3LW7A

The crystal structure of an adenylate kinase-related protein bound to amp from sulfolobus solfataricus to 2.3a
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
177
structure length
170
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase related protein (AdkA-like)
publication title The Crystal Structure of an Adenylate kinase-related protein bound to AMP from sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
total genus 65
structure length 170
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw7A00
4AYWA 5H70A 2XXAA 4Z8XA 3Q72A 4URYR 1AK2A 2WM9B 4ZI3A 1BH2A 1UM8A 3QG1A 2WWFA 1FW6A 4WZBE 3RRMA 3PFIA 2O52A 1IXSB 1RJ9B 3G5UA 4F93B 1EWQA 2EYUA 4N0EA 3BS4A 1L2TA 2DHRA 2H8KA 1GVNB 1TMKA 1UEIA 2IYQA 4GFDA 3RNLA 2IYWA 1EFRA 3U2QA 3NTUA 2IK8A 2ZM5A 1M7HA 1S9DA 5FOSA 1JNYA 1R7RA 4B34A 1IAQA 5C18A 1EK0A 1WA5A 4TQ9A 4LJYA 5CB8A 1S2MA 1UKVY 4F38A 4US0R 4Z51A 3T5GA 1KOFA 2KBFA 1WP9A 1NN5A 3LX8A 3RANA 4B3BA 4GDFA 1Z2CA 1G3IA 2D4HA 3KUDA 3C7KA 1TF7A 3QKRA 3T1OA 2CK3D 1GKUB 1TQ2A 2QPTA 3W6NA 2BDTA 3P4XA 4B33A 4O25A 1X6VA 2XAUA 2QPOA 1QRAA 1DADA 4HDQB 1IN5A 4LJ9A 3X2SA 1F2UB 4HZUB 1G5TA 1DAEA 2FEOA 2JASA 1CXZA 1P9NA 1Q3HA 3K0FB 4D82A 3K0CA 4KYIB 1MRSA 5E4FA 5LBIA 2IUTA 2WIBA 3DZ8A 5L3QB 2WSSA 3A1UA 1Q1BA 1QG2A 2EWWA 3DKVA 4RFVA 4ZKDA 4D26A 3EX7C 4M9QA 2AN9A 5B58C 4AIIA 1QDEA 4FMDB 2VSXA 3LV8A 4H1VA 4BRWA 1XMIA 4D81A 4FN5A 2ZRBA 3GD7A 3U7GA 4C30A 3IPXA 3DM9B 4ZI2A 1XRJA 4HUQA 1ZM4A 4NYIR 5FOUA 2J59A 1K8RA 3LFUA 3NWJA 4CVNA 5J4KA 1ZNZA 2QAGC 1X8JA 1F60A 2IS1A 3L82B 4Q4HB 1E69A 2MMCA 2BMFA 2HT1A 2C8VA 1Z28A 3PQCA 4E03A 4ZDIA 1SXJB 2FNAA 1XEXA 1DAKA 4B3FX 1NVVR 3HU2A 2CE2X 4HLUC 4EFLA 2ZRHA 3TSZA 2O8DA 3EZFA 1ZIOA 1G7SA 4M22A 1W4CA 2IHBA 4BFYA 4C0SA 1VMAA 1DG1G 2D7CA 1KJWA 3SR0A 3C14C 2Z0MA 3W5IA 3VMFA 2JGNA 4BEBA 4BGDA 2FZ4A 1OXXK 2OBNA 5CLLA 4BFSA 2VP6A 4NZYA 1KI4A 4ZPXA 4EQ6A 3KJIA 4CEJB 1WMSA 2W00A 2QBYA 1U0JA 2IBMA 2XTMA 3WBJA 2Q9AA 3IUYA 1AGRA 2ZEJA 4QHYA 2P6RA 3VR6A 4TZ6A 4LBYA 5DI3A 4ZDKA 1U8YA 5CK5A 4WBSA 4JT4A 5F9FA 3UKDA 1E2FA 1G1MA 4GP7A 2XXAB 1BKDR 5HZHA 3K09A 4ZV4A 1RZ3A 4I1SA 4P3YA 1S4QA 4R2IA 3ZS9A 1XU4A 3EPHA 2JLVA 1DE0A 2FF7A 2D3WA 1CR4A 2QT0A 4YLGA 3EPJA 1FP7A 2V9PA 1KIMA 2W58A 2WZQA 2RGCA 3O8CA 4IFBA 3W3AA 2GJKA 2JJ1D 5JCZA 1NKTA 1KSJA 5KNDA 4M2LA 2VHUA 2IWRA 3U6KA 1PUJA 1GNPA 1BIFA 1G3RA 4PSAA 5FPYA 3GLFB 1N5LA 4MGKR 4UNSA 4FWTA 1YVDA 2BKEA 3WP1B 3NKVA 4EJSC 3U4QB 1DBSA 1ZC4A 1E9SA 4S35A 4JKYA 1E4YA 2BWJA 1E1RA 1YZTA 3W9YA 5DLQC 1W49A 2GK7A 4HI0E 4JL8A 4B47A 1J70A 4OYHA 4MRVA 3OIUA 1KO7A 1F6BA 3QE0A 3QKRB 1E2PA 4YONB 3AVPA 5HE8A 1WCV1 2P6UA 1WRBA 2ZU6A 4B2LA 4C3ZA 1OLOA 2NMVA 4FD2A 3BB1A 3LY5A 1RKBA 3KB2A 4Q9LA 4OHVA 1VCMA 1F3OA 3THYB 1NVWQ 3ICEA 2JATA 2BV3A 4L4UA 3WMGA 5EXSA 3G0HA 4A15A 3FYHA 1NIPA 1M2OB 4DCUA 2ZE5A 3B1ZA 1T0HB 3BWDD 1E9AA 1NLFA 5IK2D 2ZVPX 5SZHB 2ORWA 3FGNA 1S8FA 3OAAD 2X1VA 1JXOA 4MRSA 1VG0B 2ZJOA 2EW1A 2GCNA 2R65A 3LVRE 1WDTA 4HUQB 4KFSA 1KDPA 3LW7A 4M1MA 2DWQA 1UBEA 2R8RA 2C5LA 4WXPA 2ZSEA 2O8BA 1E2GA 3EG5A 2PEZA 1KDTA 1W0KA 4PANA 2FPKA 3X1WA 4E09A 5EQTA 1X8KA 2HF9A 3CX6A 4I1UA 1U81A 2Z4RA 4AWXA 1NMZA 1XEXB 1Z6GA 2O8DB 3QOFA 4K8OA 1QHIA 2W2XA 1GKIA 1LB1B 3BH0A 4Q21A 1OF1A 4Q9HA 4B2IA 2YV5A 5G41A 1U8AA 2VLIA 1GUAA 2ZSFA 1NJFA 1XD2A 4BLPA 2WPDD 2FOLA 5KU1A 1SHZA 3A58B 5JSZA 2ZITA 1YZNA 3NVAA 1BYIA 4EQ6B 1Q12A 2HXSA 2QBYB 1BS1A 2J46A 3CKLA 4MYTA 4B75A 4O2RA 3K9HA 2C99A 2IYRA 3K70B 5A0FA 1KK2A 1KI1A 3P26A 1F48A 3L8ZA 1YRBA 5DI3B 2PZEA 3MMPA 4QL3A 3ZDQA 1NSTA 1M6NA 3OIWA 1XZQA 2J0VA 5E7IA 2A7QA 4EPYA 4ACBA 4ZKEA 1CKEA 1KY3A 3B1VA 2IEYA 3QPVA 4DDWA 4AY2A 4XSGA 4RZ2A 2FG5A 2R9VA 5BWMA 4ZIRB 1VKJA 4LCBA 1EFCA 3NDPA 5IHPA 4M53A 1KYIA 5J47A 4GI7A 4NU0A 4GZLA 3FMIA 4GZMA 4K46A 1JAIA 1PV4A 2V1UA 3PV0A 4ABYA 1QZXA 2GCOA 4TL9A 1J8YF 2QP4A 1MV5A 5FTMA 3E5HA 5J4HA 1Q1EA 1EGAA 2AXNA 3B5JA 3M6AA 2P5SA 3H0KA 4KU4A 3VHLB 5BYJA 3LLUA 3WBKA 5CITA 1UF9A 4GL2A 4JYBA 4RD3A 5AJZA 3AQ4A 2FDCA 4WXRA 4ZCIA 4BASA 3GEEA 4NCIA 1ZJ6A 3W5JA 4OQMA 2WHXA 2QQEA 2RAPA 2D2EA 4YDSA 1Y63A 5EZ6B 4Q7LA 1UFQA 1ZNYA 2ZS9A 3PCRB 3RS5A 4KYUA 5A5GA 3LAWA 4TTRA 2GXSA 1N6RA 2Q6TA 3SYLA 3CX7A 1YR7A 2CCJA 1ZD1A 1G7CA 3SHWA 2QE7D 1I4LD 1QG4A 2HXYA 1NSFA 2P6NA 3LBHA 3PUXA 2ECKA 3W6PA 2G9NA 5J4LA 4HDOB 2G88A 2EFEB 1YZGA 4G01B 4DLZA 3D31A 3P4YA 5LB2A 5AUNB 3BFKA 1SVKA 5EZ5A 2WSMA 1YZQA 2ORIA 2YOGA 2B92A 4RY2A 1GNQA 1NIJA 1R10A 2ERYA 2REXB 2ZS7A 5KHOC 1ZRHA 2JJ8A 4IJMA 4P33A 1G6HA 5BYKA 2J0UA 3T1TA 2O8BB 4MUBA 2EFHB 4FMCB 3AKCA 2EU8A 3LLMA 2VF7A 1TEXA 2GAOA 4LDJA 2AK3A 1NMYA 3VTKA 3T35A 3DEFA 4QGGA 4JVMA 1CULC 3GFOA 2ZR7A 3R7WA 3CRMA 4TN1A 3GEHA 5FUXA 1L8QA 4TZ0A 3I8SA 2CHVA 2Q21A 1UEJA 3A6PC 4QNRA 4DSOA 4QRHA 4Z1MA 3QQ5A 1HUQA 1UADA 2F6RA 2MSCB 2VQSA 1T9HA 1XD2B 4PQRA 4DUGA 1YR9A 4NHOA 4ARZA 4W5JA 3AKDA 5JSZB 1EESA 5FUVA 3K8YA 2RHMA 2Z6VA 3HU1A 5G3ZA 3NDBB 2TMKA 1KKMA 1J7KA 1MRNA 1KO1A 4TMVA 1KZ7B 1JEEA 2BJVA 3OEHA 4P4TA 2CNWA 1PUIA 5J40A 1Z29A 4D2IA 3C16C 1D2MA 1OXVA 1ZUIA 4Q01A 2RKOA 3RABA 1H8HA 1RFLA 2WICA 4A1FA 4ILEA 4TSFD 1XTRA 2JA1A 