3LW7A

The crystal structure of an adenylate kinase-related protein bound to amp from sulfolobus solfataricus to 2.3a
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
177
structure length
170
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an Adenylate kinase-related protein bound to AMP from sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Adenylate kinase related protein (AdkA-like)
total genus 65
structure length 170
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw7A00
5L3QA 4R7ZA 4HLUA 3WBKA 2O8EA 1MR3F 4BRUA 3RRYA 1OFIA 2PX3A 5FBVB 2QMOA 3IIJA 4MRNA 5KUTA 3GLFE 3RDPA 1E2IA 4L9WA 3BS4A 4BQSA 2G9NA 2I1VB 2ZR7A 2F7SA 2MMGA 3TSWA 1MABA 2AKAB 2WJVA 4C30A 1YZLA 1Z6YA 4WZ6A 2NO7A 4R2IA 2VP6A 4MYHA 3BIFA 1II8A 2QTFA 1N0UA 4L8GA 5EE5B 4YMTA 3H86A 5L3QB 3HP1A 3BB4A 4NYIQ 2V54A 2AKYA 3H0KA 4BEBA 1HV8A 5FR1A 5KSZA 3I1FA 2GEDA 3KFXA 4M0LA 5KDLA 4ZCMA 4TLDA 1Q57A 1KI3A 1U8AA 3OF5A 2WWIA 3PCRB 4QBHA 3FKSD 1U99A 4B2PA 1ZD8A 2XB2A 2GCOA 1OFTA 4N0DA 3BJIC 1XEXB 3V4RA 3QXXA 4B3FX 4M1TA 4EUNA 3A6PC 4JT2A 3FPAA 4UJ5A 2BM1A 4UNNA 1JAHA 5B57C 5JS7A 2R6CA 5KO2A 3I8SA 2NZ8A 4LX0A 1NJGA 1XD2A 3U3MA 1M8PA 3TGPA 2W83A 2F6RA 4FMBB 5SZHB 4URZR 5EP1A 3UMSA 3TKLA 1OKKA 1I4LD 2NOAA 2BKEA 2P5SA 1KAOA 4A8JB 1PJRA 2ZROA 3KQNA 3OEHD 3SN6A 4HB4A 2OESA 4PAMA 2R8RA 5JMTA 5FTKA 2PEYA 2FG5A 5CM9C 3WBJA 3C4JA 3AKDA 2ZAMA 1SVLA 1M2OB 4JVLA 2DWPA 4LCBA 2GTPA 2GJ8A 3NH9A 5G3ZA 1J99A 5SZJA 2UZIR 2PT7A 3IHWA 1Z28A 4DLXA 4TMTA 1BS1A 3PITA 1XCMA 1Z8FA 4H9GA 1N5IA 4GI7A 1FNNA 4TL7A 3A1WA 4YDHB 4BFXA 5BN5A 4I1OA 3B9QA 1E2HA 4HLQB 4OQFA 4PZZA 1ZM4A 4BZQA 3A1UA 3ZGXA 1KDPA 2CNWA 1RRPA 1Z5ZA 1Z2AA 2CLCX 2JLUA 3BOSA 3WMEA 3QXHA 1VMAA 5TMPA 3AVYA 3UK6A 2ZE7A 1KSHA 3QF4A 1SXJE 1ZM2A 4G0NA 4IVPA 3K09C 1XD9A 2IUSA 3QXJA 3LVQE 4AD8A 4FMDF 2VF8A 3ICEA 4QC2A 3GLGE 1GAJA 1HT1E 2CJWB 2OCYC 4H1VA 3SJCA 1F3OA 2D62A 2FEOA 3PV0A 4TLAA 2BIFA 3KXKA 4KITB 3PEWA 3CWQA 4KFTA 2ZSFA 3IDQA 3FDIA 4YXWD 1YZNA 2O5VA 1Q1EA 2RCNA 1XXHA 2WVJA 4ZI3A 4IVQA 4CVNA 2OG2A 2R6AA 3ECCA 1FTNA 4B3XA 2QZ4A 3KFVA 1A5TA 5AK0A 3NIBA 1MO3A 2RH5A 2Z6VA 3W5IA 2FPLA 2ANBA 4D0NA 2J5XA 3FHCB 4RVCA 2D3WA 3RSOA 2VA8A 3LFUA 3K0FA 5K8UA 4JLBA 5CB8A 2ZJAA 3SI7A 5EP4A 1H65A 1S96A 3CRMA 3M0EA 5C46F 3WHKA 3AEZA 2ZUCA 3RLFA 3VHLB 1KK3A 2O8DA 1CTQA 1RYHA 2YJTD 4Q48A 1SVWA 5DI9A 3N2EA 1GWNA 3N2IA 1Q1QA 1ZAKA 3RC3A 3MJHA 4W5WA 3V00A 3NVAA 2OBMA 3BGWA 3AV0B 4PC6A 3UATA 5L3SA 2CCKA 4JL5A 1JQLB 2IBMA 1P9RA 2NO0A 3W5JA 4DLTA 4P32A 4PO8A 4B2LA 4B33A 4DSUA 1VECA 3VKWA 2R9VA 5CK5A 2FSGA 3KB2A 4FW9A 1L7VC 1IONA 3CNLA 3OIUA 1TF2A 5IRCD 3K9NA 3L0IB 1YZTA 2VH5R 2V6IA 4HUQB 1KI7A 2GWHA 4Q66C 3WMGA 5IT5A 3M1IA 2ZYTX 1W36C 2JLQA 1T8UA 3U7FB 1GNPA 1KY3A 2EU8A 5JWOA 1SKYB 1ZIOA 5FOVA 4BFVA 3RHFA 5G3YA 2D2EA 2V1XA 1G17A 1HH4A 2N1BA 4TQAA 4Q9JA 1OH7A 2IEYA 4EPYA 1F2TA 1ZBDA 3REGA 3VKHA 3UG7A 3BFXA 1SXJA 3EC1A 4CF7A 1E0JA 3ZIAA 3CB4A 1E2MA 1WXQA 3Q9LA 5J40A 3ZVNA 4DC9A 4A2PA 3OFND 1UBFA 4ASUD 1MO5A 2ORWA 1LY1A 2GJKA 2W6IA 4WA7A 3THXB 4MRVA 3SNHA 1OH6A 1G18A 2WV9A 3I92A 5L3RA 3KKQA 4A15A 4IOMA 1J90A 3LXRA 3ZLJA 2CJWA 3Q72A 2ZI4A 4YC7A 2WWYA 1XTQA 4MRSA 3TBKA 3VAAA 2XTZA 2F1IA 2ODWA 4TT3A 4RD4A 1NBMD 3SR0A 5FTNA 1NLFA 1Z08A 1P75A 1X1RA 2A5YB 2GAAA 2Z0MA 4LSGA 4BZPA 2AXPA 4E07A 4DDVA 2O8BB 4IDOA 4M8NE 4B2IA 4OK3A 4O25A 4E09A 2C95A 4MDEA 2ZANA 2C9YA 5FOXA 2CHVA 2WJGA 4FWIB 2FF7A 2GJAA 3DL0A 4CEHB 3EPJA 1W1WA 4U5XA 4JZKA 3VR1A 2KWIA 4Q1DA 3G82C 2ODNA 2RKOA 1N6OA 1IN5A 1ZNZA 3K1JA 3GP8A 4CW7A 4V0OA 1W46A 1MO4A 4LK2A 1UEIA 5FOWA 3ETLA 2N42A 2JLXA 4IFBA 1Z6AA 3H1TA 4PHTA 1G3IA 4O3MA 2TMKA 1E3MA 1HTWA 1EFHA 1S1CA 5HE9A 2ZIAA 4A2WA 5KU1A 1CF4A 4EFMA 3MWYW 1L8QA 4JVNA 1FP6A 4NH0A 3K0EA 2BBTA 4ZIRA 721PA 5LBIA 1RVDA 2Q3FA 1NSFA 5CDFA 1SVKA 1PUJA 3FGNA 3KL4A 5JCPA 4II7A 4MGYR 1WP9A 4LJ7A 4RCZA 4XVQA 2V3CC 2GBLA 2FNAA 2WHXA 1EFTA 4N1AA 3DKVA 4EQ6B 2V7QD 1YZQA 5HTKA 3U7HB 4IKEA 3ZH9B 2WJYA 1Z3IX 2RGXA 4NPHA 3RYTC 1Z6GA 3ZD7A 4TYYA 1O87A 2N46A 1R0YA 1DO0A 1UM8A 4PPNA 2RHMA 2HEIA 3RRNA 2GVDC 1AZTA 4UNRA 3IPXA 3HU3A 1K5GA 4OJQA 1A4RA 4AK9A 4HLDA 3T35A 2UVQA 1TX4B 3U3JA 2G3YA 3CZQA 2PMDA 2ZSBA 4YMUA 3T1VA 1WMSA 4LJYA 2EQBA 4LBWA 1ZIPA 4ACBA 2H1LA 3FHOA 3EPKA 3D3QA 1DAIA 1H8EA 1KO5A 4A82A 5C4MA 3AVTA 4PO1A 4FIDA 5LB2A 3K0CA 3SFZA 4JJZA 5FBLB 1CR0A 1KZ7B 1XJQA 1DADA 1RRCA 2HT1A 4DLYA 4AC9A 2DFLA 3UXMA 2IWHA 2A78A 3I32A 3DEFA 1E9AA 3HR8A 3PUXA 3NG1A 1DO2A 2HXSA 5AUNB 4TWZA 3GCGA 4F4JA 5J4VA 2NMVA 3TW4A 3Q7PA 2HYIC 3B5JA 4UXHA 1T3SA 3DOFA 2IYUA 2RGBA 4LBZA 4F38A 4DLZA 5ELXA 4QFMA 3R8CA 4OI2A 4OQMA 5JJKA 2PCJA 4RZ2A 4CEJB 4C4PA 1EESA 2OLKA 1CBUA 2YWEA 1L2TA 1Q0UA 3OEED 4KSBA 1KO7A 4C0SA 2WAXA 4N0EA 4FXPA 1DAHA 1R6BX 4IW3B 1U81A 4ZV4A 2CLSA 2WSSD 3T1OA 3WYFA 4BWYA 3FMPB 5KSYA 1GL9B 3FKSA 5FOUA 4CIDA 3SOPA 1N6HA 2AK2A 1LW7A 4EPXA 3GLIE 2E87A 4K8OA 2ZI5A 1AS2A 1DS6A 3Q85A 2L0XA 4IXNA 4OK6A 1S2MA 2ZJZA 3O8BA 4LC1A 5F2EA 1IBRA 2IXFA 2VEDA 4QGGA 1ZU4A 2FSIA 1LF5A 2WJIA 5AJYA 1GIAA 4E22A 2GZDA 1JECA 4RD3A 4EJSA 5KDDA 3K9LA 2BMJA 2ORIA 3QIAA 3THWA 2ZETA 1OE0A 