3LW7A

The crystal structure of an adenylate kinase-related protein bound to amp from sulfolobus solfataricus to 2.3a
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
177
structure length
170
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase related protein (AdkA-like)
publication title The Crystal Structure of an Adenylate kinase-related protein bound to AMP from sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 65
structure length 170
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw7A00
3RHFA 4TSFD 1NVWQ 4GMXA 4JVLA 1DAEA 3OIWA 3BORA 521PA 4B76A 2ZU6A 3TMKA 1W0JA 1TF5A 4P4SB 3QEJA 4KYUA 2KSQA 1JBKA 1KDPA 5AJXA 3LRPA 3KQKA 5FTLA 5KNDA 2BBOA 3T12A 4V02A 3E70C 3A1TA 2N42A 4C0HA 3CX8A 3IKJA 3OFND 4TYPA 1LF0A 3LD9A 4DBLC 2BOVA 2CJWB 3X1DA 4KXFB 3BXZA 3KJGA 3KL4A 3RC8A 1E96A 2J5XA 1ZUHA 4B43A 6Q21A 1WQ1R 1I4LD 3AF4A 2OZEA 1H8HD 4IDOA 5KPDA 1IQPA 3ZVRA 3IGFA 2GBLA 4GP7A 4L15A 4TLDA 1Q1BA 4WVFA 4KLZA 1E9AA 4L16A 4RZ3A 3GLFE 4AWXA 3GLIE 2NMVA 1KY3A 1PZNA 3ONWA 1ZU4A 3AF1A 1IY2A 1AK2A 4WOPA 5KO2A 1CR0A 3ZYCA 1P60A 3B7GA 3FMPB 4A36A 4GOJA 2Z5FA 4PO1A 3W8RA 4EDHA 3BERA 1ZC3A 1W2GA 4KJZA 2NZJA 4NZYA 1ZCAA 1FX0A 3MAAC 2P3SA 3LV8A 3Q85A 4B34A 2ZRJA 4D0GA 2BBSA 1XMVA 4TTQA 2H8KA 1XEWY 1P2UA 4OQXA 4QG7A 1Z47A 2PT7A 1XZQA 2Z4SA 3EIHA 4FCVA 4HUQA 3B85A 3KQLA 2OE2A 4IXNA 1D2NA 1NIJA 1WDTA 4DKXA 1QHYA 5BN5A 2NOAA 3I8XA 2V1XA 2C8VA 1EG7A 2Q3FA 3ZGXA 4CEJA 4MRSA 2Q9AA 3B9PA 4V0KA 3RS7A 4LUCA 3RC3A 4PPNA 3SS8A 3LXXA 5L8VA 1NG1A 3MWJA 2D62A 2PLRA 4OJQA 5EE3A 5C2JB 2LKDA 1G3UA 2EFHB 4U02A 1JAIA 4DWJA 1Q3HA 4A8JC 1ZRHA 2VSFA 1G7RA 4TZ0A 2AD5A 3KKNA 1MR3F 3C15C 3KTAA 3KZ1E 5FL7D 1IN5A 2WBLC 5HCIA 4D0NA 2O8BA 1ZM9A 1EX7A 2FSGA 4Q4JA 2F1HA 2PL3A 3LW7A 1OXTA 3TW8B 3QG5A 2NIPA 4G1UC 4LHWA 5FTKA 2F9LA 3TJZA 1P2TA 2YWHA 1ZNXA 2PZFA 3P26A 4Z1MA 1OFIA 2P6RA 2OCBA 1E98A 1CJUC 1U9IC 2W6IA 3FMFA 4Q9HA 2C9OA 3CW2A 4NMMA 1DAKA 1KI8A 3DPUA 1R5OA 3KKMA 2A5YB 1TU4A 1M7HA 4IDHA 4I1OA 5FBLB 2DWPA 4ILEA 4WXPA 2WOOA 1FQJA 5LB2A 1UF9A 4O25A 2XJ9A 3PEYA 3NVAA 1VCOA 4GSYA 5JRJA 2DYKA 4RCZA 1XFAA 5HKKD 2ZSAA 2RGNC 4HLDA 3EIEA 4C7OA 2JJ1D 1IY0A 2DWOA 4MYTA 3ZZ0A 4ZIRA 3AUYA 5CDFE 1I2MA 5LDDC 4FXPA 4KSBA 2W6JD 1VCMA 5FTMA 3GLGA 1JQLB 2W2VA 1FP7A 1OF1A 4M4SA 4QGFA 5B58C 1G8FA 1XRJA 3F5FA 2KWIA 2V54A 1SZPA 3AM1A 2P5TB 4IVQA 4GRAA 1E6CA 1TX4B 1JI0A 2OM2A 4ZDWA 4LC1A 4YMTA 1FTSA 1VTKA 2HJVA 2VIIA 2WICA 4KYIB 1J70A 1KI4A 3AVQA 1KZ7B 1N25A 1NL3A 2VSOA 4B74A 1FX0B 2JLUA 1E2GA 3VNVA 4ZCMA 2WJJA 4LOAA 4XIGS 4Z51A 3KJIA 3T06B 3DEFA 1EESA 4CF7A 3IQWA 3QEOA 2WAXA 1E2QA 3OFNA 1P61B 3GPLA 5DISB 2J9RA 3M1IA 2V6IA 4NHOA 1ZM3A 3R8CA 2C5LA 2QZ4A 2WWYA 4HUQB 1GKYA 1EWRA 5C18A 4QFMA 2CBZA 1YR7A 2JLSA 1ZVQA 3QNUA 4B35A 2V9PA 3PUZA 4MKGA 4KU4A 4B3XA 1G8YA 5EE1A 1DAFA 1ZUNB 1E79D 2IXEA 3IO5A 1QHHA 1H8HA 4F4IA 4LJ4A 1OXSC 4BLPA 2XITA 5DSZA 1Q1QA 1GILA 4DC9A 3KJHA 2ZITA 1Z6YA 3F8TA 3I1FA 4IXMA 5EXXA 4JBXA 4YDSA 3I8SA 1TQDA 1DS6A 3KTAB 1FNNA 4BE7B 4XTCS 2O8BB 1FTNA 2ZRBA 4Q4JB 2RGEA 1NVXQ 3U7HB 1NN0A 1OSNA 1HT1E 4OK3A 1YR6A 3QQ5A 2Q9BA 1GRNA 1T5LA 2OV2A 5DI9A 4TWZA 2LCFA 3RRYA 3IBYA 4NU0A 1N6IA 4Q7KA 2JJ2A 3HR8A 1Z28A 3NKVA 2A5DA 2AL7A 3AP3A 4CVNA 4OBEA 4B33A 4B3BA 2O8EA 2GILA 2W83A 4WBSA 1XD2A 5EZ6B 5JWOA 4HAYA 4RZ2A 3GJ3A 4Z54A 4K8OA 4C7OB 1UAAA 3KX2A 2XTMA 4DCVA 2JASA 3SYLA 1CJTC 3QKTA 3A8TA 5BN4A 5BYKA 2EFEB 2IBMA 2F1JA 3QF7A 2XZOA 3GLGB 4PR0A 1OIVA 1QZXA 4RJLA 3SOPA 4KVAA 3BB4A 3QPVA 3PCRB 4J0QA 1AN0A 1ELOA 2O0JA 4E22A 2I1VB 1E99A 1L8QA 1MO6A 3CRVA 2QT0A 3O47A 4Q1EA 4TTRA 2PEZA 1NVUQ 4RD2A 3GCGA 2PX0A 2QSYA 2GVDC 3CH4B 4TYNA 2ZE5A 5FBVB 1KO7A 1LV7A 2OXCA 2O5VA 2WSSD 2XOKD 4ITRC 4WW0A 4P31A 2IYQA 3W3AA 3UPUA 4L5BA 5FOUA 1IJFA 1HEIA 2GZDA 2C04A 1EFRD 1VMAA 3UATA 2J46A 4TLBA 5EXPA 3NBYC 1TF2A 1W0KD 4DLSA 5EUMA 1GP2A 1ZW6A 2NO1A 4JMPA 3KKOA 2C03A 1WMSA 121PA 1NVVQ 1T4GA 3AF3A 4TZ6A 3LBIA 1KK2A 4FIDA 3T34A 3KKPA 3W6NA 2XSZD 3FWYA 3H4MA 1AGPA 3VTKA 1QHHB 2ZAOA 4PFSA 4ZI2A 3RWOA 1Z0KA 2W00A 4O3MA 4AKIA 3P20A 4I81A 5P21A 1S3SA 2JLVA 4HLUC 4ZKDA 1ESNA 1XEXA 4ZDIA 3GEEA 2IHBA 1TEVA 4IVPA 4BWYA 4LPKA 1NRJB 4OJKA 4GNKA 1R0WA 2REBA 3BH6A 1W4BA 2GJKA 4FD2A 5JS7A 2XXAA 2RH5A 4MYCA 1J8YF 4II7A 3BK7A 2JDIA 2IS2A 3LBNA 4NYJR 1RKBA 1X86B 5GJWC 2HDNB 2J7PD 1QRAA 2ZROA 1CTQA 4FCWA 3H84A 1NF3A 2WM9B 3ZJYA 4BLQA 1ZMXA 1VDZA 3NBFA 5FI1B 1G5RA 1U90A 5DO9A 2BM0A 2BKEA 1CR4A 5F98A 1RVDA 5FPYA 3DHWC 3T1OA 3H0KA 1UKVY 1BOFA 2YC4C 1OH8A 2O8EB 1YVDA 2ECKA 4DJTA 2UKDA 3HP1A 1EFCA 1RIFA 1XD2B 1N6HA 4BUJA 4MRNA 4YMVA 1AZTA 2WWWA 1S96A 1P75A 4HEJA 1E79A 4A6PA 4LZZA 3THWA 5K8TA 5E3HA 3PUWA 2AK3A 2P5SA 2CCKA 2ZRIA 3OIYA 2QGNA 4B3DA 4D6PA 2VRWA 2WWXA 2XX3A 3AVWA 4RZUA 4UJ3A 3X2SA 2F1IA 5DNYB 2GCOA 4LBYA 4DIDA 4TTPA 1LW7A 2ZRAA 4C0JA 1DTSA 2GBLC 2PH1A 1CKEA 1VYUA 3W6OA 4FWTA 2WAYA 4URYR 1B0UA 4MKFA 3O8DA 2XJ4A 2QG6A 4NE2A 1SVSA 4Q00A 4XOIA 3ZQ6A 3ZLJA 1GG2A 4NCJA 2I4IA 1ZINA 3SYNA 3VR5A 2ZREA 3FMOB 4KBFA 2F43A 2FPLA 5B2ZA 3K9NA 1KI3A 4LYFA 5E7JA 2QP3A 4QKQA 3VX3A 3TSZA 5L3SA 3V4RA 2DBYA 1Z63A 3FYHA 3W34A 2WPDD 