4KLAA

E343d variant of human ferrochelatase
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIDTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title E343D variant of human ferrochelatase
rcsb
source organism Homo sapiens
total genus 141
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klaA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klaA01
4MK4A 2XVXA 2C8JA 4KMMA 3LYHA 2H1VA 2JH3A 4KLAA 2PO5A 3AQIA 3HCNA 2HREA 2HK6A 1C1HA 1LD3A 1TJNA 2XWSA 3HCOA 3W1WA 2QD1A 3GOQA 1QGOA 3HCPA 2QD2A 1AK1A 1C9EA 2H1WA 2XWPA 2Q3JA 2QD5A 4F4DA 1LBQA 2XVYA 3M4ZA 2XWQA 2HRCA 2XVZA 2Q2NA 4CCSA 2AC4A 4KLCA 2QD4A 2PNJA 1DOZA 2DJ5A 3HCRA 1L8XA 4KLRA 2Q2OA 2QD3A 2PO7A 1HRKA 1N0IA 2AC2A
chains in the Genus database with same CATH superfamily
3WRYA 2Q5FA 4AFNA 4HAVA 3K0AA 2POCA 4IGKA 5K0ZA 3OI7A 1SIBE 1JQDA 5A02A 3G7SA 2CVZA 2PX8A 3ES9A 2DR3A 2H2WA 4TLEA 4ZO4A 3V3KA 2OP0A 4NS4A 1JHZA 3BKWA 3SNKA 4RVOA 3VFDA 1P39A 3AZQA 3EQ8A 1L5HB 1KQNA 2PRJA 5IF9A 1YBAA 2BFDA 3DVQX 1PL6A 4P6VF 3VJLA 1GGEA 1K6MA 4FNGA 1XZPA 5K3BA 5LXTF 3WDMA 4C76A 3ITEA 4B7CA 2EBWA 3ZV6A 1Z2EA 2CUKA 5DP2A 4G5HA 4CU2A 5ICMA 3PF9A 2ZPTX 1UM9B 1CRQA 3KCQA 1E0JA 4GPZA 3GCGA 3WQHA 3PGXA 4JL5A 3RUFA 1V7ZA 3F3KA 1PSZA 3IXMA 4U7JA 4EDHA 2ATEA 3IP6A 1RHRA 4M6WA 1P4SA 1N0HA 3GMTA 3VHLB 2A2ZA 4UD6A 1I36A 4RK6A 2RH5A 2XMZA 5BSWA 1KY2A 4CN8A 4X9XA 3V8VA 5IJ0A 5JSKA 2H2GA 3FCXA 4MWGA 2YQ5A 1T35A 3CIOA 3FWYA 5FOWA 4IOJA 4EIWA 2H1CA 2DBVO 5B6IA 3D3KA 2F1JA 4JJGA 4W7SA 1ZESA 4MLCA 1W7AA 4ZAYA 2VL7A 5JNVA 1R64A 3I37X 5EJ6A 4HN2A 1HX7A 2MSNA 3NGXA 2ACWA 4QQ8A 1R2QA 3KUDA 2G04A 3EUFA 3ZY6A 2VJPA 4HZUB 3SZUA 1GA4A 3M6UA 4LNHA 1KERA 5CVJA 1Z2NX 1OI2A 2CFTA 3H16A 3RVJA 4KXQA 5CLIA 2Y1GA 1M7HA 3MGCA 4NBRA 2ANBA 1E0AA 3K8QA 1JG6A 2OC4A 1U0LA 5B7NA 3L1IA 5AVTA 2TMKA 4RTNA 1HE4A 2C00A 4JLPA 3WV4A 4F2PA 5DYWA 3WL4A 1WV0A 3A1CA 4MVWA 4HDMB 4LY3A 3V97A 5BV7A 4OA8A 3HB4X 4B33A 2ZPUA 4CLOA 5EKUA 3CBQA 1J5PA 1XHFA 4QNNA 3LYLA 1DQZA 4YRTA 3S40A 3EW9A 2VPZA 3WWDA 3CF4A 4B7AA 2XCTB 1KHTA 1W5BA 1EG2A 3GHYA 3HB7A 2CJFA 4AP9A 1G3QA 1L6IA 3HMKA 2O1XA 3JS5A 4TMVA 5GM2A 4M0PA 1GTSA 4H35A 4UDOA 3BEDA 4U2FA 3G1TA 3FCEA 5AHOA 4YR9A 3ZJYA 1IG0A 3HJAA 3OIGA 3HN2A 4EKDA 5DK4A 3MWLA 4OB7A 4EUFA 5E1MA 4I66A 3SEAA 5JJLA 3IMGA 3SIRA 2C7BA 4C01A 5E6SA 1G20B 4XYLA 5JXWA 1YJ8A 4G0WA 1CVLA 3U80A 1KSHA 4QXMA 3Q2KA 4Z3OA 3OT1A 4XFDA 5IVDA 4A03A 4F12A 2VTKA 4Z7OB 2VR1A 5JIBA 3SHFA 2EL7A 5AT1A 5L8VA 5TEVA 2WW8A 2Z8ZA 2BGJA 2X41A 4R9NA 1FDUA 5DU2A 2TS1A 4Y3UA 3VZSA 4CF3A 2V6BA 1ZOLA 5LQCA 1XTTA 4A36A 2DFPA 3DHNA 3SX4A 3K9FC 5CM2Z 4MVYA 4DC1A 4CXMA 4UKDA 4DRYA 4JLMA 3DUWA 1CY2A 1SD5A 4WY2A 4UAGA 4CLRA 1P6UA 2H9IA 4X20A 1J7KA 4Y1RA 5FWYB 1S01A 3ZWYA 5E9QA 1TIKA 2L69A 2Y2UA 5U1PA 3CNHA 4TXLA 2QMYA 2Q0QA 5CEEA 1UP6A 1OILA 5JMTA 1BDHA 3B1XA 5CNMA 5AUPB 1KDRA 2BGUA 1U4OA 4CEIA 1EXNA 1GWNA 1MPTA 2YBDA 3ABIA 3EIXA 4KSCA 1ORRA 3O3MB 1J1UA 4FHEA 1RBMA 2ZW9A 3KYBA 3ORQA 2BONA 4E4RA 1JQJC 2DFLA 1DE0A 3CW2A 3K71B 2O3JA 1GZVA 3KKLA 2B1JA 4FLMA 3SSMA 3ZXUB 5LQAA 5DM70 1Z2OX 2Y1OA 4WNAB 1CR0A 3LO8A 3TTTA 2IIBA 1F06A 2WP0A 3H42B 4FBGA 1NC3A 1LTQA 2IEDA 4HFMA 4R4JA 1QYXA 1FP6A 3W5UA 3ROZA 3PVSA 4DZTA 3GK3A 1TF5A 2P6MA 4DYDA 3OFVA 5CCEA 1NJFA 3WK7A 3LA6A 4CMGA 3LQRA 5F9MA 1U2GC 4YAOA 5IYZA 1LZLA 1IEWA 3W6ZA 1FQOA 1ZRHA 3B52X 3TD9A 5FPQA 1WCIA 2QE7A 3VKWA 2C1ZA 2O2GA 3ONDA 5TDHA 2J9YB 4E31A 3HXOA 1OASA 1LPBB 2JD2A 1C8LA 4GPIB 4ZVKA 1L1FA 2QTTA 4CKEA 1ZK3A 4MQUA 1VIVA 1XLWA 2PQ6A 1ORWA 3DM5A 3F49S 4C3ZA 4ZV9A 4LNAA 4PZDA 3L8MA 4E4YA 1AKNA 4J1SA 5TR9A 2QRHA 1M1YB 2QN2A 4TTJA 5DGHA 1WDTA 4RVCA 3RAJA 3LP5A 3E9NA 1A8SA 2MHCA 2W6QA 4LJ7A 1VP3A 3AFNA 4ZCIA 3P9QA 1SXJC 3C70A 3MYRA 4NDNE 3ZJUA 4ND4A 2YRXA 1C5KA 3NHJA 4NV0A 1YB5A 2G72A 4P82A 3HXTA 3ZK7A 1YVPA 3IULA 4XD7A 3TQFA 3A1SA 5IUNC 3VKHA 5ALIA 3G8BA 4UQOA 2VAXA 2ZAIA 4GDMA 1H23A 4ENTA 1T8TA 2A1UA 4WH0A 1XP5A 4RF5A 3KO8A 5EPUA 1HTBA 3GVCA 3QJYA 2O8FA 2YN2A 2HDNB 3A1TA 3H9GA 3GW8A 5D8DA 4C1NA 3A7DA 4CJXA 2XCIA 4B34A 1DVRA 3WGKA 2PRIA 1PG5A 1RYEA 4RANA 2B4YA 1PSDA 4D9MA 1H6CA 1O0BA 1RXWA 1YQTA 4HDRA 3K3PA 1ULHA 3SMVA 2EKDA 3A4LA 4ZO8A 3O8QB 4UTVA 2VO1A 2Z5GA 1B2LA 3NOVA 4V0SA 3N2YA 4C5BA 2PKWA 3RHFA 1N2EA 5EC8A 4E12A 4QNMA 3OQ6A 1TE2A 2AHOA 1VJDA 2XJ9A 3IH5A 3S68A 5FWDA 4ZCSA 1WR8A 1DUSA 3S1SA 1Z2CA 2DG2A 1Z5OA 4XE5A 3GRCA 4BASA 2V4MA 1TOAA 4QU0A 4DW8A 3T9AA 1XELA 2YW2A 5G53C 5I3ZA 2GNAA 2VTBA 5LZ9A 1E99A 3PHIA 2EGUA 3CF6R 4JJIA 2PAAA 3IUYA 3I83A 3SKVA 4AL4A 1I6WA 2G09A 2PSJA 3WSVA 3ZPXA 2G4LA 1XROA 2JIBA 3C6XA 3PXDA 4OM7A 3QTBA 3ZH2A 2F3QA 3JASB 4BIMA 2CZQA 3INGA 5DXAA 5GJBA 2QRMA 4A26A 3P2OA 4WSOA 4WCFB 3CJTA 2JK0A 3FNEA 3LPLA 4W9NA 3E2MA 3S2SA 4DUGA 3EAFA 4J4TA 4LTDA 1FFCA 5F35A 5H9VA 5AKLA 3QYFA 2M6SA 3QV1A 4QUJA 1M34A 1RDFA 1F12A 4Y2UA 1OU0A 5BN4B 2FG7C 3CZMA 3TLKA 4OLAA 5KSPA 3HZZA 5IG2A 4QC2A 1DX9A 2F55A 1QU3A 5JASA 5KHAA 1PL7A 2GDZA 3Q9LA 5JAZA 5JS7A 4M87A 4ENSA 2ODQA 4D4JA 3WLFA 1M3SA 1AGXA 1Y80A 3EARA 3H2IA 1PFVA 3C7AA 3CX8A 3V8NA 4CDRA 1QDLB 4FNOA 2IELA 2FZGA 3ROGA 1YAJA 