 3W5UA 2HHAA 4FCVA 1P6XA 1QO7A 4OA8A 1YIOA 3N3AC 1FXUA 3K5HA 4RCYA 4IHJB 3ZU4A 1XELA 1ZD8A 1J2JA 4D8YA 3E58A 3S4YA 3I6ZA 3LNCA 3FVRA 4C20A 5LM3A 5DCLA 2QRLA 4NENA 3GG2A 2ROQA 4G1CA 4C6RA 3OFJA 1OVGA 2UV8A 3H84A 1OHHA 1W1IA 2I3BA 5CIWA 3MB8A 4Y1RB 3SXUA 4IVQA 1PLJA 1YS7A 4I99A 4XPIA 3TFWA 5A7FA 2WIDA 2D74A 4N48A 3RWMB 5D3QA 1UDWA 4RHTA 1B26A 3EZXA 5EZ5A 5GWXA 2VQ6A 3F3KA 3ZDQA 4AJKA 4KWHA 5CCXA 1QQBA 2FZ5A 1VMIA 1KRWA 2B4AA 3VU1A 1IIBA 5GZ3A 1J25A 2CKMA 3SKXA 3ZH2A 5ERGB 3V8EA 2QAJA 1UBSB 4LI3X 4J2OA 4MA4A 4Q3OA 4E32A 2BGWA 4C4ZA 1ZINA 1C4KA 2C2XA 1DINA 3NONA 3GP8A 2OBXA 3IMKA 5AK5A 4TTSA 4DNQA 2ZFUA 3RCBA 4CM4A 2O8CB 4B3CA 4EO9A 5IH7A 1NBOA 2CLSA 3LKVA 2JCYA 5JMPA 3VZSA 2MHCA 4W1PA 1KYQA 2RGUA 1WZ2A 1SRRA 2JGDB 3LHDA 4K9DA 1E2NA 1SH7A 4XVUA 1E3SA 3WNVA 1JXOA 4K6OA 5IM4F 2P7IA 3FI9A 2PZAA 3OD5A 3EMDA 4YT8A 5E6SA 3WP1B 5B2EA 3K9NA 3PR3A 5TR9A 3BFKA 3ZZ1A 3BB3A 1I4DD 3VYRB 4IPTA 3LOQA 3FDZA 1VL2A 4MV4A 4E08A 3GLIB 3OTWA 4TVKA 5B3JC 2G70A 3BXEA 3FKSD 3U7QB 5JARA 4GPBA 2V8OA 4HGZA 3BGSA 2RHGB 5IK2A 1B0AA 2DAPA 3FPSA 4OAQA 4BO7A 4C4XA 3FMIA 2J3IA 1WCXA 4EA9A 3MTGA 3EXIA 3GDOA 3QP9A 3VVBA 5E2IA 1A71A 1CQPA 1Y4AE 2WA2A 2X8WA 2NV6A 4PS1A 4UAUA 1Y6FA 1N9KA 3DE6X 4PBRA 4RDHA 2OPBA 3WNBA 4DMGA 4JYZA 2M6SA 1CY2A 4KXNA 3UV3A 3E9RA 1JDJA 1YCFA 4J7CA 1L7OA 4AIRA 4CKCA 3UWSA 1JLMA 4OXXA 3HYRA 2PIDA 3O9ZA 4N6GA 3P26A 1Q1AA 5F64A 3R8CA 5A5DA 3EXEA 1LS1A 5GQSA 1ADCA 4QJ3A 4AF7A 4HRVA 1RIFA 4CG3A 4MLCA 1DBIA 4YRFA 1TRKA 2Z8YM 3FOBA 4HXYA 4IY1A 3I6QA 3QUBA 1M2EA 1KQNA 3RARA 2YJ6A 1JQDA 3EPPA 3A36A 2HOQA 3Q15C 4KX5A 4UCFA 5KNCD 4YAOA 2IPLA 1Z16A 3VV3A 3KSRA 4KITB 5KINB 1XDGA 4GM1A 4MW6A 4W8OA 1SC1A 4ASUA 2W6QA 2WYWA 4WESA 3GLFA 1E5LA 1V6SA 3BFPA 1G6Q1 3B36A 3CJTA 4MYDA 5G0VA 1RZVA 3U7QA 1U7OA 2HK7A 2Q8PA 4V0KA 3P97A 1XDUA 2XECA 3HLYA 3FROA 4F3NA 1ULZA 2HU2A 1WB9A 4CMCA 4HNGA 4OLAA 1FUIA 3JV7A 4O5AA 4CKXA 1ODFA 2BW0A 4AECA 3B51X 1BJKA 4EJSB 3DUFA 3DYVA 4P0PB 4TV9B 1SM4A 2W2LA 4W6ZA 5CLGA 3HVJA 1EHIA 4LJKA 8AT1A 3QKWA 3JQFC 4KTTE 1G291 1JVBA 3NC4A 4LV5B 1SCIA 4FGKA 4LRWA 4Q9LA 3SYNA 2HIHA 3ORFA 4MWDA 2IQ5A 3B53X 3WZMA 3C7DB 3CW8X 2CFOA 4AZ3B 2P79A 3SLRA 3IIMA 1WCV1 1JJBA 2I4NA 4D41A 5DCUA 1S7GA 3QW2A 4ESHA 3LPCA 2AOUB 1AX9A 3JVIA 4CQMA 2MSLA 