3LW7A

The crystal structure of an adenylate kinase-related protein bound to amp from sulfolobus solfataricus to 2.3a
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
177
structure length
170
Chain Sequence
b'KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase related protein (AdkA-like)
molecule tags Transferase
source organism Sulfolobus solfataricus
publication title The Crystal Structure of an Adenylate kinase-related protein bound to AMP from sulfolobus solfataricus to 2.3A
rcsb
total genus 65
structure length 170
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw7A00
4LJ9A 2J41A 1XP8A 1R7RA 2JIZA 2F7SA 5DO9A 3MD0A 4BPBA 1US8A 2FN4A 2GXQA 3AUYA 2YC4C 5K8UA 1NNEA 4L15A 3RSLA 1YRAA 5KSPA 4HUTA 4B35A 1P75A 5KUTA 5CLQA 5FOTA 1AJEA 1IY0A 1M2OB 3ADKA 4C0AC 4V03A 3QKRB 1F2TA 2MSDB 3CBQA 3TR5A 2FU5C 2EFHB 3FB4A 3FMPB 3RAPR 3U7EB 5DIFA 4EPWA 4URXR 4M0LA 4G5RA 3QKRA 1FUKA 3RS3A 3OEED 1CJTC 1DADA 1Q44A 1TX4B 2LCFA 4PFSA 1Z0AA 2XNDA 1NI3A 2G9NA 3U5ZB 2ZPTX 1W46A 1XD2B 4C0LA 1WQ1R 4URVR 3VHLB 4A15A 4QBHA 2C2HA 1XCGB 1Z47A 2YOHA 4C0HA 3CR8A 1MRNA 3VR3A 4C0BA 3GLFB 2HV8A 2W83A 1VG0B 3A1VA 3C15C 4Q48A 3U3JA 3AVUA 2XXAA 2KE5A 1L8QA 2EVWX 3TW8B 4HAUA 3SFZA 3VR6A 3WMEA 5BW8A 4NCJA 3GFTA 4AYWA 3BFXA 4WVFA 3S1AA 4JLNA 4AURA 5C4MA 1E94E 4YDSA 3SN6A 2EYUA 1E2JA 4A8JA 2IBMA 1J2JA 2QBYA 2VA8A 4ZDKA 1NBMD 1UEJA 3O8BA 4LJ6A 2G83A 2VBCA 1DOAA 3KQNA 2I4IA 5G3ZA 3TKLA 4NKRA 4QBIA 2CEAA 2CJWA 5EE3A 1NRJB 3RS7A 5KNBA 4YMVA 4CT4B 3S1AB 4W5HA 2W6ID 2IS4A 1G3UA 2FEOA 2YOFA 1R8QA 1GP2A 1ZYUA 3OZXA 1OJLA 2BBOA 3BK7A 5BQ5A 3GLIB 2XB4A 2ZJBA 2CLDX 5L3SB 2H92A 4XIGS 2W2TA 1K6MA 3K0CC 2OLKA 2VQSA 4N0DA 1COWA 1OH5A 3A1UA 1XD9A 2O5VA 3THXA 2D7CA 3ECCA 1HT2E 4MYUA 3B60A 1FNMA 2A5FA 4Q21A 1Z8FA 1RJ9B 3QBVA 1CXZA 3VNUA 4MITA 2N42A 1W36C 1X6VA 1Z6TA 2J1LA 3R7WA 3THYB 4FCWA 1QZXA 3B1XA 1G5PA 3LO5A 2ZUCA 5B58C 3EZFA 3IQWA 1ZCAA 3A4NA 4JJZA 1XZPA 4WIAA 2G6BA 4IJMA 4QKQA 1N6IA 3U3RA 3P26A 5CJ2A 5BXQC 4CEJB 4V02A 4QL3A 2FV8A 4JMPA 4Q66C 4LV8B 3I5YA 3D31A 4B74A 2JLUA 2IUUA 2FFBA 3O8RA 5DH9A 1US8B 4KSCA 5JECA 3A4MA 2VL7A 1AS0A 2O8CB 3DKVA 4Q4AA 5EE0A 4BLSA 2PT7A 4NCIA 3QKSA 5FOSA 1Z6GA 3KFXA 4UNPA 5KU1A 1OH8A 4D0LB 1FMLA 3MWKA 3TMKA 2AWNA 1E1QD 1E9AA 3KKMA 3QI2A 2DWQA 4CZ2A 4GP6A 4EJSA 2FPMA 4DLVA 2OBNA 1E32A 3W5JA 5KDLA 4JLJA 3TAHA 2R8RA 4BLOA 1NIJA 3ZS8A 1OKKA 2X1VA 1HQCA 3EXAA 3EC2A 4B34A 2FWRA 5JI2E 5H8WA 3OEHD 2QSZA 2XZLA 4ZCLA 4U00A 2ZRJA 1YVDA 2XEXA 1SXJB 1OXSC 2OBMA 4NBSA 4NP6A 1W4RA 4KVGA 2O0HA 5FFMA 2F1RA 4FWIB 1MKYA 1BS1A 3O8DA 1KIMA 2QY9A 1X8KA 2DR3A 1NJGA 3RHFA 1NVWQ 2JDID 5KPJA 1CJVC 3GJ8A 3SEAA 1NBME 3EZ2A 1Q3TA 4TL9A 5E3HA 1Y63A 2IYRA 1II0A 2QGNA 3MWJA 5FI1B 2F1JA 2JGNA 2MMCA 3KB1A 3PFIA 3WYFA 2ZRGA 2PL3A 3B9QA 4XVRA 4IXMA 3U3KA 4ACAA 2GA8A 4A2WA 3CWQA 3SS8A 2OT3B 4R98A 2GDJA 2C9OA 4IHQA 2BC9A 3I5XA 1MH1A 2CNWA 3B78A 4OKSA 1ZP6A 1YHNA 2D7DA 4E07A 2GF9A 2OLJA 4PPQA 1FQJA 3ETLA 3NHBA 4B3BA 3SYLA 1LNZA 5DGXA 2BKEA 5JI3E 1GDDA 2FG5A 3FMFA 1TUEA 2VP6A 2QZ4A 3B9PA 3QIAA 8OHMA 1G3IA 2QN6A 4Q18A 1VPLA 2FGJA 5E4FA 1VDZA 1NG9A 1XNJA 1N0VC 4AG5A 3U4QA 4JL6A 4P4TA 5EP4A 3GJ0A 4TMXA 2XJ9A 4LHXA 1ZM9A 2DCUA 4RD1A 4D0GA 4V0NA 5FTKA 3TR0A 2WJVA 2C78A 4OQLA 1OW3B 4B47A 4DCTA 1ZU4A 3B7GA 2XSZD 3THXB 4M9QA 3ADDA 4F4JA 4QRHA 4Q5IA 1PUIA 3K09A 5J47A 4R2HA 2Z43A 4DZZA 2EFCB 2R2AA 1LB1B 2QL6A 4M22A 1RRFA 4Q7KA 2A5YB 4TLBA 1E2FA 2OCAA 5DNYB 2J0UA 2AK3A 5B2ZA 4NYIQ 4YQFA 2HT6A 5F9FA 2GWHA 3JVUA 2C98A 2VLIA 2L0XA 2XNDD 3UANA 5G53C 1ZCBA 5DYIA 4C0SA 2XZOA 5AUOB 3R9IA 5C18A 4NCKA 1SXJE 2ZRLA 1DO2A 4V0LA 2ZRFA 5TV2A 1WRBA 2ZJ2A 4MRVA 1AN0A 2ZYTX 2FH5B 3KUDA 3QF7A 1U2RA 3LD9A 4IDQA 3THWB 3UWKA 4B2LA 4ESHA 4Z1MD 1DS6A 1YKSA 2GBLA 4DLWA 1KK2A 2WKRA 2HYIC 1E2EA 1A82A 2W58A 2FF7A 4MH0R 2C03A 721PA 2DFNA 4A0FA 2GZAA 3HU1A 1TQDA 4RY2A 3REGA 1W44A 1T9HA 1R8SA 1SVWA 1YZGA 3B1VA 4G01B 4GOXA 5TMPA 3BWDD 1EESA 3IEVA 4F92B 2ZVPX 3EZ7A 2IYYA 4HUQB 4O3MA 1X8LA 2FJUA 3C4JA 3LV8A 2ZYVX 1KNQA 1IY1A 4MGYR 2ASEA 1AA9A 4CDGA 1MO6A 2ECKA 2ZIAA 4I1SA 2JLYA 2OFOA 2BKUA 2YWFA 3EIEA 2ZQ5A 4LHZA 1FPMA 1OXXK 1BMFA 2GTPA 5AWFC 3NBYC 3V4RA 3ZLJA 4M2LA 4RD2A 3V00A 3RLFA 3UK6A 2DBYA 3PUXA 4C4PA 1KO7A 3T1QA 2OAP1 3QG1A 4Q4HA 3PITA 1Z0FA 2AD1A 3AKYA 3L8ZA 4ZIRB 1HEIA 2RAPA 1NG1A 3IIKA 821PA 2BHRA 3CRMA 4JKIA 3AGPA 3GJ4A 4IEEA 2CXXA 1L2TA 3FGNA 3KQLA 4UNQA 3Q7QA 2PCJA 1XX6A 2C96A 2B8TA 5LB2A 4ZDWA 1AK2A 1KDTA 1D2MA 4JSTA 1S2MA 3VHXA 1HY3A 2G1JA 2VF8A 1Z29A 4EUNA 1M34E 2IEYA 2JLZA 1ZNZA 4A8JC 1G4UR 4C2UA 1TU4A 1QDEA 1XF9A 4E03A 1OLOA 3CPJB 2YZ2A 2ODBA 2O8DA 1LW7A 2ZI6A 2EFGA 3GEIA 3W5IA 1UBFA 5IF9A 3C7KA 5HKKD 1F5NA 4XWAA 2QMEA 4MRPA 2QTVB 4AIIA 3SOPA 1OKKD 2KBFA 5B57C 1G6OA 2NO6A 3BB3A 4PC1A 3I61A 3CNLA 1W5SA 1CIPA 1SKYB 3LNCA 1ZMXA 2X19A 5GJBA 1X1RA 5FBLB 3QE0A 4DEXA 4HZUB 1OV4A 1EXMA 1PLKA 4FMCF 4NMMA 4V0MA 1E1RA 2J7PA 1E0AA 5HKKA 1E2DA 1XTQA 2WJYA 2ZRIA 2JDIA 121PA 3Q72A 3VU9B 4DLUA 2EFEB 4IOKA 3P1JA 4GMDA 3UXMA 5DSZA 2BCGY 2QMUA 2JJ1D 4Y0AA 4LOAA 2QP4A 3RRYA 1ZIOA 1KJWA 4Q9JA 2HLDA 4XD7A 4PTLA 4TTPA 1UF9A 2R65A 