2ZYVX 2FFQA 2IT1A 1WBBA 2QEQA 1V43A 2O8CB 2X2EA 2I3BA 4XWOA 2VBCA 1PLJA 4AI6A 1OT3A 4DXAA 1T3HA 4BUJA 3VU9B 4XTRA 4DB2A 4DSOA 3CX7A 2AWNA 4TLBA 1XPUA 3CWZA 3A37A 3A4MA 3D7MA 3RRZA 5DH9A 1G1MA 2OFOA 3QE0A 4XWKA 4TL6A 1KMHB 4HAZA 2JLZA 2KBFA 1S3GA 1BKDR 1CJKC 2PZEA 3ZVMA 1XJCA 4KFSA 4RD2A 4RFSA 3RRMA 2W2TA 4HDCA 2B8TA 3CM0A 4LV6A 2QRNA 2F1HA 4DLSA 2IA5A 1JB1A 3DM5A 2VRWA 1DPFA 3IEUA 5GJBA 3RANA 3VMFA 1E9BA 2R44A 1FP7A 5HKKA 2IUTA 1Z47A 3KX2A 2IYYA 4DDTA 1MOZA 1MH1A 5HCNA 1E1QD 1M74A 2AHOA 1YR7A 3TVTA 1Z0IA 2KB0A 4HZIA 4OQXA 2GXUA 4M1OA 3P4XA 5H70A 1VCIA 3CLVA 1PUIA 3FTQA 3MUFA 5EE3A 4QOSA 1W5TA 4A92A 3TK1A 1E9FA 1QVAA 1D9XA 1X86B 3GPLA 2FJUA 3K0CC 2CBZA 1JR3E 2GETA 2FWRA 1KYIA 1VKJA 2ZI9A 3LW7A 1J8MF 3EA0A 4BLTA 4YXWA 3L2OB 4Z8XA 4ZKEA 4G5QA 1XXHB 1VCMA 1JEDA 4DCNA 4QRHA 1OPXA 5FI0B 1UDXA 1Z0DA 2B8WA 3QEOA 3NDBB 3ZZTA 2EYUA 3QOFA 4QNMA 1X8LA 5FI1B 4DLRA 2R6FA 4HSEA 3NXSA 4TTQA 2XEXA 1J7KA 2HYDA 4PSVA 1NVXQ 1N0WA 4ABYA 1NRJB 5K8TA 1P2SA 1P3JA 2VP9A 1P62B 2ZRKA 4LJ6A 4MRRA 3TRFA 5EJEA 2DCUA 4ESHA 1Z29A 2QTVB 4F4CA 3SYNA 1IN4A 2H16A 4F91B 4GMXA 2PZFA 4TN1A 4DCUA 4EPWA 1FQKA 3CZPA 4TLCA 4BFTA 1VTKA 2FZ4A 2ZU0C 3PUZA 3OAAD 3ZVRA 2WJJA 1QRAA 2GXSA 2QM8A 4PHFA 1L4UA 1U9IC 3DKPA 4P4SB 3U44A 1II9A 2HLDD 4C0HA 1BIFA 3B1WA 3WXMA 3Q3JB 2IL1A 4P0TA 4EFLA 1DAFA 4AKGA 1DAGA 3THWB 3ZQJA 2D74A 2QMHA 4V0LA 1P4SA 3F5FA 2HJGA 5IDVA 4B44A 1G7RA 1JPJA 2O8FA 3ADCA 1VG0B 4UNPA 2P6RA 2ZE5A 1FX0A 1G6HA 2UKDA 1J8YF 5EXPA 1QF9A 4Q18A 1OYYA 1DAMA 4NMMA 5JCZA 2VP0A 3QVVA 1ZYUA 4Q4AA 2HF9A 4KI0A 221PA 3RNLA 1WF3A 3GJ5A 4FINA 1SXJD 3VR4A 1NL3A 2IS1A 4EKDA 4RFSB 3B1VA 4WBSA 4OI4A 2W00A 1LTQA 1VYTA 2JEOA 1XCPA 3CIOA 3QF7A 4Y0AA 2O8FB 1S4QA 3EG5A 3TE6A 2QU8A 2ZJ2A 3FMIA 3HYTA 1E69A 1KSJA 3ZZ0A 2WAYA 4AYWA 3LQQA 3VTKA 4M22A 2WOOA 4Z1MA 4NKRA 4ZCIA 4Q9KA 4M9SA 1ANKA 4LDJA 1EX7A 3KB1A 1BOFA 2ZJBA 1C4OA 5B2ZA 4TQ9A 4GDFA 3W8NA 1ZNWA 2F3RA 3ADDA 1ZRHA 4QBIA 2AX4A 1IXRC 4OI0A 1Z06A 2AD5A 3FVQA 1RW4A 5FOTA 1I4TD 4CYMA 3KJHA 1NBMA 1FQJA 1LNZA 4X8OA 4L9SA 3IKJA 1XZPA 2H5EA 3THYB 1Y63A 2DFNA 2FPMA 2J7KA 3AGPA 2LKDA 3FHTA 3HPRA 4MH0R 5C2JB 4AURA 4B3GA 1OXXK 4D4KA 5CDFE 1AJEA 4OHZA 2XJ9A 2ZRCA 4JLDA 4KO8A 3PIRA 2AN9A 3QG1A 5IHPA 2PJRA 3ADBA 1KSFX 3BERA 1E2FA 2YZ2A 3WNBA 3VU9A 4IEEA 3CX8A 5DO9A 1P72A 1GM5A 3Q5DA 4HDQB 1TU4A 1E99A 3UG6A 3BFKA 3KQLA 3KKMA 3RS2A 5DI3A 4JIMA 5JSZA 2DWOA 2IEZA 3HU2A 2ATXA 2VF7A 1VDZA 1W0KA 1X8KA 3MCAA 1GILA 2NO6A 4QBGB 3LQRA 2YWHA 3B1YA 2W2XA 4IDQA 2F55A 2IHYA 1AK2A 3TMKA 1YJ5A 2QP4A 4AG5A 1OXTA 5J4LA 1RC8A 3TIFA 4A6XA 5FL7A 5EE0A 4XVUA 5A5GA 3W6NA 3BRWD 1RPZA 1E1RD 3R8FA 1T91A 2X2FA 1ZNYA 2DHRA 2NG1A 3GEIA 4W7SA 4DZZA 4IOLA 1UF9A 4I4LA 4M4SA 4Q01A 3M4YA 1EFRA 4S2EA 3BXZA 1KDOA 3NHAA 2PX0A 3KKPA 4MGIR 1E2EA 4PC7A 3X1XA 1IN6A 2AK3A 2EWVA 2ZRAA 5DN6A 2F1RA 1G16A 2QL6A 4N3NA 4ZCLA 4C9BA 2VL7A 4LRWA 3W6PA 4NYMQ 4PAOA 5GJCA 2VHJA 3LX5A 2WJHA 3CNOA 1DE0A 2OCBA 3L82B 4KSCA 3C16C 1N6PA 2C5LA 2P6UA 1KGDA 4QXAA 2KE5A 4XJXA 2EFHB 4NYMR 2KI5A 2GCNA 4JLVA 3SYLA 1Z6TA 2A9KA 3KJEA 4JLNA 4NU0A 1JQJC 1G5PA 1VG9B 2H57A 4P4TA 4BASA 2NO1A 3BD9A 3KXLA 4FMDB 4EDHA 4LHZA 1E94E 1E9SA 3EXAA 2XOKA 3LNCA 1CR4A 1N6KA 1NLZA 2AL7A 2QAGB 2GCPA 5D3MA 3MG9A 3EPLA 1E0AA 2V1UA 2FX3A 2ORVA 2VP5A 2ZRJA 4PR0A 4UNSA 1G3MA 2K5UA 4FCTA 3SJBA 2IYWA 3WYAA 3H4MA 3ADKA 2DFTA 1EXMA 1Z63A 3GLFA 3GLGB 2P3SA 3WP0A 4HAWA 3I62A 3ZVLA 5HZHA 4GZMA 3U6KA 3RS0A 4LPKA 5HCIA 1N2CE 4P4SA 3U44B 1EWRA 1M7GA 1SXJB 1TF7A 2JASA 2RAPA 3BH7A 1NG9A 3SQXA 2NPIA 4D81A 3QUSA 1SKYE 1CJMA 4GPTA 3VNUA 2CHQA 3PVSA 5HE8A 2YV5A 1NN0A 2WWXA 1BMFA 3NBFA 5GVSA 4H1UA 1NIPA 3WNCA 1WCV1 4Z1MD 1PLKA 3IBYA 3THYA 4QM6A 4YQFA 3GJ3A 1ZC4A 3KDSE 2DB3A 3T1TA 1KY2A 4X8MA 4TMXA 5F3WB 1OV4A 2GZAA 1NY5A 2ZJ5A 5KNDA 1DOAA 2FMXA 1PVOA 1WA5A 3L43A 3IILA 3NBZC 4HAXA 1N3BA 5E7MA 1GG2A 3VR3A 1COWA 5JEDA 4OHXA 4Z8YA 1MO6A 3TNFA 4JJKA 2NZJA 2EFEB 3E1SA 5AJZA 1AQYA 3T61A 2XXAA 2JLVA 4JBWA 1B23P 1EGAA 4JLJA 1T4GA 4PQYA 1D9ZA 2GNOA 4NTZA 4XOIA 4PQFA 2J9RA 4JL8A 1XPOA 4EPRA 1XMSA 4QG7A 1CR2A 1NP6A 3EZ2A 4M9XA 2YOFA 2WWGA 1DG3A 2V4ZA 5FPYA 3OEHA 1TPZA 1XTJA 1N25A 3HWSA 1NKSA 3P32A 3UIEA 4DLVA 1W36D 3QF4B 2ODEA 4MA4A 1NN3A 4WIAA 2D7DA 1T6NA 2Q9BA 1KJYA 4K81B 1YKSA 2G0NA 2A5GA 3QPUA 3ASZA 4A0HA 2C03A 1YR9A 4R71A 3AF3A 4QHYA 1UPTA 3MD0A 3QBVA 5H1YA 4TLEA 2JJ2A 4IOKA 2QPTA 1FFHA 1NMZA 1Z0JA 4MKGA 4AY2A 3BE4A 3BK7A 2VLIA 2I1QA 4NDZA 1E2JA 1US8A 2VYFA 4TTPA 2C96A 1K8RA 2ODBA 2YWFA 2J7PA 4NCIA 3D8BA 4WXPA 3R7WA 2QQEA 2ZXUA 4BPBA 2HJVA 2ZRPA 2PZGA 3BC1A 4K46A 4D6PA 1TQ4A 4B35A 2OEPA 1TTTA 4ZIRB 4Q1BA 2G83A 2ZE6A 1D5CA 4O0MA 1O3YA 2JAQA 4JSYA 4US1R 2JLRA 5JWRA 3B9PA 4OQLA 2J0SA 2QUZA 3VNVA 3NC0C 4BGDA 2BVNA 4FD2A 4NCHA 1U2RA 4Q1AA 4B76A 2ONKA 1LVGA 2QAGA 2WICA 3HJNA 4HAUA 4MRPA 5H8WA 3HYRA 3FOZA 1G8YA 4URVR 4PZYA 1MV5A 5JEEA 4G1UC 2WWFA 1EFRD 2BJVA 1SVOA 1IN8A 3GLHB 3WMFA 5JLJA 1KK1A 2BMEA 5SZIA 4MYUA 3TW8B 2JATA 3UMFA 1OJLA 4QJ3A 2MSDB 4KFRA 3DOEA 1T0HB 2QE7A 3GFTA 5G41A 1XD2B 3L8ZA 2HT6A 2ZVPX 1G41A 1YHNA 4LHYA 4UXJA 3W8RA 3NWJA 1Q1ZA 4IJMA 1Q44A 1YR6A 2ZRFA 