4KLAA

E343d variant of human ferrochelatase
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIDTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title E343D variant of human ferrochelatase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 141
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klaA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klaA01
2Q2NA 2XVZA 2JH3A 2QD5A 2HREA 3HCOA 2QD1A 3M4ZA 4F4DA 1AK1A 2Q2OA 2XWSA 2XVYA 1DOZA 1TJNA 3AQIA 2AC2A 2HRCA 4KLRA 4KLCA 2HK6A 1HRKA 2PNJA 3HCPA 2AC4A 1C9EA 3LYHA 4MK4A 2H1VA 2QD4A 2C8JA 2PO5A 2XWQA 2DJ5A 3GOQA 1C1HA 2Q3JA 1L8XA 2XWPA 2QD2A 1QGOA 4KLAA 4CCSA 2PO7A 1LBQA 1N0IA 2H1WA 2QD3A 3HCNA 3W1WA 3HCRA 2XVXA 1LD3A 4KMMA
chains in the Genus database with same CATH superfamily
1A77A 3PEEA 2W2OA 2IITA 3FCAA 1O5OA 3M4XA 1ODJA 1G20B 5J5CA 1ZONA 2WHXA 3VC2A 4PLFA 1DRKA 1U8EA 1T91A 3GQVA 5A3SA 4BQPA 2V4ZA 4ER6A 1M2GA 2DVMA 2QM8A 5KJCA 2P91A 2BFNA 2IU4A 1HFJA 5F77A 1PF7E 2I6SA 3RWOA 5F52A 4ZOQI 1F9AA 1LPSA 2R86A 2NQ8A 5AKXA 4ZAVA 4FC6A 3LF1A 4V0SA 3J81k 1TC1A 3D59A 3GZTB 1Z5NA 3M1IA 3CH4B 2VDWA 3N8IA 3TZLA 4CFYA 1USKA 4FGKA 4JVNA 4KXFB 2VHXA 1UC8A 4M1EA 4X60A 4Y2HA 3RVBA 4UPEA 3OEEA 3K0AA 5D8DA 4BMVA 2HBQA 4BS9A 1PJBA 2GZMA 1N0UA 3Q41A 4X9XA 4N48A 2QV0A 1ZGAA 3WA6A 5ARCA 2CE7A 4X91A 1OXVA 1GTSA 2HMUA 5GM2A 4DB2A 3MAJA 5DNDA 2G76A 2BGUA 4QGBA 4BCDA 3QE4A 4IV0A 4OHMA 3VFDA 4AJKA 3QHQA 3S2SA 2B8TA 4AKSA 1T25A 2CK3D 2EATA 3G8DA 1A98A 3GJTA 3JCZA 4OAPA 4K28A 4JLMA 1QP8A 3KAJA 1GM5A 4D98A 2RGGA 2B78A 1JEQB 1XU7A 4LI3X 5E7JA 1ZP6A 2E85A 5I7WA 5IAAA 1KA9H 3TK1A 3TMKA 4OIMA 4EOGA 1AMOA 4K6HA 1YJCA 2ZAOA 3WRXA 1CUZA 1I6WA 2Q27A 4FIZA 1NUQA 1ZI9A 4TKUA 1O5IA 1JZSA 2AR7A 5KX5B 3G7SA 1L5HA 4YRCA 1HSZA 3MWKA 5EN4A 1N2HA 4IOLA 3AW8A 2NZ2A 2R8BA 3FTQA 2O6HA 4K9OA 4Q0MA 4KGVA 1ISPA 3B1FA 5T67A 3QK7A 3CLTD 5DHTA 2R96A 4D8TA 2NVUA 2H4XA 1M66A 1DUVG 3SBOA 4C1BA 4L75A 3ZH9B 3AR6A 3THRA 1YJ5A 1SG9A 3IRUA 4IMPA 2PPVA 2NO6A 5AI0A 1PGNA 5LQMA 4WLEA 1CZRA 4HWGA 4S12A 2OZPA 3RB8A 4RULA 3LUJA 4OXYA 5F78A 3ANLA 4R9SA 2DFPA 1PK9A 2JZOA 1NMYA 3AFGA 3VHXB 2O5EA 4EG6A 3F74A 1WKBA 4OPMA 4AXXA 2JD1A 3LBFA 1R66A 4HTFA 4Z9AA 2GARA 4U3JA 3SQOA 1JLRA 1CERA 1FVOA 2VYND 3I9NA 3TTUA 1KJWA 1AKYA 3N74A 2A67A 3IAAA 3FSJX 5H9WA 5E2BA 2OZKA 3W7BA 1WB6A 2LNDA 1IBMB 2XJ9A 2POQX 4PLWA 2H08A 4UTNA 1RI3A 4NYMQ 1E9DA 5AR1A 3GP5A 1QG4A 2ZBPA 3QG1A 3KVNA 3V32A 4X90A 3HJFA 5JH7A 2QW1A 4D25A 2HWWA 2JAOA 1HDZA 2WSYB 3PDCA 1Y3BE 4I4IA 2DOKA 4KXMA 1ZM3A 4CMJA 1T0HB 3GGSA 3ZD8A 3NBKA 3RTEA 4HI0E 4E5SA 3KYCA 1GYQA 2G09A 2ZJFA 3TX2A 3EQ7A 4XFJA 4UU0A 4ZJZA 4OGWA 3KUUA 4NCIA 1KVRA 3B1ZA 5IXSA 3NAMA 5K6AA 1VHQA 1Q0TA 1CVRA 5THXA 3PRKE 2DFDA 3UVEA 2G0TA 4YMLA 4AY6A 1QGYA 3IT0A 4MA5A 5J2UF 1GZDA 3ZNOA 3UC9A 3C3MA 3GK3A 2IEBA 2HGSA 3O8RA 4OHRA 1GNQA 1IZ9A 3TINA 5IM4F 3FOZA 5EKDA 1YIOA 5C8VA 2PA0A 1IBRA 5AKJA 2V6JA 1Q14A 2HA2A 3G8CA 3LWBA 4XWWA 3V8QA 4LDNA 3A4YA 3FZEA 2VI5A 1I2MA 4H0CA 4UE6A 5FA5A 5ISMA 2FQYA 2XE4A 3MWEA 1RXIA 2RGBA 1YS4A 4LQLA 3BK7A 2HQSA 3A9WA 4G0QA 4HMQA 4YJGB 1WBJB 3A9TA 1XL1A 2JHFA 3HJGA 4K9MA 2EZTA 2ZBQA 2ZLBA 3S2ZA 1TZKA 4W9NA 1QAQA 2JVKA 4NVRA 2Q6IA 5CNJA 4BNIA 3OT4A 2JHCA 4GM0A 5JJIA 3BCUA 1JR3E 1J23A 5DX1A 4TV9A 2Z83A 4G37A 4LHXA 1Q2UA 4B3IA 2E0IA 5ALYA 4XX1A 3U09A 4U2EA 4YP7A 4S05A 4WN9A 4XUCA 2A8YA 3PKJA 3R9KA 4LZLA 1SC6A 1SU4A 2NZYA 2BWJA 4QOEA 3IAM6 4AI6A 3B51X 4DA8A 5GVSA 1E64A 4WNYA 3PK0A 2W6PA 3HHPA 1K4YA 3K72B 4F5WA 3ADOA 1RXSA 4ARZB 1RRMA 1TW2A 1AQ6A 3MMXA 4KIGA 5ITZB 1AGXA 1AHHA 1BA2A 2G36A 2VJLA 3NIBA 5DSTA 3ROZA 3WNBA 1P19A 2FG5A 4YDHB 3TGWA 3EHDA 3A32A 2A7QA 3AC0A 4F4HA 5KWVA 3LC0A 1YI1A 1AKNA 2XVYA 5IBRA 5IF9A 3C1UA 4X94A 3SKVA 1QR2A 3DCJA 4Q82A 4ITUA 3VJMA 5C2JB 3EFHA 4ZGGA 2O1EA 2PBLA 3INRA 3KJHA 1Z4KA 1XCGB 3TPCA 5CJJA 1BEEA 2ST1A 3BXHA 1OASA 4CMBA 4CQMA 1CUHA 4FSHA 3LRTA 3QE9Y 1JQEA 3FPHA 1KSFX 4JLOA 3NALA 3SXUB 3UKDA 1BXGA 1UKAA 4C7OA 2FVYA 4PNZA 2DQYA 4D9FA 4OQLA 1B6RA 3B2EA 1FU4A 1L7QA 1H0KA 2FEKA 3NAGA 4GRDA 4LBWA 4Y6GB 2UVPA 4MJ7A 3SIWA 4Z8YA 2XUIA 2I2AA 2QL7A 4EF5A 4KITB 1YC2A 4X7MA 1N6IA 2ZXFA 4V0NA 2Z2XA 1EBUA 3L1VA 2NUAB 1G8MA 4AUNA 3H05A 4RFSA 5FWAA 3RC3A 2JCYA 5H4GA 1RLOA 3VBEA 4MX8A 5DMHA 3NNNA 2X9QA 3E2MA 1JEAA 3BJIC 2HB6A 4LW8A 1B2RA 1GZVA 1JJIA 3VDMA 3GT3A 2C3YA 1EP1B 3CJQA 2V3CC 3QF4B 2FW7A 2AQKA 4L72A 1ESCA 1L2TA 1SBTA 4Z4QA 1FDIA 4JWTA 1B8UA 3W5CA 3FSEA 3HGMA 4JT2A 1WW8A 2B4TO 5MGNA 1XFDA 3IELA 5ILGA 1N3IA 3FRIA 5G40A 4BVLA 5LU9A 1BS1A 3WKEA 3ZXIA 1P3JA 1E0DA 1H2EA 3UMCA 1EK2A 2QRLA 4PTZA 2QMUA 3NTRA 1GPKA 2EF1A 3DL0A 2C5HA 3GZ4A 4KO3S 4BB9A 4QD3A 1YS6A 4XX0B 2YN4A 1EM6A 3JALA 3KU4A 2FZ4A 4RF5A 2A9FA 4Q3CA 4YCAA 5LIPA 4Q3EA 1TJ4A 2ZCJA 5SICE 4C5AA 1JQ3A 3FNFA 5B2ZA 4CDNA 3PEFA 4UOZA 4U7TB 4A73A 5GADl 2VJDA 1B8VA 1W96A 3M6AA 5IARA 2YV5A 1YJXA 1EMDA 1ZBDA 2R8XA 4P98A 3CR7A 1KAMA 1OFUA 3QPAA 4N7MA 3VR3A 4NFHA 4I5FA 4EYGA 1GP2A 2D4HA 1QX3A 1XZBA 3UMYA 2WFLB 4EPXA 2F48A 1S8FA 1JJAA 1IWBB 3DV9A 2DBQA 3GRAA 4OYYA 4WBSA 4JB0A 2HDWA 3SR0A 3KEQA 3BB4A 3BK2A 3PYXA 