2NOAA 4ZOBA 4EG8A 3NHLA 4WVFA 5GAJA 3OD1A 2GCEA 2APJA 4FGSA 2GOYA 3HXLA 5CA0A 1L5VA 4CMBA 4V03A 3LPDA 3ME5A 4YVFA 1A5BB 1KOGA 4FDAA 2ATIA 4ZU6X 2H2FA 1P5JA 4BO4A 5FBQB 4ZV9A 1SOUA 5CNMA 2QT0A 1N3IA 1E2HA 2CHGA 3OOYA 2QZPA 4NBSA 4MI1A 1SO8A 1Z34A 2VT2A 3VISA 3VSAA 3DA8A 1KERA 2ZJ6A 1X7GA 3ANXA 2PZ8A 3PEWA 3A32A 4ZVLA 4K46A 2DR2A 5JD6A 1BHSA 2VDUE 2JLWA 2QX4A 3A6DA 5L3QA 3ZJTA 3RWOA 1IMJA 3KSZO 2XB9A 1W5EA 2PLWA 1QMPA 3HCPA 3MWEB 5ENZA 4DHEA 2I76A 3BSSA 1BU5A 3AUTA 4KLZA 4MCJA 1N34B 1DJOA 3H9EO 2AJ8A 3MM4A 3DHYA 1TVKB 2BHSA 2H59A 3P27A 3KXIA 4L51A 1IN8A 5FTJA 1MFZA 3AF2A 2J5QA 1T2AA 1XNGA 2WAAA 4P53A 1JFFB 2SKEA 3DD1A 4FI3F 4ARAA 4OX9Y 4E15A 1PT9A 2G5PA 3NIWA 5FDFA 2HGSA 3O4JA 2IS4A 1A50B 3N2KB 5BRNA 3TLMA 3E2MA 3T99A 2X4IA 4L08A 1F2DA 1KK3A 4BNIA 1FDIA 1AQNA 7MHTA 3O0TA 1SVNA 3LWDA 4UE2A 2F7SA 4A10A 4D3DA 2ACWA 5K20A 1N5MA 5IRCD 4G8BA 1QIJA 3GLKA 4M9QA 4RCVA 2RIPA 1HNNA 2ZRQA 2AUMA 3DE2X 4MPJA 3F8TA 1RRGA 1T5OA 5DX1A 5DXFA 5HF6A 3DZHA 4ZJPA 3H2JA 4HPWA 4BGEA 1XWIA 2ST1A 3GLSA 3E61A 4YEDA 3HB4X 2A9OA 2AG8A 2HF8A 3E35A 3DE0X 3I2FA 3AZQA 2FUKA 2J3KA 2R7AA 4Q7EA 4C0XA 3K9LA 1QZ3A 3JASB 1M2FA 4O33A 4BDTA 3FUVA 2X5JO 2AWNA 1VSVA 3Q1KA 3T1OA 1VCIA 3H2HA 4EYKA 3DAPA 4PHTA 5FA5A 4MGYR 1KK0A 1R3UA 1IXRC 2GHQA 4HN2A 2IW1A 3KYCA 4N9WA 5AK3A 4XUDA 1N4DA 4TKMA 5JYBA 3F1KA 1H2WA 1XRLA 3HVIA 4JWTA 1VRVA 2H06A 2P62A 4E03A 3FNIA 3Q0EA 4F46A 2EQBA 3ZK8A 1Y3IA 4LHSA 2HLDA 3NMUF 1QXSA 5CYGA 4N9QA 2P0EA 4LTDA 4REQA 5KNBA 2YZ2A 4AP9A 4EDFA 3C3XA 4WKCA 5MGNA 1YIDA 2OAQ1 5KNCH 1R0RE 2LXNA 4JOQA 2Z6AA 5M3BA 4JJGA 1KQ3A 1O6BA 2W6IA 3AEQA 3I58A 4XWTA 2XE6A 4EY5A 4B2LA 1T8TA 2H4YA 3NWJA 5LOVB 5CBPB 1M8FA 3V2UA 5D86A 4CNQA 1JPUA 2PWBA 3VHQA 3F67A 3FZGA 1NF3A 3Q87B 5SZIA 2R9VA 2HA7A 2WD7B 3SG0A 1SWWA 6NULA 1Z0SA 3NUQA 1YDWA 5KUTA 1CD5A 4TLBA 1G8SA 2ID8A 2ANBA 1X39A 4WZAB 5LP6B 2YXBA 2Q46A 3NGLA 2CN1A 3FF1A 2YN2A 4LE0A 1DAEA 3JD0A 4MP6A 1AA6A 5H5JA 1L4KA 4IIDA 3K0AB 1PFYA 3JQAB 1ODKA 1RZ3A 3JS5A 4JSRA 2OENG 3ZC3A 1H8HD 1UZMA 4S24A 3CX3A 1GVHA 4OJMX 4RKWA 1V1RB 3E84A 1YHNA 2PS0A 4KPFC 1HY3A 2YC2C 3R9XB 4M8KA 1E3MA 1G8FA 2EFJA 2HYIC 1O03A 3IOYA 4C87A 1KDRA 1I24A 2K87A 3KYCB 1J42A 3PHIA 4TV8B 3PUWA 5E0KB 1UJ6A 4DUYB 5CH8A 5HJ5A 1G41A 1IK6A 1AQ6A 2CVQA 