4LYFA 2A78A 4QHTA 3T15A 3BD9A 2NZJA 2JLRA 5CJ2A 1X8LA 2R62A 1T3LA 2D06A 3ZLJA 2J87A 4KAXA 3K53A 2IYVA 4EPVA 3B7GA 3IDQA 5EE0A 1E2QA 1LVGA 2WOJA 4NYMQ 1TUEA 1W47A 2GXUA 2W2VA 3N2EA 3FFAA 2V8OA 3ZD6A 5KNCA 4BFTA 4DLXA 4IW3B 3IGFA 4MRNA 1TEVA 4UXJA 1FQKA 2ZYTX 1TQ4A 2GCOB 2IWHA 1HY3A 4RZ3A 1EXMA 4QKQA 3GEIA 4KCGA 4DCVA 4M1WA 4HAXA 1U2RA 2GETA 5SZJA 4OHYA 2QPAA 1M7BA 3F8TA 3KXLA 1GILA 1ODFA 4DLRA 4N1AA 4XWKA 1DVRA 2C78A 2J7PD 3CPHA 1P9WA 1SVIA 1RIFA 3LVQE 1GM5A 3QG5A 1P3JA 4AKGA 3MLEA 3QNUA 1CEEA 3OFNA 2QQ0A 2A5JA 1XMJA 2ZE8A 4IDHA 4PZLA 1XWIA 1OHHA 4ZDWA 1S9HA 4TTPA 4C0BA 3TSWA 1CRPA 1M7GA 5FL7D 1E2NA 3K0SA 4D4KA 2QP3A 3PEUA 3OF5A 3KXKA 1YQTA 1B0UA 3I72A 3RC8A 2JIZD 2OXCA 3QIAA 3ZH9B 2PLRA 2OXRA 5E7JA 5JWRA 3CNOA 3WHKA 3CB4A 2DWPA 1XXHE 1QVAA 4OI4A 5B2ZA 5KNBA 3Q85A 2YZ2A 1KK3A 4JYCA 4JBXA 3B1YA 1ZINA 3FMOB 4JVNA 1ZU5A 2FZLA 3H2YA 3ADCA 2PH1A 1OH5A 4WA7A 2JLQA 2XZOA 3DKPA 2UKDA 2J0UB 3SJAA 4F4CA 3CONA 4I81A 2IC5A 1WBDA 2GWHA 1IY0A 1FUUA 2OE2A 4KXFB 4TWZA 3KL4A 4JVSB 4C4PA 2F3RA 1Y3AA 3ASZA 2C9CA 3RDPA 3L0PA 2ZRGA 2IUSA 3I73A 1HEIA 3PG5A 1MKYA 3CR7A 3U3KA 1OKKA 4NYJQ 4B3GA 2XOKA 4X8LA 4OI0A 5EUMA 1T4GA 1JEDA 1XDBA 1OFHA 4ARZB 2C95A 3AEZA 5EE3A 3Q7PA 4WW0A 2BMEA 4TL6A 5LB4A 3IPYA 1G8PA 3T12A 1TX4B 2HLDD 3T61A 1V5WA 3OEED 1LS6A 3TUIC 1G64A 4ASUA 5P21A 4MDEA 2WWIA 2AWNA 2ZE6A 4LBZA 3MD0A 1FOEB 2O5VA 1BYUA 2F1HA 1X3SA 3HP1A 3CBQA 4WAUA 5KDLA 1OB5A 3MFYA 3DOFA 2AFIE 4A36A 1W46A 5JJLA 4XD7A 1D9XA 1KK1A 4EFNA 1AS0A 1N25A 4JZKA 1K6MA 5K8IA 2J5XA 3AH8A 3CZPA 2F55A 221PA 4JLDA 1HA3A 1XXHA 4PAOA 3TAHA 4KITB 3EPLA 2QMUA 2CHQA 1I2DA 1S0UA 2CL0X 2XEXA 4Q66C 4CIDA 3TR5A 1MT0A 3WXMA 3SJZA 5GJCA 2GESA 1QVRA 2FEMA 2G77B 3ZVRA 4M8NE 4FMBB 4GOXA 2N42A 1P4SA 2ZI5A 4LBWA 4Z54A 4X8HA 4DT1A 2QZ4A 1NBMD 4D4MA 2PMDA 4MKFA 2QM7A 4BLOA 5JZVA 5AJYA 3ICQB 3JZAA 2Q3FA 3AB3A 1C1YA 1MO5A 2ODWA 3QVUA 2CJWB 1ZUHA 2NG1A 1XD9A 2PZGA 1CLUA 2R6DA 5TB5A 4XTRA 2NGRA 5IDVA 4B48A 5EXXA 1W0JD 3I5XA 1U9IC 1SVOA 3AVWA 3GCGA 1F5NA 1GWNA 1TL7C 4GRAA 3QI2A 1JQLB 4A8JA 4Q9KA 5G3YA 5FBWB 3X1YA 1IXZA 4CEHB 4TYYA 2QP9X 2OLKA 4IFEA 3W34A 3BOSA 3LQQA 4ON9A 4DDUA 1HV8A 3BFXA 2ZRAA 4TL7A 2NO0A 2R6GA 2GXQA 2V55B 4A6PA 2CBZA 4D0LB 5AUOB 4MYHA 1Z6XA 4B76A 2VIIA 4HZIA 1ZD9A 4EPXA 1T0JB 4RD4A 5L8VA 1SVMA 1J90A 4JSTA 2WWYA 4Q9IA 3ZZTA 5JCPA 2W6JA 3C4JA 1RPZA 2YHSA 1VG9B 2WMOB 2V6IA 4DRZA 1R0ZA 3VNUA 2ZYWX 3SFZA 2O8CB 4PPGA 3FKSD 1LTQA 2G1JA 1OIWA 4HLCA 4DLTA 2F7SA 5F3WB 1Z5ZA 1ELOA 4XSHA 1SZPA 3SEAA 2ANBA 1NN1A 2RGNC 2GZAA 1D6JA 2ODBA 4AG5A 1LF0A 2BVNA 1GZSA 1Z47A 1LV7A 2O0KA 4M9ZA 2JJ2D 3THXB 4Q19A 3UIEA 4O0MA 2P5TB 1YZLA 2RCNA 1H8EA 1G8YA 4PTLA 1II9A 2HYDA 2P2LA 2V7QA 4FI3C 4A9AA 2OCPA 4FMDF 4DB4A 2PLFA 3TQFA 3JVUA 2KJQA 5GJWC 5LDDC 3SZRA 1X86B 3HYTA 4ZCMA 2ZXUA 2DBYA 2P3SA 3FFBA 3MWJA 4OL0A 4Q4AB 3A1VA 3SFVA 4A0RA 4AKHA 2FGKA 1A82A 5CLQA 3FHOA 5DIFA 3ZYCA 1K5GA 2RGXA 3CRQA 5EJEA 2NO6A 3NHAA 1NF3A 4C2TA 2R6FA 3RC3A 1FTSA 2AFHE 4C2UA 1E0AA 1US8A 2QENA 4TMTA 5FPSA 2IUUA 3AUYA 5BN4A 3N70A 4KVGA 2WSSD 2R6CA 4Q4LA 1D9ZA 4DKXA 4ZO4A 1D5CA 4XWOA 4RSGA 1WB9A 4HAZA 1XXHB 5TXGA 2ZROA 2WKRA 3ZIAD 3K1JA 2WWWA 2AHOA 2XSZA 2LKCA 5JWOA 3BORA 5JFGA 1KDOA 2P67A 4UXHA 3FMFA 1NJGA 1HTWA 2HV8A 4GNKA 3VX3A 3QXSA 1BOFA 1U94A 2FSHA 5GADl 1G5RA 3GJ4A 1YKSA 4AG6A 3WYFA 2ATXA 4DT1B 1N3BA 1F2TA 1Z0KA 2H1LA 4G0NA 1NNEA 4LHXA 1Q20A 4DZZA 2OHFA 4QNMA 3RYTC 4IOKA 3GP8A 3GJ7A 4HLDA 4TQUS 5GVSA 4U5XA 4CYMA 4I1OA 5HPYB 3REFA 2AKAB 2WKPA 4MGYR 1P5ZB 1RW4A 5ANRB 3Q8XB 4IHQA 1N5KA 3FHTA 1Q22A 4IDNA 3EASA 1W1WA 3PUZA 2F1RA 2ZRIA 3LA6A 2OV2A 4A8JB 2ZUCA 1DAIA 4AI6A 1L4YA 5LD2B 2QGNA 2YWHA 3RLFA 1NVVQ 4D6PA 2AKYA 3VQTA 2C98A 4RCZA 3T5DA 3THWA 4NCNA 4F4JA 2GDJA 5H68A 1IBRA 1U98A 5KPJA 1JI0A 3GLGA 5AJXA 1DELA 1K5DA 1UDXA 3KQKA 1WF3A 4HEJA 3R8FA 2F9MA 4JLMA 1XEWY 5M04A 3REGA 3I5YA 2QROA 5GJVC 3DO6A 4JBWA 4R2HA 1OXUA 4WVFA 3OHMA 4BQSA 4A2WA 2KWIA 5BW8A 5FPKA 3CRW1 1XJQA 5HE9A 1KO4A 1CR0A 1VG8A 1TQDA 3KDSE 5C1BA 3A4MA 1NI3A 3TVTA 1Q57A 4BUJA 3TQCA 1ZVQA 3WRYC 1EFTA 3PVSA 3H84A 3QBTA 1GDDA 3GLGE 3QF7A 1E1RD 2D62A 4PQFA 4GP6A 1KI3A 4US2R 4V03A 1XP8A 1T3HA 4DEYA 3UWOA 4HLUA 2WOOA 1Z22A 2J0QA 1G3QA 4BLSA 2ZYVX 1KI7A 1JR6A 4F4IA 4DDTA 2X8AA 4TLBA 1XJ0A 3RHFA 1R5NA 1XCPA 2GEDA 4DSTA 3A37A 2XJ9A 4F7WA 4EKDA 1W4AA 2J45A 1R4AA 1GAJA 4KODA 4M1TA 1KI8A 1AZSC 1W5TA 1US8B 3QY0A 5JLJA 2IW3A 1E0JA 2W83A 1RYHA 2QY9A 5HCNA 2I4IA 2ZRLA 1W44A 4GBMA 4O2LA 4DWJA 1GIAA 5TV2A 1E9BA 1XEFA 4U7DA 3BB4A 5KSYA 3K0AA 2WMNB 3OE7A 3BC1A 1SQ5A 3AF2A 1WQ1R 2ZSBA 1A2KC 4QJ5A 1GL9B 2ZUBA 4Q1AA 2YYZA 1KAOA 1OPXA 2CDNA 4PO9A 2XZPA 5F2EA 4QJ3A 5JEDA 1N6PA 3RSOA 1G41A 1HT2E 4LGMA 4TMKA 1ZCBA 1Z8FA 3ECCA 1F2TB 1W0KD 5JHHB 2VH5R 2Y8EA 2BM0A 3B82A 4Q4JA 3EIHA 3V4RA 2IEZA 2P0EA 1UBCA 4DEXA 1R5OA 2BCGY 3ADKA 3U3MA 2FE4A 4URWR 4C0JA 1Z0FA 1TAGA 3CM0A 4YMWA 3X1XA 3QKSA 2XZLA 1KGDA 2R6AA 4Q48A 5FOWA 3R9IA 3BE4A 4LHVA 1N5JA 2C2HA 3SYNA 4JVLA 2QMHA 4PZZA 1QHSA 4QBHA 5SZKB 1JALA 1KO5A 3B9QA 4DSUA 1XX6A 4PC3A 2ONJA 4V02A 4II7A 1M8PA 2Z43A 1ZM2A 3Q3JB 3SI7A 4QHSA 1II8A 4UNNA 4HSEA 4Q1FA 