5U4XA

Coactivator-associated arginine methyltransferase 1 with tp-064
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
b'AVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-arginine methyltransferase CARM1
publication title TP-064, a potent and selective small molecule inhibitor of PRMT4 for multiple myeloma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2016-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5u4xA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5u4xA01
5KYGA 4P7GA 4CXMA 3DUWA 3UJBA 3BKWA 3DXYA 4XCXA 2PWPA 3A25A 4QPNA 4FT2A 1TPYA 1NW8A 2CMGA 2O06A 3GXOA 3UJ8A 3LCVB 2AOTB 2XVMA 2PJDA 4GBED 3FPGA 1KP9A 5HIMA 4HTFA 1O9GA 1YFLA 4DF3A 3FTFA 3GRZA 3P2KA 4RV9A 4IKPA 4PGHA 4AZTA 5DRTA 1RI3A 2FCAA 3OU2A 4B17A 1L3CA 4V0QA 4E2XA 1EJ6A 2PX8A 3HTXA 1YUBA 2VP3A 4OBWA 3EVZA 2E5WA 2QRVB 4GOOD 1G38A 1YZ3A 3LBFA 2NXNA 4NECA 4P7KA 4OQDA 1BHJA 2XYVA 3B5IA 3DLCA 5E9JA 1BOOA 3OFKA 2ONZA 5B1SA 5FUBA 2PSSA 4YUWA 2I9KA 1EIZA 2AVDA 3FTDA 2I6GA 4V0RA 2AVNA 4EKIA 4ER0A 1KIAA 2UYOA 3F4KA 4PGGA 5GWXA 1ZGAA 2OXTA 3X0DA 2G70A 3FYCA 1L1EA 5K03A 1RI2A 2OPBA 4R6XA 2IGTA 3AY0A 3NWEA 2BM9A 2ERCA 3MERA 4RVHA 5DTRA 3ER9A 2C7QA 5ICGA 1KR5A 1VLMA 3KPWA 1U2ZA 2AR0A 1UWVA 2PKWA 1WY7A 2XYRA 3BWYA 2ZIFA 3PLAE 4FZVA 2H1RA 4PNEA 4BY9E 3P2IA 3V97A 1NW3A 4GF5A 3FTEA 2G1PA 4YMHA 3BKXA 4OX9Y 2XYQA 1AF7A 5P8WA 3BGVA 5CIYA 1SQGA 2AN5A 4QQKA 1M0EA 1FJXA 3TFWA 10MHA 2OYRA 4QDJA 1RI4A 3EVEA 1SKMA 1NBHA 3KR2A 3DMFA 2G71A 2ZBPA 3B89A 8MHTA 3KQSA 3JWJA 3EPPA 2AOXA 3DLIA 4CKCA 1R18A 4RTOA 4QPPA 4BLWA 2DPMA 3OE5A 3TQSA 3R6TA 5E9QA 4GEKA 3HCCA 5EEHA 2EJUA 2NNWB 2ZCJA 4BP1A 2WK1A 1EQAA 3EVCA 4ER6A 1F3LA 2BR4A 1JSXA 3GRVA 4RTJA 1NKVA 1O9HA 5K09A 2GS9A 5FULA 2VS1A 3A7EA 3FPEA 4PYQA 4YUZA 1JG1A 1WZNA 3I9FA 5BP7A 3EEYA 3E8SA 3MHTA 2ZZNA 3OU7A 4KRGA 1R74A 3G5LA 3MGGA 3GRUA 5DM1A 5E9WA 5C1IA 4C06A 4E33A 2IDKA 2B78A 5FHRA 3QOXA 4P58A 5KVAA 2GH1A 2IIPA 5CVUA 3MCZA 3GU3A 5DLYA 5DX1A 3IEIA 3PS9A 3NMUF 3NDJA 3KQMA 5HIJA 4E31A 2KW5A 4QQNA 5GM1A 3HA3A 1L9KA 2EJTA 3GIWA 3HCBA 5GIOE 1UFKA 3BZBA 1R00A 3DH0A 5EMJA 3KQWA 3FPFA 4RTRA 2YXEA 4XUDA 3UA4A 1H1DA 4X63A 1X19A 5K8VA 3HP7A 3ORHA 3B7PA 3CKKA 3PTAA 5LSAA 3LKDA 4LWOA 1WXWA 2P3LA 3BWMA 2PXAA 4PONA 4F85A 2PX5A 2FYTA 2C7PA 5E1OA 3LCCA 1JSZA 4X41A 2AOUA 3FPHA 5EZQA 5EIWA 4DA4A 2PX2A 2ZWAA 3C6KA 3HM2A 2UYCA 4KVZA 4WVLA 3CJQA 3HNRA 4DMGA 5LR6A 2O05A 3OU6A 4QTTB 2HV9A 3EGEA 3MTIA 1IY9A 4R6WA 2QRVA 3M6VA 1FPQA 2V7EA 3KR9A 3C6MA 5E1DA 3QV2A 3NJRA 3HVHA 4ZTBA 3P9CA 1AV6A 4RTLA 4IV8A 4QTUB 2IFTA 3DTNA 3ELYA 3DMHA 4C4AA 2P7IA 3LDUA 2PV0A 5F2OA 2ZW9A 5DX0A 1ZG3A 5DM4A 3VYWA 3SX0A 3LGAA 4F84A 1NE2A 3P8ZA 3P9NA 3PX3A 1BKYA 3P71T 5F2KA 1G55A 5CUQA 2PGXA 3IHTA 3HCFA 4MQ4A 4G56A 1I4WA 2YTZA 5U4XA 3GRRA 3HA5A 5EKUA 3UBTA 5K0JA 3NVMB 5DM0A 4EQZA 2GAFA 3S68A 3HCEA 1VPTA 2VDVE 3NTVA 4YUYA 3O4FA 5BXYA 1VBFA 1DCTA 5HZMA 1T43A 4FSDA 2FK7A 1SVUA 2JH9A 3LDFA 1SUSA 1VP9A 2B9EA 2OKCA 4PYIA 1P39A 3R24A 2Z6UA 3IV6A 2PVCA 5EKXA 5K01A 2ESRA 3BGIA 4BP3A 3GDHA 2YQZA 5FA5A 1QAQA 4LG1A 1FBNA 5EVJA 3RIEA 3VSEA 5KQRA 1QYRA 1TW2A 2FK8A 5M5BA 3FTCA 3D2LA 2PXCA 5BW4A 3BUSA 1XJ5A 2BM8A 1L3BA 4Y2HA 1RJDA 3FRIA 2HNKA 5EHIA 5ICFA 4AX8A 2EFJA 2EX4A 3UFBA 5DTMA 1JG2A 1WG8A 4HRAA 4MTLA 5HIIA 4CTJA 2Z6QA 4FR0A 3TPZA 2Y1WA 1NT2A 1NBIA 4DKJA 3U81A 4OBXA 3KU1A 2ZZKA 5EG5A 2AZTA 2ZULA 5FWDA 4L7VA 4PYOA 4GOND 2YVLA 3ANXA 1VE3A 1YZHA 5DXAA 5H02A 4F86A 5BW5A 3R9XB 2R3SA 2O57A 4MHTA 3M6XA 3T7SA 3M70A 3MTEA 5DSXA 3NVKI 1P1CA 3Q87B 1EG2A 3PFHA 3I53A 2IPXA 5E1MA 2NP6A 3LL7A 1X1AA 3KPJA 5ERGB 4DQ0A 2AOVA 3P2EA 5DRYA 5E8JA 3M4XA 4PYJA 1R6AA 4DCGA 5ICEA 2CL5A 3AXSA 4FP9A 5D1NA 4HG2A 3R0QA 4X1OA 5D1HA 3C3YA 3GWZA 1KPGA 2CKDA 3E7PA 3BWBA 3SM3A 3MQ2A 2IH2A 1XDUA 3DOUA 1XCJA 1NV9A 2ZBQA 3CJRA 2LD4A 3K0BA 5EQJB 3UWPA 4EKGA 1P91A 3CGGA 1JG4A 2ONYA 2ZLBA 1Z3CA 3UZUA 2I7CA 4A6DA 2BH2A 3G7UA 1RI1A 2NXEA 2UYHA 3VC1A 2IP2A 3A7DA 3FYDA 1JTEA 3JWGA 2AN4A 1DL5A 4HTFB 2P7HA 4RYLA 3Q7EA 1N2XA 3NWBA 3CBGA 2JG3A 4E30A 5CM2Z 3E23A 4PYNA 3M6UA 1M6YA 3JWHA 2JJQA 5FADA 2VDUE 4YV2A 3SSMA 1QAOA 4HC4A 3TKYA 5GM2A 3EVAA 2AS0A 2OB1A 3UJ6A 1JQDA 3GCZA 3K6RA 1ZKDA 1JQEA 4E2ZA 3VC2A 1L3IA 4PIPA 4ER3A 2YUIA 5E2BA 4H0NA 2P40A 2VDWA 3FZGA 2P35A 2GA9A 3HEMA 3KQPA 4XUEA 4E2WA 2HR1A 4M36A 3O7WA 3LDGA 4QDKA 3EVDA 3MB5A 3RW9A 4A6EA 1R8XA 5CVVA 2A14A 5GOZA 2O07A 3LHDA 4AZSA 3FRHA 2BR3A 3THSA 1AQJA 4C05A 1P1BA 2ZZMA 3G89A 1TW3A 4P7FA 4YV1A 3G2OA 1JR4A 1QANA 3FUTA 4PYMA 4RTSA 5CVDA 3GO4A 3UJCA 4IV0A 4YUXA 2BZGA 4RVFA 1JG3A 4KDRA 2JHCA 3T7TA 3KPYA 5GIPE 5HFJA 2AOTA 5T67A 4P7JA 4PYKA 3KHKA 1D2HA 5FWAA 3CC8A 3KQOA 2UYQA 5LQJA 2PLWA 3SR4A 4PYLA 5KQSA 2ZVJA 3HVIA 1JTFA 3G8AA 3ID6C 3MCTA 1XTPA 3B3GA 2GB4A 1RI5A 3UJ9A 5HILA 3BGDA 1O54A 3T0IA 2K4MA 2PBFA 4RTKA 1HMYA 4HH4A 2HTEA 2GLUA 1FP2A 4RTMA 3P9KA 2ORED 3TMAA 3P97A 4PCLA 1RJGA 2XVAA 3ELWA 4RTQA 1UIRA 1EAMA 4RVDA 4X61A 4C08A 2YXDA 1F38A 4FGZA 4PCAA 4GQBA 