1H65A 4AC9A 2O8CA 2ZRPA 5ELXA 2X1VA 4MITA 1HQCA 5G41A 5G53C 1F60A 3LNCA 3OE7A 1MRNA 1WA5A 3SJBA 3EWAA 2BC9A 3U5ZB 1E2LA 4M9XA 5EQTA 2G0TA 4IDPA 3TE6A 4ZDKA 4JKYA 3SE0A 2OAP1 4DUGA 4E09A 3QJYA 3AVYA 2ZS9A 3CLVA 3PXGA 5JEDA 4NCIA 4RFVA 5TVKA 3IPXA 4XWKA 4TMVA 1XXHA 3IILA 3BE4A 2EWWA 4UNSA 1GTVA 4FMBB 4BQSA 1XEXB 2AKAB 2DR3A 1RYFA 1N6KA 3KUCA 4PPQA 2O8DA 3N2IA 4WAUA 5JRZA 3HU1A 1U8AA 3DVLA 2XXAB 3WBKA 4LV8B 1OXXK 1OT3A 4TLAA 4CT4B 1FL9A 4UXIA 3SBDA 2HEIA 4XVQA 1ZD9A 1UKYA 3VQTA 1E1RA 1G4UR 1YRAA 2P2LA 3BBPA 3HPQA 4GPTA 3LX5A 5FUYA 1V43A 5CB6A 1KNQA 1BKDR 2AWNA 2QTFA 5DI3A 2VPPA 3C41J 2GCNA 4YMSA 4CDGA 4BPBA 4MDEA 2QORA 4M1MA 3TR0A 3VR1A 2R65A 4A15A 3P4XA 2GF0A 4WZ6A 1MV5A 1W0KA 5JSZA 2R8RA 2J0UA 4HI0E 2WJHA 3T5DA 1IM2A 1ZM2A 1N3BA 4JLJA 1W36B 2AWOA 2XSZA 4TMWA 3THWB 2QTHA 2O52A 1XMSA 4FMCB 4LJ7A 2O8FA 1LNZA 2A5FA 2QUZA 3AH8A 3U44A 2BVNA 2IYTA 1VHLA 3PENA 3SQXA 1S4QA 2IUUA 2GCOB 4TQ9A 1GSIA 1DO0A 2ORIA 3KXLA 3O8RA 1KKMA 2VSXA 1SKYB 2AKYA 2A7QA 1N2CE 1EX6A 3EASA 2C9YA 1E9FA 1T3HA 1U0LA 2AX4A 4TN1A 4JL6A 1MO4A 3VFDA 5LPNA 3DM9B 2J0VA 2J7PA 3BFXA 4DSUA 2ZYVX 3IIMA 5BYJA 3LVQE 1U94A 5AUNB 4PQFA 1SGWA 1SVWA 4UKDA 2F43B 2PMKA 3GJXC 1E0SA 2E9SA 5DYIA 5L3SB 4L4UA 2ODBA 2QN6A 2ZS8A 1Q12A 3HR7A 3CKLA 4AYTA 3W8NA 2O8CB 3FTQA 4OKSA 3R7WA 1OLOA 1DARA 1G6OA 1XPOA 1N6OA 5K8LA 5SZJA 4CZ2A 5B64A 2ZYTX 2ZJZA 1N0WA 1N0UA 3RABA 5B57C 1AJEA 1Z0DA 1M7GA 1OHHD 2C2HA 2IHYA 3NEYA 3NDBB 2HYDA 3KB1A 3GEIA 5FPSA 1LTQA 2FPKA 1D9ZA 3UG6A 2OESA 5C4MA 5FL3A 1XXHB 3LBHA 3SJCA 1YE8A 4MRRA 4RD0A 1IAQA 4XSHA 3D3QA 4DLTA 3CR7A 5BXQC 1G19A 4EFNA 1E4YA 2IL1A 4PHTA 2QL6A 2WWIA 2O8DB 5JI2E 3QY0A 1WP9A 2ZETA 1YZTA 3DOEA 2ZI6A 1CS4C 2EQBA 4P4SA 1E2KA 3LH5A 3RNLA 1QVRA 4B3FX 2QMOA 1G3QA 3B5JA 5J47A 2ZEJA 3FHTA 4Q1CA 3TNFA 3B13B 4JT2A 1P5ZB 2FGJA 4MUBA 2BKUA 4DSNA 3DZDA 3TVDA 8OHMA 1DE0A 1AKYA 2A5JA 2ZUBA 4NYMQ 4FMDB 2WPDA 4BFXA 5DI3B 1G16A 1WRBA 5AJZA 2HLDD 2ZSEA 4HAVA 2B21A 3FMIA 4PZZA 1T8TA 4U00A 1OE0A 2QY9A 1T6NA 2RGGA 2LWIA 4LV6A 4HLQB 1OFUX 5JSZB 1VCIA 2ZR9A 3DL0A 1I2DA 1KI9A 1E2EA 1Q21A 3ZVLA 1VHTA 3QPUA 1E2DA 3TSOA 4ESHA 4HB2A 4V0LA 2J41A 1R0XA 3LA6A 1ZM7A 4D82A 2F6RA 2ZQ5A 1UPTA 4LX0A 4M9SA 1KO5A 2O8FB 3IHWA 2FPMA 3REFA 2I1QA 3KQHA 3U44B 1XJ0A 3B1XA 1N6RA 1NKSA 5CLQA 5FPTA 4M1WA 2ZE6A 1R5BA 1GM5A 3GJ5A 3Q72A 2NG1A 1E2NA 4EFMA 4KHZA 2IUTA 1ZD1A 1GL9B 3Q8XB 1OKKD 4A6XA 5JHGB 4K46A 421PA 3VKWA 2WJVA 1DAIA 2RGDA 1AM4D 1R10A 4POAA 1DPFA 4HAXA 4G5SA 4LJ6A 3EX7C 2PJZA 2E87A 1HE1C 1N0VC 5HTKA 2QBYA 3L2OB 3T5GA 2Q6TA 1X8JA 3T61A 1CJMA 1G7TA 4ZPXA 4B32A 4NYMR 5D3MA 1Q44A 2DWQA 1KDTA 1Z07A 2GZHA 3F3YA 4MKHA 1HQYE 2JAQA 5AJYA 3A4NA 4G3XA 3R7WB 3E5HA 2WJYA 2QEQA 3K0FA 3BH7A 4DEYA 5IT5A 3SHWA 1OH7A 4KITB 2V7QD 3WP0A 2CXXA 1NIPA 4QJ3A 4RD6A 1HH4A 4PZLA 3C7KA 4R98A 3QXXA 1T0JB 3ICEA 2C96A 2IYVA 2VHCA 1W4AA 3SC3A 2NTYC 4D2IA 4G0NA 3MJHA 3SFVA 3AVTA 4GL2A 3EA0A 2KBEA 2QE7D 5CJ2A 5FOWA 3ND8A 2DFKB 2XZLA 1HV8A 3CPHA 3DDCA 4ZKEA 2CL0X 3U61B 4B3GA 1W44A 1XEWX 1GNQA 1DEKA 1OB5A 4EPXA 2XAUA 4QNMA 3K0CA 5AWFC 3ZDQA 3IIJA 4DDTA 3WMEA 4KFUA 4B73A 1NP6A 1CRPA 2B8TA 2YWGA 1CXZA 4MA4A 2CLSA 3ASYA 4IOLA 2ONJA 3LLMA 2OO7A 4OQFA 3IBGA 4C0QC 4W5WA 4I4LA 1G64A 4UNRA 2ZSDA 4NCNA 1NN3A 2FEOA 5IK2D 1CBUA 1OHHA 4MQBA 2OSBA 1E0AA 4IDNA 4LK2A 3WRYC 4C30A 4XJXA 1GNPA 1YKSA 3EA5A 4FWIB 2G1KA 3VX4A 2BEJA 2A5GA 3GMTA 1W36C 5KNBA 1VPLA 2RHMA 1NNEA 4L8GA 2EFCB 2H17A 2VP2A 2ERXA 2DHRA 2GETA 2GXUA 3A36A 3B1VA 4HDQB 1NKTA 4JIMA 1JXOA 4DZZA 4KO8A 3A1SA 1ONBA 5FOVA 3TUZC 2WKQA 1GKIA 5CK5A 4RZXA 3IDQA 3PVSA 1RPZA 4B2PA 2QBYB 4S2EA 2G1JA 1W5TA 4JJZA 1KZGB 3NH6A 2DFTA 3Q7QA 5HE9A 5KYKA 2HV8A 5DIFA 5KDOA 2JJ2D 3GD7A 1IN7A 1T3LA 2EFDB 3X1WA 2NO6A 5D3MB 3CNNA 2ZJYA 3B82A 2GJ9A 3QXSA 5KSYA 3QVVA 2HLDA 4Q4AA 4YMUA 2VQSA 4GZLA 4NCKA 4B3CA 1CR1A 4HAUA 4YQFA 1R0ZA 1NY5A 3K0FB 1PLLA 4AKGA 1CULC 3CNOA 1GAJA 2YVUA 5IDVA 3TW4A 3VAAA 3NEJA 1UEIA 4UXJA 4JL8A 1L2TA 3ZVMA 1VIAA 4V0OA 4IRUB 1MRSA 1F3OA 1RRFA 1HA3A 1QHIA 5CM9C 2A2ZA 2HCJB 4CT5A 2J7KA 1HUQA 3E2IA 5EE0A 5F9FA 3BC1A 1E2HA 5TXGA 5GJBA 1ETUA 1SVMA 2JIZD 2BMDA 3QKSA 1CJVC 1OKKA 5EXSA 1NBMA 1RRPA 3FOZA 4A0HA 2PCJA 2IC5A 4EPVA 1COWD 1PLKA 1XMIA 4YDHB 1JAHA 4YMWA 3WBJA 4U5XA 4LHZA 2EU8A 3C16C 4M9QA 4IEEA 4JLPA 4AD8A 2QRNA 4JS0A 1KO1A 1UFQA 4PAMA 2E1RA 3PUVA 2PX3A 3QUSA 1Z0AA 4RSGA 1BYUA 1V5WA 5FOTA 3TAUA 3I61A 4BECA 4Q9LA 4G5QA 1A82A 2GXSA 3GJ0A 2KE5A 1Z2AA 4Q5IA 3T1TA 1I4TD 1M34E 4CIDA 1ZD8A 2IYSA 4EIWA 1PVOA 3AVPA 5E7IA 5IHPA 4TL7A 1D8TA 2WWFA 2IYRA 5AUQA 3WNBA 3NWJA 2V7QA 1DG1G 2YOFA 1U0HC 4XD7A 2Z43A 2XTNA 4QNRA 4DSOA 4V03A 1NN1A 3KJEA 4NPHA 1MO3A 2JLRA 4L9WA 1GL7A 1R0YA 3PITA 4AIIA 1HY3A 5CIQA 4KLNA 3QF4A 1RE0A 4EPWA 4YXWD 1XTIA 2JDID 2QE7A 2OG2A 2R6CA 4TLEA 1XMJA 4M22A 1UDXA 4LSGA 1OV4A 2BIFA 3JVUA 5F2EA 4HZIA 2H5EA 3RS3A 3CONA 4C3ZA 1M74A 4EPYA 4LI0A 2RGAA 4MRVA 4JLAA 4OQLA 2WSMA 4QJ4A 4A82A 1XTSA 1OXVA 2ZS7A 3LQRA 3QI2A 4AG5A 2AR7A 2JLYA 2OCPA 2X77A 1S2MA 3PFIA 4Q4AB 2ZVPX 1TAGA 3ASZA 2BHRA 1R4AA 2XTZA 1G6HA 1QHXA 4US1R 4URWR 2WIBA 1K6MA 1ZJ6A 1Z83A 2SHKA 1YU9A 1CP2A 1KMQA 