4FOOA 4GI1A 3SI7A 4AY5A 3T3MB 3RUAA 1PJAA 4K46A 2ZM6B 1X9GA 5A03A 1AY0A 4OK3A 5HFAA 4JQZA 2HEGA 4JKOA 2Y92A 1FQOA 1CY4A 4ZVVA 4GYYA 1R0LA 1P62B 2B21A 4MYTA 2GKGA 4IUBS 5E1MA 2Q2QA 4ANFA 4AO8A 4PGGA 1STOA 4LHVA 2C5LA 4ER7A 4EAQA 5KIAA 2B5VA 4AURA 4YRDA 4B47A 4H15A 4XXHA 5AK4A 1U7TA 4AY4A 4Q47A 3FUTA 4UD6A 1XCOA 2VF2A 2GM3A 1TF5A 4ZVPA 1T9DA 1T9GR 1W5EA 4NBLA 1GZUA 4PZDA 4B2YA 1KEEA 2HCBA 4JDUA 3EMDA 2JEYA 4C6SA 1UPCA 2G9NA 4RTKA 1JIJA 2QRKA 1M34B 4M6WA 1LI5A 5TQ0B 5FPHA 4FBMA 1MJHA 1H0HA 1V8BA 4NDAA 4XGNA 4U4AA 3T52A 2FAXA 2GH1A 3U6KA 4EY4A 3K8QA 1H8ED 2AFHE 3A6KA 4QEZA 2X8AA 2XECA 5K5EA 2OZLA 2YFHA 2ZB7A 3H2ZA 3IHWA 3EVNA 3G5MA 3LG2A 3DE2X 5AJWA 4G9BA 3OZIA 3A2LA 3REQA 2ORIA 5B1EA 3NXKA 2XE6A 2XZTA 1IDN1 3P5SA 3PKZA 4ZO8A 1KRWA 1XLUA 2PWAA 5BSTA 2O8EB 1X7GA 1OQAA 4ECEA 4A15A 4BO4A 3P2EA 4RQTA 3UJBA 5BPFA 4BBZA 5PGMA 4I1IA 1C9JA 4RFVA 1GLGA 3JWHA 2MR6A 2AMJA 1EFLA 1CZHA 2EEZA 1QZZA 3B82A 4W5WA 5TGDA 2AN5A 1UJCA 3HPQA 3TIFA 4IDAA 1XEXA 3GLFA 1EFUA 1XEAA 2WG1A 2ZZNA 2ZRFA 2XUJA 4WK2B 3OM1A 2CNLA 5EIBC 2RAFA 3TG2A 4PLGA 1KEEB 1Z5ZA 3G0BA 4O4LA 3N5CA 4TT3D 2XZOA 4QJ5A 3QKRB 2C0QA 2A84A 1HSOA 2Z9CA 4KBFA 3TL2A 1AQUA 3GCXA 3IC5A 4G5OA 1QTNA 1IPHA 2XE8A 3GOHA 2FMHA 5FL7D 5MHTA 5DPMA 1EEXB 3Q85A 2G4VA 4TL7A 5ALTA 1P0FA 3ETHA 2WAOA 1K3UB 2NSYA 3SJAA 1KI2A 2CNBA 3BVPA 3IDFA 4YRRA 5IZCC 4QDZA 3AJ8A 4AAYA 5HYVA 3IUQA 2ZWVA 3F3SA 4AZVA 2ICAA 4U6SA 3F90A 4C3ZA 1GT6A 3KSMA 5KYGA 2QW0X 3I1IA 1YMUA 4G41A 3DTVD 2H85A 2JF0A 1FRNA 3HO6A 3SZLA 2PUJA 2Y67A 3R5XA 3T3DA 4B75A 1X1AA 3DOCA 4ZVTA 3GBPA 2QT1A 5EZ6B 3KJNA 3DTVB 1NBWB 4FZ3A 4JQOA 4MWOA 3AP3A 4EUSA 4ZYVA 1QZXA 2RI0A 2VBCA 3SJ7A 1GHTA 1HORA 1OI4A 2X13A 3FHOA 3NTUA 3OUZA 2H2IA 4XW2A 1TUGA 3QPUA 3LIPA 2HX1A 2QE7D 2VXBA 3IVGA 4XSGA 4EA9A 3DBVO 5BNFA 3O5AA 5B6JA 2DJIA 1QQAA 4NSNA 3EGOA 2FRDA 1I5OA 1YQDA 2GRJA 3HJUA 3W4JA 3QOWA 4YRKA 3EZNA 3PEYA 1EBFA 2IU6A 1SA0B 1UPAA 2FFHA 2X5KO 3PTZA 5KQMA 2WKWA 4ND3A 1JBEA 4RNDB 3EPPA 4AG3A 3N2KB 4TLBA 3O8QB 2A0KA 4IYRA 2QROA 3ED1A 4M8LA 4Q4AB 3T15A 5IKPA 5JBIA 4XM2A 5DO9A 4GWLA 4I4CA 3DEAA 2DX7A 1JLMA 1BHO1 4OUDB 5DOVA 3VU9A 3D6HA 3NIDB 4QULA 1WDLA 4CMHA 4NJEA 1WE2A 3REGA 4NPCA 4RZSA 5EE5B 1IY9A 3MHTA 2HRQA 4XWTA 1OKKA 1M8PA 3EMVA 2XA2A 2I2FA 1SUPA 4TSFA 3W6ZA 3L8DA 1VPDA 2RH5A 3FCSB 1SBZA 1VYVA 2HNBA 1REQB 3NHJA 3WO0A 1RABA 3EA0A 2NVOA 1Y1KE 5BSKA 2CLSA 5FNVA 3OZEA 2OY0A 4HZUB 1F8YA 2CUKA 5TQVA 4D3DA 2VSFA 1A1VA 4W5TA 4Q19A 4V0KA 1Z8NA 5JD5A 5KYUB 3U56A 4UTRA 3ORRA 3MCAA 1E0AA 1OBOA 3PGVA 1I4TD 1U0TA 4CMGA 2C4VA 4EVSA 1EINA 1X9IA 4W7HA 2PFKA 5KTTA 2A0XA 1ONOA 1U8YA 2PX0A 4MVJH 5FUXA 2GRUA 1OGYA 2O20A 3BWMA 4HNUA 5GV7A 3FMPB 3GNLA 4C4PA 1NBMD 3JD0A 4DARA 4YY3B 3X2SA 2YQ5A 4PLHA 1NUHA 5LP6C 2HSZA 5LWHA 2K2WA 3EWIA 2FOIA 2L82A 1R15A 3OZFA 4EW6A 3A0RB 3N75A 1L5WA 5FWNA 2Z8ZA 3MYRA 4UAVA 1I3OA 4UDNA 1IM2A 3JWJA 1ZJ5A 1L0BA 1KTVA 2C2WA 1D0IA 2R6DA 3F6RA 3GDOA 5K7SA 3J7TA 3NAZA 1KMHA 3IAXA 1LZKA 1PUJA 1VMKA 2FW6A 4MITA 2AMFA 1JQ5A 2LVBA 4V2UA 1GZ5A 1WUJS 4IVPA 2XQVA 3WKCA 1K92A 1V9SA 2H1CA 2CN1A 3TPFA 3WXMA 1WG8A 2DTDA 3E7PA 4G3XA 5P8WA 3EQ8A 3CSDA 1JUDA 4K87A 3RNLA 3VAZA 2XOEA 4ZFNA 3RVDA 1E5LA 5GZ1A 4Q03A 1VIDA 1YE5A 3PC6A 4Q1AA 1T9AA 4DMUB 2EJVA 5CCBA 1WWKA 4G81A 1MVNA 1ABBA 2BUCA 3MFYA 2MMGA 3OKFA 4B9AA 3LSYA 4M7PA 3NDBB 4OJKA 4EKIA 1BE0A 5BUSA 2VJBA 5LP6F 1P4JA 4JI0B 3GJRA 4YRSA 4ZJUA 5KQSA 1HL3A 3CC8A 5ESWA 3U3MA 3OPVA 3DVAA 4KMOA 1DDOA 1KSGA 2YFQA 1Q12A 3O4FA 4K3VA 2OGZA 1LJ8A 1QYDA 1QHGA 4EG7A 5F2NA 2C9BA 4TMZA 3P9YA 2JJ8A 4EM6A 4LIPD 2ZSEA 4ZYYA 2AQ8A 2XUZA 1CV2A 4RMGA 2O0KA 1GAEO 2GERA 2X2OA 3N53A 4KAJA 3FNBA 2F62A 4B3TB 2PS0A 3VVLA 1MJGM 1YBFA 4HAZA 1KMHB 4G5XA 4JLAA 4JITA 4BYMA 2HF9A 1TEZA 1GCOA 3FA2A 3GARA 3KJQA 1U7HA 1G5HA 2QVYX 1TO6A 1W0CA 3DTNA 4K9LA 5KU7A 4DZTA 4MPPA 3U4QB 1IN8A 4L51A 3RKRA 2BN4A 4NECA 3RM3A 4JL6A 3TZQA 3TW6A 3E58A 3C6YA 2QR5A 2PBFA 4I9GA 2Y93A 1DOZA 4Q9LA 1XMXA 3H0KA 4P36A 3KQKA 2JS7A 3OCXA 3K0BA 3OOSA 4W9RA 1VM6A 3M7IA 5AHWA 1W46A 1YA8A 4BFUA 3QFFA 4FMBB 4O4IA 3P2OA 3QV2A 3QMVA 3CF2A 3TZ6A 1AKRA 2H4ZA 2O59A 3QNUA 4K7JA 1X80B 3C6MA 4TWZA 2BGMA 4NOLA 3NC1C 4XRGA 4E12A 5JHHB 1S7GA 2HQOA 4Y2VA 1I80A 2R5WA 1TVEA 4MUIA 4X85A 1YHNA 3G8AA 2DHDA 3JV7A 4RVSA 1Y48E 4G5RA 1HWYA 1RZVA 4MH0R 2J5XA 3LP5A 2DBYA 3LX4A 1WZIA 2PMFA 1ZJ6A 3FYUA 1SG0A 1XLVA 3GHYA 5GJWC 3U61B 5A02A 1GL6A 1U9JA 1WM1A 3BRWD 4URZR 4JWKA 2HHJA 4JKIA 4FIDA 4NFSA 2G8NA 3TVDA 4KPEC 1UDRA 2IOFK 3OT5A 2EWVA 1C9MA 1F12A 1X7YB 3DO8A 3PF8A 4INAA 3H17A 3RU9A 2AK3A 2RHMA 2RGDA 1MU0A 3AF0A 4LTDA 1ORIA 2FSVA 1KEWA 2OFFA 1F6BA 4FXOA 5CB4A 1CUWA 1RWVA 5FPKA 1TCUA 4TM7A 1YQXA 1Q11A 2QP4A 4W99A 1NA5A 3DLTA 2GS9A 2PRZA 1I9CA 1NRXA 3G89A 1G55A 3F1KA 3SVLA 3R2JA 5BMVA 4CKZA 1G21E 1C2YA 4KQCA 4V0RA 1IVSA 1MOZA 3KCNA 5DT2A 1CDDA 1CEEA 4BWYA 3KSDO 1WP4A 3TZEA 3E15A 3ANNA 2CF6A 3EQ2A 1WCIB 3A7EA 3GMDA 2P6NA 3O95A 4TS4A 4ZJPA 1O8BA 3ED5A 2QN8A 3WLQA 2EJCA 4G1VA 4MB2A 1DIGA 3W79A 2F1OA 3AYXB 3HBAA 1UQUA 3E9NA 3SIXA 2ADMA 2B4YA 3QLJA 4NS1A 4LYJA 3KFXA 1HF3A 2GBGA 3FOBA 2QLBA 