4KLAA

E343d variant of human ferrochelatase
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIDTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title E343D variant of human ferrochelatase
rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
total genus 141
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klaA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klaA01
2QD3A 4KLCA 2PO5A 1LBQA 2AC2A 3GOQA 2H1WA 2QD4A 2HK6A 2Q3JA 2HREA 2XVZA 1C1HA 2Q2OA 2XWSA 3HCRA 3HCOA 4KLRA 1DOZA 1HRKA 2C8JA 2Q2NA 4F4DA 1TJNA 2XVYA 2JH3A 3HCPA 4MK4A 2AC4A 1QGOA 2QD2A 1C9EA 2PO7A 4CCSA 2XWQA 1L8XA 2H1VA 3W1WA 2XWPA 3HCNA 4KLAA 2QD5A 4KMMA 2HRCA 1LD3A 3M4ZA 3AQIA 2QD1A 2DJ5A 2PNJA 2XVXA 3LYHA 1AK1A 1N0IA
chains in the Genus database with same CATH superfamily
1E2UA 4P58A 3HV2A 3H04A 3PCXA 1F3OA 3GNTA 1W0KA 2ZK7A 3UB4A 1TKCA 1O94C 3WLMA 2G17A 5M2QA 5BQ5A 3KJFA 4YRDA 1H1DA 2ZIZA 3E9CA 3O0DA 4RADA 4ZOLF 4CM4A 1A9XB 5THXA 1KI4A 2HHJA 3MINB 4AP5A 4BFVA 3VA7A 3WWCA 2I1VB 2PH5A 5JTTA 3E27A 1Q12A 5EKUA 2Q7XA 2FR0A 3DZDA 3LZCA 1BMFA 1YD7A 4B35A 5JATA 2GASA 1MDFA 3IAEA 2RAVA 2XH8A 1Q74A 5LA6A 2B35A 3QBJA 5DBIA 4AG3A 5AVZA 1HE8B 2LDBA 3CO0S 4RSGA 5UKDA 3SWWA 3QUSA 5DX8A 4P4TA 3DMHA 2QX8A 3HZHA 2Q6TA 1C0IA 2F3TA 3MJ4A 1JIKA 4D46A 5CAEA 1Q21A 2PU7A 3PNQA 4RZIA 2FSIA 3EGEA 3VKFA 1GTZA 4FW9A 3AK4A 1R0LA 3Q7RA 3MRVA 4ITVA 1HWYA 4AULA 3QVGA 2BM1A 1X9GA 2RAUA 4AWBA 1C4XA 2YICA 1MB3A 4G1MB 2Q3DA 4K9MA 4R0VA 5A7HA 5IXYA 4PONA 1AN9A 1GL3A 4NSNA 3GU3A 3GZTB 4NVRA 4YGXB 3F2VA 4FMDB 4RCVA 3HJGA 7REQA 3ESYA 1U0JA 4GRDA 5KYYA 3H1FA 4AQDA 4QKQA 2G06A 5AJTA 4HAVA 3DZ8A 3EIWA 2CXSA 5IJ0A 2GKGA 1XEWX 4ZMBA 2M6SA 3VDRA 1CJMA 1N9GB 3NAGA 3Q2KA 3IHTA 1HE4A 1OTXA 2VP5A 2ODNA 3ZCPA 2QLBA 2ET6A 4DZRA 3AESA 2ZCUA 1YZNA 5JS2A 5FUBA 3O8OA 5AKXA 3H17A 2B8WA 4DXAA 3ET4A 1W52X 2QK4A 3HKEA 2Z2IA 3I92A 3W2HA 1YRBA 4X7PA 3UAVA 4PSAA 4BIMA 4EL5A 1V3TA 1C4KA 2B5VA 4NOMA 2B8TA 2Y1OA 4IUDS 5HGJA 1SKMA 1Q14A 1XN4A 2XB8A 4GPIB 4P2BA 5FBHA 1T6YA 4FYKA 4QTZA 3KZNA 3TKAA 1OFTA 1B3RA 4NZOA 2VJNA 3PKIA 1J09A 5E4FA 4AS2A 3LFUA 2OV8A 3IAS6 2XA1A 4WZAA 3W2EA 4BP3A 4RY9A 3G02A 2QZPA 2D5BA 3GK3A 4LNHA 3RIHA 1RHRA 4E1BA 2IF2A 4KX5A 2VWQA 1M76A 2G4LA 1IN4A 4W5NA 2X77A 3W78A 5DIZA 2INGX 2I6GA 3H5OA 4BO1A 1C7RA 3QXJA 3GDWA 2DGDA 4B74A 2I8AA 4C89A 3JX9A 4PTYA 1RXYA 4BGVA 2ODPA 2AV6A 1H4TA 2R4UA 5KDDA 1Z33A 2GK6A 3PE4A 1DE0A 3AEQA 2IP1A 3W3ZB 5KYNA 4UUOA 4MVXA 3LE8A 4WIAA 2GAJA 1SIOA 3L0DA 3AEKA 3ZDZB 3K2EA 3N74A 2ZAIA 3AL0C 1GDHA 1GUAA 1SVMA 1R0YA 2XVMA 3SVLA 5C5CA 1Z6YA 4GYWA 3SYMA 1X80A 2BCJQ 4DLVA 5BV8A 3KOYA 4M8SA 4WEQA 4PZ0A 4EJMA 4PW0A 4YMIA 3B7GA 3ETNA 4QYSA 4EEKA 1CJVC 3OQIA 1SUEA 4FGUA 3D64A 4IDOA 3INYA 5HK9A 1KWGA 3ISJA 4OAPA 1ISJA 5JCJD 3JSAA 1SC3A 1LH0A 4BTVA 5CIYA 2ID4A 2DT8A 1MC8A 1TLFA 4D5EA 5B58C 1K8RA 1PQUA 4CIBA 4JNKA 3MWFA 1Y1QA 4M1ZA 3ES9A 1XXHA 2Z08A 4CCAA 2ZDQA 3OTGA 2BN4A 3ELDA 4O2LA 4OP2A 5KMGB 3SG0A 3OIGA 4WCFB 3QYFA 4M46A 4A16A 1Q17A 1Q0HA 2P4EA 2VYVA 3I01M 4IRUB 4CTNA 5C4IA 3WSTA 5JAQA 1N3IA 1S8AA 1YKSA 3BXEA 3VR4H 5DYIA 4C3UA 1O54A 1ZH4A 5C1BA 3DOUA 3KVVA 2VDQB 3QE9Y 1DLJA 1SJ9A 2D3TA 1JI0A 3KAQA 3D4BA 1ST2A 3FX2A 1UDBA 1QQTA 1N2CE 2AOUA 2FQWA 1OR8A 4L50A 1Z0AA 2OWDA 5ED0A 5LZ8A 4KXFB 4X41A 4P4UA 2H48A 4E4RA 2W98A 3LWZA 3DMPA 5C7YA 3ZD7A 3L04A 3JQBC 2OGUA 5L45A 3CF6R 3V2UA 1A4RA 4EZBA 3HZRA 5IM4F 3O3MB 3C4JA 1RJGA 3H8VA 4PHTA 3Q11A 3WGTA 4ER3A 3KU4A 1D0IA 2ZSBA 3BJRA 4UAGA 5DIFA 1DEHA 2ID7A 1YOVA 2QZ4A 4QO8A 1E9BA 1UAGA 3FCEA 3VISA 4CM9A 3TNFA 4LG1A 3M5DA 1ZQ9A 1RWVA 3AQIA 3I83A 3P9CA 4G85A 3R5HA 1E64A 2M9MA 2EJBA 2VPXA 2WD8A 3QQ5A 3RSGA 4N8DA 3PJDA 2VSXA 1JXQA 3DL7A 1NDUA 2Q07A 4D02A 1E6EA 3NLLA 5ICGA 1XO1A 1FTWA 2VA9A 1VGVA 2VG8A 5I01A 4YNBA 4HPJB 3O82A 1IRIA 1R5BA 3L7AA 3DT6A 3OE7D 3VVLA 2CXXA 4J3FA 2FEOA 1X6VA 2VP9A 4FB4A 1DAHA 2Z8XA 1DHRA 3QTLA 5D6OA 4FNOA 3P71T 1YHYA 4IJKA 3WNCA 4Q3KA 5GONF 2ONYA 4D9FA 3U4AA 3VOBA 3U7GA 4Z9FA 1ADBA 3DMRA 5AVYA 1Z63A 3UTCA 2P5YA 2DLCX 1RABA 1XTUA 3MEQA 1JN0A 1IVYA 1JJ7A 2ECPA 2HV8A 3KXDA 2WDZA 2RI0A 4MQFA 4Q6WA 3NGXA 4JOSA 3CM0A 2WVJA 2JIDA 2Q29A 1J07A 4B3IA 2YIVX 4DMCA 1MEEA 2J08A 4W5RA 2GT1A 2O07A 4S0XA 4WN9B 4X60A 4BMZA 3AUSA 5FOWA 3OCCA 3PHHA 1Z16A 2QD4A 1BE1A 3S5JA 4ZYUA 3HA5A 5BWLA 2JLXA 2BJWA 3C8ZA 5CJ2A 1XKLA 3LBFA 4J76A 1GQ2A 4Z4IA 1L5HA 3MSXA 1XK6A 4Q0MA 1QRSA 1PFYA 5EY5B 1A76A 4K2AA 4H16A 3K5WA 1X7XA 1HZJA 1QHXA 2ZBQA 3KQPA 1UKEA 4BBZA 1W76A 1PN3A 4B8ZA 1FLVA 2H4ZA 3L8EA 2JDIA 3DTTA 3DZKA 1Z28A 5K0CA 1AGYA 1VIYA 4NWIA 4IHJF 1D03A 3AT1A 3DFIA 2Q8PA 1KK0A 1R5NA 2X0JA 3FVTA 3CISA 4D0GA 3FRIA 4QDXA 3GMIA 2ONZA 1NHGA 2BGIA 1CZRA 5K0SA 1DI0A 1SD2A 2HLDA 1PV2A 5JHGB 1SCUA 3KDSE 2LCQA 4B6FA 5T8KC 1RRPA 5KNLA 1HG1A 3IDOA 1GGNA 4PXSA 1AY0A 2WK1A 2ZJ8A 3K1TA 1H05A 1T5BA 3IVCA 3KQYA 1T6XA 1YKFA 4QU5A 1S2MA 1AZTA 5DN6A 2CMFA 3P0HA 4WDQA 1Y9AA 1Z8NA 1KOLA 3U9LA 4Z53A 1Q0RA 4YI5A 2AFIB 4MUAA 1MNAA 1U81A 4LRQA 3AEUB 4GO1A 5BSUA 4G9GA 3IPXA 1JDVA 2IELA 4N7RA 2NU8A 3ZHUA 4CF5A 4HX9A 4I4LA 3OMWA 3ZY3A 3MOGA 3QTTA 1X8XA 