1ZU5A 2F1RA 2PBRA 1OYYA 2YYZA 4HB3A 4JLBA 4US0R 3IIKA 3UKDA 4D4LA 3GEHA 1G7CA 4QRHA 1A2BA 5IK2A 2F9MA 1DELA 3B1ZA 4YONB 3TLXA 2WV9A 1S1MA 2GAAA 2QI9C 2CCGA 2MSDB 3KXIA 2YJTD 2XB2A 1X8LA 5H8WA 4N0EA 5G40A 1C1YA 4DEXA 4F92B 3I72A 4DCSA 3ZIAA 1YHNA 4A2WA 4CEHA 1BIFA 3K70D 3CZQA 3QKSB 1E9SA 3TK1A 4I1VA 1GZSA 1BS1A 2OUKA 1KKLA 2PCLA 4BASA 1G18A 1G3MA 1R8SA 1LFDB 2DPXA 1KI7A 4AYXA 3SDZA 4Q48A 3A4MA 3QBTA 1XX6A 4W7SA 1EGAA 3N5CA 5FFMA 3OE7D 1C9KA 2QP4A 3NHAA 3FKSA 1ZC4A 4WZAE 4TQAA 1Q57A 1DVRA 1W1WA 2A9KA 3CRQA 5FBRB 1AS3A 1SVIA 4HATA 2IYXA 3RAPR 4DUGD 5L3QA 2GRJA 3B2EA 1JPJA 3A1WA 2HJGA 4QC2A 4JVMA 4A0FA 4AURA 2VA8A 1KSHA 2MMCA 2ATXA 1VIYA 5JJIA 2CMKA 5KSZA 1G20E 3QF4B 1XU4A 3WNCA 2OFWA 2JIZA 2GA8A 1NJGA 5HCNA 2G3YA 1J2JA 2A78A 2EVWX 1MOZA 2X19A 4PSVA 1HE8B 4NYJQ 3NIBA 2VHTA 4N0DA 4NYIR 1COWA 3WXMA 2BV3A 1E1RD 3UMRA 3NC1C 4ESVA 3I62A 2Q0HA 5EP3A 5JJKA 2QP9X 2G88A 2KB0A 2VEDA 4Q18A 3QVUA 3WYFA 4QL3A 4MYHA 1G5PA 1E9EA 2G0NA 3A1VA 5TARA 3THYA 2RGXA 4TQUS 2JLZA 2Q21A 1GOTA 1AQUA 1E9RA 2QT1A 2VP0A 4DLXA 1R7RA 2KI5A 1OB2A 1WXQA 4E5UA 2B6HA 3B1YA 3R9XA 3GLHA 1J8MF 1Q0UA 2F55A 1QG2A 1TPZA 4BZPA 4D0LB 1YZQA 1Q20A 4TT3A 3CUEF 3NDPA 4YLGA 1H8ED 2BMEA 1WE2A 5E4FA 5DN6A 4H1VA 1MO5A 4B6FA 4YXWA 2XEXA 3OIVA 3LW8A 5FH9A 4CEHB 4JJKA 2C99A 4QM7A 4W9MC 2J87A 2GEDA 1D6JA 2QTVB 3C4JA 1G21E 2CHVA 3FHCB 1A5TA 1KDOA 4JYCA 4PPFA 4A92A 2JLWA 5CITA 2AFHE 2HXYA 1UBEA 2CEAA 1E2FA 2WWHA 3H1TA 4Q7MB 4LBWA 1WCV1 3BFVA 4LC0A 4V0MA 4B75A 2VTKA 1UKEA 1JR6A 3U3RA 3ETLA 1W5SA 1JB1A 2WMOB 1XPUA 3TBKA 1JR3A 2HXSA 1P9WA 3PIRA 1G8HA 1HURA 4QHYA 2R6GA 5SZKB 4A0RA 2OFOA 5SZHB 1VECA 1W2HA 3K0CC 1BO6A 2W0MA 1NBME 3ZVNA 3P32A 3ZZTA 5L3QB 2QA5A 3EZ6A 1X6VA 4PANA 3U4QA 1EFTA 3HYRA 2IXGA 4HDOB 1YZUA 1TUIA 1OJLA 1GVNB 4LBVA 4F4JA 3VR2A 2GESA 4XSGA 1SHKA 1P9NA 2ZR7A 3PQCA 5BWMA 3HU2A 4S35A 2OFXA 4EPTA 5EE9A 4OL0A 5FBQB 3CBQA 4F38A 4QBFA 2PMDA 2XNSA 1P6XA 4Q9IA 3BS4A 2GJ8A 1KTVA 2W2XA 2AK2A 3WHLA 3DKVA 4CRWB 5EP2A 1JQJC 1JECA 4GFDA 5SZIA 2CL7X 2B7CA 1T8UA 3ZS9A 2QROA 3GLGE 1YJ5A 1YR9A 2H7VA 1CLUA 4JVNA 1UKZA 3SR0A 4F7WA 5JHHB 2QAJA 5HE8A 3CR8A 1VCNA 3VKGA 2IWHA 1IBRA 5DE3A 1ZIOA 4G01B 4JZKA 4PHFA 1FUKA 4GT1A 3THYB 1XB2A 2LKCA 3CF0A 1FUUA 3K9HA 3JZAA 1ZIPA 3B60A 4LWZA 3AKEA 3LLUA 4R2IA 2IS1A 3GFTA 1OIXA 1P73A 4GOKA 4BFYA 2AFIE 3GLHB 4XWAA 4FI3C 2AD1A 4RVCA 3VR6A 1LY1A 1L4UA 1DG3A 3AP2A 4MGYR 2FX3A 1M6NA 1CF4A 3EARA 4KFRA 1FMLA 221PA 4OQNA 4DDUA 1EWQA 3PV0A 1WBBA 3OESA 1LS1A 4LBZA 3SQWA 1VYTA 5FUWA 5J5CA 1A7JA 3L43A 4M2LA 2H1LA 1JALA 1OPXA 4HSEA 4JSTA 2IF2A 4PO8A 2QGZA 4DDWA 2ZRKA 3CRMA 3RRMA 4AYWA 3TH5A 4CYMA 3EPLA 2B8WA 2F7SA 2BEKA 2N46A 4E07A 1Z2CA 4AKHA 4RFSA 3QPWA 3TUIC 4KFTA 4PSKA 3C14C 1NMYA 4OI0A 1ZNWA 4Q7JB 3W6PA 1GDDA 3V9PA 2CCJA 1UDWA 3OEEA 1KK1A 3PUYA 4ZCLA 3HWSA 3L82B 4GMDA 4Q4LA 4BZQA 2FDCA 3QIAA 3CO5A 3U4QB 1P3JA 4D4JA 1OFTA 1F5NA 3KB2A 821PA 4OI4A 4JLVA 4EPRA 3LDAA 3U7GA 2D2EA 3G0HA 1XEFA 4LJAA 4CW7A 2JCSA 4DRZA 2CVHA 4QBIA 2XNDA 4C2UA 1ZM4A 3K53A 1H8EA 3HPRA 2J0SA 4P32A 3PEWA 1W4RA 4P4TA 2Q3HA 1D9XA 1KI1A 3PUXA 4LV5B 1KSFX 2VH5R 3K70B 1KNXA 4KCGA 4QHSA 5HZHA 4DLWA 1JNYA 5FTNA 4I1UA 5H68A 2FFQA 1NG9A 2AN9A 3VHLB 3NC0C 2VP9A 2ANCA 1XZPA 1GUAA 2IT1A 2OBMA 5KHOC 3MLEA 2R62A 4AKEA 1E32A 2H16A 3F0TA 1EK0A 2FEMA 4PAQA 1P7CA 1ANKA 2IYZA 2XZPA 4RCYA 1Z6GA 3LO5A 3B8HA 3GFOA 3UG7A 2QMUA 1Z0JA 4OQMA 4BFWA 5JCPA 5KPJA 1IY1A 1F2TA 2BCGY 1X3SA 3CF2A 1DO2A 3H2YA 4QXAA 2IA5A 5JJLA 4RKFA 5G3YA 1TNDA 3BB1A 3NHBA 4UNPA 1Y3AA 2GF9A 2ASEA 1II9A 1CRQA 2HUPA 3R8FA 4ERNA 5J4VA 5GVRA 3ZH9B 3U2QA 3VNUA 4JT4A 1F2UA 4DDVA 3K9LA 5A0FA 4PC1A 4HZUA 3D6TB 4Z8XA 5CM8B 3U3KA 2PZGA 3WY9A 1G9XA 2Q3MA 1WF3A 3L8ZA 3U3MA 2GXAA 5EP1A 2VBCA 3KKQA 2IUSA 5FBWB 4WZBE 2J1LA 4ACAA 1RRCA 4LGMA 2VF7A 2GTPA 2BDTA 1P62B 4PC7A 1PJRA 2D7DA 5JCZA 4LHYA 4BEBA 4LHXA 4ZO4A 3EZFA 1RRGA 3GQBA 4CGZA 2BMJA 4OHVA 3GLHE 2B7BA 1FOEB 5J4YA 3RYTC 4RFSB 1UM8A 1VG9B 2R2AA 2VO1A 3FPAA 4Q21A 4TYYA 2W58A 2Z0MA 3W5IA 3UIEA 3MWLA 5FR2A 1XPRA 4NCHA 2GAOA 5AUPB 2IYLD 1O3YA 5TMPA 1HT2E 1BMFA 2FH5B 2OLJA 3A37A 3M4YA 4TYQA 3O8BA 4IOMA 3M6AA 1Q1ZA 3JVVA 2RKOA 4LJ5A 2OAQ1 4B2IA 3FKQA 1FQKA 2VHUA 2KBFA 2HT1A 3EIQA 3ZZUA 5AJVB 5JLJA 3W9YA 1O87A 4W5HA 3WRXC 5FOXA 1JEEA 2ZI3A 2ZRNA 4V0ME 4BFVA 2FWRA 2CE2X 3AKYA 4XVUA 2V4ZA 1FNMA 2Z83A 2VP6A 2ZRCA 4KVGA 5L3VA 4AI6A 3BB3A 1QVAA 1W36D 1NBMD 3DZ8A 1AS0A 3AF2A 1E4VA 2ZI7A 4JKIA 4DLRA 4JLKA 1AQYA 3GJ4A 4EKDA 2ZANA 4O0MA 3A1UA 3NBXX 4R7ZA 2VL7A 2QQEA 4XWOA 4LHVA 4JSYA 1W47A 4QGAA 3QOFA 3X1ZA 2C78A 2JA1A 5TDHA 1GITA 4JBWA 3RRNA 3TQCA 2FOLA 2JGNA 4BZXA 3U6BA 5B30A 1SKYE 1GWNA 4NBSA 3ADDA 1KY2A 4A4DA 2WOJA 1F2TB 1BH2A 1TF7A 3SN6A 3K8YA 4XD7D 2FFAA 1FPMA 3A58B 2V1UA 1GFIA 2ZTSA 3UXMA 1RW4A 1ESMA 5ANRB 1SVOA 1ZCBA 1F2UB 1R2QA 2ODWA 1N5KA 3HDTA 4RD1A 4IVRA 5C1BA 4HZUB 2C77A 1W46A 5CIWA 3AP1A 1P72A 1L4YA 2CLDX 4L9SA 3VHXA 3O8CA 4URUR 3KQUA 2WZQA 3PR1A 4X8OA 5KUTA 2MMGA 4D4MA 2C98A 3MG9A 5G3ZA 3I3SR 1TMKA 4OI2A 5AJWA 2QPOA 5JS8A 1A4RA 2QM8A 1M1YE 2PT5A 1YR8A 2VLIA 3B9QA 5FR1A 2ZR0A 4ASUA 2ZJ8A 1U81A 2JJ8A 4BRWA 4BFSA 