3EC2A 1OXTA 5TY0A 3N5CA 1T3SA 3H86A 3F0TA 2C96A 2ZTSA 3THWB 3SDZA 2E87A 3EIQA 2H16A 1XB2A 3TE6A 1ZNWA 2GNOA 1UKEA 1YR8A 4KSCA 4RKEA 1QHGA 1OYWA 2A5YB 4LJ8A 3NEYA 3TLXA 2KBEA 4LYHA 2PX3A 2HEIA 4M1YA 4ESHA 4GOKA 2WWXA 2OEPA 3U61B 3SJCA 2GJ9A 2ZRMA 4LPSA 5C2JB 4BFUA 2YNMA 1S1CA 2WJVA 3AF3A 4B32A 2BBTA 1DARA 8OHMA 3MSXA 2QNRA 1ZMXA 3KJGA 1J8MF 3DDCA 4LYJA 1KY2A 4DLUA 4LC1A 1XTIA 1AA9A 3LD9A 2WAXA 4NONA 3VHXA 3T1VA 1RYFA 1OFIA 4F92B 1DAMA 1DAFA 2H92A 3BJIC 5KSOA 3AM1A 3R9WA 1UDWA 4LV8B 2ZRCA 4A92A 2VSFA 2WVJA 1RRFA 5IK2A 2O0JA 4ITRC 3AP3A 3OAAA 1R0WA 5CM8B 2QMEA 3BFVA 2WJIA 3U7FB 2ZQ5A 1Q44A 1E79D 3DMDA 4RD6A 1UKZA 3NBXX 3EXAA 4Q7KA 2FFHA 1NVUQ 2QTFA 2NPIA 2Q3HA 2ZE7A 2QM8A 5J4VA 4JJKA 2R44A 3AKYA 3D6TB 3KKOA 1P60A 3L8YA 2GBLA 2WJHA 3W90A 2A2ZA 3QPWA 2OSBA 3HU3A 5JMTA 1CJUC 2JLZA 4AKIA 2CL6X 1I4DD 4NL4H 4PQYA 2XB4A 1OB2A 1WBBA 3X1DA 5EUQB 1VCNA 2YVUA 4PHGA 4NBSA 1RRPA 1LY1A 3MWYW 3AF1A 1E2LA 3UMFA 2ZJYA 4BFZA 3CRVA 1II0A 1BMFD 2ERXA 4M21A 3SQWA 1N5IA 1IQPA 3SBDA 3CH5A 5DE3A 1CF4A 5L3SA 4MQBA 4HB3A 3K0AB 3U5ZB 3WHLA 3EARA 1HE1C 3I32A 1XTQA 1P2VA 4ESVA 4RVCA 3F5FA 1E9EA 2ZAMA 1OSNA 1OJLA 3C41J 1G21E 4I99A 2OO7A 4IEEA 1KNQA 2IL1A 1TF2A 4LHWA 5FBRB 4QM7A 821PA 3PR1A 5IRCD 3O8RA 5FFMA 4D0NA 2VBCA 1PLKA 1DS6A 2REBA 4Q4JB 2IF2A 4M1OA 2B8TA 1R5BA 3MWKA 3NIBA 2A5DA 4PSVA 4EIWA 5DYIA 4J0QA 2OAQ1 3GMTA 2DPXA 4LJ7A 3FKQA 1YR6A 3DMNA 2O8FA 4R9UC 1CR1A 4DLSA 3BXZA 1KDRA 1VECA 3B2EA 5BN3A 5FUWA 4Z1MD 1VCIA 1FMJA 1XTSA 3KKMA 3K0EA 4NPHA 4PPFA 4C9BA 3GLGB 4JT2A 4QM6A 1VYTA 4IXMA 1R2QA 1GP2A 4L8GA 1ZUNB 4LI0A 4M4SA 4EPTA 4DLVA 1VPLA 1JR3E 2A5FA 4JLOA 1II8B 1JJ7A 1R8QA 1E2JA 2ZVQX 3FTQA 2FFAA 4LY6A 2EYQA 2KB0A 5J5CA 5DN6D 4URUR 2QTHA 2CNWD 1IN8A 3FMPB 4TQAA 5EP4A 1HH4A 1NKSA 4P31A 1HT1E 1GRNA 3SE0A 2YOFA 3HWSA 3VR2A 1Q1QA 2JDID 3IQWA 4DLYA 5E95A 2RGEA 4AKEA 4MRPA 2ZSDA 4LWZA 3VX4A 2BJWA 5KSPA 3WNBA 4NCJA 4TMWA 2ZJ2A 1PLJA 2EWVA 5FTKA 3TW8B 5IF9A 2AK2A 2K5UA 3ADBA 4B74A 1N6HA 2RGAA 3UMSA 5EP3A 1VCOA 1NN0A 1S3SA 1XEWX 3OESA 1R0XA 3EC1A 4OHWA 5FL3A 2G83A 2ZRPA 1EFUA 1NN3A 1AN0A 3U3JA 4YQFA 1TUIA 1XTKA 2J7KA 4P0TA 1L4UA 2QE7A 3IQXA 2VP0A 2JLXA 4E22A 1JJVA 1P7CA 4DJTA 2XNDA 5TARA 1NMXA 1LF5A 4LX0A 5BN5A 4RCYA 4AK9A 2V54A 1Z0DA 4TLEA 4S2EA 3L2OB 1E9CA 4MUAA 1Z08A 4Q1EA 4UNRA 5KOYA 1TU3A 2ZRJA 4CT5A 2VP9A 4D4JA 1CU1A 5EP2A 5AUQA 5DHFA 4NE2A 3OFND 4LBVA 1Z2AA 3HR7A 3PEWA 4AD8A 1SKYE 3UPUA 1WXQA 2VP5A 2QL6A 1P2SA 4IOJA 2OLJA 1P61B 4PHTA 5D3MA 2GCPA 1HQCA 1JR3A 3W8RA 2V3CC 2VSOA 4Q5IA 521PA 1Z6TA 3V00A 5HKKD 4UQOA 2BEKA 1QHHA 3CWZA 1G5PA 721PA 3A1WA 5L3SB 1Z83A 2RHDA 3RSLA 4YMVA 2YWEA 1N0WA 4HB4A 3CPJB 2VL7A 2ZYUX 1M74A 2F1JA 3HYRA 1MOZA 3N2IA 4U00A 1G8FA 3CNLA 1A7JA 1X1RA 3U60B 1C4OA 3TK1A 4QC2A 4TYPA 4EPWA 2BKUA 3AP1A 1CS4C 1P2TA 3IILA 2F43A 3LXRA 1GRRA 4NYMR 1AQUA 3BIFA 1FNMA 4NP6A 2ASEA 2UVQA 4KFRA 3UXMA 1N0UA 4L16A 2GAAA 1OFUX 3EW9A 2ZI6A 3BRWD 4HAYA 2QUZA 3BH6A 4TYQA 4HLQB 2A3RA 3KJHA 1G16A 4MKGA 4TMXA 3TR0A 1SKQA 2CXXA 2O8FB 3NBFA 2AD5A 3DM5A 3MJHA 4KLZA 1OKKD 2KE5A 2W2TA 1PLLA 3GPLA 2GEVA 1A4RA 2W6IA 2BMDA 3GFTA 4G3XA 2QRZA 1E1QD 5H8WA 3OIVA 2GTPA 1R8SA 2WWGA 2GRJA 4B2PA 1G3UA 2QG6A 5E3HA 3RWOA 2OCAA 2PEYA 2BHRA 2GKSA 4C7OA 1MO3A 1YJ5A 2FWRA 2IYUA 4JL5A 4L9WA 4ASUD 2HCBA 2ZJAA 1NRJB 2VTKA 2GF0A 2Q9BA 4A0GA 2AWOA 4N3NA 1RVDA 2QT1A 6Q21A 4XIGS 4G5OA 3TAUA 3TNFA 3R7WB 3G82C 3GJ5A 4D4LA 3BB3A 3B85A 3HPQA 5JWHA 2GJAA 2AD1A 3AVQA 2EFDB 4XD7D 1G7RA 2GA8A 1OT3A 4CW7A 1XMVA 1DAGA 2V1XA 2PL3A 4EAQA 4JKIA 3KQHA 3U3OA 1NG9A 2BM1A 2GK6A 2ZS8A 2C04A 4HAWA 3WYGA 1FZQA 1U0HC 4JSYA 2XJ4A 4HUTA 1E4VA 3X1ZA 4KBFA 5C4GB 1VIAA 4QBGB 2CCKA 2RGDA 1ZP6A 3P27A 4D25A 1E2IA 2JIZA 2IS6A 1ZD8A 1QHNA 3VR3A 2RGBA 3NH6A 1E98A 2JCSA 4CT4B 3U7HB 4XH9B 1N0VC 3DL0A 2QU8A 1KKLA 2PX0A 3CNNA 3LXXA 4LJAA 4Q7JB 1RRGA 4NYJR 1E2KA 3BK7A 4YMSA 3UANA 1CJVC 2C03A 2HDNB 3AGQA 1W36B 4OHXA 4LPKA 3A1TA 4B3DA 4DB2A 3CZQA 4Q1CA 1NBME 1KSHA 2OCBA 2V4ZA 3I4LA 1GSIA 3O8DA 2IYXA 2BEJA 4Z8YA 5D3MB 2WWHA 2LWIA 1EX7A 5BQ5A 2ZR0A 5DGXA 1EWRA 3I1FA 1XCGB 1DEKA 2A5GA 4NCKA 3RS0A 3I8XA 4QGAA 4HATA 2C9OA 1SXJD 2QRNA 4WIAA 5DHAA 1ANKA 3F3YA 1Z6YA 1I2MA 1Z3IX 3U44A 1COWA 1VIYA 2CE7A 4OQLA 2HLDA 4OQFA 4A8JC 4TT3D 4AURA 5JBQA 5G40A 3HJNA 4AYTA 3RRYA 4OJQA 3Q5EA 5LD2C 1MH1A 1U90A 2F43B 1KAGA 2UZIR 1GOTA 2W6JD 3IEUA 4OKSA 5SZIA 2IS4A 1HURA 3B9PA 2KI5A 4Q7MB 1SXJC 3QF4A 4DCSA 2OFXA 2ZI9A 4QG7A 4O3MA 1IN7A 5EE1A 2WTUA 4I1VA 2DWOA 5HTKA 3DOEA 5JJIA 4Q00A 2FJUA 1NLZA 1S96A 5JJKA 4XTCS 2F9LA 2OILA 2ZAOA 4JLPA 1H8ED 3AVXA 2NO1A 2WIAA 1T5IA 3KTAA 1XZPA 2YJTD 1J99A 3EZ7A 4PXAA 4YXWA 1LFDB 1ZM9A 2CMKA 4C7OB 3IKJA 1HYQA 2FFQA 2GF9A 3GLFE 4V0NA 2X2FA 4OI2A 3UATA 1OE0A 1UJ2A 1OH6A 3DHWC 4TYWA 1IN6A 4PHHA 3FOZA 1NBMA 1SKYB 1Z0IA 1M34E 2B7BA 4OK3A 1W5SA 2XTZA 1U9IA 1EFRD 2NO9A 2WV9A 2NOAA 4BE7B 1Q0UA 2IYYA 2OT3B 4GMDA 1YHNA 2G3YA 1VHTA 2E1RA 3CH4B 3NEJA 4BLRA 3SQXA 2WJGA 4HAVA 2AL7A 4P4SA 2PCLA 1W4BA 4BLTA 3M1IA 2J9RA 4M1SA 3T34A 5JEEA 4LHZA 2XSZD 2D74A 3GJ3A 3QXHA 4TLAA 4GPTA 2WKQA 2QMOA 4OBEA 5DISB 121PA 4FCVA 4HDCA 3P32A 3QKTA 3B6EA 