3KKZA 3OZRA 1VL5A 3DMGA 1PJZA 5LQUA 4OQEA 1D2GA 1X1DA 3BXOA 3EGVA 4YV0A 3A27A 5E1BA 4E32A 2P3OA 2Y1XA 5T6BA 5K0CA 1XDSA 3HVKA 3O31A 1MHTA 5FCDA 4EVIA 5EMKA 2JH8A 3OPNA 5LQRA 2JHAA 5JUWA 2ZIEA 3DULA 4FSXA 4RWZA 3PX2A 2QE6A 5HIKA 2ZFUA 3HCDA 1ZQ9A 2PT6A 4U7PB 3IYLW 1EJ0A 1ORHA 3E05A 1I9GA 4C03A 4CTKA 4KWCA 1I1NA 1KXZA 3R3HA 5MHTA 5IH3A 3KQYA 3FPJA 3KQTA 4ATNA 4LWPA 5F2NA 4M38A 3C3PA 4DCMA 4EMSA 1X1BA 3CCFA 2ZBRA 3DXXA 5KS2A 3ELDA 3NDIA 1V39A 3KPUA 2AOUB 5K0LA 1BC5A 3G2QA 3TR6A 5HOQA 1G6Q1 2C7OA 4FS8A 1XCLA 2HMYB 5K0EA 4C07A 3REOA 1Y8CA 5DWQA 4PWYA 2I62A 5FTWA 3FUXA 4Y30A 1KYZA 3PFGA 3A26A 1INLA 1JQ3A 3SSOA 5K05A 3KR0A 1X1CA 4QVGA 3I58A 4C04A 2FPOA 4QVKA 2IH5A 2UZ4A 2PY6A 5EC8A 3WSTA 5DT2A 3EMBA 2ZSUA 3FUWA 3OCJA 2CMHA 2CWWA 1HNNA 3LBYA 3OE4A 2ZTHA 4YUVA 3UJ7A 3SXJA 3G8BA 4ER5A 3SGLA 2B2CA 4AZWA 2FHPA 2P3QA 1NW6A 1KHHA 1XVAA 3DR5A 4KIGA 5EIFA 3I5UA 1IM8A 3FUUA 3GJYA 5LQCA 5C9ZA 3EVBA 2OO3A 3I64A 3UJDA 4AUKA 5GP1A 4E70A 3LPMA 1VP3A 2N47A 3LCUA 4YMGA 2G72A 1G8AA 3TM4A 3ERCA 5EOVA 3C0KA 1KPHA 4RSRA 1MJFA 3QOWA 4M7RA 2IBTA 4BLUA 2OY0A 1SUIA 4E2YA 2BR5A 2Z6AA 1NW7A 3OZSA 1WXXA 3PVCA 3M6WA 3CJTA 5DX8A 1ZGJA 4U7TB 5JR3A 2NXCA 5EHGA 2G8NA 4O29A 5K0GA 1ZHFA 3B3FA 2OBFA 3T7RA 3EEOA 2EG5A 5DPMA 4EK9A 9MHTA 4GOMD 3P9IA 5LQNA 5CVEA 3HA7A 1KYWA 3BWCA 4GC5A 5C0OE 1R8YA 3CVOA 4X60A 1SQFA 5EZSA 1YF3A 5EGSA 5EEGA 3UJAA 1QZZA 4RX1A 2GPYA 3FUVA 3JWIA 3GRYA 4ER7A 2P1DA 2ZIGA 3AXTA 3THRA 4LECA 1NW5A 3SSNA 5DXJA 4DZRA 4AZVA 4PINA 1ORIA 4JXJA 3G2MA 1RJEA 2IBSA 5E8RA 5CVJA 4GOLD 5ICCA 5CCBA 1SG9A 3KR1A 4MWZA 4CKBA 5G02A 2YXLA 3TOSA 3V8VA 1VIDA 3EGIA 3DXZA 4K6MA 5FA8A 4RTPA 4RTNA 3G2PA 1B42A 4OA5A 5EMLA 5FHQA 5CD1A 3KPVA 4POOA 3BT7A 4CKEA 3AJDA 7MHTA 2NXJA 4Z2YA 2OB2A 3GGDA 1IXKA 4KW7A 3SVZA 3RODA 3SMQA 5LQKA 4HSGA 1KPIA 1G8SA 3G88A 1G60A 2F8LA 2WA1A 3HVJA 3MAGA 1M6EX 4MIKA 3ME5A 5IKMA 2HWKA 2XBMA 2B3TA 3UA3A 4HGZA 5K0NA 2OZVA 3M33A 3TKAA 1VQ1A 2AOWA 2ZWVA 3LECA 4PIMA 3GNLA 1OR8A 1XDZA 2QYOA 3LX6A 4XUCA 4GUAA 2NYUA 3TLJA 2H00A 4RVGA 3ER8A 2PWYA 2R6ZA 4R8RA 2YR0A 5LQAA 4KIFA 3KQQA 3PT9A 5E2AA 3A4TA 2PXXA 3G5TA 2YX1A 1DUSA 2WA2A 1N7JA 2Q41A 1XXLA 1RJFA 2VZ9A 3DP7A 3OZTA 4DM3A 4BLVA 3EVFA 4OA8A 2AN3A 5HEKA 2O0LA 3HCAA 4HGYA 2P8JA 5K0BA 1FP1D 3EVGA 4CWAA 1YFJA 2P41A 5FQNA 4R05A 4R8SA 5FQOA 2IH4A 2FRXA 2NP7A 1QAMA 3H2BA 1Q0SA 2B25A 3TM5A 3TRKA 1NV8A 5T64A 1PRYA 3PB3A 2C7RA 1AQIA 2H11A 5EPEA 1N7IA 2JHPA 5GINE 5K0FA 2PT9A 3LSTA 2ADMA 1Q0TA 4WXHA 3B3JA 2V74B 2IDJA 2PX4A 5CCXA 4GC9A 3LKZA 3AWIA 3ELUA 4FT4A 4IWNA 2QM3A 3EMDA 5DTQA 3NW9A 2QY6A 4ISCA 4KDCA 4M37A 5DSTA 1D2CA 3KQVA 5EMMA 3L8DA 5DM2A 4UOEA 1YB2A 3OFJA 1WS6A 2DULA
chains in the Genus database with same CATH superfamily
3EFOA 4I1OA 3IUQA 1CQJB 1CQPA 3T34A 3K2EA 3IP8A 2C42A 1F06A 4ZO9A 3W5DA 3SZRA 4AI6A 5HKKA 4B4DA 1U7ZA 1XKQA 3PQ4A 1PDWA 5K7SA 3HBLA 4M0CA 3I9KA 1F12A 2V96A 3WXMA 2IOFK 1XVIA 3HUUA 1TVEA 2Z58A 1E2JA 3AJ8A 4JFAA 4A16A 3EVNA 2X0KA 1Z07A 3ABZA 4BNWA 2FN8A 2NXNA 1G5IA 3K30A 4OQDA 3QNMA 1BN7A 5AKGA 1L5ZA 3V80A 2G7ZA 5E9JA 4DSUA 3IMCA 3V5NA 2AVDA 2QQFA 2AVNA 3JQAD 3R6DA 4CM3A 5KNBH 4MYTA 2UYOA 1L8OA 5BMVF 5F9MA 2UVPB 2ST1A 2JGEA 3MUOA 4IR7A 5KYXB 4B4WA 3RUDA 4QUKA 2ATIA 1F0PA 3V8NA 1TVKB 2O2XA 3JRXA 4YMWA 4N0MA 3DPUA 3UHOA 5JJCA 2WTMA 1H3NA 3ZHTA 1A0OA 1N0UA 2H1IA 3QJ5A 2PTHA 3QUQA 3ONNA 4TV8A 5TXGA 4YMHA 5JPDA 3RRYA 3T9BA 1YL5A 2TRSB 1Y9DA 1THMA 2HA3A 2NNLD 3FWPA 4OXRA 4ZVRA 5ILQA 3TW6A 1M0EA 4LIPD 4N7JA 5GMOA 4XYBA 5IANA 2C98A 1W87A 3DMFA 1U99A 2EBFX 3PQDA 5E3JA 2FPRA 1DZ3A 1A5ZA 4GLJA 3EA5A 2QVLA 5D87A 4U9HS 2HCBA 2JI6A 4TMYA 3GEIA 1NDHA 1U0LA 2ZSFA 2Q1SA 5MFZA 3HCCA 3R8CA 1KEEB 1YACA 3IELA 3K0AB 2EJUA 3QVWA 3D6FA 3E7FA 4ICIA 4BP1A 4KPEC 4FW9A 1ZY2A 2O8BA 4XPIB 1BFUA 2VYVA 2FPMA 3B3AA 4P2GA 5GJVC 5IX8A 2Q29A 4B80A 4CMAA 2PTGA 4PYQA 4FMDB 4Y1RA 5CT9A 3RBXA 1DX4A 2FW9A 2J9GA 3MHTA 2ZS7A 3OU7A 4WUVA 4UUOA 3G5LA 1XTUA 3DT9A 3GT7A 3RUIA 1YJAA 5HQTA 1PLKA 1Q21A 2FZCA 3FHTA 4TV8F 1ZK3A 1HI9A 2CHFA 1Y9AA 3OKPA 4HPXB 4XM2A 1AKMA 1FJHA 3CF6R 5CB8A 4BX3A 2JW5A 3R7BA 1DCFA 5FL7A 1M5TA 4DDUA 5F78A 4QQNA 1Y5NA 4FD2A 1FZTA 3T3EA 1IMOA 1S8AA 1L4BA 1T3ZA 1Q0RA 1X8XA 1VJ5A 4P81A 3WL7A 3QE9Y 5LD2B 1XJ0A 2E18A 4PRZA 4MO9A 4QLBA 3ZDDA 4JXZA 1C9MA 3H97A 4R4JA 5LB2A 1OXBB 4RTRA 1FVHA 4DLNA 4BCDA 2VTBA 4IVNA 4KUEA 4RHEA 3HUTA 4A1FA 4LWOA 3PUJA 2X7XA 2XXBA 5FA6A 3UHFA 2Z8ZA 2QTZA 5IM4A 3LM8A 2OXEA 2PG3A 3R8FA 4OFZA 3FX2A 1VGRA 1M2VA 2L17A 5DGHA 1GYQA 1UOPA 4B6SA 5H1YA 1X2EA 2DU8A 4EQ6A 3ILHA 3WFJA 2C9ZA 4DR7B 2ID9A 2E4YA 1YRBA 5L7YA 3F3YA 3SHFA 4MA0A 4G63A 4UAGA 3D5EA 3DAOA 4DMGA 2VHUA 4IFIA 1WTAA 4GKJB 2JFVA 3B8HA 1FPQA 2D2FA 1U8UA 1E2QA 4M49A 3LDHA 1YSCA 1WZCA 4UNNA 5IW8A 5BQXA 4S0ZA 2M98A 3RKSA 3MWJA 1ZM4A 3P9ZA 1G64A 2DKNA 4NE9A 1OLXA 1X1SA 3EDRA 1Z13A 1NE2A 5DNEA 4TWRA 5A4FS 1W1UA 4BDTA 3AEQB 3SQMA 3HDGA 2N1MA 2JBAA 2QX9A 2TMDA 1ZJ6A 2Q5FA 1QGOA 3GRRA 3V1KA 4CMKA 1ISIA 1FYFA 2WF5A 1FYDA 3S68A 4D0GA 