5ENZA

S. aureus mnaa-udp co-structure
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
376
structure length
365
Chain Sequence
MKKIMTIFGTRPEAIKMAPLVKALEQEKMLEPIVVVTALDSVLSTFEIKPKYDLNTLSEITSKSITQLEQVIQLEKPDMVLVHGDTMTTFAGGLAAFYNQVPIGHVEAGLRSYDKYSPFPEEVNRQLVGVLADLHFAPTKNAASHLLSEGKYSESVVVTGNTAIDAMKYTVDDNYKSNIMDKYHDKKFILMTAHRRENIGKPMENIFKAVRRLIDEYTDLALVYPMHKNPKVREVAQKILGSHDRIELIEPLDVVDFHNFAKKSYFILTDSGGIQEEAPSFNKPVLVLRSVTERPEGVEAGTLKVIGTNKQNVYQAAKELIDDERLYHQMSEASNPYGDGFASERIVNHIKYYLNLITEKPSDFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Genetic Analysis and Functional Characterization of Staphylococcal Wall Teichoic Acid 2-Epimerases Reveals Unconventional Antibiotic Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords UDP-GlcNAc 2-epimerase
total genus 144
structure length 365
sequence length 376
chains with identical sequence B
ec nomenclature ec 5.1.3.14: UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing).
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5enzA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5enzA02
5TVGA 2AV6A 1JIVA 3OTGA 3CUVA 3SYRA 3AMVA 3SYMA 3MS4A 4BFCA 4GZ3A 1L5WA 2FFRA 1NOKA 2PRIA 1A8IA 1GPAA 4NC9A 1P2BA 1UQUA 3FROA 3IA7A 1YA6A 2AMVA 3QHPA 1FTYA 3L7CA 3NCHA 2G9UA 1K08A 2SKEA 4G2TA 4RIFA 1JEJA 1Y6FA 4YI5A 1NOIA 4EJ2A 4KQMA 3NC4A 3MS7A 3WC4A 3L7BA 4AN4A 1L5SA 3HBJA 5TMBA 3CV3A 2H1HA 1AXRA 1XV5A 1WW2A 3GUHA 3CUYA 2IYAA 2VCEA 3S29A 2BFWA 5GPBA 4KQ2A 5LQDA 2QRPA 4QLBA 4NEQA 3S0JA 4WACA 1ABBA 2PQ6A 2SKCA 1XOIA 2JLBA 2YJNA 8GPBA 2HY7A 2P6PA 3HBNA 2ATIA 3RSCA 3ZCVA 1Z6QA 2X6QA 2IV7A 4AY6A 3HBMA 3VUFA 2QLLA 3BD8A 1FTWA 1L5VA 2QN8A 1P2GA 3WADA 3E3OA 3ZCTA 1L5QA 3E3LA 1UQTA 1C3JA 1LWNA 2QRGA 3H4IA 3MS2A 2R4TA 5HXAA 4AMGA 2X6RA 3O3CA 2H1FA 3EBPA 1YGPA 4Z5XA 3GPBA 1JG7A 4RELA 5I45A 4LDPA 1P29A 1FA9A 1IXYA 2IYFA 2GM9A 4N3AA 2XCIA 3CX4A 4EKEA 3BEOA 2VG8A 3D0RA 4N39A 3CUTA 3OT5A 3C4QA 3DDWA 5JTUA 1PNVA 3RT1A 3NB0A 4PQGA 3WAGA 2FETA 2BGTA 3CEHA 5TMDA 1KTIA 4L22A 4BQFA 2R60A 2JZCA 2IV3A 2ACVA 3OY2A 3OY7A 3PE3A 1K06A 3OKCA 1P4HA 2GT1A 1GG8A 2QN2A 1E1YA 3RHZA 3T7DA 2QN9A 1L6IA 2C9ZA 4AMBA 2XCUA 2GPAA 2XA9A 4W6QA 2JJMA 3S27A 2X0FA 3BD6A 4RIIA 3COPA 3BCRA 1PSWA 3PE4A 3BD7A 2ECPA 2G9VA 2XA2A 1WUTA 4X6LA 3RSZA 3T3IA 1QKJA 4CDRA 3G2LA 3VUEA 3NAZA 1FS4A 3G2IA 2X0DA 2SKDA 1RRVA 4GYWA 3VDNB 3T3GA 4GYYA 1C8KA 2R68A 1B4DA 5D00A 1QM5A 3EBOA 3C4VA 3MSCA 3G2KA 2BISA 3OKAA 3ZCRA 1JIXA 3DD1A 1FTQA 1P4JA 1Z6PA 4RBNA 4N3BA 4BQEA 1LWOA 3VDMA 3QKWA 2ACWA 3MRTA 3T3EA 2QN3A 3L7AA 1L7XA 3OTHA 1F6DA 3CEJA 2GJ4A 4F96A 3ZCQA 1SXQA 1GPBA 4GPBA 3MT7A 3BCUA 3D0QA 3D1JA 5JTTA 2AZDA 3S28A 4WADA 3ZCSA 1GPYA 5IKOA 1NLMA 4XI9A 1JIUA 4AY5A 1RZUA 5D01A 2IUYA 1WUYA 2PYDA 1GFZA 3BDAA 1P4GA 1FU4A 4M83A 1V4VA 4BQIA 1C50A 1XL0A 1FC0A 3H4TA 1GGNA 3MT8A 4FZRA 1WV0A 4NESA 2F9FA 3CEMA 4KQ1A 1Y8ZA 1UZUA 2QN7A 1F0KA 2G9RA 1FU7A 2IEGA 4HLNA 3MRVA 3G2NA 3NP9A 9GPBA 2ZB2A 4XIFA 3ZCPA 4YUAA 2R4UA 1AHPA 1NVKA 1NOJA 2F3SA 1WV1A 3DZCA 3UYKA 2XGMA 3T3DA 4MHSA 1Z8DA 1JG6A 2F3PA 5TMEA 2IEIA 5IKPA 3MBOA 2GEKA 4MRAA 1PN3A 2BGUA 1Y6GA 3MTBA 1SXPA 2GPBA 3MT9A 1XKXA 3ZCUA 4EL5A 4M60A 1RZVA 2QZSA 3TOVA 3G2JA 2QRQA 3OKPA 1BX3A 3MTAA 2XMPA 3L79A 2F3UA 1PYGA 4N3CA 4X7RA 2O6LA 4RIHA 1VGVA 1M5RA 4MHOA 1NZDA 3Q3IA 2AW3A 2GPNA 4CTNA 1FU8A 5BNWA 3L7DA 2WTXA 2XA1A 1XL1A 2XGSA 6GPBA 4REMA 4LEIA 1C8LA 3BCSA 1XC7A 2QNBA 2G9QA 3Q3HA 3UYLA 2R66A 4RIEA 3OTIA 4F97A 3MTDA 3NPAA 5ENZA 4F9FA 4X7MA 4X7PA 3NP7A 4MI9A 4MI6A 5DU2A 4CTOA 2C1ZA 3T3HA 7GPBA 3T5TA 1GZ5A 2QLNA 1HLFA 3CUWA 3S2UA 3G2HA 2PRJA 3Q3EA 1NZFA 4YI3A 2QLMA 1E4OA 3HBFA 3IAAA 4RIGA 2X0EA 4M7PA 2Q6VA 2OFFA 3L01A 1Z62A 5C1DA 2C1XA 2IW1A 3TAXA 1L5RA 4MICA 2QRHA 2PYIA 3TSAA 2F3QA 3CUUA 4EKYA 4FKZA 1P2DA 2GEJA 1J39A 2VCHA 4RENA 2C4MA 4CTMA 1WW3A 4WHMA 2FF5A 3DDSA 2VSNA 4HWGA 2XGOA 2QN1A 3E3NA 4MI3A 1EM6A 5DLDA 2KS6A 2QRMA 1EXVA 4EL0A 2ASVA 3MRXA 4N9WA 1O6CA 3C48A 1IIRA 5DXFA 3MQFA 4GZ5A 2VSYA 4GZ6A 1H5UA
chains in the Genus database with same CATH superfamily
1R16A 2PNFA 1Z6XA 5LQCA 1GQOA 1RQPA 2YYZA 4UULA 5K8VA 1ORIA 4PW0A 3MHPA 3QLUA 2QQ5A 1Z4NA 5EJ9A 2W71A 3CUVA 5DGIA 4TKUB 3NMUF 2XUHA 4F3TA 2OA0A 3U4HA 4OIFA 3P2KA 1SPXA 2WP0A 3MWJA 3AF3A 4E7PA 1TT5A 2GN8A 4HZGA 1N1EA 5JCPA 3OF2A 3CR7A 5I3CA 2IZ0A 3U60B 1B15A 1DC3A 3BGSA 1L6RA 5KJ6A 1Y6FA 2WF8A 2XF2A 4UU1A 3O4GA 2XTJA 3VTFA 3WLFA 2PZ8A 2PUBA 2O2ZA 4N3GA 3V4SA 3DDCA 5AHWA 3UW1A 4JLDA 4C0QC 1V11A 2AZ4A 2Q1WA 4HY3A 3RR2A 5SY9A 3D8HA 4ZOBA 1TVMA 3B51X 3LQ1A 3QUCA 2ZE6A 1D2GA 3EXG2 2DERA 3E8SA 4HQ6A 5CAEB 3CVYA 3AUSA 4GH5A 3T5MA 1AQIA 3TLXA 5JBIA 1KVQA 2XKBA 3D8NA 5HVNA 3WJ7A 3V7YA 3D4OA 3OICA 3A7DA 4L15A 5ETJA 1OLSA 1WY7A 3JU3A 2KBFA 1OH8A 4PM4A 3N5CA 3GG2A 1NVXQ 2BGGA 4LVNA 1Q1BA 1V4BA 3GEDA 1BDJA 2BOVA 5EQFA 4C6HA 3R0JA 2RBKA 4YGYA 3SHVA 3FKSD 1VHLA 1KARA 5D85A 3EVEA 3IMFA 4DUGD 1PLKA 3D64A 3NANA 5JZVA 1EHYA 4KQMA 5T57A 1RHQA 1CRLA 3HU5A 5EYPA 2O0HA 4F91B 1FNCA 1L7AA 1N2IA 2JGNA 4LOHA 3L43A 5H4HA 2D3WA 5HOEA 1DQNA 3HBJA 4OMDA 1UJ6A 4IIFA 1U0JA 1OC2A 2WSMA 3C15C 3G17A 3KQNA 5AKYA 4RKFA 3HHPA 2Q7OE 2BT4A 1SVUA 3LRTA 1R0YA 4L2IA 