4DLRA 4OQMA 3TSWA 4BLRA 3A1WA 1NKTA 3ONWA 2HUPA 1Z2AA 2QMHA 3EIQA 3CF6R 4I81A 1AGPA 2ZRAA 1ANKA 2RMKA 4P4UA 4PAQA 4M9SA 5FUYA 4TTRA 1OE0A 3TW4A 2HXYA 5FOXA 3BC1A 4EFNA 5JLJA 2CE7A 4G5OA 1LY1A 4MQBA 3QKSB 4XVQA 3KQKA 3FWYA 3FYHA 3MSXA 5CM8B 4P4SA 4D0NA 3EX7C 5AR1A 4QGHA 4TMKA 5C4GB 1Q0UA 3RRZA 2QRZA 1J8YF 5LDDC 3SR0A 1D8TA 3KL4A 2IW3A 3ZD6A 3PV0A 1QHHA 2BIFA 3AM1A 4F38A 4PC6A 3GLGA 1KAGA 5KDOA 2V54A 2JJ8A 2ZS8A 3LW7A 5FBVB 3VAAA 1FW6A 1OB2A 4LDJA 1CBUA 2ZETA 2NO9A 3SBEA 1ZC3A 1KK3A 3T5DA 1KNXA 3W90A 2GZDA 2Z4SA 2I3BA 4V0OA 4DLSA 3EPHA 1W1WA 4IRUB 1A4RA 1DAGA 1Z07A 1BO6A 1TUIA 2XAUA 2LKCA 1U8YA 5L3RA 2GXAA 1M1YE 2OG2A 4Q7LA 2QI9C 3VKWA 3ZZUA 1G5TA 3C16C 2ZRPA 1HQYE 3DL0A 4BFZA 3HYRA 5L3SA 4B3CA 2OAQ1 4IXNA 3CRRA 2WJIA 2OCYC 3CZPA 4JLKA 3X1YA 5KO2A 3VMFA 1XWIA 2JASA 4MGZR 4DIEA 4ERNA 1N5IA 4D25A 4X8MA 1FP7A 3IQXA 3TUZC 1TTTA 5EUQB 1QHYA 2YWGA 1E6CA 1U98A 3B82A 2JEOA 1GUAA 4MKGA 2NO7A 4KXFB 4JL5A 3MGCA 3Q3JB 2HDNB 4Y0VA 3FMOB 1WP9A 2ZJ8A 1JI0A 4Q1EA 1G7SA 2JATA 4JLMA 4L9WA 1CJUC 1XRJA 4C0QC 5FUWA 2KBEA 1XPOA 2P0EA 1E2LA 4UXIA 2OEPA 5JCZA 4ARZB 1H65A 4NCHA 2O8CA 1OIWA 1I4DD 5JFGA 5CIQA 4N1AA 4O25A 3H84A 2GZHA 3OHMA 1IXRC 3K70B 4PPNA 1G1MA 3I73A 1N25A 1W2HA 1N6RA 3CNNA 1XZQA 2KJQA 4C9BA 4GI7A 3EPJA 1Q57A 3Q5EA 2ZS7A 2JLWA 2EWVA 2ZVQX 3GLHA 4C30A 1KY2A 3HPRA 4IEIA 5J40A 3EA0A 3CPHA 4Q4JB 5CIWA 1T3LA 1WF3A 3LVRE 2IYSA 4TQ9A 4Q00A 5JSZB 1M7BA 1UBGA 3NG1A 4RZ2A 1F2TB 3GLHB 2JLSA 3OIVA 4YDHB 3NEJA 3GPLA 2Y8EA 4HUQA 4NONA 2J87A 3F5FA 1S96A 2NPFA 2QG6A 2VRWA 1TL7C 1CRQA 1MABA 4JVMA 4OHXA 4D81A 2ODWA 3FHCB 1FOEB 2CHGA 3CX7A 4NYIR 3CR7A 3RWMB 2O52A 1TADA 2RB4A 4M4SA 2I1QA 3LRPA 4YONB 4I99A 1NMZA 3T61A 2ZRBA 1G20E 1OFUX 3FHOA 2C99A 2OFXA 1AGRA 3K0AB 1R0XA 5AUQA 3IPYA 1YJ5A 4FMCB 2GHIA 5E7MA 2DPXA 4KLZA 1KI4A 3NDBB 5K8LA 1XJQA 4DDVA 1R4AA 3DM5A 2A5JA 2NG1A 1A1VA 1TU3A 1WDTA 3K8YA 1W2GA 3U7GA 1Q3HA 1NL3A 4CEIB 4X8OA 1IHUA 4MA4A 1NF3A 2WPDA 4A9AA 2ZREA 2CK3A 3GLFA 3QOFA 1E2IA 2DB3A 3T5GA 4TL6A 1SGWA 3KQUA 1KI1A 1VCNA 3NTUA 5LPNA 4US0R 1KKMA 2PLRA 3OESA 4MUBA 1BYIA 3HDTA 4S2EA 3UMSA 4PAOA 3TSZA 2IHYA 2WWYA 1W0KD 4QC2A 2BJVA 3BH7A 3I8XA 2ZI7A 3A36A 3U7HB 1CULC 3NWJA 3BGWA 1KI9A 1COWD 2HLDD 4BGDA 2A7QA 3AF2A 4MRSA 3M4YA 4NZYA 5HCNA 1QHHB 3GJ6A 3R20A 1IY2A 3GLFE 3ASYA 4UJ3A 2H8KA 3AGQA 2D62A 3KB2A 4MYTA 3ND8A 1ZAKA 3ICEA 5AUPB 1E2QA 3CM0A 5L3QA 3ASZA 2JAQA 4R2IA 5KHOC 1YZNA 2ONJA 2QUZA 2GAOA 2QMOA 3LDAA 4BRWA 3AVXA 1KI3A 4ZKDA 2H16A 1NLYA 1IXSB 1OB5A 3TRFA 4X8LA 2PH1A 3TAUA 4RD4A 2R62A 5GJWC 1IBRA 1N6PA 1GL9B 1NMYA 1PZNA 2R6CA 3QEOA 5KSOA 3E2IA 4OHWA 4TLCA 1T8UA 2X2EA 5EP1A 3A58B 2J3EA 5UKDA 2EQBA 2YINC 4XOIA 4BFVA 1P2SA 1QHSA 4Q9HA 5JJLA 4NE2A 2XX3A 4EIWA 1HT1E 2WZQA 1HUQA 2G77B 4URYR 3FFAA 4LJ8A 1E99A 4KI0A 1F48A 5FI0B 3H1TA 3Q8XB 3VNVA 2ZRKA 3I72A 2CMKA 1GNQA 3AQ4A 2D4HA 4DXAA 1LV7A 5IRCD 2XGJA 2ZR0A 3ZDQA 1N6HA 3NBZC 3QPWA 1E9SA 5AK0A 1GL6A 5G41A 3WHLA 1ZNYA 2NOAA 2IEZA 4QJ4A 1SVLA 2DHRA 2C9CA 3HU3A 4OI1A 3WXMA 3ZD7A 1FL9A 2ZUDA 1KMHA 3ND9A 2WOJA 4B73A 1GSIA 4AC9A 5FPKA 4E22A 2V7QA 1TF5A 2WKQA 1UJ2A 1ZC4A 5JJIA 1HA3A 5GJCA 1RW4A 4W5WA 1QHGA 3IIMA 1NY5A 1UEIA 3VTKA 4C7OB 1EFRD 1L7VC 1UDXA 1D9ZA 1DVRA 3MAAC 2WVJA 4PPGA 3V4FA 5HZKA 1VCOA 4QHSA 4EPYA 4KVAA 2FDCA 3FKSA 1YZTA 1TQ6A 3K09C 2GCOA 4BFYA 3BE4A 1SHKA 4URZR 4CEJA 1T5LA 1R5OA 2BBTA 2ORWA 1RPZA 421PA 2Q9CA 4PQFA 1VG1A 3MJHA 3CONA 3QY0A 1FQKA 5AJVB 3AVPA 3C41J 4NYJR 4OYHA 5DN6D 1OXTA 3MWYW 3REFA 3D7MA 1GZSA 1G19A 2EYQA 1KTVA 2R9VA 2UVQA 3KUCA 3ZZTA 4C2TA 3LX8A 4UQOA 1TNDA 2BBSA 2VP0A 3U3OA 4ESVA 4BZPA 1EK0A 4QHYA 2FZ4A 3CWZA 5KPDA 3DZDA 5C46F 3BJIC 1G4AE 2GBLC 3Q9LA 1M7GA 3EPKA 3F8TA 4Q01A 1KI6B 4M53A 2JLRA 3DVLA 621PA 2A2ZA 5FPHA 2RKOA 5M04A 1SVKA 2A5DA 3BB4A 3L0IB 4Q9LA 5CYOA 4TYPA 5EZ6B 5FTJA 5EE9A 4DRZA 4AYXA 5EJEA 2W0MA 3FPAA 1CF4A 2W6IA 1W49A 1DAMA 4DJTA 1RIFA 3PUZA 4PC3A 4QGAA 3A37A 1NVUQ 1Z83A 4CW7A 1T91A 4PSAA 2ANBA 5HCIA 2O8BB 3AKDA 5F2EA 2QQ0A 4BQSA 4TLDA 3T35A 4KODA 4P32A 4TYYA 2ZJOA 3CRW1 3HJNA 4R9UC 4BFSA 1KI8A 2IL1A 1EG7A 2NQ2C 3O8CA 4LWZA 3BRWD 3CRQA 2QSYA 3QVVA 2IYTA 3PJRA 2F3TA 3QF4B 5DHAA 3VR1A 4TSFA 4W7SA 2Q3MA 3RS2A 2V6IA 1AZTA 3IUYA 5DI9A 1TF2A 1OFIA 3VR4A 3W6PA 3W6OA 1X86B 5G3YA 3NXSA 4PPFA 4KFSA 4TYNA 3A1TA 1VHTA 5EZ5A 3SZRA 1U94A 1YR7A 4AKGA 3IO5A 4OJKA 1DARA 1NSFA 1JEDA 2ANCA 2WPDD 4MYHA 4TLAA 1J90A 3X1WA 4I4LA 1MO3A 5KTYA 2FPLA 4Q7MB 1EFHA 3I62A 1E98A 4KFUA 4N3NA 2YNMA 3VFDA 5JEDA 4HB3A 1DG1G 1ZINA 2GK7A 4FXPA 4TWZA 3GJ5A 3CUEF 1CR1A 3EAQA 5CK4A 2VH5R 1W0KA 2ZJ5A 3AVTA 2P6NA 4DB4A 2QAJA 1E9BA 4ARZA 3K70C 3IIJA 3W34A 1G291 4MKHA 1YQTA 2BJWA 3F0TA 2DFTA 3W3ZB 1Z63A 2ZROA 1T0JB 4A2PA 2FFAA 1QHIA 4GOJA 2ZR9A 2AX4A 5FL3A 2X77A 3ZZ0A 3LVQE 4IW3B 4BEJA 1E2MA 3T34A 1JEEA 2RHDA 4HLDA 2EU8A 2BM0A 2QTHA 4OK5A 3LLMA 4KBFA 2B21A 2YJTD 2JA1A 3AVWA 1CS4C 4C0JA 1P9RA 3SBDA 4WZAE 4DB2A 4LBVA 4YMSA 2VP9A 2J7PD 4TYWA 1D9XA 2V8OA 2YC2C 4NH0A 4RSGA 4US1R 3ZYCA 2CE2X 3SU8A 1XBTA 1GKUB 5J4LA 4DLTA 5JEEA 2WAXA 1I2DA 4QM7A 3BB1A 1U99A 1XFAA 3LXRA 1IN6A 1AQYA 5KYKA 3K70D 2O8BA 3K53A 3CB4A 3KFVA 4BZXA 