3E82A 1ZWKA 5K3OA 1NQOA 3C5CA 1BH6A 3EBLA 2OECA 4MV6A 4O4JF 5EWJB 5CEEA 4RSMA 5ITVA 5IM4F 4DVGA 4IEEA 5D51S 5CNMA 1EFUA 4EJSB 4BP3A 5K6RA 2WF6A 5DCWA 1OZGA 3RH0A 2IS2A 1XZMA 1FTSA 1GCOA 2MYTA 3SX4A 3Q3GE 1REQB 3R7WA 3F9RA 5LL6P 4KTVE 1KU0A 1UEJA 1D07A 2Y9MB 4Z8XA 3OSUA 4B34A 5A0VA 4ZOLB 1JPJA 2X1HA 2FY8A 1Z6YA 3FHJA 2AJ8A 2VUTA 5CCDA 1V9LA 1WG8A 3VXKA 2QN6A 3R0VA 2QJOA 4PBTA 4M1WA 1WQ3A 5A3SA 3QX3A 3STYA 2Y4NA 4CG1A 4AN4A 1V71A 4CLRA 3WGOA 1NMQA 2AH5A 2OLKA 3LC0A 3PHBE 1NJ2A 1R4MA 4R2WA 3U17A 3ZLJA 1QV6A 2JBWA 2QN2A 2CD9A 3AY6A 1G20E 1P1CA 3FSGD 3MTEA 3PCTA 3PFHA 2ZAOA 3I2JA 1N2CE 3KWJA 3Q87B 5F1PA 5E1MA 4EF5A 5JALA 1FW8A 1G66A 3AK4A 1HE5A 3DYVA 3K53A 2AOVA 1LLQA 1WCXA 4YECA 3SFZA 2B1IA 5TSDA 2M6RA 3MWDB 4FE3A 5E6SA 4HGNA 1K86A 4NOKA 5KEIA 4JP3A 3SZLA 1NQWA 4ZO4A 3K0KA 3LU1A 2HGSA 2OQIA 3QLEA 2D5AA 1KZHA 3JVEA 4G5RA 3EG9B 1PR4A 3ZE6A 1YVPA 5LB4A 2W2XA 4ID9A 4B3IA 3GFRA 1OYYA 3IKJA 4XASA 1GNRA 3VC1A 2IP2A 1KKMA 1L5MA 4Q4JA 1PLLA 2AJDA 2ZVDA 3I2KA 1FJGB 4DW8A 1ID8A 1FIUA 4WX2B 2IW1A 1MJ5A 1IONA 4H2DA 5DHTA 1KDYA 3WDSA 4RY0A 2C5AA 4XGNA 3A3OA 3JWHA 3D02A 1NG9A 1B73A 2CW5A 4I46A 2FSGA 1H42A 1ZQ1A 3AFMA 3O38A 4IKEA 1JR6A 1DC6A 4R1OA 4Q47A 3UPUA 3GCZA 5EQTA 4LA4A 4E2ZA 1O96A 4X8HA 4KITB 2OM2A 2VDWA 3LOPA 3ZDYB 3BK2A 3TSYA 5HSGA 1CJTC 1FRFS 1G7RA 3QTTA 4FYKA 4DCTA 4BLRA 3U7JA 4E2WA 2QRMA 3I6YA 4KE8A 1SHKA 2IX3A 4QHYA 2B92A 1AQJA 5CLIA 1NBMA 4PX2A 3RVQA 2QD1A 1NJ6A 2C9YA 3GJ8A 3HKEB 3DF7A 4OU4A 3P20A 2HSEA 3F6SA 1UK7A 2RI1A 2A88A 2HHCA 1W0KD 4E5YA 2ZXUA 4IV0A 4YUXA 1IM5A 1MXHA 2VVTA 4QJIA 1WUKS 2AW3A 1ZIOA 1PTJC 1U2RA 3MS4A 5FR1A 3SYNA 2PX6A 4JB2A 4W4TA 2J0QA 2O8FB 2GJSA 1DEAA 3DEKA 4GS5A 5EMNA 2WPDD 4IQ8A 4GIBA 1E3WA 3OIFA 3JZFA 3ZUGA 1DAIA 2F1OA 2Q2WA 1A69A 2DXIA 3GBPA 4MQFA 3G8AA 2GQ0A 2PU5A 4FEAA 4EIWA 1C9DB 5IZCA 3AF6A 2OBYA 2OBMA 3CUEF 2ANCA 1XMOB 1SZJG 1GNLA 1PQ4A 4FBGA 5I3ZA 4HZUA 2W6PA 1GNPA 4HQNA 1R0CA 4JBHA 5EWLB 3UBMA 2F2TA 1FP4A 4DLXA 1JSLA 1R37A 1BE1A 3DEFA 3FBGA 2NU9B 3WRXC 3WGMA 1KFJB 2COKA 2BBOA 4NS1A 3FLMA 4UATA 4YPOA 1W4AA 4BGIA 2AC7A 3GLFA 1QPZA 1NJFA 2QTRA 3IDZA 4MIOA 1AC5A 2OGWA 1UXKA 2RCYA 4JLAA 4LJ6A 4RHFA 4A26A 4EENA 4RTQA 2VCHA 5IK2D 2CHQA 4DWVA 1RXIA 3QWAA 1H85A 1NQAO 1XQ6A 4X20A 3WLEA 1RXCA 2ODQA 4TXJA 2ZYAA 3U19A 4XM1A 4RFSA 1ILWA 3KTAA 5T4HA 4OQEA 3RVPA 1Q1ZA 2ZSDA 4JEMA 5CX1A 5DU2A 3V4LA 1OLUA 4J75A 2HIHA 1NULA 2W2LA 3EGXB 3GMDA 2P3OA 1MG0A 3LYLA 4ND8A 3VU9B 1A82A 3V42A 3EZLA 4HNUA 3LUJA 1ZX1A 2EZ9A 1R64A 4QDZA 3COWA 3DULA 5JXWA 2E21A 3M2PA 3PJEA 1N2IA 1U8FO 2QAGC 3UGQA 1IHDA 4US1R 3ICQB 2E85A 3AHGA 5FBHA 1WD7A 4I6GA 3ILVA 4M2LA 3NHWA 3KCQA 4P36A 2RB5A 2RC5A 1EVIA 4H7JA 2IITA 3KYBA 5BUSA 2A5GA 5F2NA 1FQOA 1W59A 2FH5B 3ZCPA 2A1TR 4YLYA 1DWUA 3K9BA 2PRIA 3RFTA 4O2RA 4D79A 4LJ5A 1BC5A 4FLFA 3PQ7A 3CW9A 3V1TC 1P5FA 4ZAWA 4MPTA 2CKMA 3AI3A 4MQ5A 2C4MA 1CP3A 4RJTA 5D6OA 3AESB 3TNDA 3CTPA 1KK3A 1KMMA 2GRJA 2ZYHA 4EKNB 1ZSVA 2RG7A 1MJGM 2FLKA 4AKGA 1C30B 2FUNB 4BKUA 4EARA 4DV6B 1T6XA 1N75A 3EH2A 5ARDA 1HQYE 3RFCA 2ZSUA 4CFZA 2PL5A 1A9OA 3HPRA 3QPCA 3LBYA 2GJ4A 5IN4A 1JHMA 5FTMA 2O14A 4F71A 4G4GA 2P3QA 4RZQA 2CXRA 1A2KC 5BNZA 2AFHB 5C9ZA 1N1EA 1RS0A 4S04A 2QJWA 3R4CA 1D9XA 4J7XA 1ENZA 4G1BA 1ZVKA 3SNHA 4HMQA 1L7RA 3IIJA 3U7FB 3W4JA 4BX8A 1EJ2A 1MGPA 1S5PA 3NBYC 3O3OB 1KDVA 4G5GA 1YJQA 5DMXA 3UFXB 2IBTA 1AZSC 2JGJA 2Q45A 1KBQA 5HMMA 1ORRA 1VCNA 2JFWA 1KS2A 3OZSA 5F23A 4FIZA 5JS1A 2EZUA 4G67A 2R4UA 4ND3A 2Z2ZA 3G79A 4DL9A 5HYVA 5KNDD 3C98A 3GFQA 3L7MA 4Y1EA 5JCPA 2L69A 2IL1A 1PFWA 1VI5A 1WXFA 2QROA 4JEUA 4AW9A 5K1ZA 2FI1A 2FFJA 4MW1A 2Q4OA 1HSZA 1GZ7A 1TK2A 3B9RA 2P62A 3U3MA 1EK2A 5TQVA 4JZYA 3N8IA 4M8SA 1W0CA 1YE3A 5TMPA 2OKGA 4TVBA 5CIQA 4CM8A 4LF7B 4HB0A 5B4TA 4F92B 4XYEA 1QDEA 1JDVA 1U81A 1YZFA 2VEOA 3OZCA 5BNFA 4AZVA 4WZBA 3A1DA 3D5QA 1MRNA 3O8OA 4G07A 4LDAA 4AYXA 1NYRA 1SG9A 3V2IA 2ECPA 2YXLA 3GD7A 4MV0A 4NJMA 1MUUA 4NE7A 2YVAA 5FA8A 2H1WA 2OCGA 4WBXC 3KO8A 3ADPA 4ILEA 2E3JA 3BIOA 4RS4A 3ANSA 4TMFA 2IOHA 1YVEI 5EMLA 5T8KC 5K20A 4U2FA 5C4IA 4HPWA 1JTVA 2HBYA 1EK0A 3CEJA 3PEUA 5K51A 3VKWA 3L4EA 4AURA 2XUHA 3U5ZB 3DZDA 2D1RA 3RG8A 4BKRA 2A78A 4NEQA 3FMOB 1YKSA 4AYWA 2AMJA 3F47A 4IQ4A 1FSPA 1IFXA 5ITSA 1S4QA 1H2FA 1DBVO 3HY4A 5C1PA 3SIXA 4DANA 1YRWA 1X0XA 2HF2A 5FNVA 4BB6A 1NW4A 1VQ1A 2AOWA 4EHAA 4WFKA 1H6BA 2A5DA 3KUUA 4JL8A 3HZHA 5JWRA 1USWA 3ISTA 3REFA 3SJCA 2B1RA 3PJGA 4Y2PA 3U49A 3W06A 4OSPA 3QHAA 5A7FA 5LQAA 1E4EA 3FTQA 1GZHB 2H1CA 1DUSA 2WA2A 1N7JA 1XXLA 4U7DA 2D54A 3ZX4A 3M1IA 3WB1A 2FMTA 2XLCA 4OA8A 3OOJA 3WGGA 4CG0A 1JFFB 2O0LA 1HZZA 1EKXA 1JU4A 3D3NA 4IO1A 1TU0A 1FP1D 3ODGA 1RNLA 2J1LA 3GRAA 5IWCA 2CK3A 2J3QA 4ARZB 2RBGA 3L8ZA 4K26A 3G2IA 4LDJA 3ITDA 2JIRA 2YHIA 1AQIA 1Z34A 4H7DA 2IKQA 4MWEA 2YYYA 1VJDA 3FMVA 4XD7D 2PUHA 5C2JB 2ZT7A 2B61A 4D92A 1V0JA 2WUWE 4TLDA 3ROGA 4A2WA 3UT5B 1XFAA 4JHLA 4YJ3A 4D3YA 2XA2A 4LZZA 3L5OA 3KJGA 3DBRA 1U3DA 4QQ8A 4UDNA 5CYFA 4JGBA 5FNVF 5JSKA 3TUJC 4E5VA 