3UG6A 4G1UC 4IZOA 3TS1A 1JU3A 3KOZA 1Z36A 4HH4A 2DQKA 2IS6A 3FLAA 1AXRA 3UXEA 2F1HA 4WEQA 3V7YA 1ODCA 4OHVA 5IKXA 1K7XB 3I9FA 2EARA 2R8ZA 3P9RA 1AY0A 4V02A 3VJLA 5HYVA 1SXJB 4AO6A 3BD9A 1NXWA 4XD2A 5JZOA 1EK5A 3EXFB 1QLHA 4GI7A 4J03A 4XAQA 4BMYA 2JJ1A 4YIKA 1JSXA 2QJFA 1GCGA 1NW6A 3TW8A 5IKMA 2A59A 1JFRA 4LVCA 4GICA 2NXEA 4NMXB 4PHGA 3MGCA 2GRJA 1C0PA 4O4IF 1XCGB 2DTDA 1UKZA 1E63A 1F2TA 2HCBA 3QM1A 1U90A 2C84A 4L16A 3BXHA 2WHYA 4W7IA 5T8KC 4IDGA 3U7GA 2RG1A 1RS0A 4QPCA 3U40A 4GKBA 3V1KA 1JSZA 2ENUA 3I45A 1O6CA 5EZYA 4D3XA 4MZDA 3RIMA 1JDSA 3C97A 3K5PA 2EKLA 2XUGA 3GLVA 1RRPA 1Y89A 2JIDA 2MOKA 2RG7A 3IXLA 5FYQA 3RWBA 3O5AA 4RSMA 4CM5A 1VSQA 1Y0BA 2O2GA 4LOLA 4JC5A 5KNDA 1US8B 4J9VA 3ILSA 4R1QA 4CIXA 2IU4A 1XPUA 2HDOA 2IYTA 1SOMA 1VMKA 2R44A 2FPKA 3PS9A 5EMJA 3DLIA 3RJMA 1W36C 4UUQA 3QOXA 2AN5A 3ABZA 3C48A 2QD5A 3UGKA 3E8XA 1BRTA 3PKJA 1SELA 3OQJA 4JLOA 2Q7OE 4BBZA 3H4TA 5KC8A 2FSHA 5BW8A 1E7SA 4TWBA 2ZSUA 1BC5A 2X3YA 1O54A 1M1UA 3AETB 4L6IA 5FA6A 3MBKA 2JLXA 4IGEA 3Q8WA 1NMQA 3Q9NA 1IE3A 1PR6A 4W4TA 4DRYA 2C8KA 2DRIA 3NBUA 1ACJA 1DELA 4BMPB 2VN8A 1JHAA 2VRWA 4JELA 2VJAA 4K3UA 4NFHA 4WZBE 3SBXA 4LV8B 1PL0A 2G0NA 2H1FA 2I3GA 3T0FA 3ZKAA 1W5TA 2I2BA 2AKYA 4QDTA 3DHVA 1EWKA 2IF2A 3HJUA 4LZNA 4MYSA 4PGMA 4N0QA 4Y1RA 3SXUB 1OH5A 2PX2A 4OPMA 1EX7A 4NYIQ 2ZYHA 5KVVA 2CDRA 1C30B 1FFAA 4ZMBA 4TRNA 1KAHA 2CNWA 3FJYA 5L40A 1EQUA 1RQ7A 2HIAA 1P3JA 1QB8A 1VL8A 3BWCA 4KQJA 2PRSA 5FEMA 4YRIA 4FMCB 4MJ7A 4PXYA 4RD2A 3DOUA 3LWBA 4BQOA 1P72A 2BAGA 3TWOA 3BXZA 4ZVVA 3DL4A 2ZZMA 3RFFA 5FPPA 1JXAA 3VTAA 2PAFA 5CA0F 4HXEB 1YQ9A 5EA2A 2GKSA 3MJVA 2POQX 3OT5A 3PNBA 3W90A 3WB2A 4AP5A 1DBSA 1SN7A 2L69A 4MDEA 4RQBA 2CY0A 2AKAB 3S2EA 4F11A 2DMRA 1POXA 2ONZA 4KYVA 4KK3A 1C7JA 3O74A 2GF0A 3PQ8A 3SE0A 1SQ5A 5KHAA 5JAHA 5LU8A 4IUYA 3AL2A 1BW9B 3U4QA 2X1HA 2QG4A 4IG4A 3OPYI 4RXTA 5EEGA 3PFIA 1W19A 3LT0A 3TQHA 3ZZMA 4TSFA 3EQ8A 2QN9A 2QQGA 2GPBA 1VMAA 3AEUA 4Q3BA 2GQ0A 5K01A 3VKWA 1Y1PA 3PWZA 5GY7A 2OGZA 3ONFA 3ZDCA 1TOAA 1T8WA 5ENVA 3HB9A 1H3NA 3W5VA 4A8TA 2YWDA 5GIOE 4YRQA 2GETA 1F8GA 1OXSC 3EWSA 2W90A 4PAGA 1CNFA 1HF3A 3D64A 1FP4A 4KQKA 1AH2A 5JJIA 3FNGA 2EGHA 4F91B 1F20A 2BBTA 2PX8A 1TZ2A 2QENA 1OWPA 1TECE 1U6KA 2WU3A 3OU2A 4JUCA 4R6XA 4YT5A 4BJ3A 2HBRA 