1DAHA 4HLCA 4GP7A 1NKSA 5J4YA 1E69A 2W6JA 4QBFA 3EPLA 1HTWA 1BYUA 5H68A 4EPVA 1Q1BA 4IOJA 4LJ5A 2HXSA 3CH4B 3RABA 3RYTC 1ODFA 2D2EA 3TUJC 4ZI2A 2MSCB 1JQJC 4DC9A 4JYBA 3T1OA 2ZM5A 2QM7A 2GJAA 4Q1BA 1SXJA 2CCJA 1E1RD 4B44A 1LS6A 1SQ5A 4PANA 4TQAA 4BFXA 2AWOA 1P7CA 1JXMA 2H17A 2W00A 4Q1CA 3VX4A 1S3SA 4U02A 2E87A 3K0FA 4DT1A 3NC1C 4JL8A 4WXPA 2H5EA 4BASA 2O0JA 3L0SA 3PENA 1NMXA 3SI7A 3FMIA 1OH6A 2FSHA 2UZIR 3LBNA 2WWIA 3FKSD 5CLLA 1JALA 5F9HA 1N3BA 2VP2A 3P4XA 4B76A 1E2HA 2GNOA 2CLCX 1P3JA 3CLVA 1CJKC 2F1IA 2A5GA 2XOKD 4HZIA 3L82B 2GCPA 2D3WA 4IOMA 2WMNB 5EP2A 1G17A 1EX7A 5FUVA 4ZV4A 4IFEA 1R5NA 2QM8A 5DHFA 3VKHA 3EZ6A 2JLXA 4NYMQ 1FMJA 2WBLC 4C7OA 1RC8A 2Q3HA 2C5LA 4M1SA 1CEEA 4M9XA 4HAZA 4LYFA 4GBMA 3LQQA 1YR9A 1W4BA 4B2PA 3EWSA 2ZRMA 1ZM3A 2Q9BA 2QPAA 2O8FA 3KJHA 2YOGA 5JRJA 1X8JA 1YZQA 2NZJA 1NN0A 3HPQA 1RYHA 1SVOA 4HZUA 4LBWA 4N0EA 2WWFA 4IKEA 2BDTA 3OIYA 5TDHA 1A2KC 4CYMA 2R6GA 2HCBA 2ZAMA 5L8VA 4ZCIA 5K8TA 2HJGA 4W9MC 2F9MA 2O8EB 3U6BA 4A1FA 4LYAA 3KXIA 2B6HA 1NN1A 3Q85A 3EWAA 2Z5FA 2DWPA 2RGAA 4PSKA 1XTKA 2ZE6A 3DPUA 3U60B 3ICQB 1M8PA 2VPPA 3LFUA 3ZIAD 2WOOA 1IQPA 3DM9B 1XPUA 4UXJA 1JJVA 4D4MA 4NPHA 1NJFA 4AKEA 2D74A 1QF9A 1BIFA 2F1HA 3BBPA 3R9WA 1QVRA 4LSGA 1JBKA 1FX0A 4PZLA 3K0AA 1W4CA 2CL6X 2J0QA 2FMXA 1XTRA 4Q03A 1MO4A 3K0EA 1GWNA 1RRCA 1IOZA 1P6XA 4TL7A 5BN3A 3SQXA 2ZSDA 2WM9B 1UBCA 1SVSA 3LA6A 3QG5A 3B5JA 1OFTA 5GVSA 3ZIAA 4JLDA 2W0SA 3OEEA 4KYUA 4M21A 1YZLA 3SNHA 1ESNA 1JPJA 2ZI9A 2BBWA 4BZQA 1S3GA 2CHQA 3UKDA 4II7A 2OO7A 2DFKB 5H1YA 4LHWA 1KK1A 1E3MA 1P4SA 3RS0A 1ZD8A 2XSZA 3TQCA 3DMNA 1UKZA 4Q02A 4YMWA 4IOLA 4CRWB 4MRNA 4DLYA 4DVGA 5CB6A 1DAFA 4LHVA 4B6EA 3PG5A 4B3GA 3RANA 2ZE8A 2ZJAA 1YR8A 4FINA 4B71A 5FBRB 3H0KA 1Y3AA 4TN1A 1R0YA 3TGPA 3D6TB 3U61B 2XTMA 3L2OB 4U7DA 4XVUA 2OXRA 1PUJA 5BN4A 3M1IA 4FIDA 1N0WA 4NTZA 3AKEA 2R6DA 1UKYA 1GG2A 1GILA 4GRAA 2GF0A 4Q4HB 1JECA 3AV0B 3E70C 3AF1A 4DUGA 3BORA 5HPYB 1GRQA 2OILA 1Z0IA 1TAGA 1NP6A 4IVPA 4YMTA 3SDZA 2V1UA 1E2GA 1IN8A 2FZLA 5IK2D 2RGBA 1TMKA 4RZXA 2R44A 3FVQA 3TIFA 3DHWC 3GLIE 2FOLA 1FX0B 1ZBDA 1GNPA 3CRVA 1SHZA 4LY6A 4BEBA 4E5UA 1K8RA 2UKDA 4UNNA 4NU0A 4YC7A 1S4QA 1UAAA 1KO8A 3X2SA 1VECA 5CDFE 2BWJA 2OE2A 4JLPA 2J9RA 2F43A 4NHOA 3DOEA 4TMVA 4FI3C 2N1BA 1E2KA 1UPTA 4US2R 4JBXA 1G8FA 3WP1B 1FP6A 2P5SA 2XJ4A 2CBZA 1F6BA 3GEHA 1KZ7B 1G8PA 5D3QA 1M74A 1Q22A 1T3HA 4LRWA 2A78A 3SQWA 2NGRA 4V0KA 2IXEA 4IDHA 3BFKA 5SZHB 2ZSBA 2VTKA 4OK3A 1GAJA 3SHFA 1N6OA 2QORA 5A5GA 1KK0A 2XNSA 3KXLA 5EXXA 3AB3A 2FFQA 2ZSEA 3OAAD 4OI2A 4KO8A 1YU9A 3NVAA 1P2UA 4A0GA 1L4YA 4EAQA 1E79A 2KWIA 1XU4A 4JSYA 3GLGB 3GFOA 5B64A 3P20A 3HWSA 3B1YA 1RZ3A 4G0NA 1PLJA 2CDNA 1AM4D 1I4TD 1Z0JA 5C1BA 2ZE7A 4KV9A 4B2IA 1G64A 1HV8A 3ZQ6A 3RRMA 4RZUA 3MWLA 1AS3A 3JZAA 4NL4H 5DLQC 1II9A 2IYXA 221PA 2ZTSA 4L4UA 2YWHA 3W8RA 4D6PA 521PA 4DSOA 2IS6A 2C8VA 4FMDB 4HATA 2ZEJA 3DOFA 3I92A 2REOA 3RDPA 4ZPXA 4QJ3A 2ZYWX 4AI6A 1HYQA 5L3VA 2WMOB 1P9WA 1J7KA 5BWMA 1ZJ6A 3CF2A 1A2BA 1P73A 2IXFA 2P3SA 4BECA 4NDZA 2UZ3A 4PHHA 3KJGA 3VX3A 3SJAA 1UDWA 2QE7D 1W36D 1KO4A 2IS2A 2GXSA 4G5GA 4XWKA 2QENA 3SC3A 4UNRA 4MKFA 1DG3A 4CIDA 2GRJA 4P3YA 2FA9A 3PEWA 2C77A 5CJPA 5FTNA 4FCTA 1E0KA 2OSBA 4HAWA 2Q0HA 1ELOA 2GVZC 1OF1A 4JVNA 3WBJA 1DE0A 1Z6XA 3AVQA 5E95A 3M6AA 3AVOA 1SXJC 4B3FX 1UADA 5JJKA 3ZVNA 3WNDA 4P0TA 3KZ1E 3T15A 2YWEA 4FWTA 1VYUA 3ZJYA 4ZDJA 3JVVA 2IC5A 2P67A 2V55B 4QNRA 1D6JA 3MG9A 4TMWA 3TJZA 4A0RA 4QM6A 5HR5A 3TNFA 3GQBA 4Q4AB 5L3QB 3QXCA 2N46A 1OH7A 1WMSA 3LW8A 5SZIA 2BV3A 1U8AA 4JKYA 4Q9IA 4CGZA 2V7QD 4TMTA 4WZBE 2F3RA 1G3RA 4JT4A 2GAAA 2ORIA 3GLHE 4WZ6A 2GJKA 3QXSA 2QEQA 1BOFA 4ILEA 2Q9AA 1FUUA 4HYYA 3FKQA 1KSJA 3P32A 2VIIA 1EWQA 1WA5A 2YHSA 1LF0A 4LK2A 4X8HA 3FTQA 4LJ7A 1CJMA 1IXZA 1SKYE 2FFHA 2PEZA 3W3AA 4EJSB 4EQ6A 5BYKA 3PVSA 1KI2A 2QT1A 4H1UA 3HYTA 2IYZA 1CTQA 3K0FB 4DT1B 4ZCMA 5CITA 2K5UA 3CW2A 4DIDA 1P2VA 4MKIA 4FCVA 1E2PA 1W7AA 3GJ3A 1AZSC 1GVNB 1R5BA 1SXJD 1DPFA 2IHBA 1JR3A 2AL7A 2IYLD 2IK8A 1XCPA 1XB2A 2DY1A 3WRXC 4LPSA 4LC1A 2VHCA 1GKIA 2ODNA 3QUSA 4PC2A 2ZJYA 4CEIA 5A0FA 3NBXX 3U44B 1AQUA 1KDOA 3QKUA 4JLOA 2R6AA 3C14C 3AVYA 4QBGB 5AUNB 2DFLA 3BOSA 3EW9A 2CK3D 2QRNA 1KMQA 3R7WB 4ACBA 3ADCA 3THYA 1XTIA 1PV4A 3TUIC 4MGKR 3RS4A 5JS7A 5HTKA 1G8YA 1AKYA 4DEYA 5D3MB 4ZI3A 1E9CA 5DI3B 3UWOA 1U9IA 4EDHA 1RKBA 5FPTA 3VQTA 4DCNA 1MRSA 1U8ZA 1ESMA 5FUXA 1CRPA 4LHYA 2PMKA 1XXHB 3ZVLA 2B8WA 3TBKA 2P5TB 1VIAA 3IDQA 2XXAB 3LY5A 3E5HA 3I3SR 5JHGB 4L5BA 1YRBA 2KB0A 2ZRDA 3OFNA 1JAIA 4WAUA 4PHFA 3UMFA 3LWNA 4HAXA 2O8DB 1MABB 3EIHA 2W2XA 1W48A 1ZM4A 3IKJA 5FOVA 1E9DA 1H8EA 2FPKA 2RGGA 4PR0A 1ONBA 4D80A 3AP1A 3I32A 4DCUA 3E1SA 3T12A 4KU4A 4WXRA 2IWRA 4B48A 1GRRA 1R0ZA 4R71A 5JSZA 2JJ2A 1P9NA 4JIMA 1T3SA 2GJ8A 4OHYA 4RFVA 1KAOA 2Z6VA 4FD2A 2NMVA 1GIAA 4L16A 1FTNA 2GJSA 4GL2A 4I1VA 3C5HA 3L0PA 3QBTA 5FPYA 2NTYC 2Q3FA 1HURA 2E1RA 2XITA 4BLQA 2EFDB 1HE8B 2BEKA 1Z28A 3CX8A 3SFVA 1KO5A 2IXGA 2VHQA 2WSSD 4RJLA 4JLVA 1EFTA 2VO1A 1EX6A 1N0UA 3AH8A 1B0UA 3B1WA 3LLUA 4OQXA 2RH5A 4AG6A 5FH9A 1OIVA 5KSYA 3AF4A 3L8YA 2IX3A 3Q7PA 4LJYA 4GDFA 3L0OA 1U90A 