5IYZB 1QXSA 3A28A 4GG1A 1P62B 2J6IA 2WEKA 2X2OA 3FMPB 1PJ8A 3M8KA 2JFUA 3RS8A 1W73A 2DULA 4JSYA 1A9YA 2HBQA 4H27A 4B32A 1ZNZA 3AQIA 4FT2A 4TYPA 3WFIA 5LQMA 1ZIYA 2AFIE 4QXRA 4UW9A 4CMIB 4D3XA 2ZJ7A 4EW1A 3CLTC 3L49A 1KK0A 1RAGA 3EHEA 3DQQA 5HIMA 3ZGNA 4K0KB 5C5DA 4BMNA 1BDHA 3PF8A 1A9PA 1EFDN 4PZPA 3MXTA 4QICA 4QUDA 2XMGA 2FFHA 1BX3A 4FI3C 5FKJA 4I8IA 1IQRA 2XKKA 4FFBB 1OYVA 1OAOA 2EGUA 1CPYA 2VUUA 1VBNA 5AIBA 5CBPA 1MQSA 3SFTA 2AR7A 5JZMA 4NC9A 1BHJA 1V7QA 1WMEA 3B5IA 2PMCA 4DJ5X 3COJA 2C8JA 1UJ4A 2DY0A 2YWBA 2AWNA 1HORA 1EIZA 1WKCA 3OIDA 1ZGZA 3BC1A 4FZRA 4QEKA 4YREA 2Z1MA 3SPXA 4ER0A 1F0KA 1GQSA 4YJ3F 1XTBA 2AN9A 1NOIA 2GFIA 3HKDA 1L1EA 4G97A 3HJNA 3D0QA 4PG6A 1E1RD 1V95A 3ZD8A 1CS4C 2YASA 3NG1A 1U8EA 2V7VA 1U8YA 4F9TA 3PNQA 2N42A 2J09A 3KDAA 3WAJA 3IXLA 1YZGA 5B1YA 2IP1A 2PKWA 4LXHA 2Z83A 5HM8A 5KU1A 3N75A 3OZWA 3H4IA 3I72A 1OROA 4Q3DA 1LC3A 4DCJA 5LVAA 3OIWA 2OR3A 4C4SA 1DKOA 4OJYA 4Z7JA 1J97A 3GVIA 3AF5A 1Q83A 3WGQA 4EY5A 3BQNB 5CFOA 3TGLA 4FQ7A 4NABA 3FB1A 1RI4A 1OFIA 2GBLC 4BMPB 5FLYA 5L3VA 1B23P 2ZCUA 3GCWA 2JEYA 2O1WA 3THRA 2DFTA 2OV1A 3EA0A 1C7JA 2V59A 2QVBA 1NC1A 4BO8A 1KDTA 2NU7B 1R18A 4NK5A 1U3VA 1Y6GA 3KV1A 1C0KA 2VZEA 3DZJA 5AKLA 4Z1MD 2ASVA 5HGJA 2HHJA 4MA4A 4ARBA 4YRMA 2ZCJA 3MHPA 2BR4A 4DYHA 2JAQA 2P8SA 4MP8A 3U7RA 4RCVA 2REXB 1H69A 1X38A 2XUPA 3FMFA 2OSBA 1D1SA 2J9FA 3AUTA 4EZEA 1WAMA 3F1LA 2YQ5A 2IX9A 4WAUA 4BBJA 1AV7A 2G77B 2XWQA 2FR8C 2ZBUA 1C50A 4MINA 1UMBB 4MV9A 1CRLA 4YJGB 3U7IA 4JLVA 4B82A 2W2MA 3Q8LA 4OQLA 3I0ZA 1M1YA 4IP0A 5JAPA 1YIAA 3PS9A 1BMQA 4IGAA 3PUWA 4RKEA 2DPHA 1XPRA 3SHQA 2GO7A 4R7TA 3KX2A 1J00A 1VHLA 2SKEA 2QMUA 3A6EA 3HCBA 5JHHB 5GIOE 1QRUA 2F8SA 2CZQA 4I50A 1O94A 2PFSA 3T5GA 1B15A 4F3KA 4CIAA 1JA0A 2XCTB 1RABA 5KNCA 1LX6A 4Y6OA 3EC7A 4FE4A 3DQPA 5F9HA 4W1QA 4EJFA 5ES4B 3RWBA 2EV9A 5J63A 3AJRA 3IJPA 4RMHA 2E4ZA 4YRLA 2QR3A 3H04A 1P0FA 2P2DA 3L3BA 5LMNB 3AR4A 1BYIA 5LSAA 4RXUA 4IJKA 1GRRA 1Z4QA 4JLPA 2HSZA 5CURA 2Y1GA 4HVTA 1M2GA 5AI0A 3RS3A 3O26A 3RAGA 8LDHA 1NDQA 2HPVA 4XR9A 5H0IA 4PM4A 3ZWOA 1OI7A 4CI9A 3Q85A 5B53A 4KVGA 4KVZA 4WSOA 3CUSA 1E6UA 3VR0A 4FQ5A 5DHUA 3W9UA 2C3MA 1QFZA 1JB9A 5LXTA 3M6VA 2IYLD 3DG9A 5E1DA 3ZHZA 2J0UA 4W6QA 5AW9A 1AV6A 1DJNA 2JFQA 1PKXA 1JV2B 2FMUA 2RGEA 1N6IA 2B4RO 3FFWA 3DTNA 2HJRA 3PQ6A 4K05A 4ZK6A 1JFLA 2AL7A 2VJKA 3OJOA 3WADA 1I3OA 3ZHYA 4F97A 2CV1A 3NHUA 2H17A 4B35A 3LY7A 4HXEB 4S1VA 4V03A 2Y77A 4JYCA 3ANTA 4I50F 3ZTYA 2IIBA 1DQPA 1GGNA 2HA4A 3EISA 1IZZA 1ULSA 4GW3A 5AOBA 4LOJA 1VL1A 2YN2A 3E8MA 4RZUA 5F12A 1YCDA 2VJPA 3JYHA 3W2IA 3KEGA 2RJOA 2W9XA 4YAOA 1QIHA 2Z6VA 1U0SY 4G4SO 4CV2A 4URFA 3PNBA 1PSDA 1XJCA 3GGOA 1A27A 1E94E 3OPQA 4NU8X 1KJ9A 3WWCA 1PGOA 2P0EA 4LZNA 1E99A 4P3PA 2ESRA 5EKXA 1TM3E 4PYRA 2GD0A 5AMXA 3ND8A 2F9MA 5FTKA 1GUZA 1LXCA 3O4HA 3AHIA 3IXQA 1TW2A 5EZ6B 1GTSA 3UO8B 4GLLA 1CW2B 1GNVA 2BE7A 3HCWA 3RYTC 2Q0SA 1AKEA 4KKVA 4UTZA 1EGVB 1PYOA 3VHRA 4WESB 1E5LA 1EFVA 5I47A 3CRNA 3ANLA 2GM4A 4OU5A 1G1MA 4YDRA 3ZOKA 4KQ6A 1RBMA 3SF8B 1UBRS 2PANA 4XLZA 3BRCA 1FS4A 4R81A 2OD7A 4HNHA 2GCNA 1Z8HA 3K9WA 4RZSA 3TPZA 3ZWXA 4BBAA 5BSFA 1L7MA 3GVPA 3E3OA 1TD9A 3SOZA 5AVXA 2EQAA 3KU1A 3THOA 4L7VA 5B64A 3K2QA 4OK6A 3QF4A 3O8QB 1BW9B 2PL3A 5ESRA 2VJYA 3T7SA 4NAVA 2VK4A 4NPHA 4FMCB 4B33A 1Z6QA 1DNPA 4LJ7A 2NW6A 3CY6A 4WDQA 5K3FA 3V48A 5C5IA 2OFPA 2YHUA 1U3WA 4HDMB 4UEOA 3PNLA 4LKRA 1FVFA 2I2WA 2FPIA 1XAIA 2P1RA 2XMBA 2WHPB 2BFDA 4PYJA 2C5SA 1C0PA 2XUGA 3IDQA 1GQOA 7GPBA 4BMZA 3PNVA 4KN6A 4QU0A 1XDUA 1M6VB 3AJEA 3COSA 3CJRA 3E5NA 3IP9A 3F74A 1NBOA 5CB4B 5HM6A 2H3HA 5FUMA 3E15A 4EB6B 4ZT7A 1UJMA 1F60A 3CR3C 3GLRA 2ANBA 3NB0A 4FOLA 2JLBA 3GJXC 3KLNA 2C2MA 4MVJM 2YZNA 4CUJA 1JFVA 2MDTA 3D2AA 2C4HA 5KYTA 1HO3A 1MJGA 4HTFB 3WY9A 1GGEA 1HF3A 1IHPA 1JAZA 1E7WA 3H5VA 5D84A 2DWOA 3SZ3A 4Q1FA 5E3HA 1BU5A 3ZXIA 4F6RB 1XE3A 3JQGB 4KNYA 2VDUE 2XD4A 2WTAA 1T1EA 2VWGA 5NULA 4TQAA 5KX5A 4JYAB 1T5BA 1F2TB 3EC2A 2IP4A 1ZKDA 3NS7A 4RH3A 1USGA 1VHDA 3OJEA 2P40A 4FHEA 4A8HA 5DB4A 5G53C 4XUEA 2G76A 4QUGA 1LPAB 2XVXA 4Y9TA 5DIFA 1YB4A 1ZCJA 3A6GA 1P2UA 2CVZA 1OI2A 2OHHA 2PX0A 2QE7A 3GFSA 3MF4A 1H2AS 3MJ4A 4FZJA 1M7BA 4M60A 1GKIA 1WXDA 1E2HA 1I5EA 1QRSA 1ZJ4A 1JNYA 3CNQS 2ZXFA 4QXAA 1GL6A 3VBCA 4MW2A 2M6KA 4JV5B 1JR4A 5KTTA 3FUTA 1QSGA 1E2GA 3FD8A 4HAYA 3TOXA 2WW8A 2DZDA 3PEYA 3HVUA 2JGNA 3R44A 3D3KA 3T9DA 3C5HA 1UQRA 1JXMA 3LWDA 4LGYA 1XELA 3MT7A 3OE1A 4DILA 5HFJA 2AOTA 4OIMA 5SZKB 5T67A 3RYFA 4P7JA 2X8WA 4OLAA 2JZNA 4K9MA 2D06A 1DAKA 2CXPA 4BNGA 3V1LA 4IINA 1QFJA 4KH1A 4GLFA 2RIRA 3ID6C 3WYGA 1HFJA 1Z4JA 4N41A 3M2TA 1J22A 2P4UA 2VT3A 3TOCA 1FX0A 1H6CA 1XA3A 3QKRB 4WQMA 5G0TA 4B4VA 4D9HA 1BCRA 1O97D 2C7VA 1VGVA 3HKBB 1NP6A 1GQ2A 3FCUB 1I5OA 2CMFA 3MOSA 2HQOA 2FSPA 5I7OA 1NJGA 3K9HA 4WMLA 5BQOA 1KETA 3WMXA 1Q0ZA 5TR9A 3KSZO 3KT0A 4LE1A 5DJ5A 3BJMA 3CEHA 3H9JA 4B3BA 4KFTA 3IJEB 4X61A 4ALNA 4F4HA 3DL4A 1EUYA 3Q10A 3WL4A 3K71B 3H1PA 1IOWA 2F43B 3AVWA 3WAKA 1P4GA 