3B38A 2C2ZA 4DMMA 2WHRA 1SUEA 4IIJF 3JQ8A 1Z4PX 3CLUD 3EXEB 1ORRA 1FYVA 4TXHA 2O2SA 9MHTA 4MR8A 1GDDA 1L7XA 1E32A 2YNMA 3GJ4A 3PNMA 4MWEA 4AZTA 5CDHA 2FWJA 4B1FA 1J06A 3DAFA 1BDMA 3JQ9A 2B2XA 1BEUB 1ATIA 5TVKA 3E3NA 3I8SA 3OTGA 4BXOB 3P7MA 5HQJA 2G9ZA 5KDDA 3FFWA 3WDLA 2PUVA 3EUAA 3A3OA 3IR7A 2W2NA 5C34B 5KMGB 3TB6A 1P2FA 2QQEA 1O6CA 1N78A 5IXJA 5LU8A 3RC7A 4CLDA 3MRXA 4KH0A 5GM1A 4GLBA 4DMGA 4F1KA 5CM2Z 1F6WA 3LFTA 3KDAA 3SYNA 5CK4A 4Z3OA 5DHPA 1SHUX 3NEJA 2F9FA 1CCWA 1ZHFA 3UFXA 4MV1A 2E3JA 2W5UA 3BJMA 3HO8A 3NHBA 3ZLUA 2G83A 5IU6A 1YBVA 4Q4JA 5AT1A 1H9BA 1MP0A 5DCYA 2HOQA 5EXDA 2B4AA 2HLDD 2P9HA 3NP9A 3T4XA 4U0JA 4URFA 1HQYE 4KI0A 1LVGA 1U2EA 4KC0A 2NVWA 1YS7A 4GP7A 5YASA 4CHTA 3IH5A 3L7YA 1P3Y1 5K01A 3KOOA 4CODB 1MRSA 4BZXA 2X15A 2HHCA 3LI2A 1K2WA 3N2GA 5FOTA 3B6MA 2ZJAA 1W4BA 3LJKA 1J8DA 1O6GA 2ONKA 2PUHA 2VFAA 3NKLA 4P1ZA 4ZPJA 3T61A 1T6YA 1WXIA 1N6RA 1IH8A 3IPXA 4FT2A 5L3QB 3ODPA 1QB7A 1S2OA 2EAUA 3QFSA 5TX7A 2AN4A 4B33A 4EZBA 1R74A 3E05A 3BYZA 3OCJA 4RA9B 3OLVA 4F7DA 1C3EA 2QTMA 2WJIA 4M9CA 4XR4A 5T4FA 3UK0A 2GKOA 4MIYA 3AHDA 4YXWD 3A6FA 3ANXA 3IP8A 3OM0A 1ZVQA 4ERXA 1V26A 3H0CA 4HEJA 4IG9A 3U2QA 1H1DA 1SVNA 1GPBA 3CF4A 4LN1A 4O02B 3L7BA 4H08A 4U2KA 3TB4A 3HA5A 2H9IA 3M3HA 4CG1A 4H2DA 2AVDA 3OLWA 1UT6A 1F3OA 4XB1A 1CY1A 3JU3A 1UIMA 1FU7A 3T5CA 5DU2A 2XQGA 5IZ4A 1L5FA 3BERA 2P0AA 4FYVA 3DAPA 3Q3IA 4LK3A 1YOBA 2HK9A 1EI9A 2WV9A 1CWUA 1DKOA 1LI4A 1NLUA 3MWLA 4EVRA 3WWDA 4QBTA 2AN3A 3UK2A 3ZWPA 2PL9A 3AM3A 4BIMA 3AR3A 4EHNA 5BWMA 3T7EA 3G5TA 1B8PA 1SHTX 3ZXUB 1C7RA 2GLUA 4RQBA 3QX8A 3MYYA 3C0KA 4FWBA 2CYCA 4GXQA 5CX4A 5U4XA 4XB2A 2NUTB 4CL8A 1K89A 1GPDG 1YB6A 5DBEX 2R5NA 5HRUA 2G63A 1ZEMA 3JYHA 3N3AC 4YRMA 3DBOB 4BU0A 3C48A 5EHXA 3UW1A 1C2TA 4TT8A 4L73A 2I76A 2D13A 4CM6A 2VOJA 3TJZA 2P0EA 1FLDA 1QWOA 3H83A 1X39A 3EVBA 1R0KA 2ZIAA 1NRWA 1X2EA 4D2IA 2BDTA 4J0CA 1RADA 2A7XA 4CUKA 4Z0TA 3OLYA 3T7CA 5H9VA 1WD7A 1Y6JA 5JS1A 2PGNA 1GIAA 4WFIA 1XTVA 4LJRA 4NRDA 2LXNA 1ZITA 4XYLA 3V6LA 1ZUNB 2Z30A 2Z8XA 4XGKA 1JHQA 1SQGA 4IQGA 1GVNB 3MNFA 1NX9A 2H2GA 2QX4A 3A3PA 1DHRA 3AKDA 3BF8A 121PA 5HBRA 2AB0A 3H11B 2FJUA 4FDLA 4FN5A 4HAXA 4XWYA 1PZGA 1VE6A 2CB0A 5IYZB 2MIIA 1U4NA 3NKVA 2MINA 4MROA 2JKVA 5AOAA 1E0KA 3E5RA 1YGYA 3EH2A 4RHEA 2HRRA 2HZ7A 2OK7A 2Q5IA 3UAZA 3WL6A 4I6EA 1NN0A 5D7BA 1E7WA 1RS0A 5EHNA 4CM9A 4FE3A 4HL6A 3OZSA 1NT2A 1PKEA 1EFPB 2YZGA 3COPA 5FOSA 2AEJA 2FB9A 2HK8A 3WLLA 1Y1PA 3OBBA 3G2KA 1JDPA 1F06A 1NC1A 3MERA 5IPFA 1JTEA 2OCDA 3QKUA 4O2BF 5A5EA 2Q9CA 4EKNB 4LGVA 3FPFA 2R68A 2ODNA 1CNMA 2IL1A 3BRCA 3U1BA 2IV2X 4IJVA 4FDVA 5B53A 1Y4DE 3GRYA 1KU0A 3A6HA 4O2AF 2H7VA 1CEQA 4I55A 3PL1A 4RZQA 3VX4A 4L8LA 1KPIA 3B89A 2C31A 3D31A 3RSOA 3GA5A 1H05A 3U39A 1TT7A 5C4IA 8ABPA 2OGSA 3KALA 4LHSA 3OSZA 1PL8A 2Q2VA 4MQLA 1U04A 2BISA 4HQRA 2DZDA 2MINB 2XYGA 3A05A 4WASA 4EUKA 3I2YX 3ZU3A 3MRSA 5D01A 1ISGA 4KU4A 4RA6B 2JLZA 2VYQA 1XSEA 3KJFA 2OFOA 2D2IA 5F1KA 3P26A 2HR1A 1NU6A 1SBYA 1TJPB 2ALJA 2ZB8A 4DMRA 2FMKA 3E8SA 4J2TA 3RUIA 3IRVA 4CF5A 2IHNA 4RMJA 4CKEA 1HNWB 4KV9A 1KP2A 2O6LA 5AKIA 2WLSA 3KOWA 3W8RA 1SXIA 2X4LA 5E4YA 5FBVB 2J6CA 3GLHE 1GXSA 2BELA 3WMRA 2CDCA 5JANA 3GT0A 3LH5A 4L8GA 4WZAE 1RLJA 2BHNA 4UTOA 2QSZA 5ILOA 1LPNA 3ZWDA 3FAZA 4LVOA 4RUKA 1AF4A 1KO7A 3HUUA 3QYJA 3EGIA 3HR8A 2PSSA 3PX7A 1YE3A 4TMVA 4TLEA 4UAUA 3IUJA 3PDUA 3WGZA 3KQMA 4L16A 1QC5A 2B4RO 1DAFA 2VNAA 4K6FA 5H1YA 1PQWA 1PD1A 3UG7A 4CG0A 1QGZA 4I1OA 4DSZA 4TUYF 1PLKA 3K96A 1U3CA 1O97C 3I9V1 5BNIA 3TAUA 5FOUA 2XUHA 2NUPB 1RXUA 2R7NA 3VR5H 4K0KB 3I42A 4G1MB 3AW9A 3E2IA 5C46F 4JJEA 1H8HD 4JLPA 4ICIA 2TMDA 5CNIA 4OSEA 1EXMA 2WF9A 1UBOS 3LA6A 1QFMA 1ZD4A 3N7TA 5K3EA 3HYRA 1EK1A 3EVCA 3QBTA 3RWBA 1UOEA 1NHGA 4JDPA 2XCSB 3TNLA 1KMNA 3T9EA 1OJ7A 4L7QA 2H1LA 5C4MA 4GZ5A 4ARAA 1SCKA 4N0EA 5DSXA 1PGJA 4ND7A 3F5QA 2XB4A 2GAJA 4QJIA 3ADDA 4M8IA 5BV1A 1CR4A 4LUCA 4L3VA 1E92A 1HDIA 1UBCA 1W94A 2GCOA 4R2IA 4TV8F 5K0TA 2A6PA 4GPEA 4MVJA 2L18A 4TTIA 2FWBA 3DOEA 4PFKA 4AJLA 2ZUUA 2HT6A 2AC4A 2JARA 3L6UA 1BFKA 4O6VA 3CQ9A 4BO3A 4CLOA 1T3LA 5AKYA 3NBZC 4TRMA 5KVAA 4D0LB 2ZXEA 1PS9A 1UL1X 2IGBA 4HPXB 1H1LB 1V41E 2RHWA 3FMOB 4MYUA 2ZJBA 1XU9A 3MB5A 1Z82A 4X92A 4PCUA 3IP3A 2ZRIA 4I14A 1B42A 1LF0A 3RS0A 1DXYA 1KJIA 1T6NA 2Y76A 5THQA 5K3FB 1TYDE 5KNDH 3SIRA 4ALKA 4Q4CA 4J0EA 3Q6MA 1JHUA 2J3MA 4BP1A 4ETNA 1EP9A 3K1ZA 4HEA6 3QBVA 3VJRA 3DUFA 4JLSA 3IMKA 2BGTA 1MPXA 2J33A 2V9PA 3O21A 4LXXA 4ASUA 1HDYA 4YCNA 4WI1A 3ABSB 3WQQA 4BNDB 4D3YA 5FO0A 4QFCA 2J3LA 3GFTA 3OCZA 4BVJA 5IAOA 1N57A 4JJGA 5EE1A 3JAKA 4ZREA 3RKUA 2ZJZA 5A7FA 1Z4LA 4LV8B 5LUAA 1B93A 4XZ3A 3GJXC 1RBYA 1HO3A 3JASB 4M7RA 4DNQA 2Y3IA 4EFNA 4EJ0A 3H65A 3RGGA 4B5KA 4F2GA 3UMSA 2QE6A 5IXYA 1GZ3A 1F3LA 1O0SA 3FWKA 2EV9A 1FK8A 2JDID 2B1IA 2I34A 3CF6R 3DMDA 2QUZA 4TKVB 4U7WA 2DR3A 4F2WA 4QUIA 4LRXA 4AS1A 3MAGA 1QPGA 4G4SO 5FWYA 4DMFA 2W0MA 2HY7A 3P9XA 4RV9A 2EYQA 3A1NA 3SC2A 2FX5A 2VDQB 4JSYA 1I9GA 3GRZA 3C24A 2H2WA 1Y9AA 3OOWA 3A1EA 4YMWA 3RS3A 2XGSA 1RJWA 2E4ZA 2Z5LA 3PGA1 2NU9A 4I9NA 4JC4A 2HJSA 2Y8EA 3NTOA 1RKVA 