1NBHA 1JLHA 3HXPA 4BFZA 4DJAA 3Q8MA 1XU7A 4ZICA 3BRSA 4P34A 4BVEA 3AERB 3FRIA 4MVJG 1DV1A 4RAQA 4BMSA 2WSYB 4R9UC 3RASA 4JIGA 3WV4A 5JSZB 1HR0B 3CEHA 1GYQA 3LKDA 4IIJA 4XUEA 2BGJA 4LE2A 1R6DA 1ZXLA 4NBLA 4LF7B 3ZCPA 4BLQA 1LJLA 2KWIA 3MRTA 3FI0A 2R8YA 4MV9A 2IYLD 1JLKA 5AW8A 5LDHA 2G8LA 3I09A 3CF2A 3FMVA 1B0PA 4OF4A 5CVCA 1TT5B 4CMHA 2QN7A 4L85A 4G0VA 4Z99A 3BWVA 3SNHA 4EI8A 1JJVA 1ZSNA 4OHBA 4OATA 3DPSA 4QUGA 3ZWCA 3NDBB 1I4EB 4XX1A 2DECA 3GZ4A 3L7JA 1NPDA 5IAKA 3FG9A 4ARVA 1J23A 1C1YA 1XRPA 4GECA 1Z63A 1A8SA 4YRJA 5KYXA 3U19A 1FMTA 2YUIA 3ZHZA 2XMGA 5AW0A 1HTTA 3ANSA 1A72A 2OXFA 1SUSA 3PXBA 1NQOA 2J87A 4OLFA 4TLDA 3UKJA 3FCXA 1Z47A 4OSEA 2VCEA 2WD9A 3C5HA 3CUYA 4DARA 2EG9A 1OYYA 2GAAA 3BSWA 3C3MA 3ET4A 4C76A 5AM5A 3P94A 3DBLA 3HFSA 5K3CA 3O3NB 3PJFA 4GX5A 5D6NA 3UHFA 3EIUA 3ZZTA 1I7LA 2H4XA 1BQEA 2XZTA 2EHJA 4P7FA 2ZW9A 3DKVA 4JBLA 3H19A 1A5SB 3B6KA 2VAWA 2ZCUA 4M36A 1LVUA 2OZKA 4BMZA 5FF9A 4MRPA 5ALHA 2EYUA 5K0EA 3EPHA 4AX4A 3SC3A 3W6UA 4F3RA 1YMUA 4BVFA 5F1KA 3V48A 2XMRA 3EZYA 1W0JA 3DEYX 2C5FA 2QDXA 1X19A 1P31A 1OZAA 2QOEA 2WLTA 1NP3A 2BZSA 3E1KA 2GXQA 3ZQUA 5IXYA 2Q5IA 4AMBA 1TQ8A 1B6TA 3KZXA 2YWRA 2CSUA 1VIYA 1H2FA 3PHCA 3RSSA 2QQFA 2AK3A 2H1SA 3HV0A 1Z37A 1Z8FA 4YO7A 4DUGD 1XZQA 5C7YA 3ZDEA 2PTGA 2ZYAA 3ZWPA 1T3SA 2O9JA 2W4MA 4CQNA 3GOQA 1SVOA 2M32A 2WW8A 1VKJA 3QVGA 4F0JA 1S2LA 4OHYA 4FILA 1P29A 5F2KA 2ZRIA 5A3JA 2GCNA 1ZHOA 1U0JA 1XO1A 2QN3A 4PAOA 3ZDAA 1FB5A 2E1PA 1RAHA 4KPUB 4C2BA 4B0OA 1WB5A 1U0SY 2IXTA 3HU3A 4MUAA 3WKBA 1V8FA 4EJ2A 3MWEA 3SSOA 3ZDRA 4WBNF 4MUKA 4MWSA 1UBKS 1SXQA 4OH7A 4Q21A 2XWQA 1THZA 3E2IA 4IF6A 4YDRA 5FJIA 1L5KA 1UBFA 3V34A 3VGPA 3U2QA 1KYYA 4DUGA 4UNIA 4BO6A 1P2BA 1XA3A 3JQ9A 1GTRA 1H0KA 1JEOA 3K5WA 4LZAA 4D79A 1Y48E 5JBIA 3BMOA 1OH8A 3D8TA 4KV9A 1ZAKA 5EXPA 1IM8A 2A33A 3C43A 3MTIA 4MAFA 4N0EA 4OGGA 1HDOA 5EZYF 2WUEA 3QOFA 4ZQFA 3FR7A 1QZZA 2GYWA 4FDUA 2JANA 3K0HA 3PHHA 2PR7A 2QJWA 3STWA 3UCEA 4AT1A 2FJ0A 2C1XA 2JEYA 3BKXA 3D6NB 3E9QA 3DFFA 3LQFA 1B3RA 4KXFB 3U3XA 4YMTA 3U09A 3QE9Y 3KJEA 1ZH4A 3LY9A 2ADOA 2ZRAA 4MVJM 3HXKA 4DLZA 4ZJUA 3V6LA 3AGQA 3SHWA 1QANA 2OV4A 3BMXA 1YA4A 1M34A 1AUXA 3PLNA 3TTXA 1ILWA 2WT8A 5B64A 2RJNA 4QUEA 3GJYA 2FSPA 4Q3CA 3OU7A 3JZAA 1KNXA 2GLUA 3DAFA 3WGNA 