3LW7A

The crystal structure of an adenylate kinase-related protein bound to amp from sulfolobus solfataricus to 2.3a
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
177
structure length
170
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an Adenylate kinase-related protein bound to AMP from sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Adenylate kinase related protein (AdkA-like)
total genus 65
structure length 170
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw7A00
4B2PA 1AJEA 4AG6A 2E1RA 3P1JA 1FTSA 3TSOA 3BOSA 2C96A 2VP9A 3ZGXA 1R5BA 4NYIR 5J4HA 3QXHA 1TU4A 1NVXQ 2XEXA 3KDSE 3WY9A 1VHLA 2YWHA 1G7TA 5FR1A 2WPDA 2WWWA 2JCSA 2ORVA 3SYKA 2HLDD 2F1HA 1X1SA 3K70C 4RZ3A 1VCMA 3GJ8A 4A36A 2IS6A 3UMRA 1UKZA 1E2DA 3G0HA 1KMHB 5FTMA 1KO5A 1DAIA 2GZDA 2YOFA 4ILEA 1CJKC 1JNYA 1KI6B 3I61A 4UXIA 2BBWA 4UNPA 4P4SA 2FSIA 3WRXC 1UJ2A 4CF7A 5CIQA 4X8MA 1BO6A 1NG9A 5FPTA 221PA 1OT3A 2GEVA 3K0FB 4XTRA 4XSGA 1VYUA 1OW3B 1VYTA 2PMDA 1Q1QA 4HDQB 4HI0E 3UMFA 3W90A 3I72A 4B3BA 1PLKA 1TQ6A 2D2EA 3KXIA 3ZVRA 1MO6A 4O2RA 2GTPA 4JLPA 4H1UA 1MRNA 4BFWA 3D7MA 4DLTA 1M6NA 6Q21A 3EC1A 2HT1A 1L8QA 2QQ0A 2XJ9A 4IDOA 4JLBA 1SZPA 3VTKA 2HF8A 4HUTA 2JDID 2NOAA 1LS1A 2J45A 1NBMD 4RZXA 2ZREA 1EFTA 2HYDA 4Q1CA 5KDDA 4IVPA 2J0SA 3ADKA 4RFSB 2HT6A 3ASZA 1YR8A 1A1VA 1UKEA 2OFWA 3ONWA 2P6RA 1TADA 3WNDA 4KV9A 1Z0IA 2GXSA 1S8FA 1H8EA 4NE2A 2YZ2A 3QSYA 1FMJA 3E5HA 1SXJA 2IXFA 4A0HA 1EFRD 2XTNA 1Z6GA 3T06B 3SZRA 2ZE8A 5FOXA 2OCAA 2VPPA 2YINC 2JLVA 3GEHA 4YLGA 3QG1A 4WOPA 1W7AA 2TMKA 5JHGB 1H8HA 3IHWA 1PLLA 2P6UA 1CTQA 3PEWA 4NKRA 2FJUA 2AD1A 4OQFA 1D6JA 1NVUQ 2ZRDA 3THWB 1E2GA 2Y8EA 1SKYB 2WKPA 2FV8A 5EP3A 1A2KC 5FOVA 2O8FA 2IXGA 4D25A 2ZRFA 4A9AA 5D3MA 3RVBA 2ZEJA 4AKEA 1Q20A 1W5SA 3GCGA 4RD2A 5L3SB 3T61A 2FH5B 4QC2A 2I1VB 2DWPA 4F7WA 1KZ7B 4OI0A 2BMDA 3TUJC 4LHWA 3T34A 4WXPA 5J4KA 3Q9LA 4BUJA 3S1AB 1ZU5A 3GLIB 2HXYA 5JSZA 4HB4A 5SZIA 4MRSA 5JBQA 1Q12A 4A2WA 1W0JD 1TQ2A 2FFQA 3U3MA 2BMFA 1DAFA 4QNMA 5FI1B 2HXSA 1OXTA 3JZMA 3WNCA 2JJ8A 1ZINA 3G82C 4A0FA 4DSNA 1KY2A 1ZIPA 4MRPA 4R2IA 3WHKA 3KB2A 2JIZD 2CL6X 2IYRA 3EZ9A 5BYJA 3KKPA 2W2XA 2GK6A 2OBNA 1XMIA 2ZRNA 4BASA 2RHDA 2JLUA 4Y0VA 4BEJA 2RGCA 3Q7PA 2IYVA 2CL7X 1FZQA 1Z28A 1KKMA 4XD7D 2W6IA 3TQFA 1JI0A 1M8PA 4BRUA 4AY2A 1P73A 2XJ4A 2KWIA 2R65A 1GZSA 4XD7A 1X6VA 3C14C 5G53C 4KAXA 3DZDA 1QHIA 1P9RA 4OL0A 2Z43A 3EZFA 3I8SA 3QJYA 2WJIA 2GCOB 3U4QA 2RGAA 1X1RA 2NO0A 1U8AA 2H8KA 4GPTA 3UIEA 1KI7A 2GCPA 3M6AA 3QQ5A 1TU3A 4DEXA 4WZBE 4C0SA 3AVWA 1I4LD 1NLZA 2O52A 3TIFA 4DCSA 1RC8A 1VKJA 2W2TA 1SXJC 2QAGB 2W6ID 4GZLA 3UWOA 4AYTA 2FFAA 3JZAA 1EK0A 3PITA 2PCLA 3BD9A 3U5ZB 3EG5A 2XSZA 4U00A 2RKOA 2FGKA 3L8YA 4DCTA 4DSUA 2QMOA 1SKQA 2IUTA 2QENA 3KZ1E 4IFBA 2ZXUA 2UZ3A 5DI9A 1R2QA 1E9RA 2EVWX 3MWKA 4P0TA 5BN4A 4LYFA 1Z47A 1VDZA 1CU1A 2LKCA 2ZYUX 2QMHA 4OHYA 1CR2A 3IIMA 1KK1A 3RLFA 1W0JA 4F93B 5FPHA 2NZ8A 2GEDA 3RWMB 3CRMA 4DCNA 2ZRMA 1VG1A 3QEOA 4L8GA 1Z6YA 2YYZA 2QTHA 2CLDX 4DB4A 2DCUA 2JLXA 1TEVA 2DFNA 2XNSA 3CO5A 5BXQC 3CR7A 1R5NA 3K9NA 3HPQA 3U7EB 3LVRE 4D80A 1AS3A 1E69A 2IL1A 1IN8A 1W4AA 2PZEA 3EA5A 3R8CA 3ZVNA 2OILA 4OQLA 3SBEA 2AR7A 3U3KA 2VHQA 4QRHA 4BLRA 3K9GA 4NTZA 4ABYA 4P4UA 3RSLA 4Q7LA 4JVMA 5FOTA 4MKHA 2P6NA 3KQHA 1AM4D 4P4SB 5HKKA 4QHYA 4QFMA 1N6RA 2ECKA 4KI0A 1H8HD 4EPVA 5C18A 1R0WA 5P21A 4LHVA 1FW6A 4WZAE 2JDIA 1G3QA 4PHHA 4V0ME 2G6BA 3C16C 4DLRA 3WHLA 1XTSA 4ZIRB 4W5WA 4DUGA 1K5DA 3GJ4A 1C9KA 1U9IA 1YVDA 5JEDA 2FEMA 4CEHB 1F2TB 2LWIA 3CPHA 1Y63A 4PPFA 2NPFA 3KUCA 1EFCA 1I4TD 1FQJA 1G5TA 3NHBA 1GWNA 3ZS9A 3K0CA 5H1YA 2IBMA 3CH4B 2ZS9A 5CYOA 4Y0AA 1OKKD 4NU0A 4BPBA 1JAIA 4L9SA 4K8OA 4QHTA 1CRPA 2WJYA 2R8RA 4QJ3A 4N0EA 1Q1BA 4DWJA 4MGYR 4OYHA 1FP6A 1G8FA 1L7VC 3IBGA 3LBHA 2FSHA 3ZDQA 2BC9A 3VFDA 4KYUA 1YHNA 5JJLA 2ZJOA 4DJTA 5B2ZA 4PSKA 3FHTA 1D9ZA 3EPKA 1LV7A 4X8HA 4KXFB 3VKHA 1EWQA 2P5TB 3AF2A 1QHGA 4TSFD 4BGDA 5DH9A 1R10A 1RFLA 4JVSB 3VMFA 4R9UC 4TL6A 5IHPA 1Z0JA 3R9XA 3T12A 2VL7A 5A5GA 3LLMA 3BC1A 4D0LB 1J2JA 3U2QA 3QF7A 2BBOA 2R44A 2K5UA 1X8LA 2CDNA 2P3SA 3SS8A 3SJBA 1G3RA 1OH6A 1VHTA 5JEEA 1YR6A 5F9FA 5DIFA 5J4LA 4Q1DA 3FYHA 1NMXA 1NI3A 1GSIA 4C2UA 3IQXA 3P27A 3TVTA 5JJKA 3ICEA 3RRNA 1COWA 2G3YA 2VHTA 3LQQA 2H57A 3IPXA 4C0BA 3RRYA 1MOZA 5JSZB 1KI9A 3T35A 1PLJA 2DB3A 3CX8A 4QGHA 1Z6AA 1FL9A 1Z6TA 1E9DA 3EXAA 2PH1A 4OJKA 3B1WA 2W0MA 1FX0A 4LK2A 4QG7A 1ZU4A 1EFUA 3LVQE 1YRBA 2CXXA 1U94A 4M1YA 2ZVQX 1QG2A 2ZJ5A 3QOFA 4B3CA 1ZM9A 1TMKA 1HY3A 2EWWA 3I8XA 1DARA 2KJQA 3H86A 5KPJA 2GDJA 2PBRA 4R98A 3K0SA 3F5FA 1RJ9B 2A9KA 1CLUA 3KKOA 4PZLA 5BQ5A 3DOEA 4FMCB 1XMSA 3DMDA 4AIIA 3VU9A 3GLHB 1TAGA 1IBRA 2WKQA 2WJVA 4KYIB 3AH8A 1DE0A 5KSPA 1DVRA 3B1VA 2GVDC 1XCPA 1GL9B 3IKJA 3NVAA 1E0KA 1G5RA 1SVLA 2GZAA 4AI6A 5HPYB 3I92A 4BFSA 4Q9KA 3BXZA 1DAMA 4EFLA 2JAQA 2RB4A 3EX7C 4LJ7A 1CKEA 2NIPA 2XZLA 3J81k 1AGRA 3WXMA 4Z54A 2ZI5A 4LY6A 2RGBA 3AKYA 2QAGA 2JLQA 4S2EA 1R6BX 2G88A 5TMPA 1AZSC 4D4MA 3L0OA 3GJ5A 1IY2A 2J0UB 1ESMA 2F3RA 3AV0B 1HURA 1OXSC 4I81A 4B32A 4W9MC 3X1ZA 5JI3E 2C98A 2G77B 1HQYE 3R9WA 5KSZA 