1NVTA 4M83A 1TM2A 2A0WA 4F8YA 1H23A 4TWJA 2BF4A 2WM9B 1WB5A 3L4BA 5AW1A 7MHTA 1N6OA 2K7ZA 1DFHA 4G8DA 4NAHA 4RZSA 3H75A 1FS4A 2C5GA 5K0LA 1RJDA 3LMKA 4ZQHA 2QTTA 2EJCA 4J9VA 1N8KA 2OHJA 1ZWKA 3AP2A 2OXIA 2YV2A 1MX9A 2BCEA 2ODWA 2B6NA 2I91A 2CUNA 3EPHA 2BGMA 2UAGA 2JASA 2X5XA 4QC2A 4R71A 4NZ9A 3MS4A 4LDNA 1QRUA 1JXAA 2GA9A 2V3WA 4LVUA 1SPBS 1FFHA 3K5IA 4RH1A 3QFFA 1QPBA 2RHJA 3G3EA 1KK3A 3SC6A 3RU7A 2R87A 2RBEA 3ELBA 4PINA 3VMFA 3EDCA 5DCWA 1Z5GA 4LDAA 1KVSA 2QX7A 5AVVA 4L28A 4ZCQA 3UK7A 1U8EA 2RCYA 3PNYA 3WP1B 4I3GA 3SFTA 1IATA 2H07A 3N76A 5HTOA 3STUA 2Q41A 4B84A 3F78A 4X44A 3ZI4A 1EHIA 3HXLA 5BRJA 2ZBEA 4OG2A 1AKMA 2EP8A 3P1JA 4P3KA 2VUUA 3ZGYA 1MABA 3P96A 2XUAA 3N2GB 1A50B 1XTSA 2ZANA 3NBAA 1QB7A 4J2OA 4MB0A 2A4MA 2Y0DA 3I73A 1V1JA 4R1MA 1QE3A 3OFNA 3ZVKA 2C97A 3DFUA 5HZGA 4OMFG 4K28A 4RENA 2QLMA 2XQGA 3IAUA 5KYYB 2Z2JA 5CTAA 3JALB 5BXQC 4U3JA 3HTXA 3LLUA 1AVTA 1DC5A 1RAIA 1UXJA 1LTHR 2VR1A 4LBYA 1M66A 3ZV6A 1JFSA 1QYVA 4E03A 2PDAA 3L1KA 4PN7A 4I0WB 4KAXA 5DE3A 3L6UA 2ZCVA 5D7NA 2CBGA 3H4VA 5FTJA 4C3VA 4O29A 2D0PB 1FTGA 4CM8A 2CDAA 2J32A 3M0EA 1KOJA 1L6RA 2R4QA 2P9CA 2IITA 1G21E 3HH8A 4N0PA 4V0LA 3W8RA 4DHEA 1BH6A 1QO0A 4BVEA 1ODFA 5KHOC 1A9ZA 2OUIA 3VVMA 1KJJA 4RTOA 2CCGA 1KI6A 1XJCA 3K4PA 4JU8A 2CUKA 1WPGA 3WVNA 2IPMA 2H31A 4LE1A 1M8JA 2ZPUA 2Y1KA 3WGVA 2NPFA 4RESA 4XJTA 1DFGA 5IANA 3A7EA 2C99A 1AC5A 3TF5A 3AUTA 1FJGB 2F4VB 2SCUA 2VPZA 3CJTA 1AQLA 3CVOA 5DLDA 3D5EA 4CG3A 5HRUA 3ETGA 2ACVA 3FSGA 1OREA 2BUBA 1JX6A 1ZJZA 4M1QA 5F1YA 4DR2B 3TPFA 1NU6A 4N3AA 3MMPA 5LWQA 4RTPA 2FWNA 3ZDBA 2AEJA 3KPVA 4H77A 1IUKA 2NUPB 4QTXA 3ZU4A 4X1YA 1SZJG 3KEGA 2M6LA 1SIBE 2XGJA 1GU7A 3PJGA 4FW8A 3DZHA 4OMCA 5LMUB 4BQQA 1OKKD 1EJ2A 1U9IA 1FP2A 2VDVE 4TV8B 1A8HA 2WMDA 3RSHA 4I1SA 5EYPB 4ZZ2A 1N36B 1KJZA 4EJFA 4EY7A 4L57A 1K7SN 4LY3A 4WBSA 3A3YA 4OHYA 3DYBA 4UOZA 5JYDA 1E58A 4N0EA 3KOMA 2IS6A 5HE8A 2GESA 2L69A 3HUEA 2R1VB 2FN7A 3OHSX 5IJXA 4P7GA 1BJRE 2X13A 2BKXA 2CDCA 4UASA 4ZT5A 3KSBC 1HYEA 5B4UA 1EKXA 2CNOA 4V0KA 1VYTA 3C5VA 1ORDA 4NYMQ 1H0RA 4WEOA 1A2KC 1CZKA 4A8JA 1FTYA 2B99A 4XPIB 2WNHA 5JCOA 1G55A 4JMPA 1JH8A 2VJQA 1MJGA 2GHTA 3NWOA 2YIMA 1W85B 3QOFA 4E31A 1EVJA 5K8JB 2WSBA 3H9BA 4KB5A 4LZLA 3KSRA 1IQPA 1TAQA 3HDJA 4XUDA 2P4QA 5AJZA 4CT0A 4HFMA 3FYSA 3BE6A 4MX8A 5JSHA 4KYVA 2HMVA 3RKSA 3AFNA 3LBYA 4M3NA 4GSKA 1OIWA 4W5WA 1HC7A 3UUEA 4BZWA 2EV9A 5KQPA 1VJDA 2DQ4A 1O97D 3OM9A 4CMIA 5I8WA 4I5EA 1UJ5A 3L0CA 5FYQA 5DHQA 4YMGA 3M6AA 2C07A 2YV1A 2J5KA 2NX2A 1TZCA 1N6RA 5HJ7A 2CCKA 1UM9A 2QRUA 1U8CB 1WCYA 2QJWA 3KDPA 3TI9A 1QRAA 1JHXA 2QVCA 1NBME 2HTEA 3NV9A 1U3WA 1WM1A 5DP1A 5LZ9A 1L5OA 3F0TA 2PUBA 3LRTA 1VL2A 3AFGA 1Q1GA 4GLFA 3U19A 4M1KA 2AEMA 4OMUA 1DC8A 2PSDA 5FR1A 4UQPA 1I6LA 5DCUA 1AS2A 3MIIA 3R0QA 4LHYA 4CHGA 4EMBA 3DDSA 3U6KA 2I3AA 4LMPA 4TQ9A 3Q85A 2ZYDA 4UC0A 1JG3A 5DSTA 4YWJA 5J43A 2QNRA 2XUJA 1VKHA 2ZJ5A 4DEVA 3EIOA 3GAFA 4Q1CA 3GDFA 1UM9B 3MOSA 2QRPA 4KKVA 5HG0A 1JE0A 1K97A 3FDIA 3GVCA 5CFZA 2Y99A 1L7RA 1N3YA 2WVAA 4O3MA 2JLVA 4DNOA 2NP7A 5CD1A 1WHTA 4X90A 1C3EA 5SZIA 3KQNA 2IYSA 5EKTA 1U9JA 1N5MA 2WLSA 1UMKA 3LUHA 1P1JA 1AQUA 3SHQA 1AMOA 1AF7A 5BSRA 1Y3DE 3AOEA 2XDWA 3PG5A 3W4KA 3RSQA 4B82A 2XKBA 2ZZKA 3GN2A 3KP1A 1V3QE 2GEVA 5I4IA 3KQTA 5DGIA 1VYUA 2ZQ5A 3ICEA 3VX3A 2CDNA 2J46A 4MPDA 1VA5A 3W4IA 4GLOA 3TB6A 1NMSA 1FLNA 3C3XA 3RYCB 1SKUA 1XU4A 1YL7A 1R4MA 2FK8A 4MB6A 1TUGA 3CWCA 4QXRA 4LW8A 3PPYA 2C5BA 3FZYA 3MMSA 2DTXA 3D4PA 5BV2P 3MPOA 4UW9A 2ZB4A 3MMXA 1YB1A 5EZYB 2RI1A 1XEXB 1Y9ZA 4QOIA 3WP0A 3GLFE 4E09A 3H11A 4DN6A 4ZPJA 1E5QA 2B5WA 1RAHA 1DWQA 1NJ8A 1L6IA 3MWEA 1KH2A 2BJVA 3A31A 3D3QA 4OKIA 5EAIA 1FFSA 1SBYA 1NT4A 2V65A 1ML3A 3C48A 3E2MA 1T13A 3P20A 3GT3A 3OZIA 1M5TA 1Z0DA 4F1WA 2DQSA 4ZVUA 3HSYA 3WWOA 1YUBA 2C7PA 2QUIA 3CINA 3SMVA 4PAOA 1QH8A 1W75A 3FB1A 1TT5A 1K6JA 5BSTA 3E70C 2XKJE 5L3RA 1XP8A 1WETA 4K5QA 2R84A 1RQNA 2FJPA 4JEIA 4KSCA 5BSGA 5DHAA 1JWLA 4S0ZA 2ONJA 2DWOA 4MP8A 3WIVA 2HBQA 3TNJA 5EZYA 2XMPA 4JLSA 3WMXA 4A0SA 4ZQGA 1X0XA 3SCZA 4DV5B 4OI0A 1R0ZA 1ZU4A 1M83A 2ZSJA 2WTMA 3HKCA 4L8GA 1C4WA 3EC2A 4J9UE 2X9QA 3DHEA 3MGAA 1T4GA 5TS2A 1LVHA 4YCMA 3IAM6 3GCGA 4TN1A 3V4SA 2QX9A 4HLUA 4PF1A 4DUGD 3LUPA 4ARAA 2RGAA 3EEYA 3Q4GA 3EWSA 3SDZA 3SKXA 1JMYA 1JSZA 3CF4G 3G8CA 3PJRA 1M10A 1R8SA 3TCNA 2WPDD 1JT9A 4MS1B 4ZREA 5I7SA 1AKEA 4BNLA 5IJ0B 2GD0A 3MRXA 1FYXA 4B0PA 4RUKA 2VAMA 5BWOA 4KTVE 3QITA 1JVNA 3NGLA 4PZPA 5AJXA 5DHFA 4YT8A 5KQSA 4G0UA 3VVCA 3KT0A 3KDAA 1BMTA 4KE7A 5DMXA 2Q9CA 2AJLI 4DNXA 4OHPA 4ZOEA 5IM4A 2X86A 2A86A 4IWXA 4E4TA 2YNMD 2OTCA 4TS3A 5EFZA 1O57A 1UEJA 1A98A 2QD1A 1V2GA 3ZY2A 1P29A 3PICA 2FP4A 3KM0A 3ROTA 2OQRA 4MGZR 2EZ4A 4PO9A 1FSSA 3OLYA 1T0IA 2IS1A 3VR6H 4CL0A 4L6CA 5LQRA 1M1ZA 2VJMB 4LSGA 1GCUA 10MHA 1EB9A 1TIPA 4JK3A 1YB6A 2CFRA 4LYEA 4JJIA 5K3FB 3WGHA 3CNLA 2G71A 2OC4A 2ODAA 4IAOA 3LH5A 1RYHA 4IXWA 3RD5A 5CCEA 5LKRA 1DADA 1IZ0A 1ZJYA 5A4MS 3KB6A 3B3QA 1X9HA 4C07A 4F8JA 1C7IA 3CCFA 2Z98A 4PLYA 2FG6C 2WA1A 3K9GA 3PX3A 3OQ6A 4RORA 1F0KA 1MA3A 4HEHA 4BNDA 2J8ZA 3Q3GE 1YHNA 4EG7A 