1BXRA 4TUYB 1H2HA 3VHLB 3M2PA 4A2QA 4DM7A 4PPQA 4DCJA 4O8CA 3IEMA 2W70A 3PI7A 4PZ9A 4FYJA 5CIQA 2FWMX 1F4LA 2R8RA 3L8HA 3LOUA 5FB3A 5HWSA 4MKHA 1ACJA 1OXTA 3D1LA 1QE0A 3KOUA 4CRWB 1AMUA 1DTSA 3DKIA 1Q1GA 1K5PA 4E5VA 3AKEA 5CVJA 1UINA 4G4JA 4YLYA 4PN7A 3D31A 3DMGA 5JS7A 4K1XA 1MP0A 4U3JA 4R0MA 2WSLA 1XD2B 2OKGA 2QUIA 3GXBA 2HRQA 1VA5A 1W4CA 1EP1B 1LDGA 2F9LA 3TTWA 3ZWKA 1QB7A 1B26A 3IMEA 4CIYA 3EWNA 5EXSA 2A0UA 1GDHA 1N2ZA 1ODKA 4HEA1 3KYDB 3RHFA 2OHVA 3H97A 3AERA 1DAFA 3KEGA 4H60A 3F98A 3UCEA 5DISB 2FPGA 5FJJA 1VIMA 3N7AA 1H2ZA 2EGHA 1JMVA 4R0NA 3VHXA 2Y68A 4ZQCB 4Z0PA 2Q99A 3A9WA 2PGLA 4Q19A 1TYBE 5HJ7A 1ZRHA 3UWPA 4DIUA 4ZVPA 4R9NA 1Z2PX 2FEPA 4BKUA 3GJ3A 3H75A 3HGQA 1XZGA 4OQDA 1QOQB 3UBTA 1CUWA 1U4NA 4GP7A 3KWMA 1SU4A 2YXEA 4E1AA 3P9CA 4EUNA 1YCFA 3T38A 4PPNA 2W2OA 3E1KA 4W1RA 1NSFA 2F3TA 4JDPA 4D96A 5BWBA 1N92A 2QOEA 4LQDA 1WZNA 3F5MA 4QX6A 4E2XA 1FVFA 4QICA 1XVTA 2G7ZA 3AVYA 2XUGA 3F71A 3GYGA 4P1ZA 5KTTA 2ZYTX 3Q0EA 4BX2A 1GGHA 4PRZA 2Q1XA 4ZV4A 3WWOA 2BYTA 4ZHSA 1AKVA 2JF0A 3IP8A 4QE3A 5EP3A 5C5DA 2EF0A 1K88A 2NO5A 4FFBB 3HYLA 4P22A 4B73A 1PQWA 4DNXA 3PDHA 3R7DA 4UAUA 3ZE1B 4BPBA 3ICCA 5A5VA 3EMKA 4QOJA 1F8GA 1MRNA 5GMOA 3H2JA 3AY7A 3U7QB 4RJJA 2OCPA 5BQ5A 3FYUB 4NV3A 1JFTA 3HSYA 4YRGA 1BDBA 3DVAA 4WLUA 5BUQA 4ABYA 4Z4GA 4I9UA 1Y4DE 3N8DA 3QY9A 3LTNC 1WHSA 1SBHA 2HWXA 4ADSG 4BB9A 1P1RA 2J7PD 4L1KA 2Z6AA 5LIRA 3IUPA 4Q9KA 1D6SA 4H7DA 3VZBA 3OLZA 2GBGA 3MCZA 3BBLA 4MR9B 4OHXA 2Y0DA 4XOUA 3PDIA 2QM7A 1E79D 2XNHA 2CNBA 2H2DA 3FYCA 4JNKA 1ZH0A 3N07A 3BHJA 3Q3CA 4IGFA 1RRPA 3O47A 4Y8VA 3S81A 1V6SA 3P2EA 1XZKA 4CM5A 5IAGA 4DUYB 4N76A 1GSOA 2Y92A 3V1MA 1E89A 1V1MB 1RC0A 4EG6A 2BGNA 2OBBA 3W05A 2VOEA 5FKJA 2IQIA 1SHKA 3OY7A 2V7TA 2X4GA 5HJEA 3AHFA 3DEFA 3PYXA 1GU1A 1Q57A 2DFLA 2F3RA 2GJSA 3LV8A 3Q2OA 4FOTA 1YE5A 2OHIA 2QVBA 3IPYA 3OKCA 3R5JA 2PXHA 3HR4A 5KNCD 1NUHA 3NWOA 4PZUA 2IV2X 1E6WA 1SR8A 1EE2A 4FEGA 5ED4A 1UZNA 4TZ6A 4OXQA 5HG0A 1L5ZA 1U8EA 3JQQA 4DARA 1WZCA 2ZROA 4M0KA 2G4CA 5C18A 1A7UA 1OH5A 5JHHB 1M10A 4UMVA 5ALJA 2C2OA 1WXHA 4OXYA 2XRZA 2Y1FA 2ZIAA 3DLPX 3DWEX 1T8SA 1KYVA 2O7NA 3LHIA 3WA6A 3HS3A 3L4JA 1E1MA 2VSXA 1PZGA 4DY6A 4NMXB 4WJLA 1POWA 3COPA 3P9QA 1EZZA 5ES3A 3ROMA 1TIKA 4I50A 3R3VA 4PSCA 5BUZA 3DBRB 4CV0A 4DF3A 3W6OA 2CDCA 5M04A 3PEUA 1IFXA 2N9UA 1R8JA 3D9QX 3AEZA 3PZRA 4P92A 1MABB 1NMYA 2YASA 5SV2A 4MW2A 3RE1A 4CG2A 4KC0A 3L6EA 1V8ZA 1X42A 1D1QA 3MQ2A 3WKDA 2P9JA 2C07A 3JD2A 3MPUA 1O4WA 2P4UA 3PICA 1FS4A 4YNBA 3TBKA 3VDRA 4R81A 3WAJA 2CSUA 4MS1A 3C7DB 1LFAA 4WD3A 3MUFA 5JANA 1E1RA 4N4AA 1ZUNA 1NJ5A 1R27A 2XB6A 5ITZA 2O1SA 3BRWA 2J33A 2RGEA 5F51A 2UZ4A 5D00A 4LOKA 2FW6A 1O7JA 5A05A 2V7XA 5JMWA 3MSCA 3ZTWA 4BLWA 3T7IA 3EA4A 4E33A 1F3LA 3K9NA 1OIVA 2P67A 1U28A 4OHUA 4XVUA 4FFRA 2OAGA 1PSZA 2EX4A 1G2IA 1IY9A 3TKAA 2F00A 3LVBA 2HU5A 3FOWA 3A4YA 4Z86A 3SNKA 4E15A 2B7CA 2GZAA 4ZRMA 5BWNA 1SC6A 1P91A 1PSDA 3O8QB 4WRRA 1MEJA 1K89A 1M2HA 3I52A 3RFXA 5FRDA 3O31A 4JYMA 1G4UR 2AFVA 4YUZA 3D43A 3EDCA 3VDMA 3O92A 1X1AA 1XJQA 4ER6A 5MN5A 4Z2AA 1UBNA 1FP2A 2BFCA 2GAFA 3DNFA 2P27A 4JEHA 1H42A 2FW9A 4BV2A 3Q88A 5FV7A 5KWJA 4YBZA 5ESWA 5LC1A 3LA8A 5KHOC 1FVHA 1BXKA 2C4UA 1LX7A 2YXBA 3KXDA 1UOOA 1Z25A 3CR3C 1L2TA 3UKDA 5KOHA 5J4HA 1VFNA 3MFQA 3T8YA 5TPZA 4X94A 5E4YA 5TGDA 1OW3B 4D8XA 2PZBA 4WNAB 2H1VA 1H93A 2Q3JA 3QELA 4YRBA 2Z0MA 4AUNA 1NLMA 1ZS9A 1GA1A 1Y3AA 2FVXA 1SXJE 3OE5A 3SD7A 1BGVA 2IUYA 1FB5A 4LNUA 2CLMB 2DUJA 2CLLB 3OPVA 1GR1A 3AXSA 4RLFA 3WMGA 4RLSA 1LDYA 4D42A 1XIVA 3H0CA 2FG6C 1WE2A 4OK3A 4Y6RA 1OFVA 3Q9SA 4BBAA 3LBAA 5ALLA 3GH3A 3SE7A 4M1ZA 4AS1A 3QH4A 2IYVA 1V16A 4HAVA 1NMQA 1VMKA 3T9BA 4IDBA 3B48A 3U48A 3V7UA 5KOYA 1XNRB 1UXOA 3CO5A 1R4MA 3N70A 1Y34E 4Q3KA 4PS0A 1NXQA 5EYPB 3IA2A 4EB0A 3TAUA 3E2IA 5JBNA 1DIBA 3B2QA 5AUPB 1TTTA 4JLVA 1K7XB 2E7ZA 1RM5A 4J0FA 2I6GA 3WP1B 2WMDA 4FGUA 3R9KA 4HLNA 3X1ZA 5FI0B 3TE7A 1JT2A 5FQNA 3BCHA 3DOEA 4BU0A 1KEZA 5FH9A 2QF7A 3RWBA 2DGDA 4EJ6A 1SBIA 3L7NA 3RYCB 1ITZA 4G5HA 4DA4A 1SMKA 1C7RA 1NMXA 4QNRA 2CD9A 1ZESA 1DG3A 4XIFA 4ZU6X 1OZFA 2WG1A 3ZCPA 1MJGA 2R1ZA 4BP9A 4M54A 4PLHA 1HDGO 1TLFA 1DHTA 4G0MA 1U7UA 4DQVA 4OPMA 1QE3A 1UT8A 5B3JA 2OGWA 4YP6A 2NPFA 4ISBA 5AI4A 1UDBA 4EW6A 2R3SA 3GGGA 2R2GA 3JZFA 5I5EA 1IBCA 1X70A 3ADKA 1CRPA 3UT5A 4U2KA 2OYSA 4X8MA 4WOJA 3ORHA 4KVZA 4C1NA 2CJFA 1RRMA 3DLIA 1PJ2A 3WL8A 2ZI3A 1B7GO 4P4NA 3OBBA 5FBHA 4DIBA 2P9TA 3BH6A 3GDOA 5B3JC 1UJMA 1WLYA 3FBGA 3TQRA 2B83A 5FADA 3OOEA 1RQLA 1L4NA 3K71B 1FTSA 1WSAA 5AUNB 4DYVA 1BSVA 2GJ9A 5JCJD 3O90A 4INAA 4CR7A 1GDDA 4DCTA 1JR4A 3A04A 4Q7MB 1YL7A 4ZVMA 5T3YA 1X94A 4QVGA 4CXMA 4N8SA 1SXPA 4N82A 1OBVA 3CF4A 5C8ZA 2NYVA 1XKXA 3NT4A 1EG2A 2NZ2A 2L19A 3PG5A 4QG7A 1W1UA 5JPDA 2CMHA 2EU8A 5EE1A 4ZKEA 2CJWA 4NV1A 1Y37A 3EC2A 3LKZA 4QUKA 4WWHA 2CLSA 4BGEA 1BX3A 1JQLB 3EEYA 3P0HA 5EINA 5LJIA 5LSAA 2FU5C 1NQAO 1U90A 3RCBA 3EEIA 1XK7A 3FPHA 3NNDA 4AG5A 2VJLA 3DFIA 4BE9A 2ZYUX 5HM8A 1XCJA 3TFOA 1U94A 1KY3A 2VTVA 1XE3A 4YJGA 3SC4A 5GVSA 4BQNA 3D7KA 4FTWA 4GM4A 5B7GA 3H5LA 2PS9A 5HDBB 5JFGA 3QGMA 1XDBA 5K7SA 3AEUB 3WXMA 1XLTC 2QRVB 4JITA 5IYZB 2H4FA 3FNFA 3K3PA 2NQ2C 2NU7B 3SU8A 4DSAA 