2TMYA 1QF7A 3E2PA 4L27A 2PJRA 4GM1A 2QUZA 5GAJA 1XMIA 3OKCA 3A27A 4D9JA 3PF9A 4CPDA 2Y1XA 4MWOA 3ZJVA 3OLYA 5ICEA 3M9XA 4QUBA 2QL6A 5BUCA 3U44B 1VSBA 2FMXA 4CLEA 2O8DA 3FAKA 8ATCA 1T9GS 3S2FA 1CUFA 3BDAA 2FPPA 1QHSA 3F97A 3TG2A 2W2NA 2VHWA 1B76A 5AM3A 1ZK0A 2HTFA 3OFVA 1E5DA 1EUDB 1B26A 1WZEA 1ORHA 3H0EA 4JWKA 4OHRA 5HWSA 5LQSA 4K87A 4W8GA 1A95A 4W1PA 1K8YB 1TCCA 3RK4A 3RKUA 2BMEA 2QSYA 4NH4A 5FP0A 4YVFA 5ALYA 1TA0A 5ELXA 2ZI9A 2HDWA 2LVBA 2ZBRA 4OI0A 5CDSA 2E49A 3FDZA 2AHRA 1PHPA 3RVBA 5BN5A 3QFCA 4ZU1X 1R2QA 4IJ6A 1C1YA 3CSUA 5CB0A 3QYAA 4RIFA 1VMEA 1VPEA 2YYAA 3C1TA 3MFYA 4YYEA 2FPXA 1SCBA 1DJLA 1QGUA 2DOKA 5ALIA 1ZR4A 4QBTA 2JGDA 2NZWA 4KFCA 4JC0A 4LRQA 3H2SA 4MV5A 1A5TA 5LMZA 2H07A 3HB0A 1ZCFA 1OYOA 1CS0A 1OZHA 3EG5A 4FFLA 5JO0A 2EF0A 3RYCA 1TQHA 5TQ2B 1KHTA 1ULUA 4JBIA 2WP8J 4RJIA 1GTVA 3F9CA 1E5TA 3X2FA 1P1HA 1P17A 1TU4A 1NW6A 4YQYA 1YBAA 2RGAA 3I64A 4HQKA 4C20A 4ZOQI 4JUBA 5FBQB 2WYUA 4YRKA 3NBMA 4FGLA 3C0KA 4OGKA 4QYSA 4KXMA 2Q50A 3U4QB 5HK8A 3ETEA 2RG1A 2ZRIA 2OY0A 2EAUA 4FQ8A 4ZU3A 3VR4H 1N2SA 1NW7A 1R3DA 4HLUC 3EQ7A 2ZU6A 4H1UA 2NUPA 3V8MA 4HDNA 3WC4A 1FTWA 4BQPA 2F4VB 2XA9A 1NW9B 2G8NA 4UVGA 5JO9A 3RRJA 4UMFA 1WJGA 3SOPA 5GONA 2PH3A 2DMRA 3JW8A 1X7YA 3MFQA 1UBNA 5CXUA 3LKVA 1DUVG 1OB2A 5LOVB 2P9CA 1QP7A 3FXAA 4MVJH 3P0JA 1JS1X 3MMZA 3T7EA 1K7XB 4TPKA 2PPLA 1VRWA 4Z3DA 2FW7A 4LJLA 4ROTA 4UHJA 5DVZA 1TU3A 3CVVA 1PL0A 5FORA 2OPHA 1KK1A 2ZUVA 4EFLA 2QMQA 1X70A 3K15A 4J1TA 2GZ3A 5B1EA 5IAEA 1PSZA 4TKUA 2OV4A 4KV9A 3DE1X 3H1BA 1J8FA 1EX1A 4FHFA 3TNFA 3V9AA 2BH9A 4B79A 4H0CA 2PS0A 2QM7A 3BAFA 2YJ3A 1QP8A 4FOTA 3NJ8A 3NOVA 1A8SA 3HDJA 3NAZA 3OF5A 4K0RA 5BYAA 3LQ4A 2X1VA 2JFFA 2QMHA 3NHSA 4RTNA 3X1WA 2OHVA 3G2PA 4JLJA 2OAEA 2WHEA 3F1KA 5H5JA 4ZXPA 1E20A 1QUFA 2JHFA 2R8YA 5FHQA 4BJ3A 4ZDKA 1IIBA 1AZTA 3OIYA 4IEFB 3RE1A 3SZOA 2ZRAA 3AJDA 1G9TA 4CKEA 4DSNA 4EAAA 1WHTB 2JGAA 1XTJA 4JROA 1XNRB 1CY2A 2NACA 4Y2QA 4RELA 3GI1A 4MMYB 1LFAA 1JLLB 4MGYR 1X92A 3ZIAD 1DFIA 2HWKA 3FSRA 1TAUA 2C4VA 1H2EA 1ZBQA 5JC8A 1I4DD 3NH6A 2VAWA 2Q1WA 3ZBQA 2PD3A 4BE9A 4D9MA 1H5UA 2PA3A 5FOWA 2VNIA 1Z2NX 1V5EA 4ESHA 2W6IA 3IMKA 2GTPA 2DF8A 4GH5A 1U0GA 2VZ9A 4P54A 4DM3A 9ABPA 1JQBA 2JS7A 4KVAA 3U7EB 2FETA 4IAOA 3P9XA 3P2MA 3HCAA 4I1UA 3UW3A 5K2OA 4X5OA 3H9EO 3CWZA 3EVGA 3PGVA 1NXVA 5A2GA 3KQLA 3G2KA 4JVOA 3V3TA 1WBBA 4WNCA 1GL9B 2PO7A 2A59A 4XEUA 4R8SA 1KEWA 3R9XA 1PNQA 4GHWA 3PX7A 1SCKA 3CCBA 1II8A 3SZUA 1P19A 4JJAA 3W7AA 4YGXB 2HMTA 4JJFA 5TGDA 1U5CA 1DQYA 1X8LA 2HJSA 3BK1A 3JQFC 2FSHA 4FGKA 1XPJA 3LZ6A 4DG9A 4Y2SA 5FLKA 3I01M 3KQKA 4XJSA 1SEVA 2XOKD 3GVCA 1K6XA 4ENVA 1JSRA 5JSQA 2GLXA 3JS5A 1DBWA 1IZ7A 2FXVA 1L5FA 3IAEA 1CUEA 3QVKA 3RUPA 3VJRA 1JMYA 1ZL0A 3V8EA 1ZMOA 4UUPA 2FQQA 3QX7A 2CXSA 4DZZA 4KFUA 4MDFA 1G2PA 4GSKA 4RQTA 3WHIA 4CFSA 1E69A 4CVNA 4NS4A 1KP9A 4JC4A 4MLDA 4QPJC 1JF8A 2BKUA 4G3XA 2CXQA 3OLXA 4DJJA 1K5DA 5D00A 5FJIA 4C6TA 4QLOA 1D7OA 1QHNA 4NIMA 2J7PD 1BDJA 2VF8A 1MNAA 4EB8A 2O8CB 2W6MA 2X2PA 1YBMA 4X0EA 3THYA 3MCWA 1KZ7B 3LBFA 3CZQA 1XROA 1N2CA 2HGZA 4UU1A 5G4LA 1M75A 4ABYA 3EH1A 3PCXA 3OFKA 1NHGA 4CL0A 4Y1GA 3LW8A 2JA2A 4YUWA 4AS3A 2RDMA 3GJ3A 1AGXA 3BEOA 3NV7A 4PRLA 5F7ZA 4A5OA 5GJBA 4AM8A 3K3PA 1UP7A 3QEOA 1ZGAA 3KD2A 1QHHB 2V58A 3Q98A 3G0HA 4HWSA 1X9GA 1MIOA 4DNQA 5BSEA 3VR6D 1GDHA 3I2FA 1AS3A 2ZYRA 1CQIA 3BMCB 2WICA 3QX8A 3FYUB 3M6FA 2WSLA 3A6PC 3CR8A 2JFNA 1KP3A 3T52A 2NXWA 1WCIB 4DCPA 2JD0A 2PWZA 3I9OA 3E1GA 4KTTE 4UBMA 5P8WA 2G6TA 5BWBA 1DIOB 4HWPA 2AN5A 2GN9A 4LXGA 1W2WB 5A9SA 3U9TA 3LPCA 5EXPA 3GZNA 1T5LA 4IDDA 4WKGA 4AY3A 4CLHA 4Q3OA 1RYEA 3ABRB 3FYTA 3HNOA 3JWJA 1NVTA 5KTNA 3SVTA 2CJXA 3ZD6A 3ITNA 3PGXA 1S6YA 1LSOA 4H7HA 2NVOA 1Y42X 5LJLA 5E9QA 2XY4A 1EHCA 2H9IA 5HNKA 4GGMX 3OD1A 3U3DA 3HWSA 3BULA 3QU4A 2QBYA 4IDCA 4IBOA 4ZEOA 1JXOA 2JI4A 4LZWA 4DR3B 1E8MA 3K2IA 4TYYA 4H59A 1FS5A 2VS1A 3AW8A 2RH5A 3CX4A 4D9BA 2EXXA 4KYTA 5COBA 2BEWB 2IYSA 2XSZA 3OTHA 3EFHA 2V7WA 3GCXA 4NE2A 4D3DA 1NUPA 1QZUA 4NG5A 3OT4A 2AUNA 2VSXA 3AERB 4PLFA 4J2HA 1Y1PA 4JJEA 1C3JA 3QOXA 4P58A 3WYNA 3WRYC 3Q5EA 4XQ0A 3RPEA 2HPZA 4MI1A 1W8IA 2GESA 1A76A 4LYEA 3LK7A 4CM9A 2C4TA 3NDJA 4E31A 5M7EA 4W9NA 1KIFA 1V8BA 2HO5A 3WLJA 4RVOA 3U60B 2EJTA 4BL5A 2WR8A 2VT6A 3BDIA 2XTZA 3WLSA 2Q5IA 2Q5JA 4LZLA 1HK7A 2F9FA 4CN8A 2OL4A 2XNKA 5DOVA 1KQNA 1CUHA 2QLJA 3DL7A 2C7GA 3KOOA 4L50A 4P0TA 1ZEJA 3P7MA 2QTLA 5JSZB 3RFVA 5KYYA 3FPFA 1UDRA 1ZUNB 3T1VA 1QKJA 4LI3X 4IIBA 3OA2A 3B38A 4JZKA 2PWAA 1WXWA 2P3LA 2PXAA 1TYAE 2PX5A 1RM4A 1NUSA 2G0TA 1T4GA 3FPHA 1ATZA 3LV8A 3IAM6 3C3AA 2OXIA 3WWDA 1IPEA 2HK6A 1RZRA 1QORA 3IDSA 3C5WP 3T7DA 2HFKA 5C18A 4YBRA 3M83A 1ONBA 1JE0A 1OT5A 2D13A 2RH4A 3JVVA 1GAWA 4IDGA 2UYCA 5DI9A 2HYIC 3QY0A 2EKPA 4Y7DA 1DEXA 1V1RB 3NRJA 4R6WA 2VP4A 3K8YA 2NPIA 3BTUA 4E14A 3SJ7A 4B6EA 2MSLA 4TSKA 1EFHA 2I3GA 2O1XA 2B8TA 2V7TA 3DE0X 3QXJA 2YC4C 2YWHA 3UK2A 4B76A 2EBUA 1SC1A 1FRVA 2NUTB 3QOFA 2QT1A 1ZD3A 2AG5A 4ZYYA 2R6AA 3GLVA 1E1KA 4C6RA 