5E4FA 2DLCX 2O7RA 2QQGA 3ID6C 4LTMA 5DM2A 4C03A 3BGIA 3EIWA 1U2DA 1XYGA 1U0RA 3KUXA 5DHQA 1A2OA 3WYAA 1ZGJA 3CXUA 3HH8A 3PT5A 4TZTA 4FCCA 5JD3A 4PIMA 3VBEA 3BCSA 1RAEA 1QNFA 4O0MA 4UDNA 1P9LA 4PO3X 2A9JA 4LHZA 4QPDA 2RI0A 1GRCA 1QQ7A 5AM5A 3D4LA 3OA0A 3W6PA 4BNVA 5L95A 4KKXB 4XH9B 3AEXA 3NS7A 1YE5A 2CVFA 5EG5A 4B4UA 4QSMA 4ARZB 1UF9A 3N5CA 6ADHA 2A5GA 1GUBA 4MGHA 3CNLA 4ZODA 1XD2A 4KQWA 4DIEA 1ONBA 4B3RB 4HDNA 3R5SA 2AWNA 2G25A 4RQBA 3KT6A 1X8JA 3I34X 2XZPA 3U81A 1O5OA 3H5VA 4L75A 2OAQ1 4NPHA 1I32A 5BSGA 1A5TA 4BDSA 5AOAA 1MR3F 4WXPA 5EJ9A 3MWJA 4HWSA 2OV1A 2G4CA 3N0TA 2WHQA 5EPEA 3W9YA 1Y4ZA 5J4YA 2FGJA 3G17A 3HNOA 1HPLA 1T1RA 3FSGA 4RFVA 4WOKA 1OUMA 4RA9A 4HNGA 2H8KA 1FPQA 1G6HA 3I2FA 2XUOA 1NUSA 2QL6A 3OZGA 1P2SA 1XEXA 2WWXA 4TWRA 3RH0A 4U2CA 3SYTA 3HXPA 2P2ZA 1I0IA 1DZIA 3N6VA 3PQ7A 4FFOA 2OBLA 4FCWA 3SS9X 3BF8A 2HIMA 1M8PA 5BRNA 3QJ5A 2C82A 5AI6A 4ZEXA 3TD6A 2W2QA 1D5WA 3OU7A 1DHTA 1BIFA 4G9BA 1QIJA 2JRCA 3BXHA 3OCVA 4C30A 1YJQA 1XMIA 4YT4A 4UAUA 5E6RA 5JBQA 1QZZA 2WPDD 2XXAA 8AT1A 1GG5A 1L4NA 3L41A 1TEHA 4PPFA 2Z98A 5JDIA 4Q3OA 3SN6A 4X8OA 2JCSA 5LQNA 4JJAA 3A4NA 2FFJA 2JH9A 2NT3A 1VDMA 2QT0A 3M4YA 1FRZA 3O2QB 4GIBA 4JUCA 4LE2A 4LNUA 4JU8A 1AXGA 4DCNA 1NXQA 1L1QA 1VSQA 2AA3A 3C6YA 5KNLA 2ZT5A 4DZZA 4JXXA 2X0NA 3PEVA 3RS7A 2KBFA 5FB3A 4A2WA 4EGQA 3EPLA 3PTZA 3OPYA 4GGMX 4ZYVA 4RZHA 1N9GA 1TFRA 2UKDA 3UJNA 1SC1A 3PFCA 2I2AA 5HKAA 4YXWA 2FF5A 1SVKA 4W5TA 1T4MA 1N3BA 2YYYA 4LQDA 4EHJA 1UOQA 2Q9UA 4EG4A 3WQSB 4NJMA 2HU7A 2FVXA 5EFOA 2NU9B 1RACA 3ZWPA 2A9FA 2XRFA 3BRSA 1DEXA 4XJTA 1BXGA 1AIPA 1JPUA 1NBIA 1YJ5A 2FJ0A 2P8SA 3MWGA 4MVJE 2XNSA 4EP1A 3SZMA 4CT4B 4JYAB 4FNMA 4UU1A 5A1JA 5CURA 4R1PA 1QUEA 5DYTA 4QVIA 5HCIA 4QATA 1MW8X 3E4DA 3GRUA 3KVYA 5ER9A 4JODA 1NMSA 3MTJA 3C1OA 4DDTA 5EHXA 4DIDA 5EI5A 4GDFA 1IXRC 3IP8A 3T0IA 5C80A 4MUXA 1ZL0A 4PLTA 4B8YA 5LYJA 3ZGXA 3QWFA 1BGVA 2ERXA 1FCJA 3CLVA 3FOBA 4HXYA 3CLHA 3IXLA 4WINA 4ZV7A 4YV7A 4X66B 1PZFA 4LYJA 4PYJA 4BY9E 1XLVA 2RHDA 2NG1A 3REGA 2IDZA 5KCZA 4NV3A 1I80A 2POQX 4N0EA 2GZ3A 2GZHA 2H48A 2XR1A 2HUNA 4UM9D 5J2UB 3RBAA 3JD0A 4OJNA 3SJZA 3NX4A 4V0OA 1U1GA 1M1NA 3OX1A 3ZW7A 3MHTA 1KDZA 4NLLA 2NGRA 1MJHA 1MV8A 2JJ2D 2P69A 3KHUA 3SVZA 3JD2A 4RKYA 1W88B 3VSBA 3KTFA 3WL7A 3X44A 3C7CB 4XM2A 4DTCA 3W4KA 1TF2A 3Q1KA 4W1QA 3R8FA 4RZ2A 2V6GA 5CH5A 4E14A 4AM8A 5LMNB 3ZHBA 4WZAB 1JNYA 1WUJS 3K6SB 4KP7A 4DIUA 1XD8A 2A86A 2CLDX 1PNOA 1QCDA 2P5SA 2XMBA 1V47A 5ALXA 3NR2A 1D03A 2FUG1 3E23A 1HTWA 5AK6A 3G2MA 4QFMA 4U7PB 1ONOA 2JVJA 3O82A 2IC5A 1Z7WA 2CSUA 3UYKA 3T38A 8ABPA 2D2IA 1MRNA 2EYQA 4L8GA 2QMUA 4CM8B 2EL9A 5HFAA 3JW8A 3KTAB 2JPDA 2QX8A 1DWPA 2D1TA 1REQB 3ONVA 2IEBA 2H0RA 1VZ3A 2HMSA 4PNEA 2NU8B 1FYVA 3FSEA 2XOKA 4MWOA 1P4AA 3GCDA 4Y9SA 4YYZA 4RV4A 3LM8A 3PGA1 4CMEA 4NQZA 5JXJA 3BPSA 1XAIA 2PFGA 2NUAA 5BNIA 3L6DA 4HB3A 5G0SA 2PUFA 1SC4A 4JI4B 5EIBD 1L5WA 1FNBA 1LI4A 3OQIB 1G64A 4K6MA 1LH0A 2GVNA 3L82B 4EATA 3W6UA 3KVOA 4EAQA 1U7ZA 3LBYA 1CBUA 4EUSA 1XDBA 4CCWA 4HGQA 4NR0A 4Y2SA 4F91B 2GJ8A 3DBVO 3JZAA 4YRRA 3GFTA 1GCAA 4E7PA 2GM5A 1WETA 4EMUA 5T6MA 3N0VA 4YT5A 3VYUB 4RV5A 4D9JA 1UP7A 5KWVA 2JB9A 3M89A 3H1EA 1VKZA 3AFGA 1CS0A 2I22A 2OMEA 3L7MA 5JJ5A 2BFBB 3CINA 1ZBDA 3ED1A 4Y1RB 4CLXA 4JSTA 2OBNA 2GVZC 4H0NA 3NXKA 2VYVA 3GPBA 3I2YX 2QRQA 2EP5A 2WR8A 1ABFA 4XA8A 4ECAA 3A9VA 4EFDA 2ORVA 2DQKA 3GFQA 2PTGA 4E6EA 2XXJA 2P9HA 1Q0ZA 4CM1A 1FDSA 1P80A 4N5MA 4BNGA 4QARA 3PWZA 1WJGA 5HIJA 1RAGA 4B32A 5C7YA 3STXA 1FW8A 1ODKA 5JCJD 1BCRA 2AMFA 3O3CA 4OBXA 3WB2A 1PD0A 4DXHA 2QR3A 1DJLA 1LTKA 1JWBB 3AXTA 3PIRA 3UWSA 1PD1A 3RVPA 2ZM6B 3TCKA 4HWPA 3OUZA 3NBQA 4IH9A 4UJ5A 4GQAA 1DHRA 1L7RA 4OHFA 4MS1A 1THMA 4CHGA 3KSDO 4AUKA 4UOZA 4GX5A 3SOPA 1DTWA 3F7NA 3HC7A 1GYPA 1SWWA 3R6GA 3H5AA 2HWXA 4I5GA 1D4ZA 1DC7A 4HEJA 5JJKA 1EI9A 4E08A 1CRZA 1Z5ZA 5JXHA 6REQB 1KS9A 4B3BA 1FUEA 5FA6A 1ZRSA 3FH0A 2B1GA 2I80A 2OFXA 4EGCB 3UJHA 3PX2A 3AIIA 1N4AA 1B00A 3UMBA 1NASA 2QY9A 1GAQA 3LDFA 4W5QA 2CBXA 4YRLA 4CMAA 1A5AB 1YDMA 1QHHA 2JCGA 1IG3A 5K3OA 1DAMA 1VKRA 5JV5A 4YJ3F 2R4TA 1L7PA 1BHQ1 1G8GA 1O9GA 3D02A 1XTSA 1OI4A 1HQYE 3C3AA 4ZMSA 1C1DA 1T5TA 2IYWA 2VSYA 1QGAA 3KFVA 4WQMA 1JVBA 1MT0A 1N0VC 4OO3A 2R6CA 3CKLA 4BO6A 5GONB 1P1BA 3A06A 3WK5A 4AC9A 1P8JA 1EEXB 1Z8FA 2HF2A 3JYHA 4LK2A 3T1HB 1E7WA 5EKXA 5HRUA 1V8FA 3JQCA 4GUDA 4LHXA 4FEAA 2VK1A 1SKBA 1U3WA 4GMKA 3U7QB 3M2TA 2OWEA 4GO1A 1BVHA 1E8DA 2FEXA 3P9XA 4DBLC 2H29A 2I76A 3E9YA 3EQ2A 2QI9C 4EYGA 2HT6A 2GILA 2CC2A 3M82A 4KZKA 4HQFA 1QAMA 3F90A 1VYVA 4PTZA 5GVRA 4WTOA 3U3RA 3U4AA 4GGPA 5JISA 5KJ1A 2RH4A 3SQMA 3STHA 2WA2A 4KFCA 5FH9A 2QN8A 4PYRA 2D5LA 3JQAA 1QJCA 4CMKA 1TW2A 4P3NA 4UM5A 2B94A 4BQEA 1MUUA 3QG5A 4LF7B 2QU7A 2ATCA 2Z2ZA 3K30A 1OXKB 2PANA 1RJ9B 1WQ3A 1WO8A 5AJXA 4V39A 2FW7A 5AKZA 3TQTA 3RUCA 4DVGA 1JQ3A 2YXNA 4Q03A 2XMRA 4PFJA 1DBQA 2HSZA 4G65A 2WU3A 4HAYA 1J56A 2GZRA 2RHMA 3RSFA 3DLCA 3QU9A 4Y8VA 5G0TA 1CYDA 4DPLA 4UUNA 4LOLA 5C1BA 2JLAA 1BXRB 1X6VA 2O2IA 4IAOA 1CIVA 2ZRKA 5BMOA 4MPPA 1PT9A 4YK7A 4EITA 3VYWA 3GB9A 3HJCA 3GLGB 3ZEAA 5LDDC 