1R8QA 3Q7QA 4FCWA 5DISB 3AVPA 4V0NA 3CF0A 3X1DA 2R6GA 3R20A 1U0LA 2C78A 5AUOB 3GJ4A 4YONB 4A4DA 2EVWX 4IEIA 4V0MA 1OH8A 1MKYA 1XMJA 3V9PA 1FL9A 1P7CA 2EFGA 3F3YA 2OXRA 5DYIA 1ZW6A 2GRJA 1NVVR 2VSXA 4LV8B 3UWOA 5B64A 1D2EA 1WB9A 3U60B 1G8FA 1DELA 1T3LA 4Q4HB 5D3QA 5FUYA 4CT4B 2YYZA 4EPVA 6Q21A 1KI6B 5BYJA 2ZR0A 2E1RA 4TZ6A 2QN6A 2Z4RA 5AUQA 4P4UA 5P21A 3S1AA 1IM2A 3WP1B 4O2LA 3GLIA 2A30A 1OXVA 4PHHA 4GSYA 3HR7A 2CLDX 2F1JA 2NPFA 2CK3A 3ZYCA 3THXA 4F93B 2HCJB 2E9SA 2W6ID 4BFYA 1XWIA 3AH8A 2WKQA 2QG6A 1Z07A 4M53A 4E5UA 1KMHA 1P2TA 3QPWA 3C7KA 4MITA 3FKQA 1SVMA 3LBHA 4ILEA 4B6FA 5BWMA 1M1YE 2GA8A 1W47A 4AYTA 2OLJA 4AKHA 4PC1A 5FTJA 2ZTSA 4BLQA 1Q22A 3L0SA 2OFWA 1HQCA 2C9CA 2BJWA 2Q3MA 4R2HA 3AQ4A 2ZRIA 2YOHA 4B3BA 4WAUA 5BN4A 2GXAA 2ATVA 4D4MA 3K0AB 5EXTA 2D2FA 1K5DA 1KO8A 1Q1BA 3CNNA 4G5OA 4G5SA 4KYUA 5FFMA 1G7TA 2C99A 3KZ1E 3NHBA 2QMEA 2D06A 5DHAA 1M6NA 4I1UA 5DGXA 2WOJA 2VP2A 2ZSAA 4DRZA 3REFA 3BH6A 5J5CA 2J0UA 1YQTA 2W6JA 4Q1EA 1P6XA 1JNYA 2C77A 4Q4JA 5EXSA 4GFDA 5CYPA 2XTMA 3VQTA 1T9HA 2V55B 2XB4A 4KLNA 2WM9B 1NSTA 4M9ZA 2QBYA 3C14C 1GL6A 2PEZA 3U3KA 2LWIA 1A1VA 3D31A 1G8PA 1U90A 1UBEA 1JR3A 1VG1A 4MKHA 2GK6A 5SZKB 1T5IA 1YR8A 4KBGA 3I5XA 2Z83A 3R9IA 4Q19A 1SQ5A 1G3RA 5AR1A 1I2DA 2PL3A 4XSGA 3ND9A 4C2UA 2O52A 4PFSA 4A36A 4V0KA 4V0ME 2QTHA 1NVUQ 3AM1A 1CULC 1QHYA 2F9LA 2FGJA 3KUDA 1W0JD 2YOGA 4A9AA 3TVDA 3KKOA 2GAOA 2J1LA 3FFBA 3MRSA 1J70A 4ZPXA 4TSFD 3SFVA 3T12A 4LC0A 3SE0A 1KJWA 5L3SB 4EPTA 4KHZA 3NKVA 3U7EB 4B48A 3A4NA 4B75A 1E4YA 2P6NA 1H8HD 4RCYA 2Y8EA 4GRAA 5E7IA 3V4FA 1GRRA 1QBKC 3QY0A 2QSZA 2WSSA 4M21A 2CHGA 1P9WA 1Q20A 1UKZA 3O47A 5FL3A 4TMVA 5AJVB 4LJ8A 3P1JA 2OAQ1 3NC1C 2OBLA 1VCOA 4LYHA 5BYKA 1BMFD 2J87A 4V02A 2QAGC 3OIVA 1T8TA 2EYQA 1XZQA 2ZUDA 3CF2A 1XEFA 1EWQA 4LBVA 3B82A 1FW6A 2FFAA 4Q9HA 2OT3B 3TAUA 1KTVA 1ZM3A 2RGNA 3IUYA 5J47A 5JFGA 4D82A 1SXJC 2GK7A 4Q9IA 1P61B 1Q21A 4PPFA 2JDIA 5LD2C 4C2TA 5FBRB 4D4LA 1XCGB 4DSTA 4RSGA 2JCSA 5JI2E 1TQ6A 2QPOA 3NBXX 1G7CA 1T5LA 2KJQA 4C7OA 1AM4D 2WPDD 3TQFA 3EPHA 1R0WA 3OESA 4HATA 1A7JA 3GEEA 3RVBA 4RFVA 1QDEA 3TR5A 3K70C 1E0KA 1WRBA 4JMPA 3CH4B 4PSKA 2J3EA 2ZM5A 3QXSA 3SHFA 1NLYA 2CVFA 4YDSA 5DI3B 2ANCA 4DDWA 4HUTA 2GEUA 4F7WA 2G6BA 4A6PA 1AS3A 2NO9A 3OEEA 1K6MA 2Q21A 3PQCA 4JLOA 2IS6A 3IIMA 4UQOA 2P2LA 4QGFA 2Q9AA 2BHRA 1M34E 2C9OA 1KKLA 1OYWA 2O8CA 1F60A 2JJ2D 4Z51A 1QHSA 3QVUA 2XZLA 3ZDQA 5DLQC 2LCFA 4ASUA 3I4LA 2ZU6A 3RABA 3PG5A 3CBQA 1NBME 3BAFA 2FDCA 4LHVA 3EC2A 5A0FA 2JLYA 1U94A 1E9EA 4C0BA 4IRUB 4M1KA 4AKEA 4Q9LA 4LZZA 2MMCA 4URXR 1GRQA 1KNQA 2ZPTX 1N5LA 4LYAA 4QM7A 3B6EA 4PZLA 3MAAC 4JBYA 5TARA 3JVVA 2GZHA 4QHTA 3I73A 4FMCF 2DWQA 3QKRA 1KOFA 2CL6X 2G88A 1M7BA 1ZD1A 3CRVA 3SQWA 1NMYA 3GD7A 4Q7KA 3VR5A 2QBYB 4CGZA 3EX7C 3FWYA 3B78A 2OM2A 5GJWC 1AS0A 2VP4A 2FN4A 3QKSA 4TMWA 2ZVQX 5C1BA 5J4YA 3ZQ6A 1DAEA 2ZYWX 4DB4A 1XEWY 3GJ0A 3OAAA 4JS0A 2ZJOA 1W0JA 4I1VA 1TQDA 4DIDA 1E2GA 3H2YA 4Q00A 1IJEA 2VPPA 4TL8A 4GMDA 1OW3B 1DARA 1TU3A 1UKVY 1LS6A 2JIZA 2IXGA 1Z0AA 4OHWA 1R8SA 2R2AA 2ZS9A 2XITA 1XX6A 3BBPA 1DAKA 1N5KA 4TYPA 3B60A 2AFIE 4CRWB 1ESMA 1QHGA 5KHOC 3ZS8A 1KZGB 4GL2A 4C0QC 4KODA 5GADl 1Z83A 4MUBA 1OB5A 4DUGD 3SU8A 5FUXA 1COWD 4OHYA 1IY1A 4HUQA 3ZIAD 2AR7A 4A8JA 3O8RA 1WDTA 4LPSA 3O8DA 2AWOA 2VSFA 2IC5A 3X1ZA 5IK2A 1JBKA 3PUYA 5A4JA 2XZOA 1R0ZA 2X19A 3LLMA 4CT5A 3SJAA 2GILA 1MRSA 2GHIA 1EFCA 1RRGA 1UAAA 3ZD6A 1YRBA 4PQRA 1ZM7A 2GDJA 4WOPA 4CEJA 4QBFA 1XNJA 1E2NA 1Q12A 2VTKA 4A0GA 3HPQA 4WXRA 4RZXA 1SHZA 2IYRA 2WTUA 1SZPA 1JEEA 2PBRA 2FSHA 2WSMA 5LPNA 2PLFA 5FBWB 3TUIC 2OFXA 3AVXA 1QG2A 3IQWA 1X3SA 2WKPA 1UDWA 4URUR 5CM8B 3Q5EA 1F2UB 3TAHA 521PA 1MRNA 3I5YA 2HCBA 1OIVA 2DBYA 1IJFA 2X1VA 4LGMA 1S9DA 2OO7A 3AGQA 5EQTA 1NVWQ 1DTSA 1KAGA 4FCVA 3A1VA 5TDHA 2ZS8A 1RIFA 2J7PD 4EJSC 621PA 5DNYB 3QKUA 1OF1A 2IK8A 3WRYC 3LAWA 2QI9C 3LBIA 3NTUA 3PUVA 5JS8A 3VX3A 4LBYA 3WHLA 4BLOA 4YMSA 4CEHA 4BLRA 2J41A 3C8UA 4CEIB 3EIHA 1NY6A 1G8GA 3OHMA 3TUZC 2W6JD 3LRPA 5GVRA 3I72A 1US8B 4DCVA 3C41J 1R4AA 3RS5A 2YVUA 2GKSA 2QM7A 2ZEJA 4MKIA 3R7WB 2FGKA 1AKYA 2OHFA 2ZRBA 1E9RA 3IEVA 1NKTA 1CIPA 1E2PA 4GOKA 4LHXA 3QSYA 1RE0A 1GDDA 3SZRA 2Q3HA 5B58C 3EIEA 2QRZA 2ZI7A 2PH1A 5CK4A 3KJIA 5KOYA 2G0TA 3W9YA 1HUQA 1N6NA 3PXGA 3EA5A 1T0JB 2QMUA 1E1QA 3SS8A 3UKDA 4KBFA 4QJ4A 2BBSA 3K9HA 3KUCA 3OIWA 3AVOA 5FUWA 5IK2D 2JJ8A 2ZR9A 1RJ9A 1IXSB 4XVRA 2OSBA 3K0AA 4PANA 5KSOA 1SULA 3AVWA 3MMPA 4IFEA 3B1XA 4DEYA 1G20E 1R2QA 1E98A 4LJ5A 3F0TA 3OE7D 5JJLA 1E6CA 1UBCA 4DSNA 4NCJA 4PC3A 2BCJQ 2QT0A 1D2MA 4D2IA 1SVIA 4KYIB 4DVGA 1GNRA 2REXB 1IN7A 4W5JA 4NL4H 4B3CA 1KK0A 2QGNA 4HLUC 2IWRA 1AQUA 4G3XA 3DO6A 3L0OA 5AWFC 3B13B 1S0UA 2RGCA 4WZBE 4OYHA 3X2SA 3LV8A 2PCLA 1JR6A 1IHUA 4R9UC 2A5JA 4ZDIA 3CO5A 1E1RA 3P26A 3GLHA 4NZYA 3DHWC 1SGWA 1R10A 5ANRB 1U8ZA 2YC2C 1R7RA 2VIIA 3I8XA 4X8HA 1EG7A 1BYUA 3OIYA 2OUKA 2XNDD 4XTCS 2WIBA 3I61A 1E4VA 2RGDA 2H18A 5HZKA 2XAUA 2G1JA 5CYOA 3RC8A 1JAIA 4FN5A 1UJ2A 121PA 2FOLA 3CUEF 3SYKA 3K53A 1E9DA 4Q21A 2JDID 3GFOA 1NNEA 1GP2A 4Q7LA 1G3UA 1XFAA 5E95A 1AN0A 2OBNA 3GJ6A 5KNBA 1S3SA 