1LF0A 4IOJA 2HHAA 2OFFA 2I9KA 1Y1PA 4R8LA 1LLUA 1PR2A 4ZGWA 2POQX 1KR5A 3H9JA 3N2KA 1DWUA 3WLFA 3A37A 3HVIA 5JJKA 2PT7A 1GZ5A 4NBUA 1KR2A 1TVKB 3JQGB 3RC7A 2VAXA 2A0UA 4HADA 2C1XA 3MM4A 4R40A 4BX0A 3GLFB 4KO2S 5LA6F 2UYOA 4BAGA 3ONVA 4ZCMA 2D5CA 3VOTA 2VLBA 1AU9A 2PRYA 1LX6A 2BKLA 2GCEA 3FPLA 1A9YA 1XR3A 2PS3A 2VHJA 4MA5A 4MCHA 3L4SO 1RJWA 1MEJA 3MUEA 3IUYA 1AE1A 1D2GA 1P9OA 2F90A 4GD3Q 4KITB 1MPXA 5E1BA 5P21A 1B15A 2FF7A 3IP5A 5K2MA 4R84A 2J3KA 2YWJA 4ZQEA 1ULZA 1PZMA 2Q2QA 4LE2A 4TV8F 4EW6A 3CEMA 2R7KA 5BRNA 4LHXA 1VE7A 3AJEA 3V32A 5EYPA 2J3LA 4WQMA 4XVQA 2QG4A 3RC2A 1NAHA 4EP1A 3SJZA 3GRZA 1V96A 3VU3A 5D86A 3H9UA 1UBMS 5BN5B 2A35A 1TU0A 1X77A 4AJ2A 3ENKA 2AFIA 3HL0A 1E3DA 1T1EA 2L19A 4Q24A 5BOVA 4BO2A 2IHVA 3OTOB 4MW4A 4QUGA 2C61A 3OX2A 5C7LO 2HL6A 4ZTBA 3UMCA 1GL7A 4TM7A 4BLQA 1NXSA 5KEIA 1HT2E 3GFFA 5J2UF 2IIPA 1E2BA 3MCUA 4IUYA 1N0HA 2B2NA 2Z56A 1TK2A 1K8YB 2BEWB 2P9ZA 2PPVA 3QA9A 3NC0C 4HN4B 4E07A 4I66A 5B64A 1AJEA 3FR8A 2KHZA 2X5KO 2QAGB 3AIOA 4K9OA 3K0AA 2CV1A 3GD7A 3VR5D 3O83A 1I0ZA 4FYXA 2IIQA 5E1MA 2C3MA 3F9CA 1Q7EA 1CSEE 1LBSA 1SPXA 2YV3A 2IXDA 5I9TA 1ZH0A 4XA8A 1RADA 4WE3A 5B55A 4DPMA 5J4YA 2CSUA 5DASA 2CJWA 2DQZA 5CGQB 2I33A 3K6SB 3FNIA 3DNMA 3VZDA 2D4HA 1XYGA 5L53A 3U44A 1BJKA 1E6KA 1OFUX 3F3YA 3RS9A 3U26A 1ZI6A 4YRKA 1PZXA 4ENRA 1BX0A 4NNOA 3UW1A 4LHEA 2OP0A 2Q3CA 4GLJA 4OHRA 1NFQA 4BMSA 2EP5A 4KKXB 2J5QA 8LDHA 1XRQA 2WKPA 3DXFA 2V1UA 3LHDA 3SZRA 1NXPA 2P30A 3IUJA 4XYBA 5KNCA 4NTZA 4L9WA 5KOYA 1EUDA 3GQBB 1JUDA 5EHQA 4QNRA 5KKAA 3WGUA 5BSVA 1Y37A 1MKYA 3C6YA 4XM2A 4UHDA 3J7AC 2ZXFA 5ALEA 2C2YA 1M0EA 3AMVA 3QEJA 3RREA 1H66A 2OXCA 4H6XA 5LBIA 2IPLA 2W4MA 1JLLB 2JG3A 1RR6A 3ITEA 4Y9RA 4B71A 4P8RA 4NF2A 3T3DA 2F3PA 4KWTA 1DRWA 2BEUA 1IBLB 1WZEA 4JWTA 4DABA 5ABPA 3I5XA 1F17A 5HIAA 2H00A 3AY6A 3SX0A 1MXHA 5KSPA 1FVXA 4HLQB 3FHTA 5JR3A 3DJFA 5A71A 3NKFA 4BFYA 4DT1B 4M1OA 4RNCA 4YRLA 3I2GA 3HDQA 3ESZA 3VJKA 1GZUA 1HTWA 2NN3C 1E9AA 2Y1WA 3KKMA 2HTFA 1PNTA 4WLUA 4J0EA 3VDNB 1YL6A 2DT5A 4FEYA 4J0GA 1KYZA 3FOCA 4LDJA 5ADUS 1QYXA 2QMOA 1T5SA 3ZDEA 3MJVA 5K2OA 1OXTA 1NN3A 3LUAA 1FPMA 1ZJWA 1AHIA 1IY8A 5L3ZA 2TMYA 1A4XA 2GCPA 2HDNB 2RHWA 2N3ZA 1P0QA 4O2RA 2EKBA 1YUMA 5AMXA 4I3HA 4F4CA 5KO2A 3JZMA 1V8DA 1JFVA 4O2BB 5FHRA 1I9CA 1ZM4A 1LI5A 4J1NA 1ECBA 5FA5A 2GN4A 5AK6A 3SR3A 4X8LA 4OQLA 4BYGA 1NJ6A 1J1IA 1YOVB 1T3ZA 2B61A 2Q0HA 4H6PA 2I76A 2FMUA 5K8VA 2QXTA 2G77B 5K0FA 1F6BA 3WOHA 2BPOA 4Z54A 3UK6A 1A4UA 1WULS 2KSQA 4O4HF 4WESB 4UKDA 7GPBA 5F9MA 2GBLA 4TUYB 3HYRA 1T5LA 1UPTA 2QT1A 1XTJA 1ISHA 2WZBA 4FNGA 3SSOA 4M1SA 3B70A 4PQYA 3VR6A 4Q4CA 2Y66A 1X7ZB 1PR5A 3LHFA 4S1WA 4NYJQ 5ALHA 1T0BA 1KQFA 2XWJI 5KNCH 1YAHA 1PWZA 3GLSA 4NH0A 5E8JA 2Y1EA 1ZK2A 4QDKA 3RUDA 3ZZ1A 3VAAA 4Q5IA 4ZYXA 3BIWA 1SQGA 3NHZA 3B7PA 3EGCA 3EY9A 1RYYA 4M0PA 3N28A 3PYLA 3DOJA 3DXYA 5FV7A 3WYNA 2GAOA 3K0AB 4U2DA 3V1KA 1CUHA 1XYVA 5JNSA 4OYYA 5AJUA 1LK7A 5FADA 4KQMA 4AY6A 1USIA 2W6JA 1XCPA 3TXXA 1P3DA 1WP4A 2D1FA 2G0NA 4WFIA 4L2IA 3JRXA 3ODGA 1M5RA 4MDYA 2FCRA 2PX6A 4OL9A 4PLVA 4ETNA 2O0HA 3LY9A 3AVVA 2B1QA 3I9LA 3RFTA 4KR7A 3E7DA 3WMWA 1U0TA 1NFRA 1CYEA 1NYRA 3BTVA 3LXMA 4W6QA 3Q6MA 3VNAA 1FXWF 2VHEA 1FFEA 4NJMA 5SY6A 2BTEA 1SCBA 1EGMB 1QOPB 1VXRA 3UOGA 2IHNA 1T2DA 4NPAA 4F46A 5JALA 4AKGA 1AX9A 2YFKA 1YQGA 3FI9A 3O4VA 4LYYA 4TMZA 3CZ4A 1RRVA 2C9ZA 1V1RB 1BTOA 3IQWA 4PAMA 1E1QA 4WFKA 4DWVA 4Y6PA 5EJAA 3QEAZ 2WWTA 5AK0A 4JJGA 3ZWWA 2C3YA 3U16A 3I5AA 4QODA 4GI3A 2OHGA 1XTPA 4CEJB 3BXFA 2CJFA 4Y1FA 4RY8A 3O47A 3BGSA 3UJ9A 3H4MA 4H4EA 1ZI8A 2HU2A 1BDMA 1C1YA 5IT4A 5KYWA 2DFTA 1DVRA 1KXZA 2QTFA 2H7CA 4HDNA 5ECGC 3AF6A 4BLTA 3BHMA 1T1SA 5BT9A 2ZB8A 1ZMTA 3VPXA 1XLWA 1PR6A 3RS0A 5IJ9B 3Q8LA 2COUA 1ZD3A 3ZCTA 2PE5A 2HIGA 1KIFA 4GX2A 1UBEA 1LBIA 3O92A 3OEED 4DCVA 1DKNA 1JU4A 3D2CA 1HQKA 4I4TF 4RL4A 5IWAB 4JKYA 4OHMA 1WMDA 3BKWA 4JNCA 3FPEA 4LI0A 4MV0A 4MEBA 4PFKA 3T1TA 2ZUTA 4U8GA 4EG3A 3JQ9C 2QW8A 2WZCA 3EULA 4LZOA 1KPHA 3W5CA 3E18A 4RY0A 3S28A 1RKBA 3O0TA 2Z4TA 5TE9A 2IYFA 1DIGA 3LVBA 1N5KA 3DJYA 2ZIAA 3JVVA 1ZVJA 3OZUA 1ULTA 1PIWA 1XRJA 2XCUA 3B52X 4WVLA 4YJKA 5BW5A 2C0CA 4OQDA 3OT1A 4QDTA 1NLYA 3MAGA 3DCIA 1G8MA 1YMUA 4XOIA 3L07A 4DZTA 3AESB 5KWIA 5L6LB 3MILA 1LNSA 3BF7A 1OU0A 4QGSA 4O63O 1CJUC 2ZXEA 4YS6A 5CYPA 4CTKA 1A69A 1Q1ZA 1ZGJA 3TW6A 2V5AA 4Q05A 1ZUNA 5GOZA 1CP3A 1A9TA 1DNPA 3MCTA 2C92A 3R44A 4OREX 4PGAA 4S1OA 2Y1CA 4TMWA 2Q0QA 4P38A 1PBNA 1SCIA 3EG5A 4IGAA 3F5DA 3CLSC 1MD9A 4Q7QA 1CYDA 4DAEA 2FPIA 1XDDA 1CG6A 4W7HA 2FPUA 4YCCA 4BV3A 3D3WB 3P2KA 4PLWA 3HQ4O 2G5PA 3DAPA 2BZ0A 1DX4A 4LMBA 4MRMB 1UUFA 4QUKA 1G0NA 4EKIA 1S1CA 5C5DA 2V6JA 3K6SA 2JAPA 3V6LA 1FRNA 2PLFA 2BJHA 3WBJA 2XLBA 2WM3A 4XWAA 4AW9A 5DNCA 1I3OA 4BKOA 2R85A 4JJAA 1BFDA 2I4OA 1DXQA 2YIDA 2FWJA 3OWOA 5EQTA 3SX4A 5AHOA 5TQVA 5LZ7A 4R0NA 1PV1A 2OXTA 1PAUA 5L4NA 3WGOA 1AUQA 1A82A 3CBGA 3NOXA 4S12A 2O3TA 4DLYA 1Y3HA 5EUCA 2BEKA 3ZTWA 1A9XA 1GQOA 3IBTA 4HDSA 5EIBD 3WK4A 3L02A 5JAUA 3O95A 4LQCA 3BXHA 4Q4DA 2FP3A 4NXMB 1SBCA 3OUTA 4RMHA 4BBJA 1P2UA 2C98A 5MFPA 1UMCB 4KNWA 4E51A 