3RWOA 4AK9A 2ZS9A 2ZYUX 2FGKA 3KTAA 3HR7A 1WB9A 4K46A 1ZU5A 5FBQB 2F55A 2FNAA 2V1XA 4TLEA 2AHOA 4HAVA 1U0HC 4JS0A 1NN3A 4D82A 5FOWA 4Q7JB 1A5TA 2ODEA 4RFSA 1R10A 2JIZD 5FBWB 4MDEA 1D2EA 4QOSA 2BMDA 3FDIA 4RZ3A 1F60A 4XWOA 1VYTA 3L43A 5EP3A 4XSHA 3PUWA 4L8GA 2VSOA 1EWRA 1G8GA 4BFTA 1PVOA 1YZKA 2B92A 5DYGA 1G5RA 3SJCA 2KSQA 4A6XA 1MV5A 3KKOA 4M9ZA 1RE0A 1KDPA 4PAMA 2PJRA 1E2NA 4A4DA 2BMEA 1V43A 1S1MA 3WHKA 3OEHA 1NLZA 4CEHA 4A0HA 2O0KA 1QHNA 2P2LA 3WNBA 5E7IA 4BUJA 3NC0C 5EQTA 1R0WA 1O87A 4GSYA 3K0SA 1XXHE 4TT3D 4DUGD 1IAQA 3AUXA 4KBGA 1OFHA 2AR7A 2PLFA 3RC8A 4M1YA 4FN5A 2CLSA 1KI7A 3MMPA 3MUFA 4B6FA 5JZVA 1SULA 1EGAA 1G7TA 3IGFA 5CB8A 1UBEA 4HLUC 3A1SA 2GEUA 2CCKA 4KSBA 3WRYC 2HT1A 4Q9KA 4GPTA 4DCVA 2O8EA 1MT0A 2REXB 2J46A 2V3CC 2F9LA 1N2CE 3CZQA 3IBGA 1ZRHA 4KITB 3IILA 4PQYA 4W5JA 4CF7A 3NDPA 1E0SA 2XOKA 5KSZA 4LBYA 1D2NA 1DAIA 1MO5A 4RCYA 1RRPA 4KYIB 3QSYA 5CDFA 1S0UA 2FSFA 4OK6A 3WMGA 1Z0KA 3KQHA 3RSOA 1XTJA 4D4LA 2ATVA 5FPSA 2ZU0C 5TARA 2OZEA 5JMTA 5FL7A 3DEFA 3V9PA 3ADBA 1WCV1 2V6JA 3I4LA 3RC3A 3CH5A 3KKNA 3B8HA 2VP5A 1KGDA 1OHHA 3WYGA 3C5CA 2WIAA 4I1OA 2AKYA 4LI0A 3T1VA 2KI5A 2IUSA 1CKEA 4HB4A 1CR0A 1G7CA 1QVAA 5AJWA 1TEXA 2EWWA 2X8AA 2CVHA 1E9RA 2GJ9A 2GXUA 3RNLA 3VU9A 2AXNA 3W6NA 1KDRA 1SKQA 1UM8A 4CVNA 1M7HA 1F2UB 1ZD1A 1S1CA 4KJZA 3TVTA 4BRUA 1Z3IX 3HU2A 4UKDA 5JRZA 2HF8A 5K8IA 2FE4A 2IS1A 4S35A 2VHTA 4Q19A 3BIFA 2ATXA 4DLZA 3DKPA 3QQ5A 4OQNA 1KZGB 5JHHB 3PQCA 4OHZA 3GLIA 1W4AA 4O0MA 2NIPA 2QAGA 4GMXA 3OE7D 4WOPA 2OHFA 3BAFA 4A36A 1HE1C 4BFUA 4EPRA 2IYWA 1YR6A 5LBIA 1V5WA 2NO1A 4Q1FA 4BWYA 1IJFA 3UPUA 1KKLA 4A82A 1Z22A 1X1SA 3N5CA 3I8SA 2H1LA 2OUKA 3RS5A 1QG4A 2REBA 3U7FB 2VHJA 2PEYA 1DAKA 3K1JA 5GJVC 4DDTA 5JCPA 1G6HA 1XJ0A 2ZSFA 2D2FA 4MRRA 1FNNA 2RCNA 1CU1A 3G82C 3QPUA 3KKPA 3VR5A 2WV9A 4QHTA 3JZMA 4A8JB 1ZNWA 3OFND 4DKXA 2J7KA 2QTFA 1KOFA 2J45A 3KTAB 4UXHA 1Q20A 3EG5A 4LZZA 5FR2A 5SZJA 3P27A 4Z8XA 4H1VA 4XH9B 2AFHE 1E96A 2G1KA 4WW0A 2RGNC 1KYIA 1Q12A 3OIWA 4RCZA 5FOUA 1OT3A 2P6UA 2PZEA 5DE3A 2HF9A 2V4ZA 4LPKA 3ZH9B 2IF2A 2OFWA 2VF7A 5C2JB 1SVIA 2H7VA 1RVDA 2VP4A 1BH2A 3GJ7A 4TQUS 2ZAOA 4EPXA 4HB2A 3KJEA 2WSSA 1KSHA 1WXQA 2GKSA 4GFDA 2J59A 4JJKA 2WJGA 1XEWX 3A8TA 3FE2A 3VR2A 4E09A 4O2RA 3NIBA 5TXGA 4D4KA 1XMVA 5LD2C 1GRNA 4ZIRA 3ZVMA 2MMGA 3UMRA 3SJBA 5B30A 2QQEA 3GEEA 2OCPA 3WBKA 1IM2A 1UKVY 4PO1A 5E7JA 3K9HA 1OSNA 4KCGA 1N5KA 1NVVR 5FR1A 2CVFA 4Q4LA 2QGZA 4D4JA 4B43A 5DISB 5SZKB 1E9EA 3IHLA 2WWHA 3AVVA 3UATA 4DWJA 4IDOA 5DI3A 5BN5A 1DAEA 1LFDB 1JR3D 4KLNA 1GL7A 2BM1A 1OYYA 2ZRCA 5EXTA 4RD3A 4R7ZA 4HSEA 1UFQA 4RVCA 2PMDA 1VIYA 1P5ZB 3OIUA 1XPRA 3NKVA 3QF4A 5HE8A 4LGMA 4M1TA 1VYVA 1KI6A 4DCSA 1ZM2A 1KSFX 2WAYA 3PXGA 4TT3A 1XD2A 3TQFA 4KAXA 1E79D 2AN9A 2V9PA 3IPXA 3THWA 1AIPA 4G5QA 2BMFA 2OBLA 3PEUA 4JYCA 4Z1MA 4DSTA 2ORVA 3AF0A 1XEXB 3T1TA 3IHWA 2QP9X 3NH9A 4HAYA 3A6PC 3H4MA 4YXWA 2ZRNA 4FMDF 4URWR 5CM9C 5AJYA 1N6LA 1NSTA 2VEDA 2QA5A 4JZKA 1GFIA 4AKIA 4DSUA 3W9YA 5KDDA 3U4QB 2OESA 1CLUA 3N2EA 4XD7D 2J0UB 1E1QA 1YZUA 1JNYA 2WJJA 2BVNA 2WKPA 2OCBA 2H18A 3B6EA 3KX2A 1XEWY 3PUVA 3K0CA 4G5SA 4D26A 3EC1A 3NH6A 2PZFA 3HR8A 2XTZA 2FEMA 2PJZA 3RVBA 2ZANA 5KOYA 1GNRA 3OAAA 3GD7A 5FL7D 4A92A 5BYJA 2AXPA 4LX0A 1EFUA 2GEDA 3AF3A 2QE7A 3SE0A 3UIEA 3W8NA 3PEVA 4A2QA 1NVXQ 4EQ6B 3EA5A 1BMFD 3LX5A 1G9XA 1OHHD 1E4YA 3AKCA 4Z54A 2GCNA 1ZIPA 3O47A 3R8CA 1DELA 4P31A 4POAA 1XCMA 4RD6A 4ASUA 1Z6AA 1ZW6A 1QG2A 5F98A 1Q21A 4GZLA 2YYZA 3DZ8A 4OHVA 1E4VA 2IUTA 1GITA 1J70A 1KHTA 3WMFA 1T6NA 2YV5A 1KO1A 4QGFA 1Z6YA 2IT1A 2PBRA 2YVUA 2QAGB 4M1OA 3BXZA 3UG7A 3FOZA 3NBFA 2G0NA 3BH0A 6Q21A 4GNKA 3CO5A 1G16A 1EFRA 3MRSA 1P62B 1T5IA 5GVRA 4HLUA 1RFLA 3GP8A 1VTKA 1Z2CA 1K5DA 1JB1A 1SZPA 1KMHB 3THOA 1AS2A 2QPOA 5EE1A 1N5JA 1ZM7A 4XTCS 3N70A 4NCNA 4Z8YA 5JS8A 1LTQA 4DDUA 2H57A 1G8HA 4F4CA 3D8BA 3VKGA 1GTVA 2OXCA 1IN4A 2Z83A 1E0JA 2GETA 2ZUBA 1W36B 3KJIA 4GOKA 3MLEA 1N6NA 3PCRB 4UNSA 5DN6A 2IF0A 1WBDA 2RGDA 4QXAA 2BMJA 3Q5DA 1T4GA 1VG8A 4RD0A 3BH6A 1T8TA 1C1YA 2IWHA 1U81A 2GEVA 3QPVA 4WA7A 2D06A 4ABYA 2GESA 1YE8A 2BEJA 4HDQB 4LV5B 1JAHA 4JLBA 1XEFA 4O2LA 2QPTA 1B23P 3IBYA 1W0JD 1ZUNB 3DDCA 3LAWA 3TH5A 2B7CA 3X1DA 4QG7A 4B33A 4GZMA 2RGCA 2RHMA 5LB4A 1DTSA 5J5CA 3FFBA 1ETUA 1W5TA 1WE2A 5IDVA 4HDCA 4BFWA 2RGEA 1VCIA 3QXJA 1QBKC 3NEYA 3BS4A 3QXXA 4QGGA 4C3ZA 1KJZA 2GK6A 2BCJQ 4QJ5A 4MYCA 1GOTA 2LKDA 3SHWA 4B3XA 2WWWA 5AJXA 3P4YA 3LH5A 1ZUIA 1W0JA 1NBMA 1U9IC 3J81k 3SYNA 4DSNA 3KDSE 3R8FA 2VYFA 3GFPA 3PUYA 4U5XA 1XD8A 1Z5ZA 4WBSA 2J0SA 4PSVA 4PO8A 2HCJB 4GT1A 4PHTA 2G3YA 4M1WA 4KHZA 2C9YA 5EXSA 4XSGA 4Q1DA 4IVQA 1JXOA 4Z51A 2BOVA 1S9DA 2A3RA 4JLAA 4LJAA 1XMIA 1LVGA 1Q1ZA 2C04A 3B13B 1N6KA 4MUAA 4B32A 3CIOA 3HP1A 4TSFD 4Q1AA 2WWXA 2GVDC 5P21A 2HEIA 2WJHA 1IJEA 1ZVQA 1CR2A 4OJQA 1XEXA 2OM2A 4BE7B 1A7JA 1FZQA 1RJ9A 3OF5A 3WNCA 5KNDA 4RKEA 4PZYA 2QBYB 3QKTA 4F7WA 1JR6A 2ZSAA 3PR1A 5ELXA 1JQLB 3NHAA 4HEJA 3DO6A 1N5LA 1P60A 1XMJA 1I2MA 1CR4A 1H8HD 2IYUA 3N2IA 5TY0A 1X3SA 3H86A 4ZDIA 1Q1QA 4MGIR 3CX6A 1GM5A 2ZE5A 2PT5A 1D5CA 4MDFA 5IT5A 4IVRA 4HI0E 4PQRA 1Z0DA 4XTRA 1XXHA 