3H5NA 1I5EA 3MIZA 1TCAA 3EHEA 4ZC1A 1GR1A 3G79A 2Q3LA 3ILVA 5E7QA 4N0QA 4LJ9A 5ARCA 5JEEA 3PPIA 2Y1LA 2DQZA 1JE0A 3O9VA 1OLUA 4HWGA 1WSDA 3FVVA 3KZNA 3SP1A 5D3QA 4G1FA 2B83A 3VDRA 1RWWA 2R47A 1S3IA 2PFSA 5EZ6B 3UV3A 2JVKA 3VO9A 1EFAA 1G21E 4JUIA 1M8KA 1MX5A 1HSOA 3ICEA 4M8NE 4NBLA 3MM4A 3OOHA 5DTJA 2EYUA 1XALA 3I62A 1FVXA 4P3PA 3GARA 3VR0A 4MGEA 5F73A 5T4BA 2R6GA 2AI2A 1U1FA 2FSVA 2VDOB 3HUUA 4KO1S 4BV9A 3DE2X 4GYJA 1JU9A 1J8FA 5GY7A 4H1HA 4HS9A 1CIJA 2XGSA 2GSWA 4MROA 4P3OA 5FYQA 2B99A 4CG2A 4TYQA 3HDHA 3MELA 2BMAA 3V4OA 5C8DA 4EZIA 3QPDA 1YRQA 4DKJA 5L3VA 2LBPA 2P68A 2K5UA 2YDXA 4IMPA 5E1OA 2MYNA 5LSAA 2XUFA 3F2VA 2FB9A 3PD1A 4MVJA 4IOLA 4XYEA 2QTGA 2AC4A 3LO5A 4MI6A 4BPBA 1BVYF 1YZGA 1CTQA 5K0NA 4EF5A 3WB9A 5AO9A 4HUTA 5BVGA 3DBIA 2X0KA 3MUEA 5CDHA 5T7BA 4OTZA 3I04A 4HNHA 1WWKA 3TD2A 3AQ4A 4DDUA 1C8VB 1JJ7A 3EPRA 3OTQA 1FDOA 1D0SA 1H5QA 1K9SA 1IEQA 2I2CA 4MJ7A 4V0NA 5LNK1 1GOTA 2V7GA 1SUDA 4IXWA 4AP5A 1CP2A 1UXIA 1Y9ZA 3ZCSA 5K8VA 3QA9A 3NYWA 5JSHA 3RHTA 1KMIY 5HIKA 2WJVA 1E0DA 3P27A 1JU4A 2YRFA 3WB1A 4G0OA 4BNJA 3ZE7A 3I3SR 3BZUA 2ZI7A 1NPYA 1W0KD 4LXHA 1Z29A 2FP4A 5DNWA 1EJ0A 1S2MA 3QPUA 1A9PA 4HFJA 1Z0FA 1OAOC 2GF9A 2PA0A 3OZTA 1KS2A 3KTDA 5CK4A 4L5CA 1PYDA 4BRUA 1NN0A 5CDGA 4ZVMA 3K09A 4F9EA 4XWTA 5IBQA 3TLGB 3LK6A 5KSOA 1H1LA 1TVCA 1WNFA 3KOOA 4XIIA 1F8YA 3QLTA 5IAJA 4ETWA 3PDIA 2D0IA 4CIDA 1DL5A 1ZINA 3LW7A 4C2TA 1YS1X 1DBWA 3DWIA 1NG9A 5JPIA 4HYQA 2UXBB 1LBSA 5TV2A 2K6GA 4I4TF 2P9CA 3LUDA 2HZ7A 3BFVA 4KR0A 1ZRNA 3WAKA 1QH1A 4DRZA 4Z4QA 1V8OA 1LC3A 2MT9A 1ESZA 4N54A 2BZSA 2OWDA 4JK3A 4C6TA 1YS2X 2HIAA 2DH6A 4Q48A 1V26A 3D3WB 4XX1A 1M2FA 2QJFA 4YP0A 4ZT5A 4EKEA 1EVQA 2NAPA 1VQ1A 5J63A 3MINA 3WGMA 1P3Y1 3DVAA 2B4QA 2Y0BA 1WHSA 4NAHA 1KZ1A 2A7QA 2GYWA 5D6NA 4OLFA 3LXRA 3P26A 1EX1A 3T4PA 1ULSA 2H54A 3P9RA 3OFNA 3R5FA 1PRYA 2OFOA 3AGQA 2G28A 1TZBA 3L7CA 1PTJC 3H75A 4PM4A 3BHMA 5B6PA 4GXNA 4CL3A 1A04A 3MPOA 5TXGA 3ZV5A 3ZZ0A 4Q3BA 4TMFA 2CYCA 3PHLA 1FLNA 1TEVA 2HMWA 3FLEA 4HQLA 3J81A 1TK3A 1SCAA 3M8KA 1X2BA 3UMFA 1KEEB 2YHUA 2GAIA 3GDGA 3OZXA 5M04A 1QC5B 1W36B 2FSVC 2FW9A 3HADA 2WQ6A 2VJNA 1Z38A 1FFSA 3K6RA 3WLIA 4Z7JA 1UKVY 3T7JA 2FUNB 2WG0A 4B09A 1UPTA 4O4IB 5ALUA 4N5LA 1GCOA 4P4TA 4DHWA 3IE0A 2VBFA 5LP6A 1E60A 4QKQA 1ZHHA 3F6BX 2I6TA 1RLOA 1WLSA 3IHLA 3OBIA 4IL5A 3CR3C 1FY2A 221PA 2WYUA 4MULA 2PL1A 5B58C 3LFHA 3M0EA 2JNWA 3CN9A 2HEIA 4F6CA 1QYVA 4PV7A 3HPRA 2EU8A 2XDWA 2GCOA 1DAHA 2CD9A 3DONA 4ND5A 3WBKA 1Y63A 2JZOA 1ENZA 2BUAA 1HFWA 3F4KA 5TARA 3PWTA 4TV8F 4BMZA 4EW6A 5C35A 1OXXK 4RS4A 4X0EA 4L95C 3LIPA 1JEJA 4BU0A 4DZRA 1WHTB 4N6OA 4RETA 1XCGB 2IS6A 3AF3A 3C6MA 4ZCLA 1WEKA 1QG6A 3AUXA 2IBSA 2SHKA 4N76A 2YJ6A 2FX5A 4N5HX 1KAGA 4BMSA 2D0DA 4G5OA 4QDJA 3KKEA 1AZLA 3STVA 3FPSA 4LIPD 4WMLA 1ZOIA 4IG4A 1H2WA 4DBLE 4F86A 1YKFA 1QFYA 3HVIA 3VO8A 2JFZA 2Z5VA 6NULA 1PJQA 3TR0A 4C2BA 4RZ3A 1GR0A 2A8YA 2JEOA 4UBIA 4YGXB 5THKA 5C3MA 5EXDA 1FLAA 1KZ7B 1N5MA 1Q7TA 3PZBA 4GM1A 5CBPB 1YZVA 1O8CA 1YR2A 3I52A 3IKVA 4KXMA 3T99A 2Q5OA 2PQ0A 4PTLA 4IF4A 3UHAA 1TD1A 1ZJJA 4C5CA 2I9KA 3PFFA 3V4VB 2ST1A 2X42A 1ISMA 3JALA 5DGTA 4YXFA 3Q8LA 3GPCA 4RDHA 2CY0A 2IHVA 3IT1A 4PX3A 1BEZA 5F7JA 4F38A 5JC8A 3ONNA 2AMJA 3GEEA 1SXPA 3P1JA 5UKDA 5T8KA 3O8RA 1X9IA 1MV5A 5KVVA 3MOGA 1V1JA 1S7CA 5EMMA 3D8RA 3UPDA 2XB8A 2ZSEA 3MILA 3BMNB 2CFIA 1JIXA 1BHO1 4JYMA 3HRIA 4MS4A 5AICA 5DYGA 2ZVPX 3SM9A 3M6VA 1ZJ5A 3WHPA 3R20A 4FYXA 2HX1A 4QGFA 2C3PA 3U60B 1C3OA 2AFIA 3D5TA 4RPKA 5BV2P 1X8LA 1YS9A 4QIHA 2MDTA 2AJCA 2XHEA 2R7AA 1IATA 3TZQA 3OJ0A 4A5OA 4P7GA 5B3JC 4ZZ0A 2YYSA 1ABEA 1GGHA 3P2MA 3LT4A 1PS8A 2Z8YA 3UGKA 4DLZA 5JBIA 4DR6B 3B53X 1QVRA 1P74A 1JAYA 1QG4A 1ZS9A 4NQRA 1XWIA 3IE2A 4D82A 4ZYZA 3T12A 4R16A 2ZRQA 1T0PA 1X3LA 1HQDA 4D44A 3QHQA 3IC5A 3DWGA 1ZA2A 1I3KA 1B8NA 4CG3A 3L7JA 1GPH1 4PN3A 4RIEA 3VYTB 3SLKA 1Y6FA 1KRXA 2WJGA 1BMFA 5D5QA 4OU5A 2IY7A 5F4BA 1CT9A 4FINA 3GH1A 2PKXA 2JCYA 1HE2A 1PWEA 1JFFA 4UFNA 4ZAGA 3HXMA 2DHQA 5LMZA 1FNDA 5LIPA 3TLBA 1L7AA 1ESNA 2QM0A 3NM5A 3DPSA 1ECPA 2ZAGA 2D1FA 2Q5QA 1USUA 3L6RA 3OFSA 2PH5A 4FFPA 1C7EA 4JCOA 1X14A 4FFDA 4ZT6A 3DO6A 2EZTA 2W6NA 4A0SA 721PA 1U1CA 5DO9A 1ESDA 1S6YA 2X5KO 5KTTA 3KT8A 1PEYA 1O95A 1E1YA 2O8EA 1UPXA 1C41A 3K5WA 3AF4A 1Z4JA 3ORSA 1VKNA 2XIJA 2K4MA 3QVVA 4O8CA 1Y8QA 3VHXB 2A0XA 3UC5A 2JFYA 4PC1A 3TJZA 4FMDF 3CSSA 1GTG1 1ZCBA 4DMRA 3T52A 3LDAA 2CLEB 2XUKA 4O2AF 5DNUA 3S5JA 1ATIA 1OWPA 1QB8A 2RB5A 3GV0A 1QNLA 3R0JA 2CJYA 2ZYHA 3WA6A 3KB2A 3O8CA 1SBTA 3PEYA 1DLIA 4ARBA 5KYNA 1G21A 1XPRA 2WIFA 1KH1A 2JGKA 4N7MA 3SPXA 1T0BA 2ZRNA 3N3BC 4WI1A 4P54A 4RAOA 3ZXSA 3CHYA 4EPYA 4PLVA 3GT4A 1IH8A 1KTVA 2CCKA 5J3JA 5DWVA 3RYHA 2Q1YA 3HVRA 1TM3E 2L18A 1Z6AA 2V9ZA 2F1RA 2G5PA 5C53B 4PLGA 3FGZA 5GV8A 5JWOA 4MWBA 1RP1A 1Y4AE 1JHDA 3D2LA 4MV0A 4IDCA 1ZUIA 3X1YA 4M1ZA 2HPVA 2BM0A 2O07A 4K3VA 2H11A 4WX2B 5K3DA 1ABBA 4RMJA 3FFTA 5T8KC 3KL4A 1U0GA 2WV9A 2ETXA 1PNRA 3NB0A 2AK3A 3FPGA 1L8AA 4KLAA 3WGVA 1KQPA 2W2TA 4OQPA 4TRNA 4J3NA 5JAIA 2ZYRA 4OXRA 1JR3D 3EC1A 1T9GR 2O23A 1B3BA 2VNIA 3GR6A 4KTVE 