3D8BA 1ZM7A 4NKRA 1KZGB 5CM9C 3B1XA 2ORVA 1OH7A 1AZTA 1P75A 4BFWA 3LO5A 1AQYA 1TNDA 1G17A 3MAAC 2RGNA 1G9XA 4CZ2A 3VR4A 3KQUA 4L5BA 2GEUA 3WMEA 1I4TD 1XFAA 1ZC3A 3CR8A 1KMHA 1ZCAA 2R2AA 3JZMA 1Z06A 3FKSA 4M9SA 3RRZA 3T06B 3K0CC 1P73A 5AJWA 4MRRA 1OYYA 2VP2A 3GLFA 4UXIA 1VYVA 2JJ2A 3MG9A 4OJKA 4MITA 3U4QA 1M1YE 4BWYA 4A4DA 4HYYA 3BAFA 5JRZA 4QBIA 4DSNA 3B78A 3U44B 1VG1A 3GLIE 2A9KA 2I3BA 3AGPA 1U0LA 2BIFA 4EDHA 2WAYA 4TMZA 3CF0A 2CLCX 1QBKC 4A82A 3AVVA 2OFOA 4NYIQ 2AXPA 3GLHE 3NBZC 2DR3A 2I1QA 2VRWA 1IONA 2FGJA 2GVDC 2BCJQ 1NY5A 2IYTA 3QF4B 1YE8A 5FTJA 2GXAA 2W0SA 2EFGA 4PC7A 1RRCA 3AUXA 2BMJA 4IOMA 5B64A 1ZIPA 3FPAA 1IOZA 2IX3A 2XGJA 3A1SA 3CWQA 2QEQA 3WRXC 5F98A 3QBVA 3THYA 3LBIA 2IF0A 3IIJA 3CX8A 4G5RA 3K70D 3ZVMA 2OCYC 5CJPA 2FSGA 1AKEA 4CRWB 1E3MA 2NIPA 2NPFA 1CJTC 1P62B 3ZIAA 4CDGA 2VHJA 2IYZA 3FHCB 1EX6A 1DO2A 3KTAB 4C0HA 3EA5A 3NG1A 1NLYA 3VU9A 2FN4A 2C77A 2ZIAA 2OG2A 5TDHA 5KO2A 3ZGXA 1O87A 3E70C 4XVRA 5EE5B 3K70C 1GRQA 2CK3A 3CRRA 4LJ6A 5JS8A 3TVDA 1JXMA 2FPLA 1TU4A 1AGPA 1XPRA 4PO8A 1IXRC 4DDVA 3SBEA 3NC1C 3RS3A 1GG2A 2VP4A 3ONWA 3K09C 5K8UA 3VNVA 2CLDX 5DO9A 1G8GA 4QOSA 1T6NA 1IN4A 2CCGA 2QAGA 5FBLB 2QAJA 5FUYA 3QENA 2IA5A 1W4RA 4FCWA 2FMXA 5FPHA 3PXGA 2Q9CA 1S1MA 3MRSA 5EP1A 1N2CE 4IDPA 3OE7D 1XPUA 4B3XA 2ATVA 4IVQA 2JEOA 3C5CA 2RB4A 1SGWA 4P4SB 5KUTA 4A6XA 3TGPA 1A5TA 3P1JA 3K9NA 3GLIA 2EQBA 3MCAA 2OBLA 5KPDA 1CR2A 4G1UC 1KSGA 3WYAA 4FWIB 4JLJA 4V0ME 2HYIC 2OFWA 2FA9A 3GLHA 2CEAA 4JIMA 1DO0A 3QXCA 4GT1A 2G1KA 4Y0AA 2IT1A 3KX2A 3D3QA 4JL6A 4XJXA 5DH9A 2GVZC 2LKDA 1XMSA 2D2FA 4LV6A 1G20E 3UK6A 3CIOA 2GJ8A 2FU5C 4PHFA 4V0OA 4PFSA 2YINC 5UKDA 4QXAA 3TMKA 3AF0A 4AC9A 1ETUA 4DBLC 1Q1ZA 2HJVA 2BC9A 1HQYE 3IO3A 4JLVA 5H1YA 4XVUA 2YKGA 1H65A 4BECA 2RGGA 1KMHB 3FE2A 4FW9A 2FV8A 4DC9A 3M4YA 2ANCA 1T5LA 2QI9C 3HDTA 4IVPA 4ERNA 4ZIRA 3GJ0A 4HB2A 1IHUA 1N6OA 4MKHA 4KSBA 3SN6A 2H18A 1XPOA 3L0OA 1CRQA 2PJRA 2ZI7A 3V4FA 3S1AA 1YU9A 4QJ4A 1ESMA 2PJZA 1KI6A 4MKIA 3IHWA 4JS0A 3J81k 4R71A 3KKPA 1SHKA 1ZU4A 3EZ6A 4OHZA 2ZI4A 4UNQA 1JPNA 3VFDA 1SVWA 4V0LA 1CIPA 3TIFA 5JI2E 3AVTA 4BZPA 5J4YA 2ZRDA 4X8OA 3GQBA 4B44A 4EJSA 1G18A 3ZQ6A 4YMUA 2E9SA 3I62A 4PZYA 4FIDA 5CK4A 1R0YA 1D2EA 1E94E 4Q03A 4L9SA 4BEJA 3KQNA 2VPPA 3MWLA 5TMPA 2JJ1A 5CYOA 1PVOA 5B57C 5HR5A 3IHLA 5AUPB 4UJ5A 1MABA 3R8CA 2B21A 2Z4SA 4YC7A 5G53C 1CP2A 3QEJA 4F91B 3H1TA 4GSYA 4G5GA 1TF5A 2L0XA 4V0MA 4FCTA 1ONBA 3SC3A 2XTNA 1UKYA 1XJCA 2CL7X 1ZYUA 1HE8B 3VAAA 1UAAA 4MGZR 2V6JA 2XB2A 1FFHA 3VU9B 1N6KA 1U8ZA 2NO7A 2VF8A 4PO1A 2RH5A 3KKNA 3LQRA 2F3TA 3HR8A 1PJRA 4Q1DA 1GFIA 1TADA 3VR1A 4RZUA 1B23P 2ZRNA 2ZPTX 4IEIA 4DHEA 4PC6A 2FPMA 3PENA 3ADDA 2VHQA 3CO5A 3OZXA 5L3VA 3QUSA 2BBOA 4A2QA 1KK0A 2QAGB 1NVXQ 2G0NA 3EIEA 3L0SA 5DI9A 5E7MA 4PC2A 3NHBA 5ELXA 2OM2A 1QHYA 4LUCA 2GBLC 3SNHA 2REOA 3LDAA 2IXFA 4URXR 2EVWX 2OBMA 1W7AA 4JLKA 3IBYA 4TTQA 2RMKA 3GLIB 3KB1A 4OQNA 1AIPA 1CTQA 2MMGA 1JPJA 4H1UA 1NL3A 2X77A 3GLHB 1KSFX 1OW3B 4IVRA 4P32A 3PITA 1E0SA 3PUWA 3SS8A 4EUNA 4KI0A 1VDZA 1CJMA 2PT7A 1DTSA 1P9RA 2VHTA 2ZJ8A 4FMCF 4W9MC 3C5HA 2ZETA 3AV0B 1P2UA 3ETLA 2H57A 2SHKA 4I4LA 3LBNA 3NC0C 5EXPA 2J1LA 2DCUA 1XBTA 4Q18A 1DAHA 3R20A 4B71A 2X19A 2IYLD 2WJJA 2WPDA 4IXNA 4UNPA 2OUKA 2GHIA 2EFCB 4Q47A 1G291 2ZI3A 3EA0A 3U7EB 5D3QA 4JBYA 3PUVA 4B6FA 2N46A 4IKEA 5GJBA 5GVRA 1G4AE 3OIYA 2OZEA 4H9GA 1A1VA 4WZAE 3AKEA 4P4UA 5C46F 4JLBA 4U02A 1P72A 2PBRA 3S1AB 4MYCA 5EE9A 1KI6B 2YC4C 1NG1A 1SVLA 3O8BA 4M0LA 4XOIA 1LNZA 3B13B 4Q9JA 4BZQA 3ZQJA 4UJ3A 1KI9A 1E79A 3W3ZB 5TVKA 2QGZA 3AF4A 2GJSA 3QKSB 4A0FA 3I61A 2CLSA 4EJSB 2DYKA 5CYPA 1RC8A 4GMXA 1AJEA 2ZUDA 4KO8A 3TH5A 2ZR9A 3LW8A 4RFSA 4DUGD 4ZDJA 3WMFA 4WZ6A 3QXXA 4QGHA 1W2GA 3O47A 3UWKA 1UBFA 1MABB 4LJ5A 4BFXA 2PT5A 1AS2A 2VYFA 3KXIA 2NTYC 5JHGB 4NDZA 1E2MA 1FNNA 1MO4A 3D7MA 4JMPA 3Q5DA 3WNCA 3OEHD 4R98A 5KDDA 4LC0A 2ZJBA 3T1QA 1BMFA 3QKUA 4DIEA 2XNDD 5HCIA 1H8HD 5FOVA 4N0DA 4AYXA 1IY1A 2O8EA 3KKQA 5FR1A 1V43A 2OAP1 2B8WA 4PAQA 4NCHA 3U3RA 1G3MA 3BH7A 1G6OA 1QF9A 1JQJC 4MGIR 1W36D 1PZNA 3A36A 3C8UA 4LZZA 3KUCA 2VEDA 1FX0A 1E6CA 4DLWA 2B7CA 2F1IA 5DYGA 1J2JA 3KJEA 5EXTA 1OXSC 1KO8A 2G0TA 3EZ9A 3M0EA 4OK5A 1DPFA 1JR3D 3ZVNA 2VA8A 1G8HA 1OFTA 2KSQA 2XITA 3CF6R 3FDIA 3SJBA 2XNSA 4IRUB 1XCMA 3W6OA 3ZVLA 3TUZC 1W36C 3H4MA 2I1VB 4A0HA 2IXGA 1YRAA 3IEVA 5FBVB 4Y0VA 1KHTA 4RD2A 1ZW6A 3TKLA 3VKHA 4B3CA 1U99A 1FPMA 3QJYA 3PJRA 1LW7A 3TSOA 1UBGA 4RKFA 4GOJA 1CJKC 3UG6A 4DCNA 1FUKA 3ND8A 5DN6A 2GILA 1E2HA 1GTVA 1MO6A 1GNRA 1MR3F 4FXPA 1Z63A 4HAUA 4ACAA 1XD8A 3B60A 5HZKA 2AX4A 2ZANA 1OHHD 2PCJA 4ZCLA 4B43A 2PMKA 5JI3E 3ZD7A 2JDIA 3PEVA 4OK6A 2JLYA 621PA 5KSZA 2X2EA 3EWSA 1LS1A 1E9RA 3RWMB 4LRWA 1N6IA 2CVFA 4LV5B 3BGWA 1S3GA 1SVSA 1NP6A 4IOLA 3SU8A 5C4MA 3TW4A 3PUYA 3QEOA 4JLNA 3L43A 2W6ID 4HB0A 4TLCA 1KI2A 2J41A 1YZUA 4X8MA 4G5QA 3K9GA 3P20A 3LRPA 3TRFA 1Z07A 2QA5A 4NH0A 1DOAA 1JB1A 1KMQA 2JLSA 1FMLA 1JAHA 3LNCA 3IIMA 4DXAA 1XTJA 1OV4A 3KFVA 1KJZA 2FX3A 4NTZA 1Q3TA 4TSFA 5K8LA 3ND9A 3ASYA 2IHYA 1E32A 1ZBDA 4US1R 1W48A 3CF2A 1GKYA 1ZAKA 2C9YA 2ZRFA 2CJWA 2XOKD 