4XDHA 2CY0A 4DRXB 4EGSA 5I7SA 5I9SA 2FWNA 4G63A 1HLFA 3I6QA 5JMOA 2DPMA 4EF6A 2XRMA 2ZS9A 4KFUA 1M2KA 4ZT4A 3Q1KA 4CUZA 5LJLA 4RLSA 1RTKA 1E8NA 1V39A 1LBHA 3H2SA 5FFFA 1WXXA 1I1OA 4QATA 1JLHA 1TU4A 3V8MA 4CUJA 1R1DA 1AGPA 4ZO6A 3PSHA 2R8YA 2B98A 4LXGA 5HXAA 3OJOA 1YCFA 4YT8A 4OBBA 4F96A 3NOOA 3E22A 4JR2A 2ZUSA 2W6MA 5DEOA 4KQ2A 1JE0A 1NP3A 2OCGA 3D0KA 4FYWA 2DE0X 3LX8A 3FTDA 1COWD 4TOIA 3NNDA 4DDKA 1XD2A 3DV2A 1KR2A 3SJCA 2EBHX 1YFLA 2FX3A 1M7GA 2OORA 2ZCUA 1MG0A 4MGZR 4C7JA 4Z4EA 221PA 1FNDA 1RJ9B 2DM6A 1IPFA 1VCMA 5KSWB 1YOVA 5JCOC 3S0JA 4U6QA 3SLRA 2B1GA 2PYIA 3CBQA 4TN1A 4G65A 5SYMA 3DFUA 3HFGA 4HN4B 4MWZA 1GUAA 6CHYA 4JI6B 3UHAA 1G8PA 5IAJA 1WHTA 3U3ZA 3CLSD 1E2NA 2D5LA 2YJZA 1FL9A 2INGX 4PQRA 2QNIA 1AQLA 4ZKEA 4JJFA 1UFOA 2V0NA 2IU0A 3R7NA 1ZX1A 3WSWA 4EP1A 5A0FA 3EDQA 1V7CA 1TZ2A 5E4TA 2X0DA 4WVLA 4BN5A 5CDTA 3Q87B 3M8KA 1JIKA 1V5WA 3WTBA 4BNVA 5C80A 5LKRA 3HI4A 1SBNE 2D0IA 3W2IA 5JRZA 2F43A 3PZRA 2RH4A 4Q9DA 4XQCA 5BYJA 3SZMA 3DBLA 2VZLA 2JD0A 2FTKE 4HO1X 3HBLA 1BU8A 1USGA 2EKBA 1OROA 1CRQA 4NE2A 4UHKA 4ZU3A 4CG2A 5BWBA 2F55A 3ZU2A 3PZBA 3WGHA 1E96A 3I3OA 5REQB 1QDEA 2DWUA 2PX3A 4F71A 3GAFA 1ARZA 1UBGA 1P81A 1W581 1P2UA 1WUHS 2A30A 2P90A 3EVAA 3ETDA 4ABYA 4UNRA 3FB4A 1SPXA 4MR9B 3MT7A 1OFGA 3KEGA 3B78A 1QTIA 3QYFA 2XXAA 4KWCA 4A10A 4L8FA 4AS2A 4UVDA 2PNFA 4OYLA 4A27A 4L5IA 2H7CA 1RHKA 3ACBA 4YK7A 3HXKA 3W2HA 3ZWMA 3T95A 2B8WA 3K09A 3HFRA 2VTEA 3ITNA 4KVZA 2ZUWA 4Q1CA 1J5XA 5MN4A 2FRVA 3DXYA 1PT5A 1LS6A 2RHJA 3ZWQA 5I7VA 1AO0A 1R3DA 2ZAYA 4H1TA 1JR4A 4G2TA 1AV7A 2OYSA 3TTVA 4NPAA 1HQKA 4WZ6A 5F35A 2ARKA 3O92A 1NXPA 1PS0A 3JQBC 2H5JA 4S2UA 1TA0A 2GXUA 3Q3GE 1V1RA 3LUCA 4BP8A 1G2IA 3B6ZA 3OJ0A 1VG1A 1I33A 2G06A 1Y6ZA 3RVNA 5B57C 3KTOA 5JC8A 4YALA 5B1YA 4FKBA 1J8VA 5IDXA 1ISSA 1OX6A 4H18A 4ZVQA 4B6SA 5LYJB 3TWOA 1HM5A 1NJFA 1YUNA 1LV7A 3UYLA 5JSZA 2RK4A 3FWHA 4Q6BA 1RKQA 4ZV4A 1YIDA 1FZQA 2ZDGA 3ZDCA 4ZC8A 1A97A 3P32A 2FMUA 4YTEA 2OYCA 4P9NA 5CB8A 4YJDA 2YJ4A 1II0A 2AFRA 3B6KA 3TBHA 3FFTA 4R1OA 3PPYA 3L6DA 1SEVA 3OOYA 4N5DA 1Z5OA 4DEVA 4BP9A 2IEGA 3GEMA 5I8WA 3FD8A 3K9CA 3CVOA 2PR2A 3FB1A 3TOSA 1G19A 2QDKA 1KVSA 2AUMA 4P3KA 5AKEA 4MQFB 1HDOA 3OF5A 2XTMA 2GJ8A 2CZCA 4L5YA 3ZWAA 4AIRA 1QDUA 2I7CA 3ABRB 3U1TA 4GSLA 4XVUA 3ROGA 4H35A 3P9NA 5B4UA 5HSGA 2XMZA 4UQOA 3TRFA 1PNVA 5CX1A 1FTQA 2ZJOA 2G17A 2QGNA 1TK9A 3CGGA 4FONA 2QAGC 1MJ5A 2ZAMA 3S2FA 4PYJA 1J1UA 3PC8A 3D3NA 4DQ0A 1KY3A 4B45A 1GQ2A 1LJUA 1K27A 1T24A 3CNQS 1GU7A 3FF1A 3GGJA 3NETA 1HRKA 1ADYA 2ODWA 4RGYA 3IHTA 5G3YA 3UV6A 4A0HA 5DN6D 1UINA 3WLFA 3T1NA 2VXYA 2O3JA 3SYLA 1OPXA 3SJUA 4D3XA 5TIIA 1P80A 2X3FA 2PUDA 5H5JA 2EFDB 3SE7A 4A91A 2I67A 3G9QA 1WZCA 4ZDJA 2Y99A 2XUAA 5KTMA 4BNUA 2J45A 2R6R1 3ZU6A 1V16A 4PX5A 1NURA 3R5KA 4WD3A 4XFDA 2PXCA 4F6RA 3BFPA 3IVCA 1AUXA 3K35A 1SQ0A 1NJGA 2NQTA 2OFPA 1P5HA 1T4BA 4EUEA 3OWHA 5EUMA 4CNBA 2O7QA 1USVA 3WIEA 1L5ZA 5ADHA 2QPOA 5FOWA 2HRZA 2PWPA 2BZSA 3AFHA 4KRYA 4D99A 1XVIA 2JCGA 2BGLA 2WYOA 4OLFA 1I7QB 1ZNXA 3RUCA 1Z39A 1GN9A 3HL0A 2Y2VA 4YFVA 2XT9A 2PUFA 1ZK0A 3SHOA 3T0FA 4KR7A 1HT3A 1QO0A 3UXEA 1DWQA 2J32A 2NXWA 3LLMA 3NWEA 5JI2E 1P3DA 1WUYA 2QTCA 3D5EA 2WT4A 3GUYA 1LWNA 1PSZA 3GRUA 2DWOA 3VSAA 3G5AA 4NYJQ 5HF9A 1XTRA 4RK5A 3IBCA 1BE8A 3MUNA 4PX9A 5AOCA 3WK4A 3ANTA 3JR7A 1RM4A 3KS9A 4PYOA 4HGNA 3JQPA 1P4HA 2DWCA 1H0SA 1NP7A 1VE7A 3MJTA 4DMKA 5CBPB 5HPYB 2WPNA 4DJTA 4ZEXA 3CWZA 3CZCA 4OXQA 1NBEA 2OO5C 4BLRA 4ONEA 3TMYA 2VPPA 2YYYA 3ZWWA 2P3LA 2WYVA 2CDAA 4MV3A 2RMKA 4LWOA 4YAKA 3HN6A 5TT0A 3SMQA 4ZV9A 4Y2TA 4PSCA 2WNHA 2WIBA 3RYHB 1WEKA 1JSZA 4GSYA 1Z6QA 5CVUA 3HS3A 3UWOA 3FN4A 2HXGA 3A2MA 4DLWA 2YXPX 1SB8A 1ZSVA 2CLHB 3QOFA 3EGDA 4WMLA 5SZHB 1XAGA 4TSRA 3VBCA 2D2XA 2ZU6A 1MB0A 2I5PO 5BMOA 4G4SP 3LT1A 5IT5A 3EOZA 3OPNA 1CUGA 2EG5A 2IDKA 3RQIA 3KNZA 2FPPA 2JGAA 4NIMA 3OMXA 2RJOA 3QMWA 1XZNA 3G9TA 2PR7A 2DQ4A 3BQ9A 4FS8A 4R8LA 3WLMA 1QGED 2WU8A 4GQBA 5DW0A 1P0QA 3W1VA 2DP4E 1KEUA 4J3FA 1VYTA 1YR1A 1ZESA 3M6WA 3D7KA 4IIDA 3SFVA 3ZCXA 3AF6A 3TAXA 5H8WA 3F4LA 5E9WA 4AJ4A 3RROA 3HUFA 3D3WB 4BV8A 2GJ4A 3MC1A 3VVBA 5KJ1A 5G1OA 3KVRA 4CR7A 3GJ8A 4Y2JA 5EJ6A 1E18A 1NW4A 1WXQA 4IDCA 4YJ2A 1DV1A 3Q9UA 3LIIA 1L7OA 2Z4TA 4JOCA 2ZSFA 2QSYA 4K03A 4Q1VA 2NIPA 2W8BB 1A2KC 2YXDA 3SSMA 3JQFA 4F1JA 1L3IA 4I50F 4JI4B 3FLEA 2HH9A 2JFPA 3PDHA 2GUWA 2PJDA 3AU9A 4FJ2A 4HQNA 3N39C 1SQSA 4MV0A 1YIAA 5EXPA 1FDUA 2WYUA 3EC7A 3HFJA 1IZ0A 4ZCRA 1IL0A 1R4MA 1SOVA 2Q5OA 4RVCA 4IIHA 1ICEA 4CDMA 4EW3A 2C1EA 2VEOA 3P9KA 2O8BA 2LRHA 2PEZA 1AOXA 4A0QA 4FFRA 2V6BA 4HB0A 3ZY2A 2WQ6A 4Z4FA 2GCIA 3TI7A 5CGQB 5AW4A 4HNAA 4UE3S 4OHPA 1WQ4A 1W35A 3O9VA 1VQ1A 3PQ6A 1SNYA 1E9SA 4JLKA 4BKUA 1SEPA 4ZMBA 5JNSA 1OE0A 3Q6NA 1W52X 4KK4A 1EGMB 5HOQA 1V8ZA 2YWCA 3AEQB 3WJAA 1E5VA 3DE4X 1U0OC 2JBAB 1YKGA 1CLUA 1JWBB 2W6QA 2EEPA 3WWEA 1QVWA 2JEOA 4ZHQF 3MUFA 3FYCA 2QENA 3PR1A 3IKLA 5E8JA 2IGTA 1BMDA 2Z04A 3IEVA 3NBUA 2VK1A 1ZK1A 3IT1A 4LXTA 2PT6A 4MEAA 2OTCA 1OXKB 3G0DA 2A2ZA 3V2UA 1PBTA 1E4EA 4DREA 5JXJA 4CEJA 3LY9A 2R1UA 1AGYA 1VECA 3E3MA 3DQZA 2V7QD 3GOQA 4LEIA 