1M6WA 3JWGA 2RHCA 5AVOA 1XL1A 4RVCA 2IKQA 4E5MA 2WIJA 4YMGA 1F3OA 1MJ5A 1ZN2A 2HCFA 2VJMA 1DUSA 1U0TA 2EATA 4XWGA 4I5DA 5ITVA 3AG6A 2CXHA 2H7YA 3KB2A 5IVPA 1KQGA 4NH0A 3ITNA 4JJIA 4H16A 1R9NA 2AVNA 3Q6IA 4FHZA 1JYSA 4JP3A 2EFJA 2OBLA 1FDWA 2X4IA 4N3NA 5DNVA 4Y98A 3TNLA 1NW9B 4PAWA 1NDQA 4INPA 4CTOA 1MVNA 3HDJA 4YAWA 1RJFA 4QD3A 2Z9CA 3DZKA 2DYKA 2Q0XA 4PO3X 1YFLA 1ODSA 1JAIA 3OKFA 4J0KA 2C3OA 1YI8A 2VQ6A 2WKRA 1IK4A 4MQUA 5FPSA 3PS9A 2GM5A 1CPYA 1WXGA 3A3NA 4M8KA 1RQ2A 4TXJA 4WASA 4XJVA 5F33A 2W90A 5IFKA 1U0BB 2YWGA 1QGUB 5C31A 3WYDA 4HMPA 1EAMA 3UGTA 1N2HA 2P68A 4Y9UA 2EGGA 2R6R1 4DWWA 3K9FC 1KU6A 4RDIA 5JMOA 3F7OA 1XTVA 2H1WA 2NUPA 2QXTA 4ZOAA 1NULA 1VLQA 3L93A 4RIGA 5EEHA 5EJ5A 4JUCA 2ODBA 3MEQA 4PSKA 2ZRDA 1RI1A 5AW6A 4JY7A 4K81B 1PFKA 1L5YA 1P9NA 1YDGA 3AUXA 2BBOA 4A6PA 4W5HA 3OE1A 1E3SA 3FPCA 4QYWA 5LZ5A 2QVCA 3B1WA 4KIJA 5LUBA 4ZCTA 1LVHA 1QTIA 3BTUA 4CF3A 2GEVA 1VL2A 5L51A 2XUOA 2QTAA 4ALIA 1I6MA 3QQ5A 1E7RA 1RPNA 2AE2A 4QGBA 3RKUA 3MBIA 1A2BA 2GEJA 1A4XA 1XZPA 4X84A 2G0TA 3RI3A 1KWGA 1JF8A 3R09A 2B0JA 3HE3A 2QUBA 3D5EA 2W6CX 3I9KA 4YRRA 3QFRA 3VOBA 3WI7A 5MGBA 4AIRA 4D41A 3WV5A 4E1VA 3V8QA 1Y5LA 5B1HA 3G8YA 4BP3A 1L4KA 2FYTA 3T1OA 2JK0A 1AZTA 1P5JA 1ZC3A 4O1IA 1M6EX 4HBGA 3VNUA 4QECA 1IN6A 1PW7A 3ESZA 2BZGA 3CEPB 3NOQA 3NVDA 2WZDA 3H42B 4XCVA 5ALFA 1YH3A 3JYNA 2WJGA 3GB9A 3QTLA 2IXAA 4KXUA 2RH8A 4ZO6A 2JCSA 5B36A 3H17A 3TDKA 1P39A 1EFHA 5CNKA 2PX3A 2GTIA 3UC9A 4MV8A 1XJCA 5TQ0A 3HNRA 1MH9A 1P7WA 4HVAA 3ZE9A 3QHAA 4BCDA 4YMLA 1QORA 1IHUA 2BEVB 2C9YA 4NZZA 3VR5A 4BQOA 1KQFA 4A8JB 5K6AA 1J0AA 4DNPA 4ND5A 1BOOA 3CG0A 2JCXA 4IFTA 4D9HA 4W5RA 2R1UA 5M34A 1ZD5A 1O5TA 1GG5A 3GNSA 2BFCB 1QUEA 3DFMA 4RY8A 5G41A 3S4YA 2QRJA 1PR2A 5GADl 3G88A 5AW3A 3G5MA 1U2DC 3N0RA 2TECE 3EEBA 3UWSA 4XFKA 4MZDA 2VK8A 1R37A 3AI3A 3QM1A 2H1SA 3UAXA 2WWWA 1XQVA 3CWQA 1M33A 1I30A 3PQFA 2B4RO 3U6BA 2O1EA 5H8WA 2CE2X 2IHZA 4PFQA 2ZP1A 1ZAYA 4YPFA 5A0TA 1C3OA 2J0QA 1D0IA 1FMLA 4JGBA 2RDMA 1USKA 4GOOD 4CM3A 5J4LA 2Y71A 3INRA 4JOSA 3I5UA 1X77A 4MR8A 3FNGA 4EKIA 3E7WA 5JO0A 3B85A 3QEKA 1M5UA 4LC9A 1NG1A 1ULUA 4FWIB 1W52X 4ZA2A 2QBYA 1J8MF 1PG2A 4S1PA 1UFRA 4QNMA 4RD2A 1GTG1 2IY8A 3AXTA 5LBUA 5AK0A 5KAMA 3VZRA 5EJAA 3ROKA 1U3DA 1EPUA 3RFTA 1GPMA 1Z88A 3INGA 5EPEA 3P0JA 3RSLA 1PGNA 4EAQA 4MQBA 2BBSA 4WZAB 4ASUD 1KQPA 4M1YA 1ZMOA 1CFZA 3AB7A 3C5EA 3IKMB 3G0BA 3NRCA 2WYOA 5CD9A 4PC3A 4GBJA 1NW4A 2V7VA 3DULA 1V9LA 3DBRA 4JWKA 3GBPA 4CQLB 3R6GA 3CVJA 3U4AA 5GPBA 3K0FA 1KJIA 1G3MA 4R8RA 2GHQA 1M7HA 4MGIR 3DE5X 4LSMA 2YC4C 3GLHB 2Q3DA 1KKMA 3KFXA 2ZSIA 4KQ9A 1SVSA 4KLZA 2GAOA 4F4FA 5KVSA 1WZUA 4BNZA 4EEKA 1AQUA 3LQRA 1NM5A 3QF4B 1Q7RA 1QQ6A 3WIDA 2BWJA 3ADOA 4GXRA 4J2HA 3UJHA 3ZXSA 5BP7A 4R7GA 1T8RA 3WB1A 5HKBA 4M0FA 2AI1A 2C5BA 2BCJQ 1UKZA 2NP7A 1SJ9A 2GBPA 3KQHA 5HRUA 1HYBA 5AP9A 4DE5A 2IEYA 4G5YA 1ORTA 4Z9AA 3ZE6A 1FTWA 1JKIA 1QGOA 2XT0A 5F3RA 1J5XA 3IPXA 6CHYA 1RBYA 4UNRA 1L5NA 4L02A 4O4JA 4Z7OB 3NNNA 1DTWA 2R85A 2ZPTX 3PIIA 5H02A 2Q0SA 3B1FA 3ITEA 1G5QA 3L1JA 2PIAA 5A3JA 1UQTA 1N6PA 1D4ZA 2P3SA 4LDJA 3WFJA 3ZC3A 5I8WA 3A28A 2C4KA 3PXDA 2FN4A 4PTLA 1OFUX 2OO3A 4ZEVA 1EDZA 7REQB 5KKNB 1VBMA 3NATA 3RASA 5JSZB 3H4IA 3CZCA 5A6VA 3EWIA 4HX9A 1NY5A 4YCBA 4BLTA 1D07A 3EA5A 4I3GA 3K1AA 4QWMA 1ZRMA 2X6RA 1SD5A 2J3KA 2NV2B 2PBFA 3AVOA 3BIXA 5TXGA 3EFBA 3V1LA 1Y89A 2A84A 3BE4A 4WESA 4MEJA 1SQ5A 1VPVA 1RZ3A 1FLAA 2ORVA 2QQFA 3TI9A 1N5DA 2J0UA 3ASUA 4B2YA 3OPYA 2DOKA 3LXUX 3SZ3A 3QLTA 2XTMA 4KBFA 3H9GA 4Z7QB 5HE9A 1IU9A 2UUAB 2AHOA 2IE0A 5JRZA 3AR8A 1THZA 3USCS 1PZXA 4XARA 1GCIA 1G5TA 1JJIA 2D7CA 2Y6UA 3A1DA 4KNVA 3BMQA 2XE4A 3GFSA 3WBFA 5F35A 2G80A 3K0CA 2OXIA 5JT1A 4E03A 4MCHA 1C8BA 3O8OB 3CKMA 3NBZC 5K3DA 3DAFA 1UWKA 3RC8A 1U4OA 4JBYA 1BN6A 3CUTA 3P2IA 3VPBA 1XTSA 4FFNA 4KVGA 1KYIA 3C4QA 3VZPA 3QYJA 4EHDA 3HP1A 5JNWA 2QX8A 3NHYA 1JA0A 2JGDA 1G8AA 5BNIA 3ER8A 3EW9A 3UMGA 2XTAA 3V1NA 5KAPA 1HFKA 2QMHA 5KVCA 2XUKA 4Y2UA 2GLTA 5CJPA 3G79A 3GNLA 1VL0A 3S1LA 1Z6YA 1FP4A 1ZO8A 1CE8B 1L8AA 2YR0A 2FY8A 1H3NA 3F9CA 3MOIA 4L9RA 3IAM6 4PPYA 3SJAA 1MFPA 1N4DA 1XCBA 3W2FA 3DBVO 1ZC4A 3TM5A 2O8FA 2O23A 3MGBA 2BGKA 3ZGXA 4Q05A 3KJQA 1KVUA 2NAPA 1T24A 3DE2X 2DUWA 3RNOA 2OG2A 2ZK7A 1VCHA 3LPNA 4O8ZA 3PQ8A 2AC7A 2O52A 1PHRA 2WICA 1NQUA 1TF2A 2HB6A 4NTZA 2AKYA 3ZHVA 3FVRA 1Z4QA 2IY7A 3TRIA 2EVWX 4HXGA 3C3DA 1ZUHA 1W5BA 3COZA 3ZV3A 1SCKA 4HXEB 4BVJA 1Y7PA 1LNZA 1GAJA 1P4AA 3J7TA 4G5RA 1CJVC 1EX7A 2EYQA 4WVLA 4BN5A 1H9CA 3E48A 4EGSA 3OIFA 4XJSA 3WLQA 2O0KA 1PCXA 3WOVA 5DBFA 2JLCA 1QMPA 3VDXA 1Q95A 4U5QA 2CSXA 2WF9A 5DFAA 2B5OA 1PSWA 2VK2A 3E2PA 4MW0A 4N03A 2JD0A 1BNCA 4TROA 2AG1A 3RVQA 3MTEA 5HW0A 3IKVA 1X1SA 3TAHA 4BKQA 2GRAA 1P5RA 3FOFC 3SC3A 4ME6A 1W30A 1L3CA 2Q9UA 2Z8YM 3A0UA 4FZVA 2FRDA 4EK9A 2PUEA 3EIFA 1SVLA 2JD2A 1Z82A 1CYDA 2JH8A 2XITA 3ITDA 4B8WA 2GARA 1KZ7B 3BN3A 3KQTA 3OIUA 4J07A 1DOAA 3GMSA 3MWYW 1OV4A 1FDRA 1BDIA 4HEJA 4M9RA 2B2XA 2GSDA 1DKNA 1KZHA 3W6PA 1W6UA 3D3WA 4YRNA 5BPHA 1BVRA 4JT2A 5DGXA 3KALA 3ZD7A 3R6WA 2XQVA 3EC7A 3B9RA 5DNYB 4LUCA 5ECGC 4WFJA 1L4FA 4LZNA 1KQNA 5FPHA 2D5BA 1FDUA 2VDVE 2ZAMA 3L8DA 3P2OA 2XKJE 3JZMA 3EIHA 