1R3UA 2CLEB 1K7FB 1YD7A 1HLGA 1E0SA 3DGFC 1JEDA 1N8SA 2G82A 5B2EA 1BKYA 4AWBA 4O59O 2JCVA 3H2JA 3ZHVA 1ZYUA 2JVIA 2RHLA 2H4FA 1P5HA 2RGRA 2PUTA 3UAGA 3HDQA 1X9IA 2YTZA 2XDAA 2EARA 4JA0A 2G40A 4ZVUA 4B3DA 3IQHX 3JYNA 3DLHA 1G21E 1G19A 2P67A 2XUOA 3ER6A 3VU0A 1IOLA 2ZYWX 4ZT5A 4ZXFA 4DUGA 3I6IA 1VSQA 4TN1A 1IBKB 3L77A 3LDFA 2H52A 4BNLA 1AKQA 1NQ5A 3E7DA 2DM6A 1VJGA 5BT9A 2C5GA 3BGIA 3HRIA 1GA4A 1QR2A 3PC8A 4K9RA 2UZ1A 1LC0A 2H4JA 5TVGA 1FBNA 1N92A 1G6KA 3U0BA 3QBEA 2PXCA 2Y3IA 4RZXA 1SB9A 1WVIA 4G5YA 1DIAA 1NI4B 1SXJC 2DFVA 3OZVA 2VAVA 4S1NA 3DEIA 3I1IA 2QTVA 3B48A 5AJTA 4A8PA 3PC6A 2IYAA 2FEWB 4IIDA 4NNPA 2JGRA 1PQWA 2QGFA 1Y63A 1YMUA 4CIVA 3KNZA 1APBA 4E4YA 3F8TA 3E5MA 3PIRA 4YP1A 5DM60 2VRBA 1FU4A 2IHNA 5G1NA 3ZBPA 4M8NE 4RKWA 2XUQA 4KSBA 1F8XA 3KXDA 1XLTC 3DZBA 2FUG1 1Q7TA 1YE8A 2HV8A 5THXA 3AL3A 4J8PA 4R2HA 4YN3A 4F86A 3ZY3A 1YR8A 4J0JA 4AY4A 5F51A 2DBZA 1ZM3A 4I9FA 1E58A 1OI3A 3U3ZA 3NVKI 2DBQA 2CEAA 2H51A 5E6UA 1XRLA 2OHIA 1M2OB 1UPBA 2NP6A 4C5CA 4ENQA 2D1TA 1NFFA 1TL7C 4C0JA 1C0LA 1R9JA 5DRYA 1IUKA 3A6LA 3UF0A 4PSVA 4KBYA 2OK8A 2J5BA 2Q5OA 4RE6A 2XH8A 4AMYA 1LY1A 3DZKA 3MQ2A 2Y6UA 1J2RA 3NTUA 2LD4A 3K0BA 4EWLA 1IN1A 3UWSA 4OPMA 2ONYA 3AQ4A 1LBHA 3I3SR 2AIRA 4PICA 3SJUA 1G42A 3S27A 1T0BA 1ZM2A 1XXHE 1JXQA 2IY8A 3L6RA 1B3RA 5JD3A 3QZUA 1K4KA 3PQEA 4K81B 1IXSB 3BJIC 1UK9A 1CZKA 1N2XA 1PX0A 2AD5A 2OV6A 2P91A 3NWBA 4M8IA 4OUKX 2ZJ0A 1YZQA 3E23A 1NMXA 2QF7A 1T2AA 4IWXA 3DGEC 2W6ZA 5HXAA 3NC4A 2NTVA 3KLOA 3L7CA 4HC4A 4IMJB 2FSFA 4ZD6A 1FDUA 2H29A 2AS0A 1GNSA 2GILA 1Z36A 4C2BA 1HA3A 2XE7A 1P81A 1FUYB 2CLSA 2A9OA 2BMVA 3OG9A 3R20A 2QRQA 3PD7A 4ER3A 3BQ9A 1USKA 4A2PA 3S55A 1T8RA 2P35A 2PLNA 2XNJA 2Z3ZA 4R8LA 4IJ5A 4XGQA 1QTNA 3KL4A 4F12A 2H4HA 3EVDA 3RDPA 4MS3B 3ADDA 5CVVA 2FDRA 3HKCB 4LE2A 1KE1A 1JJAA 1NNUA 1W85B 1Y4SA 4B0PA 2HUNA 1E6EA 3IEKA 4AS2A 2ZQZA 3DMTA 3CZMA 4G89A 1G5RA 3T5AA 5AIAA 4HJRA 1GDDA 3UY4A 1SC6A 2ZREA 4C01A 4OFXA 3ZY2A 3H9CA 3N2GB 2ZBEA 3T8YA 4L9AA 4ARIA 5I8ZA 3HYLA 4L07A 1ILEA 5A4AA 3V7FA 4JXKA 4YUAA 1S9DA 1S3IA 5LQJA 2AJLI 1V3UA 4IKOA 1XYGA 3H13A 4NESA 4IDAA 2F62A 2RK4A 1T13A 1ARZA 1YDHA 5FUVA 3Q8WA 4U2KA 5AI8A 3WYAA 3HLKA 3LAWA 3PUKA 2PNFA 1MVOA 3WKEA 4D8TA 4F5EA 5FO1A 2M2IA 4HS9A 1UBTS 2HKIA 1U0TA 2VTDA 3TH5A 2POCA 4TLCA 2PAFA 1L7PA 4DQLA 4DJEC 2VHVA 3D4PA 3EIXA 3HHPA 1XR3A 4LXUA 1CXZA 3PBKA 2ZSHA 2FKAA 3Q9SA 2VDLB 5JNRA 3E0XA 5JD6A 3FKJA 2I9PA 3FNIA 1CUJA 3PZBA 4HXYA 4OLHA 3BHMA 1CBUA 2IPMA 3P0HA 1XP8A 5AVZA 1NJ5A 5LWQA 5TMDA 1MO4A 1HLDA 2OCIA 3NI2A 3PPVA 4B6FA 3TRHA 1D2GA 2I2CA 1NAIA 3PSHA 4UDYX 1X1DA 4WY8A 3C3JA 4XM0A 1VE6A 1DC5A 3PE4A 4YT5A 1I2DA 4KL8S 4OHYA 3RTGA 4D8UA 3AKDA 2FDCA 2VEDA 3N87A 3CUWA 3HVKA 3DVQX 1I7NA 4G0ZA 2X9LA 4FILA 4A7PA 1OZFA 4HYYA 1P9LA 5J2UB 4EVIA 1GU1A 5JUWA 3UOWA 3G2LA 5CA1B 3DP9A 3AUKA 1SR8A 4KRXA 3W3AD 1S0UA 1BXRB 2ERXA 2VNAA 4P0PB 3U80A 5DLQC 1VXRA 2ECKA 2AFHE 2EQ5A 3L0PA 1SPBS 1GOTA 4D43A 4DR5B 2VLBA 3INNA 3EN0A 4TXNA 1LDEA 3BF8A 5TT0A 2CJPA 5TQ0A 3T3MB 4G0VA 3EZXA 1L7OA 2FPLA 3MJVA 2PO5A 3QM1A 3SJAA 1VPLA 5BR4A 5AVQA 1P7YA 1LKZA 4TS3A 3VH3A 2WMOB 4IYRA 3O03A 4E94A 1OX6A 1XZNA 5JZVA 2R60A 1D2NA 1A7AA 1CUIA 3WK9A 2H57A 3PXDA 5I3CA 4H1VA 3WO0A 3FZNA 2GNPA 2H59A 3SC2A 5CH3A 2P30A 3C15C 4FJ2A 4OUDB 4WXEA 2QVZX 4QVGA 3HZRA 2YXPX 3SJBA 2IH5A 1QYDA 1DWPA 4RFVA 5F5LA 4B3SB 4FR5A 3P9QA 1FYVA 1U6KA 2AK3A 1BE6A 5AM5A 4FUTA 2CWWA 1DINA 2ZTHA 1EUZA 1O03A 2GJKA 2ZU0C 4NP6A 5BV7A 2PZMA 2PVPA 3IUBA 3CPSA 3SGLA 5BUQA 4OKSA 4WIAA 3AEUB 2J85A 1L4KA 3T5TA 3KYCA 3TKLA 1GKYA 4I9UA 5JADA 4U02A 2P6MA 2QI9F 1X7WA 3JD2A 4WE3A 1OHHA 4NCKA 1GM5A 1LVHA 2H5LA 2GSWA 4LYJA 4CKWA 3L4BA 1T9BA 4S0XA 4X9XA 4KGZA 1PEYA 3ERCA 5EIEA 1Q19A 4U2DA 3A11A 4GVXA 2AKAB 2VZ8A 3ZOZA 4DR6B 4BMSA 3RAEC 3E9ZA 1L5VA 1RZVA 4CCYA 1N5LA 1ACMA 4KQ2A 1AY0A 4H9GA 1HUQA 1XMXA 1ICEA 3EXEA 3IT0A 2I7XA 5CLLA 3T7RA 1OU4A 2GPNA 3PHGA 4AP6A 3EEOA 4IPTA 1U8TA 3GMIA 1NIPA 2G1KA 3I45A 1YUNA 1L1FA 5LQNA 5J2TB 3UC9A 3DTVB 2XKBA 3UCFA 2JLZA 1GSHA 4GC5A 2JJ2A 4I36A 1P9WA 1XL0A 3CEPB 2IELA 3DDZX 4TV9B 5ITWA 1JQLB 2ZJ5A 1KNQA 1NP7A 1JWAB 1RPNA 2EX1A 2VJQA 3PRKE 1GZSA 4JR2A 4UREA 4IL5A 1UZAA 5AICA 3JWIA 5E7IA 2IYFA 4B45A 3C7AA 4WLVA 5B1HA 4ER7A 4YMTA 4KREA 2BGNA 2GGSA 3USES 2CL7X 1OH7A 5FUQA 3RK1A 4XPZA 1TQ8A 2X23A 4HK4A 4B44A 1DAOA 2AEJA 2GCOA 2SKCA 4ITRC 4HNVA 1FXWA 4AYTA 5CCBA 5G2OA 2VAXA 4IFBA 4MWZA 4FCWA 4QVIA 4CEHA 3AU9A 3K70B 5EWMA 2AI3A 2BDEA 4NYJQ 4TKVB 2QMOA 1QE3A 3A6ZA 2EFCB 1H94A 4KLZA 5I4IA 5JS7A 1MAWA 1B42A 4QELA 1TA4A 3PHJA 4M1YA 1XTIA 3BH0A 4F5YA 4X90A 3RO7A 1A98A 4F3TA 1O8CA 4DCSA 1TF5A 3Q7PA 3WQBA 3MELA 4UVHA 3LPAA 4GKKB 5LQKA 1SXIA 4JBYA 4NJEA 1AOXA 5BY2A 3G88A 4W5QA 1U0NA 4XGIA 1O4VA 2X0NA 2NU6B 3MT9A 1TNDA 1XDGA 2I22A 3AB3A 3WI7A 2M32A 3I61A 2JJ1A 4YS6A 3MT0A 2R8OA 1GFIA 4MVCA 1ZFNA 4O2AB 4PIMA 3VZSA 1OXSC 3NNNA 1GZ6A 1YAJA 1OWLA 4I1YA 1NY6A 1Y37A 1VE1A 3VNQA 2VFAA 2VXYA 2YFKA 4AMVA 4EUNA 4ZHQA 2QTGA 3AG5A 1I6MA 