2PT5A 1TT5B 4UU8A 3TOVA 1P2FA 4AECA 2IHYA 5TQVA 3AT1A 3C3YA 2AOUA 2EEZA 4FD2A 2QAGC 2W8BA 3GRAA 4EA6A 2O5VA 3E84A 2GLXA 2Q4DA 5A2QA 1KO1A 1O96B 1C8KA 3QVJA 5HQTA 3AU9A 3CV3A 4GICA 1P3JA 3PI7A 1KE2A 1K7FB 4HXEB 3CG0A 3TNYA 3G0CA 1XAJA 2V7BA 1PL8A 2CF5A 4LDAA 1E64A 2VTVA 5FAXA 3JZFA 4C4YA 3I4LA 4EQ6A 4ZGBA 3GBSA 4ODIA 2WD8A 1OPXA 3WWOA 4BWVA 5KHOC 1WU7A 3UWOA 5BQ3A 2EBHX 1M0EA 3VC1A 4HO1X 1KAHA 4GZMA 1O3YA 3D6AA 4X7PA 4Z6KA 4F85A 2HNAA 4ZZ1A 1L7QA 2WM3A 1ZGAA 3NNNA 3O8DA 1M6HA 3LWZA 4LJAA 4XRRA 5ANRB 3H8JA 4CM4A 5JAPA 4R6XA 4C5AA 3QX7A 2PN1A 3T61A 2ZJZA 4P33A 2V4ZA 3QBJA 1BEUB 3N2ZB 5ALDA 5A03A 3S27A 1SCBA 3VU8A 3HABA 4M76B 4OAQA 4DABA 4R2HA 2XUAA 3QWHA 2AQIA 3ND5A 3MERA 3FZQA 3QEMA 2CL7X 4MHOA 3H1BA 1OTYA 3NBXX 5A6SA 1B74A 4CTJA 2R6HA 1Q7GA 3NEJA 4M46A 4QRIA 4X63A 5L40A 4QECA 3VO1A 1RCFA 3UJ9A 3VDQA 1RABA 1TPYA 4LMBA 3REFA 3RWMB 3BSSA 2Q3MA 4JL8A 3BMCB 1KOJA 5FWAA 3TZEA 1EUZA 1PJTA 2FOLA 2VP4A 2B36A 1X1QA 2ZDGA 2OHHA 1AF7A 3OEHA 4DXAA 1S3FA 5K5EA 1M6EX 3WC4A 1IPHA 4R1UA 1V71A 4WKCA 5SZIA 1HL7A 2VYCA 3HQ4O 3DMTA 3LXUX 4J1TC 5I7FA 3BXGA 3NGMA 2PUHA 4DJ5X 4F6LA 2WTUA 2GBFA 1JALA 1VP9A 3AF1A 3DOFA 1EDDA 1WW2A 1UWVA 1DSSG 1W5SA 3SJAA 3LHSA 1LFAA 2EQAA 3C7DB 1B7GO 2FGKA 3Q11A 1Y6ZA 3GAZA 3JQFA 1LRKA 3OJLA 1OXBB 2HREA 3P0RA 4Q7LA 4Y2HA 5H68A 2WBLC 2XKBA 1W25A 3PFNA 1XZ8A 4YEDA 2VJMB 5KTRA 3HUTA 1A8HA 4UVIA 3EXIB 3B7WA 10MHA 1C7RA 3IJEB 4OJMX 1G20E 4ALNA 1KYYA 4YUZA 4GXTA 2HJVA 2NVBA 2ZIEA 4DTIA 5JFOA 1P61B 2H3HA 4KW7A 1V3TA 3JARA 4NP6A 1FTQA 3WNZA 3AW8A 1M6YA 2QD4A 3PYMA 4HGRA 3TLCA 5A4JA 4LMPA 3WRXA 3L2OB 1ESCA 3WWPA 3RVDA 5KREA 2IX9A 3UHOA 1N7HA 3BGWA 3OE1A 3OWOA 1R4MB 5EOVA 4CQLB 4UASA 4N8DA 1XLTA 4ZAZA 3RHSA 3TG8A 3P4XA 1GG8A 3AP1A 3DLAA 3BDIA 3QY9A 4IKPA 2B37A 1WP9A 4DLNA 4BKMA 1P0QA 1J09A 4GVXA 4HPXB 5IFKA 2X3FA 4DCSA 1IZ0A 2WFZA 1U1IA 2CD7A 2FPIB 2J5QA 3D8TA 4ND8A 5BN1A 3SF8A 2PZEA 4LDNA 4DSNA 3TOXA 1YC5A 2E7ZA 3Q72A 4JVLA 3SBDA 3LGAA 3EGOA 4A82A 3HO1A 1GZDA 4FVTA 4TQGA 1R88A 1FFHA 4Q3AA 1DXYA 3HYTA 1FFWA 2Z8XA 1I7QB 4KR3A 2V7EA 3DAFA 4KREA 4HQKA 3QK7A 2Q5HA 3PLRA 1JEDA 1MX3A 1GZ6A 2JAUA 3SEQA 2GH1A 3FKQA 1C14A 4E5DA 1JVSA 4PLCA 1K3UB 1KDVA 3TI7A 3DWEX 3HV2A 4K81B 2AR9A 1EBUA 3ORHA 2BR5A 2YWHA 2X6QA 1JEYB 2XNCA 3CC8A 3BJMA 4NEQA 2JDIA 1SVSA 3OZUA 4MQFB 4R0VA 4V2IA 4YAFA 3RV3A 3THYA 1ZI6A 1HYQA 2NLOA 3H9CA 1XJWA 4Q4AA 2W2LD 2XZTA 1BCSB 1Y9AA 4RELA 3ON5A 1YR6A 4BO8A 5AI9A 2PPVA 4LVNA 4BMXA 5HA5A 2PE5A 4C7OB 2UDPA 1R9JA 1ZNYA 2XA2A 3AZOA 2D7CA 1JW9B 3T9EA 1YS7A 1MJ5A 5GOZA 2YXDA 4B74A 3UK6A 1OYOA 1LNQA 1UANA 4YAJA 1FP1D 2PGXA 3HJRA 3QHPA 4L2IA 3THRA 2B2NA 1NJSA 4ZDKA 2Q7XA 1KC1A 3S7TA 3DMTC 2AQ8A 2LIPA 3OJOA 1GN8A 3AWDA 4I4IA 4WUVA 1BU8A 1M1YE 1JKIA 2DOKA 4X1IA 4HNAB 1H6DA 2PUJA 3EGIA 4OXNA 1EB8A 1J1ZA 1DJOA 1QGED 2B2XA 3AJ8A 3F2IA 3JQFC 3M1IA 5LMUB 3V7NA 4MV3A 2IPOA 4MCIA 4JX8A 1NXSA 2JI6A 1AA9A 5DNVA 2G80A 2QM3A 4DBZA 3CTMA 2JKZA 1ORVA 4IJMA 1PSWA 3ZE1B 3L40A 2PEZA 1KFKB 3AKYA 3PICA 2D62A 4L5IA 3ZJ5A 5IX8A 5KOJA 1G8FA 1I0ZA 1OB2A 2XMCA 2YMLA 5JS1A 3PPYA 3TQSA 2J87A 3DP7A 4XB1A 3WRXC 5BQXA 4E15A 2R1VB 4FWBA 1UKZA 1Z33A 2R79A 1VTKA 1XLTC 3IUBA 3PUZA 4KGXA 2NUTA 5BY2A 3GVPA 4LF5B 3G2JA 2UXCB 1SBNE 4F4CA 2XUIA 5B1IA 1WCXA 4F5WA 2E4AA 2V54A 3CTPA 3PE4A 4FLEA 4RFSB 1BX3A 1VBMA 3VMMA 2F8SA 1XGKA 3ZTTA 5F33A 5D7NA 3C85A 2G83A 2NO5A 3CE6A 3IQIX 4FFBB 2Q4TA 4Q3EA 4U9IS 3ZXXA 5JSUA 4K0KB 2ZAMA 5ECGC 3DHEA 5B12A 4H4EA 3IVGA 1G8AA 1N5RA 1U80A 2WTEA 4P34A 5KTYA 2V0GA 3EVTA 3OZBA 3RGWS 1GCUA 3KLOA 5IAEA 2YVQA 3RYFA 1KBZA 3LECA 3AOGA 5KMGA 3DKRA 3M9XA 1YOBA 4Y2RA 1DC8A 2QRVA 3BILA 3OSUA 2IYTA 4FE3A 4B6QA 4LQLA 1FTGA 4HK4A 3N2LA 2Q28A 1XFDA 3WR5A 4F4DA 1M1ZA 2WEKA 1G8MA 3LUHA 4HMPA 4OREX 2V7PA 4FYYA 4LRQA 3JQGA 1G5HA 3IAHA 3SBEA 2BEWB 4QJBA 4MUMA 4RTKA 4MPRA 4AW9A 3M9LA 4LK3A 4LY9A 4F2DA 3WK8A 2UZ4A 3B8HA 4EUEA 3FKSD 2P4SA 2XUDA 4DV3B 1FRVA 4IUYA 1MNAA 4I1PA 5EUBA 2GCIA 2DEUA 4YPFA 3TKAA 1X7HA 1E2UA 2AOWA 1L5HA 1ODIA 1EVIA 2R3SA 3ICOA 2G06A 3ZK8A 1NBWB 2F6RA 1D1TA 4IMIB 4JI3B 1GPAA 1RRVA 2WUFA 3N2NA 3AFIA 4FYKA 2HAEA 2HRZA 4MWDA 4HQRA 4ZWNA 1MZVA 3PRHA 4ENQA 1YB2A 2W48A 2XUQA 4RSGA 1AKVA 1UM9A 2LW7A 3MWKA 4BMPB 2YNMA 2OXFA 3D7NA 4D79A 4PG7A 4L9SA 5FQNA 3CPJB 3TIFA 4OLJA 2Y9PB 4GT1A 2VTEA 5LA6B 3CO0S 4N4AA 4GOOD 4LGMA 1KJZA 3DL2A 4N01A 1KVSA 1Z2PX 3ACBA 4H15A 3LQ2A 1CJSA 4MA5A 4V0RA 2J0SA 3EBLA 4JUBA 2O50A 4M49A 4EHDA 1T1EA 1JF8A 4HP8A 3GLFB 3QFHA 4KN8A 1XT6A 1T8RA 2I55A 1MRSA 5DEOA 5FD8A 2ET6A 3MW8A 3WP0A 1N8KA 3I9LA 4ZOQI 2Q0XA 3VR2D 4C4XA 2R8BA 5SYNA 4EZEA 1GYQA 2V03A 1VYHA 2EDCA 3IVRA 3QSGA 4HZUA 2NOAA 4MUHA 5EJ7A 1WPXA 4IHAA 4U2GA 4ND3A 1SHJA 5LYYA 3V4SA 4ER6A 3MJSA 3U4CA 1A7UA 3BSWA 2PX4A 4DF3A 4MRMB 4E2FA 2G6TA 5I5GA 5A5FA 2VNKA 1J21A 4MV1A 1PGJA 1QYDA 2BWJA 2PZGA 2PZAA 1H4SA 4K9SA 4KQIA 4TROA 5I9NA 4XJXA 3AUAA 3UH0A 4C7XA 4D3YA 2PIDA 3OM9A 2XT6A 2FWJA 3BWCA 4NKRA 4YMWA 4BYMA 1EGAA 1HR0B 4HDMA 2DWCA 3DXYA 3IP1A 3KQOA 1TM5E 1U3FA 2QUAA 3NT5A 3DTVD 1MDFA 4KI7A 1XX6A 2IWRA 1LS6A 3EK2A 1K7SN 3D6FA 3L1JA 1P1JA 2APJA 3E4CA 