1NN5A 2AK2A 1JPNA 2WIBA 3SYKA 2CJWB 2RGNA 1IN7A 1U0JA 1VMAA 4OQFA 1G3MA 3LXXA 4OI0A 3UG6A 3ZS9A 2PCLA 1Z08A 2ERXA 4EKDA 3K9NA 5D3MA 1PJRA 5IHPA 3GLGE 4QFMA 1LF5A 2QP3A 1NVVQ 1IONA 1TEVA 4IDPA 4DHEA 1NIPA 1AKEA 2QT0A 1C9KA 1P2TA 3U44A 5JWHA 3MJRA 3B2EA 3MFYA 1P72A 1QRAA 1BKDR 2J5XA 4K81B 1XDBA 5GADl 5LD2B 2PX0A 3QJYA 3T06B 3CF0A 3WP0A 4LCBA 1FTSA 5J4KA 2JLQA 2J0VA 4PHGA 4EFMA 4TYQA 5J4HA 3WYAA 2CHVA 3G0HA 1VHLA 1TQ4A 3EZ9A 2PZGA 4P33A 1Z06A 1KJYA 4TTQA 1ZNXA 2NZ8A 1TPZA 3M0EA 1DEKA 1OYWA 2F6RA 2NO0A 5HE9A 4CT5A 1M6NA 1R2QA 4Q4JA 4QNMA 3BERA 3SJZA 2Z0MA 4BLPA 1DO0A 2A9KA 1XTSA 1G18A 2IYVA 2RGXA 2GILA 2FSGA 1HH4A 5TB5A 5IK2A 4AYTA 1TQ2A 1XMSA 1Q1EA 2NPIA 4ZO4A 2ZI5A 4EPTA 1L4UA 2B7BA 4DBLC 1T0HB 3U2QA 1G41A 1XJCA 4TMZA 4F93B 2CL7X 5CK5A 1VKJA 3K9GA 3KXKA 2G88A 4LC0A 2YKGA 5A4JA 1UKEA 4V0ME 2W6JD 3C8UA 5H70A 4EJSC 4UJ5A 3B85A 1U0LA 3G5UA 5JWRA 2CNWD 3ZGXA 5J4VA 4JVLA 2G0TA 2JLVA 2R6FA 2WWGA 3AP2A 4B75A 4ASUD 3BD9A 3K9LA 4JBYA 5F3WB 1FFHA 4YMUA 4LYHA 2VHUA 1OXUA 3EARA 2E9SA 3QXHA 3BFVA 2JJ1A 2AKAB 4LV6A 2XB2A 1ZUHA 4ON9A 1JJ7A 2AFIE 1W47A 3CNOA 1OIXA 3B1ZA 1S8FA 3TK1A 4DLXA 4EFLA 4F91B 1S9HA 2XTNA 2DWOA 4KFRA 4TL8A 3LBHA 1P61B 4AD8A 3ZQJA 2WTUA 3QEJA 3TLXA 1EFCA 4D2IA 1J99A 2ZU6A 4PO9A 2ERYA 1J8MF 1PLLA 3GMTA 2ZJZA 2A30A 4PXAA 4YLGA 2WICA 4J0QA 4I1UA 4K8OA 4XJXA 2ZRHA 4LYJA 1IN5A 1MR3F 2LWIA 4P4SB 4BLTA 4LBZA 4TZ6A 1F3OA 3I1FA 2Q6TA 2CCGA 4ZKEA 1RRGA 5KNCA 3ZVRA 2ZITA 4M1MA 4OI4A 2QNRA 4FW9A 1G3QA 3TVDA 1F2UA 1C4OA 1DBSA 3WY9A 4F4IA 2O8FB 5G40A 4FMBB 2HJVA 5TVKA 5JWOA 4AKHA 4G1UC 5JBQA 1R6BX 2ZI3A 2Z4RA 2ZI4A 4H9GA 1OPXA 3MCAA 4URUR 2DYKA 2CL0X 5ANRB 4M8NE 3X1XA 1JR3E 1E9FA 1GKYA 2QROA 1II8B 2AD5A 2GCOB 2JCSA 3CPEA 4HB0A 5CYPA 5FTMA 3A4LA 1NLFA 1II8A 4JT2A 3LQRA 1RYFA 4L9SA 2X2FA 2VSFA 4YXWD 5EE5B 2QAGC 2P6RA 2ONKA 4JVSB 1ZD9A 2SHKA 1QHXA 1G21E 1G7RA 4ITRC 3IEUA 2IYQA 3OE7A 3EASA 3F3YA 5AJZA 3KKQA 4G3XA 4PZZA 2WSMA 3TSOA 3TE6A 1H8ED 4NYMR 1KSGA 3U6KA 2WHXA 2ZR7A 4C0KA 2XZPA 3PEYA 4RKFA 3IO3A 1VCMA 4PC7A 2W2VA 3H2YA 4AWXA 3GJXC 4NYJQ 4LJ4A 2JJ2D 2P65A 1SVMA 2Q21A 4JBWA 1K5GA 5FTLA 2TMKA 3R9XA 3D3QA 4TZ0A 2IA5A 4IDNA 4OL0A 4B3DA 4M1KA 3U3MA 1TF7A 2I1VB 3QVUA 4DDWA 4IFBA 2F43B 4OBEA 4PX9A 4A6PA 1WBBA 2PX3A 4KFTA 1NY6A 1MOZA 1H8HA 3X1ZA 3PIRA 2EW1A 4LUCA 3QNUA 4RFSB 3DMDA 4AY2A 2QU8A 2VSXA 5EUMA 2OV2A 4HLQB 3CKLA 1I4LD 1LS1A 2MSEB 3LBIA 3FHTA 3AEZA 3GCGA 5EXPA 4Q47A 4CEHB 5HZHA 2ZXUA 2FSIA 1VG9B 2HYDA 1O3YA 1CP2A 4HDOB 3RRNA 2C95A 2FX3A 3AP3A 1KY3A 3QENA 1OXVA
chains in the Genus database with same CATH superfamily
4KFCA 5DLEA 3ZW9A 2F7SA 1WNFA 4OJMX 3OPNA 3KSAC 3BIJA 2HSWA 3MD0A 4KE8A 3VO2A 3K1TA 2GXQA 2PWBA 3G2HA 5DNAA 2RK4A 3QVXA 1PHPA 2ZDHA 3E9YA 2VT3A 1NZJA 3FWPA 3K72B 4N5LA 5KSPA 4CKBB 4HUTA 3FYUC 3MXOA 5JMPA 5FOTA 2QRUA 2I7VA 4W82A 1ZA2A 1BOOA 5JNWA 2GBFA 2A7XA 4LWPA 4R9VA 5KOIA 3BGSA 3ZV5A 4Z9FA 5KVCA 4XX0B 3NYRA 2VQFB 1ORVA 4OMFG 1GZ5A 2FR8A 3KIPA 4TXMA 3RW9A 5BXYA 4LVUA 1I36A 3RADC 1QCCA 1T34A 4DQDA 2WQ7A 2OYSA 3RS3A 5HMMA 1TX4B 3RSHA 1KMCA 3ZHXA 4G1EB 4QU5A 4QQNA 4IRXA 2NVUA 1G60A 1XD2B 3GNLA 5CM2Z 1LDGA 3BWXA 5SY6A 3U7RA 2VJAA 3H19A 3IB3A 3T4PA 2OVBA 5K3OA 1XCGB 4C0HA 3CR8A 3B7WA 4YH1A 2HDHA 2WTEA 2HV8A 5AW9A 3URKA 2Q1TA 2IU6A 4TZTA 1X2EA 2X9GA 1TW2A 4HAUA 4Z3OA 4NCJA 3GFTA 2AI1A 3S1AA 4D9EA 3C6XA 1N5RA 1VHWA 3E61A 3PCTA 4JLNA 3PDJA 2Z56A 4G37A 4YDSA 2EYUA 4U2EA 4RJTA 3EWIA 1K3TA 1UWCA 3W5DA 5CX4A 1TIBA 3WJ7A 1JEYA 2VA8A 1V1MB 4YBRA 2WUWE 1IVNA 1K4MA 3DEJA 3QUQA 2Z5GA 5I4KA 3KQNA 1W85B 1XA4A 3S0JA 5TIIA 4FR0A 3Q2OA 1J56A 1M75A 2CEAA 3OSUA 4RVSA 2CJWA 1CIJA 5EE3A 2PUCA 2SICE 5JH7A 2WYIA 1P9LA 1X74A 3ABQB 3EXFB 2JKVA 4ZT2A 1R8QA 1RXUA 4UMFA 4HWRA 4I5EA 4U7FA 2BBOA 4AIRA 5BQ5A 2HNKA 5JSQA 3GLIB 1QQ5A 2CLDX 2AE1A 2ECPA 2XQVA 2A9VA 2IYOA 1IM8A 5M2QA 2FQQA 1N7IA 2OLKA 1PUXA 2BTQB 1U2SA 3EFOB 3GVHA 3PQ4A 4MKRA 2WILA 4C7VA 1MVNA 5TR9A 4BMCA 3VSCA 1XD9A 5D7NA 5EKSA 1CZLA 3V1KA 3GPBA 3RVOA 3EUWA 1U0GA 1Z8DA 3B60A 4Q21A 4ID9A 1Z8FA 1P4RA 2B0JA 2C0CA 1CXZA 3C70A 4JUAA 3RAEC 2H4ZA 4YUXA 4D8YA 1W36C 1X6VA 2V59A 1E61A 1SQ6A 4J16A 4MQFA 4NSNA 4X1KB 4KMSA 1K66A 3D6UA 2HU2A 2GZMA 5DB4A 6ABPA 3TB4A 2ZUCA 3RKUA 3EZFA 3U9SA 1T4MA 4JJZA 4B7UA 4ARCA 1J49A 5EJIA 4QKQA 3ONVA 4X85A 4FHFA 1N6IA 2IVZA 4DGQA 4DC1A 1H4VB 4JI1B 4EHLA 4RQBA 5BXQC 4V02A 2APJA 1BXKA 1KAMA 2FV8A 4Q66C 4N9WA 1L5WA 1EWTA 1E7RA 4B74A 3DEAA 1O9BA 3HZHA 3O8RA 4EJ0A 4ZAFA 4NDAA 2J5KA 3J7TA 3RUIA 5JECA 2P69A 3U4MA 1AS0A 3T41A 2HW8A 4AW9A 2CZQA 3MMZA 2UXDB 5EKTA 4FIZA 2PT7A 3DBIA 3PPXA 4PVCA 2Y1XA 2CMGA 1KVUA 3MWKA 5KQMA 3KKMA 2P1ZA 3LOUA 2C2OA 2SBTA 2DWQA 3DKKA 3QI2A 4KAJA 4X45A 2GZ1A 3WLLA 4JI6B 1S2IA 3WWPA 4AS3A 4EJSA 3FPFA 1IPEA 4RTLA 5K09A 4XB6B 2OL4A 4GM4A 4H7EA 4BJ5A 4B2YA 1R00A 3EODA 3W5UA 2O7VA 2H2GA 4C4AA 4XJVA 3ZS8A 4OLAA 1OKKA 1EVQA 4B34A 3VRHA 4YR7A 4Q3BA 3PL5A 2I6SA 3OEHD 2IZ5A 1B93A 5HZMA 2JVKA 4AQDA 5HP4A 4RFLA 1YVDA 2XT6A 1OXSC 2OBMA 1NMEA 3KYIB 1VRVA 1W4RA 1K97A 2O0HA 1H2HA 4TKUA 2DULA 5FFMA 2CVPA 4GLLA 4ZU1X 4UULA 1BS1A 3AFMA 2BLNA 3DW3X 2ZB3A 3O8OB 1YK0A 3GCDA 4FLMA 1KIMA 