3FE2A 3QBTA 1I4DD 2FV8A 1OXSC 1W49A 2B21A 2DY1A 4BFSA 3TQCA 4US0R 2IS4A 1TEVA 2QP3A 5TY0A 2IF0A 3BB3A 4MUAA 2JGNA 5LD2B 3W3ZB 4PPQA 1OIWA 2JLSA 1EK0A 1P2UA 1N0VC 2XOKD 5FTLA 4KCGA 1ZINA 4TSFA 3B85A 5BN3A 4XD7A 1OFHA 3JZAA 2A7QA 2FEMA 3IHLA 1GKUB 2ZRMA 1H8HA 1BH2A 4M1YA 3RS4A 1GKIA 5L3VA 3K70B 4HB2A 2D4HA 4GOJA 4B34A 4ZDJA 1QG4A 3U7GA 1OHHD 1TEXA 1ZVQA 2IYQA 4HAYA 4BRWA 5TXGA 3G5UA 4M1SA 1KKMA 2QSYA 4E03A 3MWLA 4BECA 3EWAA 4MGKR 4C0LA 4HLCA 1CEEA 3SBDA 4OJKA 3VFDA 3A4LA 4CDGA 3CKLA 2CVHA 1D8TA 5DIFA 3U3OA 4ARZB 4YLGA 1R0XA 2VSOA 1YVDA 1KI8A 3P4YA 5EUQB 1AKEA 1OLOA 2MSCB 3IO5A 4DLWA 5JWHA 1G21E 5JSZB 1KI9A 4TTRA 4EQ6A 5H68A 3I3SR 3BFVA 1KI4A 5KTYA 1ZUIA 2VHCA 2BOVA 3VR6A 4BLSA 2ZRLA 4AG6A 4CEIA 4GP6A 2QP9X 1KNXA 1E0SA 2AFHE 4U7DA 4FI3C 5LB4A 4GT1A 4MKFA 2PT5A 2WZQA 4W5HA 2VHUA 5EUMA 1VYVA 3ASYA 1JI0A 5GJVC 4Q1FA 2WWWA 3PEUA 2IXEA 1Q3HA 2EWWA 2YINC 3PR1A 1RFLA 3AF0A 4DHEA 5IF9A 1XTRA 4HI0E 3IPYA 3NH6A 4DT1B 4Q1CA 1OB2A 3E2IA 1KO1A 2RGGA 2GF9A 3BH0A 1E79D 2O8DB 2P5TB 3DMNA 1ZM9A 4DEXA 1CRPA 1ETUA 1VHLA 2AD1A 2YWGA 1Y3AA 3EARA 4GNKA 4UNQA 4HYYA 5CIWA 4LHWA 3Q8XB 4P33A 3H84A 5CIQA 3ICQB 1XPRA 2IYLD 5EP3A 3SC3A 1XEXA 2ONJA 1P60A 1A2BA 3RWOA 3QKSB 2DPXA 3AVVA 1OIXA 5BQ5A 1LB1B 2CCGA 2IW3A 1WBDA 3AP1A 3CX6A 1OHHA 4PSAA 3W6OA 3UWKA 1P2VA 2IYZA 1J2JA 1E2QA 1W44A 3CR8A 3MFYA 2FFHA 2VO1A 1YE8A 1TMKA 5DYGA 2C04A 1NVVQ 1GFIA 3EIQA 1M7HA 3N70A 2IYTA 1IQPA 1HY3A 4B73A 1P9NA 3DM9B 2NQ2C 4DJTA 4GZLA 1JXMA 5EE9A 4JKIA 3L0PA 1WE2A 2X8AA 2QAJA 3PEVA 2XGJA 1G4UR 3WNDA 2ZQ5A 3VKGA 1E96A 5EXXA 3GLGA 4OQNA 1XTIA 3EW9A 5CJ2A 4D25A 1V5WA 2PMKA 5E4FA 3TJZA 3KTAA 3CF6R 3UPUA 2HDNB 2XZPA 4XIGS 2F43B 4W9MC 2ZRHA 2BEKA 3JVUA 5FR2A 5TV2A 4DBLC 2IYVA 4C7OB 2XTNA 5AUPB 4JVMA 2Z43A 4DDUA 2CCJA 1H8ED 3FFAA 4S35A 1ZNXA 2GJ9A 5EZ5A 2QT1A 1HA3A 4L16A 2B6HA 4JLPA 5AJWA 4G01B 4ZDWA 2IF2A 4XH9B 2C98A 2GXQA 2O0HA 4U02A 5FUVA 2HXYA 1A2KC 1E32A 1EX6A 1KDTA 4L5BA 4WW0A 5K8IA 2FFBA 3L8YA 4OI1A 4EJSB 4B74A 4Q4LA 4QJ5A 1KJZA 5EP2A 2A3RA 4DLUA 2FZLA 4LY6A 1W4RA 2ZYUX 2IYXA 3B8HA 4Q5IA 1LFDB 2ZS7A 4AWXA 3MSXA 4OHVA 4M2LA 5B30A 1DVRA 1E79A 4TZ0A 4LJ9A 1XDBA 3LH5A 4PXAA 3TUJC 1ZU5A 1X1SA 1IAQA 4YMWA 4L4UA 2OXCA 1Q3TA 2QGZA 1QHHB 5FTMA 2CXXA 1LS1A 4M9QA 3TSZA 2XXAB 2DR3A 2WMOB 2F3TA 3DMDA 1IY2A 1G64A 2W0MA 2ECKA 1NMXA 2QA5A 4RD1A 2H92A 1YRAA 5KSPA 1FPMA 4JVSB 3T5GA 1FTSA 5JHHB 1Z0KA 3LXXA 3RSLA 2EFCB 5AJXA 1E2LA 1ZCBA 3CPEA 3EZ7A 4NCNA 2RMKA 1W4CA 1HYQA 3CH5A 4F4IA 3D6TB 4MYTA 5LDDC 1XD8A 3DVLA 1X6VA 2SHKA 2ERXA 1CJVC 421PA 2Q6TA 1UKYA 3AVUA 5F9FA 3QKRB 4KV9A 1E2KA 1G5RA 4URWR 4QKQA 3K8YA 2Q0HA 1II0A 2Z4SA 3UANA 1CKEA 2OE2A 3DZDA 2R6DA 1HQYE 4EFNA 2HF8A 2CDNA 2QE7D 1HEIA 4JBXA 4RKEA 4C3ZA 4IVRA 4D80A 4JLAA 4EAQA 1PZNA 2BC9A 1S9HA 4UXIA 1MABB 1ZCAA 4DT1A 1CLUA 1N6RA 2WIAA 1U0JA 2H17A 3AUYA 4GBMA 3W3AA 2XNDA 3CRW1 4RZ3A 2P67A 5L8VA 2O8EB 2QROA 3ZZUA 2REBA 1GZSA 3ZS9A 4PTLA 3SEAA 2RB4A 4NP6A 1RZ3A 1VCNA 1TADA 1P5ZB 3RWMB 5JI3E 3OE7A 1R5OA 5CB6A 1G9XA 3BWDD 3U4QA 3KQHA 1JJ7A 2G77B 4L15A 5FPSA 4B32A 3J81k 5CITA 2AXNA 1L4YA 3DDCA 2IS2A 4G5RA 5C4GB 2H7VA 3PEYA 2PLRA 1W4AA 2FA9A 1ESNA 2V7QA 3QKTA 4BE7B 3A36A 1U8YA 1G8HA 3M6AA 1AGRA 4BLPA 2OILA 3P20A 3QJYA 2Z5FA 1W2HA 4NBSA 3EAQA 4P31A 3CW2A 2FPKA 1DG1G 1U9IA 4B47A 1D2NA 2O0JA 3MGCA 4HZUB 2DYKA 3W90A 2IYSA 4OBEA 1G7SA 2FU5C 3ZJYA 4HB0A 4CZ2A 4ERNA 5G40A 4TYQA 2JA1A 3KQUA 2RGAA 1QZXA 1TAGA 3FMFA 1FUKA 1N5JA 4KAXA 3NBYC 1A82A 2ZRGA 2XJ4A 1NJFA 4HDOB 1FUUA 1QVRA 4AIIA 4LV5B 2ZAOA 4KLZA 1XP8A 3B2EA 4HB3A 5D3MB 3GEHA 5FBQB 2H8KA 4KFUA 1XTSA 1YZKA 2YC4C 4C0JA 4ZDKA 1F2UA 2FSFA 1JPNA 2OZEA 1W2GA 3EZFA 1NF3A 1GNQA 1QHHA 1W7AA 2KSQA 4KVGA 3OZXA 4KJZA 2JJ1D 4ON9A 3GLFB 4A2QA 1D6JA 2J0VA 2R62A 1XTKA 2FH5B 1ONBA 1YZUA 5E3HA 5JRJA 3AF1A 1SHKA 3EZ9A 1NN1A 1XJ0A 2IUUA 2OAP1 3T06B 3LBNA 1FMLA 4MDFA 3QEJA 1R5NA 4XD7D 4D4JA 3S1AB 5KYKA 1W4BA 4D26A 3PJRA 2WWHA 2BM0A 2QQ0A 2C2HA 3QQ5A 4JYBA 4F92B 1ZUHA 3CR7A 4D0GA 1NN5A 1BYIA 4IDHA 5UKDA 4BFUA 1KI1A 1OH5A 5KPJA 1E2DA 1C9KA 2QENA 2QORA 3FB4A 2NTYC 4KVAA 2DFKB 3KXIA 2XSZA 4PPGA 821PA 2UZ3A 1NIJA 4KU4A 2A2ZA 4ESVA 4Q47A 1ODFA 3MWKA 4DIEA 1QHXA 4FWTA 4C0AC 1FZQA 1KK2A 3AUXA 4A0FA 2QY9A 3FYHA 1VIYA 1TUIA 3TLXA 1PV4A 2P65A 1AZSC 1XEWX 3A1SA 5G53C 2W2VA 4OKSA 2ASEA 2WKRA 1XMIA 1HT2E 1TL7C 2CE7A 1KI2A 5FPHA 4HEJA 4Q7MB 4US2R 1NI3A 3LX8A 4ARZA 4PO9A 2J46A 4TL9A 4POAA 3C5CA 3KJGA 3KKNA 4PHGA 3BB1A 1SVSA 1ZMXA 3CRRA 3JZMA 1HE8B 4RD6A 3K0FB 3T15A 3N5CA 2B7BA 3SHWA 2IX3A 3PUWA 4ZO4A 1G6OA 5CLLA 1FOEB 1U0HC 2JIZD 3AVQA 5DSZA 4AKIA 1G5TA 1GITA 2C8VA 5FH9A 4MQBA 4LI0A 4LJ4A 4XSHA 4PC2A 2IHBA 3TSOA 1IXZA 4LWZA 3LLUA 5M04A 3SJZA 2YHSA 2GVZC 2V6JA 4TMKA 4R98A 5C18A 3VR2A 3O8CA 2VHTA 4JYCA 2CK3D 4QHSA 4V03A 1S1MA 4Q02A 5F9HA 1GRNA 1OSNA 3HDTA 3CPJB 2REOA 3F8TA 5JJIA 4BZXA 1F2TB 2HUPA 2OCPA 1XBTA 1GVNB 1G3QA 4DCSA 2CE2X 4GP7A 2D7CA 3W34A 4NHOA 1IOZA 3PENA 2ZITA 5HPYB 3GLHE 5CJPA 1IY0A 2P0EA 3U5ZB 4BFZA 4I1SA 5J4KA 4O2RA 1KIMA 1UEJA 4RJLA 2YKGA 1ZC3A 1W0KD 4QGHA 5EE1A 1W48A 3AKEA 3U4QB 4TQUS 2O8BA 3AKYA 4B43A 2J45A 2GESA 3LO5A 2FE4A 