2FEWB 2F17A 2QLFA 3DNPA 1BX3A 2O14A 2WHPA 3FJOA 4OHVA 1D09A 1W96A 1F0NA 2G40A 1K0UA 4L9RA 2YJNA 5AOVA 1M1YA 5FA6A 2H1RA 3ND6A 1P7PA 1FSPA 4RA6A 3PLAE 5CDFA 2N42A 3BL6A 1W0CA 1YE8A 3EVZA 2GWRA 4YECA 4EIWA 1PVVA 3RRNA 5E4JA 3S81A 1M2GA 4M6WA 3ZQJA 4FCWA 1S8FA 3CQ9A 3PC6A 2GRAA 3U4DA 3B6KA 4UXJA 2EIXA 4J7AA 1EWKA 2C58A 1TT5B 2J31A 3X1XA 2ZBGA 1PEYA 2QDKA 2NXCA 2G5GX 2QGNA 2AYXA 1CDOA 2XUOA 2DHCA 2REQB 2HK6A 1N3LA 1IJBA 4JI5B 1FJXA 3MUOA 4YCSA 4P83A 5AOBA 3HXOA 4BKQA 2HF8A 3FWYA 3P9XA 1E6UA 2XHEA 1QQ6A 2R11A 2Q99A 1V8PA 1JKFA 4S2EA 5I7HA 2YS7A 3MG9A 2IYUA 1QK3A 1CEXA 3LPMA 3E5RA 4Q18A 2RONA 1OFIA 5FNVA 1DJNA 3EQ8A 4KXLA 5TQ2A 4I4TA 4KEAA 3WTBA 3Q8XB 2H51A 3W5DA 3R6LA 3PR3A 4L0QA 2PGDA 2DRIA 3VYRB 2WFLA 3BDAA 3AUFA 4B9EA 3LBIA 4OLBA 2D7JA 4RA9B 4HUQB 1Z2PX 4FFPA 4IDDA 3IAS1 1NULA 2JFYA 4WZAB 4HZGA 3GV0A 1F1BA 1UJNA 2WHPB 1UKCA 2IF0A 2Q3LA 1G63A 4OIMA 1TO6A 3SQMA 2UUAB 3KXIA 4HH0A 1LW7A 1MH9A 3PLNA 2CFOA 3PFNA 5CUQA 4OAOA 3DLBA 5KYVA 5TS3A 3LDHA 3G89A 1SFRA 3BXOA 4LY0A 1JG7A 4Q1DA 4UHBA 3AO0B 3I5UA 3C8DA 4MS4A 1RDFA 1GYQA 2OMKA 2WIAA 3DXXA 5FBWB 4GMHA 3E5HA 1LZKA 1LUAA 3CKYA 4BE4A 4QOSA 5BWBA 3A2LA 3C6QA 3OKAA 1N7IA 4LWOA 4QPDA 2G25A 1LDEA 1Y4UA 4HZIA 1D9ZA 2YFHA 2CKMA 5EN4A 1FFDA 2BHNA 4COKA 1JXOA 1XVLA 5DXJA 1KP2A 4URZR 1QC5A 3GJ3A 4B3CA 1JEYB 1HORA 1RLUA 2FUCA 2FP4B 1QGYA 2GJ9A 2R1UA 1F2UA 1MRZA 1NQUA 1W5SA 3QEOA 4N5DA 5CB4A 1WPXA 1TO1E 1Y7LA 1Z47A 2QTZA 4Q66C 4CGZA 2MYUA 3PUVA 4GZLA 1QO9A 1QKKA 5DNWA 3MS7A 5IC6A 2I2DA 3TTVA 1SXQA 4KFRA 1ODJA 1GSOA 4LSMA 3VKGA 1XJ0A 2NSLA 1KEWA 3BPSA 3EVGA 2K2WA 1C9EA 3PDIB 1IB6A 1YNOA 1ZRMA 2YHUA 3HUFA 1UDCA 3WLEA 4DUYB 2CLSA 1KY4A 3Q3IA 3I5YA 3L0SA 3K2IA 2MSKA 5FI0B 3EQ6A 4MPTA 3GFSA 5B4VA 4XB6B 1E2EA 3BZUA 3SJ7A 4ND1A 1P5JA 4QATA 4AX8A 2QZ9A 3HMKA 2DHDA 4JUCA 4UUBA 1QZUA 5KNBD 2H9IA 1YV9A 3GIDA 5DULA 1IK6A 4D0LB 3AVXA 1KMMA 3LK6A 1IPFA 4E6PA 2AN9A 4I5GA 3LC7O 3TDMA 1U3TA 3HZOA 5ALGA 5JFGA 5LFAA 1KKMA 4LYJA 1YR3A 2KMLA 3GMTA 4X71A 4FGWA 3TPCA 3UJ8A 4PGMA 1XTVA 1JU3A 3EWAA 3FYCA 4HQLA 4LQLA 3WADA 1E4EA 4AL4A 1ESMA 1R9NA 3EIEA 4DLXA 4ND7A 5J3JA 2IEBA 1GAWA 3I6BA 4A36A 3G7NA 1BWSA 2A1UB 3KEOA 4LWQA 5JVDB 4HMPA 4XIFA 4REQB 2V9CA 1FP7A 3E23A 2NSJA 4JVNA 2C7BA 3EA5A 3B9RA 4GKVA 4J3NA 1FS5A 4U6SA 1Z15A 3PGKA 4UAVA 1O4VA 3ADDA 4WECA 4B87A 1A7AA 1FVFA 3BH6A 5L51A 3HLYA 2HA2A 3DB1A 4LJ5A 1UKBA 1PR0A 1S0UA 3SFZA 1ONSA 3DBVO 3INGA 3U80A 4BY9E 4RVGA 5CYFA 1A9OA 2OSVA 2QNIA 4N0MA 2HU8A 2AWNA 4G1UC 3CGGA 4B6RA 1HLFA 4XVCA 1NVWQ 1WTCA 2BFFA 4YRPA 2QUKA 4ZDIA 3QX8A 1AQJA 2HMUA 3ML1A 5CR9A 2E6UX 1NJ1A 1K4YA 1XDZA 1Z7EA 3TD2A 5CNIA 2CT8A 3GH3A 3S55A 1MAAA 1KO1A 3NANA 2JDID 5IYZB 4IQ8A 4P36A 3RRMA 4P7FA 3ZZMA 1QG4A 5AM4A 4ABTA 5EXPA 1K8QA 3OQJA 3KKPA 1NRIA 1TZ2A 2B8JA 1QGED 1YVDA 2DF8A 1QSGA 3EK2A 2P9JA 1YO6A 1CDEA 1NW4A 3KQWA 4RX1A 3UUWA 4PNHA 4AROA 5KX5B 1S01A 5AI0A 3TIIA 4NJEA 2IP2A 3VR3A 4X91A 2IKSA 3EDOA 4R1QA 2GAFA 4CJXA 3K70D 1KRHA 1NXWA 4EGQA 4YEDA 1T1IA 2VNKA 4DOMA 1L5RA 3EXFB 4ARSA 1O9GA 3QJGA 4R0MA 2BGLA 5FPSA 1THTA 3RRZA 2AK3A 4G9EA 4ZEWA 4EA9A 4ER5A 3TQCA 4H60A 4QIHA 3MC1A 1ID1A 4RDHA 3PQ4A 4HGYA 1CUXA 3V4LA 5DVZA 2OHOA 3KTAA 2GFIA 2HM7A 5B3KA 4HBGA 3TQQA 3GCDA 5DBEX 3AHCA 4R7ZA 1EQ2A 3DE5X 1B6GA 4YDQA 2PX3A 1K66A 1RZ3A 2B3DA 2IUYA 2FTKE 1ZD9A 1LJ8A 2PA0A 2WU3A 4L78A 4L4SA 1SUAA 1HFEL 3AUXA 3RWMB 2PMDA 5DX0A 3WKBA 4ZEVA 3UJAA 3UJDA 3CWZA 3FMIA 2FVXA 3M89A 1SKYB 2JGNA 2XKAA 3CJQA 3Q7TA 1J22A 4FHCA 3WB2A 3ZHZA 3EC7A 4DDTA 2QIPA 3NO4A 1MT0A 4QUEA 1G20A 3WDLA 2CYAA 3FWZA 1KL7A 4BWYA 4DJ5X 2Z04A 5E8RA 4BHTA 4JT4A 1NZDA 1JT2A 4DLNA 2BCGY 2ZE5A 2EYUA 1QO7A 5T3UA 3N75A 2AF3C 1Q92A 4Z3KA 5C5EA 5KUTA 4LJ9A 3CTPA 1C1XA 2VPQA 4CF7A 1KO7A 1US8A 2BGKA 2G80A 5ALOA 3BWYA 5EHZA 5I9NA 1GKLA 4OX9B 1C1HA 3UH0A 1MB2A 3RT1A 3CGWA 3BEDA 1P77A 2ZJ6A 3OZFA 3EMDA 4HUQA 1B41A 2A94A 5DHPA 3RWOA 3LECA 1XTRA 1QYIA 3KFXA 4GKBA 4Q3CA 3UMFA 3BICA 1NVBA 1SUPA 4JXJA 4WLNA 1TTPB 2J3IA 3T4PA 3HPRA 4M1WA 2X9GA 1C9JA 4NS4A 2L17A 4B09A 2OORA 1JLSA 2G6BA 2WHYA 2XITA 3OESA 3W5AA 2XODA 1JQ5A 3ZV5A 3E8SA 4IHJA 3A6FA 4BX8A 2V4ZA 1NU8A 4RJTA 3M2PA 3PDUA 3PIDA 5H68A 3C8UA 3H13A 5JD5A 1W5BA 1FDWA 1EBBA 2R6GA 1P1HA 2ZR9A 2JJ2A 4MR7A 4LF7B 1R5OA 3OJXA 2ZKIA 3JWEA 5CK5A 1WCIA 4N1AA 2QN6A 4Y1RA 2I65A 2C54A 4G5HA 4H1HA 4N7BA 4MYSA 4JI7B 1K9VF 2QTMA 1CB7A 4YBRA 4ALIA 3GQBA 3DOIA 3C7DB 1IYZA 3IUQA 1RYFA 4J29A 2G28A 5K1ZA 1J6UA 4NQRA 4BVLA 1N8TA 1WKBA 1L8XA 1LPBB 4HEJA 4CR6A 2Y05A 4OHKA 3RFCA 5CBPB 4H7KA 5H83A 4RJLA 2XCIA 2JIQA 1NGSA 2NU8B 1GLNA 5KQRA 3OUZA 4DNFA 4QAQA 4W5TA 1FFWA 1I1QB 4EX7A 1XAGA 3OOJA 2PL5A 2R62A 2I4TA 4RSHA 1O0SA 2XYPA 5EP1A 4GPBA 5DZSA 3IJRA 3E9RA 2DKOA 4HRYA 2PWYA 4J7XA 1CQJB 3CUSA 1JP7A 4RS4A 1OGIA 1QH1B 2UYQA 2X6TA 3FROA 2H5EA 4BVKA 5AW0A 2P1RA 1M8GA 3OWHA 1VBMA 1MUUA 1EGAA 1Y5IA 1PUJA 4HAUA 4U39A 4UD2A 3T0FA 1C9KA 4J4BA 1DBSA 4L6IA 3DKIA 3NBFA 3NC4A 3ZI0A 2Z5GA 4DGSA 4GLLA 5F7OA 1QFMA 3GYBA 3N86A 1IN5A 1U11A 2ACWA 3FTDA 1XSEA 1XZCA 2FDRA 4LJ4A 5EQJB 4CG2A 4Z51A 4PLFA 5A5EA 1VCHA 4FFBB 5TT1A 2PL3A 2D2EA 3VBEA 5ALSA 