3HNRA 4NYIR 4P3KA 3NHLA 4L74A 5CH3A 1M1UA 5IJWA 2X3YA 4WW0A 3UT5B 2IXAA 3PEWA 2A30A 4AYXA 3PWSA 3KEGA 3RJZA 2IOFK 3B2EA 2KB0A 4XLZA 4CGYA 3OCXA 4DB4A 3PITA 4RE6A 1YRBA 2YXPX 2QM8A 3UJ3X 4KSYA 2GF0A 5C7OO 3Q41A 3AKCA 2AN9A 2FNAA 3FJOA 2V1XA 3NAZA 1Z0UA 3E9ZA 2BKEA 1Z6QA 1UODA 1DC5A 2VT3A 3TWOA 1FSGA 4C2AA 1WSAA 2Q2OA 1D2HA 5LQSA 1U2QA 4AJ1A 5DLQC 1G20A 2H9YA 3ETCA 5AIAA 2Q62A 4MVJM 2GJKA 4MK4A 3RS9A 4D7AA 3KIPA 1K3TA 4JXKA 4X6LA 1ZAYA 1TLFA 2RCYA 1XZLA 2JLQA 4DEVA 1I2AA 4YJKA 1RRPA 4QA9A 4H7KA 4LX8A 2DB3A 3I04M 1UAAA 3N6XA 3ROEA 2E2WA 5EYPA 2G4VA 1E2DA 2J0UB 2IU0A 4EUNA 2CHQA 1RWBA 2QL5A 3C0KA 4EJ0A 4YRFA 2W70A 3TR5A 2WJ4A 3GFGA 3VV2A 2HQSA 2V0NA 3AM5A 4IFEA 3IIJA 3QKIA 4UNSA 1HT3A 5CA0F 1IC6A 3GO4A 4YFYA 3TZBA 4UPEA 4H6WA 5FWYA 4BOYA 1CSEE 2G07A 3RKRA 3JQ6A 4UUOA 2RAPA 2B92A 1IFXA 2BKAA 1TX4B 2LNDA 3V6LA 3F8SA 1DWUA 4HN9A 1VDZA 4AJHA 4P0PB 4HRYA 5T67A 1EH5A 5DH9A 4L1KA 4OMCA 4AURA 3EMDA 2R84A 4BNLA 4D9FA 3PS9A 2ZSKA 3BGSA 2E9SA 2ZOSA 3IQGX 4HDQB 4RK1A 3OZFA 3UAVA 1HYEA 4GPD1 1PGNA 4PONA 5CFMA 4QD3A 1MH9A 2QG6A 1RBYA 1NN5A 4WNAA 4D6PA 1Y98A 3S2EA 4QAQA 4DG5A 5JSYA 2ODWA 1S2NA 2ZSJA 4IZIA 4JJKA 4KO3S 4WK6A 1VPWA 4LXTA 1XVTA 2A88A 5AVKA 3LS2A 2QU8A 1BU5A 1O4WA 3QI2A 4JUDX 3UFXB 4BAGA 3SZ3A 1NLYA 2H2FA 1O0CA 4WZAE 3GPIA 4I2NA 1TEZA 1BS9A 3EXHB 1L7BA 4UEJA 2Y66A 4XR4A 5A4AA 2P2YA 4YJ2F 4JXZA 3DBOB 2O14A 2XQKA 2DUNA 1AUQA 3IB6A 5CUQA 4LDRA 1FK8A 2A78A 4K5QA 3DCNA 1XCBA 4NNPA 4RM2A 5CIQA 4EHIA 2WYOA 1YJAA 1DAKA 1FP2A 1JYFA 3ANMA 2E87A 5CT8A 3T0GA 3T3GA 4C3UA 2GCPA 1UFVA 4L16A 4DC0A 2UU9B 2IS1A 2GD1O 4NU5A 2WB2A 4R2LA 1M2HA 2ZULA 1M1YA 2WTXA 3W78A 1RLMA 2PMKA 3KB6A 3BAZA 1II0A 2JFWA 4IJWA 1EK0A 2J67A 4M0FA 1MP0A 3N3AC 5DULA 1ST2A 3K72B 4TXHA 1P0IA 4K8RB 4QHTA 4TRMA 5BMVB 5SYMA 2WIKA 3GC6A 3ZBTA 3KQWA 4R7TA 1DIBA 4HNUA 2ZREA 5B36A 4QQKA 4CI0B 2DWPA 2ZWAA 4Q16A 3VC2A 2R86A 5F52A 1GZ4A 1CB0A 5CFOA 2CLKB 1JAIA 3BGDA 3R4VA 3Q9NA 4BX9A 2GZMA 4YR7A 4OHWA 5JYBA 3U9LA 2DPHA 1Y42X 4NV1A 4PNHA 1TLLA 2JJMA 1NY5A 3DUFB 3ESZA 4X44A 3O8QA 2G08A 5H3LA 2PNJA 4AB1A 2VK4A 5JAMA 2FEWB 3ZX5A 3I9OA 3TNFA 5JO0A 2EZ9A 3UHFA 1BC5A 2C9BA 1YT5A 1CKEA 2H85A 5E1BA 4IPTA 1T3GA 4B5LA 1SIWA 1E3SA 2YJ3A 3IERA 3IR6A 4NFSA 4PAWA 2ZWVA 3MJ4A 3KQUA 4OQ4A 3EZ6A 4DIFA 5T5QA 2HMTA 3C2QA 3QVGB 3HJBA 2JIRA 5BR7A 1RQGA 2IGTA 2WJAA 4LQCA 1NKSA 4MQBA 2HF8A 4PZLA 1Z56C 1OIXA 4CKXA 5AJVB 1EJBA 1QLHA 4GC9A 5F1KA 4F04A 1N5JA 5ENZA 3JASA 3I42A 4JASB 2ENWA 3ILYA 3A1WA 4M1YA 2YYZA 3IODA 1ZWKA 3F5SA 5SY6A 4WCFA 1YB4A 2BJVA 4HI0E 4AZ0B 4OGGA 4V1CB 3TB6A 4HQ0A 2JCXA 4YO8A 1KJ9A 5J5CA 2UYQA 1VSBA 2II6A 4JOCA 4MQ5A 4GE0A 4ZFNA 5B55A 1NN1A 3FSJX 5J4LA 2SCUB 2H5EA 3QMMA 5BSMA 5BN4A 3B3GA 4P36A 1UT5A 3HYNA 2VNJA 1RLIA 3V1LA 3WRWA 4RQAA 2X13A 1D2NA 1U04A 2EFEB 3P2JA 1NQUA 1OWOA 4HAUA 4Y1GA 4EJSB 2GT1A 1DAIA 4N9WA 1EDOA 1T10A 2QQ0A 2N1BA 3RKUA 3RUIA 3W06A 1FUUA 3C7KA 4GOMD 2VRBA 1N75A 1QSGA 3D6UA 3E82A 2AD5A 4PZ0A 4RVUA 2Z8YM 2IF2A 3K9HA 3V4FA 3HU2A 1UT8A 2FHSA 5KNDA 3WAGA 1CJUC 2J0EA 3DZJA 3DV0B 2VNAA 2I3ZA 4O59O 2FSFA 2PQ2A 2BTQB 2UZ1B 3FCOA 4HAXA 1W6UA 2O1WA 2RI6A 1KJQA 5G41A 5NLLA 1TFUA 2CVPA 3VPDA 4C0WA 1F1BA 4OD0A 3RVRA 4WK2B 4BP8A 4WL0A 3LPAA 4P08A 5HF6A 4JI2B 3WJAA 2NN3C 3ABZA 2AYYA 3PC8A 3CRMA 5L7YA 4IO1A 4DCTA 2BZ0A 4ZHQB 4E5SA 4PCVA 3D7KA 5CT6A 2VEOA 3O7WA 3U6KA 3UY4A 3QVUA 2YWJA 1NJ2A 2GEKA 3I2GA 3R6LA 2DERA 3N0XA 4YASA 1CQPA 3EZFA 1T0IA 1AHHA 4KJZA 1H1TA 5TQJA 3EZLA 4WFKA 4CM6A 5GOTA 3ABSB 1XVUA 4QOGA 3H2YA 1AGYA 4MPDA 3NBUA 3MLBA 4QFDA 4MV4A 2WF5A 1GPKA 4TLLB 3OMWA 3NLLA 3V42A 3VQTA 2F3UA 4BATA 2OHVA 1SUWA 3BERA 3CPEA 3TQRA 3HJUA 5AESA 1G59A 1RPZA 1BTOA 5K8CA 4KDFA 5KOIA 4QQFA 1AQ6A 3AOEA 3E3OA 2WAMA 3UB3A 1EVJA 2Z6QA 4I9UA 4YRZA 3KP1A 1MEJA 4NZPA 3CA8A 1HDOA 2A5YB 4G0YA 2GWRA 2HFKA 4UHFA 2I4IA 4CETA 1K7YA 4A6EA 4TWJA 2E37A 3W1EA 2FZWA 5LD2C 2QTRA 1R0ZA 3CURA 1PEDA 4IHJF 1U3GA 5FO0A 4XCVA 3NC4A 3T06B 4JS0A 4KDEA 2FUEA 4KYIB 4DY6A 2R6FA 3UJBA 2ENUA 1CUUA 1GGMA 2Z57A 3CXRA 2HPHA 2WSMA 1FS5A 3FYHA 1J99A 2MYTA 1KQGA 1VIYA 1MENA 4B83A 4PPNA 1IY8A 3PFIA 3W90A 3EZ2A 4WDQA 1GLVA 1H8HA 1HG0A 3G8CA 4NYMQ 1AO3A 1RLUA 2D7DA 4QODA 2QBYB 3QXGA 1EIZA 2FEPA 1W4LA 1RP7A 3JAKA 4U3JB 3VDMA 1AJEA 2HHJA 3OC0A 3C8HA 4HWTA 4ZYLA 2KPOA 1J42A 3S7ZA 2WZDA 5CYPA 3Q6NA 3E3LA 4EMBA 4GBGA 4YAIA 1V8ZA 1W29A 1LV8A 4M1KA 1CR2A 2VH2A 2NO0A 2ZBVA 4KH0A 4IIFA 3L0IB 5C0OE 2NU9A 5GWXA 2YHAA 2B78A 1GA6A 1BE6A 4WY5A 1T3SA 3CO5A 2QUBA 2V6FA 4XEHA 2OO5C 4ZQFA 1SCJA 2OB2A 4PHCA 4XW2A 3D31A 4XQ9A 3A9SA 3ZE6A 2BMFA 4QXRA 4I50B 1FU4A 1ZSVA 5KVQA 1T3HA 4CTOA 3OD1A 3R9KA 5DNCA 1JFRA 2J5KA 1KK0A 2Y1XA 1OD6A 3A6ZA 3BQMB 1Z0IA 1MVLA 3FZYA 5C51B 5C3UA 1XMSA 1RWKA 1WNTA 1NKVA 4ARVA 3I5XA 1GPJA 2DTEA 1NRJB 3NZEA 1W9MA 3BD6A 3H3JA 3T5CA 3KYCB 1OBCA 1SXGA 1DNPA 2B25A 2ZIFA 1T5HX 1CQJB 4IY1A 3WGTA 3IP9A 4MCAA 1FXWA 3PNKA 1Z18A 3QWAA 3AXSA 2GN1A 4AJLA 4I5FA 2YZKA 1FXUA 1O94A 1WUHS 2DBRA 3W3AA 4WJZA 5AVVA 5GV7A 1X39A 3CR7A 1A1VA 2P9BA 4DEYA 2OCGA 1UBTS 2ZS9A 3GUCA 1KO4A 2F2TA 1W88A 1XD9A 1ZM2A 1QOZA 4AO6A 1IZ8A 1RKXA 