3OLYA 5J59A 5KTMA 4KDRA 3AWIA 4V1CI 1HT0A 1B1AA 3DZKA 3PPXA 2UU9B 2HCTA 3ITNA 1NQAO 3SS8A 1Q21A 2GRAA 3P7MA 4BE9A 3PVSA 3H6KA 5FNZA 2O4CA 3OZ7A 2CE7A 3NBYC 4RD4A 4C9BA 1TJPB 2D7JA 1TB4A 3MK31 4I9UA 1Q0SA 4G0XA 2GN9A 1CVLA 3ICWA 2HI0A 3D3JA 1F8UA 4Q6WA 4DMMA 3MPUA 2IYYA 4NNPA 5IT9A 1MOZA 1ZVKA 3M89A 3H1FA 4XXHA 4D0GA 5IFLA 5AVOA 4UJ5A 3GVHA 3LCCA 3ANTA 3DBHA 2J6IA 4K6FA 3AHEA 2HA4A 4ND2A 2V65A 4MQBA 1NQXA 1MC4A 1WE2A 3EGDA 4OJYA 3HVRA 4YRLA 4JU9A 1NLMA 3D7KA 4NENB 1BEUB 3KHUA 1NUAA 4IHKA 2IU6A 4N6OA 1L8XA 4QRIA 2GXAA 2BGTA 1FU8A 3MMNA 2I80A 1U8EA 3DFZA 1H1DA 3F3MA 1UMCA 3GUHA 2DERA 2R1UA 3H11A 3QHAA 4HNSA 4PZZA 1Z5WA 1QQ5A 2XB4A 4R9NA 3OUZA 5DXJA 3W9UA 3U4HA 2WUVA 4AM8A 5T8KA 3OE1A 4YRNA 4XWWA 2OLKA 2BP7B 4W82A 3LLCA 5G53C 4LS3A 5AUPB 2WWGA 4EVSA 2GZ3A 3L7MA 1ZN7A 4GVPA 10MHA 3FZNA 4JJFA 2VI5A 1C3LA 1YB2A 1P3DA 2D2IA 3JR3A 4YJ3A 3RU7A 3ER8A 4ZP1A 4N39A 3NTLA 3VKHA 2QNIA 3AV0B 4FS8A 1CIVA 2BF7A 4LXYA 5KWIA 4G1MB 4BJ1A 4RPJA 2QLBA 4UEOA 2NZYA 4DS3A 1YR1A 4X1KA 4YP0A 1IXZA 2VOJA 4G36A 5HFNA 3BL5A 3ZKWB 3JYOA 2G6BA 2JL1A 1H4QA 1XMJA 821PA 2I3AA 2PYZA 1OXMA 5I9SA 1WZCA 1ELOA 3PWKA 4OQDA 5H81A 1KC3A 4MR9A 3M1YA 4AJOA 1P2TA 2WTMA 2WWRA 4AD8A 2QD4A 2AEEA 3JD3A 4JBIA 4F5DA 4L27A 1ZMRA 1E3JA 4L57A 3EISA 2J59A 3GCWA 2RHRA 2H31A 3JSXA 4KMRA 1ADBA 3SQWA 2IH2A 1M2VB 1NYQA 5I9MA 3FDZB 1A9PA 2C4UA 2WOOA 4BCDA 2XVYA 3NPMA 3MXOA 3CZ9A 4RPLA 2WKPA 3WLTA 4INZA 4ZT2A 2J67A 4IZ6A 4XJXA 3PP8A 2GFIA 3VKVA 1SKMA 5AJVB 4BIMA 1EWQA 3O8RA 2AOXA 5AVRA 1Z08A 1NIPA 4FMBB 2QX9A 5LZ4A 1IC6A 1ZM2A 2AZMA 3MAGA 3BE4A 4PZCA 1L5YA 1NLUA 4LYEA 3UAYA 4MB0A 4OQQA 1FQWA 3JQGA 5ALLA 4B6SA 1W35A 1ZNZA 2HLNA 3QVUA 4GR5A 1Z4QA 3SQMA 1NDQA 5FJJA 3HXMA 1Z26A 3KJXA 3TCNA 4B3MB 2NNWB 3VPHA 4I4TF 3B1WA 1PO7A 2BR5A 1UPXA 5I4BA 4Y1GA 1D1PA 1D6NA 1H0SA 3EN0A 3VR4D 2B8TA 4BKQA 4E5YA 4Q1AA 3QU2A 2JLZA 4U7GA 5DGXA 5KJCA 5FWYA 3NM5A 3K96A 1W59A 4A1FA 1Q14A 4LVOA 4U6SA 2BH2A 2XQJA 1PEYA 4P1ZA 2O7QA 2IIPA 4PN3A 4H1VA 5TNXA 4F38A 5BVHB 2WB4A 2WVAA 3IBGA 1V43A 3UHJA 4RA9A 3I61A 1PWEA 4X60A 3NHMA 4HX5A 4DMHA 4CKWA 4IJWA 1WKBA 2PV7A 2R4TA 1Y1TA 4IIHA 3I3SR 1KPIA 4AJNA 1H8EA 3GJRA 3IUEA 4LUCA 1KPGA 1WUYA 3OZSA 3LO8A 1NR7A 4MIOA 3QKTA 1I51A 1EU1A 2R7KA 4G65A 1ORDA 5LIPA 2ZYDA 2OHJA 