3QG1A 1XXHE 4DLYA 4PSAA 3Q5DA 2REXB 1OXUA 5BW8A 1U99A 2IEZA 3CX7A 4OYHA 4OI1A 4IDQA 3KUDA 4IEIA 3CPJB 2GK7A 5LB4A 4GZMA 4G5RA 3EWSA 1YZKA 4GDFA 2FSHA 4M21A 1F48A 4ABYA 2QNRA 2NO9A 4LCBA 4QM6A 1LS6A 1XTQA 2W2TA 3IEVA 3MCAA 3BIFA 2D4HA 5CLLA 5CYPA 4GBMA 2QMHA 2JLXA 4OHYA 3FVQA 3VR3A 1XWIA 3QBVA 3C5CA 3IPYA 3MRSA 4NL4H 4ZCIA 1A2KC 3W3ZB 1OH5A 1KHTA 2ERYA 2EYUA 3VMFA 1CIPA 3SEAA 3ZIAD 2QMEA 1KYIA 1K5DA 2ZSFA 3S1AA 1Z6XA 3QSYA 5LD2B 3QKUA 3LWNA 5AUOB 2ZRMA 4D25A 2RMKA 2DFLA 2V8OA 4ZDJA 1NLZA 4FINA 2WIAA 4DT1B 3ZD6A 2WHXA 3OEHD 3K70C 1FFHA 4LJ8A 5J4LA 1OW3B 2GJSA 4QBGB 4JLMA 3T1QA 3AF0A 3OAAA 2FNAA 3QE0A 5IF9A 2P0EA 3FKSD 5CK4A 2BWJA 4TMZA 3X1YA 2OT3B 3TR5A 4MUAA 621PA 4ZV4A 2Y8EA 3CIOA 4MDFA 1PV4A 1NSTA 2ZYWX 5KTYA 1J90A 1G8PA 1QHNA 4B71A 1LB1B 2ZSBA 1KO8A 3KDSE 3SJAA 2VF8A 1IOZA 1S1CA 4LJ9A 4BLTA 1Z6TA 4KV9A 3RDPA 4CEIA 5D3QA 1L7VC 2OILA 1MH1A 2CK3D 3KXKA 1IONA 2D74A 4C9BA 3TVTA 1IXZA 3CWQA 3LFUA 5F9HA 4EUNA 3X1XA 3R20A 3BWDD 2JATA 2J0QA 3Q5EA 4PC2A 2OLKA 2CE7A 1OH6A 1AZSC 4KSCA 1U0JA 2RHDA 2CVFA 3JZMA 2QENA 2OHFA 1XP8A 4PO9A 1ZBDA 3WMGA 1KAOA 2ZRHA 5KU1A 4IOKA 4A1FA 2YC2C 1UEJA 2FMXA 5A4JA 3MMPA 1CU1A 2NPFA 2ZJ2A 4B47A 4BLRA 5DH9A 4NDZA 2YNMA 4UJ5A 4PC3A 3K0SA 1XTRA 4WIAA 4ARZA 5GADl 3RS0A 3RLFA 2HCBA 4NP6A 4PQRA 2GVZC 2BMFA 2J59A 4M1TA 2OCAA 3MGCA 3UMFA 1N6PA 3EW9A 4XVRA 3VU9B 3EPJA 4IHQA 1UBFA 3AVUA 3AUXA 1II8A 3CF6R 5J4HA 4Q1FA 4I1SA 2KJQA 2GJAA 4GI7A 2IK8A 1P2VA 2GK6A 2H92A 4JBYA 3K09A 4RD4A 2R6AA 2ZJOA 3H86A 4NTZA 1TTTA 4F93B 4PZYA 3TSWA 4F4CA 4HB4A 2V6JA 2VHJA 1XTJA 4Q03A 3QXJA 3AGPA 1CJKC 3DM5A 3RRZA 3ECCA 4C0KA 5JZVA 3FB4A 2ZIAA 2EFGA 4PPGA 1KDRA 1KK0A 2WMNB 4Y0VA 1D2MA 3OF5A 4DCTA 1XCPA 3CX6A 4TT3D 1LF5A 3UANA 2JLQA 3CB4A 1RC8A 5UKDA 5DN6D 4EQ6A 4C0SA 4HAWA 3S1AB 1UBCA 5BN3A 1TUEA 1Z06A 1E9DA 3L8YA 1M8PA 3D7MA 4MGZR 5KDDA 2FSIA 1E69A 3DKPA 4LYJA 1XBTA 4KODA 4LYHA 1SXJA 2UZIR 4TMKA 1B23P 4XH9B 3U7EB 3AGQA 3SYKA 3P1JA 1E9CA 2BBWA 3LVRE 1DADA 2ZU0C 4O2LA 4PC6A 3SFZA 3PG5A 2FZ4A 5K8UA 4LRWA 1G1MA 1JR3D 1VKJA 3I5YA 4TSFA 1QBKC 1QF9A 4PX9A 1ZNYA 2IW3A 2PLFA 4IOJA 2FZLA 2FE4A 2QRZA 1X8KA 1DBSA 4RY2A 2QAGA 1VG0B 3MWKA 4AY2A 5HZKA 2D7CA 1DAMA 1NMZA 3GJ6A 4PQYA 2GXQA 4OK5A 4QJ5A 1XD8A 1KJYA 2HF9A 1KGDA 3UWKA 4RD3A 2HYIC 3RVBA 1RFLA 2BM1A 2MSEB 5TV2A 1A1VA 1KIMA 4TL6A 4CEIB 5J4KA 2ZI4A 2OBNA 2VYFA 5EUQB 3U6KA 2QPTA 1RJ9A 4IFBA 1YRBA 4US2R 1II0A 3N70A 4F91B 3EAQA 2ODEA 2UZ3A 3V4FA 1LVGA 2IYWA 2ZM5A 1S9HA 3IUYA 1DAGA 4Q1AA 3GP8A 4CEJB 4DB4A 3IHLA 1HYQA 2RCNA 3V00A 3TIFA 4NYIQ 2ZJBA 2G9NA 4JVSB 1E3MA 4ON9A 1RYHA 4X8LA 4Q01A 1JJVA 4H1UA 3OEHA 4M0LA 1Z8FA 3U7FB 1TQ2A 3BOSA 4UNNA 4ARZB 1KK3A 1RZ3A 3DMNA 4A2PA 4NKRA 2D06A 3WNDA 2ZJAA 2CNWD 2XB4A 3AKCA 1HTWA 4DLVA 1DAHA 3LQQA 3MFYA 4Q02A 1IHUA 4OHWA 1M2OB 5FOSA 1II8B 2ZVQX 2CHQA 3B1WA 3WP1B 3KQNA 4B2LA 2R6DA 2GHIA 1NJFA 4A2QA 4N3NA 1X1RA 1Z29A 2YOHA 2O0HA 4G5GA 3TUJC 5K8IA 3RANA 4DHEA 1R5NA 4HB0A 4MYUA 3HYTA 5LBIA 1TEXA 4DVGA 3AKDA 2XGJA 2CK3A 3G5UA 1TL7C 3A6PC 3BD9A 1G291 5KSPA 3P27A 3L0OA 4LDJA 4HYYA 5TB5A 4EJSA 2ZAMA 2WWGA 3LY5A 1VG1A 4GOXA 1W49A 1SVLA 2ZI5A 4EQ6B 2IF0A 2RB4A 1C4OA 2ZPTX 1WB9A 3T15A 3KFVA 1Y63A 4ZIRB 1N5JA 2EW1A 5KNCA 3NXSA 1G5TA 3EPKA 5LD2C 3SZRA 3U60B 3L0IB 5F3WB 1AGRA 5FUVA 1ZUIA 1S8FA 2ZRFA 1ZP6A 1SXJB 4X8HA 2FGKA 2ODNA 3TKLA 2J45A 2OXRA 3VR4A 4JLNA 3SI7A 2ATVA 2C9CA 4JL5A 4N1AA 1KOFA 4WXRA 3WYAA 1TADA 1JPNA 3G82C 4ACBA 4OHZA 3AQ4A 3BGWA 1E9BA 4M1YA 5FL7A 3OEED 2FA9A 1UBGA 1R8QA 2Z6VA 3PJRA 3C5HA 1AA9A 4LYAA 2ZI9A 3SNHA 3UWOA 2NO0A 2YOGA 4KFSA 1CR2A 2AXNA 1N5IA 1EXMA 2QAGB 3U3OA 4R71A 2L0XA 1I4DD 3ND9A 1IN8A 1E2IA 1K8RA 2NO7A 2ZUCA 4UNQA 3FFAA 4IJMA 3EZ2A 2IWRA 5EXTA 3RS2A 3EZ7A 4R9UC 1MKYA 4KI0A 2ONKA 4LY6A 2O0KA 1G41A 1S0UA 2XNDD 3J81k 3Q7PA 1RJ9B 3KFXA 4B44A 4BLSA 2AXPA 2NZ8A 2YWFA 1ZAKA 4OK6A 4DIEA 1KMHA 2QPAA 1E0JA 4LPSA 5HKKA 3T1VA 2EWVA 2FU5C 2JJ1A 1KSGA 1T3SA 4BFTA 4Q9JA 1XCGB 2ZXUA 3CPEA 2YKGA 4TMTA 1FMJA 2W6JA 4QOSA 4U7DA 5AK0A 5JEEA 1E0KA 3FE2A 4TLCA 3NTUA 4DCUA 4Q19A 3CNLA 4BEJA 1W4CA 1XF9A 3AV0B 1OYWA 4DLUA 2PJRA 1PLJA 4WA7A 2WTUA 1G3IA 1P2SA 1U8ZA 4I99A 1OIWA 2CLCX 4EFLA 3DMDA 4BRUA 4H9GA 3HJNA 2IS4A 1ZNZA 3EG5A 2NGRA 4KAXA 3CM0A 4NONA 5FPKA 1YZGA 3K1JA 2V3CC 2REOA 2DB3A 4O2RA 1F6BA 4Y0AA 3CRRA 2H57A 4HLCA 2X8AA 2R44A 4V0NA 4BLOA 2CDNA 3BFKA 4HAZA 3R9WA 2OEPA 4D26A 4C0AC 1J99A 3EZ9A 4BGDA 4FMCF 4GP6A 4Q1DA 1KAGA 4FW9A 3ICQB 4MGKR 1Z0IA 4EJSB 2VHQA 3SBEA 3CRW1 4D4KA 3RWMB 1MT0A 2GEUA 5JFGA 3R9IA 1NVVR 1EFHA 1KI6A 5HR5A 2W0SA 4QBHA 2IYUA 2FSFA 2YWEA 4FCTA 1GL6A 1U98A 3VKHA 3THXA 3K0AA 3LX8A 5EE5B 1E1QD 1NMXA 1YZLA 1IXRC 3LAWA 1ZYUA 4P33A 1N5LA 1T0HB 1NI3A 1QHGA 3BH0A 1S9DA 1GKUB 5EJEA 1NLFA 2CNWA 2P6NA 4X8MA 1US8A 4C0BA 4M8NE 1BMFD 3C8UA 2ZE8A 4Z8YA 3D31A 2RGCA 3GJ8A 1UJ2A 1J7KA 2FN4A 3CWZA 1G7SA 1MABA 1KJZA 1S3GA 1WBDA 1M7BA 1T9HA 4JYBA 4PTLA 2GEVA 1QG4A 2X2EA 2ZUDA 2YV5A 3MJRA 3BJIC 1SXJE 4Q7LA 2YHSA 1E2PA 1G3RA 5EP4A 1TU3A 4BFUA 5CB8A 4TYWA 2P65A 1XCMA 3N2EA 2BJWA 4A0GA 4URXR 2ZRDA 1KMHB 1IN4A 3A4LA 4MGIR 1OFHA 2G83A 4A8JA 4K81B 4TL9A 3RSOA 2GCPA 