4MGYR 4DLTA 1ZH2A 5KOJB 2X19A 1SU6A 1URPA 3HR7A 4FDAA 2F1JA 4DBVO 2R1VA 5DCWA 4W63A 3KSRA 3U9TA 3VZQA 3U19A 3WQBA 4F4FA 4LMAA 1G3QA 2V0CA 1SJ9A 2X7XA 3EIQA 3ABIA 3D8TA 2F9MA 3PXDA 4J7AA 1Z28A 4IZHA 1YKSA 1RE1A 3P2YA 5PNTA 1YRLA 1OT3A 3AF3A 5E6RB 5JH7F 1W1UA 4GRAA 4MMXB 4E7PA 2FP4A 4U39A 1KDPA 1AA9A 2CMHA 3K1AB 4F7WA 1BVUA 1PK7A 4YQEA 2FMFA 5M04A 3GR6A 3KUDA 4KR6A 5GAJA 4LG1A 1JSLA 4M54A 5TPZD 3TUJC 3ZHRA 4B7AA 4MUJA 4DB4A 1QGAA 1NZDA 1U94A 2ORWA 3WYDA 1MZVA 1DRVA 4HAVA 3ELUA 2GN1A 4UDYX 1PSDA 1EH5A 1QRAA 1EDEA 4PC6A 5KNDA 4KUEA 3RRFA 5JDIA 4RTLA 2F90A 4QDJA 5HGXA 2EZ8A 4CEJB 3SKXA 2X5NA 4OYRA 4L5BA 3WLRA 1S4QA 4LMRA 3L4BA 1Y98A 4QDTA 1HQDA 3RSQA 3DMTC 3DHEA 1GQYA 2HYIC 2P9QA 3C74A 4IOJA 2PUGA 1S01A 1ULZA 3JZIA 5HKKD 1ADCA 1MH1A 1RC0A 1A2QA 3TCKA 1QF6A 3VX3A 3KKOA 2X6TA 3A3NA 3THXA 5LLTA 2HQRA 3DGFC 1SBHA 3BFJA 4TTJA 5FHRA 4LE0A 1OBHA 2RG1A 1CQJB 3H8WA 4QL3A 3KXLA 3T7IA 2VXOA 3KQQA 3CR3C 4IX9A 4KPUA 5FWXB 3PXBA 2AFHB 1S7CA 1TU0A 2JATA 3A1WA 3RANA 1KQGA 4K40A 1E8MA 4S0XA 3D7LA 1MAUA 3D1JA 5JR3A 2EERA 2IYAA 2VG8A 3D2AA 4LZJA 4HF7A 1YMQA 5LMUB 4HH1A 3C7KA 2BMDA 4AJNA 2COUA 2HK7A 4G4IA 1OXMA 1DL5A 1VPEA 2VP6A 3TOZA 2A5FA 1FC0A 2C54A 2H8GA 2OC4A 4P81A 2NPFA 2WAMA 4CIXA 2DECA 4YBZA 4NDZA 5SY6A 2GKSA 2EW1A 5L45A 1RPJA 4PPYA 1UBRS 1RJFA 1R0CA 4WDQA 4ER0A 2BMJA 2R7AA 4JC5A 4PO8A 2I22A 4ZCSA 1DIOB 4D9HA 1DKMA 2GSWA 4GGPA 3CXUA 2O8DB 2PRKA 4EYQA 4I9FA 2QLNA 2PO5A 3L7JA 2JHPA 3NJ8A 4IIFA 1SXHA 3AK4A 1Z7EA 4J7XA 1NMEA 4C7MA 2AZ4A 4RGQA 3WP0A 4X3OA 1UM9B 1NBAA 1Y5RA 3ZY5A 4BV3A 4PHFA 3QYPA 5CCXA 1SVSA 1DE0A 5CTAA 4CM4B 2AWOA 4Z86A 1FPMA 3D0QA 1Z15A 1A76A 4ENUA 2FDRA 3HXLA 2HKIA 7YASA 1XZGA 1ELOA 2FPRA 1PJCA 1J33A 3B70A 1GPJA 2B3TA 4MRNA 4YUAA 2C4NA 2Q4OA 1M2OA 4KEAA 2YJ5A 4ZI2A 1XELA 1AGNA 3PQ2A 1QK5A 1ZRNA 2I6XA 3MCTA 4R3UC 4AJPA 3ROPA 3SHWA 3W34A 5BUQA 3OIGA 3QQPA 1G7SA 5FIUA 3ZHTA 5GINE 2G0NA 2BP7B 5JAIA 3EARA 4V24A 1KWKA 4M87A 3H9BA 1KQOA 5ALIA 1E3QA 3BGDA 3TQFA 3TSYA 4YRFA 4QPNA 4W1SA 3S3TA 1JG1A 4RE6A 1JEYB 1UBEA 2A5LA 4JI1B 3K16A 3DVRX 2FSHA 3EIXA 4HC4A 3ESDA 3JYOA 2R60A 1YMVA 4HDKA 1FE8A 1U3VA 4LJYA 5TQJA 4UM7A 3WL8A 4ETIA 1CXZA 3SPXA 1KNQA 5L4SA 1N5LA 2IZ6A 1ZISA 5I8ZA 3MJFA 1A9YA 1NYRA 4R7GA 4G1BA 4DFDA 2UZAA 1M76A 2GPAA 4ETMA 3BMQB 3DEFA 2YZ2A 4H7HA 4YROA 3LRXA 1NMZA 1PR0A 1VG9B 2OAP1 4MS4B 3RVMA 1DFHA 1Q95A 3WKBA 1ZWKA 3GRKA 3L6CA 3F7TA 2AZDA 4NC9A 2YX1A 3I6ZA 1AMNA 3IP7A 4KBYA 4CN8A 3L0OA 1S6YA 4W8OA 4KZPA 4R1QA 3IUSA 3KO8A 1X13A 4D46A 3L8YA 2PAFA 4TXJA 1A7UA 3F6SA 3BK1A 4KQJA 4MV4A 3RJMA 1N9ZA 2NNWB 5KCMA 5IVKA 1MO5A 1ZICA 4R8SA 1XWIA 1RC8A 1DOHA 1Y8RA 2I80A 3A1FA 4JASB 3LYLA 4UUPA 2FMIA 2C57A 4I6JA 5IJ0A 3V1NA 2DHCA 2FGJA 2DQSA 1E3MA 1P6XA 1Z6AA 3HBNA 3N7AA 2ENUA 3BGSA 2O1XA 2G80A 2V7UA 3E18A 4OXKA 4Q15A 1PEAA 2WUGA 1ZJ4A 3PDIA 4UBMA 4DIMA 2B8JA 3JVEA 4JR0A 3WL5A 1RW4A 4UUOA 5LD2B 1NFRA 3AL3A 3O84A 4P5DA 3O82A 1BRMA 4PAMA 2BI4A 2D06A 3GEHA 3NX4A 5AP9A 3TW8B 2JFFA 3T5DA 4OY3A 2HCRA 4RPKA 4WJZA 5AI4A 3A2NA 4FX5A 2DU8A 3X1ZA 1PFUA 3CEAA 4YV7A 1E2GA 1F8FA 1M5UA 1K7CA 1DB3A 1FFWA 1Y5LA 1EXWA 4NZYA 1XYYA 2OCIA 5J5AA 4ZKDA 2ILVA 1IJEA 1BFUA 1P1HA 1Q0RA 1TMYA 2ZIWB 1I4DD 3TCXB 1OB2A 4M8SA 3OO0A 3E0XA 1VA5A 2XJ4A 3D4OA 3ETNA 4A6XA 4DF3A 3WFIA 1XPUA 1ECFA 1T36B 3MIZA 3QOXA 4PS0A 1XD8A 2HMWA 3HCPA 3ZTYA 3H2BA 4BOYA 1M2VA 1O94D 3RF6A 5EFZA 4HVLA 2CCJA 3O8LA 1ZD2P 3O2QB 5DCUA 3MOIA 3HP1A 1OTXA 4Z1MD 3C5HA 5JFTA 4LFAB 3B1KA 4JLNA 5IBQA 2VA9A 5EKXA 4R3WA 1QS0A 3PHIA 1EXVA 4NXNB 3CNNA 4U2BA 4GOJA 1U7ZA 1D6NA 1FDSA 1E2EA 3WSVA 3D2BA 3QOYA 2YINC 4JA2A 4KQGA 3GVXA 3OZRA 1FUEA 4HMOA 3UMGA 5IX8A 5AW5A 3VNUA 1KI8A 2CBGA 4V3CA 4C3UA 3SEFA 4Z7NB 4YMVA 1EK0A 1GUDA 3S2GA 3EXAA 3PU6A 4AN1A 1NVEA 1KPGA 4F97A 2XDAA 4C3OB 4EQZA 4OI1A 2Y71A 4N7BA 3QM1A 4DXDA 3ONWA 2B7BA 2G5CA 1FFXB 3TFWA 1NKTA 2VPYA 4B2IA 4UM5A 4UHFA 4JVSB 4D81A 2YJTD 2JL1A 3EOAI 2CLDX 4I4LA 3E8XA 3BFVA 3ZV6A 5C3MA 5BSEA 3GNQA 4IH1A 2FCAA 2NYRA 1I1HA 5B3JC 2MWMA 1XTQA 3NVMB 5JWRA 2EVWX 4OQNA 3RPEA 3X2EA 1D3AA 1ADGA 2RSLA 3L01A 1X3SA 3TLMA 3WNCA 4DV2B 4ZHSA 2P6MA 2XIQA 3HBJA 1ZK3A 4HXYA 3H19A 1IZ7A 3R44A 5EPOA 4OM7A 5DX8A 2V03A 4CM8B 1XI2A 3HMQA 1ZLYA 2H1VA 5B1SA 3KHTA 3WGTA 4D6PA 4A0RA 2ETVA 1NUPA 2HWUA 1F38A 1WZNA 2EQBA 3QLTA 4J0FA 2ORED 4NMXB 3LPAA 3OZUA 3ZHBA 1YB2A 4HDNA 5K6AC 2R48A 3EQ6A 5B6PA 1FS4A 5K8TA 1ZXBA 4DV4B 3QWAA 3VV3A 3TQHA 2C2MA 4E5PA 4L28A 1F7UA 3K9QO 4HDOB 521PA 3W9SA 3AGQA 5D3MA 3O75A 3RJTA 4NHEA 4LXIA 5FCDA 4DCVA 2Q4BA 3ZNPA 3BFKA 1ZW1A 3THWB 1HQCA 5K45A 1L7DA 3U7IA 3W0LB 4CLHA 3L7IA 2Q5HA 5EY5B 1ZIYA 1E9AA 1AN0A 1J00A 1BN6A 1XTJA 3WNQA 2WJYA 4PG6A 1H23A 2XYPA 1Z4NA 2WJHA 1TM4E 3ELYA 3MCWA 4R1TA 3L0PA 4PY2A 4YAEA 1H65A 1GGHA 1KK1A 4KIJA 3O38A 1PV2A 3BSSA 2C94A 1BMQA 2C88A 2B2NA 2I1VB 2RKBA 3R0QA 5CHYA 5FQNA 5MFPA 1TVKB 1GY8A 3LAWA 3ND9A 5KU1A 1Y6GA 1XK6A 4W9NC 4R2LA 5KI6A 3ADPA 1U7UA 5KHAA 1KEKA 4A2CA 2W7TA 1JT2A 1P44A 3CZMA 2IIQA 2GYYA 1U8TA 1VRVA 2P27A 3KKPA 4RYDA 4TTQA 3HE3A 3U5TA 2UU9B 1MQSA 1N92A 1U7DA 2HCTA 3AI7A 1AN9A 1EVEA 1Z7GA 3OHPA 3RW9A 