2MSCB 2W0SA 2W58A 1RPJA 1E58A 4HAYA 5GVRA 3ZWVA 1JQAA 4QO8A 3LDAA 4U6QA 4BFSA 1QH9A 2OPHA 4M1ZA 2BKEA 1YNOA 5GMOA 2XWPA 1A82A 5CDYA 3FB1A 5J2UB 4LF5B 3GROA 4M54A 1I8TA 4R8RA 2WIKA 1NKTA 1NJGA 3E27A 5BN3B 3UBTA 5JS6A 2ZBQA 4QFDA 2CYBA 1VLLA 4H6VA 1H85A 5AHRA 2CFTA 3HSSA 3N87A 2D7CA 4OLHA 4UAVA 4WASA 5FFNA 5I9BA 3TUIC 4UTRA 3JWGA 3PTAA 2JJYA 4G8DA 5T67A 2XWJI 1T1SA 3B7WA 2V6IA 1F8FA 2HJHA 1RC1A 1V16B 3I9LA 3DB1A 3KQKA 1DIAA 2NXCA 3C87A 2IHTA 2ZUBA 1L3BA 3UFXA 4AUMA 3NM6B 2OAP1 3SF8B 3VPDA 4TXJA 4KKVA 1X7ZA 3PFBA 3UJAA 2HNBA 3AVOA 1IAVA 1FF9A 5KZMB 2C9DA 3L7YA 3EXAA 4NPHA 3GFSA 1EP3B 3V8QA 4CUZA 2E1RA 2IXGA 3CNBA 1XZBA 2A78A 2J85A 4TYMA 2ZJ7A 5JE8A 1R2QA 4YHBA 2Q1WA 5CK5A 4YCJA 1O4WA 2C1ZA 1IBLB 3PUKA 3BK7A 1TZBA 5LJLA 3UG7A 1UPFA 2W0MA 1FP4B 3DEIA 3ORQA 3FFBA 4UJ3A 4F1JA 3EBOA 3FETA 4RVUA 2O3RA 4JS0A 1J9EA 1O58A 3SCZA 3OCZA 3TAUA 1Z6QA 4EECA 1XNRB 5K51A 2PUFA 3FOAA 4PGFA 5K9ZA 2O59A 4U9HS 3DD5A 1TO1E 1FLAA 4OEHA 5IJ9A 1SPBS 3B3FA 3NAZA 1JFFA 4FQ7A 4XWOA 4MH0R 4XM1A 4MXDA 5EWLB 3RSCA 3HH8A 4M21A 4CUJA 4E6PA 3QMWA 3DOFA 5TSDA 2YZMA 2WAYA 5C8DA 2FRDC 3C15C 3QFSA 3TOCA 4FYKA 3ZS9A 3PXAA 1VL5A 4MLZA 4B32A 3EZNA 2IY7A 5A5EA 4CEIB 2PYDA 1IULA 2L19A 3TXXA 4JX8A 4HQOA 3PNPA 3H0CA 5F51A 2BUBA 5D1HA 2PRYA 1Z5UA 1VL6A 4HTFA 2C9BA 3OO1A 1DCFA 4M0PA 5AVJA 5IKEA 3Q0IA 4ZEMA 4LSZA 5EE9A 1Z83A 2OHFA 1XPJA 3HB0A 3HS3A 1XQ9A 3LY7A 3S2FA 3FIJA 3W2GA 3LA6A 4ENRA 2JFBA 2AFHE 3NHYA 4ZCSA 1DQNA 1DVRA 4A15A 3G88A 1JAXA 2FFAA 3CLRC 2C7OA 1VG9B 2CB9A 3K8OE 2IZ5A 5ALJA 4MR8B 2P9GA 1P9OA 2VPZA 1LDGA 2JBAB 3ZXIA 3FCAA 4DB4A 2XUIA 5C3MA 1KVQA 1N2ZA 2P9EA 1TLTA 3KQOA 5BQOA 2W6JA 2ZR9A 1SXPA 4DMFA 1VSTA 1NL3A 3QF7A 1V5WA 3IBFA 1KJNA 4BZQA 4HB3A 5BUZA 4KR2A 3HA2A 1VGRA 1BDHA 3IMGA 1YDGA 4LOAA 3O2QB 1UDCA 2I54A 1ZMXA 2G17A 2ZAGA 2J41A 4X24A 5LCXA 1AN0A 4NPCA 4NCIA 1TPYA 4FI3C 1LQUA 4X1YA 2RKBA 2FI1A 1RKXA 1E3QA 4KB5A 4NZ9A 4X8HA 2Z43A 3OJFA 3L9XA 3L0CA 2ZT5A 1OLUA 2IV3A 1HT1E 3A4TA 1FFXA 2C7VA 2PJUA 3UK7A 4HBGA 3TR0A 5JMOA 3CJQA 3TKLA 2QP4A 2JIMA 4I4LA 1CUJA 1DMSA 2F3PA 2P6MA 2SCUB 4KWTA 4MSUA 5GGXA 1DEAA 1G5PA 2QV0A 4IINA 2HF7A 2LE0A 1O5TA 4BKPA 5BOSB 3BFXA 4GS5A 2PMDA 2ZBDA 1TO2E 1W5SA 3H17A 5DNWA 2G4LA 4AF8A 1Z6GA 3FWYA 5EI5A 4CF5A 2EG5A 3BE5A 1KDVA 