3H16A 5JQGF 1XDBA 5DTRA 2NVBA 2PTHA 5AW8A 3ZLUA 2YZNA 2Q3EA 1E1DA 2PVPA 3DO6A 3K9CA 1NZFA 3GDGA 4Y7DA 1AUXA 2PIDA 2JGIA 3KXPA 3ITNA 3N0VA 4HD8A 2Z83A 5T4FA 3WRVA 4KO3S 1A8IA 1QDUA 1TQ8A 1Z18A 4JLBA 1KE1A 2LIPA 3HKBA 1HH4A 1K0FA 3E53A 4Y2HA 4BFCA 5BURA 6CHYA 1P4AA 5JARA 3F3SA 4MR9A 2Z8ZA 1Y82A 3EYAA 1ESDA 2ZJBA 3IRUA 4AJEA 5ICSA 1U99A 3DVAA 1W36C 5BYKA 3SC4A 3QXXA 1CY6A 1DG9A 2QZJA 4ZTUB 4RF4A 3KJNA 1DKLA 2P6OA 2X8BA 3RADC 3QY9A 4G23A 3TD6A 3HCFA 4RM2A 1SUBA 4A1OA 1FP6A 4Z0HO 1ZN7A 2I2BA 2BD0A 2ZM6B 1YVRA 2Q2WA 2NQ2C 3H0CA 4IS3A 5T6MA 2ZUUA 4PYKA 1KARA 2VBFA 2Z30A 3I9KA 2H1SA 3FDZB 4L9AA 4DIKA 1Y5MA 4Z4HA 3M6LA 1H5NA 2X1MA 1WXQA 4OFBA 5DNDA 3TZHA 2P9GA 4JUAA 4KIWA 3RM3A 3K31A 2MYNA 1EK6A 4US2R 1R9JA 3I4FA 3R6TA 4M1MA 3LBAA 4DIUA 4AUNA 3K5HA 2J4CA 4DZZA 5EXTA 1R27A 5IVPA 1T9ZA 1NWHA 4UEQA 5KVAA 2QY6A 3UWOA 5AI6A 3W3AA 4W8GA 4X24A 4PFSA 1FYWA 3UGKA 3KD2A 5E4TA 3GUYA 4BASA 3BTUA 1OOEA 4IJWA 4EI9A 1CBUA 3DKPA 4XWOA 5ALVA 1MQ8B 3C3WA 5A06A 5IXJA 2XOXA 1COWA 2A7QA 1XHEA 3A6ZA 3RKUA 4JEHA 2AFRA 4XRGA 5E6UB 3PVSA 1IAQA 2ANBA 3CLRD 2UYHA 1N33B 1E1QD 3KLMX 1W29A 5HZHA 2VO1A 2AN5A 1I1HA 1NM5C 3AF3A 2VK2A 1JWBB 1ZGHA 1FRQA 4DF3A 4Y6GB 3TFWA 3TUJC 3W2GA 4HUJA 3OU2A 4IVPA 1TJ5A 2QRVB 3H9CA 4YH1A 4I7EA 4JN6B 5LWHA 1DDIA 2BFDA 2OORC 4EPYA 2XUGA 5DGCA 2DY1A 1I4TD 3PUZA 4K6OA 1KO8A 1NLFA 3C3EA 4Q9AA 4TZKA 2JRLA 3ZC3A 5K4GA 2DBYA 1N2HA 1H4SA 1VL6A 1E4YA 1SXPA 2VQSA 2PUFA 1XHFA 3HCWA 3PUHA 4JX9A 5I9LA 5E0KB 1D0VA 1A3CA 3AY3A 3CJRA 1AURA 1HGXA 3GUCA 4XJVA 1MVNA 4HFRA 1NRXA 3TTWA 4WJZA 1FNCA 1VG1A 1IXKA 2XPCA 4FIZA 3D4NA 3I3SR 3QFCA 3I6MA 4HWRA 4W99A 4EUNA 1Z4KA 2SECE 3F5QA 4FMCB 5BMOA 2QMUA 2VZEA 3N39C 4KK4A 1P72A 1RAAA 3ZZNA 1DO2A 1TIBA 4CVNA 4KVGA 4MAMA 1BDHA 2WTBA 3SIXA 3F90A 1PUXA 2O3JA 1ZUD1 2OEPA 3TR0A 3BHIA 1ZC3A 4KPUB 4J0FA 4BO5A 4IY1A 4KAAA 3BSSA 5LQNA 4RACA 1GN9A 1N0WA 3O21A 4OQXA 3I23A 4AI6A 4DV4B 3E84A 4L7VA 4A92A 1QNLA 3M8KA 1KE2A 2B94A 1RRGA 3HCOA 3FAKA 2X1LA 5HW0A 1MOSA 1QKIA 3M6VA 4R8MA 1TKBA 1RI4A 3O26A 4X61A 5TJHA 4I08A 3EQZA 1OFVA 1ULSA 2WJHA 2NO7A 2XECA 5LB2A 3C3PA 3K1ZA 3TTUA 5ED4A 1KDRA 4HGZA 1QHGA 4C4XA 2X23A 4P2GA 4JYAB 1TQDA 4Y6OA 3QU2A 2NOAA 3L01A 4KGDA 1TYDE 4ROTA 4RLQA 4R01A 5KBYA 1UXHA 4E1VA 3GJZA 3G2KA 5BPHA 2H5JA 2WIKA 3FCYA 2A14A 2D54A 1B7GO 3N5KA 2FMKA 4LYFA 3EZ2A 5D3MB 5EP3A 5ES3A 4RVHA 4ZZ3A 2AG5A 1HDZA 4GGMX 1VSBA 4M49A 1JAZA 4L5AA 1ISIA 1MO5A 2EF0A 4LC0A 4XDZA 3E7PA 3ZQKA 3OPVA 1IZZA 1KYIA 1T34A 3I6ZA 3HY4A 1WA5A 1GY8A 3VC2A 2W2MA 4KLZA 3WKAA 4G84A 1EWRA 3OAAA 2GMWA 1OA0A 2AUTA 4QWMA 2JFGA 4BRSA 5CLHA 4B9AA 5DWQA 4KU4A 3F74A 3CVUA 1YK1A 3LCMA 5JS6A 1LPNA 4UBNA 1G9TA 2PS9A 3PX2A 1J5PA 4M88A 1H6CA 3AINA 1ADJA 1PNOA 4F5WA 1PFGA 3RUHA 1YASA 2FU5C 1IG0A 3CUEF 4DJAA 5FOQA 4A1FA 2DM6A 1WF3A 3KZOA 3DA8A 3T7AA 1CY8A 5ERXA 1XL0A 2YS6A 2C42A 2QL9A 4PLCA 3UCXA 5F3WB 3QUTA 2QPOA 4OJYA 1KZGB 4RZXA 4YMTA 1SHLA 2I6XA 1RACA 1KK2A 1TYAE 2ES4A 1L5GB 1OI3A 4WNAA 4IR7A 4H7PA 3SF8A 1VTKA 4OGFA 2BFDB 4TL7A 1RYDA 5ITSA 1TM7E 1N2CB 1R50A 3QKSB 1SVLA 4BWFB 4PO1A 5BR8B 3IAFA 1KP9A 2WP8J 1V4VA 1VE6A 3MPUA 1PT9A 3KL4A 1V95A 1KBZA 2ZJ0A 1QV9A 2IUUA 4URYR 3UPDA 3CR7A 4KPFC 1QZZA 3WBBA 1ZRSA 1MG0A 3STTA 1Y89A 3NJ8A 4WCVA 1QIFA 4C0QC 3G8DA 3T12A 3MQ2A 4C0LA 1Y6FA 4PX5A 4XX1A 1YSCA 5EGSA 4R7GA 4F5DA 1TW2A 2NNLD 1PG0A 1Y81A 2Y3IA 5ICCA 3KB2A 1T8TA 1J97A 2FX3A 4C78A 1UXGA 3AJDA 2DWQA 2Q9UA 3N1UA 3QIVA 5G1OA 4ZAFA 5JRDS 3C87A 3FYUC 2VJYA 3UA3A 2IU3A 3C5HA 5EEHA 2C5AA 1SH7A 3LLMA 2OLEA 1NF8A 4ZV4A 3A9WA 1T8WA 4MKRA 4HN9A 4Q3AA 2F00A 3U5ZB 5FPQA 4LBWA 4MWTA 4N0DA 1Q57A 4N47A 3PQ8A 1PF7E 3ONFA 4OB6A 5DI3B 3VYTB 1SY7A 3QA3E 1UBGA 4N0QA 4RA9A 1MDBA 4FKBA 5F1OA 1NQOA 2DTEA 2XD9A 4E0BA 2REBA 3H86A 1HXHA 3OO1A 4RQAA 1ICIA 3TZCA 2YWRA 1MJHA 3OC6A 3FZEA 1NUAA 2X6QA 2R7AA 3YASA 4JB2A 1NT2A 1POWA 1LRLA 3KAKA 3DMTC 3M3HA 1CUGA 4KO4S 2O4UX 4HG2A 3WYEA 1OF1A 1KMHA 1XEFA 2IEGA 5IHXA 3WQRA 4IIFA 3PLRA 5DPMA 4IS2A 3U81A 1RZRD 1HE3A 1ZK3A 2YHIB 4ZHQA 3FI0A 3IV7A 3OEHD 5K3CA 1UZAA 1S9DA 1WL8A 3MWYW 1WMSA 2ILVA 2Z5LA 4UTOA 3SHFA 3V8NA 1SC4A 2QJFA 1Y48E 1P39A 2B2CA 3HCAA 3LYUA 4JR1A 4F3RA 5KVCA 1G9SA 2X9LA 3W9UA 2FPSA 4JL6A 4UU7A 5C53B 2IWRA 2JGRA 4YJ3B 1WB4A 3U1VA 1PT8A 2IZ1A 2SKCA 2VDPB 3FNEA 3SDBA 3JQGA 3SIRA 3ZE1B 3P4XA 1XF1A 2BBWA 4KODA 1P31A 4WK6A 5IUJC 4HLUC 4CDMA 3X1JA 3P0IA 1M2EA 1L1EA 3JWJA 2NZUG 2HEGA 3CEJA 4IXDA 4WOKA 3DFKA 3LM8A 3VO2A 1M1YB 1CP2A 1W4ZA 1SHJA 1SIUA 1WEKA 4PO8A 3Q10A 1WNTA 3KOZA 1Y5LA 5F52A 3HM2A 3UNXA 1XROA 3WFZA 5G4KA 1K7EB 5AM3A 1LS1A 2O3UA 2YN0A 4YO8A 4RPHA 1Y8RB 5J4KA 1U5CA 3GXBA 4OSPA 3HSSA 3A2KA 2VYVD 3AM1A 4ZIRA 1XKXA 4AJKA 5KTSA 3DHWC 3GAMA 4KXQA 2FRDA 2ZSHA 3OFSA 5AUQA 2P8JA 5K6AC 3MRTA 2ZYRA 1O9HA 1YRYE 4W6ZA 5AJVB 3UQYS 5A05A 3GLIA 1GCIA 4XJXA 3O4HA 1UKAA 4HO1X 4U02A 3RSCA 1U63A 4IYJA 2GEUA 3WYAA 4V24A 3OPQA 3IMKA 4FYVA 3ZU6A 4ZKDA 4M9CA 3H6GA 1WB9A 3EF3A 1IY1A 4F93B 2HO5A 1FJHA 1DHTA 1OAKA 1OLXA 1QVWA 1TQHA 2DP4E 3SF8B 3NT5A 5KU1A 2WYVA 4XIIA 3ONNA 4C4RA 1R8QA 1BE6A 3C7AA 3PWTA 1NOJA 1CE8B 4TVSA 3E3OA 4FEGA 