3IOEA 2QLNA 4M9ZA 3OAAD 3WBJA 4CQMB 1JIUA 4KAJA 1CUEA 2WF8A 4AAYA 4NBNA 2QN1A 3L7IA 2WHXA 4WZAA 2OLJA 4UUQA 4C07A 1CZKA 2QYTA 3P8ZA 1JWLA 3IQEA 3HR4A 3IA2A 4ILKA 4HAZA 4JP8A 5B2ZA 4GEGA 1WCYA 4KB5A 4DCUA 4DE5A 4J76A 4IF6A 3QXJA 3R74A 3HI4A 5FPYA 3VSCA 1Z4NA 1XZBA 2UVDA 3QYPA 5E2IA 5HF8A 3V2HA 3AEUB 1EFKA 4CM8A 4PZZA 2FW1A 3EIOA 4H7IA 4JT9A 1RHKA 3D0QA 3HCEA 1N2CB 3DFFA 3KTAA 1REQA 3CRZA 4O5AA 3K1AB 4B84A 4MDFA 2NU8A 2ZB2A 1I6KA 4QLOA 4B81A 1NMZA 1VE1A 5M5BA 1WXDA 3FI9A 4GKBA 3O1HB 3G9ZA 4QDOA 3ER6A 4JR2A 4UUBA 1POXA 2YOGA 4QUEA 4OQQA 2ZIAA 5FTMA 3DXXA 5EZ5A 1CEXA 1N25A 3TMKA 4QG3A 2CMDA 2WG1A 2XAAA 3AB8A 4X92A 3BK2A 3OQIA 1R0WA 2BE9A 4G97A 5DF1A 4YQFA 1JFSA 3GVXA 4JFRA 1QQBA 4OQDA 1R0KA 1P3DA 3KELA 4HX5A 3T5PA 1UC4B 1FDRA 3E8SA 3GBVA 1H5NA 4EHKA 2MR6A 1LC0A 4G4JA 3HWX1 4QGBA 3Q7PA 3VI4B 1C0LA 1GG9A 1JX6A 2ZK7A 2HBZA 1T91A 2RHLA 4JVSB 4RLSA 1PR0A 3SWWA 4G1BA 1GYRA 1CY0A 3FOAA 3QMVA 4GSLA 5DE3A 4E21A 3ZD8A 3AU8A 3PTAA 2WNHA 2GBPA 4ZPJA 1XFAA 2DGDA 1CUXA 2BFBA 3FGOA 3QXSA 2HCRA 1QKKA 1KI8A 1OYVA 3IAM1 1FYXA 1YR9A 1UK8A 2RK4A 2QRPA 3H5TA 3HCWA 4LXXA 1ZJYA 4M1TA 4NRDA 3KS9A 4MVJI 2Q0HA 4CPDA 5FTLA 1TUBB 2ZIGA 3OZDA 4KYUA 5JRZA 2J31A 2O0MA 1QS0B 1U0FA 3NHUA 4HWOA 2KX7A 4EI8A 2SICE 1AMOA 1R6BX 4W5HA 2FEAA 4FGZA 4D8WA 3KXIA 4ERXA 4LVUA 4GR9A 2DULA 1YIOA 2BHRA 3BIWA 5K8JB 4X62B 5D3ZA 1XNQB 1V8BA 2D6FA 2OQVA 3SSNA 2OM2A 1JQKA 3ZJTA 3D4IA 1NMEA 4O4LB 5ESWA 2QDXA 5FOQA 4ZCMA 2HJRA 1Z5WA 1YE8A 2WI8A 1F48A 1KO8A 3ZR4B 2I4NA 4QTXA 1BX0A 2CNLA 3ZCTA 4K46A 4DSZA 4B3HA 3DXZA 3ET5A 3LK7A 1NQWA 1LBHA 1RQRA 1Y3BE 4ESEA 4OQEA 3CUTA 3ADBA 5AK4A 1LPPA 2GUGA 1V6CA 2XD4A 1VG9B 4PZUA 5JYDA 1ZPDA 6REQA 3RSLA 5LQJA 1E9DA 3R3ZA 421PA 3ZGZA 3V1UA 3MTQA 3WNDA 5HOQA 1U9ZA 3CH6A 3AY6A 2NPOA 4OGWA 3GAFA 4F5ZA 1EESA 1QOQB 3GI1A 5C1DA 3PIIA 1N6KA 2WNIA 3GT7A 2BEJA 1L7MA 2P9FA 4ZT3A 4GGOA 2RARA 1DV2A 3UTDA 3JX9A 3GFOA 3TW0A 1B0UA 1N5LA 4MZXA 3UF0A 3DOCA 3RRNA 3TEFA 1AHIA 3OD5A 2ODAA 1N34B 3KZMA 5HKBA 1MB0A 4ZAWA 4QDUA 4KPUB 1VA4A 1W5FA 2QI9F 1RBQA 3G2LA 3N8IA 13PKA 3GUUA 5I9IA 2AN5A 3U3DA 5GONA 2ZQYA 2Q7DA 5C1OA 5JH7B 4V0QA 4YJHB 4GXQA 5B1DA 3QKSB 4L5YA 2HEGA 4CL8A 2JFQA 5IN5A 2W6ID 1Y4DE 3U7QA 2WWTA 4D43A 3J7AC 4KG7A 1G1AA 3KRTA 3NTRA 4KX5A 4G3XA 3HYLA 3VR6D 4DKXA 3IT0A 4G2TA 1P0FA 3PJEA 1R0LA 1RIIA 1LDMA 1CUHA 4LVCA 3RD5A 4PAOA 1IY1A 1J07A 3EASA 1T8WA 1QOPB 2C4KA 4XVCA 1OBFO 4KL8S 5I6DA 1RCUA 4I19A 4M9XA 1VG1A 1OPRA 2VQ3A 2FJPA 4R3WA 4B3IA 2O0JA 3LBIA 2F4VB 4CZ2A 1NR1A 2ON6A 4X61A 2XT0A 1BWSA 3FRIA 4IS2A 4OI1A 3WLOA 3AF0A 2CV2A 1RRMA 2OPBA 3DOEA 2JLSA 2FMHA 3H1FA 4QPCA 1IDN1 1RJ9A 3NHWA 2QL7A 1EVLA 4M3NA 4IO0A 1IPFA 3H84A 3U4IA 3OE7D 3WO1A 2OD7A 3EC2A 5FTJA 2B4KA 5KDLA 5F2KA 5FOXA 5A7FA 4P81A 2VJCA 3QUCA 5DIFA 2ZETA 5EJFA 1UL1X 1US8B 4RAQA 1BXRA 1V39A 4KWTA 4AJEA 2FFAA 3BD9A 1A76A 2NUBA 1J8DA 2J9RA 3H9BA 4OEHA 2C7QA 3F9IA 1RPTA 2IUEA 4MI9A 1R9GA 4S1NA 5FTWA 2EBUA 2YVUA 5AI0A 3EYWA 4FXOA 3UA4A 5ETJA 2Q49A 4G84A 2EARA 1KDPA 2PX2A 1E2HA 3KJEA 4MUEA 4C7BA 4JA2A 5F9HA 1QRDA 5TEWA 3VPHA 1FIUA 2BMJA 5KWSA 3UPTA 3VTFA 3T34A 1W85B 5JECA 1GARA 2CMFA 2JFHA 4GZLA 1PLKA 3PCRB 4FW8A 3WZLA 2FFBA 4GQIA 5LBIA 1Q0LA 5BPFA 2Y27A 4EMTA 3WYFA 2IPMA 4LXGA 3WL5A 4TMKA 4WKNA 2YJ5A 2XEDA 4RHUA 5JSFA 4F21A 1KJIA 4OK5A 4GOXA 1WBDA 1F2DA 1DCFA 4A10A 4U9HS 4XGIA 1RCTE 1IZZA 1RLJA 3A6HA 3O5AA 4RVDA 1BE0A 4XB6B 4HGNA 1Z17A 4R7GA 4X85A 4PX9A 3ZD6A 1R6DA 4C4ZA 2BRUC 2KE5A 4FHZA 3L0CA 3OQBA 1E7QA 4Q7QA 4F3TA 3FDJA 5ENVA 5LCXA 2LPMA 1HZZA 4RBNA 2EFGA 4J0FA 4V0LA 3EFOB 2YWGA 2OYRA 3ML1A 3D8SA 3UMMA 2RKBA 3BE8A 3PR2B 3TN7A 1MFPA 2YY5A 1ARZA 4BGDA 2XNDA 1XPUA 1RMQA 2D5AA 3IFSA 5A3VA 4YMLA 3M1LA 4H4CA 1GZ7A 8ADHA 1JNXX 4L6AA 4NCXA 4ZALA 1J2YA 1IYZA 1O6GA 2NZWA 2PMCA 5TF4A 4AZ3B 1KMQA 4RVFA 4GG1A 4XVRA 3ITDA 1ZM9A 4WGFA 1GV1A 2C8KA 3AI7A 1GGFA 4GSKA 1O6ZA 1ZIPA 2J4CA 5I7RA 4B47A 4C7JA 3II6X 5EP2A 1MC4A 1P91A 2VT7A 3H8VA 1XP8A 4MYDA 1J1IA 4XTCS 1VJ0A 1U5CA 2FAXA 2YIJA 3H8SA 3B89A 3M70A 3MS2A 2VSNA 3TLGA 5FV7A 3TX6A 5CYOA 2AF4C 4J75A 1LFDB 1VE6A 3R3UA 2OOSA 5DHAA 1H2FA 3KHKA 4EB6B 3CU5A 1FW6A 4DMGA 2B5WA 2V55B 2C5GA 3VZBA 1ND5A 1W0JA 5CIYA 1KARA 1DJNA 1XCMA 1YK1A 2WF9A 2XVYA 1ML4A 4PRKA 4PYMA 5J9FA 2VQFB 1TIPA 3OZEA 2OBBA 3I9KA 4LKRA 5F3RA 4N0DA 4HTAA 4EX6A 5HXAA 2XRZA 3ZQ6A 2VJAA 4KNWA 2JZNA 3IUEA 4KH1A 3M3PA 2BKVA 3D3WA 4G4SP 1SCUB 4IEIA 5HUJA 2I4TA 3TM5A 3JVIA 3K94A 2VT2A 1ZCJA 1WMAA 3K2QA 1NJGA 2I33A 2WSSA 3PUJA 4FE4A 2BMDA 1GL3A 1GL7A 1KP9A 1QIIA 2HO5A 3FRJA 3AERB 5EUQB 3AF2A 5F64A 4RLHA 3NWEA 3T5MA 1IAQA 2ZSBA 1V41E 3ICWA 4QASA 4RSHA 5AWFC 1T9HA 1U6IA 3AR4A 5DNDA 1NUAA 3RS4A 4AO7A 1Q0UA 1T4GA 1TB4A 1LPAB 5EXXA 1Z3IX 2XYVA 3IMFA 4PFQA 1EVZA 4PRLA 4UNPA 5EL0A 3LIIA 5IT0A 4LYAA 1LS1A 3OCZA 4INAA 3UK1A 3C3PA 4ARIA 1S1MA 2C3UA 5HGJA 4MV8A 2WU0A 1KEEA 3Q8XB 4ISBA 3PXBA 3CVWA 1JILA 1QC5A 1TZ2A 1LK7A 3DEYX 3FPBA 4BKPA 1BAPA 3I9V1 5CHYA 5EIWA 3VAAA 2PUGA 4QU8A 4O5OA 4OCZA 1XRNA 3U5ZB 4R1TA 3EVBA 4O4IA 5JXIA 2Q3JA 5JY6A 1H66A 1NW8A 4DA7A 4QYXA 2R00C 1IN6A 1OREA 1Y3HA 3L4EA 3WKEA 5IJ9A 