2WG0A 3R0XA 4FILA 4DDUA 4R1UA 4HAUA 1V11B 3G0GA 1DEAA 4ER5A 4FJ0A 3PLRA 3Q8MA 1TJYA 1NLUA 3GU3A 1YOVA 1SKYE 2OGTA 3GR6A 4PU0A 5KYVA 5DM4A 3UCFA 1FDTA 3AM1A 3SICE 4QUGA 5HE8A 2IVFA 2Z9BA 4I9FA 4LGVA 1AM4D 3ZZMA 1ZNQO 3V4RA 2FUNB 3WK6A 1T0PA 2E82A 2J5BA 2UVQA 3L7AA 3PGA1 3VPCA 4EATA 5CLFA 3DE3X 4D9NA 5FWAA 3A7EA 2C2BA 4J0GA 4V02A 4L3WA 2J9FA 4TXMA 3R20A 4PHFA 3ZWBA 1N3LA 1USGA 4ZK2A 3ZQKA 4F6LA 3F2VA 5EC8A 4OXKA 1X3SA 4P5PA 1GV1A 5DTRA 4HTAA 3PA8A 1S8AA 4IL5A 3O82A 2WHEA 4LV8B 4R40A 3S99A 4C88A 1PV4A 3O2SB 3SX2A 1T2VA 1U5BB 1Z75A 3TZCA 4S12A 2DQSA 3MD9A 1L5HA 1AB5A 1XWWA 4GLLA 3UAWA 3DMFA 5CLLA 3G68A 1JYEA 3N5KA 4WKCA 4X1KA 5C3UA 1J70A 4DLSA 3J81A 5T64A 4C4SA 1N0IA 3UGKA 4A0SA 2P9CA 3SZUA 1RI3A 3LPDA 3H2IA 2EG5A 3SC6A 3R8CA 2HH9A 4EUSA 3SN6A 2FPMA 4FN4A 2WIAA 2NXEA 2PL1A 3PTZA 2C4WA 4Y2RA 1GRCA 4YRMA 5B7QA 4CEJB 1C50A 1Z7GA 5FOUA 4QLAA 1CWUA 4KQCA 4RKEA 5A1JA 1WBBA 1ZMBA 3LE8A 4Y7CA 4MVJD 3ROZA 4H0NA 4F4UA 3NV9A 4W9MC 1XRQA 1E1CB 2RJ3A 3D0OA 5HCNA 1MMFB 1II8A 1QP8A 3FRJA 3RVRA 2BSAA 4JT8A 1QG6A 2F9FA 1E92A 1R0WA 1E69A 2YFYA 4DBLE 1A9PA 4KPUB 2PUFA 5KYYA 1YMUA 1EI9A 2ZWPA 1C2YA 4O4HB 4LAFA 3F6EX 4QO8A 2M9MA 3CYFA 5CU7A 4KHZA 5E3IA 2G40A 3U1VA 2V98A 3BHIA 4ZAFA 5IKXA 4II3A 3HXOA 1A8SA 3L4BA 1F8UA 4WZAE 3D0KA 3QU4A 3SF0A 5JD6A 3NP9A 4LRYA 4ZOLF 1ECJA 3OQVA 2QW0X 3C70A 2VZEA 4N0EA 1GZ3A 5IABA 1QCCA 1FYDA 5FO0A 3KJZA 4ZOLA 3QEAZ 3MWEB 1F8YA 3NEJA 3AM4A 4FINA 5TT1A 2AD5A 4YPVA 1I0ZA 3GO4A 4A3SA 3U7HB 5H9VA 1Q11A 1QFZA 4KN6A 3SHOA 3T4UA 1E79A 4Z7JA 1XRNA 1DKQA 3W2IA 1YK0A 4RMHA 4Y9TA 3GLGB 3C1AA 4BC1A 3IIJA 1VYHA 2PT9A 1IOVA 3G3EA 4WAUA 3L77A 2QHXA 1Z8DA 4FR5A 4HPWA 4WBSA 1WUIS 5G1PA 3WS7A 4KJXA 1U0EA 3NIDB 4KZKA 2CZGA 3BQ9A 3QKTA 3TVYA 1A4RA 1GYPA 2LUOA 2R6FA 3BSSA 4WH0A 4CIBA 5I7WA 1U0OC 4HN9A 3SM9A 5I9NA 4DZTA 1E3QA 5KNCA 4CNQA 1NATA 5CVVA 3ZG6A 3W9YA 4E4YA 3RIEA 2BGUA 3MJVA 3DW1X 5BVGA 1R6DA 3IVGA 1I6KA 1G3UA 1P1FA 3G6KA 3OPYI 3W77A 1OOEA 1W49A 1I4OA 4JJAA 5MFZA 1NJSA 1V96A 1ZAKA 2GPBA 3KJNA 5DW3A 2JGKA 5IM4F 1GV0A 1SZJG 4G5XA 1GNTA 2O5EA 3GRVA 4KODA 1J1IA 1A71A 3REQB 4MW1A 4BVEA 2G63A 2HJHA 1GL7A 4IF4A 1RZVA 2BUBA 3T9DA 1J9GA 1Z0AA 3G2JA 3FHCB 1Z74A 3NTLA 1X2EA 3SR3A 4M7RA 5U9CA 4PQFA 1XRLA 5TQVA 2CNDA 1S89A 3HXQA 1OYOA 2R47A 1SD1A 3ENQA 4BV8A 2G9NA 4X7RA 4YWJA 3K6KA 2A88A 2P30A 3OZIA 3OZCA 3TBFA 4DIEA 4B3MB 3FZGA 1QRUA 1OTYA 1ZVJA 5B1SA 3K5WA 3WK7A 4D0SA 1T29A 2PT5A 1JSCA 1WQ1R 1OXMA 4EP1A 4NJMB 2CF5A 3B9BA 4TL8A 2PZMA 1BFKA 5FEMA 3I9LA 1W46A 1Z83A 2PFKA 3NBFA 5AKEA 1KNXA 4FXOA 1FU8A 1ZK0A 1K0UA 3UAZA 3ND8A 4Q48A 4EZEA 1DX4A 5CFQA 4BVGA 2DR3A 5K0BA 3WLOA 1VSVA 2G3YA 4CM6A 2HXGA 5IWCA 2HJ9A 3FY4A 1SK9A 1E7MA 2A5JA 3JVUA 3AF0A 4YA6A 3RHSA 3OJLA 3ZYZA 5CLHA 4DT1B 3MTIA 4YJ3B 4UOEA 5JCXA 2QR3A 3PFHA 3CSDA 4NYIR 3EIUA 4A82A 1G5HA 3PNPA 4HNHA 4UUOA 1WMDA 2R7NA 3MFYA 5D86A 2VR1A 4KITB 1THTA 4HN2A 4E4RA 3ZN2A 1W88B 3K9LA 3L02A 2BZ1A 1I3KA 5KREA 4XWWA 2WJIA 3KZMA 5DIZA 3HI6A 2Z9DA 3I2YX 4FDTA 4OL9A 5FA6A 4C3ZA 1FRQA 3DGFC 4AG3A 1GL9B 1QIEA 1Z12A 2E3JA 2JHFA 4WECA 4BVBA 4TRNA 4CMKA 2I2CA 4MEAA 3IE2A 1AKNA 1A5ZA 3PFNA 1T8WA 4JXZA 3VPSA 2B8TA 4ZI3A 2FZEA 1PWHA 3UY4A 1P2TA 1PX2A 4EB6A 3FFXA 2PMCA 3AGPA 2ZI6A 1M67A 2AMFA 3ADBA 1HYEA 3ZNQA 3OE7A 5KKAA 4J7AA 4R8MA 1E4OA 3QY0A 3EZXA 1N8NA 1VYTA 3OZSA 1M0SA 3SVLA 3BKXA 3NM6B 3EODA 1KXJA 4QA9A 4BGIA 1KJ9A 3TLGA 1OQAA 2P78A 2JLSA 2WSYB 4Y9DA 4BVFA 1X74A 1X80B 2X0EA 1QO7A 2IEBA 3RK4A 4MKFA 3EN0A 3FWHA 3I8XA 2I71A 4B79A 2HJRA 1P2SA 4DUPA 4DOMA 4ZK6A 2YN2A 4LI3X 3TNDA 4YR9A 2ZTUA 4G0NA 5J5CA 4HFJA 2ZYWX 3A8TA 1EJ6A 1Y9ZA 2IU3A 2E48A 3PB3A 4NBUA 2AJDA 1A4IA 1RWPA 3GEPA 3QBDA 4TYMA 5CX1A 2AOTB 4EUHA 1T13A 2DH6A 1JALA 2RGNA 2VF5X 4OP1A 2IXEA 3BIWA 5DI3B 2HOQA 3TIGA 3ILXA 4A03A 1HOTA 821PA 2N47A 1DJOA 4AYTA 2ZQYA 4HVLA 4S1WA 1CEEA 3HHEA 4RA6A 2PZAA 3F7NA 3IP7A 2E4YA 3FIUA 5JH7A 3SYKA 4ZGWA 1EMDA 3PVCA 2YJ3A 1HDOA 1NPDA 1JR2A 5HZMA 2QN1A 5E4FA 2RCNA 4TL6A 1ULBA 4WGGA 2RGNC 3HJTA 3LW7A 1SBTA 1KOLA 5LWQA 1RJEA 1UZAA 3HLTA 4XR9A 3OEHA 4LCJA 5DM1A 4C14A 3L4KA 4CQNA 1F0NA 1Z3IX 4JSTA 5LVAA 4TMTA 2GKOA 4A0RA 5HJ2A 4BAUA 2VF4X 3BAZA 4JV5B 3CURA 2QVZX 2FZCA 2Z5FA 4GPAA 4Q4HB 2QG4A 2UZ0A 3FBTA 4WJZA 3WWCA 4AYWA 3EF0A 4MO2A 4I4TA 5CLGA 5D5HA 2DLCX 2DVMA 2I3DA 2QK4A 4GZ6A 2GDJA 5EXEA 2B4AA 3JATA 2FWRA 5GZ1A 3R6LA 1GQYA 4QTYA 3ODGA 4ZYZA 1E7WA 4LF9B 3TVDA 1TLLA 2II6A 2VNJA 4G0VA 1V5WA 3CH6A 3QVGA 2BMJA 4R2HA 4ZT6A 4GO1A 2PRIA 1QV6A 1K2WA 3B1XA 3B36A 4LDAA 3IERA 5DHFA 4BUJA 4D8UA 3AEXA 1M2JA 3EHDA 4L0MA 1UZLA 4M9CA 2RKOA 3B1ZA 1D6MA 1COZA 1QCZA 1VE7A 3FAKA 1JHZA 3CW2A 1BQEA 1UQUA 4J16A 5HILA 1IJEA 1KK0A 1L7EA 3DOJA 2UVDA 3BAFA 1NJFA 2AMVA 4LVUA 1KYXA 1DJMA 4M1SA 1W75A 5ALVA 5KBYA 1EM8B 3EW7A 1M2GA 3T0IA 4CWAA 4YRZA 1A8HA 1LJLA 2VSFA 4G8CA 4R7TA 3NALA 4EYEA 4F11A 1MO2A 3C3JA 1YB1A 4L6AA 1K08A 5K4GA 1S96A 2HDWA 4XQ9A 1ZKDA 1KU0A 5ARDA 5JYDA 2J59A 3I6ZA 3TN7A 3X43A 3KS9A 4NI5A 3U09A 1G3QA 2VHJA 3DAOA 1NVFA 3QNWA 2XMCA 3QYPA 4EQZA 4PC1A 4QHYA 1KI2A 4DC0A 1U8UA 3DKPA 5INTA 1KK1A 2DSNA 4E09A 3QITA 1U9ZA 2FZKA 4JXKA 1JH8A 1ZXLA 5D1HA 5DLPA 2RHOA 4IAOA 1JU3A 4W8GA 3WLSA 4P8RA 5EZ5A 4I9HA 