3TIFA 1YU6A 1PX0A 5H9VA 2FX5A 2Q6KA 3HLKA 1NPTO 1QFZA 3DF7A 2B4YA 2VJKA 4PQEA 1R3UA 2E4YA 3GJRA 4G5FA 4JHLA 4U3JB 4UTZA 3TCKA 1KH1A 3RAGA 4E5PA 4Q4HA 3ILXA 2GCOA 4G4SP 5BV1A 4CMGA 3MCZA 1BKSB 3LCJA 3I04M 5IAKA 1GPUA 3KUKA 4B2YA 2HDHA 1N0UA 4IL5A 5AK5A 5I8ZA 4M0EA 3LLVA 3N2NA 3RQIA 4I4NA 2BDEA 2REXB 1U80A 1PT6A 1ZZGA 2BKVA 1AUVA 2FEKA 2HIMA 2PXAA 4WA7A 5E9WA 5B3JA 3W9YA 5FPKA 2WM8A 5FFFA 4ATNA 4YGYA 5LQUA 2X0NA 1PJ3A 2ZUEA 4FMDF 1I3LA 4RJIA 4F4IA 2XRZA 2N1BA 3PKZA 2LIVA 4A3SA 2VNSA 4XI9A 3LFHA 3AZOA 4YN3A 4GXQA 2FOXA 3HFRA 3QYJA 5L3VA 3DMYA 5HF5A 3C15C 1PJAA 1BMFD 2FRVA 1KZYC 1I13A 3FBTA 2WJ6A 2QEQA 2FW7A 3OZBA 4MUGA 4TLEA 5L6MB 2R48A 4EQZA 3HJBA 4Z1MD 4WGFA 1M6HA 4DWWA 1Z4QA 3S7ZA 5JNRA 1NW6A 2GZDA 1P44A 5ADVA 1W93A 1IXSB 1GGKA 1SKQA 1VCOA 2QL7A 2W4IA 4P7JA 5CT6A 4U7PB 4Z0TA 5FULA 1EX7A 4AJ4A 1COWD 2EEPA 1UBOS 2HIAA 3OCUA 4N49A 5JS8A 3T15A 2CNWA 3MB5A 5HKBA 2QRQA 2DG2A 4OLFA 5EE3A 2QX4A 2MTBA 1MJNA 2XJ9A 3FVQA 3LW7A 5KWSA 2J5BA 3QF4B 1WKCA 2V55B 4QYTA 1AK1A 1RP1A 1JXMA 3OVMA 4UU1A 1ONPA 1O1YA 3TBFA 1DT5A 4AD8A 2O19A 4LIPD 5I7RA 2EZUA 3AFMA 2PT6A 1N57A 3FOWA 4EDHA 1QIJA 4QREA 5ELMA 2V8OA 4KMOA 5KSOA 3C4VA 3SJAA 2AB0A 4I1UA 5JI3E 2ORIA 2CXQA 2ZIUB 1R0KA 2TMKA 2ZSAA 3FSGD 2ECKA 3STWA 4MV4A 2TMGA 4ZO8A 2A57A 1NJ2A 4DBVO 1BQEA 1U2GA 1TFRA 2WF6A 1CR1A 3RIYA 3W1EA 3ZGOA 5KAMA 1PUIA 2AG8A 3T35A 1JKXA 3BK1A 1H2EA 1OXMA 2C7RA 5EMNA 4UPDA 2GJ4A 4JCCA 4MVJE 3BS4A 3TLMA 1RPAA 2Y0EA 1RKUA 1QCYA 4BFTA 4CU2A 1LWOA 4ZVPA 3LQRA 3QWBA 4XWKA 1PFQA 2JEZA 3CH7A 1IZ9A 4CI9A 4NU5A 5FPPA 1MO2A 3ZUPA 4BB9A 5CDSA 1EZ1A 1T2NA 2E37A 2HZBA 1PFKA 3O75A 4P7KA 3TAHA 3ZGLA 3L6OO 1E9CA 3UHPA 4QNMA 4D41A 4E7OA 4I81A 3A7DA 4AP6A 4PYJA 4D8UA 1ZC4A 1FP1D 1VG9B 2HLPA 2QAJA 2CHGA 3IUNA 3PT9A 2FVYA 4IKOA 3RVSA 4K9DA 3PPXA 2O8EA 2R00C 3PF9A 2Y77A 3BQNB 4BNHA 4EEZA 3C45A 3TR6A 4JZYA 1ZBDA 3FOFC 4ND5A 2V9PA 3BFXA 3CURA 4AF7A 1T3LA 4Q19A 1THZA 3O4GA 3TTXA 3TL6A 1M33A 4K6MA 3R0IA 1IRXA 1V8OA 1PGJA 2Q1WA 4H0FA 1E2IA 1QC5B 1WXGA 3RUEA 5TIIA 1JR3A 3CX4A 4PYOA 2MSLA 3KJGA 4CDGA 2BAGA 2BONA 1QVAA 1A88A 2YW2A 3P45A 3QF4A 4L0DA 3HJTA 4OYLA 2I7VA 3TRKA 1LGYA 3CLTC 1ORWA 2Q3FA 1TB4A 5IX8A 4PYRA 1JQJC 1JWAB 1LPOA 4B4VA 5LLTA 1ID8A 4JLMA 4Q02A 4UOEA 3QX7A 1EDEA 3T99A 1HOTA 2NU7A 1N5IA 4Z8YA 4IRMA 5K3SA 4M21A 4AJPA 5BW4A 1RJ9A 3CO5A 3HEMA 4OB7A 3AI7A 2O1EA 3ME5A 4XQEA 5A6VA 4LJ8A 1Y7HA 1KKUA 4K6HA 5HJ2A 3ERCA 4C7OA 3DV9A 3LA8A 4J07A 3E7WA 4BNXA 4A9AA 2HJHA 2RH4A 4AKTA 1U28C 1HA3A 4PX3A 3I9V6 4W9RA 1PT7A 1OUMA 4JB3A 4O59O 5F73A 4RXMA 1L7QA 1ZHOA 4G0WA 2GPYA 2P4HX 2P4UA 3A4NA 1T0HB 3GMDA 3L0PA 821PA 2G08A 2BGWA 1MENA 1WRBA 5FUQA 3J7TA 1PZFA 2Z9DA 3GOQA 1XEAA 2MYTA 5BSMA 1K92A 4AICA 4U8HA 4ZA2A 3FDZA 5EINA 2YC2C 4U7GA 3LK7A 3PDWA 3Q15C 4IIJF 4K6GA 4MK4A 4NBLA 1CKEA 3EGDB 3OX3A 4IF6A 4PHHA 5KKNB 3IL2A 4PSDA 4NV3A 3IEIA 2J1LA 3DGFC 4GPAA 3WRYC 4CLXA 4DMRA 5CH8A 3R3YA 5G0WA 4RD0A 3DW1X 3NB0A 3VQTA 1FNBA 3IV9A 2J09A 5L9AA 3LQYA 1T0JB 5JROA 2UYCA 1UIRA 3D6TB 2LWIA 4CHTA 5MDHA 3AFHA 5J23A 3GFTA 4R8SA 3QE0A 4O3FA 2JA1A 1J2JA 2FMTA 1HT0A 8GPBA 1TTHA 2P40A 1IONA 3BN3A 4H59A 1IQRA 4RKYA 4ZU1X 5TXGA 5IAJA 4EFLA 4Y6LA 2FSUA 5BPFA 3SXPA 8MHTA 4OATA 4BLPA 1F38A 3HKBB 3LSYA 4YMLA 5AVJA 4PNEA 2R47A 4ZC1A 2XZLA 2KYRA 3OCVA 1QRDA 3WGYA 2XMZA 3NUZA 3CUVA 3P19A 4DARA 2W6QA 3PBKA 4FDUA 4PPNA 4D3ZA 5LXTB 1Z2AA 5J9FA 2R7MA 2YWFA 3FRJA 4TRJA 3X43A 1IQ0A 1GZ3A 2NXNA 3Q7PA 2D2XA 1IBRA 3QW2A 4IVQA 3A36A 3IO3A 5CVCA 3VU1A 1LQTA 1HX7A 4DQVA 1N8SA 1XCGB 3FUVA 4EYEA 2ORYA 3MCAA 2RAFA 1GNRA 1NJ5A 1RBZA 3Q3VA 5DSXA 4WCFA 4PRKA 3V4RA 3F97A 4Y18A 1U0NA 1GNTA 4URXR 3I39X 3NUQA 4XUEA 2XB2A 3WJ2A 3GNSA 1Z73A 3DMNA 3PQ6A 1E9FA 5I7EA 2PV0A 1FSGA 3BF8A 4IZOA 3T6KA 4CQMA 3UFBA 3LC0A 1XLUA 3OQHA 5JY1A 3CLKA 2RH9B 2OOSA 5FO0A 2BGNA 2QL5A 4J03A 3GRVA 4IV8A 2PO7A 3ZDDA 1ORRA 1TL7C 2JFWA 2ODBA 4QULA 5BN5A 4ER6A 1EK5A 4RMIA 4QM7A 2WHQA 1O95A 2YHAA 4L4YA 2X9VA 2VP6A 1TLLA 4JSRA 1SC9A 5BN4B 3PQ3A 1FCJA 3BMNB 4MUBA 4KO8A 4LF9B 2XEXA 2IV7A 1QHNA 3CEHA 3CB2A 3AQ4A 5EHXA 1VPVA 5H3LA 1ISRA 1YZLA 2W2QA 2PFSA 3FBWA 4G1VA 4URFA 2X8WA 2ZM5A 4RFSA 2PSHA 1EFLA 3PD1A 2J9GA 4TKVB 3TK1A 4TTSA 3OQNA 5JBIA 2XKKA 3BRWD 5NLLA 1N6LA 4KLNA 4OK6A 1JG2A 1NI4B 1IY0A 2FPXA 1NI4A 4MR7B 3AIIA 4TUYF 5A5DA 4YP6A 1ZSNA 4LFAB 1D2RA 2I4MA 2H4HA 3ADPA 3BCRA 4LJAA 4WUTA 4NYIQ 2Q5HA 2IYAA 2X8AA 3Q7QA 1ZEMA 1DTSA 2MINA 5PNTA 5JC8A 2WW8A 1HNNA 1M0SA 5DBOA 3ZWYA 2ATVA 3MBOA 3ODPA 3P9NA 2DULA 2AUMA 2VZ0A 4JU9A 3WK6A 1QRTA 2YR0A 3GVHA 4NU6A 3RE1A 3K9FC 2H0RA 3L40A 4XD2A 5FBZA 3D4IA 3A25A 5K8TA 2VRCA 3TBHA 1GAJA 3AG5A 1ZXLA 4UMDA 4BNTA 3SC3A 3LQKA 5CG1A 1G3UA 3M6WA 2HJVA 4NEQA 1CQIB 2GM5A 1I4LD 3M9WA 4CQLA 1T5OA 2CZGA 2ICAA 4LKRA 4US0R 3HB4X 3PR2B 4IDAA 1PSZA 3K8YA 3O84A 1WHSA 4PG6A 2OCGA 5IABA 2DR3A 2GDJA 1NXOA 3BA6A 3HVKA 1WOMA 2ZDHA 1KI3A 4GEKA 3EB9A 5EFOA 3IX7A 4WNCA 3W1WA 4H6WA 3NXKA 2JGAA 2A5LA 4L1KA 2RB5A 3PZBA 1KO4A 4EGSA 2AFHA 2HA5A 3IQFA 2X0DA 5DGXA 2Z09A 2WWYA 4ARCA 2EF1A 1DEOA 4E94A 5A5GA 3H19A 3NVKI 4C0SA 1JDSA 1NV9A 4MV6A 5E6RA 4D3YA 4YT4A 