1QHIA 1HE1C 4EIWA 5DHFA 4A8JC 2BKUA 1CJUC 3LWNA 1FX0B 5K8LA 1F6BA 2R65A 3C15C 3THOA 2W58A 4NE2A 3QENA 3QI2A 3IQXA 1LF0A 1F5NA 2JJ1A 2ZRNA 4I99A 3C5HA 4G5GA 4OL0A 1XMVA 4Q4AB 2BWJA 1ELOA 2OV2A 1W5SA 3VX4A 3U61B 2ZUBA 4Q4HA 3MLEA 3K70D 2RGEA 2ZRDA 3E70C 1GTVA 2NIPA 4LOAA 2B92A 4TYNA 3NEJA 3K0SA 4D0LB 2ZE8A 4YMVA 1GUAA 3AB3A 2F43A 4QNRA 1JR3D 2V8OA 4RZUA 4IDPA 4HAVA 4DWJA 3U6BA 5JBQA 5TB5A 3EASA 2GJSA 3MWJA 2VQSA 2CL7X 1KI6A 2BMFA 4BEJA 3CRQA 1C1YA 5DE3A 2ZI3A 1CS4C 1TQ2A 3BORA 1ZD9A 4A0RA 3NDPA 3G0HA 1RYFA 3A58B 3TH5A 1TNDA 1Z22A 1UFQA 2XNSA 1S8FA 3OFNA 1KO4A 2ERYA 3SBEA 5JHGB 2RHDA 3IGFA 4JL6A 4OK5A 1G291 4NYJR 4RKFA 4P3YA 4TMZA 2BBOA 1DBSA 1UADA 4UJ3A 1VHTA 2BDTA 2BV3A 1AIPA 4Y0VA 2X77A 2V9PA 1KSGA 5KPDA 2XSZD 1CRQA 3LD9A 4TYWA 2BCGY 4M1WA 4DUGA 2VHQA 4JT4A 3EWSA 3U2QA 1XXHE 3T1QA 4B71A 3IO3A 5HKKD 1OFUX 2GBLC 4JLKA 4LJAA 4DKXA 1II8B 1WQ1R 4U00A 1P73A 1LV7A 3AP3A 4JLMA 3MJRA 3R9WA 2HV8A 1SKQA 3E5HA 4NONA 4NCKA 1XU4A 1FNMA 3EZ6A 2WBLC 1GSIA 4URYR 3IIKA 2MSEB 5DN6D 5JZVA 3QXCA 3X1WA 1UBGA 3HU1A 2ZI6A 4IOJA 2CEAA 4Z54A 3NEYA 4Q4JB 1TUEA 8OHMA 2NGRA 4LYFA 5HR5A 3AF2A 4Q7JB 2WPDA 5FOSA 5JECA 2F9MA 1KMQA 4ITRC 3GMTA 3T5DA 1VYUA 2PJZA 1RKBA 1TF5A 4WZAE 2CMKA 1DEKA 3GFPA 1GKYA 2QPAA 3UMRA 2WMNB 4BFWA 3CONA 3LVRE 3CPHA 1UKEA 2I4IA 1VIAA 3FMOB 3RAPR 1W36B 4AYXA 3QNUA 1F48A 1X8JA 2ZSEA 1OKKD 5CLQA 4C0KA 1KHTA 3TR0A 1VG8A 2G1KA 4RY2A 3PFIA 5BXQC 4LYJA 1G4AE 2KBEA 1AGPA 1CJTC 5FPTA 4FMCB 2RGNC 3B7GA 4J0QA 4NYIR 4B3DA 1BO6A 3ONWA 2GF0A 4RD0A 2A5FA 4XWAA 4JSTA 4A1FA 4ZKDA 3ND8A 2BMDA 1OXUA 3R9XA 1U98A 3U3RA 1N6LA 3AKCA 1ZJ6A 4JKYA 2HLDA 2J0QA 3RS3A 4QL3A 1R5BA 3GLIB 2J59A 4X8LA 4DCTA 4IXMA 4B6EA 1Z6XA 5F98A 1RRFA 2BEJA 4LUCA 2B7CA 4UKDA 3X1YA 4ZI2A 3GJXC 1QHNA 2GCOB 1MT0A 3KTAB 4HZUA 4PAQA 1GL7A 2EFDB 3K9GA 2LKCA 3B1ZA 3LY5A 1FMJA 2EW1A 4GOXA 4NYJQ 3VHXA 2QNRA 1ZP6A 5EZ6B 2CL0X 2Q9CA 3GJ7A 4MGZR 4WVFA 2GEVA 1JALA 1JJVA 2A5DA 1VPLA 3LA6A 1EFUA 1Z2CA 1YU9A 1GOTA 4MYCA 2ZREA 3WRXC 2O0KA 2YNMA 1YZGA 3LDAA 4TT3D 5J4HA 3WY9A 3GQBA 5TVKA 1XB2A 3A1TA 5E7JA 4QGAA 2OCAA 3QPVA 2J0UB 4IHQA 4IDNA 4M1MA 1G19A 4KXFB 1AA9A 5FL7D 5JRZA 1CR1A 2ZSDA 4ACAA 1HURA 3DPUA 2ZJ8A 1CXZA 3T34A 2W0SA 3LW8A 1XRJA 3IBGA 1XF9A 1CP2A 1KDRA 4PX9A 5KNCA 3A8TA 1NG1A 3AP2A 2XX3A 3K09A 1ZUNB 1JXOA 1RJ9B 5KDOA 3DZ8A 1B0UA 1PLLA 3KQKA 4Q03A 3AF4A 2BBWA 1I2MA 3RS7A 1E9CA 3SDZA 4I81A 1CU1A 2ZJYA 2JLWA 1N6IA 1Z0FA 5BW8A 3GJ8A 3WYGA 3P27A 5FPKA 3QG5A 2CNWD
chains in the Genus database with same CATH superfamily
1QLWA 2YXBA 2CMGA 3JQFA 3R4VA 5L3QA 2OK8A 2D5LA 2O7VA 3RRYA 3O31A 4W63A 2QMOA 3FSGA 2IE8A 3GPIA 1BGXT 4MRNA 2AIRA 3G2MA 4RDHA 4WCFB 4AKTA 3LYLA 3GLFE 1GZHB 2ZR8A 1UFRA 3FLBA 1LPNA 2QRQA 2I1VB 3H1FA 1MABA 2OZVA 1FMCA 4H6VA 5ENDA 5JD6A 4C30A 1Z6YA 1AHHA 1T9DA 4MYHA 3EFBA 1OBHA 4H6WA 4D3YA 5EE5B 5L3QB 2C61A 3GJYA 1M73E 3H86A 4QU8A 3BB4A 4AECA 5BSHA 3MCTA 5JNTA 1ADCA 3SM9A 3H0KA 3BCRA 3OPYB 4ML3A 4GKAA 2O7SA 4ZQGA 3OCUA 4QUAA 4I4TA 1GKKA 3FFXA 4ZCMA 1G5QA 5A3JA 3IVMA 1Q0TA 5ECYA 1PR3A 3OF5A 3F9IA 2JVKA 1ODJA 4MUGA 1ZD8A 2GCOA 3VMMA 1TK2A 4OBXA 3NAGA 4NEQA 3ZXIA 3A6PC 3QXXA 4EUNA 2FP4B 4JT2A 3BZBA 1O95A 1B2RA 4MV1A 1F17A 2R6CA 4EELA 2HSEA 2NZ8A 4M9RA 3MLBA 3T9CA 5KJFA 4B6OA 5JYDA 2XCSB 1QGED 2W83A 4AN0A 3VDQA 1GAEO 1J07A 4FMBB 1PR6A 2XXJA 4RELA 4Y1RB 3Q40A 3WRWA 1JW9B 1YNOA 4OKNA 2RGRA 3JQRA 2G8NA 4D99A 4WBNA 3R76A 4A8JB 4HWKA 3GRYA 1MA0A 4D3XA 3BMQA 2DHDA 2QRLA 3SC2A 5ADUS 5H81A 1PYGA 4LRXA 2OESA 4O3FA 3STVA 5CB4B 2R8RA 6YASA 3H6GA 1NQUA 5HHTA 5FTKA 1EDBA 2PEYA 2Q1TA 3KZKA 3DFZA 3PFGA 1WU8A 5DP1A 3WBJA 4YCCA 1WHTA 5C7LO 3DKKA 2HTEA 1D1QA 1T1GA 4DGQA 1M2OB 2E48A 4QNNA 3WVNA 4RZHA 3IURA 2C9MA 3NH9A 4CR7A 5G3ZA 3PX7A 3NM6B 3UJ8A 2PT7A 1X94A 4ESEA 1C0PA 2CFRA 4TMTA 1EEHA 3V6MA 3LHDA 1XCMA 1Z8FA 2VVTA 2JCGA 4FZRA 1ZK3A 4YDHB 5GGYA 2ZAYA 4BFXA 1WDMA 4HLQB 3GV0A 3OIGA 4PZZA 5B4UA 4CQNA 3VH4A 5ESDA 3LZDA 3ZGXA 3C5WP 2UUBB 2WUDA 1SCQA 1YOVB 1Z4KA 4ZEWA 1C9EA 2WRZA 3AVYA 2ZE7A 1KSHA 3BRCA 4M8SA 1YAJA 2XUJA 3FCAA 2H2WA 3JWHA 4IWYA 3K09C 4CTKA 5AJHA 5CD9A 3LVQE 1V8DA 3HO1A 3RIXA 1PF7E 2XWJI 3P9ZA 4R01A 4QC2A 1YQQA 1GAJA 1HT1E 2DWUA 2J9YB 2NWQA 3WK8A 3W5BA 4RA9A 4G0UA 5CVDA 4I5EA 5JPCA 5LQDA 2O3SA 4HZGA 1N5RA 2A1IA 4UTXA 3WL7A 3ND7A 5IDQA 5JNSA 3NBQA 2WHEA 4KITB 4D6XA 4EZIA 1NJSA 4LMPA 2Z9DA 1SXHA 3FDIA 4YXWD 2O5VA 1YB2A 1RBMA 5E9QA 3ACCA 3D5TA 3D6FA 2JPDA 4IVQA 4LNHA 4YP0A 2OG2A 2R6AA 1B0PA 3C98A 5K3DA 1E3EA 4PG6A 5DTMA 5D5HA 3Q0EA 4RS4A 2IX9A 1T5OA 2VJMB 2Q45A 3LWDA 3DYIA 1UK7A 3DC2A 2Z6VA 4TKVB 1JHMA 4YI3A 2J5XA 3EOAI 4RVCA 3OTWA 5BPHA 1ESZA 3WADA 2VA8A 3LFUA 4BNUA 4E33A 4MCAA 2AX3A 1XLWA 1I1HA 3P2OA 4JLBA 4NDAA 4HEQA 2Z5GA 5F3RA 2R2GA 1H65A 4U2EA 4WGGA 1U0SY 1FRFS 1DRVA 4NS4A 4WY2A 1PK7A 4N41A 1BQ4A 3L7JA 1TCUA 2Q9UA 2Z04A 5C46F 3ETEA 4W99A 3TFOA 3MWFA 3GP3A 3UT0A 1ZL2A 4M37A 3IOMA 1WQ4A 3V2HA 5E6RA 3BIWA 1CTQA 1RYHA 4DG8A 3T9EA 1BAPA 2VC2B 3N2IA 3SIWA 4MO2A 1HORA 3WMXA 1PL8A 3RC3A 1M3SA 2FJPA 3Q12A 3V00A 2OBMA 1FJHA 3BGWA 5JAMA 3AV0B 3UATA 2JEZA 3JYQA 4RIIA 5IC4A 2C29D 1Y5IA 1QP7A 2NO0A 