1JJ7A 4PHHA 3W90A 3P4YA 5L3RA 2A30A 4MRPA 3TQFA 2IX3A 3OIUA 3REGA 4R2HA 2NPIA 3SJZA 1XNJA 4IW3B 2GZAA 5FPHA 2GKSA 3EXAA 2C95A 4FMDF 1NLYA 2FG5A 1Z0FA 4PXAA 3GFPA 1XJQA 2WKPA 2YZ2A 4QHTA 4XTRA 1U9IA 2FF7A 1GRRA 1FZQA 1E2MA 1Q22A 4IKEA 3TGPA 4OHXA 2DFNA 5GJVC 4P3YA 3GLIA 1XTKA 1P4SA 2QM7A 3GLFA 2DY1A 3QXCA 1T91A 2WSSA 2XOKA 2RAPA 3MUFA 5BQ5A 4A9AA 1KI2A 1XD9A 1GRQA 4C0LA 2HF8A 2RGNA 3K09C 2HT6A 2ZRGA 1EFRA 2BBTA 3ADKA 1Z6AA 4Q1BA 3DO6A 3WYGA 1AS2A 1N6LA 3OZXA 1E2JA 4Q4HA 4AG6A 5FUXA 1JEDA 3PEUA 3AVXA 3K0EA 3U3JA 1KI6B 3FFBA 5DGXA 1TQ4A 5IRCD 1W48A 2WJGA 1SQ5A 2FFHA 3RSLA 5M04A 1U8YA 1SKQA 4ASUD 5FI0B 2FJUA 3L0PA 3NH9A 3THXB 3K0AB 2QQ0A 4B6EA 2QU8A 2JEOA 2MSCB 5H70A 3CZPA 1SXJC 3QKRA 1AIPA 2BJVA 1US8B 2WJIA 1KSJA 5DHAA 2N1BA 1W0JD 5KSOA 3ZQJA 2B92A 1Z08A 3L0SA 2PZEA 1GIAA 5EZ5A 2F3TA 4Q66C 3EPHA 5DLQC 1BYIA 4W5JA 3ZD7A 1MABB 3FHOA 4M9ZA 2TMKA 2I3BA 2ORWA 4MH0R 3Q3JB 2QAGC 3ZS8A 2IS6A 3MD0A 5KDLA 2G77B 4YC7A 1FP6A 2ZE7A 4IFEA 2BCJQ 2FV8A 3RS4A 5JECA 1IJEA 3UK6A 4C2TA 1DOAA 5GVSA 4DXAA 4TL8A 2YINC 3NBZC 2VP4A 4ZI3A 5JWRA 3VU9A 3E1SA 5DYGA 3FGNA 5C4GB 1PUIA 1TQ6A 4NH0A 4C4PA 5JI3E 2OCYC 3IQXA 2FFBA 4A8JB 4P0TA 4DLZA 3MWYW 1N6NA 4UQOA 2Z4RA 1CEEA 3SU8A 2X2FA 1KO4A 721PA 2J3EA 1P9RA 1AKEA 2CHGA 3OHMA 1E1QA 5AR1A 5DHFA 3WHKA 1FW6A 3OAAD 2P6UA 2UVQA 1GNRA 2DCUA 2R6FA 1PUJA 4DB2A 3TAHA 2NQ2C 3Q9LA 1UADA 2K5UA 3ADBA 4B48A 3LXRA 2VP5A 3CH5A 1G17A 1ODFA 3MSXA 5CDFA 1K5GA 1Z5ZA 3IEUA 3I92A 1Q3TA 3I73A 3SHFA 1Q1EA 4D80A 2AHOA 4UXHA 1IN6A 2D2FA 3GLIB 3GLFB 2QSZA 3EC1A 4QGGA 1XJCA 4URVR 4PAOA 3B6EA 2CJWA 1NSFA 4M53A 2D3WA 2GWHA 3BRWD 4M1SA 4EAQA 1NY6A 5CYOA 2WVJA 4JLDA 1JR3E 4QGHA 4BFZA 3NG1A 5HPYB 4M1OA 5TY0A 3HU3A 3PEVA 4Q4HB 1D5CA 2J0UB 1R6BX 3TRFA 5FTJA 4Q47A 2CL6X 5C46F 4Q9KA 2A3RA 2V55B 3FDIA 4EJSC 4DT1A 1X1SA 1KJWA 1EFUA 3QENA 3UMSA 1VYVA 2ZYUX 2Q9CA 3T35A 3QXHA 4M1KA 5JBQA 1YZNA 5JMTA 1SHZA 2GNOA 3I32A 3M0EA 5JWHA 2GDJA 3QKRB 4DSTA 4G5OA 3K9GA 4AK9A 2RGBA 4DCNA 1T5IA 3AVVA 3W5JA 1G8GA 3BAFA 4JLOA 4HUTA 3WMFA 4Z1MD 2ZJ5A 4HDCA 2OBLA 2W6ID 2P67A 2H18A 3AVOA 3IO3A 2IXFA 2R9VA 4URZR 5GJCA 3I4LA 1NN5A 5A5GA 1E94E 4RKEA 1SULA 3I5XA 1XDBA 1YQTA 3D8BA 3ADCA 3EC2A 5CJPA 1VG8A 4MKIA 1Z22A 1JXMA 4LJYA 1W7AA 2IEYA 4KBGA 1SVKA 5E7MA 2PEYA 4P4UA 1IXSB 4HLUA 1G4AE 2ANBA 5H1YA 1QHSA 2WKRA 4TMXA 3RS5A 2ORVA 3AEZA 2EYQA 4D81A 4PHGA 1U2RA 2F3RA 4FN5A 3AB3A 1SXJD 5KOYA 1QDEA 1D2EA 3THOA 1Z3IX 3DOFA 2IYYA 4E03A 2ZRLA 5E95A 3GJ7A 3B78A 2G6BA 5J40A
chains in the Genus database with same CATH superfamily
5LQSA 1XJWA 3O82A 4RS3A 2H08A 2WZCA 3VZRA 3OIWA 3GLTA 3B2NA 4JOBA 1V6CA 5DHTA 1H2RS 1Z17A 521PA 5K2MA 3VO8A 1GSAA 3H5AA 4GF5A 5EMKA 2JH3A 1RI5A 1SXQA 4EB6B 3ZH2A 2EKPA 4HH4A 3LQYA 4OQYA 3FYCA 4EA6A 4MUKA 2PT6A 3T12A 4EWLA 1NDQA 1PDVA 2R4QA 1NP7A 1JA1A 1SU8A 2N42A 3A1TA 3CX8A 3N76A 4QDOA 4NEQA 4R8SA 5TMDA 4C0HA 2C29D 2ZIZA 4IF4A 3UN1A 3ZUGA 2R1UA 3JQDA 4E2ZA 3AKZA 1PGQA 4KXFB 5ECGC 2GYYA 1Z88A 1OLUB 3SG0A 3A6DA 4U6SA 2C9ZA 3RC8A 3U16A 4INOA 1OREA 3MFQA 4G26A 2QZZA 1KFCB 1U1GA 3AG6A 5K20A 3HWWA 1EGVB 3HVHA 3PRJA 3Q11A 4UHHA 3M5CA 1TDJA 1GEEA 2BI4A 1FVHA 1T1RA 1GR1A 1U28A 4L8WB 5F33A 2CJXA 2UZ0A 1JHXA 1H8HD 5GGYA 2RD2A 4F4HA 4UBLA 4IDOA 4XXHA 1R6UA 2D13A 3IGFA 3PJEA 5FWYA 4GP7A 3W5HA 4G5FA 4L16A 3GLFE 3M9LA 1D2CA 3BSSA 4AWXA 2NMVA 3ONWA 1U2GC 2XUFA 1ZU4A 2XMZA 1MOPA 3EJWA 3OP4A 1IY2A 5KO2A 1CR0A 2F8LA 2BFDA 1C5KA 3H42B 1KS9A 4S1WA 1LQTA 4TV8A 2VDQB 5GONA 5E38A 2EATA 2Y1DA 1FXWF 4A36A 3FMPB 5L3ZA 4GE3A 4Z99A 3V32A 4FNAA 2WFZA 3N2GA 4LXGA 2NVBA 4MUYA 4UUOA 1C3VA 4EDHA 3WLQA 3BERA 5A4MS 1ZC3A 4KJZA 4AMGA 1SOVA 1ZCAA 1FX0A 3LCCA 3CLSD 3MAAC 3LV8A 4KQ6A 2JEZA 2NU9B 3GK3A 4YPVA 2ZRJA 4N76A 3W9BA 3PHGA 1LX6A 4IEFB 1XMVA 1KZ6A 2FXVA 2AIRA 2IPMA 2OHVA 1XEWY 1NJ5A 1G4HA 3PHJA 4FGLA 4PFJA 4QQ8A 1H6DA 5KTMA 4EL5A 1KRXA 3GFRA 1Z47A 2I78A 3EGEA 1R88A 2YCLA 1RPNA 1YBVA 1DJOA 4FCVA 4E11A 4Y2XA 3B85A 2PWYA 2JIPA 4MQFB 4MI6A 5REQA 1DIOB 4IXNA 4BO1A 5AW8A 3REQA 3CA8A 2ZTVA 4DKXA 3LX6A 1GZ5A 4W5QA 3F9CA 2VJCA 1QCYA 4DMFA 3GHHA 3R0IA 2Q3FA 3NOVA 1WZCA 3PKIA 4G1EB 4R69A 3B9PA 1WXIA 4V0KA 2HN9A 3RS7A 4LUCA 1QZZA 1TYEB 2KLHA 3RSCA 2R5WA 2PUCA 2AFHA 2YHUA 3LM8A 3WIOA 2CLIB 2PVCA 4HWKA 1LLQA 2R60A 3CV3A 1GTSA 3Q8MA 5K0FA 1HE5A 1T10A 4MAFA 4OJQA 4PGAA 1SBTA 3RVPA 2LKDA 4BJ1A 2EFHB 3FWNA 4DG8A 4F56A 2DFDA 1P2GA 3EGXA 3PCXA 1KA9H 3UQZA 1ORTA 4A8JC 1JPUA 2VSFA 4ITVA 2WVHA 1MR3F 3BWEA 3C15C 4IRMA 2BR3A 3B20A 3KTAA 3PXAA 4DANA 3W7AA 4Q4JA 1GPLA 2A3NA 2GGSA 3GFQA 1CZLA 4EG1A 3CHYA 1DFGA 3LW7A 1YFKA 4EG5A 3IBFA 4AW9A 2NIPA 5LWHA 3RM3A 4Q4CA 4RWZA 4TXJA 5G1OA 4YFVA 4D9NA 1P2TA 2VCYA 1ZNXA 2NYRA 5THXA 4DDHA 1N2SA 2OCBA 2I2XB 1HNWB 2W6IA 3GLVA 4Q9HA 3WGHA 5EVJA 4C6TB 1P7YA 3GLUA 3HY4A 1R5OA 1UZUA 1ESEA 4MQEB 2AUNA 4I1OA 1IEXA 4RLSA 3LPCA 5K3BA 3D2BA 4ILEA 3U37A 4HGRA 3OZCA 1FQJA 1N9GB 2IJGX 2OL4A 2X7HA 5LB2A 1NWHA 5FQOA 2AN1A 2XJ9A 3NVAA 1J56A 3HXOA 4GSYA 1YQ9A 4UUQA 1ECPA 5JRJA 4RCZA 4ZYLA 2ZB2A 2ZSAA 3CZ9A 3DHEA 2JK1A 3OFKA 4HLDA 3AIOA 2PRJA 4EX6A 2XCTB 1QNFA 1RT9A 4S3MA 4JUDX 1IFXA 4JP3A 3ZZ0A 2UV8A 