3TNJA 1FXSA 1IHPA 5BWCA 4IHQA 1TCAA 5J3JA 2PX5A 4ZTZB 2GT1A 2CVFA 2ZUVA 2CZQA 4WFJA 4NYMR 5THKA 4BMDA 5LFAA 4TT3A 3U16A 4D3SA 2CFRA 3RABA 1PGQA 3R5HA 4F4UA 1DCMA 1HKUA 2Z9DA 3KPVA 4GOMD 1BE1A 1G21B 4FW9A 1Q7TA 4R1LA 5HWSA 3KWMA 1PQPA 2OC9A 3BS4A 1FMFA 1E5DA 5LWQA 1IRXA 3DQQA 4GMHA 3FNEA 4UHHA 4GPAA 1IXZA 3T38A 5BV0A 1MFZA 2WWWA 3RRNA 3IKJA 4C4RA 5EHZA 1K8ZB 1GGVA 5B5SA 2GZRA 3Q1LA 2FPGB 2Q6OA 4BN4A 4YQYA 4C30A 2AFIE 4TQGA 5HFNA 3HM9A 1QOQB 1F8XA 1MQ8B 1OWNA 1IQRA 2UV8A 2GX6A 4KR0A 1YZLA 2PL3A 2PKQO 3L0BA 2RGEA 3TPZA 3ZE1B 1LA2A 3GNSA 2HW8A 1OD6A 1RXCA 3EULA 3BJEA 5EAIA 3CLRC 4YT4A 3AVWA 3L4EA 3L18A 4EG3A 2BFEB 5AJVB 5HG0A 3Q9LA 4QOHA 1NVUQ 2QE7A 3TFQA 2FSFA 1DGQA 4LV6A 1U2SA 2DAPA 5ICCA 5LSAA 4MVJM 4UUMA 3L8HA 4J90A 1H6AA 2WD7A 4TSKA 4C43A 1L5YA 1UBFA 2DULA 4XKJA 3BF7A 2YWBA 4Q3NA 2GZ3A 5IANA 3QEJA 1YL5A 2P2YA 3L8ZA 4IWXA 1P75A 3FDZA 5CURA 1M73E 2A9RA 2NMVA 3OP1A 5EOVA 5C4GB 5U1PA 3RC1A 1TQDA 1VCOA 5JJLA 1QH9A 3R4CA 3C43A 2PGOA 5H02A 2VNJA 4A26A 2YS7A 3VZCA 4OXNA 4LHEA 2OV8A 3N0TA 1MN6A 2VDRB 3QVGA 1A9ZA 4KGXA 3ODGA 4ROTA 2AN1A 4GS5A 4X1YA 3ZHVA 2HMSA 1Y9EA 4J0IA 3KT6A 1FMCA 4M21A 5DBOA 3U7RA 1BOOA 1ZZGA 4C5CA 1BQEA 3G6KA 4ZYZA 5EWLA 3IUMA 2QLFA 3F49S 5LZ8A 4AULA 5CCEA 1J7KA 3MFQA 3RFFA 4H7FA 3ROQA 4ZZ3A 1XDWA 3Q5DA 1JXMA 1P2TA 1A0OA 4G1FA 1AQJA 1NLMA 3ZD9A 1P9WA 3F97A 5T4BA 3G2MA 4JOQA 3DQPA 4B0OA 1OB5A 4EYOA 2B5OA 3ZHSA 2RAVA 4DLLA 2QUJA 1LDGA 4KYTA 4E51A 1XAJA 4ZU1X 1PQYA 3TRIA 3JPYA 3WE7A 2GEVA 1L5MA 2SNIE 1P0PA 3FAKA 4MCIA 4H7PA 1OVMA 4C2AA 4F5DA 4ZYWA 2F3PA 4MQEA 3ZZ1A 1WZEA 2CHQA 1FFGA 1W88A 3AIKA 2AXNA 3CX6A 4IQ0A 1R16A 4DXHA 1PHRA 4TTRA 4E70A 3MBKA 2O2JA 3KT3A 3I62A 4GAEA 3CUEF 1N9GB 3OEHA 1NBMA 1FSZA 3KYJB 3STYA 2VZ9A 2CVZA 3EBLA 1AKUA 4MP8A 3LX5A 3IEKA 4U8HA 3TD6A 3WMGA 3IBTA 3OOEA 4RKWA 4E3WA 3A4NA 1S0UA 2JH8A 2NLOA 3D43A 2E1RA 3TDNA 4ALJA 2P77A 3NTVA 4CV0A 3GBSA 4QFDA 5DNVA 4P58A 4DA9A 4P5EA 1SVUA 1KDZA 3GQBB 4YV2A 4KGDA 4R2XA 1G3RA 3R5JA 1ZW6A 4NK5A 3SX0A 4LCBA 2VAXA 2A78A 4L22A 1ATZA 4OGKA 4WN3A 3OQIB 4GNKA 4BRZA 2AFVA 4XYBA 2I3AA 4ZAFA 2RHDA 1JVBA 1SZPA 5EHQA 4MKFA 3WL7A 2BDEA 5BQ5A 1ODFA 1PWXA 1DAIA 4Y0VA 2WWFA 4RF2A 2CMGA 1DCKA 3ET4A 3L7LA 1JH8A 1HOXA 4N82A 1FYXA 4LDAA 2VDVE 3ZV4A 5CLJA 3QI2A 1H4VB 4BKOA 1RAIA 4GD3Q 2ZBRA 4FUTA 2MYUA 5FBKA 2JHAA 4NMMA 2JVJA 2VJPA 3CVJA 3TLYA 5AVZA 1XUOA 2GN8A 1CFZA 2EIXA 1M1NB 3H5VA 3M6VA 4F92B 3TM4A 1K5DA 1UFQA 3GCDA 4W5HA 3V2GA 5HIKA 3DL2A 1BXKA 4MYCA 3HABA 1SB9A 2WYIA 1QHSA 1ZMXA 2V59A 2DUWA 2E89A 1OI2A 2R97A 1GU0A 4CFSA 4DJ5X 3LCJA 4BBAA 1NVXQ 4J3NA 2O2XA 3EXHB 3ZWCA 1Y42X 4PAQA 5JZ9A 1HT1E 5A62A 3U3DA 1KYYA 2PT5A 3VZRA 1QG2A 2C9OA 3AEXA 2ZVDA 3RHSA 4CJXA 3U7HB 2UXBB 4PVCA 2VHZA 4OHCA 1LZLA 5IKMA 3BXZA 3ONDA 3ML1A 4ER3A 4P33A 2HLNA 2DXIA 1BU5A 2UZ1B 3GO4A 4P8RA 3ILSA 1ZH8A 1V43A 1EZ1A 1LPAB 3WLIA 4QWMA 5BNWA 2HSEA 4DCPA 1GYRA 2X0FA 1BCSB 4HP8A 3T0GA 1KFBB 2CJPA 3C15C 2Q1TA 4M0MA 3RAPR 4KQKA 4LJ8A 1E9EA 4JXXA 2P4SA 2ZWPA 3E1SA 5ALFA 1JI3A 1US8B 2PS1A 3CEJA 3HR4A 1KFKB 3OZDA 4IFIA 4KR3A 4HQ0A 3TQTA 4HXGA 2XR1A 1K7XB 2W8ZA 3T7RA 3EGWA 2AG1A 4DM7A 5DMXA 5JECA 2P1RA 1KQPA 4DMLA 2D5BA 4YI5A 5HBGA 2I1LA 1UJ6A 2G1UA 3ZQ6A 4RK4A 4LJSA 5FJIA 4C7BA 4DBLE 2Q8PA 1NXXA 1KAHA 1XKTA 1ZN7A 4P84A 4D9BA 4HRXA 2ONYA 3NHAA 3PUYA 4TWRA 4QIHA 5L7YA 4DV0B 1KOLA 1XHLA 2P9YA 2B36A 4G4JA 4FWIB 5GWXA 2X8JB 4QTUB 4BFVA 3FTFA 1RMQA 1MORA 4EJFA 1O8CA 4JIGA 3IQZA 4O4LF 1NI3A 4Y9SA 1QTQA 5FPQA 1YK0A 3RRBA 4BMNA 1CUCA 4Q7JB 4V0MA 3ZZUA 2RHBA 4O63O 5DK6A 4HBZA 2OXTA 2FRDC 3GA0A 3PXGA 2OWDA 2R00C 4ZK2A 4GC5A 4C5BA 3RYFA 2EP8A 3CUUA 1FDOA 1M9NA 3QFRA 1NJSA 3UCXA 2H1IA 4IJUA 4IICA 2FRXA 3RFTA 5F23A 4D9EA 3R77A 4EBFA 2BUAA 4ZVLA 4EO7A 2QLLA 3JAMA 2C03A 2WPDD 1Z83A 3CH5A 4H3SA 4RL4A 4DNPA 1QSGA 1N3YA 4RELA 3IAFA 5DTQA 2Q5CA 2VSYA 3MK31 5ENVA 5F64A 2O19A 4WJLA 5EMMA 4XYGA 1WHSA 2QV7A 1E2JA 3I5UA 2W90A 3GLHB 5F3DA 1LKZA 2EGGA 2XADA 2AF3C 2A59A 4WZAB 3SLGA 4BFWA 1C4WA 4CRWB 5KPDA 2JFOA 5JVDA 3G02A 4DIFA 3NT4A 3F4KA 3LPNA 4HDSB 3TKAA 5HQTA 3SR3A 3KKEA 1XQYA 3F2VA 1PWYE 2GR9A 1SU8A 2HO5A 3AH8A 3H3JA 4WHMA 3PPWA 5T4EA 4P0QB 3H4MA 4UDXX 5CFOA 3KQLA 1WU8A 1V4NA 3WBFA 1SKQA 4H7JA 5J4VA 2C2GA 4YECA 1CEXA 3FFAA 2VCEA 1RZRA 3UJ7A 4F04A 1UEXC 1T8UA 4P4GA 1M0WA 1RYYA 2A33A 2DWQA 3QUQA 2W2QA 4PPQA 4Q9HA 3WYNA 2H9AA 1JDJA 3MZ0A 4JHXA 1H66A 1XCLA 3KOUA 4CNQA 2BZ1A 3MLBA 4RS3A 5DULA 7AT1A 1BMFD 3QUSA 1M67A 3M4YA 1PDWA 1T3ZA 4KCGA 5ALXA 3T4EA 3BB1A 4YUWA 4KBGA 4B82A 1XDSA 1YJBA 3BMNA 3I9FA 3N2NA 5ETJA 3V7FA 4L6IA 4U1RA 1D4OA 4BFCA 4DHWA 6NULA 5C1DA 2SKEA 5FT9A 1BQ3A 3LW7A 2XSZD 1B6GA 3QW2A 5E0KB 2WU3A 1YFZA 3MGAA 3K2EA 2WJ6A 2QTVA 4LI0A 2PKQP 4D9GA 1ZEJA 4MWSA 1X42A 1UKZA 2IYSA 4P92A 3ZTTA 3ESRA 2OL4A 4MW0A 3GT7A 5IHPA 1W48A 2JLBA 3K7EA 4CMIA 2VJOA 3RYCB 3AONB 2X0EA 1HNNA 3BE4A 3ZUPA 1LQUA 4RM2A 3H18A 3ER9A 4HKTA 5A1TA 6ABPA 3I0MA 3IVRA 3QXJA 1I13A 3KR1A 3O74A 3WGNA 4TMXA 1RD4A 4BEJA 1ZVMA 2O4UX 1J7JA 1AKVA 4Y98A 2QD2A 4DR7B 5DFAA 4ZCQA 3WZMA 1T2EA 4L9SA 1V8OA 3UH1A 3YASA 1FF9A 1PJ3A 4PS1A 1O4VA 2I4RA 3BA1A 