4MS3A 1X0XA 3HY6A 5F3DA 4FB5A 1WCWA 2WINI 4IUYA 1VL5A 1HZZC 1XRMA 2VXCA 4FP9A 2P9HA 4G9BA 1CUSA 3FUTA 4AJEA 3P27A 1KYZA 2JAOA 1QZ3A 1AOXA 1DG9A 3MYRA 4K9RA 1X7WA 2BEUB 1CC1S 3IR7A 4U7JA 4TLMB 2JLBA 5FWXB 2BD0A 5A6SB 1GZUA 1JLLA 3P9NA 4F5ZA 4MPJA 4JZKA 3PIRA 2NVOA 2P6PA 5F4BA 1M2WA 2E0IA 3OEHD 3UJ8A 1CHNA 1Z6QA 2R8XA 4N5NA 3ORQA 4JUAA 2CVFA 4UFNA 5JO9A 1NASA 3OUTA 5KU7A 3GBSA 3V2IA 3KB6A 1YJ5A 3GD5A 3EIWA 3G1TA 2BE7A 1USUA 5IW8A 5J4YA 1IVSA 4EFDA 2EC5A 1MQAA 5AJHA 3V2UA 4L95C 1FXWF 1EVKA 5ALHA 2Y1CA 2DHQA 5J59A 2FMFA 3RYIA 2X8BA 4ER0A 5IG2A 4PBRA 1HNXB 3TZ6A 5EQJB 3AHGA 1SHLA 3GC6A 4ID9A 3H05A 3BICA 1VHJA 4R8SA 3KQYA 2FG7C 2O3RA 1H0HA 1CP2A 1LBQA 1U3CA 1V1RA 3O3CA 5FBLB 2QAGC 3VSCA 3EX7C 2QYHA 3NIFB 2NOAA 4MUKA 4FFMA 1VKZA 4UTNA 4K6CA 1Z0ZA 2D1TA 2KBEA 3OIYA 4UPDA 3H9UA 2ZWMA 4OREX 1IY2A 1I7NA 4PC2A 3LCUA 3O93A 4OKSA 4UUNA 2OQ2A 3AP1A 2YMQA 3WMRA 3NBXX 3B70A 1JHXA 5BN3A 1XP8A 1T8PA 4QJ4A 3GT7A 3RUAA 3VC1A 1GU7A 3WL5A 4BAGA 1KERA 2QXUA 2WK1A 3WZLA 1FEZA 2XV1A 1YI0A 3WLIA 3WAKA 2Y67A 4B4OA 4ZCIA 3AFGA 3EYWA 2PGOA 4CMHA 2R00C 1DAGA 5AJUA 4EECA 4AK9A 3BMXA 1NGSA 2B78A 2V7EA 2CMGA 4NX2A 3SFVA 4QM6A 1WS6A 4WXMA 3DQPA 4GVLA 4GPTA 3VO2A 4DA8A 3P4YA 5A2GA 1CDEA 5DHUA 3ETEA 4HT3B 1G8GA 4EYSA 1KGDA 2H18A 2MSNA 3D4IA 1E5DA 1ZNXA 3HC7A 8ADHA 5ICGA 2FFJA 2ZRKA 3VKUA 3AK4A 2ZGVA 1I6WA 4R2LA 3B1JA 2ZSDA 4HMOA 2P6NA 1WB5A 3H16A 4JOBA 4L22A 1GSIA 5LA6A 3L1VA 1WL8A 1XTQA 1FDIA 3LHFA 3OZRA 1IY8A 1J0EA 1U2SA 1VPEA 1ZM3A 4ZT4A 4OHZA 3FFAA 3UCXA 2QTGA 1W0KA 2H8GA 1L4MA 1KKLA 1X14A 2HCRA 3LZDA 4D4HA 4YR7A 2DULA 4M0MA 1AJEA 4AKGA 2LTAA 5ALZA 2LRHA 2H06A 4KQHA 4ZZ3A 2O2SA 2OGUA 1VJRA 3UMVA 3HUEA 1J20A 1JG4A 1DKUA 3JQ7B 2V54A 2Q07A 1DBSA 1MHPA 2KLHA 1KDOA 5DNWA 4GECA 5ITZB 3RT9A 5T6MA 6Q21A 3L41A 3SQWA 4LF8B 1PJQA 3HVHA 1BE8A 3IOMA 4JENA 4P4TA 4BOYA 6YASA 3IBCA 2EFYA 1IJBA 4BFYA 3RHZA 1U8ZA 4ETNA 4JLAA 2ZUDA 1R5OA 4R01A 3SJ7A 1U8TA 3BJMA 3GP5A 4F4JA 3RAGA 2PSEA 1NBMA 1LTHR 4DLXA 3MZ0A 3WWPA 3U4DA 2D7JA 1PL0A 4DA6A 4HGYA 1NVBA 2MSDB 2XA9A 4PYLA 2FFBA 5AYVA 1FXSA 2Q41A 2OV3A 4KNYA 3A9SA 4N18A 1UDXA 3UXMA 1QIJA 2C9CA 4HGNA 4JQOA 4JJGA 1T5SA 4G0PA 4C20A 4TSRA 2CC2A 3W04A 5AXAA 2ECQA 1LQUA 2V9ZA 4IIJA 5LB4A 3M34A 4LXXA 2ECPA 3ETJA 3ZNNA 5KTSA 4OLBA 5C8DA 2OZPA 4JR0A 3PXEA 4HAOA 1LPMA 1E2KA 4DV3B 2NQ8A 1GNPA 1GUAA 2WF6A 1GVHA 2IDJA 4UUPA 2Z5GA 3AFIA 3JQPA 4OQNA 2X0DA 2PPVA 3N74A 3OQNA 4I8XA 2AXPA 3WB9A 5LPNA 2W6JA 3OIDA 4QPCA 1PT9A 3U0BA 4BB5A 3GLIE 1XMOB 3ESXA 2VOJA 5GZ3A 1CR4A 1LPSA 4GXTA 4RAQA 1CJSA 2O57A 5A6SA 1SURA 3AF6A 2JA1A 3OJFA 1WXDA 1UMDA 3CF0A 1RFGE 1XZHA 4C7JA 3C6KA 4XB2A 4LKOA 2PSJA 3LT0A 1GTRA 1Z9BA 2E4VA 3AO0B 2YXDA 4HS9A 4MYUA 1VGQA 3TBHA 1RYZA 4ALKA 4GHWA 1VL1A 4RO0A 3T35A 3T3PB 1LUAA 2PMDA 4I6GA 4K9PA 4JQCA 5F3WB 1KR5A 4KK3A 3SOZA 3E1GA 4POOA 4YRSA 4K3UA 4L73A 2O3UA 3NEYA 2P6OA 4IHAA 3L5KA 2XYGA 1TZBA 2YJ5A 1Z6ZA 1M3SA 4F96A 3G7NA 1LW7A 1JVSA 2CMKA 2KW5A 1M8KA 2O5CA 2Q5IA 2IZ7A 3DCIA 4G5GA 5A7HA 3DTVB 3MT7A 1NI3A 2JIQA 3IILA 5GAJA 1D2HA 3JQAB 4DDKA 3MJDA 4J75A 1TF5A 3MPOA 3UJCA 2WSIA 3JQAD 4C30A 2C7VA 3OTWA 1JDUA 4IVRA 5FUBA 3VGJA 2QV7A 2XUIA 4Y1RB 1ZPDA 2HXSA 1XZEA 1PK7A 4I5GA 2BIFA 4IWYA 1NVVQ 2ID9A 2VHYA 3N3AC 3GGPA 4CPDA 2AFHE 2EDCA 1JQBA 2YMPA 1V47A 1TFRA 3RF6A 1TD9A 4QPNA 4ALMA 1XTRA 2ONZA 1JW9B 3CIFA 3CU5A 4FYVA 5CLIA 3ZHXA 3O3MB 2MYPA 2RH5A 4BPRA 3RC7A 3DUFA 2ZVPX 4EA6A 2FZ5A 4GMFA 4G84A 4M1MA 3BIJA 1E3DA 2F59A 4EEZA 3L1KA 1XL0A 4C6SA 2WDPA 4GYKA 1XAHA 5HQJA 2EX1A 4L5CA 3REQA 2CV1A 1Z28A 2MMGA 1FZQA 2OE2A 3PX3A 3OJXA 4YVFA 3N2NA 1NG9A 5LMUB 4WCFB 1K98A 1FFDA 1HT3A 4GAEA 4NCIA 1AMOA 2EFHB 4PC6A 1PZNA 1TQDA 1YI1A 4LI0A 4M87A 3RRXA 3CNHA 3OZ7A 2PMKA 5IARA 2B2CA 2VQFB 4XUGB 4LWPA 4NS4A 1FOEB 1JXQA 1R9JA 3WGTA 1SC3A 1ZGGA 2IU4A 3BIFA 3K30A 3LLSA 4YDSA 3ZWPA 2Z83A 3PCXA 3LCVB 2W2TA 2BMDA 3ZDAA 3KAQA 3ELBA 3EYAA 2A1UB 2WOJA 2C2GA 3RVDA 4PE5B 2HCTA 4EPXA 3PJGA 1J8YF 2HMAA 3NO4A 4UVHA 2DXIA 2ZRHA 2YTZA 1X7ZB 4RORA 1V95A 1M2FA 4Z53A 1H2RS 5BSVA 4BMXA 3RUPA 2A1TS 4FGLA 3RD5A 5LOVB 1BMQA 4YB8A 1HFEL 3R44A 1ZP6A 2OWDA 2H00A 3KXKA 4Q4JB 4LNAA 5JPIA 4ZU3A 4OQZA 1OXKB 4B87A 3AF1A 2IPXA 5CM9C 2E18A 1PAUA 1JR3A 3IALA 1K92A 5J5AA 3UA3A 4BCCA 4ND2A 2RK6A 5DGDA 1U3UA 2WVAA 3KKMA 4Q1FA 3RBZA 1XXLA 3A37A 2DFVA 4CG0A 1TM5E 1EXMA 2XMQA 3LQFA 3OCUA 4YLEA 5FFFA 3M3DA 5PNTA 3TSYA 1JEYB 3MUEA 1XRRA 1DDOA 4QOEA 4D3YA 3MGKA 1C4WA 1JLKA 3BHMA 4FXPA 5F98A 1Y3CE 3IV9A 4UQLA 2XVMA 3LL7A 1VPLA 3AHIA 1Y3IA 3TTXA 1SO8A 4B84A 4EJSB 5JQGB 1L1FA 4JWTA 3KYCB 2MSCB 4EA7A 4GMDA 1KZGB 1SUCA 3OO0A 4QOSA 2WQZA 3DMPA 1UBFA 1JHQA 2AIRA 2FEAA 1ZK3A 1Z2NX 4YMWA 1QBGA 3TTSA 3IQZA 4IIJF 3U2QA 3ZCUA 1EX6A 1TJ4A 1XVAA 2ZUCA 2JB9A 1H6AA 3GRFA 3PUYA 1HDXA 2D2EA 2VH5R 5JSQA 4EO4A 2ZZKA 1YB2A 5CFNA 4Y6SA 2EZUA 1Q2UA 3MTAA 1PLJA 1KI3A 1Y5RA 3EZ9A 4RZSA 1SPBS 1I80A 5G0UA 3TRKA 3WDLA 3I01A 4HRYA 4IV5A 4OHMA 5KJEA 4DA0A 5JH7F 4DRYA 1D5CA 1OKKA 2N3ZA 1V41E 2DX7A 2QG9A 3HYRA 3U26A 3UG7A 3JQFA 2GZRA 2DFPA 1Q0HA 1UJNA 2AW3A 1V5IA 2P4EA 1PR6A 2PFGA 4TS9A 5JXJA 4P33A 1Z4JA 2CDAA 1I7PA 1G8PA 2IPLA 4GLJA 2YOFA 5IC6A 1ZJ6A 1RI2A 1LVUA 3LVQE 2XA1A 4RS4A 2FRXA 3WNBA 