2OORC 4ND2A 4CKXA 3IOCA 3V1TC 2XA9A 1K7FB 1V41E 2YW2A 5IC4A 2A0WA 2LRHA 3QYPA 4IZOA 5I9NA 3GLGA 2P11A 1QANA 1YL7A 4WA8A 3B6MA 5LBUA 4RPLA 4C07A 1OF1A 3I01M 4IIEA 5B58C 1G8FA 3HUEA 4LXXA 4OIMA 3C3CA 3F5FA 4E2WA 2KWIA 2L19A 4RK0A 4DXDA 3AR5A 3L77A 2P5TB 4GRAA 1U0FA 2YYAA 2P9BA 4OFZA 1EDOA 2WICA 4I4TF 1JHRA 1NAHA 4KYIB 3OZUA 5TQ2B 2C7GA 2SECE 2AYZA 3AVQA 3GRAA 3H83A 1NOIA 4W1SA 4AIRA 1NVBA 2ZBPA 3PD0A 2HBQA 1XF1A 4I46A 1FP2A 1A71A 2Q1WA 1N8KA 4OLFA 4YS6A 3WLSA 1IJBA 1R12A 1TJ5A 3DUFA 4OREX 5EZYA 1EHIA 4LOAA 4XIGS 1E6KA 3KJIA 3T06B 5AVRA 1X1QA 3GGGA 3OO1A 5KVVA 3QEOA 5DGIA 4J6EA 1EESA 2ZSIA 3KKZA 3UV6A 1DJNA 3DMPA 4QPPA 4RLFA 4BWFB 4NMLA 4BDSA 4GHWA 4KW7A 4G4GA 2C5LA 3ME5A 2DSNA 4R8VA 5JMOA 4HUQB 4ZZ3A 2DR0A 4P4GA 4YQYA 4XWGA 3ZGOA 3C3JA 2R6HA 3QNUA 1A0OA 3LT1A 5J2UF 2AOXA 4O1MA 3PUZA 1B7GO 5EIWA 1TAUA 3PNKA 4NHEA 1G8YA 4RZSA 3KDAA 2IXEA 1SOUA 3IO5A 2HDOA 2JVIA 1J8FA 1ATZA 4JASB 2DSTA 1T1JA 4C22A 1RPJA 2X41A 4KN5A 5CTAA 5B6JA 1HDEA 4YT4A 3OT4A 4CM9D 4NZNA 1K6XA 4PAGA 1GILA 2RAUA 1KYXA 3KJHA 4LWPA 3F8TA 1YK0A 4IXMA 3ZIDA 4E33A 4DIKA 1ECJA 5EXXA 4GXTA 3PHBE 3Q7RA 3WL5A 2FW0A 1BHJA 1SWVA 3ELDA 4BE7B 1QU3A 1T1SA 4AZTA 1FE8A 1NVXQ 2JNWA 3U7HB 1HT1E 5EIOA 1UMBB 1YR6A 2Q9BA 1GRNA 2K2QB 3I2FA 2OV2A 5DI9A 4X7RA 1KEPA 3RVMA 1U3TA 3S2GA 1JVNA 1R15A 2JD1A 1BE6A 1JKFA 1N6IA 3R0QA 2FOXA 1UJMA 1Z0SA 2PH5A 1LDBA 3E23A 4WTOA 4FJ0A 4C1NA 4Z4CA 2G63A 4FEAA 3RVKA 3NUGA 2QN8A 4G23A 2A57A 1ZFNA 3AEUA 3RBXA 1CNMA 4B3BA 3WKBA 2FPIB 2W83A 1W87A 2EJBA 3HR4A 3MTDA 5SV2A 1NQ5A 4HDMB 3I9NA 4HAYA 5F1KA 2RJNA 1CIVA 2X40A 3GJ3A 1BDHA 3EK2A 3NTRA 1V7QA 2YWDA 4YDRA 4F1JA 1UAAA 3KYJB 4XQEA 1YMVA 4MYRA 4AG3A 1M2GA 3NUQA 1KH1A 3VH3A 3CUKA 3JZFA 3A8TA 5BN4A 1V2GA 1Y3HA 1Q14A 3QF7A 2PL9A 1NE7A 4HWTA 4ALMA 5KWSA 1QRDA 4RJLA 1QZXA 5T4EA 3CJTA 3O21A 4H0FA 1PR6A 4EM6A 3BB4A 1GVHA 1ZK0A 2B36A 3H9BA 4C7BA 3HY3A 4Q3LA 1VYHA 4CLEA 1L6RA 3SDSA 3VRHA 4E22A 5IM4A 1D2AA 3R3HA 2XIJA 1ISJA 1L8QA 3PI6A 3CRVA 3MXOA 1IBLB 4B6JA 1NVUQ 1SQGA 2E4WA 2Q2VA 1NATA 2QSYA 1EVKA 7YASA 4TYNA 2ZE5A 5U4XA 2V45A 5F4BA 1GXSA 3AEQA 1UZAA 3L7NA 4HQLA 3ZK7A 3EULA 3JQBA 4GI5A 5A3VA 1XYYA 1HWYA 1WPXA 2Q8PA 2XPCA 4I50F 4O4LB 2EL7A 2XNJA 3W3AA 2ZUTA 5K0NA 3VSBA 1TCAA 1HEIA 3FUVA 3NBKA 5FOUA 3UPUA 3EGIA 4ND1A 2C04A 3V55A 1VMAA 4PZ0A 2J32A 3HXQA 2J46A 3H87A 3NNSA 1TF2A 1W0KD 3FYUC 4DA0A 5EUMA 1ZW6A 3KKOA 2H5LA 4HY3A 3N8DA 3ENKA 4N3BA 2Z9CA 1NVVQ 1GEGA 1T4GA 5IUJC 3LBIA 2G4VA 4LWQA 4UBIA 2O7QA 2XSZD 4YRTA 4DIBA 4OXNA 3OOWA 5F4ZA 1O5IA 5C4IA 4KWCA 1Z0KA 2RBKA 2W00A 4L02A 4AMVA 2L69A 1NOJA 2RGUA 1XXLA 3L1HA 5P21A 4CKBB 4DQXA 2JLVA 1ESNA 2WUWE 3L7YA 1Y37A 2Y66A 3PDIB 4KZKA 2DUJA 4UD6A 2IHBA 5EN4A 1XIVA 1KMIY 5HUJA 2BUBA 1EUCA 2B3DA 2QD2A 4LPKA 3V2IA 1NRJB 1S3FA 3KZNA 4MB6A 2PWZA 4OJKA 5TGDA 4A91A 1ZVMA 2ACVA 3BH6A 1AV6A 1FU8A 1KMNA 4U6NA 4MYCA 1J8YF 1UCFA 2OGZA 3BK7A 3K6KA 4II7A 5TGZA 3UWPA 5IFKA 2GM5A 4NYJR 1RKBA 3H5IA 3K32A 4JBIA 2O3JA 4WV3A 4P83A 4Y1EA 1Z56C 2W4IA 4MZDA 5AKZA 1FDOA 5FI1B 1G5RA 1C9JA 2ZUUA 1CR4A 2VUSA 2YJGA 4IJVA 2EQ5A 5FPYA 3JCZA 2ZXEA 2P0AA 2ZDGA 3R7NA 4O2AB 4GPBA 2BGIA 1BOFA 3K73O 5FCDA 4Z9YA 4M0MA 2FUG1 4K9QA 5WRFA 2ECKA 3BGSA 1W6UA 4DJTA 2UKDA 1EFCA 3FY4A 1XD2B 3GXOA 3MTIA 3G5MA 3QVJA 4FCCA 3HNPA 4J9UE 4RZHA 5CX1A 4AU1A 2GAJA 1VJ1A 3UB4A 5AM3A 2NZYA 1E79A 4Q12A 2B1RA 4LYEA 1CW2B 1XVIA 3DNMA 3KU4A 4QTTB 1C9DB 1MC5A 3PUWA 5K8TA 1Q0SA 5IS2A 2CCKA 4RVHA 5JT1A 4XB1A 1G6Q1 1ZPDA 2QGNA 3KIPA 1N5MA 3K30A 2WWXA 1TC1A 2XX3A 4IUYA 2Q4BA 3FA2A 4GBGA 4HNAA 4I0WB 4RX1A 2E4YA 3UCFA 3X2SA 1QHEA 4EGQA 5DNYB 5JVDA 4IWXA 1KJ8A 4JGIA 4ZOCA 1Z0UA 2KPOA 4GKBA 2ZUEA 3UB3A 1VYUA 4D8YA 1M3SA 1ZONA 1H2BA 4K9OA 4FWTA 1SK9A 2WAYA 1YDHA 2EOAA 2H1VA 2QV7A 3AR7A 3QW2A 4MKFA 2JGFA 2Y67A 3O8DA 3GBSA 4HQ0A 4NE2A 3KB8A 3ZQ6A 1JVSA 3R3JA 5KYNA 2HK7A 4YA6A 3SYNA 3FMOB 4GD3Q 2VJBA 1VL6A 2F43A 5B2ZA 4LYFA 5LIPA 1BDBA 2FR8C 3G9ZA 3M1YA 4GO1A 5E7JA 1Z63A 3DBIA 5DT9A 3MCTA 1BMTA 3FYHA 2BFBB 3PGJA 1C0LA 1UT6A 1WCXA 4ZU6X 3RW9A 2HJ9A 4AC9A 5KNBH 2ZRPA 5ELXA 1KH2A 4YRQA 3FUUA 4HGQA 3ZGNA 3ABIA 1KEEB 3GC6A 5EJ2A 4Y6GB 2QRMA 3QP9A 1M6EX 1F60A 3PC8C 3LNCA 3OE7A 4DWWA 1MENA 1WA5A 3ZJ4A 4KIFA 3EWAA 5DBOA 3V8PA 4C78A 3KOYA 3ZXSA 1GUDA 4DGSA 1X15A 3OUZA 4UMDA 4IDPA 3CIFA 4ZDKA 4MROA 2NVWA 3SE0A 4U7TB 3L8DA 4ZK6A 1TA4A 3MS4A 1BH6A 5MN4A 1RI4A 4Y1RB 3AVYA 2OHIA 3IDOA 1ZJ5A 5CFOA 3LA8A 1RJWA 1BWSA 1FMTA 2DUUA 2Y05A 4Q9DA 3M70A 1OLSA 2JF0A 1WHTB 2JLCA 1TUBA 3H13A 4ZAYA 1T6ZA 2WYHA 1H23A 2AQKA 3BF8A 4UNSA 4X20B 5BQXA 4FMBB 2WF7A 2B4QA 3BMOA 4BQSA 3ANXA 5EJ9A 2VJAA 2C2GA 2O0MA 3KJXA 3CUTA 3DMFA 2O8DA 2Y1OA 3ZNOA 4LRYA 4B6OA 3HU1A 1ENPA 2OGSA 3ZHXA 2NTVA 1JIJA 1OXXK 1OT3A 2O6HA 3ENVA 3S5UA 4DFDA 3N28A 2IPXA 2XKBA 5AD1A 5JSHA 1T4MA 4WWHA 3DZFA 3LSTA 1UKYA 3VQTA 1E1RA 1G4UR 1KQPA 4ZALA 3FZNA 2AC7A 2GS9A 3EN0A 1PG0A 2BRUC 4LA4A 2HGZA 1I24A 3MCWA 4PYIA 1BKDR 3TM5A 3UMJA 1EP9A 2UVPB 4RVGA 4L78A 4EMBA 1EFAA 2VPPA 2VT6A 3BDIA 2C7VA 3MN1A 1Q95A 4OY3A 2ASVA 2AZMA 3Q7IA 3K1TA 3UK2A 4RFLA 3AOEC 1FTWA 2A88A 2IXDA 4OQDA 1FFEA 4KK4A 4R83A 4Y6RA 2H07A 5JSZA 