4MS1A 4D46A 5TS2A 2Y66A 2J6CA 4P32A 4PO8A 4B33A 2EF1A 2B20A 1ONNA 3VKWA 3DAPA 4YJ2B 1MW8X 1M5UA 1E3TA 1IONA 3CNLA 2BPOA 1LBTA 3ZGZA 1FDRA 1EQUA 1I4OA 1WCXA 1IZ0A 2NV0A 2QMQA 4OFXA 3WNZA 3GBVA 5F77A 4HEA1 3WGLA 3AEYA 2Y93A 1EVZA 1KI7A 2H0RA 3DF7A 5DM70 4Q66C 4ITUA 2ZYTX 4HWOA 4IDDA 5G0WA 4ZZ3A 1F0PA 1W36C 4EA7A 1AXGA 1S02A 4GF5A 3W2GA 2IJGX 4WOBA 3X2FA 3JD2A 1GNPA 4KR9A 3C3KA 1E20A 4L4SA 2B8EA 2EU8A 2Q1SA 1JWAB 2WAMA 5KKAA 1QP0A 3IUEA 2ZYSA 4R1UA 3GUVA 1YIOA 3EE6A 3CLUD 4EPYA 4RIHA 3NBKA 3VKHA 5EMKA 1SXJA 1U31A 3WAJA 3EC1A 1R9NA 4CE6A 2OQVA 3OTHA 3ZIAA 3CB4A 3WYNA 4AQYB 4DC9A 3NHPA 2LGJA 1UBFA 3Q7TA 3UVEA 4ASUD 2AJ8A 4LHEA 3U1VA 5I45A 3DFKA 5IN5A 5JISA 2XH8A 1O5IA 3IRVA 3PJGA 4R1LA 1MQAA 2GJKA 3VV3A 4FZJA 3TPCA 2DM6A 2Q62A 2CEKA 4L6IA 4MRVA 1QNFA 4W8OA 3C5EA 2BGTA 1MCZA 4DQDA 2XKKA 2P2CA 1O6FA 1ISFA 2CJWA 4OYLA 2ZI4A 5TIIA 4YC7A 2AOUB 1PZMA 1XTQA 4MRSA 1PCXA 4BL5A 1TO6A 4M1EA 2P4EA 3KNZA 5FA8A 4OLBA 1NBMD 4MI1A 2B6NA 1P75A 3HCCA 3WGZA 4FYMA 1CS0B 3RG2A 5B2EA 2PNFA 1U0BB 3E5RA 4L8YA 4Y1RA 4OK3A 5LUBA 2FPPB 2E1PA 5DHQA 5TPZD 3ENNA 3NHMA 3IDOA 5DV9A 5G1OA 2PA3A 4DHWA 4YH1A 2CHVA 2GJAA 3DL0A 4CEHB 1ZRNA 2AH5A 3DLIA 1Z4IA 4JP8A 3G6WA 3ZDCA 4DNOA 1ZH2A 1KR2A 1MC8A 2KWIA 1QE3A 2A8YA 1QYCA 2UUPA 3DH0A 4LN1A 4IV5A 4Q1DA 1N6OA 1ZNZA 3D64A 1GZ5A 3VZDA 3N53A 4FT2A 1DXQA 3GP8A 4ND5A 3TW0A 4CW7A 1AD2A 4OLJA 1W46A 1MO4A 3F3KA 5BUSA 4M6WB 1AX9A 1M2WA 1R74A 1YCDA 4FBLA 4URHA 3K71B 1NTOA 4L2IB 3KV1A 1O5OA 1RCTE 3N59A 4BNNA 2TMKA 3HEAA 1KMMA 3O9VA 1EFHA 2COKA 3DKRA 3JR3A 4G0QA 5CVVA 3FNRA 4EHAA 3S1LA 1ODTC 1W36D 3M4NA 4JVNA 4HGOA 4WLOA 3RUCA 4QODA 3O83A 1ZG3A 3Q8WA 4PLGA 1RVDA 2Q3FA 3JU3A 1K75A 4TT8A 1QCCA 4BUZA 1NQ5A 5JCPA 1AF4A 5EPOA 1TTHA 3ZBPA 3N75A 2V3CC 4JBLA 5HIJA 2O59A 1YZQA 5H3HA 3CO0S 3LUDA 1C8LA 2WJYA 4IKEA 2RGXA 3F5QA 1XN1A 1R4MA 1Z6GA 3ZD7A 1RYMA 1PQYA 3AY6A 3JD0A 1MENA 3W4JA 4AJPA 1RHQA 3BXHA 4HTAA 4H6XA 2PG3A 3D43A 5FNVA 3VXKA 3EB9A 5ED0A 5KNDH 2V7GA 2O6HA 2BFFB 3HU3A 4DJFC 5EWLB 3HB0A 4GSKA 4HLDA 5C1IA 4K26A 3H83A 5AK5A 5IYZB 3CZQA 3IUNA 4K8RB 2HA4A 3HI6A 3C3WA 4YMUA 4G37A 5T57A 3OQVA 3PIDA 1WMSA 4X20B 3H9EO 1PJZA 2XCQA 2H1LA 1YULA 2I7TA 3FHOA 3I9JA 3MT9A 2JL1A 3I2KA 1DAIA 3IP6A 4NZPA 4URFA 4A82A 4XUDA 2OXEA 1KP2A 1BFKA 2EC5A 1J0BA 4PO1A 2PUTA 3VAZA 2CBGA 1UZUA 1CR0A 1KZ7B 1W34A 2P9YA 2R7MA 4OATA 2EEPA 4TN5A 3UK0A 5HKOA 1RRCA 4R0MA 1LEHA 1J9ZA 4R4JA 1GKLA 1EZ1A 1SUCA 2H2FA 2G36A 4NC9A 5ALRA 4ZTZB 5BVHB 2XGSA 3FSGD 3FZYA 1DO2A 1CUIA 3DOOA 3EDCA 3GCGA 3OZ7A 4BVGA 1X9HA 3DBHA 4F4JA 5CA1A 4MLZA 2HSJA 5JJ5A 2G04A 2HJSA 3FR7A 3LI2A 3USCS 2GM9A 3DOFA 1WXGA 3LYHA 3HL0A 1HDZA 4TV9B 2AZDA 2QN3A 4LRTB 5G4KA 5HFAA 3R8CA 4EKYA 3NCHA 4M0CA 4OQMA 4A10A 5GZ3A 2Z2KA 1PSZA 4BWVA 1MNAA 3T3HA 2XWSA 1BHJA 1F9AA 1Q6YA 4EGFA 4EW6A 3N74A 4OM8A 4P5DA 2C7QA 4IIXA 1Q0UA 1TQ8A 1RBYA 2R1TB 4PNPA 4ZGWA 2VZ9A 1DAHA 1X7XA 4NFYA 2PGOA 3Q0IA 2DBRA 1Y4AE 2WSSD 3BWMA 5K1ZA 3WYFA 1QU2A 3PXBA 5KSYA 1GL9B 3NWBA 3SOPA 3HJRA 3UJ6A 3IE1A 1I13A 3OBBA 2FX5A 3GLIE 2A58A 4P5PA 4HS9A 4C88A 1AS2A 2LIVA 4Y2XA 4A3SA 2AV6A 4XUGB 2L0XA 3FYSA 3MHPA 4IXNA 2X22A 3F90A 4IHJF 4QQNA 4YJDA 3WL3A 1HRKA 5A4FS 3ETJA 5I8WA 1ENYA 3PR2B 4IXWA 4UE2A 4CN8A 1W8IA 4QOFA 1Y9EA 4QEZA 1G98A 7GPBA 1Y1TA 2RH9B 1GIAA 2OYRA 3ELDA 3K9LA 2A9JA 2ORIA 4WT7A 1EFPA 3EH1A 1JH8A 1HC7A 2ZETA 1OE0A 2ZYVX 4Y1EA 2FFQA 1XRNA 3ZHQA 1W35A 3LPAA 1KEWA 2PSSA 2O8CB 3OZRA 2X2EA 5IUJC 3OC6A 1IAVA 4AI6A 1TVMA 2G7MC 1ISRA 5ELLA 3W4IA 2EIXA 5K3CA 3VU9B 2P1ZA 1KXJA 3COJA 5TX7A 1A9QA 3M6WA 2XCUA 1NV8A 4G0OA 4TLBA 2AN3A 2O3QA 4DSOA 5F7JA 3D7MA 1V3TA 1JEJA 3EMDA 3RRZA 4E5KA 3QE0A 4KB5A 1KMHB 1TTPB 1B6TA 3ZVMA 2Z6AA 5LA6B 1XJCA 5DHTA 3VM6A 3RRMA 2H1IA 1NVEA 1WWKA 1PL6A 1EUQA 3VUFA 2JK0A 4LV6A 2QRNA 2F1HA 6GPBA 5KBYA 4B7ZA 2IA5A 3DM5A 1MLDA 1A8QA 4XB1A 5CA0F 3H9BA 4N9QA 1E9BA 2R44A 2H1VA 4HTFA 3ZIDA 4DDTA 4LEIA 1NVAA 1MH1A 4AZTA 4JT8A 5DASA 1FS4A 3PXAA 1Z0IA 2FCAA 4LE1A 1P44A 3FUCA 2GXUA 3PBKA 4OQXA 5MGNA 5ALXA 5H70A 2EZTA 1VCIA 2W2QA 2VTEA 3H9QA 3R40A 4GXNA 4P4NA 2QTZA 3VR4D 4FDMA 1ZJWA 1D2HA 1QVAA 2QDXA 1D9XA 1GGNA 1PNTA 2X23A 3K6RA 3OT1B 3GPLA 2FJUA 3DOUA 1UKAA 2QTWB 2GETA 1JR3E 2Q2WA 3AJ9A 4MWCA 2G6TA 1MEJA 1VKJA 3QVGA 4RZIA 5DWQA 4K9RA 1EHYA 3RUDA 1TVKB 2B5WA 4DDHA 2DUNA 4ZOLF 4J16A 3IESA 1L6IA 3LYUA 3JYLA 4G5QA 1HWYA 1A0OA 3KLPX 4Z8XA 4ZKEA 3BN3A 4KNYA 5IVHA 3EVZA 3KKEA 1CUWA 4QRHA 1OPXA 4DCNA 4TWJA 4C5CA 3H9GA 2Z6QA 3TL2A 2PA0A 3VPBA 4QPNA 3AEUA 1V8FA 1Z0DA 1N8NA 2IDKA 2PRYA 1RP7A 4MCJA 2QTCA 5CCDA 3WLSA 2EYUA 5JJBA 3F1KA 3PD0A 3MCWA 2H5IA 4GVLA 4LGCA 4EI9A 4LJSA 4UHBA 5FI1B 1L5YA 1BFUA 4LQDA 3O1LA 3UEOA 2VQDA 2EARA 1YL7A 4IP0A 3RYHB 1C7QA 5JPIA 3V7YA 1KIFA 1QGYA 1M33A 3D3WB 4O4IB 3TKYA 1X9GA 3OOWA 1UM9B 2IKSA 3QBEA 3QRWA 1P62B 2ZRKA 3CUWA 1LJUA 3PHIA 3TRFA 3A6EA 2VSNA 3BTOA 3X1JA 1C3EA 2JJQA 3RSGA 4UZSA 5EJEA 5GGXA 3ZGLA 4B83A 4G9BA 3V34A 4TLCA 3QU5A 2UV8A 4YAGA 2JIDA 1ZOPA 3EXHC 1C1XB 3TSAA 1V9SA 2OAEA 1EX1A 2ADOA 5CEFA 1U9IC 1S3FA 2OM6A 2VKQA 3MWDB 4WHMA 3UT6A 2A6PA 1MW9X 1QTRA 3JWIA 1B74A 1DBQA 1YB1A 5ILGA 3Q9NA 2PGJA 