1T8TA 2PZFA 4BLQA 3KZ1E 4LSGA 4QFMA 4M9XA 1Z0JA 4RFSB 1N6LA 2CVHA 4C0KA 1FL9A 1G4UR 3LH5A 1L7VC 1SULA 4KJZA 4QBFA 4RZXA 4W5WA 1GL6A 3QPUA 2H7VA 2YC2C 4TLDA 4B73A 1E9FA 2GZHA 4L15A 5FR2A 3V9PA 1OIXA 4B35A 2HCJB 2QORA 1IM2A 1RE0A 3WP0A 1KNXA 2HT6A 2HF8A 4MDFA 2ZU0C 3RVBA 4E07A 5HKKA 4B6EA 4CEHA 3W8NA 4LJ4A 3QSYA 4CGZA 4BPBA 1G7TA 1E9DA 1C9KA 2QSYA 5AR1A 1KJYA 3WY9A 2WJYA 4LOAA 3AVUA 5F9HA 3PEYA 4UKDA 4DIDA 4CF7A 2IS2A 2O8EB 1VTKA 2J7PA 3GJXC 4Q1BA 5CIQA 3Q9LA 1A2BA 1E0KA 4V0KA 2FSIA 1OIVA 4PR0A 4KFUA 1AM4D 2H17A 4M1KA 5A4JA 2H5EA 3IIKA 1G19A 2IXEA 2IYSA 1FX0B 1T8UA 4C0AC 1Z6AA 1IJFA 4LYAA 3RS7A 4DCTA 5LPNA 2O8CA 2OESA 3FVQA 2WBLC 2XX3A 3QVVA 5FL7A 3C15C 1JECA 5FOXA 3TBKA 2Q3MA 4KLNA 5L3RA 4RJLA 4CEIA 3QXJA 3BBPA 2YOHA 5IT5A 3SOPA 1JBKA 1Z0AA 2Z83A 1YZKA 2ONKA 4KVAA 4E5UA 1N6NA 3THXA 2QN6A 3JVVA 4PPQA 2D7DA 1ZNXA 5JS7A 2YWFA 1E1QA 4KV9A 3RRNA 1FP6A 4FINA 4RD0A 5KYKA 1COWD 1D2NA 2MSDB 5JRJA 1Q21A 3IBGA 2QSZA 4C0LA 5K8TA 3EAQA 3U6BA 2BBWA 3NBYC 2JLWA 4A2PA 5DSZA 4G5SA 3TUJC 2DB3A 1RJ9A 2W0MA 4TL8A 4Q4AA 1SXJE 2DFLA 3DZDA 1WE2A 3GFPA 3NXSA 5CDFE 3MJRA 2AR7A 4LK2A 4PSKA 1EG7A 3GJ8A 4K81B 2O0HA 2ZJZA 3E2IA 3HPRA 5FBQB 3RS2A 5FH9A 3AVYA 4WOPA 2ZRKA 3EPKA 1QHHB 2HJGA 1W2HA 2Z5FA 4MYUA 3LX5A 4YDHB 2DFNA 3DPUA 3CLVA 3SHFA 2DFTA 4KHZA 3TJZA 5FOTA 3KQLA 3LWNA 5FTNA 3BERA 3CUEF 4URVR 3A4NA 4QGFA 3R9XA 3SYKA 4D0GA 4YMTA 2GZDA 3RAPR 4YXWD 2ODEA 3OEEA 2N1BA 3A8TA 4LHYA 5FI1B 3NH9A 1E2DA 3IO5A 3Q7QA 1EFHA 4POAA 4OQXA 3DVLA 1DG3A 421PA 2VO1A 2BBSA 3AVOA 3CPEA 3I92A 2NQ2C 2VHCA 3PIRA 4MA4A 5B30A 4IDOA 3FB4A 1ZM3A 1F2UA 4HZUA 1FQJA 3ZZ0A 4TYNA 1IY2A 2JAQA 3EZ2A 1VHLA 3K0FA 5FI0B 3MUFA 5L3QA 1XF9A 1ESNA 5BXQC 2MSEB 4W7SA 4C0QC 2B6HA 2ZREA 2DFKB 4MH0R 4BFVA 4DVGA 2J0SA 5KTYA 3CW2A 5DNYB 4PPNA 2QTVB 4PAMA 2V7QD 1TTTA 2UZ3A 4W5HA 2NZ8A 1NY6A 5JECA 3GJ6A 3B8HA 2JLUA 5FPTA 1T91A 2Q0HA 4IDQA 2ZSAA 4Q4HA 4XVQA 1UPTA 1X1SA 3UG7A 1O3YA 1VYUA 4OI1A 2FH5B 1SXJA 1QHXA 5CDFA 3UMRA 1TQ6A 5AJVB 3I3SR 1KTVA 1P6XA 5AWFC 1CBUA 3ZS8A 4EFMA 3ZJYA 4R7ZA 4KBGA 3FWYA 1TPZA 1IJEA 4JLAA 1GL7A 3VKWA 3VKGA 4NMMA 1AKYA 2ODNA 4TT3A 4XWAA 4BZXA 3KFXA 2HUPA 3MGCA 3ZZUA 3E1SA 2YWGA 1W0JA 1XNJA 2CHGA 2J3EA 1E99A 3RS4A 4RD1A 1OH8A 1FTNA 4PC1A 5FTLA 4PX9A 3THOA 2BOVA 4BRUA 1BO6A 5AK0A 1GITA 2P65A 5CB6A 4KFTA 2FFBA 2DY1A 5CIWA 5KDOA 4CEJA 1E96A 4CEIB 4Q02A 3AP2A 4EPRA 3VR5A 3B1WA 2LCFA 3L0IB 1AS3A 1E2EA 2A30A 2FSFA 2ZJ5A 4D80A 2G6BA 1D8TA 3A4LA 1R6BX 3K9LA 4JJZA 3WNDA 4URZR 3EWAA
chains in the Genus database with same CATH superfamily
5BQFA 2NP7A 4EW1A 1NP7A 2D3TA 4BLVA 3ES9A 4PYQA 3Q72A 4URYR 1AK2A 3RU3A 1Y7LA 3TZBA 1T5SA 2J07A 5FWXB 2P9EA 4ZJUA 3QG1A 3PWZA 2YHBA 4OJTA 5ED0A 3VVCA 1P2FA 2WJ6A 3RRMA 1JZQA 3PFIA 1U9JA 5HIIA 1IXSB 1ZY2A 3G5UA 3GAZA 1EWQA 1Y1RA 2EYUA 3OQJA 2IOFK 1CY0A 4GX2A 4QU5A 2DHRA 4YJ2B 1BJTA 1WP4A 1GVNB 1QK3A 1PGQA 1XYVA 1UK8A 2PKQP 1EUDB 3SZGA 4BUCA 3ANLA 4FW8A 2AE1A 3IA2A 4PS1A 1JNYA 3NGXA 1ZGHA 3FI0A 4B34A 1EK0A 4CKZA 1VJ0A 1J33A 4QT4A 4I9UA 1AKQA 2IHZA 4UUAA 4YDRA 3DOUA 1K5HA 2ZYHA 4Z51A 3R9XB 4PX3A 2JC3A 1KOFA 4N3AA 1YQDA 1BX0A 3MWFA 1KJQA 3LPCA 1O96B 2FKNA 3I1YA 4D8YA 3TIIA 3IUQA 4L27A 4UE3S 3MMXA 4R8MA 5G4LA 4CLRA 3QM1A 3QKRA 5EY5B 2QRKA 3FWNA 1GKUB 3LHDA 1OA1A 1C3OA 1Q11A 4AM8A 3HVKA 4L4YA 1X6VA 4AF8A 1QRAA 1IN5A 1HXHA 1F2UB 3BTUA 4HZUB 4KO4S 5EZYA 3AUFA 1DAEA 2JASA 4RY9A 3UF0A 1WOYA 2VDPB 4KYIB 4BO9A 2WIBA 4J0GA 4LRYA 4RGQA 2WSSA 2C92A 4HEA6 1Y6QA 2EWWA 4RFVA 5LZ8A 4E2YA 1GDTA 2AN9A 3ZHBA 4AIIA 1DL5A 1QDEA 1F38A 1NHGA 1I5RA 2DFPA 2WD7A 3DR5A 3M6VA 1AHHA 3R3VA 4H1VA 3RUCA 2DSTA 4FR5A 4FN5A 4REOA 4HWPA 4C30A 5FV4A 4JX8A 3ONNA 1U5BA 3DM9B 1NMQA 1GUZA 1NNSA 2ZWPA 1ZM4A 4Y6SA 1K6JA 5FOUA 2J59A 4BFLA 5BWBA 1FXWF 2QAGC 3K20A 1F60A 1O94D 2XCUA 4FDVA 3SR3A 1CR6A 2BMFA 5C1PA 4PGAA 2PPVA 3F6SA 2C8VA 3PL5A 3PQCA 3RC2A 4EB3A 1SXJB 1KP9A 1IZ7A 2GZ2A 1M6YA 2D5IA 2FNAA 2D5CA 2FUG1 3TM5A 2JD1A 3GHHA 2I9PA 4PR3A 2ZYSA 4HLUC 4KIJA 4A0SA 5JQWA 2ZRHA 2V0CA 3IAHA 3EZFA 3N9IA 1O94C 4DWWA 1W4CA 3CKKA 2J9FA 4C0SA 4O5AA 5A5DA 1DG1G 2VFAA 4KXYA 3FW1A 3H5NA 1MXFA 3DT6A 1KERA 1QLHA 3C14C 4NFYA 5BVHB 2FP4B 5CDYA 1EYZA 2OBNA 1OXXK 4D9NA 2BFAA 2NM0A 3A9TA 4ZPXA 1ZN9A 5LVAA 2I4OA 3QWHA 3KJIA 4EQ6A 4LXHA 3SZLA 3ZWPA 2W00A 3HN6A 4WUVA 4DJ5X 2DJ5A 5JAIA 2XTMA 2QBYA 4UD2A 3KEFA 1M9NA 4RADA 3L8HA 1P39A 3FPSA 4ENRA 2R79A 1ND5A 1G8MA 5NULA 1B6SA 1OWPA 2GLTA 5CT9A 5F35A 4B5LA 2ODPA 3WNZA 2DAPA 1N36B 1V16A 4WTOA 2OFFA 1GY8A 3G88A 4P5PA 4J3FA 3H19A 2XXAB 1BW9B 1VE1A 4K9SA 5G0UA 3W06A 2ZKIA 1KEPA 1L3IA 1QG0A 1QIMA 1I0LA 1S4QA 3OZBA 4I1SA 4R2IA 5I8ZA 3R5JA 3TQHA 4TV9F 4E6EA 4EOGA 1ADJA 5IXJA 1AKVA 2DLNA 4CJXA 2VOJA 5ALIA 1E1KA 2BZ1A 4Y0NA 1DTEA 2V59A 4IQ8A 3O8CA 3KB6A 3W3AA 2JJ1D 3UJ9A 1XJWA 4NV1A 1JVSA 1CZUA 1O0SA 1KSJA 2R8ZA 3OI7A 3TB6A 4Q3CA 5ALFA 2Q46A 4WY2A 1U8TA 1F9AA 1QDUA 4PSAA 3GLFB 2XR1A 3QOYA 3VC2A 1YVDA 3WP1B 4LSZA 1JIUA 2JIRA 4EJSC 5B7QA 1TCBA 4RAOA 1ZC4A 1ZA2A 4F4FA 5COBA 3E2PA 2WTMA 2YUTA 4LI3X 4UBNA 3DGFC 1ZJWA 3D6HA 1M34B 4RPJA 2ICAA 1UZUA 1E1RA 3W9YA 4YMHA 1W49A 3S27A 3GB9A 3UMCA 4HI0E 