2R6ZA 3O4FA 5E6RA 1P81A 2PBLA 3OIDA 3HCFA 2QK4A 4ROSA 2X22A 3RHFA 4OX9Y 4MS1B 1PNQA 4IP0A 3WYBA 2AX3A 3JAWA 1NBME 5AQEA 3EZ2A 3KYBA 3FDFA 4TL9A 4BMZA 5CGZA 4OXXA 1S5PA 1QU2A 1B7GO 2QGNA 3N53A 4GWGA 1GPYA 2H1FA 4MLDA 5FADA 4TWIA 4C5AA 2JGNA 4KQGA 2MMCA 4PY2A 2IHTA 2A9PA 4YQYA 3WYFA 2XNKA 5CT5A 1F6WA 3B9QA 1R27A 1A88A 3PSAA 2FPPA 4XB1A 4XVRA 4ZV9A 3RSSA 3ZHZA 4BBPA 1DAOA 2OT3B 2D8MA 2BYTA 4AXBA 3I12A 2BEVB 2G5GX 5A03A 2WJ4A 1E1CA 2YS6A 3DEZA 3IUJA 1X7WA 4E07A 4HGPA 4EATA 4AUEA 1XXLA 5BOVA 4WZBA 3BFPA 1FQJA 4B3BA 1DOHA 2HJHA 2C0QA 2C31A 2OV6A 2P4EA 3A4YA 3OOEA 4G5YA 4GXTA 2D2IA 2QG9A 4JBNA 1JG4A 2QRHA 4QYXA 5JSYA 3PWTA 2VUUA 1N5OX 3BJRA 5LC1A 1BCSA 3GMIA 1A9QA 3U7QB 3UYKA 4BTVA 5A0VA 1P2GA 2QZ4A 2R4QA 3KPVA 3QIAA 4MQUA 4ZQFA 2OXIA 2BH2A 4J3JA 1E3JA 4PGGA 5EINA 3FRIA 1L7PA 4YUVA 2VQDA 4ZPJA 4CG2A 1H22A 2XJ9A 4LHXA 5B1EA 1WZ2A 4W5RA 2P9JA 2PZAA 2WE8A 4MVJI 3GWZA 1AQIA 3H8WA 5AKIA 3O84A 1PEAA 3HUEA 2HCFA 3DWIA 5A4MS 3ADDA 4R40A 4B7ZA 4RVHA 1POXA 1AKTA 1OXKB 1H3FA 1PV1A 1I7PA 3OG9A 4ZT3A 3VAYA 4CM6A 4AJ4A 5CEEA 4XQ9A 4FYKA 1YBFA 4DVJA 4FK8A 4YRRA 3PTAA 3E9CA 1TM7E 3EE6A 2J0UA 1HLGA 3LCVB 4Z7NB 3GI1A 4HFRA 4C20A 2R8BA 1Z37A 3PEEA 4YQFA 3T99A 4JXXA 1QGED 5F9FA 2AGVA 2GWHA 5D6OA 2C98A 4C0SA 2P2GA 3BQNB 1P1IA 4RC9A 4DIBA 3GCXA 3L0BA 3HLKA 3R9IA 5CXUA 4QE3A 5AVSA 4AS1A 3WWYA 5ABPA 2RE8A 1Q2XA 5EEGA 2ZRLA 4V0LA 2O0MA 2ZRFA 3VR5H 4MRVA 3PXDA 4N3BA 2AUMA 3KUDA 5JTTA 1U2RA 4IFTA 1UZLA 4MDHA 1NKVA 2ETXA 4Z1MD 4PYKA 3OM8A 4DLWA 3ENZA 4BXOB 3NHPA 4L50A 2HYIC 3K05A 3O8LA 3SYTA 4E88A 2PMEA 3DT6A 2FOIA 3CF4A 1DI0A 2QVBA 3ECAA 4I5GA 4JP5A 2NUBA 5FTWA 1T5DX 1E5LA 2DFNA 1NR5A 1YGYA 1TQDA 3KOZA 1I8TA 1U2GA 3JPYA 3KQOA 4L8WB 4FEYA 5HILA 2H4WA 1N2EA 1JMVA 4BVKA 3B1VA 1YZGA 4G01B 1L3CA 5CA0F 5TMPA 1EESA 4KGXA 2VDPB 4BV3A 3DMRA 1VJRA 5IKXA 4RVUA 2QLMA 3A6GA 3AETB 2ZVPX 2X86A 1JPUA 4LYEA 3LV8A 1RTTA 2WJ6A 1O95A 1R4MA 2AG8A 2FKNA 1JAZA 2OGSA 4GI2A 2AC4A 1WW3A 4HDRB 4M55A 4F2PA 1IY1A 5LXTB 2ASEA 3STWA 2ECKA 2P6PA 5IJZA 3FOCA 1NXVA 3EIEA 4G23A 3PR3A 2DPGA 4LHZA 1FPMA 3AB8A 3K8OE 5IAAA 1OXXK 4WV3A 5J58A 1U2EA 4M2LA 1QYCA 1R9GA 1ZI6A 4EGFA 4LG1A 1J24A 4KN8A 3SF8B 5A0TA 1TD9A 1UPBA 1GUZA 3TTWA 2Q5LA 3HKDA 4GKJB 1RJFA 4TUYA 2AD1A 2QYTA 2WNIA 1VGQA 3SKVA 3S8MA 4E2WA 1XKLA 4CETA 2JAPA 4MWDA 5GM2A 5IAGA 1PR0A 2IP1A 2AS0A 2X3YA 2BHRA 3OFVA 3CRMA 4RIHA 3PTLA 3IODA 3ZE8A 4WX2B 1L2TA 3FGNA 3KQLA 3PLRA 1N57A 2HRDA 4UNQA 4ENTA 2C07A 2QN7A 3PHCA 2B8TA 3F97A 3K35A 4ZDWA 3W8DA 2A92A 1AK2A 1VIVA 1D2MA 4PQGA 5KINB 1M9NA 3KP1A 3LF2A 3OETA 2HF7A 2G1JA 2HPZA 4N40A 4UEKA 2HOQA 3I2JA 4BIMA 2DEUA 4K9PA 1D1SA 2FN8A 1ZCJA 2A0WA 3EAFA 2JLZA 3IUEA 1UBLS 4A8JC 1YA4A 4BJ1A 2XWQA 5FUBA 4C2UA 1TU4A 1QDEA 1XF9A 2O8FB 1DSSG 3UO8B 3ICPA 2YZ2A 4ZYUA 3ZYZA 3F7MA 4EB0A 2ZI6A 1UH5A 1BH6A 1K63A 2EFGA 3GEIA 3FJOA 4U9IS 5IF9A 3O0TA 3C3JA 1EA5A 1OWMA 2O3TA 2NQTA 4XWAA 1ISGA 2HY7A 2QTVB 3UCEA 4BMVA 2G17A 1G6OA 4XE5A 2OAGA 3BB3A 2B3DA 2WLSA 3TG2A 4X65B 3I61A 2W98A 4JEIA 1JYFA 4HDSB 4P86A 2RH9B 4GQAA 9LDBA 1RI5A 2FSSA 3FOBA 3U4HA 1NBEA 4W9RA 5DOVA 3I05A 3WGNA 5FBLB 4AMGA 4DEXA 1RE1A 2EX0A 1G59A 2V7TA 4J9VA 3KJNA 3QTLA 1X0VA 4LE0A 3DYBA 3M4NA 3OVMA 5K3FB 2HV9A 4JJ8A 1E1RA 1G98A 2Y66A 1AV6A 2NU6A 1E0AA 5HKKA 2WJYA 3B2NA 3V8MA 4LF4B 1CYDA 1MAAA 2JDIA 121PA 1L7DA 2V7GA 3GCWA 3OD1A 3Q72A 2DC1A 4J16C 5K6TA 1VL6A 2CN1A 4UEWA 2OO3A 2FUG6 4MO2A 4PG6A 2H1VA 5DSZA 3UXMA 7MDHA 2A3NA 4QVGA 5A9SB 3MB8A 2V74B 4D98A 4OHBA 2QMUA 3DBLA 4E31A 1MC8A 3P45A 5KJEA 4EO4A 4TKUB 5DT2A 1KEWA 5BW5A 1ZIOA 1SK9A 1KJWA 3L6DA 4JC8A 2HLDA 2QUHA 1BXRB 1C3LA 4DREA 2MOKA 2W2QA 1S2NA 1AH2A 5EJFA 5FV7A 3DVQX 4OLBA 1VPDA 3UOAB 1UF9A 2C4MA 4TZKA 3RVPA 1PTJA 4BLRA 2PD3A 1ZHFA 2UVDA 3A1WA 3FPSA 4RTNA 2HUPA 2GPWA 2YH2A 2QMHA 3EIQA 1EK1A 1DQNA 3ODGA 1Q6ZA 5B58C 5IDWA 2ZRAA 1ANKA 1HDEA 1RM5A 1MVOA 1XRSB 3UHPA 1PQYA 3MUNA 1XWFA 3GT4A 3I2GA 4GLBA 4P7FA 4UE6A 3I9V6 3U26A 4I5FA 3BC1A 1Z8HA 3JR3A 4G5OA 4PO3X 4MQBA 1C9DB 5K51A 2OHXA 3ZU4A 2UUAB 1K88A 4G0UA 2OC4A 3OT4A 3FGOA 4G09A 3FWYA 3ODPA 1HKUA 5CM8B 4D0NA 4HSGA 3V4VB 5AR1A 2EDCA 1QWSA 4QGHA 5DCLA 5C8ZA 2DKFA 2Q46A 3EDCA 5FUQA 5JSHA 3AFNA 2GUWA 1J8YF 3PJGA 2VWGA 4BVJA 1T25A 8AT1A 2Z6AA 3ZD6A 3L79A 1ZJ4A 2BIFA 3JZIA 3GLGA 1L8OA 4LRQA 3MS4A 2JJ8A 2ZS8A 1Z5GA 1PG5A 3LW7A 3O9VA 2P4UA 1L5HB 2QTCA 1OB2A 1GZ3A 4E2ZA 2I22A 2HO4A 2F8LA 5IULC 1KK3A 1NBWB 1KNXA 1FVHA 1UMKA 2Z4SA 4E3WA 1VSUA 2I3BA 3OOHA 1LI4A 2QM3A 1CIVA 1W1WA 5MN6A 4X91A 5ESXA 4XUCA 2LKCA 5EHGA 1SWWA 1M1YE 1E1KA 2QI9C 4F9TA 4F11A 3ROFA 4FFRA 3O8NA 4OXYA 4X7MA 2OZLA 1VJ0A 3W7AA 3E27A 1WSDA 4IXNA 3LA8A 2OXTA 3PNYA 1P3DA 3G2QA 3OTIA 4M1ZA 1XWIA 2JASA 1Z62A 3H16A 3QUCA 4OFBA 3GRVA 4ERNA 4RV9A 2YHIA 4UBJA 4TXHA 3ZY3A 1EUZA 2P1DA 5C5EA 4D25A 1LU9A 2I78A 1C2TA 3GVPA 3IKLA 2EJWA 3ORSA 2GDZA 4GOOD 3ORFA 1WVIA 2YWBA 4F45A 3D1JA 2ZBRA 5EUQB 1QHYA 3ETEA 4I2NA 4DY6A 3PTZA 1ACLA 5K03A 1LLQA 5FF9A 1Y82A 4MKGA 4RHUA 5A3RA 5GP1A 2GGSA 1TCBA 2ATIA 3Q3JB 3IV6A 4R8RA 4ZOCA 4DDMA 5DHQA 4RPKA 2OD7A 1JI0A 4EG8A 1G7SA 5IMBA 2F67A 4UDXX 3KFLA 4INAA 2YYYA 3TRKA 3VYRB 4C0QC 4N0MA 