2GLUA 4PNZA 4XB6B 1GZ6A 3AXTA 3D3KA 1O5TA 1QP4A 1JDZA 1EUDB 3BK1A 1MZVA 1NQTA 4NBKA 3AUSA 4DGSA 3S5UA 2PRIA 4CM8A 5FD8A 2AC2A 1N33B 4UUMA 2QMHA 1P4SA 1ISJA 2HJGA 2QT9A 2Z4TA 1KQFA 1GSHA 1A5BB 4KG7A 2ZWAA 4UNPA 2ZE5A 2P6RA 1FX0A 5HIIA 1DMRA 1QU3A 2OZPA 3IMGA 3GEPA 2OR3A 4HH1A 1PR9A 3WLEA 1FJXA 3F96A 3CLRD 1JAYA 4D98A 1NUPA 3DBHB 4DJAA 2ATCA 5BUQA 2Q6LA 3L5KA 4B3IA 3LSTA 5JCZA 1VA5A 2VP0A 3HKBB 1ZYUA 2IZ0A 2A67A 3OX3A 1TT5B 2HF9A 3R75A 221PA 7MDHA 3C48A 1SXJD 1LJ8A 1NL3A 2CD9A 4P7FA 3JRXA 3A70A 4MRAA 4U5QA 1N9GA 4WBSA 3H2KA 2BISA 3MD9A 4CIAA 5JAHA 4X54A 5AHOA 1XCPA 3CIOA 1KFJB 3UC9A 3V4VB 1NUQA 4AX4A 4C14A 4ALMA 3EG5A 5ECDA 1SELA 4V1CA 3E9RA 1J2YA 1NPYA 4ZMSA 4FKMA 2WAYA 3UPDA 3ZZ0A 4CV2A 3NYRA 1SY7A 1KBQA 4OX9B 2WOOA 3ISJA 2GBFA 3G6KA 3K5HA 5BORA 2B25A 3H1EA 4TKUB 4WI1A 4M9SA 4Q9KA 3RD5A 2XGOA 3P2MA 4JBHA 5GONF 2R1UA 5J63A 5B2ZA 4E7PA 1E8DA 1UQRA 1Z6QA 3V55A 2BGLA 1ZNWA 5BO5A 2QIOA 2CJXA 2O1WA 3KEFA 3W8NA 2HN9A 4QBIA 3RK4A 4V39A 4OI0A 4G8BA 3NHKA 3JYHA 1VOTA 4CYMA 3KJHA 1NBMA 3OJ0A 4JDUA 4D1YA 1L7OA 4XIJA 1XZPA 3W06A 4ZQCB 5FF9A 2C57A 2IRWA 2DFNA 2NVUA 3AGPA 3KK0A 3NANA 3FHTA 1Q3KA 4C06A 5ALZA 4GXQA 1OX6A 3HPRA 5DHPA 2SKDA 5C2JB 2TMYA 1OXXK 3OF2A 4WJKB 4HNUA 3OM1A 4IPTA 2J09A 2MYPA 2ZRCA 4KO8A 3QG1A 2PJRA 4EABA 2ZYGA 3ADBA 1NA5A 3BERA 2Z5LA 5F2NA 1E2FA 4ZEMA 2NADA 2R8OA 4FUQA 4CIWA 3VU9A 2XB2A 3F3SA 3KB8A 3P0FA 4MQEB 1T4BA 2QX7A 5DWDA 1P72A 3Q5DA 5AM1A 3OJXA 4MJXA 2PSDA 4PW0A 3KKMA 3BIXA 3ILVA 2MR5A 3BHNA 4JIMA 5JSZA 1E59A 1PS9A 1YL6A 3N87A 3ZLVA 1W0KA 2WF7A 3G2LA 4R9VA 2A94A 2YWHA 3LQRA 3SAJA 4AF7A 4IDQA 4J1QA 2IHYA 4RGVA 4BNIA 1QM5A 4U8HA 3COZA 1DTWB 1J49A 5J4LA 3ANSA 5KX5F 4A6XA 5FL7A 1EB9A 5E6UA 2A59A 4NXMB 3W6NA 4HP8A 1QB8A 1DAOA 4GU5A 1IOVA 1NT2A 2IOYA 1GLNA 1QZUA 1R18A 2HU5A 3H42B 1Y1PA 4CTJA 2X2FA 1ZNYA 3HI4A 2DHRA 4LYEA 5LFAA 3Q7IA 3EWNA 3ETGA 2W98A 1EZZA 4UDYX 3TLKA 3GLTA 5B5SA 5JIBA 2W2LD 3M4YA 2CLIB 3BXZA 3NHAA 4PC7A 3HDJA 3H87A 5D87A 5JCXA 3GA7A 3UB2A 1O9BA 1V2HE 4RQBA 3W8FA 1NVKA 1EWKA 4MMZB 1RMTA 1FSZA 2BEVB 3J7AC 1IQUA 3DHNA 1GUDA 2D0OB 1X7ZA 2AJTA 4PAOA 3TI9A 2Y0DA 3ZCPA 5BUZA 1V7ZA 2H65A 4G0ZA 2GAIA 4CMAA 1K5HA 1PWEA 2BFCB 3UJPA 2AMFA 3K73O 3P45A 5HUJA 4FHFA 3L92A 4OD0A 5LQAA 1YBFA 2C5LA 1UMCA 1NQXA 2HBQA 2V6BA 2J8ZA 4QXAA 5EIAA 4XJXA 2KI5A 3P0RA 4JLVA 3WIVA 1V8OA 4JH0A 4JLNA 2H57A 1VG9B 2HMYB 3UXHA 2HQ1A 4IDAA 3RTCA 4FDUA 4R7TA 3K3PA 3AC0A 3L49A 3I0NA 2QRMA 1E94E 2Z3WA 3IAXA 4G56A 3DEAA 2V7EA 1CR4A 3CV3A 1O4VA 1OLXB 2FQXA 1NLZA 2CVQA 5D3MA 3NHWA 5J23A 1YC5A 5AVJA 1CEYA 4P22A 1ZGHA 1V8ZA 2ORVA 3KAPA 4G2NA 4YA6A 4DA0A 4PR0A 4G63A 5JH7B 4FCTA 3SJBA 3X1MA 4AJHA 4LC9A 3PT9A 3RH0A 1C0KA 3WYAA 3Q2IA 1MAHA 1EXMA 1Z63A 4HWSA 4HAWA 4PNEA 1PFYA 4GZMA 3RS0A 5HCIA 1N2CE 1RXSA 2Z58A 5JVDA 3CE6A 3SQXA 2Y1OA 1W93A 3W3AD 4KNVA 2JFWA 4GPTA 4DIKA 3JQAA 1QNLA 2YV5A 3P2YA 1BMFA 1VC2A 3MGGA 1NIPA 1WCV1 4ZI5A 1C29B 3IBYA 4QM6A 2DB3A 1ZC4A 3KDSE 3SSMA 2ZWVA 2ZUSA 1W4ZA 3JSAA 3OJLA 1N2HA 1H0HA 2FUEA 3QH4A 2VXBA 4TMXA 4DMLA 2GZAA 2OV8A 1NY5A 4ZXFA 2GI4A 5B12A 5KNDA 1PVOA 3C39A 1ZXLA 5EXEA 3RJ9A 3WB2A 3UHPA 4UTNA 2FSPA 1N3BA 4YRRA 5H82A 5JS6A 2AZXA 4DMMA 3FI9A 1BTOA 2PQ6A 2Q4RA 2HWXA 2QUAA 3HCOA 5H4HA 4OHXA 3VAYA 1G1AA 3VR3A 4RPGA 5JEDA 2D7JA 3PDJA 2NZJA 3TNFA 2B0CA 3T61A 1OFGA 2R7NA 2XXAA 2H2IA 1V41E 2C59A 3W8DA 5KTOA 4JOBA 4QVKA 1BGWA 2A14A 1HZJA 1UR5A 2EX0A 3B9RA 4YV0A 4HFRA 4KRGA 4PQFA 4JL8A 3KZVA 4AJ9A 2ET6A 3B53X 4G8CA 4EPRA 5E4TA 4GWGA 4QG7A 1CR2A 1JVNA 2D1SA 4XFDA 1U7WA 1WSDA 1Y1SA 2PS3A 3JQ7B 4A27A 1X87A 3MTAA 2V4ZA 3HDQA 4BE4A 4Z4FA 1DBRA 3OEHA 3R6LA 5DNWA 4BX0A 3HWSA 3A27A 4KVFA 4YJ3A 3A1NA 1KJYA 3ZV7A 4C89A 3R7SA 1PEKE 5P8WA 4WVLA 1BW9B 3K30A 3ONEA 4KQKA 4KR6A 2ZPUA 1GPAA 1ZHFA 4WN3A 4RJIA 4EG8A 1V35A 1WDKA 4JI8B 3AF3A 2Z2IA 1JIQA 1GXSB 1RWNA 4PLWA 5H1YA 2BR5A 4TLEA 5SICE 2G7ZA 1Z38A 3TNLA 1KEPA 1IRXA 1FFHA 2JBWA 3HQ4O 3P0HA 3QUQA 4MKGA 2HSWA 1VDMA 3SY8A 2WFAA 1JHPA 5B58T 5KREA 1C3XA 4QYMA 3IQHX 4C20A 2I1QA 4D5EA 1YASA 4UTPA 2FB9A 2C96A 2ODBA 3EZXA 3FDZB 3WOVA 3VR6H 4CU2A 5IYZA 4NCIA 1Z0ZA 4BWFB 3MPOA 2BLNA 4WCDA 2ZXUA 4A8PA 2PZGA 3FPGA 1QFJA 1TTTA 4EKIA 4M1ZA 2IUEA 5K8CA 3O3NB 2P2ZA 3CW8X 4KXNA 3WSTA 2JAQA 3H16A 3A6DA 2JLRA 5JWRA 3O92A 2O2ZA 3PRJA 3JAWB 4MLCA 3WZLA 1FP4B 1W94A 2RHGB 2DQ4A 2PUDA 3HA7A 4B76A 1SG9A 4C76A 2ONKA 1DCKA 1LVGA 1RBQA 3HJNA 1VZ3A 4MRPA 3HEBA 3MXTA 1ID1A 2HCFA 4BQIA 3VU0A 5H8WA 1H4QA 1JLSA 1CUUA 1JMKC 4N7JA 4URVR 1MV5A 1JR4A 4XPIB 1D04A 2WWFA 1EFRD 1TMOA 3R0JA 1XO1A 2EEZA 2ILVA 3GLHB 3H6KA 1ITZA 1MRZA 3FPEA 5U9CA 5BR8B 3R3VA 1ZISA 3INNA 3UMFA 4DDKA 5C53B 2F3QA 5BPFA 3GR6A 4LXGA 3JAWA 4XGRA 4QJ3A 1BE0A 3E7PA 4JITA 2ACWA 4U9IS 3RC9A 1PJ2A 4BNFA 1T0HB 3GFTA 2QL5A 1E1CA 2BJHA 1X70A 3D3NA 3TQHA 4WUTA 2HT6A 2J6HA 4DG5A 1CUFA 2E49A 3NWJA 5HIMA 4K3UA 4J2HA 3LHKA 1Q44A 1JFLA 2I4NA 3QIVA 4IH9A 5DISB 3WGUA 3TI7A 4M38A 3TMYA 2W71A 2OVFA 1UH5A 2C78A 3GARA 1I1QB 4YONB 2PBZA 3QV1A 4F85A 4IEIA 3I42A 1OH8A 3V9PA 4RQTA 1E3IA 1U7OA 2EFGA 2OXRA 1E1DA 3B3QA 3F3YA 1ZW6A 1U3TA 3GGSA 2C2OA 1GZUA 1IE3A 4RA6B 4CMJA 1RPJA 3BL8A 