5JAMA 4BDSA 4IY1A 5FBVB 2E21A 2ZI4A 3ZBPA 4QUHA 2JIZD 3RS0A 2BMVA 1GPWB 1R6UA 4Q21A 5EHIA 3ZGLA 3U4QA 4WLVA 3GPLA 2GD1O 3IP6A 2WT8A 1YZNA 1LTKA 1UPFA 4ZZ0A 3U6KA 1XZMA 3LOQA 5JD4A 1FJGB 3K8OE 2F2TA 4G37A 5DOZA 3E81A 4KNWA 1XP5A 1TQHA 3BB3A 3V3TA 2X22A 4HRXA 2J07A 3ZPXA 1ENPA 3BXXA 1BCSA 2FEWB 4X7MA 4YJFA 5B5SA 4GE3A 2G1UA 1E0SA 3T3HA 2FMHA 5KJ1A 1GZ5A 5JY1A 5KSWB 4GR4A 3TYXA 1YNOA 4WY8A 5JUWA 5SICE 2I78A 1NPYA 7ADHA 4BV3A 4IMPA 5JQGF 3S2UA 1JPNA 5C1OA 2BFAA 1HQYE 2HU8A 4LC0A 4QYIA 3NW9A 3WJ2A 4UTZA 4B6SA 2HF7A 7REQA 1LBHA 2PVSA 4G0ZA 1E1DA 2GJ8A 3FBWA 3HVJA 4DLUA 2Y05A 2VYQA 2HHAA 4HLCA 2VPWA 4P6VF 4PFSA 1LC3A 3SXUB 4FWTA 4N40A 1Q7BA 3B5IA 4UC0A 3HLKA 1NJGA 4JOQA 4UE6A 2SHKA 4MWCA 1GGEA 5F73A 1W581 4NEGA 4YBRA 1JFRA 1P18A 4OKIA 4YP1A 3BA6A 3DR5A 3I12A 4I5EA 4WUVA 5DEOA 3KV1A 2B25A 3K2QA 2CNNA 1ZUD1 2VSOA 2YW9A 7MDHA 3A1CA 3QE4A 3CUUA 1MX5A 5K05A 3IDAA 3X1XA 3UMMA 4IIVA 1F60A 4OKNA 2AK2A 3PWSA 4PRKA 4WZBB 2DJIA 2J5KA 4MYCA 4Q9NA 4Y7DA 4URXR 5GTDA 1K4YA 1OWLA 4XD2A 1EUQA 1B8NA 1QNLA 1MUUA 1RQGA 3FOEC 3WFZA 4DC9A 3K20A 1EQ2A 5EIHA 2VSNA 2ZJ2A 1PYOA 4HWGA 5DYIA 3RRBA 3I3OA 3K9CA 5FOVA 4YV1A 2FF7A 2HLHA 4WXYB 3B7WA 4NE2A 1OKKD 3V4VB 1XEWY 2I65A 5ALWA 2EX0A 1G8MA 3NHZA 1ABEA 1HTTA 1P9WA 2Y4NA 2YUTA 3E9DA 3F74A 3F78A 3W0LB 2QRMA 1OBHA 1SKQA 1PR0A 2Z09A 2WYUA 1EXVA 1JG2A 2AN4A 10MHA 3K6JA 4QYMA 4XIGS 2XNSA 3L0SA 1DOZA 4JVNA 5F1KA 1N0UA 2CB0A 2GNAA 3P19A 1WW8A 2WV9A 4GZ5A 5AIAA 5FNVA 3LY7A 2UZIR 4RTPA 4OHKA 2HAEA 4ALNA 5AKXA 3VV3A 2B8EA 2POQX 1U9YA 2GZ3A 4ZI7B 2GJAA 2P2NA 3PVZA 1CE8A 5KYUB 1E64A 4IDHA 2ZWOA 2W5UA 3BREA 4N9QA 2PQMA 2R6DA 4MCAA 5IJXA 3FSEA 1TAHA 1F7VA 2HYIC 3LHSA 2VRCA 3JQEA 1FUYB 5HQ3B 1ZQ9A 4UBMA 3DFFA 4F1WA 1TCCA 2J3LA 1BA2A 3KZCA 4JJ7A 1RKUA 4O2AF 4W1PA 3WDSA 1JB9A 3NZEA 1ADGA 3DE0X 1H4TA 2NYRA 3LT5A 2C9BA 2K2QB 4M4SA 2WVJA 4MYDA 4TS4A 3W6NA 1MAUA 2HR1A 4DZZA 4QOFA 1Z4IA 4PYIA 2KX7A 5FR1A 5IJ0A 1RWNA 3BFVA 1XPJA 4BZQA 4BZZA 2P1ZA 3D2AA 2BFBA 3CS3A 4RHUA 2F67A 2YXLA 3RS5A 2CV2A 2B3DA 1CQPA 3HRHA 2ZT5A 4BEVA 2WU0A 3L7CA 3ND6A 4HQRA 5GWXA 1ZKMA 2Y0CA 4OAOA 3CZAA 3IBGA 5C8YB 4XVRA 1SG0A 2IHTA 1JJVA 2OUIA 3EFOB 2ID7A 1I10A 3HA3A 1Q6YA 2PJZA 1J21A 2JK1A 3AI1A 4LRTB 5CK4A 4UD2A 2SNIE 2XVYA 1PS0A 4PG6A 4GGPA 2IXDA 3U4QB 3AFOA 1ULHA 4L3VA 3SR4A 2FMIA 1M34E 1Z2OX 3CLVA 4H3KB 5JJIA 1A3CA 1C0EA 1JLHA 1ZVQA 2FK7A 2ZYAA 3FOBA 3GJYA 1AO3A 2XQKA 1Q3HA 4WXEA 5DX0A 4EGAA 4B8ZA 1EAYA 3LIIA 4H1HA 4FYYA 2Y1EA 3L0PA 3W7VA 2F55A 1I14A 1Q0SA 1UADA 3BF7A 4HSGA 5CDFE 4KWIA 4XEUA 4HDRB 3N2GB 2Q27A 3CPSA 2PX6A 3SF8A 3QWIA 4DCSA 1KXZA 4NBTA 1D8AA 4KSBA 2Q4RA 1T4CA 3I34X 4IWXA 5CB0A 3JV7A 4AJ2A 1BS9A 4DR6B 3G5UA 3DXZA 2GBIA 1IZZA 4S04A 4DV4B 4AWBA 1OLXA 4JMPA 5HP4A 1E63A 2I62A 1T1RA 2IZ5A 5BR8B 3GJSA 4H6PA 4EFKA 3KELA 1CUCA 2A94A 2HY7A 4MUIA 4CQMB 1NXOA 1U2GC 4WSOA 4Q3BA 2WFLA 4QATA 1SKAA 1XF1A 1OZHA 3GVXA 1GKKA 5KQGA 1T5OA 5EEGA 3LT2A 3SBXA 3L18A 2C9DA 4Y67A 1CLEA 4IG9A 3V4LA 1VHTA 2OHFA 1FFAA 1Q19A 4DSUA 1GVNB 5CGQB 1EIWA 3WHIA 1U0HC 4A9AA 4D57A 2FP3A 4FOLA 3VVMA 4PGMA 2ZJ8A 3C8MA 1GZHB 3QJGA 4B85A 3AU9A 1DO2A 3E3LA 4WY2A 1JJBA 2EWWA 1FRFS 2PUTA 4H6VA 1BRMA 1B8UA 1NBEA 2H4YA 3PDCA 1PJ4A 1SCUA 1UM9A 3DM9B 4I08A 4JB3A 5DXJA 4BNJA 2BJHA 1NQVA 3FOZA 1JTVA 1DL5A 2IJGX 2P6RA 1EESA 5CFMA 1D4AA 1E59A 2Z08A 2VT7A 4PLYA 1EDEA 2C58A 1NTOA 1T4MA 3T12A 3M6FA 1NXSA 3C4JA 3RAEC 1G6HA 2H1FA 3LUJA 4TMXA 1P44A 2A0FA 5KQPA 3SZRA 2KQUA 1P72A 1Z0IA 2BM0A 3BGVA 4ZO9A 2G72A 2PXCA 1EGMB 1UXJA 1SC9A 2WJAA 4OOFA 3S68A 2QBYB 3R6TA 2XIJA 2Q5CA 5AW0A 3RHTA 3VR5D 5AVWA 2H2HA 1LFDB 1G5PA 3VSBA 4QHSA 3LG2A 1JBKA 4J4TA 3S40A 3G2QA 4PVDA 1IATA 1JPVA 1PUIA 2PUHA 1C4OA 4TT3A 2ZSBA 4D74A 1IXYA 2G5TA 2QZJA 3V7FA 1MW8X 3J7AC 5PGMA 2D5LA 1G7RA 1ZCFA 1D6NA 3L2OB 4TXLA 5T8KA 2WWFA 3T15A 4EKEA 3TJRA 3I61A 1NVDA 5AHRA 1SOUA 3E7FA 2M2IA 2ZIXB 3ZHSA 1L5OA 2PLRA 1N3IA 2C0QA 4RDCA 2EBFX 4XAQA 3TEJA 4OI4A 2AG8A 1Y6RA 3C5WP 4H08A 4YRQA 4BYMA 2D5CA 5EJMA 1CJKC 1TO2E 3MIIA 1CF2O 4CEIA 3S1AB 2XQIA 1XEFA 2W11A 3IAEA 3OQ1A 1N0VC 2XCQA 2YZKA 2B1QA 5G0TA 2XX3A 3E8XA 3ILVA 4R54A 2BEJA 5NLLA 4X6XA 4D8TA 5HIJA 5L8VA 3JQ6A 1BD4A 4YJGB 2NO9A 3EGXA 2J6BA 1T25A 1I0IA 3O95A 5F2EA 1N5JA 1SUFA 2ACVA 2H07A 1Y6QA 1ADYA 1W8IA 3ESRA 3QVTA 2GBLC 2XF8A 1UKYA 3CO0S 5E9AA 4ZWNA 5B30A 4BO7A 5BNTA 4WK2B 2NU8B 1EJ2A 2D1FA 1U0GA 2ZDHA 4OF4A 4QYSA 4Y30A 4PGAA 5TEVA 3FFWA 5BWCA 4KXLA 1AXEA 1SHUX 1FLVA 2FQXA 4F12A 1L1QA 3WK5A 3VYVA 5EXTA 5LU8A 1TAUA 1WXQA 2ZCUA 3TLKA 4D3FA 2FX5A 2PBLA 1L4HA 1VG0B 3SOPA 2XCSB 2A4KA 3A27A 1OA1A 2FEOA 3OETA 4U7GA 2XCUA 1YUNA 3SQLA 4AM8A 1MOQA 3UHPA 3GL9A 1WVMA 5CDYA 1I94B 2WMYA 1HA3A 3Q4GA 4NPCA 1K7CA 1JPUA 4X6UA 1MF7A 4D81A 5ECDA 4UZEA 2V4MA 2A5FA 3L0DA 3OOSA 3OT1A 4RIIA 4UU7A 1DKRA 1TJ5A 2A9FA 3NI2A 4DLVA 1Z07A 4MPPA 1HE1C 3BXOA 3L1HA 4J2OA 1VPTA 2IZ1A 3K9QO 3ZVKA 4MW5A 4C7VA 3RIHA 1HL7A 1JQDA 4EUFA 2GETA 4OB8A 4EG8A 1DXHA 5K5EA 3K2BA 3ZE0B 3EZ2A 4I1OA 1RXCA 3GNTA 3OH8A 2JEZA 4UBKA 2IS4A 1UMDB 4O4JB 4LWZA 5H83A 3LC1O 2HK6A 3AFMA 4PEVA 1DFHA 2RFLA 1OXVA 1WPRA 2AN1A 3CB4A 4C89A 1DDIA 1GPNA 3OWXA 4GOXA 1NC3A 2ETXA 1ULZA 3VSAA 1IMOA 3C8UA 3FWPA 3IAXA 1Q5PA 