2V1XA 3D8BA 5DN6D 2CE7A 2OCPA 1BMFD 2YHSA 4EKDA 2Q9AA 5LD2C 2VP0A 3KQLA 4HEJA 4M9QA 4K46A 4HLUC 2FEOA 4MDEA 1BYUA 3AUYA 5E7JA 2O8CB 2G0NA 3K70B 2ZRGA 4EQ6B 1RE0A 1E2PA 4MA4A 2CK3D 2Q3MA 4OK6A 4CDGA 3GJXC 3QI2A 4FCTA 4L9WA 3IO3A 5EXTA 3SJAA 1N5LA 2WIAA 2QEQA 4HYYA 4DB2A 1ZC4A 3VNVA 2QM8A 3CPEA 5B57C 2ZSDA 3B60A 2PLFA 2QE7A 3QF4A 2FZ4A 2QRNA 4CYMA 3GMTA 5HE9A 4RD3A 5M04A 2VTKA 4HAXA 4LGMA 4OQXA 4TLCA 3TGPA 3QG5A 1K5GA 3TUZC 2P5SA 4G1UC 4JL6A 5FOWA 3PUXA 1S9HA 5AUPB 2XSZD 4YDHB 5JECA 1OFHA 3OAAD 1DG3A 5LBIA 4LV6A 2QE7D 5CYPA 1T3HA 4IVQA 2QPAA 3GLGA 1HT1E 3GLFA 3FFAA 5SZHB 3D3QA 1KI3A 1N6KA 3T1VA 2KB0A 1I4DD 1G8PA 2O8FB 5FTJA 4TYNA 4URYR 4KFTA 1YKSA 2CK3A 2IUSA 2OM2A 4HAYA 3KQKA 2QBYA 2QMEA 2Z83A 2P67A 2D06A 2ZI7A 1UDWA 5L3SA 1A2BA 4Q66C 4G5OA 4TT3A 3QIAA 3OIUA 3GJ0A 4A0GA 2G0TA 1E1RA 2VSOA 3QXXA 4L5BA 4RY2A 5FUVA 1ZNZA 1OYYA 3S1AA 3CRW1 3FHOA 3REFA 5GVSA 2VSXA 4ZDIA 2ZRBA 1NVVR 3U3RA 1QG4A 2CCGA 4NONA 2GKSA 3N5CA 4HLDA 4JBWA 4PAOA 5GJWC 2JA1A 4CEJB 5F3WB 4KSBA 1XEWX 3HWSA 1XTIA 5KNCA 1Q22A 3T5GA 3CB4A 4M2LA 4ZCLA 2B8TA 3WNBA 4JZKA 5CLLA 1DPFA 3MWYW 5FL7D 2IS2A 4HUQB 4M9XA 2A5DA 5EE9A 1N3BA 4US2R 1EFRA 3QKTA 1W0KD 1XD9A 3U7HB 1DEKA 3KJEA 2ERYA 2VP6A 2FA9A 1NN3A 3QKUA 4YMTA 2EQBA 4B34A 2ZPTX 5HKKD 1FOEB 5C4GB 4FN5A 4D26A 4LYJA 2HJVA 1MO3A 1AKEA 3CF6R 3FWYA 4FMDF 3QXCA 4PFSA 1E4YA 5L8VA 2QMUA 1VTKA 2WZQA 4C0JA 1DAKA 3X1XA 1ZAKA 3EW9A 4LHXA 2W6JD 2CEAA 4XVUA 2WSSA 4IOLA 1E1RD 4QM6A 2WKRA 5KOYA 2QM7A 2GCOA 4B2IA 2ATXA 4MYCA 1KHTA 3C8UA 1YR7A 4HDOB 4Q4LA 4YDSA 4KVGA 1OLOA 4C7OB 3TK1A 4MGKR 1JQJC 2KI5A 1N6OA 1M7BA 2IC5A 3TSWA 4BFXA 4NHOA 1GL7A 4JBXA 1PV4A 3R7WA 1KNQA 1KK0A 1EGAA 1Z2AA 2GBLA 4IFEA 1I2DA 3VKWA 4XWAA 1G17A 1WF3A 1CP2A 3IHLA 4B2LA 5JI2E 5FTNA 4Q5IA 2PMKA 4Q21A 1SGWA 4RCZA 4RVCA 4M1OA 3QBVA 2V6IA 4J0QA 1J8YF 1OB5A 4ZI2A 1Q0UA 4CVNA 3V4FA 4KODA 1WE2A 3LXXA 5AUOB 2PJRA 1RIFA 1T4GA 5CK4A 5K8LA 4POAA 3I62A 4LJYA 4DHEA 2A2ZA 2F1JA 1RVDA 2IA5A 4YMWA 1RKBA 5TXGA 4ON9A 1LF5A 1ZNXA 3I3SR 4EPWA 3AF0A 2HUPA 3TLXA 3HJNA 2GETA 2IF0A 4GP7A 5J4VA 2DR3A 3B1YA 3DL0A 3FHCB 2VF8A 2GXAA 2BKEA 4ZDKA 2O8DA 4IRUB 4TSFA 1LTQA 1GIAA 3KKMA 4Q9IA 4Q9HA 3KQUA 4JBYA 4NCIA 3MJRA 4B6FA 2EU8A 4DDTA 2OUKA 4Q4HB 1US8A 2ZE7A 2PX3A 3NWJA 5F2EA 4RZ2A 4A0RA 2MSCB 3RANA 1CR1A 2C8VA 4UNNA 3CWZA 3E2IA 3SYNA 2C77A 4EUNA 4B76A 4B3DA 1RZ3A 3U6KA 3TE6A 3OAAA 3OF5A 4A15A 2OBMA 4JT4A 1M2OB 1EESA 1NVWQ 2ZRKA 4FWTA 2W0SA 1FMLA 5FBRB 1IJFA 2ZUCA 5CITA 2JIZA 4NYMQ 1QHHA 5HZHA 4A6PA 2J7PA 4ERNA 1X8KA 3SHWA 2ORIA 4JLNA 3UKDA 4OHVA 1S1CA 2HLDA 3QKSA 4H9GA 4DKXA 3T1TA 1KGDA 1KDTA 1H65A 1OHHD 3W9YA 1NSFA 4IEEA 4M0LA 4PR0A 4FW9A 1E9FA 2CE2X 2X1VA 1GNQA 1G291 4TYYA 3AVOA 4NPHA 3AM1A 5JCPA 3SBDA 2GAAA 1IXSB 5EXPA 1KO1A 3FMPB 2IXEA 2O8BB 3PVSA 3GLIE 3IIJA 3PV0A 4QM7A 1P61B 3E1SA 2DFTA 4PANA 1G3MA 3BGWA 3LY5A 3UMSA 1WQ1R 3IIKA 4M1WA 5EUMA 3AF3A 4GOJA 5D3QA 2KBFA 3U7FB 1WRBA 2EFDB 4TWZA 3MMPA 3O8BA 5FTLA 4EJSC 2G1JA 3BAFA 2VP4A 4NZYA 1HE8B 3D31A 3W5IA 3W6OA 2HCBA 3DM9B 1E6CA 1GL6A 1WA5A 5KNDA 1T9HA 2GAOA 3SN6A 4TN1A 3UATA 1UPTA 1AIPA 2XB4A 2Z0MA 4IKEA 5FL3A 4TQUS 5FOUA 2BVNA 1GTVA 4DLWA 5GJCA 4A8JB 1T5LA 2GCNA 1OHHA 4LRWA 2V6JA 2B8WA 1AK2A 2DFLA 4LV8B 5GJVC 5JRJA 1OFTA 5BWMA 1E2HA 3PUZA 4QGAA 2IS4A 2A78A 3B9PA 1C4OA 1ZM3A 2J87A 4RSGA 4WBSA 4DT1A 4C30A 1JR3E 3UANA 5FR2A 4O2LA 3B2EA 1Z2CA 4K81B 5B30A 3OEHA 121PA 2AX4A 2P2LA 3K9HA 1XD2B 2V8OA 3DMNA 4HZUA 1PUJA 4LWZA 1KZGB 4HUQA 2X2FA 1CIPA 1HUQA 1U0JA 3C5CA 3DHWC 1K6MA 1MR3F 1XZPA 4QJ5A 1NKSA 3R20A 2QAGC 2RHMA 2XNDA 2R2AA 4PQYA 5ANRB 4G01B 1XTJA 1XEXB 2AFHE 2WM9B 2RGNC 3C5HA 4YC7A 2VO1A 1OB2A 2XOKA 3FKSD 1MV5A 2H7VA 1JXMA 3PEVA 2YC2C 4LYHA 3ZQJA 3GLHA 4PPQA 1EFHA 1XD8A 3LW7A 4ZKEA 1SHKA 3L8ZA 1RRFA 4IHQA 3THYA 4C4PA 3T15A 4UXJA 1BOFA 2VF7A 2YOGA 4Q9JA 4QHSA 1OH5A 1KAGA 2ANBA 1G19A 1LF0A 3BFVA 1F2UA 2V9PA 1XMVA 1WCV1 1GP2A 5GADl 2ZAMA 3GD7A 3GJ6A 4R71A 4S35A 3I4LA 5C46F 2WWYA 5L3QA 1KK2A 2FPKA 4IDHA 3LO5A 1XJ0A 3OEEA 3Q85A 3CNNA 5EE1A 1CRQA 1KDRA 5CM8B 4R2HA 1OH8A 2OT3B 2WBLC 4GOKA 3X1WA 3WYGA 2J0UA 3EPJA 5C4MA 5A0FA 4TMZA 4OI4A 2ZITA 4DEYA 2CCJA 5K8UA 4ACAA 1NLFA 4BFUA 3U44B 3LAWA 2MMGA 3KUDA 1AGPA 3LH5A 1OIWA 3CRVA 4PSVA 1HA3A 2WJGA 1Q21A 2ZRIA 5HTKA 5HR5A 1IN5A 1P9WA 1DAGA 1YZLA 1ZM4A 1GUAA 5FI0B 3PQCA 2PEZA 2OFXA 4P32A 4UNQA 2D3WA 2B7CA 3W3ZB 1E2QA 4G3XA 2ZJYA 4NL4H 3SFVA 1V43A 3GLFE 1XTQA 1NLYA 1L4UA 3A4MA 3C7KA 5TARA 3V4RA 1AQYA 3AB3A 4Z8YA 1GKUB 1WXQA 2GNOA 2CHGA 4A8JC 3AP3A 1U99A 4TMXA 2WAYA 1X3SA 2YOHA 5DGXA 3K53A 2JJ2A 3CZPA 3WP0A 4M1KA 1MABA 2Z5FA 4AWXA 1EXMA 1XP8A 1Z63A 1NF3A 1I2MA 5EP4A 2RGGA 4I1VA 5FUXA 1LY1A 2NG1A 1P5ZB 2D7CA 3CLVA 4LBWA 4KU4A 3EWSA 1ZUIA 5TB5A 2ZQ5A 3CW2A 4JSYA 5FOSA 2ZANA 3ZYCA 1IN4A 3QPUA 4ACBA 2BWJA 3NG1A 2DFKB 2B7BA 4PHGA 4PHTA 3IEUA 1E1QD 2QP9X 2AKAB 5HCNA 4LHZA 4HB0A 3IEVA 1S3SA 1KYIA 1Z6XA 2ZYTX 1LB1B 3K1JA 3SU8A 2FN4A 1JR6A 4Q4JB 5UKDA 2FE4A 1W4RA 2YJTD 3VNUA 4NBSA 4NDZA 5JWRA 3A6PC 1N6NA 1TF2A 5IRCD 3AGPA 1XJQA 4QNRA 5EP2A 1Z0AA 3QKSB 4URUR 4MYUA 2B92A 2AFIE 1DG1G 3BIFA 1UADA 4GMXA 1KJWA 3MG9A 3GJ3A 