1MEOA 1X1RA 4G0QA 4FHGA 3TSOA 1C3XA 1PEAA 4MGYR 1NG1A 2ZXUA 1QIMA 4F2DA 1IFXA 3OCWA 4UPEA 2APJA 3K6RA 5CLLA 2DLDA 1P0MA 1UDWA 1Q15A 2P9TA 2WAYA 1GAEO 1G6KA 2NZVG 3LU1A 3O73A 5GV8A 3PC2A 1CIJA 2EFDB 3JAMA 2D5AA 1J0DA 2PJRA 3WFIA 3SLGA 3EH2A 2P91A 4Z7JA 3NV7A 3LGAA 5ERYA 5D2CA 4E15A 2XGMA 1DBVO 1OFGA 2WSMA 3G6KA 3FE2A 3DOCA 3TFQA 1S2LA 5LB4A 4PLGA 1OGJA 2GZHA 3QPVA 1XAJA 3DPSA 2ZBFA 4K3UA 5GZ3A 3E15A 3PR1A 4DBZA 4GT1A 2ISQA 3F4BA 1ZD4A 2REOA 2BM8A 1VE1A 3EE6A 1TT7A 3I0ZA 1G5PA 1LPMA 1EB8A 1SC6A 2PZ8A 2FMXA 2VT3A 3IQHX 3MTEA 2V5UA 3N53A 2YVQA 4L6AA 4MJXA 4G4SO 3WLLA 1IN1A 3ZE7A 3SE0A 1I01A 1SVKA 2XRYA 3L0BA 4PHCA 2VOEA 1YZQA 1K5PA 1X3SA 2JIBA 2LE0A 2RGGA 1HBJA 2Y92A 3F47A 1LB1B 3CC8A 3KYCA 5JSZA 1FXUA 4CEIA 2XUIA 4QE3A 3ST7A 5JAOA 2X0RA 1DRVA 3VDQA 4IX1A 4YRIA 4FBGA 1C81A 1BS1A 5AKKA 3ZOKA 4BE9A 3IDFA 2AX3A 4ODIA 4AZVA 1ZSVA 3W34A 2ZW9A 3G79A 1C4OA 1DTWB 1P0FA 3JAKB 4GYKA 3RYIB 1KAMA 3LQ4A 2MMGA 4N6NA 3G0DA 1QPGA 4R54A 3FMFA 3HXKA 4MYTA 1C29B 2PBRA 2WTAA 2I78A 3O9VA 2IODA 4MICA 3TQFA 4HY3A 4ZGGA 4ILKA 3PHCA 3R1IA 3BA1A 2OZPA 2Y71A 3COYA 3KLNA 3OPYI 1E59A 5CBKA 5CLJA 3QX9A 1K27A 2G8NA 4ML3A 2WIFA 1R4NB 1XZBA 1YCHA 2QVYX 1DBIA 1H1LB 3PCRB 5DJ5A 5FJJA 3VNBA 3SGLA 3M5CA 2XUKA 1ZJJA 2OBYA 5DM2A 4MB2A 3S70A 4BTEA 2B3TA 1IDOA 1MAUA 3ZWCA 4HVLA 1HUQA 4GX5A 4EW1A 4UHFA 1T91A 3CX6A 1OV4A 1XD8A 1ZKMA 2PR7A 3ZR4B 1TYBE 4EG8A 2FQ1A 2XW6A 3GGJA 3ZLVA 1XNGA 2PAFA 2YY6A 3ANYB 4UBJA 2XF2A 4GI5A 2YJ4A 4C5BA 1XQXA 5JDIC 1P4HA 3JYNA 3UXEA 1AKTA 2VRNA 4IQFA 1XZJA 4NATA 4PZUA 4REMA 1E4VA 1M67A 4HQOA 1KDYA 3RSSA 1VKOA 5KU7A 3T52A 3H1EA 3OBIA 3D43A 3PXXA 1SA0A 3I4LA 2ECFA 2V7EA 1L4YA 2BEJA 2YDYA 3E2PA 5HBRA 4DUGA 3KSAC 2OFWA 5JY6A 1KDPA 2H8KA 4G89A 2HWKA 3PSAA 1JVSA 2HWWA 4CKEB 1T25A 2QI9C 3CKMA 4P0PB 2WKWA 2WYIA 3OQPA 1KMIY 1G7TA 1XCLA 4FWIB 1C7ZA 1IXRC 4OGWA 3SQDA 2JJ1D 1Z22A 3IXLA 3AF4A 3FD8A 3F4LA 2L82A 4WJLA 2YQ5A 2HRCA 5IXSA 1TW3A 1U1IA 2RMKA 2V4UA 3AHJA 1II0A 4Q12A 5I5GA 1RXSA 3PDIA 4FVTA 4HXYA 5G0VA 4YJHB 2CLEB 2RBKA 3RV3A 3N2ZB 3ZCXA 3ZHBA 4A03A 2WQ7A 3R0ZA 1A95A 1Q91A 4DA7A 4Y3UA 3B3AA 3NPAA 1XN1A 3CU5A 3TG2A 1FOEB 3A9TA 4ZI7B 1XMJA 2FQYA 2VYCA 3KWFA 1HMYA 3AERB 4X84A 3H83A 1LY1A 2R97A 2HY7A 2Y4OA 2B25A 2ZUWA 4JJZA 4KACA 2JFHA 4TMXA 3ICQB 2EBWA 2QP3A 3C98A 5FFNA 5KREA 1VBFA 4YHBA 5ESWA 3N7AA 2IK8A 3E5MA 3IJPA 4F11A 3TLXA 1GZDA 3JR7A 4LBVA 3FHLA 3HO6A 4IIJA 2H4JA 3S8YA 1R3DA 3PTZA 3I04A 2BHLA 4K9NA 5C7OO 2HSWA 1Y33E 5TPWA 4AJ1A 1X87A 3KQQA 2DUMA 1Z0KA 2I34A 2ZITA 3CSUA 5IN5A 2WE7A 3GNQA 5CVEA 4HQRA 1E2GA 1WR8A 1T43A 2QR5A 4AT1A 4PFQA 3ZW7A 2ECQA 5JAPA 2UUBB 3A3KA 4F97A 4OXXA 3HDVA 4FD3A 1TAUA 1CUFA 2CLHB 3DFMA 4F5EA 5H7XA 4CR7A 3GLGA 1LQ2A 3K94A 1RTKA 2IV2X 1CJTC 2J3MA 1U3UA 4R9UC 1WUTA 5FDFA 3MGCA 5TGDA 3W3AH 4O1HA 3ZD9A 1DKQA 3EG9A 4F9TA 4GL2A 4A8JB 1C3LA 1SAYA 4XB1A 4GVPA 2NT3A 1X2BA 2WYOA 3MW8A 5I9IA 3SVTA 1W36D 5K0GA 2PPLA 1VG0B 4IZ6A 5CRIA 5FNVB 3TZLA 5C1PA 3I6YA 2R1TB 3SZMA 3O8QA 1TM5E 4K05A 5ER6A 3ECSA 2NO6A 2HJ9A 1AKNA 4GRIA 1HRDA 1NURA 1EESA 5A4FS 3SS7X 4NU0A 1WBBA 1NNEA 3B2EA 2N75A 5K4AA 5C31A 5TF0A 3H84A 3ZD6A 3A28A 3E05A 3L7IA 3D2LA 3P9RA 5A3VA 4TKVA 3GLFA 2FSFA 1TPZA 3THRA 1P7ZA 3OIYA 1Z12A 1F2VA 1YAJA 1QGAA 5JO9A 2WTNA 2BM9A 3R3ZA 3KXLA 5EKXA 2C4WA 2RG7A 4FEEA 1CR0A 4IQGA 4QZVA 1Q3HA 3P2EA 3OQ1A 1L4UA 4ISCA 4JLJA 1E3IA 3AKYA 3SLRA 1U2RA 4JLVA 2J07A 4W5HA 5DI3A 3U40A 5KWJA 3CR8A 1AGNA 3CSSA 2ZIXB 1YCFA 4RE6A 2VQEB 2GGSA 2ZVPX 2P9QA 4BP9A 1FNMA 4CMKA 2WFZA 1T6ZA 3FHOA 3HV0A 4TKMA 1OBHA 1JIJA 1SEVA 1SVOA 2FUEA 3OOWA 3PYXA 1G6OA 3DP9A 3UQZA 4CFSA 2BBSA 1OZGA 1GDTA 2YXEA 1YB4A 4OKSA 2YFYA 2PU5A 2FAXA 1FW6A 2A9OA 4QOJA 4FE3A 4MVCA 4XCXA 4AUEA 3TSCA 3BGIA 3FPFA 4GLBA 4D9BA 2GLXA 3IMFA 1NDHA 3P97A 4Q1BA 1TCAA 3ETCA 5JMPA 3TOVA 5G4LA 4DR6B 4JKIA 3H9GA 4N5MA 4BV2A 1XE3A 3IVRA 4W1SA 4X1OA 2HMAA 4E33A 1MIOA 5AO9A 5IRCD 3RK4A 3S2IA 3G6WA 4C20A 3DEZA 4ZMSA 4N9QA 4QRDA 1UPUA 5EE5B 3H1GA 3L05A 2VAVA 4ND4A 4BMDA 3ZWDA 1NBMA 5BORA 4TKUA 3D3WA 2F8SA 1BN6A 1PNQA 2EAUA 2GEDA 4FCVA 4KHZA 5DXAA 1H3NA 1MW8X 2QP4A 1FNNA 1A77A 2ZI3A 3FVRA 4GGPA 4K40A 1I1NA 5H1YA 4XQGA 5GWXA 3ZPXA 1UBTS 1QPZA 1DAIA 4CM9D 2J9XB 4OQFA 1T9GS 1YDEA 2DR0A 5B1DA 4Z7QB 4OK3A 2XCOA 2D0IA 2LRHA 1XD2B 3PUKA 5E6SB 5JZ9A 3KWJA 2RGRA 4ND6A 1Z5PA 2QRMA 3M1YA 2HH9A 3U7QA 2G9QA 3OMLA 3ICPA 2O2DA 4QSHA 3QMVA 4U7JA 1P18A 2VPTA 4XVUA 5IDXA 2IEDA 2ZWAA 3B5EA 3U1TA 2I55A 1T1RA 3F6SA 1VMDA 2OVBA 4HS9A 3IEXA 4CLHA 2VJDA 4M7PA 4O25A 4Q6BA 5ICMA 1HMPA 4US1R 3ZWOA 1QLWA 1JQAA 3HKCB 5AKZA 5JADA 2QQFA 2ON6A 3RIXA 1IE3A 3U7JA 4ARUA 6ADHA 1EJBA 4ZANA 5DHUA 2XWQA 2VWPA 3IDSA 3NAMA 4IOLA 4X3OA 4XXHA 4F3YA 5IT5A 1XDGA 4NPHA 4ENVA 2A9FA 1ZG3A 2H8GA 3GLTA 2YV5A 4FE4A 2FNAA 3H87A 3TD9A 3FBGA 2FDCA 1L4HA 1GNPA 2VP4A 3IKJA 4DILA 4C43A 2CD7A 4ADSG 4JJFA 2WSLA 3TIGA 3DTVB 5K0NA 1N5OX 2QRLA 1KOGA 3ETHA 2ZJ4A 2LKCA 3QKTA 5F7XA 2MU1A 3B85A 4WY5A 3DVLA 4WAUA 2BFPA 1QWOA 1F5NA 5KOHB 1XTTA 3GLKA 4C05A 3IE1A 5IKXA 2GF0A 5AVTA 1GPDG 5EEGA 4CT4B 5F77A 1R4ZA 5GV7A 3ORHA 2YQ4A 1RBYA 4HYEA 4DSUA 3FNHA 2NO5A 