4BWVA 2Q99A 4TWAA 5FX2A 4YV1A 3WAGA 4IFEA 1V8FA 1ZD9A 1E2IA 4IIXA 2C2OA 4EJSA 2I2XB 4Y1GA 1Y3IA 3KV3O 3QU7A 4QTZA 3ZY6A 4D4IA 4RKFA 4ZK6A 4OVKA 4EYSA 2AW3A 5J9FA 5EPEA 4KE6A 4CCYB 3ECAA 4BQRA 5CFPA 2JLAA 1Q77A 2I4IA 2WT8A 3LQFA 1ODSA 2YHSA 2IYTA 3N70A 1MA0A 4ZVOA 3AIMA 2QTFA 5FUMA 1R5OA 4PU0A 3RH0A 4B46A 5K8VA 1R8XA 2HFKA 3ORQA 4P2BA 5DGDA 5EJGA 2MCFA 4KDFA 1XPOA 4XD7D 2H3EA 2BHRA 1UPUA 1XDZA 4W1QA 2FPWA 3GEGA 1FTYA 3OSUA 4X3CA 4C78A 2O3UA 4JB8A 3UAOA 1RYEA 2HWYA 3VPBA 1K6XA 2H2AA 1KARA 1HT2E 2P3QA 4N9QA 4MKRA 2QN3A 5EIFA 5CDUA 4YMUA 1KMCA 4PZLA 1DFGA 1OY1A 1ZQ1A 4OXXA 2V1UA 3U49A 1NQ5A 1P7PA 3WKAA 2AX4A 1DRUA 1E3DA 3RFUA 3OA2A 1QB8A 4BQSA 3IBFA 4QUBA 4YP9A 5I3ZA 4DV5B 4MUKA 5JD4A 4H7DA 2XNKA 3IIKA 3WZLA 5A5FA 3OZGA 5JNTA 3DE3X 3L4SO 3L7MA 1GARA 4KNVA 1RWXA 1ZIXA 3IL2A 3FYUC 5CB0A 9GPBA 1B43A 2KBFA 1ZD5A 2WSBA 4ND8A 4PEVA 2FKNA 5LXTB 1WNTA 2RGXA 5FI3A 1XTPA 3ZNQA 2FXIA 1SCBA 4KAFA 3QWHA 2AW5A 4KXYA 1BOFA 1A9SA 1VJTA 1T5LA 3L05A 4D9NA 3RAEC 3PX3A 3RO7A 2VHWA 3PXXA 5FEMA 3DB2A 3T1HB 2FSVC 2XAAA 3RS8A 2ZSDA 3SCZA 3SQDA 5DH9A 1ULHA 3MTIA 1QX4A 4N65A 4N5MA 4PV7A 1N2CE 5CLGA 4U2GA 2ZBFA 1DCFA 3BH0A 2IYFA 2OCBA 5ALMA 3SXJA 3UN1A 4J1TC 4YWJA 3RGWS 1Q57A 2OZEA 1VIYA 3VPGA 1W85B 1X15A 2DKOA 1M6HA 1GUYA 2VSNA 1ADJA 1WF6A 2FN8A 1IOWA 2ECKA 2YDXA 2V9ZA 1SVMA 3QVSA 3H9GA 5HJEA 4LDRA 3BC1A 5JADA 2FN7A 5LQRA 1T4CB 3IDSA 3OY2A 3CPSA 1NRIA 1U0NA 2G25A 3DKPA 4JVLA 2PD6A 2BY4A 4KFSA 2PSFA 4QUDA 4XUEA 3SDZA 4E1AA 3KLMX 1MIOA 3WK5A 3FDIA 1WETA 1SFRA 1R4NA 1VBNA 5I4KA 1W0KD 1MX9A 2J7PD 4OB6A 2QG6A 1CYEA 4ZOLA 4PFJA 3MUOA 5HE9A 4PRLA 3PWTA 1JH9A 1KF0A 3K1TA 3STUA 3GG9A 3OX1A 4HXFB 1J21A 4JC0A 5CB4F 5KAPA 4BZPA 4P35A 4DM4A 1ZAKA 2JCBA 1TT5B 5JRDS 4MV8A 4BMZA 4EVQA 2IUFA 3EFOB 4MQ4A 4YMIA 2NSHA 2WJVA 5BMVF 4E2YA 2IEDA 3MJCA 1DC8A 2H51A 2ZRPA 4EATA 2IPOA 5ED4A 2FEXA 1V35A 4IRMA 1AZWA 1EDOA 2PX8A 2G40A 2FY8A 2ZUDA 3FSGA 4P7KA 5JCJD 1JKJA 5E6SA 3SC4A 4K88A 1T2NA 1YONA 4MV6A 5K0FA 3D9QX 4JUFA 1MVLA 2QMEA 1GLNA 4QLAA 3NVKI 2CEKA 2YFKA 4ZEOA 5HX7A 3PNSA 2H0AA 4OIFA 5L3RA 1IXRC 2REQB 3U3OA 4IJWA 1JJBA 3R41A 2QMQA 3HJCA 5B2EA 1EB8A 4GWGA 4Q21A 2J3QA 4NAVA 1XQVA 1TEVA 2YY7A 2WU0A 4EMSA 4NZOA 1DXOA 3LQ2A 5CLHA 3ZGNA 1F1JA 1UBUS 3C70A 2Z2YA 3MHPA 4HS9A 3AEUA 1JU3A 2LCQA 1JT9A 1A04A 2Q6LA 4EPTA 3BG5A 4OQ4A 2IK8A 4WCFA 1MW9X 3ENVA 3FF4A 4LY3A 3ZGLA 2WE7A 1YRYE 2XUPA 5DE3A 3O91A 1A9QA 1CUJA 3TRHA 3BGIA 2C61A 2C2XA 1DXQA 4DYHA 1TZBA 1M0TA 3T1QA 1P72A 4FMDB 3GMTA 3UZUA 1LK5A 4DUGD 1T2UA 2GTPA 3VZBA 4HGOA 4OB8A 3G2NA 3AR5A 5LBUA 3RVRA 4O4HB 4BMPB 2ZRGA 3MPOA 3D8BA 4RD2A 1SVOA 1ZUWA 1THTA 1WTAA 1XLTA 4REQA 4D0GA 4DNFA 2NZ8A 1C30B 2ACWA 1W0JA 5EJAA 1U31A 2ZZMA 3UWDA 2IWHA 2BD0A 2Q3HA 2X5OA 1JDTA 1N2EA 2NP7A 3RSGA 3W4IA 1RXYA 3R7WB 4MKXA 3AVUA 4C87A 5FBWB 2M9MA 1UK8A 5K99A 3EPHA 1HEUA 3TQQA 4E3ZA 3TH5A 3E3AA 3MRVA 4IL5A 4HS4A 2WZQA 1LB1B 1IWOA 2BR3A 5DBFA 3VAAA 4F8EA 4JC8A 1UKBA 3ILHA 5BY2A 5TF4A 3LQRA 4BB5A 2JLWA 3ZGYA 1ULBA 1K8YB 1V9LA 3L1IA 5A9SB 1BEZA 1VSVA 3IDAA 4JAVC 4ALLA 5C8YB 2Z6QA 2W11A 1G6KA 5BW4A 1NX6A 5I9TA 2P7HA 3GLIE 1DEAA 4Q18A 1GNSA 1N2OA 2XKJE 5E8RA 1J9GA 5AK6A 1M2JA 1W2WB 4A8JA 2P2GA 1NW8A 3OJXA 1FSGA 2CFTA 3DBRA 4I2NA 4B3HA 5IT4A 5KYXB 1GGFA 3RASA 1FTWA 5IK2A 5A9TA 1Z34A 2IYNA 2P35A 3FMFA 3LGXA 4QGSA 1CIVA 1I2AA 4AWAA 3HBFA 3LYAA 1KY4A 4BE4A 2X2EA 2JAWA 1TECE 1KJ8A 4MP6A 5BSUA 5IYZF 5GZ3A 2VK8A 1RRFA 4WXMA 1IY0A 4X1OA 4OA8A 3DNPA 3RBXA 1JB1A 3ZV5A 2IIPA 5BYAA 2AZXA 3A1DA 1JG7A 1XCBA 3MSXA 5EWJB 1NOKA 1J8FA 4QJ3A 1XZPA 3L2OB 4TLLB 1GSHA 3IB6A 2P40A 1PJ4A 3OEYA 1BG6A 5FADA 4D9IA 1QE3A 2JAXA 3JVVA 3NKFA 3LQYA 4RK6A 4OI4A 4KQHA 1ZY2A 3CG4A 3PC3A 1T9HA 1Y9JA 1JYSA 4RHUA 1QIIA 1P5ZB 1XVUA 4NCKA 5LPNA 3OQMA 2ACVA 5JCZA 4LZPA 2BJWA 5MGBA 3SU8A 1FUUA 1KAQA 1Z47A 4QICA 2OBMA 1H5QA 5K03A 4Y2YA 5A0TA 4UCFA 5WRFA 2PEYA 2WUWE 4QJBA 3HYSA 3P9SA 4ODIA 1AXRA 1X0XA 2MTBA 2R87A 4HDMA 1ILWA 5AQ1A 4C4AA 1O58A 2EWWA 1CR1A 4TTAA 3TR6A 3KTAA 4ZYUA 1L8XA 2QDXA 1PU2A 3QVLA 1FUIA 5FXMA 2X4IA 2PGLA 2H65A 2Q5JA 4TPKA 3CGWA 3QUBA 5DXAA 4W1PA 5GGXA 2F4VB 3AVXA 3I23A 1XZDA 1Y4AE 3ONEA 1ZN8A 5AKZA 1D2AA 4M1MA 3U6BA 3DMHA 1C1XA 3ZE9A 4IYJA 4W5OA 2FW9A 1ULSA 3I5XA 3GWGA 4ESOA 1G8HA 1K68A 3GRRA 4YJ3A 4KR2A 1SIUA 2GYWA 1N77A 4OK6A 4CDGA 1U1IA 2PMKA 5E4FA 4O4JA 3TSOA 1I4OA 5BN4A 1EIWA 2RC6A 3K9BA 1NUSA 5CT6A 5F5NA 2JEZA 3THOA 3ZBQA 1ZMRA 3EPLA 1RPNA 4J7UA 3V8VA 1Z0AA 3ZS9A 5IMSA 2GZ2A 2XWJI 1K8RA 3KQWA 2FSGA 3Q3VA 3CKKA 3LU1A 3FZNA 2E2WA 3CRZA 2ZIEA 3PGKA 3PJDA 4BGVA 1P7VA 1Q1QA 5AW3A 4D4KA 4ALNA 1KZ1A 1E3WB 2P9JA 1BS9A 1COWA 1RLMA 2YN2A 4LNUA 3ZQKA 4YB8A 3LL4A 2ZT6A 1OFHA 5EIBD 3T5AA 4O5AA 4AYXA 3BA6A 4IHAA 1T9KA 4FX2A 2QVXX 3IB3A 1TO1E 3RTBA 1Z6XA 1C41A 5HCNA 4YMGA 4ZIRA 4CQLB 1LBSA 4RKEA 4NE7A 5TMEA 3NHKA 3FHJA 3WB1A 3QVKA 1QK3A 4DBZA 3EDCA 1NE2A 4O8CA 5FUBA 1P91A 2J09A 2WM9B 2Q3LA 1CVLA 1MXFA 2XVAA 3GCZA 4K1XA 1ZD1A 4S2EA 3M81A 4S24A 4DGQA 4EHFA 2IBSA 1BVHA 4BVEA 5J1TB 4CEHB 4R7ZA 1AQIA 2JLUA 1RJDA 3DKIA 3UXYA 4NG4A 4BKQA 3I72A 4E33A 1SZDA 4LRYA 1DJOA 2GOYA 4GR4A 