4DLZA 3MJHA 3NH9A 2IHBA 4EFMA 2IHYA 1XRJA 2DWQA 4X8OA 2IWRA 1YZTA 821PA 1S96A 1ODFA 3A4LA 2D74A 3CRQA 4CEJA 1E2LA 2V1UA 2WJJA 5FPKA 3LRPA 1FUKA 1JALA 1JR3D 4BECA 5BW8A 2QPTA 3OIYA 2ZSBA 4KFRA 1EWRA 4US1R 2YKGA 1IY0A 4D2IA 4RD1A 2QSYA 1XWIA 2J9RA 2ZJBA 5KSYA 1KIMA 3W8NA 5LB4A 4Q01A 1GRRA 1YQTA 2IYSA 4FINA 2FDCA 3NBZC 1G7SA 2EYUA 1NL3A 2ZYVX 4DCUA 1SVOA 3I5XA 2ZRPA 4G0NA 5E7MA 1P3JA 2JLYA 4QBHA 2QUZA 4W5JA 3P20A 3ZD6A 3W6NA 1LW7A 5J4YA 1WB9A 2ONJA 3GEIA 1E9BA 2AK2A 4MRNA 1T5IA 3I1FA 3O8RA 4PC3A 4PSAA 4GT1A 1BH2A 1G5PA 1A7JA 2EFHB 1NIPA 2GXQA 1TPZA 5GVRA 1KO8A 3C15C 4RD6A 1UEIA 3QBTA 3CX7A 3CPJB 4WXRA 2OSBA 4JKYA 1YR9A 5E95A 4LC0A 1D5CA 2ODBA 4DT1B 3GLIA 1ZUHA 1HT2E 4XVRA 1BS1A 4OKSA 2ZR9A 2ZS8A 4I1OA 2XOKD 3CX6A 1CULC 4KJZA 1XB2A 1HYQA 3NKVA 4Z1MD 1ZCAA 2IWHA 4RCYA 2ZS7A 2DY1A 1ESNA 1W48A 2LCFA 4HAVA 4URXR 5CK5A 1SXJD 1QBKC 2IUUA 1RRPA 1IAQA 3W3AA 1N6IA 5DNYB 4HLCA 2D7DA 3L0PA 2J0VA 1E1QA 4GI7A 1KI4A 4PAQA 4DBLC 4QKQA 4LHYA 4NYJR 4I1SA 3IILA 2GWHA 5JS8A 2SHKA 4V03A 5AUQA 2AWNA 4MUBA 2C95A 5EE3A 4XWOA 1N0VC 4DVGA 1YZUA 2R6GA 4DDWA 2O5VA 1D8TA 2JLSA 2HF9A 1P2TA 1E2EA 2QRZA 3AVTA 4TLDA 1NJGA 4LJ6A 3RWOA 1II0A 3X2SA 3U4QB 3FB4A 4F91B 4FXPA 2EW1A 4U7DA 4EIWA 4GP6A 1NMZA 3LX8A 4GNKA 2JLWA 1QZXA 4KBGA 2QGNA 4TL8A 2ZJZA 2IT1A 5IDVA 3RRMA 3HU2A 1OXXK 2NO1A 5AJVB 3BB1A 4Z1MA 4E07A 1IONA 4E5UA 2PX0A 1U9IC 1NN0A 2Q3FA 4PX9A 4JLKA 2J0QA 3EPLA 1WMSA 3U44A 3KFVA 4N1AA 4DCVA 3DEFA 1QHHB 2GESA 4B6EA 4WW0A 3SEAA 5J40A 2QPOA 2X77A 3Q8XB 2OG2A 2O8EA 1SVKA 3TH5A 3BORA 4NH0A 1G16A 4IDNA 2AHOA 2V7QA 4MKGA 2FZLA 4MYHA 5G3YA 5CJ2A 1L2TA 2QG6A 1G9XA 1VG0B 5K8IA 4B75A 3QXJA 1CR0A 2WPDD 3NIBA 3PUVA 1U90A 2YWFA 4CRWB 1W36B 2CLCX 1P6XA 3VR1A 5JS7A 3A1SA 2PZFA 4CW7A 1JBKA 1TEXA 1YZKA 2V55B 2W00A 1G1MA 3K09A 4QGFA 4RD0A 1DOAA 3NH6A 4JL5A 2BV3A 4IXNA 1NNEA 3K70D 1T0HB 2R6AA 1LNZA 2GF0A 2QY9A 3QENA 1MABB 4ZPXA 1Z22A 4YXWA 1TUEA 4C3ZA 3P4YA 3CNLA 3C41J 2ASEA 2GK7A 5CIWA 3FOZA 2O0JA 3AVVA 2NPIA 2JJ1A 3W6PA 3ADCA 1CXZA 2L0XA 4V0OA 4YQFA 1YZNA 3P4XA 4HDCA 4LPSA 1E98A 4NMMA 4D6PA 3B9QA 4EAQA 1ZMXA 2CHQA 1GNRA 3SC3A 2WOOA 1E94E 1R5OA 4TZ6A 2ATVA 1UFQA 2PT7A 5FBWB 3F3YA 2ZROA 2FU5C 4E03A 2O8CA 1ZNWA 1NY6A 4U02A 3RS3A 3B78A 1P75A 5IK2A 2I3BA 3ZQ6A 3FFBA 2BKUA 4EQ6A 4DXAA 1VCIA 4ESHA 3B13B 1ZD8A 3TUIC 4V0KA 2RGEA 2B6HA 1G41A 4IOMA 2IYZA 1QDEA 4KFSA 3OIVA 1ZC3A 2BOVA 4W5HA 5F98A 3RABA 4TYWA 1GVNB 2PL3A 1P60A 4GL2A 3N70A 1WP9A 3KXKA 4PO8A 3QF4B 3TAHA 3GJ7A 2PLRA 3LLUA 1GRNA 3AF1A 5KU1A 3LDAA 4KBFA 1IN7A 5LD2B 2BIFA 4HZUB 3AGQA 1RPZA 3CF2A 2VYFA 1GG2A 4DSOA 1VIYA 1AZTA 4IXMA 1RYHA 3K0AA 4TMKA 1Z3IX 1U8YA 2FFHA 4UXHA 5BN3A 3ZZ0A 1KDPA 4XTCS 4ESVA 3GLFB 1X86B 5IT5A 1FTNA 3IGFA 5KSOA 3H0KA 5EP1A 3RC8A 4DLVA 4Z8XA 1OH7A 2Q3HA 3A4NA 4LX0A 4V02A 3M4YA 2AXPA 5DISB 4MDFA 5E7IA 1F3OA 2GEUA 1XPUA 1Q1EA 1RW4A 1K8RA 2G9NA 4C0HA 2C2HA 2OFOA 1TF7A 3PR1A 1VG8A 4AD8A 5BYKA 1FNNA 2A5YB 3HYRA 2FG5A 4LOAA 2WV9A 2XXAB 3OE7D 4EPYA 3QVVA 1DELA 4PO9A 2BM1A 2WMOB 4RZUA 3B82A 2MSDB 2WAXA 2ZJAA 4JVLA 4B3GA 2AXNA 4AKHA 3CNOA 4BFZA 2GBLC 2C78A 3EIQA 3U7GA 5JZVA 3B6EA 5FL7A 4CEIB 1ZD9A 1ZM2A 1BYIA 3DVLA 3BH7A 3FMFA 3UK6A 1KI8A 1JB1A 1GFIA 3HR7A 4A2QA 3T1QA 1DO2A 4B74A 2JATA 1OSNA 2QT0A 2C04A 2Q9BA 3UG6A 2OEPA 3FKSA 1S0UA 4MKFA 2OV2A 1F60A 4JIMA 1N5KA 1J7KA 3WBJA 1ZNYA 1E2NA 3V00A 2REXB 3I73A 3GQBA 4FMCF 1G6HA 4TTPA 4C7OA 4HLUA 2WSMA 2OCYC 2VHJA 1HEIA 4A1FA 4LPKA 4ASUA 3PUWA 2VBCA 2F9LA 3GFPA 2F1RA 3QKRB 1VCOA 4XH9B 3G5UA 5KUTA 2BEJA 5EE5B 1XTRA 4PC6A 1JXOA 4P4TA 3A1UA 3U60B 4Q7MB 4US0R 1N25A 1P4SA 3SE0A 3DZ8A 2G1KA 2F9MA 4CZ2A 4OHWA 3EIHA 2O8EB 1D2NA 1KY3A 2BHRA 4BLPA 5FBVB 1JR3A 1LS6A 3BJIC 2JJ2D 2I1QA 4F4IA 3M0EA 1AS0A 1NIJA 1QVAA 2ODNA 4WVFA 4PXAA 4F4CA 4D82A 4E09A 1KSGA 1IN6A 3TQCA 3RNLA 1VYVA 3VQTA 1DAHA 2ZR7A 3H1TA 3T1OA 4O25A 2YWGA 1JQLB 2ZTSA 1MO4A 1F48A 4QOSA 2WWGA 1VMAA 2A5GA 1SVIA 1GAJA 2FMXA 3A8TA 4XIGS 3TRFA 1NKTA 3ZIAA 3ZS8A 5EXXA 1S1MA 3CIOA 4B3FX 4IOKA 2Q0HA 2E9SA 1T91A 2QQEA 1BMFA 1LFDB 2XAUA 1UKYA 2FFBA 3EAQA 1Z08A 4RFVA 1KI6A 3FMIA 4IW3B 1TTTA 5A4JA 5IF9A 2WTUA 4MH0R 1F6BA 1KAOA 1AKYA 3LD9A 1OFIA 4F92B 1XEFA 3NC1C 4QBIA 1C1YA 3R9IA 1W0KA 4M1MA 3RRZA 3GPLA 5AJWA 2CNWA 2ZU0C 3N2IA 4GBMA 2OESA 1KI1A 2NQ2C 4UJ5A 4TQAA 2ZE5A 1QHXA 3BRWD 1XFAA 3FVQA 3Q7QA 4II7A 2B21A 2ZE6A 1G18A 4ARZB 1ELOA 1U0LA 2JEOA 2OLJA 2EFEB 4LSGA 1XF9A 4B47A 4UKDA 1G7RA 4G5SA 3DDCA 1U81A 3DKPA 4PZZA 5J5CA 3PUYA 4M1SA 3RS7A 4GDFA 3GFOA 3SDZA 4D0GA 2C03A 2J1LA 4B44A 1SKYE 3THXB 2BJVA 1QF9A 1TF5A 1XX6A 1ZBDA 4BFVA 3FPAA 3EASA 3P26A 1N5IA 2ZRAA 3A37A 3GFTA 4IDQA 1CR4A 3AKEA 1LVGA 2JLRA 3B5JA 1AA9A 2R6CA 4W7SA 2QU8A 4MRRA 3JVVA 3QPVA 5L3RA 4Q4AB 1IXRC 2CBZA 1A5TA 4AG5A 1G7CA 3MGCA 3K09C 2H17A 2QROA 3ZVLA 2XITA 2F3TA 1HV8A 3GP8A 1Z0KA 4JLOA 2A7QA 2DPXA 3OEHD 2IEZA 1HQCA 1ZW6A 3NTUA 4LBZA 4FIDA 2D4HA 4JKIA 2FX3A 3NHAA 4U5XA 1E79D 1KO7A 2LKDA 3RC3A 4Q19A 3AVQA 5JWHA 1G21E 1ZRHA 2OAP1 3L0SA 4EJSB 4YXWD 3KFXA 3EIEA 4C0KA 5D3MB 1VIAA 1NG1A 4QBFA 2GZHA 3SFZA 1ANKA 1KJZA 3AQ4A 4LJAA 4URZR 1E2KA 2ZRJA 4L4UA 3Q5EA 3RS0A 1TX4B 