4B47A 4C4SA 1CV2A 3E1GA 4HWRA 1VBNA 4EZBA 1L6RA 4BP1A 3Q3GE 4PZDA 2HRDA 1F6BA 3B6ZA 5HDQA 2XV1A 3V8BA 1JG1A 1QRUA 5HE8A 3H2SA 2VAXA 4BQRA 4CXMA 4JELA 1DC4A 2ZU6A 2C2YA 3HJBA 3NYWA 5DMXA 3PT9A 1M76A 1QH0A 1FTYA 2ZBFA 2R48A 3AINA 3LY5A 4OHVA 5CB4B 3FYSA 4O1HA 1NPYA 4L4UA 1QGED 1Y1QA 4QEZA 5E38A 5C31A 3RNOA 1NIPA 3B1ZA 1T0HB 3GC6A 3BWDD 3MGKA 3CUTA 2QTZA 1YB1A 5SZHB 2VJYA 3N6RA 2NTVA 3I04M 2H08A 3TNJA 2WU0A 4KAJA 3R5SA 2E4XA 1HNXB 1NW3A 2EW1A 2J3QA 5JPDA 5LQRA 3LVRE 5BMVB 3GRAA 2DWQA 4KRYA 1YU6A 2LDXA 3TXYA 1J4AA 2NSLA 5AM1A 4QUKA 2J3LA 2Z6QA 3NPAA 3WKEA 2IOQA 3EG5A 4WZBB 1R4NB 2J4CA 5HFAA 1XV5A 4DUYB 1KDTA 4LF6B 4ZEWA 2P30A 1U0TA 4PY2A 5EERA 3IC5A 5EQTA 4CM6A 3LG2A 3U13A 1U81A 2C0PA 3G85A 4LA4A 1NMZA 1L5LA 4AWXA 2A4MA 1Z6GA 1ID8A 5KSWB 1JG4A 2JA2A 1QO7A 3I0NA 1FE8A 2BEWB 2W2XA 1GKIA 3JQAA 1CYDA 2QI9F 1OF1A 3KQOA 4YI3A 3COYA 4CIBA 5JS6A 2E48A 3LY8A 2W2QA 4M9CA 4MGEA 2VLIA 3U7RA 2ZSFA 5BSMA 3T95A 4F8EA 4HNHA 4JLSA 2D1YA 4DN6A 2WK1A 4FXOA 4KXUA 1WXHA 2FOLA 3C3PA 1LH0A 3VV3A 4D4IA 2A9OA 4TRJA 1TMOA 1YZNA 2H5IA 1S02A 3AW8A 3ISTA 1N5MA 2JIQA 4XIYA 4X1YA 3CKLA 1K4MA 1U4OA 3FPFA 2JL1A 3WMWA 5A0FA 1MB0A 4MS4A 1TEHA 3VDQA 2AZTA 1BGWA 1T4MA 2GQ0A 1Z17A 3P26A 4CIXA 3L8ZA 2PFKA 1F12A 3MMPA 2OQ2A 3GAFA 4WX2B 1LLFA 1JIJA 5DB4A 4Z4HA 1M6NA 5CG1A 1YA6A 4RVFA 2FSSA 3VO2A 2RGYA 3FLEA 4I55A 4PLFA 2K6GA 5E7IA 1RT9A 3KU4A 5EG5A 3WRVA 4ZKEA 4QPCA 4J8PA 3MYYA 4L5CA 3ZWOA 1M5RA 2A0KA 1FDRA 2EG9A 3OKAA 1BH6A 1VE7A 4LCBA 4OQDA 1EFCA 4E13A 3JARB 4M53A 1KYIA 2IV7A 4E5NA 3MERA 4WFIA 4GZLA 4K46A 1ZONA 3EHDA 3G7SA 4ZT5A 1A4UA 2VJPA 3PGJA 1AV7A 1CUAA 1S4MA 4GI2A 3MMZA 4JODA 3SIRA 4B4WA 4Z7JA 5I7HA 2AXNA 5LP6F 1NJ1A 2HRRA 1GCGA 2GPNA 4HDSB 3B2NA 3E22B 3DV9A 1VYHA 5BYJA 1LEHA 5CITA 3MT8A 5GTDA 5KOJB 3GQVA 3HCRA 4IV0A 2BEVA 5F3DA 3TLBA 3JQEA 4I9HA 5LL6P 4RD3A 1BDMA 1ODTC 1Z88A 2RARA 4WXRA 1EFVA 3VZSA 4QUBA 4X1IB 1LLDA 4BASA 1BDBA 3GEEA 2YW2A 3LX4A 4GD3Q 3AI1A 5EXEA 1SWVA 5K3DA 5DX1A 1PZXA 3ITEA 3MOIA 2QQEA 3LWZA 1PW7A 3N76A 4H18A 5KTOA 4MUIA 2XCSB 3HACA 2Y66A 4N65A 4BKUA 2ZS9A 2PT9A 4U2KA 3RS5A 5SY9A 1Y5IA 5A06A 2GXSA 2Y1FA 1LRKA 1XPJA 2UV8A 3DT9A 1JEOA 1J42A 3O3NB 3CX7A 2M6KA 2XYPA 1WSWA 3KP1A 3A0RB 1J22A 3NP7A 3PFNA 3I83A 3JTMA 2QE7D 3OTHA 4KJXA 2HXYA 3R0QA 4LTNA 2G9NA 5TC4A 5J4LA 4QXPA 2EFEB 4LVOA 1C9EA 4G01B 1HQDA 5LB2A 2AB0A 3TX2A 1W93A 2D5LA 4L8YA 3HKCB 1X9IA 5EZ5A 1KEEB 2AXQA 2GZRA 2CYAA 3EMDA 3WFJA 4AO8A 2I3GA 1EH5A 2B92A 2H1FA 3R0JA 4Q39A 5GM2A 3ROPA 1GNQA 4CKXA 2ZS7A 5KHOC 1YB6A 4IJMA 5CDGA 2H8GA 3KQWA 3T1TA 3H1PA 4AWAA 2O8BB 1J2RA 3EVCA 1WDWB 1X7HA 4Y6PA 2A8YA 2EFHB 4PONA 5ITZB 2X8WA 3AKCA 3PF8A 4B8YA 3WGLA 4IKPA 3KXPA 1OBOA 2AK3A 1NMYA 3PS9A 2ZT5A 4WASA 1NU8A 4K7JA 1AGXA 5T3YA 3H11B 2ZR7A 5CRIA 1IBLB 5CLIA 5SYAA 5E8RA 4TZ0A 3I8SA 3GZJA 3LIIA 3A6PC 3RT1A 3UUGA 2HSWA 3LRTA 5DW3A 3ESXA 3QQ5A 1PR2A 1WQ3A 1JQDA 3W5VA 1DPGA 4M60A 3DZJA 3PZRA 5B3KA 3LECA 5KUTA 3MLAA 2D1RA 1EESA 3OM8A 4PIVA 2W4QA 1Z4MA 5FUVA 1Z2OX 2UYGA 1T2FA 4IQ4A 1P9OA 10MHA 2VTVA 3BXGA 4MZXA 4BKQA 4GKVA 4C6SA 4XGRA 3IAXA 5AVTA 1X39A 2Y77A 2YWCA 3DMFA 3IBFA 2IHNA 3LT1A 3WJ7A 1CEYA 2EKZA 4WEOA 1ZUIA 1ST3A 1RFLA 2WICA 1L4LA 5AQEA 2JA1A 4U2BA 2O2JA 2PGLA 4O2BA 4XDZA 4PGHA 4CR7A 5JFOA 3QFTA 1IUNA 1UPAA 1KY5A 3ABQB 4AXXA 3D7LA 4PN3A 2DRIA 2EJUA 2ZUSA 5J63A 5CM2Z 2E1PA 4FC7A 3BDVA 3RFTA 2EX4A 4BE4A 3U1TA 5I47A 1ILEA 4C05A 1X13A 1O6GA 1QFYA 3AOEC 3GMDA 1N9GB 3KOOA 4B31A 1QP4A 1MB2A 4ZOBA 1MAAA 3K4QA 3NEPX 1BKSB 3H2HA 3LS2A 4H1TA 4G23A 4NJEB 1VRWA 2VK8A 3GN2A 4Y9UA 4AQYB 3I23A 2EX1A 3P0JA 1YACA 1W4ZA 1VJ1A 4UXJA 3L6CA 3TYXA 1QH1B 4IBOA 3GGOA 3FFXA 1KXZA 1TI7A 4KCGA 3WIEA 1TO2E 4DCVA 1TU0A 6AT1A 1U2RA 1JHPA 4XJVA 3GRPA 4GDMA 5SZJA 3COPA 2IY8A 2QPAA 1DFHA 5GONF 1C7EA 3PDIA 3FAKA 1A71A 5DEOA 4KGZA 4MUFA 2NU9B 5JAPA 5C7YA 1P9WA 3BD7A 4MINA 3PC3A 4FYYA 2EEPA 1P3JA 3U1VA 1ITZA 3QWBA 1NP3A 3DS8A 2H4ZA 1XMJA 1DUSA 3RUDA 1FYEA 1JQ5A 1RBMA 5TJHA 3TIXB 2B94A 3VNQA 3RVOA 5T8KA 2PVCA 3UMYA 4TTJA 5FL7D 1E2NA 3T5MA 3UW3A 3K0SA 2QP3A 4NATA 3UB3A 1N5OX 13PKA 1HEYA 3WIBA 1B0UA 3R6WA 1M67A 2XY4A 3QIAA 4FN4A 4KUHA 1VL2A 5E7JA 1I7SB 2IITA 3LYLA 2JFYA 2DWPA 2I34A 3CB4A 3GGJA 2FUG6 3PR3A 4J1SA 4P3OA 3VUFA 3WLOA 4IIXA 1U6KA 1C81A 1WPQA 2TSYB 3Q85A 1UMDB 4ZQIA 5KNBA 5LUAA 2QK4A 2JAHA 4JVNA 5D8DA 4R54A 4YH1A 2JLQA 3LK7A 3CE9A 5JMWA 1E7RA 2WSYB 3DKPA 3FTDA 3LCVB 4GO1A 4N12A 5K20A 2L17A 4EVIA 4C4YA 1GSAA 2JCXA 3X44A 4I81A 5JAUA 2VK1A 1E63A 3S7TA 1L7RA 2JGDA 5PNTA 4MUMA 2ECOA 2BONA 2ZUEA 3OUUA 4FLMA 2GBFA 2XWQA 4KE9A 4QUIA 1CVLA 4XFJA 1O6BA 1M2JA 3PICA 4NNOA 1Y8RA 3ASZA 2C9CA 2EZTA 2YV2A 3GF4A 3TN7A 3CZMA 1U7HA 3KHTA 1ZMOA 3PG5A 1R15A 4QYIB 1P0MA 1TVKB 4FLFA 1NXPA 4HWOA 4KTVE 2H2HA 2BFFA 4Z3OA 2ISCA 4IILA 1MORA 3D6VA 1IEXA 4G1FA 4MQFA 4V38A 4ZAGA 3U4GA 3BZWA 3R6LA 1PJ3A 4JT9A 5EUMA 1AF4A 1F20A 1XDBA 3AHFA 4FJ1A 1HWYA 3V4PB 1R6TA 3DGEC 4BMCA 4Y1GA 1EZZA 1CQWA 3FM9A 3QFCA 5LLSA 4NZPA 3C3WA 4P7FA 3Q7PA 3FGZA 4TL6A 2BI4A 2D54A 3T12A 3F6PA 4MLCA 1LS6A 1V7PC 4JSRA 5P21A 3KD3A 1JBEA 3KQPA 1PNTA 2WWIA 5K3FA 2MCFA 3SZ3A 3VGPA 3BJZA 4LOLA 