2YIDA 4F06A 3C3KA 2FI1A 3OQHA 2WY2D 5DGXA 3PJGA 2H1FA 4C22A 1IM8A 3WGVA 5JLJA 2BM1A 2IYZA 3FWPA 4XJXA 1CUAA 2BTQA 1W2HA 4PAGA 1C9YA 1TPZA 3I09A 3CZ4A 4DCGA 2JLSA 3PLNA 4OKNA 4KO4S 1I94B 1PGPA 4UBKA 4Y2GA 1CTQA 5JIBA 3QEAZ 4BWGA 5F9FA 3H97A 2W83A 4YREA 2PIAA 4JI3B 4R2KA 1YI0A 2I8LA 3R5SA 1FJXA 4MDHA 3PYLA 2GETA 5CW1A 4QBGB 3RYTC 1K63A 2BR4A 5FKJA 2R8OA 5KS2A 1FXWA 4L4RA 2Z5GA 1NLFA 1PUXA 2IEIA 3AUAA 3W5JA 4QFBA 4GYKA 2EX4A 1CG6A 3CUYA 4ZPXA 5LMZA 4GKJB 4EMTA 3MS4A 2OXFA 4A0FA 4R51A 1JF8A 5JQGB 3MWDA 3KLNA 4BZQA 1G41A 3EF1A 2BW0A 3E82A 3FWZA 4S3MA 3VDQA 4ZZIA 1R5NA 3AEKB 1S8AA 3OCUA 2HBYA 5DHQA 4JJIA 1XVLA 3MCUA 1GGJA 4YUVA 3VU8A 4Q7EA 3BGWA 1ZUD1 3FZYA 5CEJA 4CF6A 4C4SA 5EXEA 3FIUA 2GO1A 3K5WA 1YVUA 2DHRA 1YZVA 3FNHA 1VL5A 2Y1FA 2YHIA 4RVGA 1CQIB 5C7LO 1KSHA 3WOVA 3VPXA 3B36A 3G59A 1W44A 2J9YB 3F8SA 2WWGA 4U7JA 2XEDA 2DYKA 4Q24A 1KY2A 4E0BA 1E69A 3TD2A 6REQB 4Q39A 2J59A 2DQKA 3H1AA 1QFJA 2DPLA 3KD3A 4ZO4A 3T54A 3NBAA 1M6VA 5CJ2A 1E7RA 4YIHA 5JV5A 1N32B 1Y8CA 1W49A 3S8MA 3VJLA 5JXHA 3B3AA 1CHDA 5IJ9A 1WXFA 2ZUEA 1HDRA 1H9CA 3SN6A 4WZBA 1OIWA 1CQXA 3H1TA 5A4MS 1EFDN 2GZAA 2QD4A 3LSTA 2Z2JA 3GFBA 3RVPA 2A0UA 3SZRA 2XE7A 1E4YA 3OE4A 5TJ9A 2ZSUA 3OFJA 3AXSA 1EA7A 3EWNA 2GAFA 3K6RA 2PUBA 2H2HA 2MT9A 3ESBA 1PG2A 1XRNA 3BL8A 4DY6A 5LP6B 3NFYA 4O1MA 2D0PB 1N4AA 5H0IA 5IP5A 4Q9IA 1JIXA 5BRAA 4R71A 4Z7JA 5AK3A 1FNSA 1Q0QA 3EXFB 3ZUGA 1KJQA 2AV6A 2P2DA 4C7VA 2FPXA 2XLCA 4FHDA 1Y63A 2ESRA 3E7WA 1AKMA 4XM1A 4UXHA 4EQ6B 5HZMA 1JIVA 4H17A 4PSVA 5JAHA 4RC9A 4YAIA 2BV3A 4WNAA 1JHPA 3VISA 2G7MC 4UCQA 3QUAA 4FFVA 3VPHA 3HV0A 3LUHA 3LD9A 3GT4A 1UJMA 2B1RA 2M98A 4NTZA 2P2SA 3BTVA 1E6MA 1NL3A 1W4CA 1KQNA 1E4VA 1GNLA 1UBMS 4KRGA 2PZ8A 1H2BA 4XLZA 3HKDA 3TCNA 1K66A 3CUSA 3EODA 2O3QA 1PYOA 1MRZA 2H7YA 3T8YA 1KC1A 2IZOA 1LS1A 3AKEA 4LNAA 4DKJA 1ITZA 4FZ5A 4MV5A 3O3MB 5KKAA 3WL4A 5I45A 2B30A 3L02A 1JG6A 4CTOA 1RP7A 3OQBA 2UXDB 3ICWA 5B1HA 4XJVA 5AWFC 1PGOA 1TFRA 3BN3A 4URUR 4J0DA 5DYTA 2WFAA 4BMYA 2GO7A 4JI2B 2NU8A 3O8OB 3B3FA 3ZWNA 3QTLA 2BT4A 3EZYA 4XGQA 3MTGA 4EFKA 1G0NA 3ZCTA 1R0SA 5BSFA 2OORC 3C5CA 1N4DA 1R0RE 1Y3FE 3H2IA 4RL6A 3WWPA 5B36A 3E9YA 4KLAA 2Q46A 2BM0A 4EA7A 2FETA 3B53X 4FN4A 2UYHA 2BAGA 3WGGA 4JBXA 1ND6A 1OMOA 1A2OA 3AT1A 1VSBA 3G9ZA 2YJGA 3O8NA 4RF3A 5FBHA 4BEWA 4M3NA 3HA7A 4KE7A 3S2UA 4PZAA 3VRHA 4BLUA 1RAEA 2GMWA 2VQDA 4PGMA 1OFIA 4JX9A 1X74A 5KREA 2BBOA 2YIJA 1OI7A 2AYZA 3IV7A 2HADA 4EHAA 5AM2A 2CB9A 2ECOA 2ZIGA 3CW9A 3I2HA 2Q0QA 3TLGB 1OHHD 4OLJA 1PWEA 4NQRA 3NHYA 3VTAA 4PNEA 3ND6A 1T6ZA 1GLVA 1J56A 1M72A 4FLFA 2I99A 4LRQA 2DUUA 2AOTB 1BDIA 821PA 1VYHA 2QP3A 3MJDA 4AICA 2BM8A 5EZYA 1K75A 1KMIY 3R9XB 4U9IS 4L95C 4F5ZA 4QHTA 3ABZA 4QOIA 5BVGA 3MINB 5JS7A 4Y6OA 1UOPA 2KLHA 3VR2D 2F3SA 3MWFA 1GQQA 2QB5A 2XKBA 2ZSAA 1JLSA 4E4TA 2HU8A 5KHOC 5HE8A 1QIFA 1EJ2A 3O83A 4QVGA 2L0XA 4LDJA 5CMLA 1G8AA 1GCIA 4W5RA 3JATA 5SYAA 1VPWA 2AOWA 3K09C 5EKUA 4PBTA 5F7ZA 1XYVA 4DNXA 1UMBA 5DYWA 3K3PA 1KYXA 2IVFA 1XE3A 4GP9A 2C07A 5L95A 3OKAA 4IJMA 1XKXA 2D1TA 2WJPA 4MB6A 4MVYA 1Q7CA 4COKA 3EFEA 5AVSA 2J31A 3KQHA 4TGLA 1ZH4A 4RAQA 4ZD6A 3NUZA 4UPDA 5JYCA 3KR0A 1BE6A 2I8AA 4U5XA 3ESXA 3UBMA 2OO7A 1WSBA 4NAUA 3UWMA 2H2FA 3ZHZA 4ZYXA 4KFCA 3JWPA 4RXTA 3ROMA 2QX6A 5LYJF 4HMPA 2QUHA 3VNVA 2VRCA 2VPZA 1VJCA 2YHBA 1RRCA 2J9FA 5DYNA 2BMFA 4KQEA 2OV1A 2ZAIA 4X41A 1U2PA 3BQNB 5EIXA 4L2IB 1TTQB 2H4FA 1S2NA 2AHOA 3BMCB 3P94A 5C81A 3ZJUA 1J4AA 4M83A 4MVWA 1KJNA 1QP4A 1U7OA 3OICA 4Y2PA 1XZAA 4GSKA 2EARA 3FOWA 5JS2A 1B3RA 3WYEA 2KB0A 2ZM5A 2JGIA 4RS4A 2I4LA 1NQOA 2G0AA 4B7ZA 4C4XA 2XTNA 4OAOA 4EL5A 1RMTA 5CFNA 1GEEA 2I3ZA 5BN5B 3EZ6A 3QITA 2NZWA 4NCXA 1W5TA 1R37A 2VKTA 2VOEA 3FBWA 3JQAA 4HH4A 3TL6A 1U8UA 4HAUA 1B8OA 5K0GA 2WIKA 3VR6H 2CXRA 1CR0A 3ZDDA 1VXOA 4DLNA 2QNBA 3WRYA 3SSAA 4MKGA 1E9FA 2XPCA 3QPWA 1GADO 1W7AA 1DT3A 4CEIB 2CXOA 4KO8A 5DF1A 2B92A 4FCCA 4WA8A 4Z8XA 3HADA 1SK8A 4L4XA 4MWTA 5CBKA 2J4FA 3F46A 2PQMA 5LN1A 3M6LA 4D8YA 2FLVA 3VMFA 1N2IA 1RLIA 4HN9A 2N3ZA 2R62A 2YN0A 2BFMA 3FR8A 4LYHA 3ZI0A 1CVIA 1T5BA 4FHZA 4RPCA 4HWOA 3V3KA 2X41A 3W3AD 1NMXA 1YQTA 3EGVA 3O26A 4FNOA 4UULA 5AKHA 4JXKA 5TPZA 3PJRA 2PANA 5EINA 3TTYA 2HA4A 3L3BA 2QSUA 5HIIA 2WJ4A 3K0KA 5K09A 5K0SA 2QJRA 4D9JA 4DRZA 1SXPA 1SAYA 4B6JA 1DKUA 1E66A 1TAQA 2OE2A 3INGA 3L04A 3PNBA 5A6SA 5CLFA 3DV0B 1XNGA 3KSUA 2RHCA 3T94A 4GNRA 3DFZA 5K3CA 5TF0A 1H85A 1WMAA 3F98A 3A31A 2BI7A 4QBIA 4RD1A 2YC2C 3J81A 5G4KB 1RYHA 4KUHA 3IUYA 2RKWA 1YCGA 4LJ4A 1VPLA 4MA0A 1UODA 2GWRA 3QNWA 1U0BB 1ORTA 3W6NA 1T13A 4H31A 4B32A 2MYTA 3PC4A 4HYEA 1SCQA 4FVTA 1KHTA 3OWXA 3PVCA 5E7QA 3EVFA 4ALMA 1PFKA 3I9JA 1KJZA 1V7ZA 1VSQA 2H0QA 4CTMA 1G5QA 1Q83A 2PZEA 3E4DA 5HOEA 1JWAB 1WKCA 2VZ0A 3VR4H 1E61A 1E1MA 1AC5A 4E7OA 1Z29A 3IERA 3GLQA 3MGCA 4K2HA 4F6CA 3K6JA 5EEHA 4CG3A 4RD3A 4AQDA 4BAUA 1KDVA 2Z08A 2P2LA 1NW9B 3KWFA 2YJ6A 1DHTA 1KXJA 2JK1A 3M5PA 4N40A 5HCUA 2J07A 4HH0A 4BQQA 3HYLA 4IDBA 1F1BA 2BH2A 3OPYB 5C35A 1V3UA 5DHRA 2H1RA 1YRHA 2GBLA 3ONFA 4MHSA 4PONA 4WDRA 3RS7A 1UMDA 1T9BA 1WMBA 4H16A 3VPAA 3MBOA 3IFSA