1WBDA 2Q9CA 1R0XA 2IF2A 4M53A 1E2JA 2PZGA 1P2VA 1KNXA 4CT5A 1Q3HA 3WYFA 3WMFA 3VKGA 1PZNA 1TUIA 4OHZA 1VECA 4P3YA 5AUNB 1UF9A 1Y3AA 3P32A 4WA7A 4TTQA 3R7WB 2V7QD 4LJ5A 1T3LA 1XD2A 1UAAA 4KLZA 2YV5A 2NGRA 2N42A 2WWHA 3LA6A 2ZR0A 3OFND 4KVAA 1SQ5A 4HAWA 3TR5A 3LX5A 4GRAA 5FBLB 4IOJA 2MMCA 1JPJA 1ZUNB 2CVHA 2VH5R 3QE0A 2IK8A 4WZ6A 3FMOB 2WOJA 2WSSD 2GVZC 2Z6VA 4LDJA 4TZ0A 1AN0A 1NBME 3FDIA 4FMBB 4YONB 4C0LA 1OF1A 1ZM7A 4BE7B 2OXRA 3A36A 1W2HA 2OCBA 5ELXA 1W36D 4BEBA 4KO8A 4JVNA 3X1YA 3B8HA 5AJZA 1YJ5A 1PUIA 4JLDA 4B35A 4C0AC 4OQNA 4DC9A 2H16A 3KJHA 1J90A 4PC2A 1OPXA 2PJZA 2ZJ2A 3M1IA 2CCKA 5AWFC 4HAUA 3LW8A 3TMKA 1D2EA 2ANCA 2J7PD 2OE2A 1R8SA 4ZCIA 5L3QB 3PENA 4MITA 5KDLA 3TAUA 4IVRA 3L0IB 1UBCA 4L15A 2ZUBA 1XPOA 2XGJA 2R62A 4XJXA 4C2TA 3FE2A 1TNDA 2ZRCA 1L4YA 1OXUA 4XSHA 4JT2A 5FPYA 3VR6A 4BLSA 4ZO4A 1JAHA 2QP4A 2YWEA 4P33A 8OHMA 1MKYA 5HZKA 1P72A 3LWNA 2QN6A 2PT5A 2UZIR 2IYWA 3ZIAD 4LBYA 4GSYA 4FI3C 4V0MA 2V4ZA 3THOA 4HATA 3BS4A 3SYLA 1HE1C 4N3NA 1G8GA 4B33A 3U6BA 3ND9A 4LI0A 4A82A 2FWRA 1XDBA 4GZMA 1G3UA 2QA5A 4LUCA 3SNHA 4OQMA 1RYFA 1G64A 2UVQA 1R4AA 3BBPA 3WMGA 2Z4RA 4JMPA 2J5XA 2R6FA 5GJBA 3NXSA 2O8BA 4AKGA 4ZDJA 3ICQB 1CJTC 1FFHA 3CBQA 4HB3A 1VPLA 1SXJB 3H84A 4A2PA 4AC9A 4NYMR 2ZRHA 1XXHB 1QHYA 5F9HA 2F43A 3SJCA 4JLVA 3K0AB 1OYWA 3CH5A 1E79A 2VP2A 5DI3B 3U3JA 3ETLA 3ASYA 2OBLA 3ZLJA 1YE8A 4X8LA 3OESA 1R0YA 1GNPA 1FQKA 1NRJB 2ZU6A 4EPTA 1TQDA 5DHFA 3MRSA 4BLOA 4LJ4A 4CGZA 1IJEA 1Q44A 1UKVY 2H1LA 4Q4JA 5C2JB 1JJ7A 5SZKB 4B71A 4A8JA 1RRGA 3RS2A 1PVOA 4PPNA 2VP5A 1KO4A 2AL7A 1N6LA 1F2TA 3E70C 4V0LA 3NDPA 5FBQB 2CL0X 3CUEF 3TBKA 3WP1B 1NN5A 3MWLA 4TMTA 2O0HA 2GJKA 3REGA 1OXVA 3SI7A 4Q02A 2GHIA 2CJWA 2VLIA 4QXAA 2C99A 2GF9A 3TSZA 3PJRA 3AKDA 1Q1ZA 4HB2A 1IOZA 1W47A 1GRQA 2ZI4A 2XXAA 1T3SA 4IEIA 3AUXA 3QY0A 3CWQA 4Z51A 3THXA 3K0CC 4IDPA 2IYTA 1T8TA 3O8DA 2PEYA 4AK9A 2VHCA 3SQXA 5JWOA 1QVRA 5G40A 2C9YA 4AKIA 4KITB 1FUUA 2FNAA 4Q03A 3FKQA 2BCGY 3NEJA 2NZJA 1UDXA 4P31A 4YMUA 2QI9C 3GEEA 1H8ED 1N5JA 4KCGA 1XEXA 3BFXA 2BDTA 3GLHE 1M7GA 2D2FA 3QVUA 4B3XA 5FUWA 1ZCBA 2ZSFA 3A1WA 3FTQA 1QHNA 3UPUA 3HYTA 1X8JA 2IYXA 3NBXX 2OLKA 2XB2A 1M34E 4JS0A 1BKDR 1MT0A 4ZV4A 5EUQB 3ZH9B 5JJIA 3AEZA 2REOA 4M8NE 3LBIA 3EWAA 4OI2A 4AYXA 5CB8A 3TW4A 3AVUA 3IUYA 4G5GA 3PCRB 2P0EA 2W6JA 3CZQA 1KDOA 3H4MA 3ADDA 3WRYC 5G41A 4H1VA 3BFKA 3OFNA 3HU3A 3TNFA 4QGGA 3ZZTA 5C1BA 1O87A 2BBSA 1SULA 1G6OA 2F1IA 2AK3A 2ZYWX 3AP2A 3BWDD 2W83A 2ZIAA 2WMNB 2JASA 4Q47A 2C9OA 3KTAB 1NY5A 5CB6A 2A3RA 1ZJ6A 2IYUA 1SVWA 4TMWA 3CM0A 1P2UA 3F0TA 2HYIC 3D6TB 2XZOA 1ETUA 4OK5A 1Z0DA 2EWVA 5HCIA 1ZD1A 3T5DA 621PA 4M9ZA 4GMDA 2QTFA 3X1DA 721PA 4BLQA 5TVKA 3EARA 1YRAA 2ZAOA 1ZYUA 2D62A 1II8A 1S4QA 1JPNA 5JLJA 1EX7A 2J3EA 1RJ9A 3DOFA 2QL6A 2ZI9A 1OE0A 3VU9B 1OFUX 1UBEA 1JEDA 4LJ9A 2GXUA 1NJFA 4NCKA 2GRJA 1CJMA 4PC1A 2ODEA 3QPWA 4HAZA 5EQTA 2IX3A 2RMKA 1DAEA 4DLYA 2XNDD 3AVYA 3K9LA 4ZCMA 3W8RA 3R8FA 3GLGE 4JJKA 2OZEA 4PC7A 2BMEA 4FWIB 4I99A 4DDUA 1Z8FA 1KMQA 1UEJA 2REBA 1Z29A 4Q9LA 3VR3A 2QTVB 4G5RA 3VR5A 4F38A 2IW3A 3V9PA 4DLXA 4ZKDA 2BMJA 4TL7A 1E9EA 3F8TA 2ZSEA 5SZJA 5KHOC 1KTVA 2FSFA 3PG5A 3RHFA 2JGNA 1OKKA 4DSTA 4KFUA 2DWOA 1M7HA 3HPRA 3PEYA 3CKLA 4TYQA 1IY1A 4MRVA 1E2FA 5CM9C 2MSEB 1N0WA 1R8QA 4HZIA 1W49A 2AWOA 1SHZA 2OAQ1 3A58B 1II9A 3UXMA 4CIDA 2BCJQ 4ARZA 1CF4A 3OE7A 4JLJA 4JYBA 1EX6A 3KB1A 5BN5A 3LXRA 4LBVA 1OIXA 3EZ7A 5LPNA 3SQWA 2VSFA 4PPGA 2X19A 3SJZA 2ZI6A 3IQWA 3MAAC 4NYJQ 3VR4A 1W1WA 4JYCA 2NO7A 4L16A 2Q21A 3ECCA 5FTKA 1KSFX 4I1UA 1G20E 2V3CC 4KSCA 2HDNB 3AVPA 1W46A 2H92A 2GA8A 1G3IA 2GJ9A 1KMHA 2I4IA 1N6HA 5B58C 2CMKA 2F43B 1FPMA 2J46A 4QL3A 4MGIR 4DDVA 5TV2A 4N0DA 2X2EA 5E3HA 4TLEA 1T0JB 1DS6A 1JEEA 2RGNA 5AK0A 5KO2A 3QEJA 5H8WA 4Q48A 4BFYA 2JLZA 2G83A 3GLGB 2AN9A 3MLEA 3WBKA 1W36C 3QNUA 5AJXA 1R7RA 2RGXA 4TMVA 3VX3A 1DO0A 1S3GA 3KXLA 5KTYA 4B73A 1IHUA 2FSGA 1MO5A 2WVJA 2VIIA 1COWD 3IBYA 3BB3A 5TDHA 3VAAA 2W2VA 1WDTA 3U61B 4NCNA 1S9DA 3MUFA 3HU1A 3I32A 3KQNA 4UNSA 1OV4A 3KJGA 1W4BA 3LFUA 3DO6A 4JLMA 4OK3A 1NBMA 1V5WA 3AP1A 1Q3TA 1W4CA 2FGJA 5HE8A 4EPRA 2CJWB 2QT1A 3RAPR 4PTLA 1OIVA 2VEDA 2YC4C 3RSOA 1HTWA 1JECA 1F5NA 1NMYA 1OJLA 3LQRA 4PO1A 4PZYA 1CEEA 1E9SA 2QNRA 4M1TA 4KLNA 5EXSA 1KK3A 3KL4A 4EPXA 4PAMA 4Q1FA 4YMSA 3IO5A 3TR0A 4DLUA 1MH1A 3O47A 4TLBA 4MQBA 3ZD7A 3CRRA 1QHSA 2RCNA 1SVSA 4TL9A 2CLSA 1HH4A 3CF0A 3MCAA 4RKFA 4GOXA 4FCVA 2NMVA 2X8AA 4YMVA 3BE4A 4F4JA 1AS2A 1QRAA 3TVDA 3W34A 4C0QC 2ZUDA 2XTZA 2IYLD 4DZZA 5CDFE 4XWKA 3TJZA 4D4JA 2XTMA 4DIEA 3AKCA 5KNBA 3THWA 3L82B 3U3OA 2W58A 3VX4A 3I5YA 1E32A 5KYKA 1J8MF 4JLAA 2FPMA 1UBFA 3DM5A 4M4SA 4PHFA 2KSQA 3W5JA 4MKIA 3UG7A 2HCJB 3B1XA 3RS5A 1IXZA 3O8CA 4UJ3A 4D4LA 1O3YA 5JMTA 4V0NA 4OJQA 5G3ZA 2WWXA 4DUGD 5DE3A 1KJYA 5KPDA 1XZQA 2FPLA 3RDPA 1Z5ZA 4EFNA 2EFCB 5LB2A 1P9NA 2WWIA 3PIRA 1DTSA 1M74A 3KTAA 1UM8A 2WHXA 3A1VA 2CHVA 1CBUA 1XTKA 2Q6TA 2DBYA 3VR2A 5JHHB 1VCNA 1ZIOA 1E2MA 3NBYC 4E22A 3KJIA 4A6XA 1SVMA 4M9SA 1GOTA 2DHRA 2KE5A 2VHUA 3PXGA 2O0KA 5EZ6B 5B64A 3KX2A 2ZJ8A 2F6RA 1E99A 3QXSA 4CEIA 1E9AA 1J99A 5J47A 4O0MA 