5CVTA 4K0KB 1O08A 2HRDA 3R8XA 2Y2VA 3F47A 1DELA 2CXRA 4EPVA 5IXJA 2AG0A 2QLLA 3HBFA 2CYAA 4RY9A 5JSUA 2WM8A 2GD1O 4H0FA 4FWTA 2HNAA 2Z4RA 5AUQA 4MS3A 4P4UA 2P41A 1I6WA 1IM2A 3PKIA 3S1AA 1H42A 1P4GA 3O75A 3LBAA 4GR4A 4PHHA 1LC3A 2NM0A 3HR7A 4FNGA 2JGKA 1LQTA 4FOOA 4NG4A 5E9AA 2I6FA 2HCJB 1IOWA 2QRUA 3FRHA 2OBYA 3HUUA 1HSOA 4UEJA 1PZHA 2GBCA 4WKNA 4XKJA 3CF4A 2BT4A 1L4GA 1KMHA 1P2TA 1GZDA 2VATA 1Y9JA 3C7KA 1FU8A 3FKQA 1GZVA 3AL2A 5BN5B 2PSEA 3LBHA 5B7QA 4B6FA 2HPZA 4RQAA 1F4PA 1P7VA 4TRRA 2O8NA 4AYTA 4LVCA 1E7QA 4IXTA 1ZVVA 2ONCA 4PC1A 2ZYRA 4AKHA 1A88A 2AYYA 4BLQA 1KEEA 4W1PA 1F7VA 1SBNE 2BF4A 2ILTA 3HB1A 3A1DA 4UC0A 3FZQA 2J08A 1PQ4A 2VDKB 2HLHA 4RMGA 4L08A 2XCLA 4C1BA 1I5EA 2BJWA 2JD0A 5F7ZA 4HO1X 1P77A 4ND8A 4B3BA 3E7FA 4F9GA 4ETNA 1EQAA 3VTZA 4AZ3A 5AVSA 4D4MA 5IC6A 2D2FA 3O84A 5LYJF 4F3TA 2VPZA 2AA3A 1FMTA 3K15A 4G5SA 1G5HA 2QLBA 4Q4CA 3NHBA 2FN3A 3UOWA 4D79A 2BFMA 2QMEA 2ZUWA 3B6IA 5DHAA 3U13A 1A8UA 3H19A 1XAIA 4CKEB 3P7MA 3TE7A 3OLXA 5ITZB 2VP2A 2I7VA 3REFA 2WTAA 3HV0A 5EAIA 1P6XA 3ZHZA 5F73A 4C2BA 3KYCB 1N0IA 1H4TA 4Q4JA 5GY7A 1I5RA 1NOJA 1RAGA 2JAPA 4ND8B 2IIPA 1JLKA 2V55B 4NFLA 2XB4A 1QPGA 1T25A 4DC1A 4QTYA 5C4IA 5KC9A 1GFWA 3K5WA 2PEZA 1DJNA 2GYVA 1KRWA 2W93A 2QZJA 1SXGA 2HD4A 1D0IA 3DMHA 1E92A 3KPVA 1JR3A 2FOXA 1HG0A 3EODA 4QYIB 4E30A 4E2YA 4MK4A 5AVYA 5I51A 3UTDA 5SZKB 1T8WA 1ZR4A 1K8ZB 2GSWA 2P9CA 3I5XA 2FEKA 2GM5A 3R9IA 2G9RA 5THXA 2A4MA 4YS6A 3IJEB 2E2WA 3IRUA 4PFSA 2WUEA 1WPRA 1NVUQ 2QTHA 2JBAB 3AM1A 1BN6A 1QHYA 2XIQA 3DHYA 1JDTA 5A4DA 5I4BA 1W0JD 5IMSA 1LSJA 1I32A 2VJLA 1K2VN 2BGJA 2X3UA 3FFBA 1Z7GA 3MRSA 4LNUA 3PPIA 4UEKA 4ZPXA 3SFVA 2H2HA 3TAXA 1EJ6A 4MP6A 2GF2A 1R15A 4IUYA 4FR2A 3TTUA 4EKGA 4EPTA 2RGWA 3DG9A 1RI4A 1EP2B 1WMAA 3HFGA 1LWNA 2P6NA 3PZRA 4YAOA 1H8HD 2WABA 2Y8EA 3T12A 5JY1A 2I2WA 2P6OA 2JAWA 4PFQA 1RHMA 3G8CA 2WSSA 1TZCA 2I91A 2CHGA 1PJCA 1RHJA 2TMGA 3IOBA 1WUKS 3O47A 4N3AA 1DEOA 4TMVA 2IOFA 4LJ8A 2IPNA 3ZE8A 1WB5A 2OAQ1 4HGZA 2FPGB 4YJ2F 1UJ4A 4DY4A 2FRVA 3HLYA 3WISA 1A9YA 4R0VA 1BMFD 2J87A 4V02A 2QAGC 2TS1A 2E4WA 1XA4A 4H7EA 5JAQA 5BR4A 4CWAA 5I7EA 1XZQA 2ZUDA 4GEKA 3LVFO 3R9KA 3QKWA 3VO8A 2BW0A 2CXQA 2XWPA 4MVJI 5EIOA 3ZNQA 3A6JA 3ELWA 2NAFA 2Q6OA 4UTOA 1RLIA 3Q3VA 1Z2PX 1LNSA 3TAUA 1PJ4A 1ORDA 3FNEA 3N2YA 1C4XA 3ZLUA 4ZYYA 3HKBA 4UCXA 3ROXA 4K6CA 1KTVA 1ZM3A 3AETA 3DBIA 3IUYA 3E0QA 3OM8A 3L6EA 4PONA 1DKNA 2AG1A 1A76A 3HCBA 1SXJC 1FRVA 3FOBA 1UPBA 4PN7A 4IM7A 2JDIA 4D4LA 4CU5A 1DINA 5CURA 4DSTA 2QUHA 2C84A 1NYTA 4RSGA 1LX6A 1Z15A 5LSAA 4NI5A 1TKAA 1JSZA 4JYPA 1TRHA 5K4AA 4CM9A 5CDSA 1G7CA 3MBIA 1CUCA 2AQHA 2I8LA 3MUEA 4LFCB 4C7OA 1Z33A 1IMJA 1QOZA 3LHIA 1HGXA 1KGSA 3EPHA 3OESA 2GHRA 3EUEA 4G1VA 2PUFA 4O8ZA 2BN4A 5DOVA 3Q3IA 3K70C 1PFWA 1V1MB 4F2HA 3CH4B 9LDBA 4TUYA 3EVAA 3AB7A 4QLAA 1J21A 5HDQA 4UAGA 1K8XB 4YDSA 1TFRA 2XKJE 3DDSA 2VF5X 5DGTA 2QW0X 3JW8A 3RFUA 4GGMX 2G6BA 3AL0C 1XVIA 1UBTS 1ECCA 3BX1A 3MB8A 1OR8A 1YV9A 1C7JA 2PZAA 1KVSA 3OEEA 4G5HA 3ZH2A 3IIMA 4FSHA 1XCJA 4KYTA 2Q9AA 3RNOA 2ZDGA 2C9OA 2P9TA 4F3NA 3PQFA 4H0NA 2CLKB 1M1NA 4YGXB 1XU9A 4D4HA 3KLMX 4Z51A 3QVUA 3C85A 1HTTA 3QBDA 3CU5A 4HDKA 4DQLA 2VNJA 2G5CA 4BB6A 1ECFA 1A9TA 2Z5VA 1JIIA 3IERA 4Q12A 4EJMA 4FGKA 4ZZIA 3CBQA 1NBME 3BAFA 5I01A 5JXWA 1T13A 3RVMA 3DE4X 4KMOA 3G0IA 3OO1A 2X5OA 1G8MA 4IRUB 4RVNA 2B9VA 2YIJA 4LZZA 4O4LA 5C8YF 2QUKA 3QLTA 4URXR 4YP6A 3P2JA 2NU6B 4I8IA 5TRTA 4KBYA 1HE5A 3LDUA 1D09A 1QHEA 4QXRA 2QX9A 4QM7A 1ZOIA 3D7KA 3MAAC 1X38A 4FOTA 1L5SA 2H4WA 2ZWIA 4N54A 1U5CA 2X9LA 4B0OA 1IXYA 1TYEB 2WAOA 1U0FA 3AEUB 2HMWA 4LZJA 3H97A 4OP3A 2G17A 4FMCF 3WJ2A 5C1DA 4KHPB 4RIEA 1K5PA 1KOFA 3DV9A 1XF1A 2G88A 2OWEA 3U0VA 4E70A 1ZD1A 4MROA 5HK8A 2QPLA 3MLAA 4WEQA 1NMEA 4WINA 2ARKA 3FWYA 1ODIA 2OM2A 1BCRB 2EQAA 4XQGA 3V48A 1RQRA 1YDGA 1PEAA 3UOAB 4POOA 2C3OA 3WYDA 3ASVA 3FMVA 3ZQ6A 1DAEA 2F59A 2FRDC 2PO7A 3KCNA 1NXWA 1JPVA 1NU6A 3PXXA 3R5HA 3D7RA 1FP1D 1NX6A 2Q5QA 1TYBE 1TMGE 1TQDA 4I1VA 2O2GA 4ZD6A 1E2GA 1FLVA 4HGRA 1SA0B 4Z9YA 4GMDA 3Q6NA 1F8UA 3OA2A 1FVXA 1TU3A 2XWQA 1UKVY 2H51A 2GZRA 2JIZA 2IXGA 2WLTA 1Z0AA 1DDOA 4HH0A 2R2AA 2P9ZA 1VP3A 1DRKA 3URMA 3K4HA 3EH2A 3UMVA 4C6RA 4R2JA 2FZKA 3TRHA 1N5KA 1EFLA 1ESMA 1QHGA 2BHTA 2J33A 1PD1A 4KODA 5GADl 1Z83A 2ISCA 2O20A 3EBOA 3OG9A 3OICA 4H15A 5LYJB 2ZBUA 4U2BA 4YROA 5BQPA 3QYFA 4NBVA 5FUXA 1COWD 4OHYA 2WTMA 1NYRA 1ZGZA 3I5MA 4RO0A 1P0PA 3K4PA 1DCMA 3ZIAD 4XYLA 2NP6A 2AR7A 4UREA 4Y2RA 4A8JA 1GGVA 3R6GA 4J9VA 3TFWA 3UPTA 2A7XA 2CLMB 4HS4A 5A2GA 3P9YA 2O5RA 2AWOA 2PFSA 5K9ZA 1E4EA 2O2XA 1I30A 3WWEA 3X1ZA 4F4UA 2H08A 4HK4A 5BRNA 3ZU2A 1FZTA 2XZOA 5AP9A 4BDSA 5JH7A 1IY9A 1VGVA 4LXQA 3HUEA 3V7FA 4CT5A 3T1YB 5T64A 1YJAA 1JQ5A 2OCGA 3GN2A 1QTQA 1T3GA 3ZD6A 2ADFA 3WO1A 4O2BB 5J43A 2WU3A 2GDJA 2C88A 2HMVA 3QHQA 4WOPA 1JXAA 2HBZA 2QL9A 2EIHA 3VTFA 2H31A 3AR6A 3OHSX 2QRVA 3C5VA 2XYGA 1W85A 5CLIA 1BEEA 2Y0EA 1P91A 2IYRA 4BX9A 1XSEA 4LRSB 2CJFA 1JEEA 1T8SA 2PMEA 3KR1A 2E5LB 2B99A 2DWCA 5ER9A 2F9FA 4XGIA 3SHQA 4OYRA 1JYEA 1BWQA 3ORQA 4P35A 5CM8B 5ARBA 2DERA 1EWYA 2EZ8A 3TAHA 1L8XA 2WW8A 1Y1LA</