4FSXA 1IZ7A 4OQQA 3KZXA 1NULA 2NZUG 1N3BA 3OZ7A 4PLHA 2AWOA 3AUJB 3ZGVA 3R3WA 2I71A 3R76A 3DC7A 3RUDA 3SHOA 1NQUA 3PGVA 5LNK6 2O8FA 3AH8A 4L6AA 2IH2A 4KRFA 1U0RA 1VHLA 2JIBA 2XVZA 3WQBA 1E61A 1W85B 1JDBC 1JDNA 1YS4A 2ZTLA 5AXCA 1V7PC 2GPBA 3TLMA 2H9YA 3I12A 3NKLA 1P31A 3OZFA 1O6CA 2ORIA 3KXLA 4TV9B 3L8MA 4KOEC 4DRXB 2Y0CA 3O8RA 4AUNA 1JLLB 1Y1QA 2A7QA 3MNFA 1O97D 5DCWA 4DMGA 3DD1A 3DWIA 4ZHSA 5EHXA 1MO4A 5LPNA 2R1VA 5HXAA 2BISA 2J7PA 2QWXA 2FP3A 4DSUA 5BUQA 1ZZEA 3ZI4A 2WG2A 4BV8A 5HYVA 4ZOLB 3TMAA 3PE4A 4JI0B 1SGWA 1RLJA 4HFNA 1SVWA 2Q4TA 4XCQA 3WL7A 1QRSA 3BRQA 2E9SA 3T8YA 4RGBA 2PGOA 2GTIA 3C97A 4L4UA 3FJ1A 1DBVO 3HR7A 5C80A 5IUNC 2NUPA 3CKLA 3LZCA 2GKGA 4I3FA 5A3RA 2D7JA 4A26A 1WPRA 4PYRA 4IG9A 2ZWOA 1C50A 2BZ0A 2OVFA 2YVAA 2HA3A 4OKSA 3R7WA 1DARA 2XB8A 1K2VN 2J4CA 3OZVA 4KQ9A 1NQWA 3L18A 2IYAA 4WLOA 3FWKA 1N0UA 1OXMA 2VPYA 3HI6A 5KWEA 3ZJUA 5TQVA 1C1DA 2BR4A 4UCWA 4B81A 2GFQA 2CNKA 1Z0DA 2R84A 1A8SA 2JFHA 4GKAA 3E22A 3BDAA 3P9IA 5C5CA 4YGXB 1KOLA 3DA8A 5HWSA 2XBMA 1P1RA 2WYWA 3KB1A 1Y8RA 2QTRA 5GAJA 1JFTA 4JIGA 3K05A 1D9ZA 3ESBA 3OHPA 4EO9A 1XXHB 3LBHA 1IUNA 1O1YA 1B76A 6REQB 3D6HA 5EPOA 3S8EA 4JV5B 2D4AA 1XHLA 1ZH4A 3S99A 2G36A 2JFPA 3KSMA 3S2EA 4ZJYA 3CR7A 1U2QA 4K88A 4BVAA 3PC7A 1BJTA 1JI3A 2WP8J 1EK6A 4PHTA 4XX0A 1QCCA 1VGQA 2FSVC 2YTZA 4WQMA 4UU0A 1YZTA 1J22A 3WZ2A 1L6IA 4ND6A 2EQBA 1FJHA 3LH5A 3O8LA 4B3FX 3HUUA 5J47A 5C8ZA 3B5JA 2X76A 5ALUA 1TJ4A 5JJBA 1U4OA 1JQ3A 1CQIB 1TKCA 4BVEA 3KOZA 4Q37A 3NB0A 5E0KB 2FGJA 5CCDA 4LYYA 2P35A 8OHMA 4L0MA 1XTPA 3P0EA 2HWYA 2XVMA 3ID6C 3MAJA 2RHTA 4PVCA 4PFKA 1UP6A 4PZDA 2Q5IA 4FMDB 2Z3VA 3RU2A 4Z7OB 2ZG6A 5K0SA 2O2JA 2E5WA 5C8YB 4CMAA 2V5VA 3P9YA 5AHXA 2ZWMA 3GP5A 5EWJB 4NG5A 1WKCA 1RCTE 5H82A 1D2GA 2HSZA 2YWCA 5FX2A 3DL0A 4DE5A 5ALVA 1RYBA 3JQ7B 1P0FA 3OQIA 1PWXA 5DYWA 2A9PA 2HHCA 3GDWA 3ZVLA 1OTYA 1VHTA 1KQFA 1PTJC 2E5FA 4O4IB 2PU5A 2WIDA 3TSOA 1QHFA 3QEMA 4HB2A 4HGYA 4V0LA 3PBKA 1YQXA 4WE3A 1ZM7A 4AP9A 1GZ7A 1WXDA 2F6RA 1UPTA 3D4BA 2BELA 3FSRA 4LX0A 1SG6A 1SAYA 3TOSA 4YJ2F 2I1QA 3U44B 5AVYA 3B1XA 5FPTA 5FB3A 2ZE6A 1R5BA 3NEAA 3ADPA 3V4LA 1MJGM 2QKYA 1XI2A 3PHIA 4MKZA 1SCUA 3L46A 3Q8XB 5EWLB 1IZ0A 1OKKD 3ZTYA 4AFNA 1YHYA 2XQJA 2WJVA 3L7KA 1DAIA 1U3GA 1AM4D 3DAGA 4I5GA 4KAJA 1TIBA 4YUZA 4TPKA 5H7XA 1T34A 1CEQA 4YGYA 1HE1C 1N0VC 2J30A 5HTKA 2QBYA 1RYZA 3P2IA 5F7OA 3M1AA 2Y4NA 3IPCA 3QV2A 1CJMA 1G7TA 5T5QA 4X1IB 3JQ9A 4B32A 4WNIA 2GLXA 1Q44A 4UVEA 1KDTA 4XWWA 4AKSA 3QUTA 3KOXA 1MFZA 4Y2UA 1B14A 1U5CA 2JJYA 3ZQUA 3O3NB 1NVGA 3F7NA 1N5OX 4J9VA 4MW5A 3E5HA 2WJYA 3MW8A 2QEQA 3SGLA 3K0FA 5BV0A 1NFFA 1XFDA 2BEVA 4RPGA 5ENDA 3VISA 4C0LA 4EHBA 1LX7A 2GCIA 2Y1KA 2D2IA 5LZ9A 4LDPA 3PQFA 1AQJA 4Z9FA 1FYFA 2CXXA 4JSRA 2VPWA 3E48A 2FG6C 1TO6A 3P2YA 1NIPA 4EP1A 5IAJA 4QJ3A 4KTTE 2JKYA 1LSOA 3WC4A 3ICEA 4JHXA 3VR4H 4LCJA 3FG9A 1W4AA 1F0PA 4QYMA 4W7IA 1M2FA 3SC3A 5B1SA 3T54A 3VDNB 4LE0A 2JAUA 3PPIA 1OZHA 1B16A 2VNIA 3NS7A 1E66A 4HO1X 4K28A 4UAVA 3RS8A 5BRNA 5JNSA 1UXOA 1EB9A 2QVLA 5HBRA 3GBVA 3SFVA 3IXMA 1L5QA 2IU4A 4MVJH 4XUEA 4EUKA 2YJ4A 4ZI7A 2XZLA 3PD1A 4ZKEA 3UJPA 4F72A 2W2NA 3QH4A 2CL0X 3OBBA 3ZWKA 1W44A 2DMRA 2V3VA 3G0GA 1MG5A 1RIIA 2OWDA 5FAXA 5LXTF 4DVJA 3AHIA 3QMVA 4EUEA 4OHPA 1E64A 1U1IA 1KOJA 1T43A 3ILSA 3P9KA 3R9KA 3Q3GE 2VT7A 1JHOA 2FUNB 2QM0A 2XAUA 5AKKA 5JANA 3D1JA 4DDTA 1STOA 4R2XA 1ZN8A 1SC3A 1V96A 3WB1A 4IF6A 4PLCA 1DSSG 4H27A 1L5VA 2H9AA 2CXUA 4B73A 1C7FA 1X1TA 3OIDA 4UBNA 4WESB 3L84A 4MA4A 3ASYA 4CMEA 3WGIA 2HIMA 1WJGA 2OO7A 4MWZA 3EUAA 2Y71A 4I4LA 1G64A 2GEJA 3UK0A 1PBTA 2ZSDA 4NCNA 5DTQA 1RZUA 1CBUA 3HJAA 1QBGA 4MQBA 3K2QA 2O2DA 3KCQA 3RLIA 4JCCA 1DBQA 1GNPA 1YKSA 3EA5A 3D8RA 3MB8A 3ZDZB 1CRZA 4X1OA 1USWA 2A5GA 2BEJA 3RT7A 3VC1A 5C7LO 5ICEA 3ZQKA 5KNBA 4L8GA 1DMRA 4P3KA 3U7RA 1GQQA 2H17A 1AU9A 2GETA 3GA7A 3A36A 3B1VA 4TS4A 5DYTA 1XKQA 3F1LA 4C7MA 1L8AA 4DZZA 3A1SA 5I7VA 3TUZC 1GKIA 1NONA 1M8JA 3GZ4A 1K0FA 4PYOA 4RZXA 5DBEX 2IDKA 3PIIA 4MS3B 1KH3A 3RJZA 1RPZA 3RYFB 4ARCA 1CB0A 2OC4A 4YDQA 1FMCA 4NOMA 2TMGA 4HDKA 4QD3A 4D74A 5KDOA 2A1TR 5JQWA 1FXWA 1EIZA 4YUWA 2BKXA 5D3MB 1GAXA 1XYVA 1GPDG 4OSOA 3W1EA 5LQKA 3QXSA 4DCGA 2ZRQA 3CLHA 2R47A 3ZX4A 3R23A 4YMUA 4GZLA 1JHZA 4B3CA 1CR1A 1P4HA 1B26A 5F12A 3ZKWA 1KFBB 4C4YA 1CUEA 1HDOA 3KVNA 2Z30A 5DNDA 1PLLA 4GMHA 3IKLA 2JCYA 2NO5A 2YVUA 1Q50A 4Y6QA 1JIVA 3NEJA 1UEIA 3IP7A 1DKNA 1FFAA 5HIMA 3V42A 4G2TA 3GNTA 4GQIA 1EA7A 4AJJA 3E6AA 1G2PA 1TMYA 2YWXA 3UT5B 5FF9A 1C9YA 4D57A 4CMGA 3CVXA 3V3TA 1EVLA 4IR7A 3S2YA 2JZNA 2QVCA 3BSWA 4BATA 1M0SA 5IANA 3UAYA 3I6MA 1T13A 3BC1A 1U2DC 1E2HA 5TXGA 1DOZA 5JSFA 1UFVA 5A9SA 4WZAB 3TGLA 5GJBA 2JS7A 2E48A 1K8XB 4P38A 1ISMA 1BW9A 1RRPA 3PHCA 4RYDA 1U0SY 2Q4RA 2PV0A 1EVQA 3W2IA 4W6QA 4B8WA 1XV5A 1FF9A 4F04A 1DV1A 4L4ZA 2NPOA 3D7NA 4ARBA 1YASA 1MJGA 2X5NA 1UFQA 1SKMA 2BE7A 3VR6H 3RIMA 4MVJM 1T4CA 4H7KA 4JJ8A 5ALZA 4RSGA 1BYUA 3I61A 5FOTA 1SR8A 4X3OA 3DV0A 2UUOA 1BROA 3LF2A 2RSLA 2MSLA 4Q5IA 1G20B 4CTKA 3KP1A 1ZCFA 3EF1A 1WDWB 1T8YA 3T1NA 1I4TD 5BOSA 1M34E 1AMOA 1VKHA 4MIEA 1ZEMA 4OXRA 4EIWA 4WCFB 5JQGB 3EYAA 