4URVR 1FP7A 1II8B 2VA8A 1E9CA 1GILA 4FMDB 2RAPA 4ZI3A 4IJMA 2QSZA 4CT4B 1Q57A 1GKYA 4QJ4A 2C5LA 3N2EA 1E4VA 1N0UA 2J41A 5DO9A 2WIBA 1XPRA 2J59A 2R9VA 3H2YA 2A30A 2ERXA 4RD4A 4BZXA 1A82A 1D9XA 3QUSA 3K0EA 1D2MA 3UWKA 3VHLB 4JJZA 1U0HC 2NO9A 2PCJA 4DIDA 1UBGA 2A5JA 1XU4A 4AURA 2A5FA 1GKIA 5EE0A 3KKQA 4TLAA 2J7KA 2CNWD 1XXHA 3ZZUA 1G4UR 4B48A 1E3MA 1US8B 1U2RA 3JVUA 4Q18A 4URWR 1BIFA 1ONBA 1E0SA 2BBTA 3A1TA 5DI3A 3SR0A 3QKRA 1GITA 1KSJA 3OHMA 4JL8A 2GILA 4ASUD 2ODWA 3AVXA 3K0FA 4ZDWA 2H5EA 1W2GA 2ONKA 4NYIQ 1DBSA 1E0JA 1P7CA 2IYQA 3OEED 4GFDA 1KOFA 1G4AE 1A4RA 1TL7C 1XMJA 4MYTA 3HDTA 3AF4A 3OIWA 1IM2A 4HLQB 2QBYB 4ITRC 5KDOA 1JJVA 3NBFA 5DLQC 1CJVC 1J70A 1PJRA 4NP6A 4A92A 2NTYC 4PQFA 3LV8A 2YVUA 4M22A 2ZETA 4LZZA 4Q1EA 2WICA 2QGZA 1XNJA 4LCBA 4C9BA 3ZVMA 1XJCA 2ZI3A 4LC1A 5FH9A 1EG7A 4BRWA 5L3VA 2QORA 5DYGA 4QBGB 3Q3JB 2OO7A 2CVFA 4RFSA 3NDBB 1Z07A 2ORWA 2XX3A 4TT3D 521PA 2N1BA 2JJ1D 3NC0C 2WWFA 2BEKA 4WIAA 2HV8A 1W5TA 2WJHA 3TKLA 5EJEA 4R7ZA 4AYWA 1Z83A 1XBTA 1P2SA 3PEUA 4MGZR 2ZSAA 5LDDC 1T8UA 1E96A 1G8HA 4WAUA 5DHAA 1B23P 1AQUA 1ZVQA 2EYQA 3BERA 3EZ2A 3BH6A 4TTRA 4PQRA 4RJLA 2BJWA 3EC2A 3DPUA 3L43A 5DYIA 1IQPA 4UQOA 3MD0A 2ZVPX 4XOIA 5AR1A 2FOLA 4ZIRA 2Z4SA 4UNRA 4CEHA 4TQ9A 3VHXA 2QAJA 4EDHA 1M1YE 5FUYA 4O3MA 4HSEA 4MUAA 1T6NA 4KHZA 4LYAA 3ADBA 3KKNA 4BZPA 1KSHA 2VRWA 5CDFA 4LJ8A 1GM5A 4BFTA 1WBBA 2AKYA 4D81A 4D0NA 1YU9A 1Z06A 4I4LA 4DLSA 3RS4A 2H18A 2XZPA 1NVVQ 4Q7JB 5DSZA 2V54A 4A4DA 2RGDA 3C4JA 2R6DA 5K8TA 3DKVA 2E87A 3K8YA 4NCHA 2F7SA 3MWJA 1ZP6A 4BQSA 4NCJA 2F55A 1N2CE 2GJAA 421PA 4Q4AA 4BWYA 3HP1A 5DN6A 2IS1A 3Q72A 4FCWA 4TYPA 5TY0A 4Q7KA 5CLQA 1YZQA 2ZRLA 3MSXA 1CS4C 1XXHE 1W44A 2RH5A 5E4FA 1E0AA 2AD5A 4Q00A 1SXJE 3HR8A 3LBNA 2IEYA 3ND8A 2YNMA 3BK7A 4XVQA 4M21A 1NN1A 4BLTA 3THYB 4RKEA 5H70A 4EJSA 3WMEA 2ZM5A 2BM0A 1KI2A 4FD2A 3LNCA 1MRSA 2HJGA 5JRZA 1FNMA 3FGNA 3Q5DA 1XCGB 3BB4A 2KBEA 2O8DB 1F2UB 5IK2D 1P62B 1U98A 3NEYA 3CR8A 3IPYA 3EPHA 2QP3A 1G8YA 1B0UA 2C9CA 3OZXA 1N6PA 3SHFA 4OBEA 4DRZA 1NP6A 2P65A 2UKDA 4JSTA 4OI1A 4Q4HA 4G5QA 4BZQA 5JCZA 5AJYA 1RRCA 1Z0FA 1GDDA 5H68A 4LV5B 3MFYA 5CJPA 3TW8B 2OHFA 1NSTA 1KKLA 4Q1BA 3ZJYA 2VQSA 5FPSA 3EA0A 1FX0B 2GJSA 2FF7A 3EZ6A 1S2MA 1U8ZA 1YZGA 3IDQA 3L2OB 1XEWY 3SOPA 1CJUC 4Q1AA 3WYAA 4D4KA 1TQ4A 3PFIA 3B1ZA 4B43A 2IYYA 2DYKA 3RYTC 2GJ8A 1XCMA 2EFGA 1R0ZA 1VG9B 2HEIA 4OHXA 3B85A 5EZ5A 5FFMA 3BH0A 1E2IA 1DADA 2N46A 2NO6A 3B7GA 2QZ4A 2OXCA 3CONA 5JFGA
chains in the Genus database with same CATH superfamily
2H2IA 2AMVA 4MQEB 2E1RA 4R6XA 4EARA 5KWSA 4B09A 1FTSA 3QE4A 5KVVA 1AHHA 1W4ZA 3ZGXA 4NYIR 5J2UA 3GJQA 1KQGA 1JIXA 1FVXA 1NVXQ 3KDSE 4QJIA 5AKHA 1H4TA 4YQEA 3W5DA 4CN9A 3VJRA 4DA9A 1MA0A 2FETA 4Z7JA 2EJTA 5FR1A 2JGDA 4JB3A 3L7NA 2PH7A 3SYKA 2DF8A 1ZVVA 1EB9A 3GA5A 4XX0A 4IY1A 3FTNA 1NXSA 1YUNA 3WO1A 3M9XA 1B8OA 2AMLA 1I94B 2NUAB 3KJZA 4ZV7A 4YAEA 3WZMA 5AW7A 3WGQA 5LU8A 1J49A 3CTMA 4GQAA 5BUSA 1SELA 2YOFA 3R74A 3V1UA 1DMRA 4I1IA 4UXIA 2G25A 3E58A 1RHKA 3I39X 4JOBA 1UJ2A 2Z04A 4UATA 1IJBA 2OYRA 3WRXC 2NV6A 2O2HA 1AK1A 4NJEB 3ZWCA 3ZIDA 3AY6A 5ALHA 3A7EA 221PA 5FPTA 4DV2B 3K0FB 1QQTA 1ZEJA 2VXOA 1YRQA 4XSGA 2GFHA 4TV9B 1VYTA 1Q1NA 3PE3A 3T3EA 4Z2AA 2B1QA 1VLJA 4FJ1A 4PYOA 1JHOA 2B69A 4B3BA 4FOTA 2EERA 4RDIA 1FDRA 4GICA 1CS0B 4P58A 1KIAA 3NIGB 1E4EB 1G6KA 2GUGA 2XYPA 1MRNA 4RIGA 3WLJA 4DLTA 1M6NA 6Q21A 3VAZA 5GMOA 4OL9A 3LL7A 5D86A 1LVHA 3IIIA 1L8QA 4MPDA 2TSYB 5JFTA 5L4LA 2QAIA 4IDOA 1Y3IA 4JLBA 5B1DA 5TJ9A 4HUTA 1GLVA 3M1LA 1LS1A 5ILQA 4RZXA 1KC1A 1CUFA 4Q1CA 2HYDA 4TVBA 1FYXA 1K2VN 2ZIWB 5ITVA 2HBZA 5ESWA 3N1UA 5FKJA 1UKEA 2OFWA 3ONWA 4H60A 2VATA 4BU0A 3MLBA 2GNAA 2X4DA 2GXSA 3CXRA 4QRDA 3T3OA 4NE2A 2YZ2A 1V95A 5ECDA 3VDNB 3W3AD 1SXJA 1FP4A 4W63A 1EFRD 2XTNA 4NBKA 1I80A 2YIDA 1FDIA 5CVEA 1U9JA 2Q5CA 5M7EA 2OCAA 2YINC 1RCUA 2LV8A 2BH9A 3KQOA 3RYCB 1W7AA 1NP7A 5JHGB 3PTAA 2QTRA 3JQBA 4ZVKA 1PLLA 4IYRA 5E2BA 1XEAA 2O48X 2P6UA 5ILOA 4NKRA 4NNPA 1Y8QB 5LP6A 2AD1A 3NS7A 2UVDA 3AHHA 1NI4A 2P90A 3AEUB 1AGXA 3DKKA 1SXIA 3M6UA 1E2GA 2EG9A 2JH3A 3QU2A 2ZIXB 4RA6B 4BWGA 1SKYB 1O54A 5A9TA 5EP3A 1ADFA 3VZQA 3QLUC 2VP3A 2IXGA 2VPWA 2O2GA 2ZRFA 4OQ4A 3VYUB 1Z5NA 2OZLA 4MOWA 3RVBA 1PVVA 3L4KA 3W9UA 3PFFA 4AKEA 1JQEA 1MB4A 1F9AA 1UINA 2QD3A 2R6ZA 1TZMA 2FH5B 4RD2A 1RAHA 4RHFA 2NUBA 4L0DA 4GOLD 1VL1A 4UCXA 4OI0A 1P0MA 4HY3A 3AI2A 3RT7A 4U2EA 2BMDA 1QB7A 3DMTC 4K6OA 4LHWA 1DUSA 3T34A 3N6VA 3IERA 3Q9LA 5J4KA 1EFLA 4DXDA 4KNYA 3CNHA 1I14A 1CRWG 3C6ZA 4PTZA 4FQ8A 3GLIB 5JBQA 1L7MA 3LCRA 3MYYA 2OHJA 2CJXA 1W0JD 1WXXA 1TQ2A 2FFQA 4KO4S 2MSWA 1O96A 1IHYA 4HBZA 2IZ5A 1NW9B 5AKZA 1NP3A 1Y5MA 4C21A 1E1KA 1ZINA 5JSKA 2W6MA 4A0FA 4DSNA 2AB0A 2FP4B 4KVZA 3S4YA 3O3CA 4R2IA 5HILA 4QGBA 2B8EA 2QN1A 1TQHA 2ZYIA 1DCKA 2XF8A 4BP1A 5C8YA 1V8OA 4Z0TA 4JBGA 4CKEB 1P8AA 4JJGA 2W2XA 5IJWA 1SVUA 4O4JB 4WY8A 4X62B 4BASA 4INPA 1JJAA 1NJ5A 2R6JA 4ZK2A 3E1KA 1TD9A 4MUHA 3FWPA 3W8DA 3CHYA 4Y0VA 3Q7PA 4ARAA 1FZQA 1Z28A 1CY6A 2JZNA 2PVSA 1TA9A 1YI1A 3D4PA 3NVMB 3OPYI 1JI0A 3QMPA 1P73A 1CVIA 2OBFA 2AYXA 3LT5A 5JZSA 4LGCA 4X45A 