1V1RA 1P1KA 5GJWC 1LD3A 1ODSA 4I8XA 4R05A 4MROA 2DWCA 3SZGA 3TRDA 3ZJVA 4WI1A 3LCVB 4GYYA 3E6AA 3L8GA 4L5CA 4LY9A 3WG9A 1QTQA 4MRPA 1NY5A 2OV1A 3PTLA 1CUSA 4JZKA 4D74A 2AWOA 2CB0A 2WOJA 4GBMA 3IR6A 3DT9A 4MUXA 2KJQA 4XGQA 4E88A 2FCAA 5E95A 1QLHA 1OKKA 1F2TB 4PS1A 3G0HA 4IV0A 1QJCA 1EUCA 1T4CA 3Q72A 1U6JA 3IALA 4PYIA 2GCIA 4K87A 4O08A 1A9RA 1QF9A 1RHJA 1JPUA 1X7HA 3QMPA 4LTMA 3SLKA 5B7QA 4C2TA 2V7QD 2WHRA 4C04A 4C0AC 4B46A 3IQIX 2Z3VA 2EW2A 2OBBA 3PEYA 5LLSA 2OO5A 2GVNA 1ADYA 3I09A 4P0TA 3T7IA 2VI5A 4HGRA 2XD4A 3QLTA 3LY5A 2WWWA 2NLOA 4ROSA 5H3CA 1PR4A 3K9BA 5EPOA 1LBQA 2EHDA 2OKCA 5TVGA 4G5GA 4GI7A 1CHDA 1ZO8A 1TI7A 5JCOC 4CEHA 2R0QC 3L06A 4ZAXA 2GI4A 2YOHA 1YIDA 2IEIA 3CF4A 1JU9A 3SYRA 2IH5A 4B6SA 4AKIA 1JQEA 1L5HB 1I2ZA 1M7HA 1W34A 2IW3A 4INPA 5JTUA 1OWOA 4Y2YA 1YE3A 3GJ8A 4LZAA 4EYGA 1MFPA 3FXAA 4NENB 2FPGA 3NTXA 5HSGA 4Q3OA 2VNIA 1WXEA 4II2A 2JI7A 1BVUA 1EZZA 1ORIA 2IYNA 2JFXA 3BFKA 4GFDA 3DTNA 4TXHA 4YJGA 3ZVRA 3JXEA 2C2OA 2QPTA 3DDZX 1QM5A 2HOQA 2JVIA 1I7QB 1DO8A 1XOIA 4G26A 4D81A 4MQ4A 4A27A 3F5FA 4F84A 1K89A 3T7TA 4RCYA 1RMTA 4NARA 3LZDA 5KTKA 5I4KA 1HDOA 1Z7BA 2JAWA 2P9BA 2Y0CA 4TMFA 1NI5A 3D5QA 1WABA 1OVMA 4Q3NA 4OYRA 3R3UA 3HVJA 1O87A 2I7XA 5SICE 1ANKA 3DAFA 1V7PC 2O8FB 1MQSA 4MIOA 3RF7A 4ALLA 3CVVA 3GJ5A 3V8VA 1DOAA 5B5SA 2WYUA 2QROA 2DB3A 2AUNA 3BSFA 1XVUA 5HFAA 3UGTA 5I3CA 2MSNA 3BG5A 1E94E 3RVMA 4ZAGA 4WBNF 2XUFA 1HYGA 4JR0A 5G0UA 2ZI7A 1WQ1R 3OTQA 5CW1A 2BH2A 5AVOA 1AO0A 2VF8A 5IEBA 4LSZA 3JAWA 5DB4A 2AE1A 3GFPA 2JFPA 3SPXA 4Z7OB 5CDFE 1O95D 3VPAA 2B78A 1XZFA 1VSTA 5KNBH 1J21A 3WGMA 3ZYCA 1BEEA 3OPMA 2FETA 5JZSA 4RZHA 3W7BA 3BJZA 1NQXA 2EJVA 3WIDA 3NR2A 1O9BA 4LNUB 2IBSA 2AL7A 2PL9A 4LYHA 2WWIA 1E7SA 1W30A 3MELA 1BA3A 2CJPA 5FRDA 4NCNA 2VTKA 2LUOA 4NBVA 4BFSA 1EFKA 3LUGA 1Y8QB 2B5OA 1VKNA 2JANA 2QYSA 2VPPA 3G2HA 3KXKA 4JASB 5JAIA 3FOZA 3A4YA 1JEYA 2B34A 2QTGA 1WP9A 3NWPA 3ZGNA 2JJ8A 4QJ3A 3PL1A 2GHIA 2JIZD 2QB5A 4FFBA 3V8PA 621PA 5CXQA 2PHZA 1IZ8A 4IOKA 4IV5A 4YJ2A 1E77A 1RFGE 4O2AA 1J25A 3OJ0A 4YQFA 3VPGA 3TECE 3H18A 2OPBA 1S5PA 1YDGA 3IQEA 5FEMA 5FWAA 4Y2XA 2GM3A 5AD1A 4YREA 4K2HA 4BGUA 1KFCB 3GD5A 1YVPA 3VSAA 2VDOB 3NNDA 1IOWA 2GLTA 2IHTA 2IYPA 4DPLA 4G0VA 3MWJA 4HTFA 3W1VA 2PZFA 1EXMA 3LX4A 421PA 1B16A 1PJ4A 1NVGA 2O2JA 3ABRB 4LTDA 2QD3A 1U6IA 2G72A 5KPJA 1FDUA 1NLUA 1BHSA 3NT2A 4HBZA 2GD2A 3EFHA 3R9KA 4AO7A 4D6YA 3JQQA 2LD4A 3IILA 4KMRA 3BIXA 4R51A 2PKXA 2P6NA 1DJQA 4KZKA 4R1NA 4R5HA 4Q1EA 1IJFA 1QE5A 2JLQA 2P2YA 3IAXA 2ZRKA 3BTSA 4YXWD 1LDMA 4EGFA 1YCDA 2CMKA 4N6GA 3B1KA 3F46A 4RNDB 4XCQA 4Y1RB 4TTAA 4X1IA 4TLCA 5FWDA 4R8VA 3OOSA 4JDPA 3UJCA 4KK3A 3VR6D 2NO9A 4AJNA 5KI6A 3AB7A 3R4CA 4Q3EA 2O8DA 5CT4A 1IVNA 2R6AA 4JHXA 4J2TA 4TMTA 2GXUA 3DTVD 3WICA 1Z39A 2YKGA 2O8FA 4QT4A 3ASVA 2X4DA 4Y9UA 3TZEA 3UT0A 1WLYA 3VV3A 3MQFA 4QBIA 4JSYA 1GSAA 2PKRA 1NRWA 3IP6A 3OJEA 4TV8A 3RPEA 1QF7A 2BF7A 1UFOA 3ZS9A 1KYTA 1USGA 5ILOA 5E3IA 4N5LA 3MD9A 3TINA 1MNQA 2MR6A 1ZH2A 4FGKA 1Y8CA 2JVJA 1SCKA 3QH4A 4HNHA 3B78A 2QQGA 4IDPA 4MGKR 5KYGA 3P0JA 5ESDA 3EZ6A 4HTFB 3RGWS 1FP4A 3AU8A 3DAOA 1CR6A 1UAYA 1RRMA 1WD7A 3EQ2A 3L9WA 4H0CA 4WASA 2EFYA 4N39A 1QX3A 2Y2VA 4IEFB 4TXLA 4D4KA 4P4GA 4B4WA 3DEYX 4UTXA 2Z43A 3D7SA 1IQUA 4KDCA 1G2OA 4JFAA 2WR8A 2IUSA 3G5LA 3GC6A 2GBLC 4KGVA 5IULC 1R0RE 2ZRQA 1XAHA 3Q0TA 2DZDA 1XMOB 1GPWB 3PC8C 1ZM3A 3SMQA 3OZWA 2Z5FA 4O8ZA 2BR3A 4BDTA 3C1TA 2N1MA 4R2XA 1IVSA 3CNHA 1FQWA 1QHIA 1SBIA 1XZAA 2HFKA 1DQPA 2W6IA 4ZXFA 1CCWA 1MMFB 4DEYA 3AF1A 1B2LA 5BUZA 2CL5A 4RABA 3OZDA 1P3Y1 5HOEA 1U8ZA 1R1DA 2B7LA 1PVOA 5CP8A 4L3WA 3IODA 1NMEA 2DPGA 1N5DA 1HQDA 1YQXA 3UK2A 1V71A 3FDXA 3FYTA 4FOSA 4KRYA 3MN1A 3TQSA 3NI2A 3A04A 2BEVB 4OTZA 2JGDA 3CRMA 1RTTA 1VI2A 2CLIB 3PC8A 2ZWPA 2Q45A 4JGBA 4OHBA 4AJJA 4QASA 1JHPA 2CLKB 5EMJA 3FF1A 3NNNA 1OWMA 4I55F 2JB9A 1Z5VA 4WJKB 5DBHX 1XXHE 1JEOA 2FYTA 4O4IA 4LOHA 3LPDA 2VK4A 1TZMA 3C3MA 2F2TA 2C7OA 3G68A 3E0XA 2HPHA 1TU3A 4EY5A 4CM4B 4DCNA 4UFPA 3RCBA 4FHDA 1M3SA 3RRFA 4F6LA 2IBTA 4QPCA 6AT1A 5HX7A 4A0QA 4R1LA 3STVA 3PXCX 3AYZB 4Z0NA 1OWNA 2PH1A 2JGMA 5G1NA 3ZV4A 5D5PA 3PPIA 4KZPA 4A91A 2W48A 3D1LA 1JSRA 1CQXA 3A4MA 2CXPA 4DMUB 3AYXB 1JKJA 4GVXA 4KV7A 4KFTA 3T1HB 3VI3B 3SC2A 3T7RA 4GS5A 2JJ1A 1P17A 1T5IA 2YMQA 3VBCA 4XQCA 2PQ2A 2I2WA 4QLBA 3A6DA 1G0OA 2VPWA 2P3SA 3AKEA 3ZHOA 3PHLA 4KMSA 1QAMA 3R3SA 1J70A 4BYMA 3ONEA 4HFNA 2C83A 4URUR 1TAHA 2ZSKA 3H8SA 4LNAA 4C30A 2NAFA 2NYVA 4WBXC 2G09A 1BKDR 3HE3A 2HQBA 2ZIWB 3ICOA 3C3CA 4BKRA 8ATCA 1EFTA 3RU2A 3IVAA 4PRLA 3QRWA 5GJBA 5EKDA 4LPSA 3RC3A 3UV3A 4G8CA 1CUWA 4R8KA 4A26A 1LLCA 4EO4A 3HVRA 3UZUA 2CL0X 2HXYA 2JD1A 2QVLA 2YN4A 3PVCA 4DA9A 1DCFA 2CSXA 5B36A 2W6ZA 4NMXB 3ZS8A 1UBLS 2J59A 1HM5A 1U94A 3QHAA 4FZ5A 1VPWA 3A9VA 2O5RA 1ZJ5A 1A2QA 2H4FA 1QAQA 2J9FB 1NUHA 5REQA 3FYUB 3ZH2A 3TLEA 2CXTA 1ZOIA 2O8NA 4DVJA 4IDNA 3FW1A 3PTAA 1K9SA 2O8EB 3HDTA 3LPAA 4KBGA 4D9MA 1OLOA 4PR3A 4MRNA 6ABPA 1OIVA 2W22A 4KRXA 1PZEA 1UK7A 4I1YA 2YC4C 4QUIA 4V1CA 2X3UA 5EE1A 5TVKA 1DAGA 2PRSA 3LDGA 4AURA 4EJSB 4YUYA 3T5PA 3WNDA 3WB0A 4KVAA