1G5FA 2F62A 2MSKA 5FF9A 3AEKB 3ZLBA 1NQVA 1QIFA 3JYQA 5L4LA 2J8ZA 3L4BA 1HLDA 3ZOKA 4J1NA 4GH5A 5A4FS 5E9WA 3OJCA 5F23A 1HZZC 4F2WA 4YY3B 2JGIA 1Y3AA 2JIZA 3AR3A 4QTUB 1COWA 3U7FB 1HDZA 3WLMA 2QRNA 1ZU4A 3V55A 2WIGA 1WHTA 4MWTA 4PANA 1FQJA 4K6HA 3UANA 5C5EA 3FCUB 5IUKC 1RPAA 3OO1A 4OQNA 3DOIA 1B93A 2ETVA 3L8EA 5KU7A 3BDVA 1OFUA 2FA9A 3ENZA 1E5VA 1AQYA 4JHXA 4B17A 4ABTA 1JHPA 3F7MA 1WSWA 1YZUA 4YMGA 1NVGA 1JR6A 3ESYA 5DBFA 1ZNZA 2D4AA 1X9HA 1TCUA 2ZU0C 3BJZA 3JAWB 1NUHA 4ZEOA 2O7QA 3QOWA 4YCAA 4BWYA 4CLHA 1TO1E 3LA8A 4MV5A 4N5DA 5EZYB 1MORA 1PX0A 2ONJA 1T6ZA 4D0SA 3W8NA 4QX6A 1IZYA 1ZX1A 2VPTA 4G67A 5AVOA 1N0IA 3RWBA 2CUTA 2VKTA 3LCMA 4OMDA 2VPYA 4CF4A 1W59A 4ZPXA 4QSHA 4NL4H 4RCZA 1AKQA 1QIEA 3HCNA 3NOXA 1RPNA 4IINA 2P8JA 2WC1A 4U1RA 1E9AA 5EIBC 2CWDA 4PPGA 3U26A 3JQBA 4CEIB 2VXBA 1LW6E 4W82A 4A0QA 4LFAB 1FQWA 2ID9A 2XA1A 1NP6A 1WW8A 5K51A 4CKCB 3U48A 4MDYA 5D3KA 2ZSDA 4I55F 2X15A 1DKPA 1D9XA 1WCV1 4UBJA 1HRDA 4LHEA 5J4HA 3RU3A 4Z2YA 1E1LA 2IIPA 3BMNA 3LAWA 3L9WA 5FNVA 3L1UA 4YQEA 1TJ3A 4L15A 9MHTA 4C14A 3PF8A 4NX2A 2D13A 3UC9A 4HCJA 1PJCA 4RZSA 3CPSA 4DWVA 2FW0A 1T9GS 2IPAB 1XN1A 1U7TA 3R5XA 1T4BA 1IY0A 2FE4A 4WEQA 2AWOA 3VPCA 5HSGA 8GPBA 1DQRA 1XHEA 1GSAA 3PHGA 2BL4A 4A0GA 4ZK6A 1ISPA 3T3NA 3B36A 2F3RA 1Q50A 2JGJA 2GASA 4O4JF 1B42A 1RC1A 1Z88A 2PL5A 3C3KA 4DMFA 4KR6A 1N3YA 2QV7A 3ZC3A 3U9TA 3V1NA 4ID3A 2CNDA 1UDCA 1EK2A 2E49A 5SZJA 1IM5A 3WVNA 4X65B 3WL6A 1W36C 5IF3A 2WNSA 4RY2A 3O1JC 3RC8A 5EAIA 1ZK2A 5B6JA 3D54D 5SICE 3WLLA 3F3MA 3JTMA 5BO5A 3T9DA 4ZOLB 2PWPA 2W58A 2XB6A 2ZBUA 3ZXYA 1SBHA 3EZGA 4UQLA 1P4RA 3EGWA 1YRYE 4XUCA 3TFOA 3L4BC 1HFEL 2Q9BA 4TUYA 2XTMA 3A6KA 4NENB 4L3WA 4NPAA 1RC8A 4Z0NA 3ME5A 4AN4A 2CUZA 4JKYA 5B5SA 4WCVA 1UZUA 2DWOA 1Z9BA 4WA8A 2C5FA 4DSTA 2YZMA 3PL1A 2ORED 3DDOA 5DX0A 4JLWA 4IUBS 3GLHE 3VHXA 1XTZA 3Q2OA 1V11B 1KZ6A 3E5RA 5F78A 2XUJA 3L7KA 4GRIA 1ZG3A 4FGLA 1IUPA 1ZIDA 1ZOOA 1Q2UA 4J0HA 4LI0A 4JZKA 5FX2A 2P4EA 3K1ZA 2BSQA 1HNNA 3EDYA 3RJ9A 2ZANA 1Z4PX 3FAZA 4HQNA 1FFEA 3TTUA 1IWPB 4J7CA 3RIGA 2JFGA 4F92B 2P9QA 4QBHA 1M0TA 2W2VA 4TT3A 1WXIA 5DOVA 1Q0HA 2QNBA 3GUYA 3I0MA 1ZOPA 1UWLA 4D9IA 5C8ZA 2IHKA 3EOAI 5CHEA 2DQ4A 4FDMA 3QVTA 1TMYA 2HA0A 4HLUC 4P98A 1B15A 1M8GA 1NYQA 3RDPA 2E89A 5A4MS 1KK1A 1RYYA 1NPDA 3I39X 4J03A 4EO4A 1YFLA 3PKZA 2IX3A 5IJZA 1GFWA 2BGKA 2NXWA 5C7IO 1N6HA 2UYHA 3AH8A 4LN1A 4QJ5A 3SZOA 3EPJA 4DNFA 2ZJ3A 4LE0A 1E4VA 4C05A 1Z34A 2WLSA 5DISB 1KIAA 3FJ1A 1H6AA 4KAXA 4QE3A 2BEVB 4M8SA 4QUHA 4B31A 4D0NA 2ZE5A 1FMCA 1KEZA 2A57A 1VI2A 5FULA 5KYXA 5IKXA 1DDGA 2OGWA 1TT5A 2QE7D 3HS3A 4M60A 3F9RA 3USZA 2P41A 3KR1A 3WLEA 1CF4A 1FYWA 4MKGA 3SJ7A 3FWZA 4QHYA 1RWOA 2X4GA 4JOBA 1ZMTA 1O96A 2GETA 1I1QB 2Z83A 1VLZA 2PSDA 3L18A 4OHPA 4BO3A 2CL6X 4COOA 1ORHA 1II8B 3UVEA 1PR3A 3VH4A 2SECE 2IYPA 2FK8A 1Q7EA 4Q4JB 4ZN6A 4JQYA 4L22A 4XOUA 3QFFA 5FR2A 1Q7CA 2DHEA 4XD7D 4MKHA 1TF7A 4O3FA 1AHPA 1F0YA 1W94A 4AK9A 1KTIA 2YH2A 2FMXA 2Z2XA 4JYBA 4IFTA 3R77A 3LX4A 4M8KA 2ZS8A 1THZA 1PR9A 2HK6A 2QPLA 2VYNA 3O8BA 3S55A 5MHTA 2XBMA 1MU0A 1KYZA 2D1QA 1YI1A 3JQQA 4G0QA 3WMWA 3K70D 1UJ4A 3CWZA 4OX9B 4PXYA 3PNMA 3D0RA 4OB6A 2QPAA 4RZXA 1KMNA 2YL2A 3QE3A 1ULUA 1VM6A 1Q1EA 3GLRA 4KFUA 2XCOA 1JLLA 1TM4E 2WTMA 1ZN7A 2B98A 1ORTA 3IIKA 5FLYA 2PFKA 1I7SB 4OUDB 2E85A 1CV2A 3WGQA 3PQCA 1QFSA 2I78A 3K4PA 3T7RA 2XE4A 3DJYA 3RRXA 2RHRA 5BSTA 1P1CA 3VDXA 1JBEA 3RK4A 2WPNA 1A8UA 2HCBA 4MINA 2VPPA 1X94A 5JI2E 3GP8A 1C30B 2R66A 4YACA 1X7YB 1TJYA 1KKMA 3BMCA 4U5XA 3RS5A 4M0CA 4MGYR 3NTVA 4B3MB 5FYDA 2XMSA 1YBFA 4RVSA 1AQIA 2X6TA 1MHTA 1UCFA 2PU7A 4P5DA 5EMLA 1NTOA 2FSUA 5FIUA 2DQYA 4GKVA 1V25A 2HM7A 5FI1B 3STTA 3I1JA 2OA0A 2ACVA 1KAMA 2C99A 4DUGD 2XB2A 4URZR 1ZK0A 3B3QA 3EZ9A 3MMSA 4TTRA 3FGNA 2AK2A 1R4NB 3I6QA 4PBRA 3TRIA 2OSVA 1WDKA 3T5DA 1G5IA 2PK3A 3QKUA 3OQVA 3ST7A 2VJMA 5DSTA 1FB5A 1NMQA 4JJEA 4YCLA 3EXIA 5AW6A 2MTBA 2I1LA 4LXUA 5K0GA 5HCNA 3P0EA 3Q3IA 5JMWA 4L07A 4LZWA 2FFQA 3A6JA 5SZKB 3MHPA 4Z9XA 4IDBA 4M4SA 3T3OA 2PD4A 1DTSA 3AVOA 3A9TA 4RESA 4JBYA 1ISIA 4BQRA 2LUOA 1AHNA 1R4MA 1JKJB 4CQLA 1W73A 4IQ8A 3U2QA 5JTUA 2W83A 2X8WA 4UDXX 4H2DA 1CUZA 5IAOA 3I9NA 1QVAA 1KY4A 2PBFA 2XKJE 3DZCA 3FNBA 1JIKA 3MAJA 4NFYA 1J24A 1OVGA 4B75A 1W9HA 1U7PA 2FPIA 1QHYA 4B80A 4V0ME 1PT7A 1JKXA 5D01A 4QEKA 5LXTB 4GL4A 1E4EB 3L1HA 3TAXA 3IJRA 5DHSA 2NX2A 3E0XA 3QU7A 2BDTA 2IXDA 2CYAA 2WOOA 5E1DA 4Z9YA 4HPWA 3MC1A 2DF8A 2J3HA 3OZCA 3LC2O 2C4UA 2ISQA 4BTVA 4BC1A 4ZJYA 5B3LA 3EOZA 4TKMA 3B51X 3EIQA 3GLQA 2VDNB 1QH9A 3DL0A 4RD0A 1Z6YA 5BYKA 4H1UA 4OL9A 1EXMA 2JAQA 2R8PA 3A37A 2Q7OE 5I47A 1TL7C 4DA8A 5TE9A 5HFJA 3C1TA 3P7MA 3SK0A 5I4KA 3FSGD 3UMSA 2X9VA 3KT3A 4PO9A 2F1IA 4BQNA 1QP8A 4MQFA 4TSRA 5DIZA 5JAOA 5JNTA 1L5OA 2B61A 2XQIA 4HSGA 2WWGA 4D9KA 2VUSA 1W4CA 1RYHA 4KQHA 1M76A 1BCSA 3NHRA 3KQHA 1OBHA 2H1RA 2FZKA 1HNZB 4ZOAA 1B6GA 2FETA 4YRGA 3CFYA 3LT1A 4URWR 4ZVQA 1AB5A 4WNIA 4AZSA 1WD7A 4UNRA 2OV8A 4C7OA 1IVSA 1PYGA 3C45A 5FR1A 1TJPB 1W581 2FWBA 3HY4A 2X4DA 3K0EA 1AUXA 3UXEA 4Z0TA 5JZ9A 3GRYA 1EX6A 3VVBA 3M6MD 3LPCA 3L8FA 4QFCA 