2ZTHA 2KWIA 4RTSA 4LRYA 1GZSA 3B53X 4E94A 1W6UA 1U3DA 3C14C 4KAXA 1V1JA 1M2EA 3DZDA 1JKJA 3RC2A 3L4BC 2YFHA 4OL0A 3EZFA 1WS6A 3PQ4A 4BJ5A 2I2WA 3BHIA 5GINE 4FNGA 1BJKA 3EXG2 3GVIA 3UIEA 5A4DA 1H3NA 1ILEA 3OX1A 1TU3A 2CYCA 3EDMA 4R31A 5DJ5A 1L9KA 4EKGA 4ES6A 2FN3A 3AVWA 2O52A 5J1TB 4U63A 1J22A 1GQSA 2W2TA 4GZLA 3RKUA 1JEOA 4BV9A 1EFPB 2ZBDA 4RQUA 3LDGA 4R01A 1FFDA 2XNHA 2PCLA 3U5ZB 4W1SA 1WY5A 4U00A 3VPFA 3N59A 2RKOA 1AXRA 2PSEA 1REQB 1GN9A 1V39A 2X9VA 2IUTA 2QENA 3G17A 3KZ1E 2EKBA 1VPDA 1JAYA 4IFBA 3FOAA 3LECA 4LYDA 4WNAB 2G4LA 2Q5QA 2E4ZA 2IYNA 3AG6A 3MJVA 5G0TA 4GM0A 3WIDA 5A04A 1BWPA 3SXJA 1V8DA 4S0XA 5HJ5A 2G70A 3SS9X 1HO3A 1ZY2A 5GOZA 4D4IA 1WU8A 1ZOIA 2LKCA 1TUBB 4OHYA 2ZIVB 2Z5GA 4AKTA 1KK1A 1BX0A 4UBMA 3RLFA 3ZDYB 5KTRA 3K9BA 2GAIA 4AU1A 2YWJA 4NULA 1YONA 2IY9A 3ICWA 1V4VA 2E48A 4PEVA 1TJNA 2VAWA 5M2QA 2ET6A 3IVGA 2QIPA 1E3TA 4TS1A 2H31A 3TMAA 1NULA 3QEOA 1AHNA 3GMDA 4IPTA 4PLYA 4EHLA 2CLDX 1XYYA 1GV1A 3COJA 3ASVA 1NNUA 4GLFA 2XNSA 3CO5A 3O4RA 4G37A 4BU1A 4C7JA 4ENTA 3KWMA 5BXQC 3ZJVA 2EW2A 4PFQA 1AS3A 2IL1A 1JPVA 3EA5A 1W4AA 2PZEA 3R8CA 3K5WA 2NUAA 2OILA 3NDRA 4JELA 1U31A 3TPFA 1OXMA 4FDTA 4CV2A 3AOEC 3EXG1 3K9GA 4X66B 3BSWA 1N4AA 1B6SA 4Q7LA 1NVEA 2HQ1A 3V3TA 4KTVE 2IIBA 4MKHA 3ZXXA 5HKKA 2VJCA 3PWZA 4J29A 3UK1A 4DFDA 5BWLA 2I4OA 4QFMA 1SN7A 4AULA 2R85A 2R7NA 4P86A 2Y0EA 3PDWA 5E9WA 2WA1A 2Q3JA 1M10A 3ISTA 4HDRA 1Q0QA 4LHVA 4B4OA 1G3QA 4YJ3A 3T7SA 3HCPA 2WINI 3C16C 1CUIA 4REMA 1V45E 5J59A 2YZ7A 1K9SA 4PIMA 3RE1A 3D9QX 1TXGA 3PLRA 3GJ4A 4ENWA 4CEHB 2FEMA 2FPIB 2G08A 1A0OA 4GI2A 4GO1A 2BUBA 2Y1KA 1A9TA 3EPPA 3EIFA 4PPFA 3VUFA 3EGXB 2Q3EA 1ZRSA 1EFCA 1FQJA 1SUAA 3PD1A 3E0XA 2AOUB 4JJ7A 4QJBA 5K6AA 3K0CA 5H1YA 1V16B 1I30A 1VLHA 3CH4B 3KZOA 5AKXA 4UASA 1ZD2P 5CYOA 1FMFA 3HLYA 2DSTA 3C6YA 4WCDA 5IKXA 2Z6UA 1PX2A 3VJMA 4L9SA 4FN4A 1NJSA 1U8EA 4A73A 2FE1A 4QHTA 2R8RA 4QJ3A 3HDHA 4BKRA 4BX0A 3IBGA 1D1SA 4LXTA 2FSHA 1PZXA 4RGQA 1CDOA 4M86A 2ZJOA 2HSJA 3ZHBA 4XPZA 5MN5A 1V6CA 1T6BY 2DPGA 4WV3A 4ZARA 3MGBA 3VKHA 3ND7A 1EWQA 2V6BA 3NHRA 5JROA 4D6XA 4TSFD 4ZAFA 5K0FA 2NX2A 2KW5A 5DH9A 4Q12A 4X61A 1I3NA 1NF2A 4JVSB 3C74A 3KPWA 3VMFA 5LQAA 5FA6A 4LOJA 3Q87B 3Q88A 3CVWA 1HGXA 3BC1A 4ZRMA 2X3YA 3WL8A 3K8OE 4OLHA 3UICA 4RA6A 4B5LA 4C03A 2XQVA 3HK2A 5EWLB 3A6FA 2BLNA 1XLUA 1X8LA 4CMHA 3PWKA 3SS8A 1LBEA 2EZTA 4H6VA 1N3YA 1VHTA 4B7UA 5JEEA 1JPUA 1GAXA 3HA7A 5DIFA 5J4LA 5F9FA 5AVQA 2L42A 2G1PA 3HO1A 2PWPA 2O5CA 3LUCA 1NMXA 4CM9D 2NXWA 1GSIA 3G2MA 9GPBA 5JCXA 1GTJ1 3T7IA 4LWOA 4JEUA 2QUKA 3P27A 1JHQA 3CNBA 3THSA 5JJKA 3PXDA 4S1PA 1Q7TA 3SOZA 1DU4A 1PDWA 2PIDA 3K6KA 4XR4A 3RRYA 4RF5A 1PT9A 2RKWA 3EEYA 5KOHA 1EBUA 1PLJA 2Y76A 5C3UA 1UOOA 3CX8A 4QGHA 4MVWA 5LZ8A 3HJCA 1JIIA 3HNPA 1E64A 4KLRA 4YO7A 2IH4A 5ICCA 1DV2A 2Z95A 2CV0A 5E3JA 2PKRA 2WG2A 2BGTA 4QTYA 5DTQA 1WMFA 3VNBA 1MCZA 3RPEA 1FLNA 1H0KA 2CXXA 1JHAA 5BW4A 3PR3A 1ODKA 2C2OA 4S2UA 1DCTA 1FYVA 1XVUA 4A16A 3QOFA 4KAFA 1WSDA 2ARKA 4QIHA 1UPAA 5GIPE 3ZKAA 5I8ZA 4F7DA 3I8XA 4IEFB 5ALTA 1GNSA 3WGNA 2NNLD 3ESRA 2JGLA 4CMCA 3C3JA 2DEUA 3KKOA 4L0QA 1CLUA 4BNDB 3VAYA 2OECA 4FMCB 3FJYA 4J0IA 4RESA 4X7RA 1GKLA 1PFUA 3SX4A 4FKZA 1E92A 4FWBA 3GLHB 2BR3A 5E6SA 2V0NA 5HBRA 3TLZA 3VO9A 3K6SA 2YYAA 4EENA 2WC1A 2Q1YA 5KSPA 1JZSA 2GVDC 4XIFA 1ZZEA 3MIZA 1XCPA 4UTZA 5JAUA 3OOYA 2I62A 2Y0BA 4TTAA 2FK8A 4X3PA 3E4CA 3DMPA 4GDMA 4AI6A 4K05A 3NWPA 3E03A 1DJLA 4BFSA 2DKNA 2ZIZA 3LL4A 3QW4B 1UWVA 1N7GA 2NVUA 5JAZA 3CVVA 1P1FA 3I6IA 2RB4A 1GFWA 2C2XA 2P9YA 5BNFA 3RTEA 2XE6A 4U2BA 4YRIA 3AKYA 3LP6A 4N3CA 1L7EA 1MQ8B 3W77A 2XKJE 4L7VA 3GJ5A 4JODA 1HZJA 2F3RA 2J0UB 3AV0B 4M6WA 1OXSC 1A8QA 4B32A 4DCJA 3X1ZA 4DYHA 5DB4A 4P34A 1FDWA 1OA0A 3D2LA 4KIFA 4P82A 2YHSA 3H6HA 4EKDA 2CFIA 6ABPA 3JZFA 1K8QA 1CZUA 2REQA 4YASA 3T7CA 3FNEA 2CF5A 4M9QA 2FEOA 1WHSA 4MDEA 5JANA 5E7JA 1WULS 2VK4A 2AUTA 2DFPA 2G0NA 3K70B 2L69A 3ACBA 4M0MA 3AM5A 2BF4A 4HFMA 4BZZA 3PB3A 4FMPA 2GN9A 1Z5OA 2IEBA 1NC1A 4HH1A 4I9NA 2HK8A 4F5DA 2FFRA 1XKLA 4CDGA 1RJDA 4JI8B 1K63A 2H9AA 2X13A 3GJXC 4FCTA 4L9WA 2CY0A 4UCWA 2PMEA 3DCNA 3WIEA 3ORHA 2WIAA 2QEQA 1QO7A 1KXJA 1YS9A 2MSLA 3V8QA 5LLDA 3VNVA 2FPPB 2QM8A 3NOOA 4IM7A 4NOMA 5JXHA 3P45A 2P4UA 4DA6A 4LF9B 5B57C 4ZEXA 4FZ3A 3G2IA 4CM9A 2QE7A 4M76B 2NU6A 2D1RA 1MG0A 4WDQA 3OPVA 2DTXA 2X23A 5H16A 1M2HA 5LBTA 3S0JA 4FE3A 3S2YA 5A9SB 1ML3A 4LGMA 5JSYA 2AKEA 2BTOA 4MR7B 3ZCPA 1NPDA 4TLCA 3HDJA 5AOCA 3TGPA 5EUBA 4QYIB 2P5SA 4AG3A 1FYDA 3PUXA 4LJLA 4DC1A 4YDHB 2BFAA 5AUPB 3N2YA 1GDTA 3CINA 1OUMA 4G1VA 4KQXA 2PRIA 4LV6A 1Y8AA 2NWQA 4QTZA 1WQ4A 1T3HA 2RC5A 4EMUA 3GLGA 2PGJA 4E11A 2N75A 4NZ9A 1YDGA 4CIBA 2IOFK 2YHAA 1OLUA 3W7VA 3PX7A 1KI3A 2JI7A 1C7IA 3T1VA 3ZXUB 1AH2A 3UT5A 2KB0A 1GZ4A 1I4DD 1Z33A 1R9NA 4IP0A 2QSUA 2CK3A 2OM2A 1QOPB 2QBYA 2QMEA 2Z83A 2IVFA 2B25A 1P0QA 3GW8A 4B8ZA 5JNRA 4G5OA 5EFZA 3T7KA 3WE7A 3JRNA 4A0GA 3LVFO 1T0UA 1QIIA 4L5BA 5FUVA 3VC3A 3B1KA 3P0IA 1TOAA 4MARA 4HDSB 3L77A 4R40A 3CRW1 3UMJA 5K01A 2NSLA 3MVEA 3REFA 5E9JA 3RI3A 4LRTB 4DMRA 5KQSA 2QHXA 4IBOA 4MS1A 2VSXA 1KAQA 3SF8A 3UF0A 3ZI0A 1ZMTA 