4RD6A 2P3SA 3IIIA 4RHXA 3PF9A 1EVEA 4D6PA 4LECA 4CDRA 5I9NA 4B6EA 3A6EA 1R5JA 1S1MA 1WZNA 1CQIB 4R2IA 1OLXA 1RWWA 2XUDA 4BP3A 4NU5A 1CY6A 1YZ3A 4FHCA 4KBGA 4Q47A 3T5BA 3HQ4O 2EW1A 2B5OA 1G8KA 2VJNA 4OUDB 3CH4B 3HCOA 3OQPA 3VH3A 1NKSA 4WXPA 2BGNA 2QTCA 1YV9A 4UEQA 4F4UA 3SPXA 1YZLA 4PICA 4EEKA 5BSWA 3PYLA 1ANKA 1ZH6A 4NE7A 2JAQA 1EDZA 2QL5A 4H7DA 1TCUA 4Y3UA 4B45A 3CVWA 3DKPA 4Y2UA 3IDZA 3OMWA 5HBGA 5A05A 3VR0A 3WNZA 5BNTA 1HE4A 3BIOA 5F3DA 1BE6A 1TIKA 2Q41A 4GSYA 4D0RA 2DBQA 1ZC3A 2AIRA 4F92B 1P9LA 2CNLA 1YQQA 2IJGX 1QOPB 4HB4A 5ELMA 1F2VA 5J5VA 3ZBUA 4IEIA 3KWLA 1A1SA 4GMHA 5C7IO 2D6FA 3EA5A 1CUHA 4KQ1A 3M34A 4OIFA 1JECA 4YALA 3KZ1E 1IOWA 3EWNA 1SB9A 4KL8S 3UJ3X 5BQ3A 1BX3A 2WMNB 3TSAA 1CZHA 1AUPA 1Q20A 1RYFA 4ZVQA 3D4BA 5A1JA 5HZGA 3CCFA 2ZTUA 3FUUA 2C2HA 4LHWA 4TT3A 4BFLA 2R5WA 5ER9A 3ZLVA 1BRMA 1LBTA 1QQ7A 3VU9A 4BQSA 4XX0B 1DAMA 2YVAA 3RYIB 1KBZA 4TUYA 5JJ5A 2NO1A 1NUPA 2GK6A 4E30A 4PPNA 3QBEA 4M8NE 2I6SA 4NWIA 4FBGA 4KO8A 4A92A 5L7WA 4RDCA 4HLUC 4RL6A 3HBLA 4BHTA 2HU8A 3JYQA 3TE6A 2Z3VA 4ASUD 3ONWA 4X00A 5GZ1A 1E2DA 4K0KB 3HU5A 4JK3A 1JP7A 2HXGA 2B7CA 3VPAA 5JDIC 1GZDA 4L6AA 1HRKA 1I4LD 1UC9A 5F2NA 3NC0C 2FPXA 5BN4A 2PUGA 3CMCO 4E2WA 1A5AB 1TT7A 4LXQA 4DV4B 1EX1A 5BYAA 5JI2E 2OC9A 4MVJP 5AICA 4M7RA 1O7JA 1T3HA 4AJ2A 5C80A 1AGNA 3TGPA 1QGZA 3FZEA 3GT0A 3TEFA 3ZBPA 2QZ4A 4F3TA 2PL1A 5K09A 2OCPA 2XJ9A 4AJEA 3OCUA 3RHFA 3ML1A 3OPYA 3JALB 1IJBA 2QJOA 5G02A 3ETGA 3TW6A 3ZGYA 4S04A 2PGXA 2DR0A 2GTIA 3EUAA 1TE2A 2HHCA 2NPIA 1XZ8A 2PWYA 3KLBA 4FFOA 4I1UA 1A95A 1GNLA 3K9GA 3HJCA 2C9MA 1DC8A 1BU8A 1G63A 3E5RA 4CQMB 4W1RA 3NYIA 3GLIE 1RWNA 4BUZA 3AJAA 1JF8A 1ZCBA 4BN5A 4XLZA 3WL3A 2AA3A 2ZBPA 1DFGA 2FEKA 4LQCA 4BYMA 2IY8A 2HRCA 3QPDA 5D7NA 4GZMA 1WPQA 1II8A 1ZUNA 1ZJJA 4KZKA 4V38A 3H2SA 2ZRGA 1J5XA 2UZIR 4V0SA 1F4VA 3JYPA 2E5FA 1FVHA 5FPQA 4GOOD 2GEBA 5DK6A 5HKLA 3URMA 4EYGA 1YL7A 2BBOA 1FX1A 4C0SA 3WISA 4FXPA 3T61A 2VNHA 3NNSA 2PR2A 5J58A 3EUEA 4PYMA 4YLGA 4A6EA 1TADA 2IOYA 3KKOA 3IJEB 3RUDA 2OFOA 2GZRA 2A14A 5K4HA 2XA9A 4R1UA 4PEVA 3F2IA 3RNLA 4F5EA 3WG9A 3IILA 4WESB 3PC6A 4H6WA 2DG2A 2H1VA 1FPQA 2PHZA 4OHMA 5GP1A 3M6XA 1P5FA 3E9ZA 1V5FA 1CZLA 1KKMA 1GQ2A 2H8KA 4EBBA 1VA5A 3RGWS 1BS1A 2BKVA 1UM9A 4DDVA 1W0JD 1J9GA 5JSHA 1KU0A 