3INYA 1A69A 3SHQA 4BO5A 1K8ZB 2AEJA 1UF9A 3LPAA 5EWMA 3RRMA 3B20A 3W8NA 3UK0A 5U1PA 4KO8A 1EBFA 2BEUA 4PHTA 4Q93A 4QDJA 5A3RA 1E77A 1KQ3A 4NCBA 1TU3A 2BRUA 4NF2A 1I3MA 3DE4X 3MJCA 1EGAA 3AG5A 3GAMA 5JC8A 4LGMA 1U2TA 2Y76A 1Z37A 2L42A 2AH5A 1EVEA 1YQWA 1II9A 3M4YA 5KJCA 4M0DA 4MB0A 5LDDC 3BL5A 1TLTA 2EQBA 4MW7A 1ZD1A 4NOJA 4OH7A 4PQRA 1JEQA 5CNMA 3TSZA 1JQ5A 2EBHX 1I5OA 1MV8A 1POXA 1G20E 1QAOA 2H2FA 2HA6A 2HQ1A 1TKBA 4KYUA 1FNMA 2BRUC 1ESDA 5GP1A 4ESHA 5I7VA 2C9MA 2F8SA 5AOBA 4DLLA 3D4BA 1XMSA 5BORA 4QBFA 3CE9A 3H4MA 3EGCA 3ZIUA 2VWQA 4IS2A 1U3TA 3ZCQA 4MSUA 1Y8QA 1Y80A 3JRNA 4P38A 4GPBA 2Y1GA 2A9VA 1WPQA 2UVPB 3HJCA 4Q9IA 4OHFA 3D0QA 4OAPA 4NQRA 3KTOA 1G1AA 3T7SA 3ZCSA 5KMGA 2L0XA 1GPYA 4BZXA 3PPYA 3V80A 3UJBA 1YT5A 2CVPA 1TT7A 2X8LA 3FHLA 1YACA 1IAQA 2VHZA 4RJIA 3LA6A 4IG4A 3MVEA 5IKOA 3WMXA 4Q7EA 2DBRA 3MWKA 4ZO8A 3E23A 2PMBA 3BX1A 3GJQA 1AVTA 5FI5A 3KSBC 3RSGA 4YJKA 2FAXA 1T1SA 2C82A 1WWKA 2BR4A 4FFLA 4JGGA 4TQUS 1P45A 5D01A 3QJ5A 2FN7A 4WCFC 4K2AA 5K3CA 3ZWVA 1IHDA 5LP6C 4R6XA 3FF4A 4XX1A 4YO7A 5T4HA 1XLUA 3W1VA 2EWVA 4BMSA 4V0MA 2W7TA 2BKVA 3NYQA 4YRIA 1T91A 3VZSA 1XD8A 1RHKA 2AR7A 3QE2A 2NT3A 1UJ2A 3A36A 3DVQX 1H9BA 4LZWA 4IM7A 2AJTA 1W8DA 1KWKA 3GT3A 2UU9B 1M8PA 3AHDA 2A8YA 5ICCA 1W94A 4CUJA 4BFUA 1JDPA 3H4TA 1W1WA 4HUQA 4LXGA 1NRWA 3QFHA 2IP2A 1LJ8A 4LRQA 4N7BA 3WWYA 4D3DA 5IVDA 3L92A 2QJWA 1JFFA 2WILA 4KQ1A 2GK3A 3L0IB 1KIFA 1ORRA 3L07A 3THXA 4ETIA 3HJFA 4Q9LA 3QOFA 2DEUA 4DBZA 1PVOA 1ZOIA 2EJWA 5IZ4A 1U3VA 5L53A 2Q9AA 2HV8A 2HMSA 2PBRA 5IDQA 2C88A 5D5PA 4TZ0A 5JZBA 3D6NB 3RV4A 1E5TA 1EFCA 8OHMA 2D6FA 5TJHA 1M2EA 2HL6A 1R6BX 1AUPA 2AJLI 4Q3OA 3O7MA 1I4DD 4LYDA 4GX5A 3V1KA 1KMMA 2IYEA 1SBZA 4M76B 1PJ3A 1MPXA 4MS4B 3WRXC 1CJMA 2FE1A 3SWWA 1IM8A 1RZRA 2GO1A 3VR2A 1UK7A 2E85A 4PLZA 2N42A 4BFWA 1X2BA 1FVXA 2JFWA 3C5HA 3T0FA 3NETA 4EHHA 4N47A 3UJAA 1G5RA 2Q50A 2Q2OA 2Z5LA 4Y2GA 4ZOCA 5BO5A 3FSJX 3QTTA 4R5MA 1CR2A 3KNZA 2IUTA 2QT1A 3IUMA 4CCWA 1IVNA 3Q7EA 3ET5A 4BLRA 5EOVA 3MBOA 1QV7A 2GEKA 4HJRA 4ND3A 4CF6A 5CEEA 3UOAB 1SVIA 4W4TA 3UWKA 2R8PA 1X80A 3TQCA 1W5TA 4EI8A 7YASA 4B3GA 3DOUA 2HF9A 3FTQA 3F67A 5KS2A 1M73E 2JFVA 3N6XA 4UHCA 3TLJA 4DSTA 5BRNA 1OBCA 2XTZA 1DUVG 2AQKA 1OLSB 3KLOA 4WJKB 1QTQA 5KDLA 2LCIA 4OLHA 2LCFA 1T3GA 1YJXA 2J87A 2JIDA 1XTIA 1GUYA 4N65A 4PAMA 4XRRA 4ZCLA 5J63A 5AMXA 3R0QA 4RF2A 3A9TA 1XNJA 3SM3A 1LSUA 2HMTA 2Z1DA 4KXQA 3I28A 2LR0A 4LYHA 4A6XA 4DY4A 4N3CA 1OI4A 2FJPA 2QGZA 2O6LA 1X7YB 3H4VA 3PUJA 1MDFA 3PXXA 3QBVA 1XZBA 3RAFC 1TU4A 3CGWA 4TMKA 4C06A 2JD1A 5I4IA 2I3ZA 3ZJ4A 1NVVR 3AR6A 1M5RA 2BGLA 1GNQA 5CH8A 1H85A 2V6IA 4O63O 5K01A 4AICA 4XSVA 4URHA 4NAVA 4M98A 1YJBA 2X77A 4ZVNA 2GXSA 5BNWA 2HSEA 3CZQA 4P3OA 2WTXA 5G0WA 2XY4A 5BQ3A 1EFKA 1NMSA 4ILEA 4PXAA 1BEUB 3BXEA 3DVAB 5COAA 6GPBA 3ZE2B 4J43A 1CYEA 5LA6F 1I1HA 2HA4A 3MCTA 1W19A 2CNWA 5ALQA 2IHBA 2IIBA 5I9LA 2IHVA 3H9BA 5EAIA 2ZITA 2FW1A 4D79A 5AM4A 4YRJA 4BMYA 1C3XA 2AN5A 4HH3C 3N7TA 5HF6A 1WMSA 5IX8A 3DV0A 1Z45A 2YX1A 5DKFA 1Y3HA 3EQZA 5D2CA 1PJTA 4CEHA 3JS5A 4EUEA 2F9MA 2ZYVX 4TLBA 4LMAA 5DU2A 1USWA 3FJYA 3OIWA 4YT8A 3EVTA 2F1IA 5AVQA 1RACA 3FI0A 5JW6A 4OA8A 4IQ4A 5LR6A 4GUDA 3KWJA 2X1HA 3EXG1 4L9WA 2XDWA 4D0GA 3RPEA 3CTPA 4MGEA 5ALMA 2B30A 721PA 1AV6A 4TTVA 1NNEA 4HNUA 1CIPA 2F43B 2PO5A 4B34A 4ESVA 1R8SA 4P54A 4CKBA 3OQBA 4CMEA 2JI4A 2F48A 3IXLA 5ELXA 1QH8B 1IHOA 4H2DA 3PNOA 1EEXB 1MR3F 2FJ0A 2P11A 2XEDA 4Q0MA 4QU0A 1VPDA 5ADVA 3OOYA 4QPJC 3ZEIA 2BTOA 4KJZA 2H7CA 2DQKA 1L5RA 1CXZA 2ORED 4YN3A 5M2QA 4KO2S 3IE0A 1V5FA 4LTNA 1IZ7A 3JAKA 3ZH2A 1M8FA 4I50B 3N39C 3PCRB 4YAUA 1J5PA 2NO1A 1F48A 4UZSA 2PGAA 4BVKA 1PJRA 2WVGA 2NW6A 3GLGA 3H1TA 2VCHA 4ND8A 1XWFA 5BRAA 2XZPA 5KQRA 2Q4BA 1ZNWA 1EUDB 2IITA 3ZWYA 3THYB 3EIOA 2BMAA 2K7ZA 4B75A 1X9IA 1X7YA 2WHXA 4OD0A 4WHMA 2WBLC 4MWDA 2FRDC 3V4OA 3IHLA 4EFLA 4EMUA 5JSHA 5E7JA 1DQZA 3QXCA 3E9ZA 2C61A 4NEHB 3RVLA 4CKCA 2V4ZA 1AKEA 4B5LA 1U9JA 4F38A 4EFMA 1Y82A 3QPAA 2O0JA 2P9GA 3P52A 1DXQA 5ARBA 1DARA 4HQLA 3ROEA 4U1RA 3DBHB 1TIPA 2BKLA 5FUYA 4GKVA 1I2CA 1GT6A 3E0XA 3B38A 3LDHA 1WG8A 1ZL0A 3DM5A 4E22A 3DVRX 4MRNA 1ZJJA 1Z8HA 3MM4A 3QFCA 3OJOA 4YMHA 1IOLA 1W85A 2ZRAA 3GQBA 2CNWD 1GIAA 4RD1A 2GD6A 2FEMA 2YDYA 2JFZA 3C74A 5JRJA 5LP1A 3AMVA 3H2SA 3HU3A 1K9VF 1VDZA 2GD0A 3SYMA 2B9VA 2WFLB 2WHYA 1HBJA 1ID8A 2VIIA 3G9ZA 2WZQA 4NLLA 5COBA 2X9QA 2GESA 1FFHA 2Y3IA 3TH5A 1WPXA 1PU2A 1ZD8A 4RHYA 2MJLA 3HQ4O 2AOXA 5DH9A 4KDRA 3TLCA 1LCIA 1CW2B 4GF5A 4X1KB 1O58A 2C2ZA 2DUNA 4OGKA 1LRKA 1U5BA 5BV1A 5J47A 4LBZA 1YASA 2P75A 4MYTA 4V3BA 2CE7A 2CCJA 2ZSAA 3O84A 3DMRA 3AC0A 4JIMA 4B48A 4RVFA 3VR4A 4FEYA 2VNIA 4HNSA 1RCTE 1T9KA 3H5NA 4LRWA 1E1LA 2ZRCA 5AICA 1ENOA 3P4XA 5DWVA 3WX0A 3BXGA 4HDNA 2SICE 1H0KA 2BDTA 4ZMBA 4MV7A 4S1NA 1KSGA 3NC4A 1RJDA 2EEZA 2YWEA 2ADMA 5F4ZA 4TVSA 1PR5A 4UFOA 3DOCA 4WLFA 2D1QA 4G3XA 4PQEA 4BXOA 5TMBA 3Q1KA 5E2IA 1RLIA 3ECCA 3TMAA 1WW2A 4GI2A 3GELA 4UHDA 1KAHA 2VCEA 1FS5A 3JALA 5CFLA 2V97A 1LVGA 5SZKB 3VMMA 1RPJA 1FFSA 5CP8A 1I1QB 2AR0A 3E3MA 1NXVA 2GA8A 4JEMA 3PQCA 4KMOA 5HM6A 1UAAA 2Q3HA 2QZZA 2H54A 3C6YA 3EZNA 4XGQA 4EHLA 3GLFB 2W4IA 1WBJB 4OJMX 5JJBA 3AERB 4F72A 