3G5TA 3SIWA 1JBEA 4L6CA 4Z9BA 4I8DA 1CF4A 2MSEB 1QQ7A 3C1UA 4JYPA 4IIUA 1KC3A 3FVRA 3V32A 3W79A 1MR3F 1FXWF 2W48A 5KSWB 1PNTA 5AUNB 5AJYA 4G0XA 3DOIA 3CRW1 1ADCA 2DRIA 3NBXX 4MWTA 5LC1A 2DUJA 5TPZA 4CWAA 4EI2A 3QLVA 1H0SA 2GD1O 1V5GA 2HZ7A 3B51X 4HAXA 1W88B 4HFRA 4MARA 4FFNA 3FH0A 5FQOA 4OHCA 3G8CA 5HS6A 4KXVA 4JA2A 4DR4B 2FEMA 4RD4A 5E9AA 2MJLA 2XOXA 2X42A 2DTEA 2ATEA 5JFGA 1U80A 1Y3HA 2OCYC 2PX4A 5F7OA 5T3UA 2COUA 2ECOA 1WUTA 1IY8A 2I65A 4GPTA 4JBGA 3D9QX 1E0KA 2WHQA 3GOQA 3PC7A 5F1KA 4FFPA 2VZ0A 4GE0A 1YQXA 1WS6A 1N77A 1PWYE 5DYGA 2H9YA 4Q7EA 3TPCA 2VDNB 3TBHA 3G0CA 4L0MA 1E60A 2GM9A 5IZCC 2X41A 3I1YA 4WBNA 2O06A 2QV0A 2SICE 4BQEA 1THTA 3LCVB 3F3MA 2ARKA 2NX2A 3QW4B 4FYVA 4LRTB 4DA6A 1O9GA 4WFQA 4U2EA 5EYPB 4C2TA 2OK7A 4OHWA 2BGWA 3RSSA 1YXMA 3WDKA 3Q11A 1WY5A 3RRXA 2WU0A 5JYBA 3KVVA 3WBBA 3FWYA 1YS2X 3LT1A 3VYTB 1OTHA 4HKTA 3IILA 1OFUA 2A1TS 2H1FA 5CW2A 3QIVA 2PSSA 4RGQA 4U39A 2H5JA 4OSOA 1MOZA 2AF4C 3IP3A 1D2MA 2FWAA 3R3SA 2VTVA 4QUEA 1XOIA 4E5NA 1QBGA 1CY7A 1V8FA 3H1FA 4HDKA 3X0DA 4LHSA 4HD8A 1TT5B 2QEQA 4EW2A 3IAUA 4AG3A 4R6XA 1A77A 4B3XA 1E2IA 3F5MA 3IHWA 2YYSA 4G0QA 1NURA 5IAKA 4FZ3A 4RVHA 2MU1A 2Q4TA 1MTZA 2FWPA 3RC9A 4ZCMA 2HMWA 3GPBA 4DJTA 5E3IA 1AZLA 3FCAA 4U7GA 3L7BA 1NI3A 1JNXX 2RHHA 4KYUA 4WLFA 4BQIA 4F96A 4WBNF 1P0IA 2F6RA 5FUXA 1S3SA 1ZVJA 3L07A 4MH0R 3HB7A 4XYMA 3SBOA 3AFHA 3M0EA 2ZCVA 5CIYA 3SCZA 4WOJA 2BFMA 4ZAXA 1QO7A 1Z15A 2C0CA 4BO1A 4KU4A 4X1IB 1ENPA 1I7LA 4QDJA 4BE7B 4C7VA 1SGWA 2RK6A 3ACCA 5LYJA 3K0EA 1NNI1 4UUAA 5T7BA 2A33A 4I66A 1R12A 1PGPA 4IXTA 5TQJA 3S2EA 2C2KA 3ZJYA 1NE7A 4YLGA 3EPLA 4AQ7A 1QB8A 3ISVA 4RGYA 1Z4OA 3C6ZA 5BWMA 1FNCA 3IB6A 1N0IA 3Q12A 2Y0BA 2B9VA 2WSMA 2GO1A 4TZTA 2FU5C 1XEFA 1BCSA 4MW5A 2Y93A 4RMGA 4IIEA 4FJ0A 6GPBA 1F3LA 1AO3A 5A05A 1IRXA 3ND7A 3ZHRA 3IP7A 3UH1A 5GTDA 3T1TA 1CEXA 1GLNA 1ADYA 1SJ9A 1EXWA 3E8SA 4Y0VA 4DQVA 3IQIX 1HQDA 4I9HA 4PRYA 5E9WA 3V6MA 5C1IA 1Y5MA 2IDKA 2PMWB 1KEKA 2D2XA 2XQVA 2AI2A 3PKIA 4GECA 3UV3A 3GP5A 1MVLA 5F21A 1YQDA 2IXFA 3Q8KA 3MWLA 1CT9A 1AQUA 2QD2A 3EXG1 4WNAA 2IXBA 3U3JA 4CTNA 3ONFA 3JALB 3VNAA 4YMLA 1ZZGA 2QTTA 4YRTA 3Q9UA 5HIJA 4QKQA 4LHXA 4CU5A 3EEFA 2XA1A 1L9KA 5LYJF 2PUDA 4QNNA 2OILA 1ECPA 2JJMA 4Q48A 4RF4A 1ENOA 2QAIA 4B3CA 3KQWA 4CYMA 1TGVA 4UZEA 1BXGB 1C3OB 1UBKS 4YEDA 1HEIA 4XUDA 2D0IA 4Y2XA 3TSWA 1SBYA 4UM7A 4PG4A 5KWVA 3O3MB 2C7PA 3QVOA 1O7JA 5CCEA 3EOAI 5CNKA 3K9LA 2Z2XA 4NDZA 3G1TA 3JSAA 3LKBA 3GQBB 4JQSA 1WO8A 1PGQA 1YT5A 3ROPA 3VPBA 3IAM1 1YL7A 4CNBA 4Z3OA 3MUNA 1W0KA 2EIHA 4FUQA 4MVJP 4IIXA 3SXUB 4B48A 2QRVA 2FJUA 2XTMA 2QYHA 3AG6A 3D6UA 1KO8A 2OZLB 3A4MA 3KR9A 4MRAA 5DBOA 1RVDA 1TQDA 3NH9A 4X71A 3G9QA 3ADOA 5JNTA 1P45A 1TVCA 5HJ5A 4MCHA 5DLDA 7AT1A 2NZXA 4J2OA 4L2IA 2WPDA 4UXJA 2V6JA 4TSRA 3LDUA 5F2OA 3TLYA 4RPCA 3A3NA 3TR0A 2V8OA 4TL7A 2BW0A 1AUVA 1RKXA 4E5SA 4CF3A 1XZAA 1FBTA 2FRDC 4TMVA 4IEIA 3ZWWA 1ODFA 4QXPA 2HXYA 1RJ9A 4A5SA 2GJAA 2PFGA 3PWKA 1MT3A 3TG8A 2DERA 3K0HA 3HA5A 5AM0A 1FFEA 3C5EA 3S8MA 5DM0A 3V4RA 4BNFA 4BB9A 3ZNOA 1IULA 4ZVSA 2KHZA 2LR0A 2BUAA 2XE4A 4OQQA 4D97A 1FLVA 1U0RA 3QXCA 4L51A 1JEYA 2O59A 1WSDA 3INGA 3PQCA 4LRXA 4BRUA 5AVOA 1XT6A 2G88A 3FOEC 1IWBB 2FPUA 1TQ6A 3QLUA 2IWRA 3IPAA 4I8XA 3NIGB 3FTCA 4P53A 3SBDA 2CHVA 3HLTA 4RVSA 1G41A 4R1NA 1C9YA 4OHKA 3QELA 1RWQA 4ENRA 3FRIA 5IJ0A 3ORSA 1J0EA 1XI2A 2J3DA 1G3QA 2R2AA 3FPLA 3HU3A 5D86A 4XDHA 5EJIA 4JIMA 5IULC 5AWFC 5KSYA 3BMQB 4BP8A 4CR8A 2WV9A 1KBZA 2D8AA 1MAUA 2FWNA 5B2ZA 1Y3BE 3EW7A 4JKIA 2Y1WA 3G3EA 3UXHA 4RE5A 4JL6A 1YMVA 3HG7A 3ODPA 2CDAA 2Z8YA 1M1NB 4WXRA 2V8BA 5FWDA 3WMEA 1NLZA 2I5PO 2WY2D 4BBZA 4F72A 5LKAA 3C1OA 2AXNA 2FP3A 2PUVA 1NKSA 1DQNA 3JQ7B 4ZQHA 3L5KA 3TLGA 5KTYA 4S1OA 4NFHA 2OWDA 3QA3E 2V6GA 4KGVA 1G4UR 1QC5B 3VM6A 3TLXA 3ZPXA 1A3CA 5TY0A 5FV7A 1JDBC 2ZRHA 1RBZA 2WIKA 1TMGE 1KPGA 4GR9A 5TQ0B 4EL0A 1VJCA 1PV4A 5IJZA 1NONA 2A9FA 1NV9A 1OC4A 2VIIA 4AMBA 2EOAA 3DV0B 4QD3A 2HNAA 2VK1A 5EJGA 2QB5A 3KZOA 4WLUA 1AK9A 1I0LA 2A3NA 2P2CA 3CNBA 2OCLA 4R9RA 1Y7PA 4HUJA 1C1DA 5KNCH 2G6BA 5CXSA 4GVLA 4LVUA 3F5SA 4KZKA 4G0UA 5A7GA 4DDTA 4LBZA 2IRWA 1G5TA 2WINI 3RVLA 3TOVA 2VXCA 5FWYA 2VCEA 4L8YA 4WA8A 3U0VA 1KEPA 2QRLA 3IP5A 3T61A 2C4NA 4FC6A 1WVMA 3C41J 5GM2A 2JIZA 5LM3A 3H5RA 1DFGA 4PPGA 3N2NA 3RJ5A 1ULBA 4BZXA 1QGZA 2WQZA 1JQEA 4M0DA 3GDOA 3S1AA 1EAYA 3E2MA 3DDOA 3GAAA 3TUIC 2FFQA 5JJIA 2CUTA 4Q4AB 4I5GA 1J99A 1BOFA 1GG2A 3OFNA 3HE3A 2F64A 4QDKA 4MUMA 3RS7A 3UAZA 3ZE9A 4C4PA 3CE6A 3L7AA 4J0QA 3I4LA 4PG7A 2DBYA 2C77A 3E2IA 4F6CA 3REGA 1XRPA 3JQ9A 1FU8A 4EKYA 4CEIB 4V39A 1R9MA 1Y4ZA 3VKUA 1UR5A 1JE1A 2XCRB 1YVDA 1N5RA 2WNHA 5CVDA 1L8AA 1TJPB 4Q5IA 4TZKA 4L5IA 2ZROA 4MWBA 4UNIA 5EP2A 3TMYA 2YMLA 4KDRA 3CX8A 2C97A 3HWRA 4V1CB 1XLWA 4D0RA 2EKQA 1YI8A 3BORA 3VU8A 5K5EA 5LD2C 1DMSA 1QH1B 2VP5A 1JLSA 4GO1A 3ZDZB 3KOWA 2BGIA 1ZOPA 4F4JA 3OX4A 1V26A 3R8XA 3LE8A 1BQEA 2XW6A 3GFVA 2H16A 2QTBA 1LQUA 2OUKA 1Q12A 5F5NA 4KC0A 1CKEA 2BLNA 4OLFA 4S1PA 5C5EA 