3KQHA 3N5CA 1YBMA 3OCUA 4CEJB 5F3WB 3HWSA 4W99A 1QQAA 1WXGA 3CB4A 2E21A 4M2LA 5FL7D 3JQPA 3MWYW 4ZYVA 1C8KA 2QYOA 1XP5A 3D7LA 4PYRA 1V7CA 1FRFS 2OVBA 2WHYA 3I76A 4WA8A 1RHQA 2WP0A 1P31A 1EFRA 1Q74A 1QV7A 3GCXA 4IIVA 1NT4A 2D59A 1LCIA 3JPWA 1G8KA 3M7IA 1XD9A 1G59A 3DH0A 3ESAA 4YRKA 2ZCJA 1TT7A 4NABA 2RSLA 3KQSA 4G36A 4PLTA 3G1WA 1NN3A 1X0XA 3ZHRA 3EXEA 1CF2O 5EJ8A 2IVZA 5JO0A 4LFAB 3NP7A 2GEBA 4HVAA 1CY1A 2K2WA 1XC7A 2YYSA 3BGVA 3FPFA 3GRFA 3IV7A 3N7AA 4FN5A 4LSZA 1UOPA 4DMKA 4EWLA 3AFGA 3FWYA 4FMDF 3TCNA 1RRKA 1PL6A 3VNQA 1QYRA 4GKAA 4Z9FA 4MW6A 4ZA2A 1VTKA 3LE8A 1DAKA 1ODLA 1P1JA 3X1XA 3MIIA 1P6QA 2I9PA 4LHXA 2OQIA 1JKJB 1V2HE 2WSSA 3BKXA 2RG7A 2WSIA 4GXNA 4WLNA 4QM6A 4MKRA 5D5PA 4UE3S 5H81A 2QM7A 4B2IA 1X15A 2VAMA 3C8UA 4KXLA 3VPSA 4Q4LA 3TQIA 3KYCA 1OLOA 5IFKA 4B85A 2PVCA 5LDHA 1W34A 1L3IA 3NEAA 3HA2A 1E58A 1E0DA 4MK4A 2CMDA 3VBCA 1JDBC 1PQPA 1MB3A 1WB5A 2HA7A 1O97C 3NQ41 5T5QA 4JBXA 1PV4A 1HSZA 3VDMA 1KNQA 2W4MA 3OOEA 2IDKA 1EGAA 2R7AA 4HN4B 3WLQA 3VSEA 1TE2A 2QUHA 1G17A 1AY0A 1WF3A 2X22A 1GA6A 3IHLA 3OQBA 4RKRA 4WKNA 5FTNA 2AYZA 2B8NA 1BX3A 1REQA 2CJPA 3C2QA 1SBNE 3AETA 4Q21A 1IOWA 4RCZA 3T61A 3I2IA 3ES9A 1USWA 1J8YF 4TWIA 4R3WA 5IDXA 1O95C 2VNAA 4H4CA 2XYVA 4KODA 3V4FA 2J6HA 1WE2A 1Y37A 2E4YA 3DVQX 1QBGA 4BJHB 2PJRA 1T4GA 2V74B 3R3WA 3SE7A 1RVDA 2IA5A 4HK4A 1RKBA 1ECFA 1CQWA 1ZNXA 2O7SA 3D2BA 1KJNA 5LJIA 2HUPA 3KEQA 2X1HA 3COWA 2VPQA 5FCDA 1GLNA 2HLPA 4ZOLF 3UA4A 5C8DA 1Q0RA 2GETA 5J4VA 3ZZMA 3R7FA 1IWBB 2V7PA 3O75A 1B8PA 2GS9A 1A2QA 3USES 2O8DA 3ZWMA 4H15A 4WZBB 1QPGA 1LTQA 3ZXSA 3Q6NA 4Q93A 4F5ZA 5B2EA 1D1TA 2R68A 3O82A 4FYPA 3L6DA 1BHQ1 1O89A 4GZ5A 2IGBA 3AHJA 4MQ6A 1RQ2A 3PUIA 3RUIA 1QIGA 2CW5A 2ZE7A 2PX3A 5ALFA 4A91A 4RZ2A 4BGEA 2BYTA 4RE6A 2PN1A 2M32A 1CR1A 4KEAA 3AB7A 2ODAA 2P0AA 3SYNA 1NW4A 4R7GA 3AR3A 3G8AA 3I04A 4OQPA 3T1HB 5FJJA 2NSJA 4UQPA 3WGMA 2OBMA 4JT4A 3IHTA 3DEAA 4HH0A 1EESA 2AC2A 4L73A 4BNMA 3WJAA 5B1YA 2WVAA 5DULA 2IHVA 4JJAA 1DXOA 1QTNA 5TGZA 2ZUCA 3JARB 4NYMQ 3UENA 5JSHA 3JALA 5HZHA 4A6PA 1WHSB 1QK4A 2A67A 2DJ5A 1X8KA 4FC7A 4ERNA 3TLGA 4DV6B 1MZPA 1M5UA 2ZKIA 4YCDA 4FGWA 1BMQA 4JLNA 5I7RA 4KR6A 2DP4E 1S1CA 2HLDA 4N7BA 5FORA 2B8JA 4DKXA 5LIPA 3T1TA 1B8VA 2H1IA 2K87A 1H65A 4Q3CA 1Z4NA 1ZGZA 1QCZA 2AOUA 4I08A 2JI8A 2CE2X 1XDSA 3QNMA 1GNQA 5EVCA 4KTTE 1RM5A 5WRFA 3AVOA 3I53A 5CB4F 3L92A 3SBDA 4N47A 1KO1A 4JC8A 2C5EA 3A10A 2C5HA 1R66A 3PV0A 3ZBUA 3E1SA 2NXNA 4J90A 4PANA 1F51E 2XUFA 4P92A 1PNVA 1GQOA 2XMGA 3I2YX 5CJJA 1CZNA 3IIKA 2PD6A 4M1WA 4J0FA 4YNBA 5B6JA 3LYHA 1B6GA 3KNZA 3FNQA 4GOJA 3EQZA 5AVTA 4KRFA 1WMDA 2KBFA 1NXVA 1WRBA 3U7FB 3O8BA 4PSUA 2VT3A 3DE2X 3K72B 3BAFA 4HTFA 4I50F 4NZYA 1KU0A 1T15A 4RY0A 3UOGA 4CF3A 3D31A 3SVZA 4D9CA 3HGTA 3F9CA 1B2LA 4QUIA 1Z6ZA 4F1WA 2HCBA 4U7GA 1JHZA 1JQKA 3JTEA 1GL6A 1LVUA 4LXGA 1OLUB 3HGMA 1SCUB 4H18A 2AV6A 1I3CA 3DT6A 4O4HB 4ZOAA 4TS3A 3KPJA 3U81A 4PIVA 3UATA 3VKVA 1OXBB 3FFTA 1ODTC 2EDAA 5FL3A 3UMYA 5AM3A 4ND1A 1ZJ4A 4BKQA 5GJCA 4A8JB 4CF5A 3A3YA 1L4KA 3UJCA 1OHHA 1Z17A 2B8WA 2GN1A 3EUEA 3P0HA 3EZLA 1HDEA 1L3BA 5BWMA 1NUPA 3EHDA 4RBNA 2IOHA 3EIXA 4I19A 3B9PA 4HDSA 4Z53A 2QX7A 1A97A 3H1AA 4RSGA 3S99A 4HQOA 4DL9A 1XRQA 4BBPA 5JS1A 4EQZA 3QK7A 4AZ0B 2IZ6A 3HCBA 3MUNA 5TMEA 3RRFA 1CSEE 1UKAA 1U6JA 5JS6A 3ZQUA 4MDHA 1G8MA 121PA 1XFDA 2AX4A 2NTVA 2WIJA 3HUTA 3OJWA 3DQZA 4U8HA 4ZREA 5F23A 1NAHA 1YCHA 1MX1A 3P2KA 4G8JA 4HZUA 4OHRA 4PX3A 4LWZA 4CMIB 1CIPA 1DTEA 3C5CA 3ZVKA 1DQZA 2VDPB 1KFJB 2OV8A 4RM2A 2JGRA 1MR3F 4Y8VA 3DBLB 2NZUG 3R20A 1N8TA 3LC7O 3HVIA 4L4ZA 5BYAA 3AZOA 4G01B 3HJUA 1F5SA 1ZCFA 1XEXB 2WM9B 3PR2B 3SZGA 4BQOA 3EEFA 1ZK2A 2ACKA 2WZDA 3V7NA 4N41A 2NYUA 1JT9A 4K9RA 2ON6A 4IGFA 1MV5A 2H7VA 2ONYA 4EYOA 4JFRA 4R1TA 1BHSA 4LYHA 3ZQJA 4I5GA 1OPRA 4XI9A 1Y9ZA 4X1IB 5HOEA 1KP2A 1LC3A 1M6YA 3IQGX 3EFOA 2LRHA 4IHQA 4UU7A 1ODCA 1MEEA 4ZKEA 3WWEA 3ZZ1A 3GGGA 4BNVA 4GEGA 1E8MA 4BNWA 5IC6A 4YVFA 1C9YA 3DFZA 4S1TA 4BAZA 1KE2A 2PUFA 2ZUSA 4BVEA 3N2GB 3AJRA 3RREA 5C51B 1T36A 2Q5EA 4MW4A 3L6UA 4C4ZA 2FPKA 3Q0TA 4LY0A 5FAXA 1XJ0A 4YMHA 3OEEA 1E1CA 2RHBA 2BDUA 2PS3A 3WL5A 2EKPA 4L2IB 1CRQA 5CM8B 4FHCA 2DBZA 3GT4A 3N9IA 5JNSA 3GFBA 2OT3B 4FU0A 1XZCA 5T8KA 3WA6A 2J0UA 4M6WB 1UPXA 2KMLA 1D2RA 4JX8A 2ZT6A 4OI4A 3HKDA 4OXXA 4TMZA 5MHTA 2AN4A 1XMQB 1CUGA 4HXYA 4OXIA 1DBIA 4U2DA 1LTKA 4YUYA 3U44B 4MNTA 5CHYA 1FNBA 1H2EA 1TM4E 5ALRA 3B3GA 2NZYA 3G6KA 1YUBA 1ZM4A 2AXEA 2CDAA 3RJZA 1XTBA 3NT2A 4FVTA 5G1OA 3M3PA 1NM5C 1E2QA 1WG8A 2Y2VA 5K6TA 3SFVA 4N8DA 3T7TA 4YJ2A 1U5AA 2E5FA 2QRJA 4JI2B 1T5DX 3WL3A 3HWWA 5TARA 4JQZA 1LLUA 4R2XA 3UCFA 1MJNA 5B7GA 3AB3A 3QE2A 1UK9A 2GNOA 1A2OA 2CHGA 3VU0A 3FBGA 4A8JC 3AP3A 2BTQA 3SZOA 4RPIA 2YYYA 3CKYA 2OXFA 3ABOB 3G0DA 5DBGA 1N9GB 1YSCA 2XMDA 5DLYA 3FXAA 3ZU2A 2BR4A 4AWXA 3PCTA 1QIKA 1S89A 4J16A 5IUNC 4I1VA 2AC7A 3AEQA 3ONNA 4QYIA 1UDCA 1U2DA 1EK5A 2NG1A 3CLVA 3WKCA 2XWQA 1F2VA 4CM4A 4XIYA 4YV0A 3KQVA 5TB5A 2FTKE 2ZQ5A 4JSYA 5FOSA 2ZANA 2PUEA 3L05A 1C4WA 1IN4A 2YY5A 3NG1A 2DFKB 2NVWA 1OBCA 3MGGA 2B4RO 3H19A 5HCNA 2IPNA 3T94A 5AW5A 1SIOA 3IEVA 2GOYA 1KYIA 