3HXLA 4XEHA 3C8HA 1BVYF 4CLDA 4EYQA 3VYWA 2O8CA 3T3HA 3PWSA 2KX7A 1WV0A 2QUAA 3AI3A 4N1AA 2VHEA 4OF4A 4OSOA 3Q5GA 3V6MA 3UJ9A 3OHMA 5HFAA 1CEYA 4NCBA 1DJQA 1ZH0A 1R66A 5CDUA 1QFMA 1K68A 3UMGA 3HZZA 4WK4B 4C9BA 1XZQA 4J49A 1SBHA 5LMCA 3EPJA 4ZODA 3NONA 2PKYX 3Q5EA 2ZS7A 3RQIA 4J43A 4QZVA 1GXSB 4A5OA 2EWVA 3HPRA 3A1CA 5J40A 5LP6C 1PL6A 4IAOA 1X38A 1U7UA 3EA0A 4Q4JB 1XL0A 2IP4A 1T3LA 4QPZA 4BU1A 1WNTA 4TQ9A 5LXTA 4Z4FA 5JSZB 2CFRA 3MQFA 4JAVC 1F2TB 3GLHB 2ZCVA 3PPIA 1Y9ZA 2PUFA 1ZJJA 4NONA 2J87A 4DM3A 1S96A 5B55A 2QG6A 1GN9A 2JBAA 1UZNA 2VRWA 1TL7C 3QFCA 1XYGA 3L8MA 3LE8A 3EZNA 4L5IA 4QAJA 4QBKA 4NZNA 3HSKA 1GN8A 4JVMA 3SQLA 5C7LO 3K9CA 3KKEA 3QP9A 2IDZA 4ER3A 1FOEB 2MR6A 3L5OA 4H16A 3CX7A 1SWVA 1AF4A 4RY8A 1IU9A 3KR2A 2ZSJA 3QWAA 3HMQA 2QN9A 4NYIR 2Q5QA 4F3RA 1IULA 3BMNA 4AO6A 2VPYA 3RWMB 3HKCB 5BWNA 5CFZA 3L1UA 2XCTB 1TADA 2CLOB 1YUNA 2ODQA 5T4EA 2XE7A 3ANSA 4MVJF 5BORA 3FHOA 2OFXA 3C24A 4JV5B 1HSZA 4N76A 3ROQA 1TU0A 2Q7XA 3RFXA 1HT0A 4FHCA 1YJ5A 1OFUA 3RD5A 3QWFA 1KC3A 2GHIA 5H02A 2JFVA 4RZIA 4RH3A 4EG0A 4KXNA 4WDQA 4DDVA 5EFZA 5K3DA 1L5LA 4RMHA 2BUBA 3ZWXA 1TU3A 3PU6A 4GGMX 4UPEA 1BDJA 4FKZA 3DV2A 3K8YA 4W6QA 5AW7A 1J23A 1Q3HA 3HKCA 5BV0A 4X8OA 1IHUA 4MA4A 4L3WA 4A9AA 1HX7A 2H4XA 3L1KA 4ID3A 5ALNA 3SSMA 1OMOA 1TC2A 3I76A 1E2IA 5IPFA 3T5GA 4S1TA 5IUJC 1P1FA 3WLAA 4DMHA 5ERGB 3I58A 5AFSA 5LZ9A 2PL9A 3KM0A 4E30A 1YZVA 4PG8A 4Z4CA 1KKMA 2PLRA 1BYIA 1XRMA 3FZQA 3ILXA 4L0CA 5B1DA 4B84A 4BC1A 2DT5A 2NXCA 2Q41A 3HJBA 4DNQA 5EIEA 1S8NA 4BBAA 1AGXA 4ENRA 1GQFA 4JI7B 2VYCA 3OM0A 2HQSA 3BMCA 1WKVA 3NTQA 4KQHA 3QVSA 5AQ1A 4BXOA 1WDKA 4BCCA 3NM6B 1XO1A 3A36A 3H11A 3HHPA 3NWJA 3BGWA 3IBCA 1IXYA 4XR4A 3FA2A 4QUEA 1B3RA 1R8XA 2IPAB 2BEUB 5HBRA 1SCBA 5LBUA 3VZPA 5AM0A 1LQUA 2F62A 4NZYA 5HCNA 3R20A 3OX2A 4UJ3A 3HDGA 3RVDA 4OFZA 2LP4Y 3AGQA 1OREA 1ECJA 2BMAA 3L0ZA 1JHRA 3OA0A 3X2FA 5I7WA 2DY0A 5AVTA 4HOYA 3CM0A 2O7RA 4OLHA 3FCYA 3EBPA 2PGOA 3L6RA 5ARDA 1RQNA 1ZOIA 2QMOA 2C8LA 4BRWA 3GIWA 2EP8A 3QWBA 1OB5A 3O4JA 3MEQA 3TRFA 5IEJA 1KR5A 1LX7A 4FYIA 4X8LA 2FW8A 4UUAA 3ZIUA 2VPWA 1EYZA 4EMUA 3CCFA 1OVMA 1SQFA 2G09A 4A8PA 4KPFC 4RD4A 4CN8A 2R62A 3MSCA 4Z9AA 1U0SY 3KEGA 3QEOA 4QSMA 2J9XB 2ZYRA 3P0JA 3GRAA 4F46A 5EP1A 5JBNA 4YHHB 5UKDA 3ME5A 1JDTA 4FBGA 3AG6A 4G4GA 4NE2A 3EBLA 3QV2A 5K05A 1XCJA 1MMFB 3LJKA 3OIGA 4A03A 4KOAA 2NN3C 4C3OB 3E22B 2OV4A 1JTFA 3MMNA 5HKOA 1PVOA 2D5AA 4LJ8A 1E99A 4KI0A 1F48A 1NE2A 3KZNA 1BN6A 3OKCA 4C7KA 1Y9EA 3ISVA 3Q8XB 2PUBA 3H99A 2CMKA 3IPLA 3GLKA 2ZR0A 4MS4A 1N6HA 3ZBUA 5HYVA 4RTOA 1OZFA 2XI4A 4TV9A 5KYYA 4DG8A 4G1FA 2QRVA 3PGKA 2IEZA 1U8UA 4DPLA 4QJ4A 1WUJS 2DHRA 3HU3A 2EKPA 3IEIA 5I9LA 3B1FA 4GSKA 3ZK8A 2QXUA 1J0EA 3ND9A 4Y2UA 3ZJ5A 4XWYA 1I7SB 1GSIA 2WAMA 2NPOA 3B6ZA 4AC9A 5FPKA 3I45A 5KTRA 1X15A 1Z4KA 1E3IA 3PNSA 1JJFA 4ZVTA 4AF7A 1GKKA 1TE2A 2RI1A 1UPXA 5TVGA 5JNUA 2P3OA 5GJCA 4Y9SA 3V1NA 1EKXA 4W5WA 1QHGA 3MQ2A 1XHEA 3QVMA 1BRTA 1U04A 1H2RS 1L7VC 4FNGA 1D9ZA 4BB6A 3C3KA 3IAFA 4Z9XA 4ZYWA 1T5BA 1OU4A 3VPSA 1XZHA 4BKMA 4QHSA 4EPYA 4WFJA 2FDCA 2TMYA 2ES4A 4IPTA 4BFYA 1O6FA 3BE4A 4UTNA 1SHKA 5J2UF 3IRVA 4CEJA 4XFKA 2ORWA 4HFMA 4V1CA 2A4KA 3OU7A 1RPZA 2Q9CA 1GGHA 3U4DA 4R2LA 2GHRA 3PDIB 2O48X 4QDKA 1ZN2A 2Q45A 1SKBA 2O1WA 1NXWA 3T9BA 3BRSA 5AJVB 1T6BY 5B6IA 4WNIA 4MQFB 1PT6A 2B7LA 2EZTA 5BNWA 4EECA 2EYQA 2OCLA 1KFBB 1G1AA 5TS2A 3MRXA 1EAYA 3IPAA 4O5OA 3UJ6A 4DS3A 2CNDA 3LX8A 4INPA 4ZVRA 1ATZA 1K9SA 1NJ8A 1TLLA 1DDGA 3IQIX 3KE9A 3U3OA 4JI0B 1SD5A 4G0XA 1EK0A 1IC6A 3U13A 1GGNA 2ASVA 3AJEA 4NFSA 3TDNA 3CF4G 1VJGA 1PVDA 4CM4B 3UHJA 3LKZA 4LE2A 4WUTA 2COKA 4I6EA 1VPTA 2FQ1A 5BSGA 1C1DB 1EX9A 2XZDA 2FMUA 2C3OA 3ABSB 1NQ5A 3M33A 1SVKA 2A5DA 1B41A 3L0IB 4OFXA 5CYOA 3VDQA 4C78A 4LXYA 4AYXA 3FPAA 4TV8B 2IDMA 3D3WB 4YP7A 2GO1A 1ETHA 3E15A 4P4LA 4PC3A 1I4EB 3A37A 4QGAA 1K4YA 4RLHA 4CLXA 1OGYA 2HPAA 2IEIA 1EFVB 3RASA 4EVRA 1Z75A 5DBGA 3HNPA 1K3FA 4LISA 2FB9A 2H2HA 5HCIA 4FGUA 3P9PA 2UZ1B 4HMOA 4TLDA 3A10A 4JHLA 4KODA 2H7CA 3O8QA 4FBMA 4Y6QA 4YT8A 1JQKA 1HI9A 3FTPA 3NZEA 4UCFA 1O9GA 2AR0A 3CRW1 3K2IA 1YAHA 3UM9A 2UUCB 4K6HA 3BXGA 3G2JA 3O8CA 1QGUB 3DC2A 3EUEA 1NPTO 1RI2A 4LN1A 2VJLA 4R05A 1V7PC 2VNJA 2HJWA 3L7YA 1CSEE 4GO1A 1C0PA 1ODKA 1ZXBA 3FLAA 3ON5A 3VR4A 4Q1VA 1KDZA 1NVKA 3BK2A 2HMSA 1X86B 3QNWA 1ZGGA 4P3XA 4FB5A 4PN7A 1Z8NA 3BEDA 3V1LA 4TYNA 3SZRA 3A1NA 3KDPA 4AKGA 2BHNA 1H9CA 3T1NA 5LWHA 4ALMA 1Z4MA 2ANCA 4YB8A 1AZLA 2BT4A 2Z8ZA 1J90A 4I4LA 3KBBA 4GF5A 4LXHA 3SPXA 1P6QA 3DE0X 4QLAA 2FPLA 2NUAB 5K8VA 3VTZA 4X62B 3HYCA 4ZMBA 3I62A 3PXEA 3B51X 1LPOA 3ZXXA 3DMHA 3BSYA 4QWMA 5JEDA 5EFOA 4O4JB 4YP0A 3GBPA 1ZINA 2GK7A 1ZJWA 3C3PA 5BYBA 1DWQA 4GDMA 4CR6A 2QUIA 4JQZA 4P7KA 1ZW1A 4I50B 5CK4A 2VKQA 3JVIA 4JY7A 1ZGAA 4CV0A 5HZGA 2OHOA 1FUYB 2I7CA 1D4OA 3IIJA 4GZ5A 1G291 1NXXA 3UV3A 3RUEA 4EF4A 1M67A 5ARBA 3LF1A 3KHKA 4IV0A 5HJEA 1SUWA 3VYVA 3E81A 3W3ZB 1LNQA 3ZDAA 1JVBA 1E4EA 2H1SA 4WCFA 2P30A 3JQRA 4R6XA 3ESDA 1XZKA 3DMTC 3LX6A 3BL6A 5K6RA 2WLTA 1A4XA 3S6JA 2QX7A 3CRZA 5EIBC 2AX4A 1E3WA 2W43A 5FL3A 5E8JA 4PLTA 2W93A 4F5WA 1AQLA 2PWYA 1N5DA 3L0YA 2X6QA 