3AVPA 5IHPA 2COKA 4LSWA 2PJDA 1E2UA 3C98A 4DQLA 3DXZA 1RRVA 2V7QA 5JD6A 1MAAA 3CTMA 4Q4DA 4DSOA 1SBYA 4PR3A 1NW9B 3BHJA 3UOWA 4NPHA 1MLDA 4AXXA 2RB5A 2FZKA 3OX2A 1RLMA 4JN6B 1GL7A 1YCHA 1R0YA 5I5GA 4KGVA 1RMQA 3ZG6A 4AIIA 1RZRD 5L7TA 5CIQA 2WYVA 1EVYA 4KLNA 2W2KA 4Y2TA 1YQWA 1PL0A 2OHXA 2X9VA 2Z8YM 4MWTA 4AF8A 4R9SA 4YUAA 4P0PB 1WCWA 3H5RA 5AXDA 4EEKA 2Q2OA 4JB2A 5CPFA 4WXYB 2O19A 1UDXA 4LSGA 3JVUA 1Q19A 2PIAA 3UYKA 3ZW8A 5JZ9A 3H5TA 2H5EA 4HZIA 4C3ZA 4FNOA 5C81A 1M74A 4EPYA 4LI0A 4MRVA 1EXNA 2XHEA 5JR3A 2WSMA 3TD9A 4I4TA 3N86A 4NF2A 4QFCA 4S1PA 2ZS7A 1OXVA 2AR7A 2JLYA 1M5UA 3D43A 1EVZA 2X77A 1KPHA 1ISFA 4MMXB 4RIHA 1XDGA 2ZVPX 2E82A 4QTUB 2P3OA 1PQWA 1U80A 3KS9A 3Q12A 4US1R 2WIBA 4OUDB 4D46A 1G98A 3H4MA 1FFYA 2F1RA 1ZU5A 1QQTA 3TCNA 4US0R 1XCBA 4BBAA 4BO6A 1G7CA 1G21B 2J0EA 2OVBA 3H8WA 3NX4A 4EMSA 4JXXA 1QOPB 4WEQA 3K35A 3GUUA 1Z4QA 2DLNA 3B1ZA 1NVFA 4HR7A 4Z3OA 2JGMA 1EQ2A 2G7MC 4GLOA 4MRMB 4CV3A 5B6PA 5J2UA 3LY7A 1X8LA 2F3PA 2VN8A 3GEPA 4JLSA 4NVRA 5H8WA 4H7DA 2GN4A 1FTQA 3DR3A 4M7PA 5I9BA 3ZE1B 2IH4A 3GEGA 3L7MA 2I2WA 1YHNA 3IAXA 4A2WA 2PRSA 3NRBA 4P6VF 5DNUA 3CZQA 5B37A 3Q98A 3TK1A 1TW2A 1DI0A 4EGCB 3FX2A 2G71A 2V4UA 2OUKA 2I6FA 3NNNA 4NBNA 2PCLA 4RMIA 1E0DA 1COZA 4BASA 1G18A 1R8SA 3TQQA 2XOXA 1X7XA 1N8SA 2V7EA 1P4JA 3WDLA 3ODGA 1UEXC 4MOWA 3DP9A 4YTEA 2W90A 5AK6A 5AKHA 2PYDA 1EDDA 2P2ZA 3KLOA 3N5CA 4PVDA 3ZWVA 1NJ1A 4TKVA 1XZLA 3HRHA 5TQ0B 4CDMA 3OE7D 1DV2A 2Y3IA 1P5JA 2ROQA 1ZC4A 3LP8A 1KVQA 4JD5A 4TQAA 4G8BA 4WZAE 1U7PA 1DVRA 3CRQA 1AS3A 4DF3A 3FI0A 1LBSA 1Q0PA 2IYXA 2Q1TA 3D7SA 3ODPA 1GQOA 1LI4A 5EG5A 5L3QA 3B2EA 2VWPA 5ETJA 1ADFA 2HJGA 3EDQA 1ECFA 3U62A 1YNSA 3OOHA 5JC1A 5FA8A 4AURA 3HL0A 3VPHA 3HV0A 4FE3A 4OQZA 4P2BA 5ALMA 3T7KA 2MMCA 3E4DA 1R4MA 4M87A 2O5RA 4DBZA 1P3DA 4PNHA 5JJIA 1G20E 5K51A 3VJKA 3WWEA 4CM1A 1XU4A 3BTVA 1UZNA 4HLNA 5CFRA 4R1SA 1ZI6A 2BMAA 2GA8A 3PQ4A 3E58A 2I1WA 2G3YA 1IXYA 3FHJA 1N7IA 1T1IA 2YZMA 4E2FA 1M8KA 2CDRA 1YDGA 1JKMA 1Q1GA 3GY0A 3ONVA 3DVSX 4NYIR 1T25A 1ZH8A 3L6DA 2BV3A 1IBMB 1E1RD 1O9GA 2NACA 2Q6LA 3NO4A 5KWJA 4B84A 5BQOA 2A8YA 3ISTA 2R11A 1L5WA 4C87A 3EFEA 4Z2YA 5CM2Z 4CLHA 1NP3A 3GT3A 5JNVA 4W4TA 4JI2B 4XB2A 5AYVA 3USES 3F6CA 5D5PA 3UY4A 2YXBA 2G88A 2VEDA 1JSRA 3R5TA 4DHWA 5IZCC 3ZU4A 4MYHA 4LKRA 1G5PA 5TARA 3T94A 3THYA 1XKTA 1OAKA 3PKJA 4TQUS 3ZWPA 2M32A 1EI9A 3KETA 1UKCA 1EE9A 1GOTA 1OVGA 4CM7A 4H2DA 5HQJA 5BSKA 5F76A 2H7CA 3C3YA 1E9RA 4I50A 2GBGA 2JD2A 4DLXA 4GM4A 4FYWA 3TX2A 3TFOA 2X0DA 4IDAA 4YJGA 4FOPA 1RM5A 3U80A 4DPLA 1QAOA 2UYHA 3LT5A 3GLHA 3PRKE 1B41A 4EFKA 4KAFA 2YY6A 3IRVA 4COOA 2FZVA 4CLRB 2B6NA 5LP6B 3SSAA 4LY0A 5C5DA 1SUBA 3ILVA 3O1IC 4C03A 5B4VA 1XNGA 2QN1A 2PZ8A 3HCEA 3B5EA 1H8ED 1CV2A 1NFQA 1WE2A 3EXFB 3C3BA 4LZOA 3S2FA 4H3VA 3LW8A 4MR9B 5GGXA 3VNAA 5BPHA 5I9LA 3HB4X 5BY2A 1GRCA 4QLBA 1JG2A 4BPRA 1G21E 2CHVA 1A5TA 1KDOA 4IIUA 3JZIA 5CITA 2HXYA 1UBEA 2Q1XA 1E2FA 3PJFA 2Z8YA 4JJFA 1O97C 5HIIA 3C3WA 4LBWA 1WSWA 2XLCA 4LC0A 4GX2A 4L57A 3JD4A 1Z5VA 2VTKA 3D6FA 4B75A 3I6QA 1ZAYA 4P4LA 3Q3CA 4EL0A 1W5SA 2XKAA 4QU9A 3V3KA 4Z4FA 1JR3A 2PBFA 3U9TA 4ZODA 2VCEA 2ZB8A 4KN8A 4WXEA 5SZHB 5JS6A 2HWUA 3MCUA 4HWGA 2VZ9A 1XVLA 1NBME 2BF7A 4X63A 4I6EA 3ZVNA 5ADWA 3ZZTA 3PC6A 2XF2A 3E35A 1KIFA 4CG0A 3U4QA 1T5HX 3ZWBA 4DM4A 3SVLA 1EFTA 4RF3A 2J6HA 4HDOB 3BMCA 3ZDYB 1J07A 2GHQA 1JQBA 2CBGA 4F4JA 2C54A 1Q84A 2AMFA 3VR2A 4F9TA 2C7QA 1DRKA 3M82A 5ITVA 1P9NA 3PQCA 4NPAA 1JKIA 4H15A 3T4EA 4IXDA 5IW8A 4LRUA 4JUCA 4FEYA 4EPTA 4CKCB 5AM1A 1H9BA 3CBQA 1ZIDA 2FVXA 4QBFA 2XNSA 5LNK1 1X0XA 2HCFA 1JE1A 4HGOA 3VDRA 4Q9IA 3M4ZA 2WB4A 1YZFA 4YP0A 3BJEA 1MUUA 4MVCA 4MWOA 2NSDA 3LFHA 3WHLA 1QV9A 2HHJA 2MSNA 4Y8VA 5EP2A 1JQJC 1TK9A 2CD9A 1VP9A 3DMRA 4GFDA 4O4JF 2B7CA 5EMNA 5SZIA 5LJIA 1H3NA 1UJ5A 4ID3A 1EAYA 4QARA 5DTJA 2WHPA 4DQUA 3D64A 3I9JA 1PV1A 3WAJA 3PGMA 3H9UA 1AHHA 2PGXA 2YXNA 3CJRA 1MDFA 1VCNA 4GRIA 2IWHA 3CG4A 3JQ8A 4C2BA 4OATA 4P7BA 1JU3A 5JH7B 2I6QA 4NARA 3W5VA 1S2NA 1FQOA 1XVVA 2YV3A 3GOHA 4GT1A 3F49S 1RXEA 2CNBA 3ORQA 1T3TA 1T3ZA 2D5CA 1IZ8A 1CS0A 1UK7A 3O31A 4A03A 3ZWWA 3AKEA 3CF4G 3KAPA 2ZW9A 3KWJA 1AD2A 1MIOB 1W93A 4U7HA 5C51B 4GOKA 1HDXA 4BFYA 4NOLA 1T9KA 3VR6A 3RRFA 2KYRA 1LY1A 2RIRA 1RXYA 2X4IA 1AF4A 1RHUA 3ANLA 3SC2A 3T7JA 2FQXA 4YRLA 4LX8A 1XU7A 3UGTA 5C35A 1J9EA 2FX3A 3TJRA 2HGSA 2QMQA 5AK3A 4DDUA 4ONEA 2PUAA 3OESA 2I5PO 1LS1A 1FP1D 5EYPB 2O48X 3A6KA 3QLUC 1QP7A 4QGBA 4QLAA 1XEAA 3QSGA 3PRYA 4AS1A 5G0VA 2VZLA 5AICA 3G2IA 2LZ0A 3H2IA 4HSEA 4JSTA 4PO8A 3ZNPA 4QXMA 4F5YA 3CRMA 3RRMA 3EPLA 2APJA 2F17A 1EUZA 1VSVA 3TH5A 4NNOA 4AMZA 4BAZA 3PNOA 2F7SA 4E07A 1M54A 3SYRA 1AH2A 3NRCA 3UK6A 3QPWA 3C14C 1JFRA 1KFJB 1L8LA 1UQTA 2PGJA 3JQGA 3PKZA 1ZNWA 4RK5A 1M6VB 1TGVA 3HVUA 4OI0A 4Q7JB 3UK1A 2Y77A 2VUTA 2W6MA 1OVMA 1DC4A 4KDRA 4QELA 2IHKA 3ZHUA 1JYEA 2IUFA 1UJBA 2C5SA 1DQPA 1IVYA 3O4JA 1K86A 4Q1VA 1FS6A 4FFLA 1JKJA 5J1TB 4RM2A 2FDCA 3FFTA 2TYSB 1WHSB 3HDVA 4W8OA 1IIBA 4ZT6A 1ESCA 4BFLA 1E9VA 1FDUA 3CO5A 3NV7A 1P3JA 4D4JA 5CVJA 1KEKA 1GU1A 2OK8A 3NM5A 5DM70 1P17A 3WADA 1AKQA 3G0HA 3M6MD 4HDRB 3CMCO