1H2AS 1Z6XA 2GN4A 4WLFA 3K1JA 1LB1B 1NQTA 1YDMA 2LTAA 1JR6A 4Q4JB 1NQVA 4X00A 1KMNA 5UKDA 3V48A 2M2IA 4AJEA 5KOJB 1N2IA 1CV2A 2SKEA 2PXCA 4KN9S 5FTWA 2ZTVA 4HADA 3LFTA 1QF7A 2R1ZA 3LZ6A 2QDXA 4KQJA 3QKSB 5KVQA 1XKXA 4URUR 5A6SB 5LBUA 4YRMA 1KBOA 3SD7A 3U4GA 3HDYA 1AUPA 1DG1G 3IEIA 3FTFA 3SP1A 4L6IA 1XLVA 4BN0A 3MG9A 3TD2A 3GJ3A 4EJMA 1YJAA 3NH9A 3OU6A 2QGFA 4EY7A 1YRLA 2XRYA 5BURA 1IZYA 3OIDA 4DPLA 1YZTA 1D1QA 4FLEA 1VHDA 1ZVMA 2HO5A 1S96A 1N7HA 1W581 1I3LA 2PAAA 3EQ2A 4UD2A 3G79A 3SYTA 3V7FA 4BTLA 1XZHA 4CEJA 1E2LA 3D5TA 5KREA 2QR5A 1MGPA 3PYLA 3UV3A 1EJBA 4HGQA 1JALA 4CMJA 2HJSA 1IBKB 3OIYA 4KFRA 4W1RA 2MYTA 4US1R 3RUAA 2V4UA 1IY0A 3RC7A 3DAYA 1L6RA 1PR5A 2JCXA 1CB7A 1EVQA 3E5NA 3I6MA 1TRHA 3P96A 3RYCA 4MV3A 4DG8A 1B3RA 3NV7A 3ICPA 4N0MA 4YHBA 1MC5A 2A0UA 1KARA 4R5MA 2FDCA 3CUSA 4BVJA 3NBZC 1G7SA 2R8PA 2XCUA 1QWSA 2HSDA 2OY0A 2ZYVX 3AONB 2XQKA 4RHTA 1SVOA 3OM0A 4WTOA 5LP6B 2J6CA 1XDGA 1W94A 2PGLA 3UFXA 5BSWA 2DUNA 4IZIA 2QTBA 3W6NA 1K7EB 5DCUA 3GEIA 3FUXA 2D1TA 4Q82A 1QRSA 5KYWA 4BMOB 2JKVA 3IEPA 1CUWA 2HXGA 2EQAA 1NTOA 1YS7A 3LQ2A 4GT1A 3KKLA 3UUFA 5BV2P 1NIPA 3ZE1B 3W0LB 5ALLA 4CI0B 2NLOA 3NRCA 2CDRA 2QG4A 2VXCA 3QWBA 1YR9A 2P9ZA 4X65B 2ZSUA 1J09A 3ESBA 3QX8A 4LC0A 4Y9UA 1EUZA 1D5CA 1TZCA 4MW2A 5HFJA 4B46A 5CVJA 4UOEA 1JLMA 1AF7A 2NZVG 3OD5A 4RK5A 5C35A 1R8XA 4CQNA 3K9QO 4E14A 3IP7A 3RRJA 1Y7IA 1IM8A 1CULC 1DG9A 1JWBB 2X0KA 3GLSA 1AVTA 2JRCA 3OCVA 5EIWA 3FWKA 4BKPA 1QH9A 4BPRA 1N2EA 1JLHA 3D2CA 2QRKA 4GW3A 4ME6A 3EVDA 3CCFA 4NMHA 1CIVA 1N92A 2VH1A 4RCYA 4YWHA 2ZS7A 1XDUA 3U9TA 4DANA 4KO3S 5CURA 5DRYA 2ES4A 1W48A 3QPCA 2Z2KA 2IV3A 3DAFA 1RRPA 4F5WA 1P7ZA 3IBTA 2R8ZA 4X24A 2PYIA 5DBEX 2J0VA 2OHIA 3TG8A 1P1BA 1SBCA 3VR6D 1USIA 4LE0A 2Q4RA 2HRCA 1EB8A 3MBIA 1ZIXA 3PI7A 4ZCQA 4DPKA 4NYJR 1IU9A 2V65A 4J0CA 4C7MA 2GWHA 2OO5C 5JS8A 1CR6A 2JGKA 2SHKA 4H7EA 4TYMA 5ICFA 4V03A 3BWMA 2RBKA 4MUBA 4M9CA 4XWOA 4DVGA 2GUWA 4IHKA 2R6GA 1EVLA 1ZX1A 2O5VA 2ZFUA 2ZAYA 2ZBPA 4OAOA 2Q6VA 1NVAA 2QRZA 4BNUA 1E2EA 4OBXA 3WR5A 2DQYA 1NJGA 2H52A 1DCMA 1II0A 3PNBA 3PRHA 3GRKA 3L8CA 3R0QA 2EKQA 4MV9A 3WK6A 3FIUA 1KFCB 2GM9A 4MVJF 3PFCA 4W82A 3VNAA 2EW1A 1T3GA 4U7DA 1AB5A 1NMZA 2MDTA 2RI0A 3LX8A 4GNKA 2JLWA 2IYPA 5IDVA 3RRMA 4Z5XA 1RKUA 1BVYF 3BL6A 1HORA 3DDUA 4G4SO 4WMLA 2H1FA 4MJ7A 2NO1A 2A94A 3DPIA 4L28A 1JBEA 4OXRA 3BB1A 5FYDA 3HQ4O 4EITA 4E5UA 1IONA 4Q3EA 3PZBA 4UUPA 1U9IC 4TXMA 3VZDA 4PX9A 3NFRA 1ST2A 3L7AA 1RWOA 1UL1X 2DETA 4OU5A 1Q15A 4CKCA 4N1AA 5TC4A 5JMWA 3RJ9A 1QNFA 1QHHB 4R16A 3TKAA 1QZ3A 2C31A 2EGGA 2OP1A 3LHIA 4ISCA 5GONA 5H3LA 1S02A 2QPOA 3Q8XB 3RVMA 1CDZA 4ZJPA 2UUBB 3TH5A 2RHHA 5DZSA 1JU4A 1XZIA 4MCHA 4LJRA 1G16A 4BP8A 2H4HA 2FZLA 2OB1A 3AIIA 1NE7A 1T9DA 4MYHA 2G9RA 4OJNA 3GGDA 5KYTA 3VR2D 1CR0A 3M4NA 4X92A 3EGOA 3EQ8A 3OQPA 1RYBA 4L4RA 4QDUA 3ZE2B 4BMNA 2C97A 5KZMB 1UMBB 1P6XA 3FZQA 1CUCA 3S1LA 4EJFA 1RXVA 1ETHA 3A1SA 3PUJA 1SCKA 2QN9A 3OT1A 1Y80A 6CHYA 1PIWA 1YZKA 2BD0A 2W00A 2RAVA 3G6WA 1YBFA 3IMFA 4QGFA 1DOAA 4RD0A 2C4MA 4L5CA 2Q50A 4TRNA 4YJHA 5DHRA 2O2YA 5L53A 4N4AA 3L46A 5HF8A 1QQ6A 2A0KA 2CHUA 3WDLA 3K70D 1T0HB 2VQFB 5JRDS 3T38A 3IAS6 2GF0A 1JG4A 4PIPA 3GHYA 4E33A 5AO9A 4OSEA 1EP3B 2HQRA 1WO8A 3L5OA 3L9XA 4NK4A 2DLCX 3CE6A 1MW9X 5YASA 3DQQA 1KZ9A 3CNLA 1ZAYA 2ASEA 3O91A 3AVVA 1ZXXA 2NPIA 3UV6A 4EEZA 2FPWA 4X0EA 4CHGA 1CXZA 4YJGB 2WSLA 3VNRA 1P3DA 3OQ1A 5AIAA 1W85B 3WQRA 4EAQA 5TT1A 2JHFA 3V55A 4OHMA 1IBMB 5BQFA 4BCDA 1QMPA 2ZB3A 4IH4A 3U7QB 4D9FA 3BJEA 4TZ6A 1CY4A 3ME5A 5KOJA 3ZBQA 4ENUA 1M3SA 2PT7A 4EBBA 4YLYA 3F3YA 4L07A 1MJGA 1J39A 2P30A 3F5QA 5LUAA 5IK2A 3COZA 2SICE 4M7PA 2BKUA 4DXAA 1VCIA 2AQIA 1EP2B 4YQZA 3QTBA 4V0KA 2PS9A 3EVZA 1K7FB 3DW3X 4ILKA 1L4FA 3KFLA 3PQ6A 4OQQA 5C8YF 1QDEA 2PR7A 4A26A 5C5DA 4BC1A 2FN8A 3FOEC 1ZW1A 1ZC3A 2BOVA 4W5HA 2L2QA 3AK4A 5HIJA 2HH9A 1A7UA 4ESEA 1UIRA 1GVNB 4RVOA 4PICA 3ZV3A 3FNBA 3N70A 4GL2A 1U63A 3QF4B 3A05A 2PLRA 3AEKA 1XWFA 3AF1A 1R27A 4KDCA 4QXOA 5SY4A 3LU1A 1BEZA 1RPZA 1IVSA 2VYFA 3UAYA 3GRVA 4C7KA 4FYYA 2VK8A 5FWXB 5K0BA 3UCXA 3L7OA 1F8XA 4G5FA 1Z82A 1TVMA 3L4SO 4OOFA 3UHAA 3U09A 3KHKA 3ZWDA 4F2DA 3IMEA 4JVOA 3BD6A 4U7JA 3OECA 1A9XA 1UJBA 4TT8A 1X86B 2BHSA 1H2XA 4Z8XA 3SSNA 2FX2A 3ERCA 2IQIA 4PPYA 4KYTA 2WVHA 2GGSA 1D4ZA 3A4NA 3ZX4A 3WYDA 3ZIUA 3H04A 2N9UA 2Q3LA 4MX8A 3ADPA 1F06A 3HXKA 1W19A 3PGKA 4ENPA 3TN7A 4DABA 1EKXA 4XYMA 5E8JA 1F3OA 1WF6A 3D6VA 2IIPA 3H9UA 2ZZMA 4G0VA 1X7DA 3A6DA 4C0HA 4DY4A 1V8ZA 3KLNA 2ZB2A 3O0TA 4UVGA 4DN6A 4YXFA 2HADA 5BYKA 3BCUA 5BRNA 1EM8A 3WWZA 4ZEVA 1LLCA 1WX1A 1V25A 2EEPA 3X0DA 3D4NA 5J2TA 4LOAA 3L1UA 4JASB 1R50A 3QVVA 1DELA 2HBQA 2HSWA 2WMOB 1NNI1 5EVJA 3S2IA 2V9CA 4RZUA 4AT1A 4B6GA 1U0BB 4IZ6A 4JVLA 4ML3A 2AXNA 4N54A 5CU7A 2YW9A 3UOWA 4GUDA 1C81A 4QX6A 1IEVA 4HG2A 4BV8A 3LQYA 2JBAA 1RDFA 2O2IA 3V1MA 5JZVA 2M6RA 3DB2A 3QUCA 4IHJB 4TWRA 3F4LA 2G07A 1SCDA 2K7ZA 4WKBA 4Z1OA 1XF1A 3NDIA 4RORA 5BPHA 3FMFA 1C9NA 3EG9B 3EQ9A 1JB1A 5JTUA 1KYYA 3D3WB 1CW2B 5AHWA 2C9BA 4A2QA 3FCCA 3T1QA 2QTZA 5A3JA 2ZZKA 3REQB 2FHPA 4S3MA 2PQ6A 1OSNA 1YQWA 2SCUA 2Q9BA 4NAHA</