4XLZA 3HEBA 4MV7A 1BYUA 2F1HA 4HGPA 4YWHA 4BVLA 4LDQA 4B9EA 2BGRA 3GOQA 1CYEA 1GR0A 1WVGA 2A0XA 2R7KA 2ZYRA 3LHSA 2C8JA 1E3WB 2I8LA 3RLIA 4RQBA 3ZCRA 5JJLA 4I5IA 4MVJF 3ELYA 4JZKA 1JR2A 1NVDA 3IP3A 3OZWA 4J1TC 4OMDA 4MQMA 4NG4A 3GELA 2RBKA 2F55A 1E8DA 2BFEA 3MTIA 1FJHA 2Q4EA 3VZBA 4QQKA 4PYNA 4EGAA 3TQTA 4AN0A 4PAOA 4WJZA 1I3NA 3EEBA 3HFGA 2ISSD 2OQIA 1N7IA 3MINB 3SBOA 2CL0X 1QH8A 1O0CA 1DDGA 3H05A 4ICIA 1V1JA 2FEMA 4L28A 5FI5A 4HQ6A 3ZVRA 3DTVD 5DX8A 4X85A 2P4EA 1GTJ1 4PGFA 4KK3A 4Z54A 2XXBA 4IZOA 1NBMD 2P9HA 3SK0A 1TJ5A 1XCOA 3E9CA 4OXQA 4BLOA 5JZVA 2HA7A 2OV4A 2OVBA 4JI6B 2CHFA 2OZVA 3ICQB 5CLFA 3WGNA 3PRYA 5IHXA 1C1YA 2ODWA 4I5EA 3S2UA 4RIGA 4EWLA 3RO7A 3ERCA 4DLBA 1CLUA 5TB5A 4XTRA 1OVMA 1A9OA 3IUJA 5CGZA 2IRWA 3GZTB 1MUUA 1K9SA 2UVPB 1D2HA 1NOKA 1T2UA 3OCUA 5JY1A 3AVWA 4IS2A 2PO5A 3IVMA 4GRAA 5JH7F 1JQLB 2QVYX 4Q9KA 2ZB8A 3AK4A 3T5TA 2VJAA 1G8SA 2JI7A 3T4EA 1UP4A 1TYAE 1YB4A 2I1WA 4P92A 3JATA 4KYTA 3VI3B 2ZRAA 1RFGE 4IDEA 1W25A 2CDAA 2NO0A 2GXQA 4A6PA 4X6YA 1JQEA 4FKMA 4GBGA 2E18A 1OX4B 1UJBA 1GJRA 2VYVD 3RE1A 2Q5LA 5EYPB 3WB1A 5LLDA 3HB0A 5JC1A 4UZFA 4X00A 5LSAA 4ITVA 2X0RA 4KR7A 1RLTA 4U6SA 2WWYA 1G38A 1SQ6A 1AO3A 2XPCA 2BI8A 2W6JA 3KYDB 1AF7A 1VLJA 3TI7A 2O4UX 2E0IA 3CUYA 2WMOB 1R9JA 2PE5A 1SUAA 3EUWA 3WK9A 1EUZA 4PLCA 3SQMA 1R0ZA 1V2HE 3PP8A 1PGNA 3LCCA 3IT3A 1GNSA 1XELA 3ZV7A 3FKSD 4J0JA 4YRKA 3A1FA 5KEIA 2PGIA 1DXYA 5FBHA 1CWUA 2JJYA 1UWKA 2ANBA 2GZAA 2ODBA 3IHKA 1T36A 4MICA 3PFKA 2BVNA 4JJIA 2F17A 1IE3A 1LV7A 1ZEMA 2O0KA 1KQ3A 3BXXA 4Q19A 4YQZA 3RFVA 3UIEA 2J8ZA 1YZLA 4TKZA 4X63A 1DWPA 3EQ7A 1H8EA 4AO7A 3UHJA 6LDHA 3C1UA 2HYDA 1Z7GA 2IP2A 2L69A 2P2LA 2V7QA 3CW8X 4D56A 1DKRA 1ZI8A 2O57A 3B6KA 4IWXA 4YACA 1GPYA 2PS9A 1QM5A 2DVMA 3DHVA 1TKCA 4FMDF 1Z75A 1BGVA 1B76A 1EB8A 2CXQA 2XEDA 2Q9UA 2XZDA 2FETA 3JWGA 2ZXUA 1OV6A 2C3MA 3O4HA 4OL0A 4HV4A 3RSQA 2XI4A 5IBPA 4ND2A 2YDXA 2FGKA 2X8JB 3BA1A 3L7JA 2JFQA 3M6MD 2NO6A 5EJEA 4C2TA 4JQYA 4GIBA 4JGGA 3L18A 3I53A 4C2UA 4H0NA 1Z82A 4ZEVA 1X7XB 1E0AA 1JKXA 1US8A 2CXUA 2R8PA 5C7LO 1M73E 2IYFA 2A58A 3PUJA 4DTIA 5LNK1 3HVRA 3N70A 3NKFA 1B00A 2R6CA 4KBYA 4Q4LA 1CQPA 2ETVA 3VJLA 3K0HA 4DKXA 1D5CA 4S1OA 3MHPA 4QU8A 4HAZA 1XFDA 3QVGA 2Q5JA 1K7SN 2WKRA 3K1JA 3OF2A 4N7MA 5M34A 2HK9A 1ECPA 4ZC1A 3O91A 2AHOA 1FXWA 2XSZA 2F1KA 4TYMA 2P67A 1XZAA 1NF2A 2CXRA 2JK1A 3FMFA 3OOJA 2EBHX 4RM2A 1GAQA 2GA9A 2ZOSA 3HXTA 3VX3A 5EPOA 2FSHA 4ZU3A 3URMA 5GADl 5A02A 4R1QA 5LCXA 4A5OA 1N1EA 4P7KA 1W19A 2CLIB 3HEAA 4NJMB 1Z0KA 1ZH8A 2HJHA 3B2QA 3CQ9A 3OA2A 3QHPA 4G0NA 4R2JA 4YTEA 5IW8A 4C03A 4DZZA 1NNEA 2AW3A 1SXGA 5I48A 4IOKA 2WILA 1UPBA 1V7CA 4J75A 4QARA 4HLDA 1CHDA 1EJ6A 1XDUA 2HTEA 2FLKA 4OXKA 5JROA 1OI3A 2JAXA 2YHIA 4MGYR 4QLAA 1EI9A 3KSMA 4UFNA 2WFLA 2XD4A 3RYFB 4IHQA 4QOEA 4WUTA 2VWPA 1TIPA 2JH8A 2R96A 3H1BA 4XR9A 3U56A 4IPTA 1W1WA 2OORA 4Z86A 2HA0A 2BGLA 3EEIA 5DBFA 2ZRIA 3LA6A 3BMNB 2HO5A 2C82A 2O54A 3J80A 5A04A 3HVHA 2W93A 2ZUCA 4NOJA 1AE1A 4FD3A 3EGDA 2Z58A 2XUIA 3N2YA 5F7ZA 5EJ6A 4MPJA 2VATA 3VQTA 5BSTA 3WGMA 2DUWA 4C78A 5JDCA 4EBFA 4CODB 1IBRA 1JI0A 1Z5GA 1MOSA 2XMGA 2F8SA 4Y9RA 1JBQA 1TE2A 4TV9A 4WCFA 5KYYA 3R8FA 5HNKA 1N2OA 2RBGA 4OB8A 1V1RB 2WB2A 3KPJA 2W6NA 3PRHA 3I5YA 2QROA 5ICGA 3C85A 1N8KA 1OXUA 3SZMA 4RA6A 2LCIA 4MWZA 4DMLA 4MTLA 1ECCA 2CW5A 4IMJB 2ZZMA 5HE9A 4DWOA 3COWA 3WHIA 1T4CA 2VXOA 4C7JA 5JQGB 4XPIA 1PR4A 3PXDA 2FWJA 4UU1A 2CJXA 4YQEA 1NI3A 5KOHA 2I4RA 3DWFA 4G4IA 3REOA 1EE2A 2C3YA 1BZYA 1E1DA 1PD1A 3P7MA 4HN2A 3AFGA 4YCDA 3PVSA 2HA4A 3F8SA 3QBTA 4B85A 1GDDA 4CLHA 2AOUB 1Z8DA 3ANSA 1JTEA 1LQ2A 1RSZA 4Q3DA 3UAYA 3VH3A 2QB5A 3PVCA 3WFIA 3D6NB 1RWVA 4XPZA 1EMDA 1GDHA 2FPWA 4UHCA 1SFRA 2XF2A 4M37A 3GU3A 5DGHA 1KI3A 2O3RA 3OPNA 5LXTB 4DEYA 4AP5A 3QW2A 2V4MA 1RLUA 2C7VA 2O8VA 3E5MA 3LLVA 2WOOA 4CIWA 4UDXX 4AJIA 1G3QA 1G8KA 3PR2B 4OHOA 4BLSA 4QUAA 4X65B 1KI7A 5IC6A 1CVIA 1Y80A 3EF1A 3KT0A 3MOSA 1JR6A 4ZV7A 7ADHA 4MAFA 2IU4A 1J2EA 1L4BA 2XCOA 5ER6A 1KQGA 1YQUA 1GKKA 1XTVA 1ODIA 1R5NA 1W6UA 1XCPA 2GEDA 4LWPA 4CLOA 3U0BA 4EKDA 3UAXA 4M1TA 4CNQA 1LPBB 2P7IA 1KAEA 2QN9A 5ITWA 2W83A 1RRKA 1ENPA 2GX6A 4HDRA 5BN4B 2ZRLA 4DA4A 1B8UA 4IICA 4O2LA 4CM1A 4YBRA 3RF7A 2AG8A 4RETA 1XEFA 1RKUA 1O95C 1YZFA 2WMNB 1EAYA 5IYZB 1JG2A 4RPCA 2VDJA 5FPPA 2N1MA 3A6ZA 5K03A 3IAS1 2PG3A 4FONA 2ZSBA 3EAGA 3ELWA 3MOGA 1IZ8A 1A2KC 3HCFA 4JAVC 3IE1A 1FNDA 1D4FA 4K8RB 2YYZA 4Q1AA 4O8CA 1U0EA 1OPXA 1I5EA 1LBIA 2X8LA 2BFBB 3IQHX 4YT5A 4QJ3A 5JEDA 2H2WA 1YF3A 1ULZA 1WHTB 2FPPB 3O8QB 4C43A 1HT2E 3D7RA 1IZZA 2HHAA 3DONA 4TMKA 1Z8FA 3ZLUA 1JT2A 2RKBA 1CE8A 2VYND 4Q4JA 4GPD1 4PCLA 3VH2A 4C4OA 1DXHA 1T2AA 2P0EA 3UOGA 3R4CA 1E8NA 1MAUA 1CDOA 2OTCA 3LC0A 4IIUA 2OV1A 3M2TA 2AFRA 1TAGA 3AL0C 1NTOA 4RJJA 3QKSA 3GPCA 4YMWA 5EKUA 2R6AA 3K4PA 4LOKA 1Y81A 4P35A 3T7DA 2PUBA 3PHBE 4CF3A 3R9IA 3BE4A 4LHVA 4MUXA 1O6FA 1N5JA 3KQQA 1JKIA 1PAUA 3BEOA 2QMHA 3C8DA 3SYNA 1B15A 1JDBC 1P1CA 4LRTB 2B8JA 3IQFA 3VPCA 4PC3A 2ONJA 2VG8A 4II7A 3MCVA 5HMLA 1M8PA 2Z43A 1ZM2A 3GFVA 2PYDA 4DQ0A 3DWGA 3FSGA 4Q1FA 3VZCA 1ZN7A 2QHXA 2K2QB 1OXTA 5TY0A 3N5CA 3CRZA 