2JFBA 3SYTA 5FORA 4B1FA 5JECA 2FOIA 2PA3A 1R0BA 1RADA 2JI7A 2VBCA 4GR5A 3VVLA 3KYJB 1JRLA 5EFZA 2FPSA 5JVDF 5HQ3A 1H5QA 4DIFA 3CZMA 3QNUA 4KFUA 4LZPA 4MV6A 4LY9A 3B6IA 4Q12A 3H2YA 4RABA 4ZT2A 1L5GB 1OILA 5B57C 1ZRSA 1QGAA 1Q7CA 4PG5A 2QLLA 4CFSA 4HOYA 3ACCA 4KH0A 1W59A 4YT5A 4RWZA 2IELA 3HCNA 5CTJA 1AS0A 2ACKA 2KMLA 1FIUA 2OV6A 1JZQA 4MQFB 3D81A 5C5EA 3F6BX 1YZFA 1WSBA 5DCUA 2EL9A 3IVRA 3NIWA 2X0IA 1GN9A 3BB1A 1CVRA 1YL6A 3KOXA 1GL6A 5IMSA 4WFKA 1MX3A 5CDFA 4YCAA 1TM2A 3BUSA 1LGYA 2E9SA 3M1YA 4ZAXA 3ENWA 4AMGA 3CZ9A 4QQKA 1QU2A 1VJCA 5FPQA 4CKWB 4IEEA 4E5KA 2DWOA 3H5TA 2PKEA 2WMNB 2D62A 1AC5A 2J08A 2J9ZB 2JS7A 2NTJA 3EZFA 3IAS1 1Z6GA 3IYLW 2HRRA 3P9ZA 2GHTA 4RELA 2HSJA 4UM8B 5AKIA 2HMWA 2ZWVA 3SZMA 2AUNA 5TT0A 5I45A 4KRFA 2JAWA 4HCJA 3LQ2A 3NDBB 2YBEA 2IYFA 1HG1A 1LSJA 3LUPA 5ALOA 1OYWA 4FE4A 2PKRA 4O2BF 1T2NA 4O3FA 2X8JA 1IQUA 4RAOA 5CAEA 2IS1A 1KEWA 2Q5JA 4MGKR 1USVA 1WCV1 3V7NA 3BEOA 4DJ5X 2XDQB 3VPXA 3OCCA 2OT3B 2BM8A 3M3PA 1P3JA 1XZAA 3T5GA 3HYSA 4E5NA 4HADA 1B0UA 2IXGA 3LK7A 1LW6E 3FZNA 3ZXIA 1EFUA 5K0NA 4DFDA 5CFOA 4RTNA 4O1HA 1PNVA 3GF4A 2IPAB 4B82A 4BZPA 1XVLA 4X20B 3ML1A 3NHBA 1DVRA 4OFWA 4J7UA 3E9NA 1IZ8A 4TKUA 5JMPA 5J4KA 1RM0A 4WDRA 3RBVA 1Y33E 1PFYA 4L5IA 1JX6A 3B1VA 3EXAA 3PVSA 4FNAA 4P3YA 1Z17A 3O75A 4TV9A 3GZNB 3VKVA 1YULA 3E84A 4Q47A 3HUDA 2P9ZA 4I55F 1QVAA 2OCLA 4FK8A 2RAPA 4XSHA 3RJ5A 5FPKA 1HLDA 3A3PA 3OY2A 5IVIA 5HSGA 3GA0A 2A0KA 3L8CA 3C3WA 5B6PA 4M8LA 1QKIA 5L7TA 4GNRA 4JKYA 2G67A 5IVHA 1EBUA 4AVYA 3G1WA 2HGSA 1WEHA 5JJKA 4F5WA 4OGGA 2H16A 2BFBB 1XMJA 3NDRA 5FDFA 4W5OA 5EP4A 1GNSA 1QF6A 1Z5WA 4DV2B 4I5IA 2FPWA 1PDVA 1OB2A 2LV8A 3KHUA 4IQFA 2EP8A 2X9GA 1K6EA 1C0PA 1L7VC 1QOPB 2XVAA 4RENA 5DMHA 2EGUA 2EZ9A 3U40A 3DUWA 3KKKA 2BKXA 5EIXA 5BV7A 1YO6A 4CHTA 2GK6A 4XLZA 4CM8B 2GCEA 3DWGA 4EPTA 1CF9A 3K96A 1K8QA 2XQJA 5DGCA 4LFBB 5LOVF 1Q1EA 2R96A 4O2BB 3WIVA 1WUTA 1VYVA 2LPMA 5B6JA 1F8XA 4GG1A 3ZD8A 1LTQA 2H4XA 3HXLA 5ED0A 2REOA 5A9TA 2FH5B 3IQIX 4N41A 5CHYA 1XROA 3EVGA 3I9JA 2OQIA 2J4CA 1XDSA 3DE1X 3QBTA 4LJ9A 4MIKA 3SEFA 1FNBA 1E58A 4D5GA 4NATA 1L7OA 4QFCA 1HC7A 3GYBA 1QRTA 4JYZA 2X1VA 1E3EA 1T3TA 3KVYA 3VU9B 5I7HA 2O3SA 1FMFA 2JCYA 2DQYA 2XE8A 4PPFA 3TXAA 3IQWA 5CBKA 2H9AA 2WE8A 4ARUA 3TF5A 4UMFA 4MW9A 1WXFA 3PWKA 3JQGA 1H6CA 1YBMA 2BISA 2CBZA 1AGYA 1VG9B 5KYWA 3PF8A 3JZIA 3BERA 4TLEA 4US0R 1OWOA 3GVPA 5TE9A 4ARZA 1JEYA 1QVWA 2B1GA 5K3OA 2IUFA 5T67A 1ZM2A 5JAUA 1QG2A 2CXPA 4RBNA 1Y0BA 5K1ZA 4BFLA 3COYA 3QI2A 2A59A 4HWOA 1HKUA 5TQJA 2Q8NA 2W4MA 3QOYA 2VT3A 3WKAA 4EHIA 1YR9A 2NGRA 4ENVA 4BKOA 4HQ0A 1DB3A 1CEQA 1DT5A 3EUAA 3LVRE 1GPBA 2ZREA 3LDAA 3Q7IA 4Q7JB 1EJBA 3GY0A 4L50A 4LSGA 1DIAA 3UIEA 5JS8A 1J99A 4R4JA 1JFSA 5CIWA 3V1UA 4UHHA 3ACBA 2YQ5A 4NRDA 4BNIA 4AQYB 3PGJA 4I3HA 4WX2B 5HMLA 5ULLA 3IFSA 1HLGA 2PYDA 3BE8A 3TX2A 2HHCA 2I8CA 3FIJA 1MH1A 1QYDA 4ZHQF 2HRZA 5DN9A 3CCFA 3LUHA 1WHTA 2JDID 1A2OA 2M6SA 3R4CA 1E2BA 4LJ4A 5CYGA 3HLYA 3ESYA 3R5XA 4Q9DA 4WXHA 4FYPA 5CHEA 3T9CA 1A8QA 5JAPA 2WLSA 5LDHA 4JJZA 3WMWA 3JVVA 4UCFA 4R68A 4D02A 4HDRA 4WKBA 3K09A 4C4XA 3AUUA 2RE8A 3OUZA 3X2EA 1OAAA 5KNLA 1A9RA 3JQ9C 2PAAA 1PQUA 3F1KA 4TRMA 5G3YA 4MDHA 1T2FA 2UYOA 4BIIA 1LPNA 1YHNA 2R6ZA 2VRWA 2ZI5A 3R4VA 1EK6A 2BJVA 1PR4A 2VN8A 2XGJA 4NG5A 5ANRB 2M6LA 3DMTA 3IESA 1MC1A 4HZUB 2XCTB 3CCBA 3DAGA 1KH3A 2ON6A 3HCOA 3T7JA 1RWWA 1JIIA 3G8DA 4AZ3A 4MA4A 3BL6A 3SFZA 3BJEA 4KIWA 3WGNA 4OLJA 1ADCA 4UNSA 2PZJA 5I48A 5LMNB 1ZICA 4Q4LA 4N12A 4NYMQ 1F0PA 1FFBA 1KC3A 3I42A 3OCWA 3A4LA 1E9AA 1D1SA 3NOXA 2X14A 4LE1A 2FDRA 4MUNA 3NFYA 4CM4B 5JADA 1CF4A 2WMOB 3HWRA 1NY6A 4MRPA 5AVRA 4ZAWA 4KXNA 3QLVA 5HEKA 5FA8A 2GEBA 4F6RB 4C78A 1DWPA 1CVIA 2J4FA 3X1KA 1QX4A 2QTVB 3A06A 3L0CA 3T3DA 1AUXA 5DSZA 3GPIA 1NBAA 2OPHA 1KK3A 1FMJA 3T1TA 1N25A 2IEIA 1EUCB 3ETDA 2XXAA 3AKDA 2O19A 5A5DA 5I4CA 3LKBA 1NIPA 1Y3FE 2HC9A 3NOVA 3A0RB 4UW9A 4KIUA 3U9TA 4EJSA 4J91A 1UBKS 1DTWB 4K7JA 4FEEA 1ZIDA 1V8OA 3PD7A 3KXLA 1QR2A 1E6MA 2XE7A 4NCXA 3V48A 2A4MA 4B33A 1M8JA 2G77B 1NF9A 1PEKE 2CJPA 2DCMA 3AHCA 3JASB 4KXXA 4IOMA 5EVJA 2YJGA 1PWYE 4CMGA 4EO9A 2YY6A 3AR5A 1JQ3A 3TQIA 3UGJA 4B9EA 3TM4A 2QRQA 4ZI2A 4TWAA 1O3YA 2NNLD 4RDXA 2XMPA 1F2VA 3VJMA 1PYGA 2WD9A 3QF4A 1ESNA 5EKUA 1W2GA 1Z26A 1G8SA 5CXXA 4CKWA 5FTWA 5JCZA 1N3YA 2CLKB 2GXAA 1R0CA 2EHJA 1W4BA 1Z38A 3DVLA 4IZOA 3ROXA 4DQ0A 5IZCC 2OXCA 2HSWA 1UBRS 4CJXA 3TJZA 3EGEA 5DLEA 3O8DA 4Y2YA 2QAJA 4O25A 1ISHA 1D03A 2JKYA 2Z2KA 5IKEA 1P5FA 4AO8A 4D2IA 2ZAYA 5J2UB 2ZW9A 3RVBA 2HNKA 3D1VA 4HQKA 2SBTA 1KQOA 2NXCA 1MENA 2Z2IA 2F1RA 1N5OX 4PX2A 3AJEA 1Q0RA 2WWVD 5IC5A 2FFQA 3P32A 5THKA 4RK4A 2NU6B 3K15A 3ORSA 3VO9A 4QFDA 3HKCB 5DHTA 1XEXB 1SXGA 1ZDMA 3I5AA 1IHXA 2GDZA 3HB4X 1RAHA 3N0XA 2RARA 2OBYA 1A9XA 2OQVA 5HS4A 3PSAA 1HMPA 1YFJA 1RC1A 4RPKA 1WDTA 4BLVA 2QTVA 1NVWQ 1WU8A 2QM8A 2J6HA 4LDZA 3I62A 5FTJA 3R7WA 4KX5A 4UDNA 3GOQA 2ZULA 3EGVA 4J49A 1XAIA 1Z5OA 3W5CA 4AP5A 3K31A 3PQ3A 5D8DA 1X7DA 4Z9FA 5I51A 5FOWA 2HBQA 5BSFA 3WB0A 1WVIA 4YI3A 1K68A 1BS1A 5IFLA 4MV3A 4MRRA 3U3OA 2C4HA 3F8TA 1PF7E 2OK7A 1M6HA 1J07A 1SRQA 3STUA 1NVEA 1T36B 3C3PA 4EPWA 2QE7D 1QVRA 3C6QA 1DU4A 1NN3A 5K0GA 2HF8A