2XMGA 3G88A 3T34A 3NHYA 1YJQA 1NDQA 1G20A 2B4RO 2P68A 2H1HA 1FDOA 2BKLA 3HY3A 2BLLA 2QTHA 4OK5A 3MF4A 2I54A 3HCOA 2B21A 2NXNA 1BS9A 3G6WA 3BF8A 1CS4C 4C0JA 1VPWA 4ETWA 3WZLA 4I08A 3S8YA 4LBVA 1QWOA 2ZPAA 3IX7A 4YMSA 5K6AC 4Z0NA 4EY3A 4A27A 4TYWA 1D9XA 5DHSA 2YC2C 1QX4A 3PHIA 3DOUA 4TTAA 4ARVA 2PT9A 5ALRA 4AN1A 3OPQA 5AKGA 2QI9F 1Z73A 4DLTA 5JEEA 4ZQEA 2PFGA 1GNTA 2EZ4A 1D7OA 3O2NA 4HS9A 3IXLA 1XFAA 2HAEA 1IN6A 5IZCC 3U1TA 5LOVA 1KYVA 3L04A 3KEQA 4KC0A 3ORQA 2O8BA 1IFXA 3K53A 3VV3A 5BRJA 3CB4A 5C80A 3W2FA 4B3RB 4BZXA 3RSFA 1MTZA 2H1RA 2A84A 1E69A 1I1QB 4RSHA 5COQA 1AKMA 4WBXC 1HTWA 1BYUA 5H68A 1BXGB 1C7FA 3JRNA 4N47A 4NIMA 4LJ5A 1O89A 2JLAA 4ZZ3A 3W6ZA 4BO9A 3CH4B 4IUDS 1UC9A 3RYTC 4LJRA 4J07A 3CN7A 1WHSB 3ILYA 1ODFA 1M6YA 5IBPA 2A1UB 3OURA 5LLTA 4CXMA 2VYVA 1JHZA 3N5KA 4R0NA 2MSCB 5ALDA 5EKDA 4AN0A 1CUJA 1JQJC 3T1OA 4CM4A 2QM7A 3WYCA 2CCJA 2JHCA 2ZVDA 2XD9A 4KWEA 5F1PA 1LS6A 3GFSA 3HDJA 1F0KA 5KC9A 1P7CA 1GA6A 2V5AA 3EGXA 1KU0A 2JAOA 3VX4A 2DQ4A 1CLEA 4HXGA 1XDSA 4KZPA 4M0DA 4S2UA 3UEOA 5JD4A 4WXPA 2Y1KA 3KV1A 3QU7A 3AWDA 1JBEA 4YAFA 2Y1EA 3EULA 5AJTA 1T3TA 4C3UA 1JSLA 3PENA 1D6MA 1NMXA 4CE6A 3GG9A 3KLBA 4LSMA 3FMIA 1O94C 2UZIR 2WWVD 1QQTA 2WWIA 5L7TA 2DP4E 4CLOA 1N3BA 5IJ0B 4XASA 2CLCX 4LY0A 1UOOA 4J7CA 4AZ0B 3WB1A 3CLUC 3VDXA 1IJKA 1WLYA 4MW1A 1J0BA 1VP9A 4BYGA 3UWMA 1FUEA 4M0EA 5FUVA 4IFEA 1C4XA 5BOSB 1GUYA 4MTCA 4EW3A 4NYMQ 1X7WB 1FMJA 2WBLC 1RC8A 3NBMA 2NXJA 4P7JA 1OR8A 4XPIA 1XQWA 1IBKB 4LNUA 1XQYA 1HLDA 3M5DA 3HGTA 4HAZA 1B2LA 5HSGA 2Q9BA 3CUWA 2O8FA 1FTGA 1ZD5A 3QUAA 2NZJA 2VCHA 4KO3S 4LBWA 1RXIA 1UBHS 2HREA 4IKEA 2BDTA 5TDHA 4AWBA 3PL1A 4CYMA 2J30A 3CIFA 2R6GA 3PSHA 1OFVA 4RVFA 4Z3DA 4ZCIA 3RIEA 4W9MC 2HJGA 1XU7A 5E6SA 2YV4A 3TI9A 2F9MA 2FPGA 3T0GA 2B30A 3I2KA 3WICA 4AROA 3HVHA 4ZYTA 3KXIA 4FXOA 2B6HA 3A25A 1FDIA 3FPEA 4YJFB 4FTWA 5L95A 1GO2A 3HGQA 1L7NA 1J22A 4B3IA 2Z5FA 1GGFA 1ECGA 2DWPA 4HRXA 3U60B 2PRSA 2RG7A 2V97A 5A6SA 4RA6B 5KNDD 1YTLA 1IQPA 4UXJA 1AHHA 4C4SA 1JJVA 4D4MA 1DFIA 2NM0A 1YWGO 3KEMA 4B9EA 2D74A 1MV8A 5A05A 3BRWA 3BBPA 4QODA 3R9WA 5C51B 2I9KA 4LSGA 1QM5A 4XYGA 3K6KA 2PZMA 1EK5A 4FFLA 2I6XA 3HFSA 1BDMA 4L3VA 4TLMB 2J0QA 4YCSA 1H05A 4AN4A 3K0EA 1IOZA 3VR4D 2XVMA 1A95A 1BD3A 3NTRA 3ROKA 1A9SA 3UUFA 3UT0A 4HN2A 3SQXA 5JS1A 2ZSDA 1AK9A 1UBCA 1SVSA 1N2OA 1NYTA 3D3JA 3LA6A 3B5JA 1OFTA 3MIZA 4M54A 1QIIA 3DV9A 5GVSA 1IHXA 2W0SA 3V3KA 3UK1A 1U28A 4XIYA 1D07A 4RA9B 1TJ4A 2OXFA 3BWCA 4HL6A 4II7A 2OO7A 2JGDB 2CW5A 1L7XA 4YHBA 5BN4B 1KK1A 1QR2A 2IYFA 4R1TA 5EHNA 3ZNOA 2D0OB 1ZD8A 3QK7A 5AVXA 1C3OB 3DMNA 1AT1A 3EEBA 4Q02A 2WF8A 5FXMA 4ZOLA 3RBZA 4DLYA 3IEPA 3E7PA 1DAFA 4H2DA 5CB6A 2N1MA 4YCJA 4BTEA 2Y4NA 2ZJAA 4EJMA 3KQYA 2BFAA 3IDOA 5FBRB 3W9UA 1PGPA 1Y3AA 2YXLA 3MWGA 1XDZA 4TN1A 4UUOA 3SNKA 5JCJD 1DMRA 2FX5A 3Q1KA 4IIHA 4XW2A 5KNCD 3L2OB 1K8ZB 1J0XO 5K0NA 5DGTA 3QIVA 4OKIA 1QBGA 1ISRA 3E3OA 3M1IA 4DIOA 1GUFA 3AKEA 3EF3A 4NTZA 2R6DA 1OASA 1OJ7A 2HLPA 2ZAIA 3EG9B 3RHZA 3ZQUA 1GG2A 2B98A 2OM6A 1WWKA 1IPFA 4FHGA 5T4FA 3BORA 5CXXA 2H07A 2VQ6A 4L7QA 4XYMA 3MN1A 2OILA 1MW8X 4Y7DA 3LOPA 1Z0IA 1MB0A 1TAGA 4IVPA 2ZUFA 4MVJP 3WLJA 3BM5A 1RXSA 3SDZA 4KQ6A 4YMTA 1OLSB 2O05A 3U4AA 1NOIA 3UQYS 1DTEA 1JIQA 4RZXA 1QLJA 2R44A 4IZIA 3TIFA 1XLUA 2WHRA 2EKBA 2UYQA 3QBJA 3OZBA 1ZBDA 1TAUA 3CRVA 1CF2O 1J5XA 1SHZA 2G4LA 4WK6A 3WLIA 2H85A 4O4HB 4UNNA 4IBOA 4NU0A 3KETA 1S4QA 4I55F 1KO8A 1CRLA 3FYTA 2EGGA 3AY6A 3VXKA 2J9ZB 5CDFE 3H2ZA 4IINA 3FSRA 3CMCO 2GLUA 2ISQA 4RA6A 2IYPA 4FI3C 1THMA 1HRDA 2YY6A 4UTOA 3TJMA 1E6KA 5JYEA 2G25A 1G0OA 1JJAA 2C2XA 3OWHA 4OG2A 3GRZA 1KPIA 4R2XA 2V0GA 4TS1A 1PGNA 3IVXA 3GEHA 3HWX1 3NANA 3QUTA 1MB3A 3ZD8A 4W7IA 2VKTA 2CLEB 4KAAA 1JG2A 2GM9A 4K6OA 1G8PA 2C92A 1YO6A 2QTLA 1M74A 4LRYA 3ZD9A 5B4VA 4LRWA 3JQGB 2P3LA 5DM4A 3SQWA 1L3IA 2IBTA 1Z7YA 4S0XA 2PKXA 3CYFA 2R1TA 5A5GA 1KK0A 3H8JA 4D42A 5MF6A 4QFDA 1ZSYA 5EVCA 3OI7A 2VCEA 1WU8A 2FFQA 2YMPA 3A3NA 4K5QA 4OI2A 2H29A 5DNWA 1YU9A 2H7XA 3NVAA 4A0GA 4EAQA 2JGJA 1YBVA 4JSYA 3AR8A 4RHCA 2Z8YM 4EW2A 2UYOA 3OFSA 1OX4A 4L74A 2VZ0A 2W4IA 4ZD6A 1MB4A 3KQQA 1PLJA 1WDLA 4FX2A 1AM4D 2HBZA 2QL7A 2Y68A 2CV0A 1G64A 3O9ZA 4P2GA 4KR7A 3ZQ6A 1H69A 3KS9A 1YDEA 3MWLA 2Y1LA 4W1SA 1RZRA 3ETCA 4MV9A 2WYWA 1EGMB 2VPXA 2ZTSA 3L07A 1Y1PA 2YWHA 3B9RA 1GZDA 521PA 2IS6A 3WGMA 4Z7QB 4FMDB 4HATA 3DOFA 1ZFNA 3RDPA 3L1JA 3OJFA 3P5BA 1PYOA 2MYPA 3ZEAA 2ZYWX 3NBQA 3MTBA 4G6ZA 3LDGA 4LXIA 4AI6A 1OT5A 4TRNA 3EMVA 3LQKA 1FSFA 2XIQA 4TWAA 3UPDA 2IXFA 3KG2A 2VTBA 4NCXA 2J85A 3BDVA 4NDZA 4KG7A 2J4FA 4PHHA 2W70A 3UAYA 3G9UA 3I6IA 3RSZA 5K8CA 1U1DA 4QU8A 3W8EA 2NV2B 3BRCA 3R6DA 1KO4A 4WOJA 2GXSA 3PR2B 4BMXA 3P9ZA 4GBGA 2PKCA 1Q17A 2JFYA 3G49A 4YECA 4EI7A 4JB0A 3MBOA 3SSAA 1GTG1 1PFUA 1QRDA 1VZ2A 4WPGA 3E9DA 3T9EA 1EXWA 1QYIA 1I24A 4P3YA 5EIWA 1N4AA 4DNPA 3PEWA 1TO2E 2DRIA 4LXGA 2FFRA 2XYRA 3ETDA 4MVCA 1PDWA 4URFA 5FTNA 1DQYA 1E0KA 4FCTA 4HAWA 4MVJM 3EPPA 4ZAVA 1ISSA 1T36B 3HGMA 2GVZC 3Q40A 1OF1A 1GQRA 1QE5A 5LQMA 2AQKA 2AZ4A 4BY9E 1WXEA 2P9EA 4OH1A 2YJ3A 4N5HX 3NNSA 3EVZA 1GPDG 3K9QO 3OCWA 2X0DA 4IZHA 5ESWA 1N7HA