3VAYA 1XO1A 4Q6BA 4PCAA 4XIJA 2QXTA 3BGVA 4YT2A 3NBFA 2Z4RA 4QRDA 1JHAA 1QQAA 4KDCA 4CLRB 3CVOA 4HNAA 2RI1A 4JEIA 4X60A 2O2YA 3Q40A 5F2EA 2HJHA 4I1IA 4EHAA 4M2LA 3E2PA 7REQB 4KO4S 4J2OA 3RANA 3KBBA 2PRKA 2ZTHA 3SC4A 4LV6A 3DFUA 2J46A 1SHUX 3ROFA 3PSAA 4YXWD 4XR9A 1Z74A 2GD2A 3M5CA 4MUGA 4R9SA 1D07A 3RRYA 4FMPA 2N46A 3IEMA 4B40A 2EEPA 4EJMA 3GGPA 1B6TA 3A26A 2GJAA 2I2BA 2X2EA 3TIIA 3WGLA 2PS1A 2IY8A 4WHMA 3L5OA 5JWRA 3Q2IA 1UKYA 3RTCA 3K05A 1UBFA 4QJ4A 2R1VA 3DM9B 4BFLA 4ZAVA 4YGYA 5CFRA 4KVZA 5ECDA 1PU2A 1RJEA 3AUJB 2GK4A 4HUJA 2NYRA 1KI9A 3V1YA 3L46A 4UFOA 4NNJA 3VTAA 4JYCA 5JT1A 2XWSA 1N8NA 1HYGA 2H4ZA 4RJJA 3R9IA 5BUCA 3X1MA 4RFSA 1MKYA 2C9DA 4TSFA 3ITNA 3EHDA 2EP8A 4FFBA 1R4AA 2RGEA 2G9RA 2OO7A 2P5YA 3JRNA 5FORA 4LBZA 4XGNA 2VHZA 4KQGA 3BDAA 1A9SA 4XWYA 1A3CA 1BGWA 4Y6RA 4E22A 1I4DD 1JWAB 5EP4A 2HSGA 3D6TB 4G9EA 2G5CA 2IYOA 4J3FA 5CDSA 2EDAA 1Y6RA 3F3SA 2QYHA 2NO6A 2B35A 4O29A 2Q4EA 3P9YA 4U6NA 3LYHA 5IEJA 1LBEA 1XEWX 4AO8A 5JARA 1ZKDA 4E13A 1G4AE 1QG0A 3O1IC 1KI7A 2KJQA 2IBMA 3HFJA 3BX1A 4IX1A 1QIKA 4PO8A 3E7XA 3PFHA 3WDKA 1ISJA 3G2NA 3JQ8B 4KGVA 4ZQBA 4BO4A 5C1PA 1NVWQ 1A9XB 3VZPA 4DQDA 2BEWA 1CUVA 3AUSA 3HNPA 3QELB 1PX2A 2FFHA 4DOMA 1PWXA 3W7AA 1JMKC 4R5MA 9ABPA 3H1AA 3PEUA 3TB4A 3IR7A 2Z30A 5FOTA 2WHPB 5EGNA 5IMSA 4W1RA 1CD5A 4Q1BA 4UAJA 2RKOA 5EPOA 5EUCA 2AJDA 5M3BA 4CL2A 1YASA 1BA3A 1B8UA 1E2PA 1SQ5A 4C21A 4LYGA 3G5MA 4HDRB 5DGXA 2XOKD 4BB0A 4LA4A 5HNKA 1QHIA 2HY7A 2KW5A 3K8OE 1TTTA 2Y68A 2DP4E 4RHFA 5HQJA 2VDQB 3ENWA 4BTLA 3KQQA 3R7FA 3ZLVA 3F46A 5FCDA 1K5DA 1EYZA 3QVSA 3UAXA 1EX7A 2DM6A 3E7FA 5LA6A 3NIDB 3SF0A 2D1YA 4NCBA 1DOAA 5H81A 2O19A 4IDHA 1DGQA 2C95A 1JDSA 3DAGA 4U7TB 1VCNA 4KOEC 1L4KA 4IM7A 4H08A 4DNQA 3FTPA 4OHXA 1GAJA 4F3YA 5G1PA 3ZUGA 2IW3A 2BYTA 4H60A 1M0SA 3E9QA 1NHWA 3E48A 3GLFA 1PEAA 1Y81A 3DGEC 4XWWA 1LPSA 1DFGA 1VLJA 3BKXA 4JP1A 2VHEA 3KM0A 3WYDA 3ZE2B 2WWRA 9LDBA 2C7OA 5CRIA 3LBFA 3BWVA 5ICFA 2AKYA 4FWIB 1QONA 5H16A 4XYBA 2QF7A 3NPMA 2VYVD 3MPUA 3FIUA 4Q15A 3OMLA 6GPBA 4MRMA 2DPXA 2C9MA 5C5CA 5JMOA 1AQNA 5YASA 7ABPA 4CV2A 1PL0A 3NT4A 4JSYA 3X2FA 5GM1A 3G2QA 1BQ4A 4KMRA 3KCNA 3P20A 4NBTA 4X3OA 3QI7A 2Y77A 1WUYA 4BO2A 3HZRA 1KXJA 1PJBA 3D9QX 3MA0A 1T9DA 4KHZA 2HXGA 3FIJA 2M1ZA 3F5QA 2NUPB 4MJLA 3HBAA 4V2UA 5TLSA 5AJUA 4DCGA 3VOAA 1MO6A 3WWYA 2H9AA 4D81A 1IN8A 3SJCA 1AK2A 3ZCQA 2GI4A 1KEKA 4E2WA 3UT5A 2BW0A 2OCLA 2OUKA 3QWBA 4KN6A 3BHNA 4LYYA 4XUGB 3RU7A 3TKYA 4C88A 3HDVA 3PC4A 3FVWA 3FOZA 1EGVB 4RD1A 3AVUA 1AZWA 3QXCA 2QVGA 2P0YA 4FC6A 2PRZA 2YICA 1JPJA 4IVNA 1RJFA 4MWEA 3FKJA 5JLAA 1DOHA 1KIMA 2P5TB 3IEIA 5AK5A 4FONA 4IOMA 3WXBA 2GN8A 3W7VA 5K05A 3OKPA 3VPSA 2ZUEA 1CY7A 4AKHA 4NK4A 1P1RA 2WFLB 3NM4A 1N6NA 2C2YA 1Z5PA 5FLXA 1IJFA 1NW9B 2MIIA 3R3WA 4WADA 2NACA 1QP4A 1E2EA 4HG2A 3GD5A 2I91A 2C3YA 1NBME 2J0UA 1RI2A 1VYTA 4MUNA 1Q92A 5E95A 2O48X 1NIPA 1NSYA 1NVTA 2GXUA 2J7PA 4UD2A 3WNBA 1ISGA 1ZQ9A 2H1WA 3HXQA 2GD0A 4WBXC 3Q15C 4Z9AA 4NY1A 1XQ9A 1XUOA 3O1LA 4F46A 4K9DA 3BRQA 1SZCA 4R1QA 1G3MA 1PV1A 1Q21A 4ID9A 2GBGA 2WYVA 3CZRA 2J41A 4V0MA 3H97A 5T57A 3T9FA 4BFWA 1NI3A 1YO6A 1CLUA 2ZZKA 4GUAA 4ITRC 1G66A 3IURA 4XPZA 3PQ6A 3K0KA 3TUJC 4E88A 1LQTA 1XWWA 2PPLA 2VZ0A 4AKSA 1KYWA 4I3HA 3UT0A 3TCXB 4INOA 4XSGA 4G86A 5GTDA 1AVTA 1CXZA 1X7WB 4HH4A 1OV6A 2Z09A 2V97A 4R40A 4P9NA 3JQAD 3R6DA 2B8JA 1JJVA 4CMCA 4HVLA 1ETUA 4DM4A 5LOVB 4RTMA 4G1UC 2Q3HA 4LRWA 3ZLTA 1EXDA 1N3LA 1OAKA 1N2BA 1L8LA 2N0SA 2OCYC 3HE3A 1VHJA 2YXBA 4D41A 2OOKA 2EW8A 4YRJA 3AIMA 2C5HA 4FGKA 5KUTA 3QYJA 3QE0A 1EFPA 4KYTA 1D3AA 2FVYA 1TO2E 4FFWA 2IXBA 3RB8A 4QM6A 3KEOA 3UFXA 4IV0A 2XV1A 5IHPA 3K9CA 4RHTA 1T5IA 1TA4A 2ZJOA 4LAFA 2JW5A 3EXHA 1H42A 3I2HA 2WJPA 3F8WA 1ECCA 4URHA 4YNBA 4ZJPA 5BV0A 3PNOA 1XXHE 2YCBA 2JLZA 2H65A 1F2VA 4LV8B 4TLBA 5AXDA 1S2DA 3W05A 2FG6C 1GEGA 2DKNA 3I8XA 3TAUA 3ZBQA 3ZU6A 1SUIA 1EFTA 1YZKA 3WLNA 1PZXA 7MDHA 2D74A 2WD7B 1ZGCA 1RAAA 3R0IA 3ZDRA 4B6RA 4LEIA 4QGHA 2Z6VA 4Y6LA 2CMHA 4IIVA 4WD3A 1J70A 1BS2A 1T1JA 4NCKA 3B60A 3EUWA 4QVGA 4QBIA 4ESVA 2YMQA 1LX6A 2QJOA 4ALLA 3CJQA 4FFVA 1NPTO 4A7PA 1Q74A 1XZMA 2A67A 4AXXA 1KOLA 1P2TA 1NURA 1SG0A 1TTPB 2EF1A 1N36B 4K1XA 4ZICA 2NU6B 1IRXA 1J0BA 1V3QE 5AJWA 4ZCPA 3T0FA 3WS7A 3LP6A 4P84A 4HRXA 5BMVA 3OETA 4OGLA 3LYAA 3CCFA 4XZ3A 2KLBA 1SU4A 4XQGA 4CUZA 3OF3A 4DQVA 1KZYC 2Q4OA 3ETHA 4FILA 4BWGA 2PJZA 4D5GA 3DV9A 3SQNA 2IQ5A 4LPSA 1GU0A 1LB1B 3IUNA 1HKHA 2PLRA 4MVJD 3DS8A 2PT9A 1BN7A 5DTEA 2BF7A 2HO4A 2OHXA 3UAZA 5AVZA 1ZNXA 1D5CA 1II9A 2D3TA 3DUFA 4FU0A 4Q9JA 3S4YA 3TQQA 3W6NA 4L50A 3SXUB 4M9CA 5EJIA 4ZU3A 2MINB 1RXSA 3HXKA 3BE6A 1Z7YA 4QEDA 5BOSB 1XMJA 1L0BA 5K8LA 3M3DA 4D4LA 1Y5MA 3HB0A 3FF1A 2FV8A 4YHHB 2EFCB 3VGJA 4MAAA 4DWOA 1ZVKA 2IUSA 4RHXA 3VRHA 2ILVA 3WP1B 1APBA 2J7KA 2VA8A 3EY9A 3KAQA 3QLVC 3UK7A 2BT4A 3OX4A 3ZKAA 1YD7A 3G0IA 4N6NA 4NBSA 4UU7A 4W1PA 1UOOA 4NZMA 4A73A 3QVGA 4EHLA 5BSKA 5H59A 2I6XA 4I5EA 5CB8A 1FUIA 1IOWA 1YBHA 2REQB 2V6IA 1RR6A 4L8FA 4AMVA 2OG1A 1WXFA 1Q95A 1S2LA 2E5WA 3JRXA 4K7JA 4JI0B 5T4FA 4JJ4A 3BUSA 3LHFA 2X9GA 4R9RA 3GLVA 1OIVA