3ISVA 1T3SA 2JFWA 4MW0A 1QYDA 1VP9A 5EJIA 1U3CA 1O6ZA 3ZDFA 4BIIA 3THWB 3SDZA 1Y8ZA 4TS3A 1KL7A 3G0HA 1DBIA 2H16A 4ZVOA 1WVMA 3AO0B 1XB2A 3TE6A 4AJNA 4B4VA 5BXYA 1OYWA 2G5GX 3RFCA 1IVNA 3KWFA 4G89A 1WAMA 4M7RA 3RIHA 5BSUA 1ODCA 3ZNPA 4ESHA 5TPZA 4OP2A 3U61B 4Y9SA 3SJCA 5C2JB 4LPSA 3VR5H 3EIWA 3TW8A 2YNMA 2VR1A 1D7OA 1NQUA 1ACJA 2BBTA 8OHMA 4OXXA 3WGOA 3GJTA 1DOHA 2RG7A 3DO5A 3KJGA 5AHXA 4LYJA 4PG7A 5FJJA 2VUUA 3FOWA 1Y5NA 3BDIA 1MENA 4DLUA 3LD9A 4NONA 4RF5A 3Q9UA 1ORVA 3T1VA 3VHXA 4XB6B 5LZ2A 1OFIA 1XTZA 1DAMA 2H92A 4EHKA 3JQGA 2Z09A 3R6GA 3JY6A 4MQLA 5K05A 3AUJB 4WKCA 3HDJA 2PX8A 5JR3A 1BVUA 4KQJA 1DBWA 1P1JA 1V1MA 4LWQA 2DF8A 5I8WA 5EIFA 5MN5A 1IOWA 3PNOA 2O9JA 2VSFA 1JHQA 2UUPA 1WUIS 2FVXA 4L02A 2B1QA 5JU6A 2QX4A 3HGQA 1E2UA 4ITRC 3PPIA 3RASA 4ARUA 1U1FA 3M5PA 4QPJC 5HOEA 2QMEA 3EPPA 2WJIA 3DD5A 3U7FB 1K4KA 1XA4A 2ZQ5A 4OAOA 4NECA 3LCMA 4F9TA 2P6PA 5B7PA 4Q7KA 3EXAA 3W1WA 1DDIA 2CVOA 3HYLA 1NVUQ 2NPIA 1XDZA 1AUQA 4JJKA 1TVCA 1N34B 1K98A 3IT1A 1PE0A 3AW9A 1SHJA 4R7GA 3PTZA 2AMJA 4NS4A 3KZOA 1N2JA 1RC0A 1WXFA 4BQIA 2JLZA 4TOIA 3HXPA 4PQYA 5EN4A 1OB2A 3R3ZA 5EUQB 2JVJA 2P9CA 4IIHA 1L1EA 3NIGB 5DT2A 3X1DA 4AROA 4NBSA 1I94B 3ADOA 5LYJF 2FUKA 2HA5A 5HM6A 2JBAA 4ISBA 3UMFA 1G1AA 2ZJYA 3NX4A 3CRVA 1II0A 3Q3CA 3SBDA 1IQPA 3NYIA 3VNBA 1M2VA 2E6KA 4OP3A 4ZD6A 2FPGB 1XTQA 1QIJA 4M0DA 4RVCA 1NMSA 5HGXA 2W2PA 3VHXB 3DUWA 3OMXA 4ISCA 1OJLA 4K9KA 3C41J 3BBLA 3L9XA 3GBPA 2OO7A 2FI1A 2IBTA 2V03A 2KMLA 3AB7A 4GYKA 4S1NA 4KREA 1KNQA 1DZIA 4JGBA 1L7MA 3I37X 2EP7A 2JPDA 1ZFNA 1HE3A 2A9FA 1OZFA 2XT0A 4IRXA 4JUAA 3PR1A 4TKMA 4OA8A 4YT8A 2H5LA 2VXCA 5IRCD 2Z6AA 1QG6A 1ZKDA 5FFMA 2HK6A 4BBJA 4RKYA 3SFTA 2R2GA 4PVDA 2IF2A 3MWKA 3P96A 2NYVA 2CNOA 5DYIA 3UK6A 1QYIA 5DNAA 4YYZA 4FZVA 3GMTA 2DPXA 4LJ7A 4QYWA 4B80A 1SXPA 1EBUA 4ZT4A 2D13A 3F7TA 4MVWA 3OCVA 1Y3DE 2ZTUA 3QITA 4H3KB 3TGWA 3ZHQA 5DNUA 5LZ5A 5DTMA 4FEEA 1VECA 3CLTD 3B2EA 5CBPB 1X1DA 2HSJA 4PPFA 1T9GR 3KKMA 1N1MA 1M6VB 1YBVA 2AZDA 1VYTA 3ET4A 3HB4X 3IP1A 4MA5A 4PRKA 1PNVA 4PV7A 4L8GA 1ZUNB 4M4SA 3R7LA 3K1AA 4RDIA 4DLVA 1JR3E 2A5FA 5JXIA 2OVFA 1II8B 5HIMA 1PCXA 3AT1A 1BFKA 5C1IA 1QZ3A 1CLEA 2F1OA 2OQVA 2EYQA 2XLCA 3ZTTA 4URUR 4B0PA 1B43A 3CLTC 2IVFA 5CCDA 1ZK1A 3A6HA 1NKSA 5AI9A 4P31A 4CL0A 1GRNA 3SE0A 2BUBA 1R9GA 3Q0IA 3MWDB 1QOQB 1YT5A 4MGHA 4BN4A 1O0BA 3IQWA 4X3CA 6YASA 1RXYA 2IU0A 4DR6B 2G9VA 4KQ2A 4KQXA 1Q7EA 4MRPA 4AKEA 4BNDA 1ODSA 1U5CA 3PQ4A 3RC9A 4OQQA 3VX4A 3WJAA 3DEAA 4QWMA 2CXNA 4QTZA 1I6KA 5FTKA 2BHTA 2Q4RA 5IF9A 3QEBZ 3EVAA 4B74A 1N6HA 4EY7A 4F3RA 1QAOA 3UMSA 5JCJD 3SXUB 3KQSA 4UM5A 5EP3A 2WAOA 4B3MB 3R5FA 4RHUA 3ROTA 4YJ3A 3C98A 3HJUA 3TDNA 5LJLA 1R0XA 4DLAA 4DXHA 4KV7A 4DARA 4YQFA 3RVPA 2IUYA 2QTLA 1VDMA 5HM8A 4P0TA 4JC5A 5DHUA 1R6AA 1JIIA 2PU5A 3HC7A 1RP7A 3VYSB 5AW1A 2XRFA 2C8LA 2Z57A 3C6KA 5GONA 4E22A 3ZCUA 2Z1MA 3QX9A 4O4IF 3HS3A 1CUCA 3BM5A 3ULKA 3JAWA 3TW0A 1W73A 1LF5A 3ASUA 4LX0A 4BE9A 1GT91 2O59A 1O97D 4RPHA 2AEJA 5I9LA 4CHGA 1V71A 2VDWB 2O8NA 3GDFA 4DCMA 2AZMA 3I9V1 4D4JA 3ASVA 3NCTA 4LF7B 1TYZA 1V4NA 5TMBA 5AUQA 1SIWA 1ORDA 3N53A 2CDBA 4D5EA 4A10A 5I45A 3UYLA 3IT0A 4JYMA 2GN8A 4CIVA 1UPFA 3PEWA 2CNBA 1SKYE 4XRGA 1O97C 2QL6A 2YV4A 5TS3A 3MAGA 1LLQA 2JZOA 4IOJA 4U6QA 3V4OA 4UFPA 4MVJE 2J5QA 5ICSA 1P61B 3ORSA 4MWGA 2FRVA 2BFDA 2NV2B 2BSAA 5KJ1A 1HQCA 1JR3A 1WLYA 3IR7A 4AY6A 521PA 1N77A 4MQ5A 4F2WA 2BEKA 1HLGA 4KDRA 4J9VA 3RBZA 3DVQX 2O5EA 3QU9A 1Z83A 1DC5A 2RI1A 3KLNA 1UBOS 4P9NA 1N0WA 3GEDA 3WLEA 3OFSA 2RKWA 3ORYA 3WV5A 1LI5A 4FGWA 1FXSA 1M74A 4YB8A 4LOHA 1V9CA 1VJRA 4U00A 1G8FA 5JYBA 1A7JA 2GO7A 4EPWA 2FG7C 3D7NA 3AP1A 3MBKA 1NASA 2F43A 3GFBA 5A9TA 1AQUA 3TZHA 5E9QA 4AJEA 1FNMA 3VVMA 3UMVA 4GI1A 4B8ZA 1N0UA 4BQNA 1KPIA 3EW9A 2TECE 1HE4A 4BNFA 1A1SA 4I66A 4TYQA 5HG0A 4DBZA 4KQKA 4GGPA 1OX5A 1NUQA 3WGGA 1WZ2A 1SKQA 2APJA 1XROA 2WA1A 3P9ZA 4U2CA 4P84A 3DM5A 3MJHA 4TVBA 3AJRA 3P9YA 1PT5A 1X9GA 3TEJA 1DOZA 1P45A 3QYAA 4L1KA 3Q0EA 2GEVA 3RJMA 5HIJA 2W6IA 2PZMA 3N8NA 1XWFA 1KOLA 5K8CA 1BN7A 4KE7A 3OIVA 2ZIGA 3QYFA 2GTPA 2WWGA 3EDCA 1UK7A 1KEKA 5A62A 4WESA 1K88A 3RWOA 1KAHA 2OCAA 5G4KA 2WLTA 1YWGO 5IZ4A 3DVAB 3S44A 4NBKA 3PQEA 4N5MA 3SX4A 3CH7A 5FEUA 4KI7A 2HCBA 2ZJAA 1DTWB 2GF0A 4XAQA 2PZAA 3GROA 1YQQA 3EIFA 3CISA 4TRMA 1A50B 1RVDA 3V34A 5KYGA 3BICA 1RWPA 2QT1A 3IIEA 4HP8A 2YWBA 4PLZA 4MPPA 3VPXA 1PX0A 1GA4A 4MCJA 3EVEA 3OPVA 3WWDA 3HCEA 3R7WB 2ORYA 2YICA 4DJEC 4Z0HO 3GJ5A 4JUCA 5DPMA 1YDWA 3YASA 1YXMA 5JWHA 2G1AA 3PPXA 1RWNA 2PWAA 4X3PA 1Q0QA 3AVQA 2EFDB 3Q41A 4BEVA 5CA0B 1ACMA 1I3MA 1OT3A 2OZPA 4EUFA 1XMVA 1DAGA 1EBBA 1YMUA 1JMKC 3OY2A 4MUHA 3OTQA 4D57A 4JKIA 1T8SA 3U3OA 4GKKB 3JQBC 2GK6A 3RTDA 2ZS8A 4JSYA 1Z34A 2FW1A 1PQYA 2XJ4A 2YY5A 4LHEA 4UCWA 4WK2B 2HUNA 3X1ZA 4KBFA 1SPBS 5C4GB 2XVZA 2C42A 4RH0A 1VIAA 4HXGA 2AE2A 2NACA 1F1BA 4QBGB 3RCBA 3ZCSA 4X7PA 4CG0A 1A0OA 3T7JA 4X62B 2GPTA 1GPMA 3DFKA 2B5WA 1GPJA 5IP5A 3ZY4A 5AK5A 5IT4A 5BN5B 4QRIA 2ZWOA 5DJ5A 4R31A 4YAGA 2WNSA 4CT4B 1V5GA 2YN0A 4I50A 4OU5A 1N2ZA 4A27A 2PX0A 4U7WA 5MFZA 1QFJA 2ET6A 1Y1KE 1RRGA 3UANA 5BRJA 3ZVKA 3SC2A