1XSEA 3OI7A 3B70A 4HCJA 2ERXA 5GOZA 3RRMA 2CLIB 4DKXA 1N1MA 4Z5XA 4WBSA 3W5CA 3SS9X 1I2BA 2HQBA 2RC5A 3N5KA 3JQDA 1BVHA 1L5ZA 1MABB 4IDDA 2CNBA 2R8BA 4DTCA 4CM6A 1PL6A 2I4IA 3GV0A 3I34X 4ICIA 1X7XB 2A9KA 3IALA 3KUUA 4JT4A 4UREA 1E0DA 4PG7A 5AVKA 3RRJA 1C1XB 1YQXA 1CT9A 4DLNA 1EBBA 1VTKA 4C2TA 4B75A 4RLHA 1QB7A 2CDAA 2HPZA 2AEFA 4UBLA 1JL3A 1SWVA 1MJGA 4HYTA 1R8JA 3CLTC 2QEQA 4NSNA 4HX2A 5AK4A 5JU6A 1QG4A 1SCJA 1CRPA 1E8NA 2I3ZA 2FSIA 4CNBA 3F73A 1JRLA 4F6RB 4B44A 2RC6A 3HVHA 1G8JA 3EF1A 2AS0A 1JU4A 2MTBA 3G8YA 5FWXA 1VKHA 3MSCA 1GSIA 4FYWA 2CFIA 2HWXA 3GHHA 1J8FA 1SEVA 3PGLA 3ZNQA 4B2IA 1Z06A 2WJYA 3QX9A 1U3WA 4CKBB 3ESYA 1A7JA 1I0LA 3WLOA 2YYSA 4BLPA 5IWCA 1M2GA 1GKKA 1E9AA 2XUJA 4INJA 1L8OA 1ND6A 2C2KA 1DX6A 3RSLA 5AI4A 2AXNA 3UA4A 4TMVA 1GD1O 2J9FA 1ZK1A 4YBRA 3SJCA 2J48A 4HC4A 1G5RA 4AIIA 1N2EA 2ZJZA 3DOEA 3COZA 4C08A 3W6ZA 3JZDA 3N59A 2PUCA 1OX5A 4P4UA 2VWPA 3IT0A 1E8MA 1VRCA 3CUEF 3W3AD 4IR7A 2H1RA 4PE5B 1SQ0A 4D96A 3B9RA 3FN4A 5F9HA 1TKCA 2WD7A 3THRA 4QTYA 4WNCA 5K2OA 2QRGA 2AJTA 1U2PA 3LD9A 1JVSA 4A8JA 3CNQS 4JEMA 4UMEA 3B20A 5CT8A 5ALYA 5J4LA 4IDBA 1Y3CE 1AKQA 4UBIA 1PTKA 3BREA 2RAFA 2P4SA 3U16A 1E96A 2C2ZA 2YFKA 4KZPA 1XU4A 2DPGA 4C4TA 2JGAA 4GQBA 3FGZA 3JVEA 4HZUB 5KTNA 5C51B 1N5IA 1EDOA 3DKKA 4OSOA 4RH0A 4HDKB 4KQ2A 4UU1A 2D0PB 4XIIA 3UAOA 1X7ZB 4C7VA 1E1CA 4NBTA 4N6NA 2X14A 1UPBA 1LFAA 3H5OA 1GN9A 4FMDF 5CGZA 5TGDA 4DA0A 1F0NA 1T5BA 2EZ9A 3O9MA 2WV7A 3I9OA 5MN4A 4PC2A 1W85A 1NMZA 2Y6UA 3I2JA 2PUAA 3W3ZB 3UM9A 5HVNA 1H2XA 1QZUA 1Z5GA 3KPYA 3N2GA 5TPZD 4GX0A 1DUIA 2Y1FA 3G9ZA 3IDOA 3R76A 4BVJA 1MW8X 4R2WA 1NVWQ 2CFSA 1BEEA 1F12A 4MINA 1Z18A 3EAFA 1XLWA 1IHUA 1XL0A 4Q3DA 4QELA 2QTRA 3V1LA 2BZ1A 3S7TA 4ZPJA 4WY2A 3DMGA 3TNLA 2O1SA 3PSHA 4EHAA 1VRWA 1RKUA 1XVUA 4GI5A 3ZWYA 3FUCA 1XL1A 1T5LA 1U98A 2XSZD 1VHDA 3TD2A 3ZR4B 3VUEA 1KJIA 5H83A 5ALKA 2GCGA 2AW5A 3OX2A 1JEEA 1JQJC 1UOOA 2BMWA 1BWPA 4CEHA 1MW9X 2DWUA 3EB9A 4CJXA 4YMUA 1ML3A 4DR7B 5LOVA 4ZT3A 5DEIA 1E5VA 2WUFA 2VWHA 3D3KA 1HDGO 4HADA 5KSZA 3PGKA 4Y1EA 1XTBA 4FFDA 1MZVA 4X63A 1HOXA 1JQ3A 4MV1A 1ZH0A 4M3NA 3KTOA 3T34A 2VSYA 3TW4A 2ISCA 2F67A 2NT4A 3CO0S 3QV2A 4DEXA 2RJ3A 3AIMA 5J4KA 3MUOA 1FPMA 3NTQA 3RRZA 3UUWA 1UWVA 2FR1A 2Q2QA 3BX1A 5A3SA 1W5BA 3WK4A