4JAVC 1G5PA 3FNGA 1JKJA 3WK8A 4AJKA 1EBBA 1N3LA 2GHTA 2UVDA 3A06A 3Q8XB 3TCNA 3RC8A 2I1LA 3EXG2 3RC3A 4NMXB 4N76A 5F76A 3AR9A 4X54A 4R9SA 2R9VA 3IODA 1UDXA 4JP2A 4XX0A 5PGMA 1OBFO 1RJGA 3VZRA 4DXDA 1XX6A 2UVPA 5G40A 3IA2A 2CNLA 1ZITA 1YR7A 2HCTA 3VRHA 4DPLA 2BSQA 3ZY5A 2VBCA 3DTVD 3LRPA 1TVKA 4YRRA 2OO7A 3G0BA 4MICA 3BSWA 2JLUA 4BPBA 1IY2A 1NFRA 1NMSA 1VYHA 5DHQA 2I3ZA 4CHTA 4QM6A 4YY3B 4P4NA 1EX9A 1Q7CA 3I12A 2EKZA 2QN1A 1L5HA 4OXXA 3MYYA 3FLEA 1WABA 4AUEA 4C0LA 1II0A 2KWIA 2VO1A 4GR5A 4QFMA 3U6KA 4NCAA 3PHHA 4RWZA 3SHOA 4K7JA 2VT2A 2BFCB 4HNAB 5I7EA 3K70D 5TS2A 1EJ0A 1I3MA 1HURA 3F9IA 3HV0A 3QYPA 3ZDEA 2IIQA 4TM8A 3AEXA 1M7GA 4N3GA 3IQFA 4Q1VA 5BV1A 5EJFA 1RM5A 1GVHA 3ITEA 3VI3B 2M9MA 2OEPA 1ODJA 2W11A 3EZYA 4YQZA 1NTRA 4DR2B 4WEQA 4COOA 1AXGA 2VDKB 3G2QA 5AI4A 3HU5A 5D6NA 2FDXA 3A9RA 3PIDA 3FR7A 1OFGA 3K35A 3ETJA 4XPIA 4Z0HO 3TIVA 2CNKA 5DWQA 3M5WA 2BF7A 1XZ8A 1BX1A 3FUXA 5KQLA 4O1HA 1GG9A 2JGFA 1VDZA 1K5GA 1R6XA 2QW0X 4LV6A 4AJ4A 5ER9A 2J59A 3WGTA 3PRJA 2VJAA 2Y1LA 3WSTA 4UBKA 4NBKA 2AR9A 3QPBA 3NNDA 4N6GA 4QEZA 3MCAA 2Y1OA 2GBFA 2NOAA 3G8BA 4ZEVA 3GBVA 2ZAYA 2B2CA 1HDOA 3Q1KA 3DE7X 4A2QA 3B1KA 1O3YA 4B09A 1KJYA 1SOWA 3QX9A 3SI7A 5LZ7A 1C1XB 3E53A 4H3KB 3JYQA 4BWFB 2XGGA 2IZ6A 3LQRA 4RSRA 2ZS8A 2QLFA 3NEJA 2VRCA 3QOWA 4P33A 1RXSA 4TYMA 4E22A 4UTRA 4E2YA 3KKPA 5JC1A 1EX7A 1WXXA 3ESCA 4BJ6A 4CDNA 1ZGJA 1KJZA 3JYLA 5G0SA 3B53X 4AG6A 3BXFA 3VISA 1AQYA 5KYWA 2ZM5A 4JENA 1EYZA 1AUXA 3OJLA 1E1RA 5F7JA 1QQ5A 4MITA 4NHOA 2VLIA 2R7MA 1FYWA 1MC5A 3WQQA 3HA7A 4L5JA 1BMFD 1OLSA 4DA7A 3ILXA 1S02A 1VL8A 1BHO1 1OFHA 1UOOA 1JZSA 2ODTX 3I0MA 4L08A 4Q7JB 3UJAA 5IG2A 2BMJA 4UU0A 1KH2A 1D6NA 4V0LA 2P1DA 3JQ8A 2OQVA 4BYGA 2D4HA 5L53A 3BERA 5K45A 3R5JA 3LSYA 3UJNA 2QTMA 4PCUA 4IMPA 1RJEA 5D5HA 5CVJA 2IXGA 3KTOA 4RW0A 3UW1A 2IBSA 3C97A 3ELBA 1C4KA 3VGJA 2JIPA 1ESCA 2PSJA 3TOSA 1IJFA 5HTOA 3OCXA 2WIAA 4NSNA 5DGTA 3S3TA 2A9QA 2NTNA 2ZQ5A 5HUQA 2FLVA 1KO4A 4HH0A 2WYVA 2WTXA 3EE6A 3LIPA 5U1PA 1U1CA 2XJ9A 1KQPA 5G4KA 4JUDX 1AVTA 4IOKA 4CTMA 1Z22A 5ALVA 3QNWA 3UWOA 4UAVA 2IE8A 1TLFA 3RUHA 3WIOA 2OO5C 2RAFA 1BKDR 3GGDA 3GYGA 3ZWNA 4G26A 2VL7A 1N57A 3C3XA 1ZJJA 4TZ0A 2D00A 2A0XA 3RASA 1JHRA 5EWJA 3ME5A 3RNOA 2DBVO 2Y2UA 5K0NA 1JECA 2OZVA 6CHYA 2DC1A 3GLIB 2RK3A 3GNLA 4Z5XA 1UM9B 5BNWA 1GL3A 3P4XA 5FOUA 3T4EA 4AKIA 3ETLA 3EHDA 1NVVR 1TGYA 3AC0A 1KQFA 3GJ7A 4KQ9A 4KIFA 4ZOLA 1TK3A 5DN9A 4TKMA 4RY9A 3GRCA 4BASA 2Y05A 3EGOA 3EYWA 5ESXA 3W2FA 4XH9B 2M1ZA 3TTSA 2YWJA 2O1SA 4EECA 3BMNA 2MYNA 5HCUA 3CLRC 4R84A 2X8BA 5HF5A 3VPFA 1RC0A 1IEWA 2DUWA 1WWKA 1YS7A 5C37A 1GPLA 5L7WA 3CH7A 2C96A 1QAMA 4OAPA 1JL3A 3C3WA 4KPFC 1N9GB 3OCWA 5C8YB 3WDLA 1MG5A 1WUJS 2WIJA 3PVZA 4MUGA 4ALMA 3CLUD 1ZUIA 1GQFA 5ALSA 1BS9A 2D5BA 3IDOA 1WW8A 1H9BA 4C4RA 1E5XA 1KYVA 1UPFA 3AWIA 3HI4A 1BGVA 1BXKA 3IX7A 4OQZA 2RAUA 1MORA 4WGFA 3QA9A 4NZMA 4CLOB 1SU8A 4Z4HA 3PT5A 2JFZA 5AK3A 4JT8A 3L8DA 1IUNA 1TCAA 3QNUA 1V4BA 4N5LA 5C51B 1SXPA 4P7GA 4WOBA 5FBLB 1CRQA 2O5CA 1V11A 4YFYA 2RJNA 4ZOLF 3B1JA 3AGPA 4NOJA 5BR7A 3UJ8A 1VM6A 4CI0B 4EW3A 3MAJA 3ZJUA 5B36A 4JT2A 1QRRA 1VLZA 3QFFA 4YALA 4D4MA 2PGAA 5E0OA 1E9CA 2NSJA 2VHTA 4B74A 4IKPA 3WHKA 2A67A 4I3GA 4ZFNA 2G9VA 2J3LA 2P68A 4IIJB 3DPSA 2HQBA 1ADBA 3A1CA 4GOOD 4BLPA 4BCCA 4XKJA 4AJ1A 3U1VA 5A3QA 2A9PA 2XI4A 4E2FA 1G0OA 2NPOA 3KCNA 3L7JA 1ODCA 3LYHA 4WJKB 1AZWA 2XIQA 2ONJA 4BNHA 1DMRA 3HJRA 2GJ9A 3S1LA 4BFCA 1G8GA 2B5WA 2W4IA 3FYCA 3DFFA 4MYDA 1RI2A 2OPBA 4WINA 2XMQA 1POXA 3CT6A 4M8KA 4W63A 3ORYA 1GGHA 3L1VA 4PLHA 4AL4A 3NHZA 1X39A 4N40A 1DGQA 2BL4A 3BHNA 3HKEA 1BAPA 2BWJA 2HMVA 1X7XB 3USCS 5G1OA 1XMJA 2PJZA 4OYLA 4W1RA 1AKNA 2BONA 1KDZA 3FTFA 3PC3A 1NF9A 3P2IA 5J9FA 2CYCA 2RHWA 2H5IA 3LJKA 3BTSA 5FIUA 2I8AA 4MQEA 4PZEA 4LF4B 1N2JA 2WOJA 1U1GA 2O8FA 2J0VA 4R51A 3GG2A 1AXRA 1KBOA 1O97C 3A1NA 3NNSA 1F17A 4HEA6 3KHTA 3NALA 4JVMA 3VO2A 3RKRA 4LJSA 1U7HA 1U9ZA 3A6FA 3SICE 2G71A 4N9QA 4MAFA 3N07A 5DP2A 1KOFA 5FLXA 4H1HA 3F3KA 2AOXA 1DBIA 3DZHA 4CM7A 4QPPA 1AK2A 1TEXA 1K92A 2ET6A 3DNPA 4M4SA 3GD5A 4N47A 3H2YA 4MMZB 4YJ2A 1ZGBA 4MV3A 5CNJA 5I45A 4WW0A 3FVWA 2P0AA 5HPYB 1M5RA 3QU5A 1Y4AE 1O0BA 1H66A 3O1IC 1KEVA 2XNDA 2C9BA 3VO1A 4YR9A 4JJ7A 5DGIA 4GYJA 2I2AA 3INYA 4BEJA 4AO6A 1N5OX 3AJ9A 5CFPA 1UQUA 1B6SA 4FFRA 3OE7A 3MGGA 2HY7A 3DV2A 3EGCA 2B78A 2XXAB 2PFKA 3TRFA 2GETA 4P4TA 2E6UX 4C0XA 1I3NA 5DLYA 3WOVA 2KI5A 1EFTA 1L5WA 4O63O 2Y6VA 3IPRA 3V8BA 1VPVA 4MKZA 1ZR2A 4US2R 2JANA 4C30A 1KRXA 1V4VA 4FHGA 3WGJA 4IOMA 1RRVA 3R5SA 3UTCA 1PFGA 3UMGA 3UENA 5BWLA 4JQYA 1N3BA 3QXXA 5TEWA 3RVSA 2VJMB 4EG6A 2H2DA 3OPYB 4YJ2F 3L4JA 3C3DA 3C4QA 4JJGA 3SYLA 4ND7A 2QVYX 5K4HA 4J9UE 2IEBA 1B2RA 3ORHA 5D5QA 1AHNA 1T24A 4R5MA 4ZQBA 3T5CA 1N7GA 5IKOA 3V7YA 3L8GA 3VYRB 1Z47A 2AGVA 1EGQA 4BNXA 4DSTA 4MW4A 1P4HA 1Q1AA 3VTZA 1YTLA 1Y8QB 2RHRA 3CZCA 1YBHA 1OZ0A 4EMTA 2IEYA 2K2WA 3W5HA 1GPAA 2XHEA 4JUCA 4NBUA 4LZOA 3HNRA 1Z75A 1MF7A 2B8EA 4KPUB 5IJAA 5NLLA 4IMIB 4ZO7A 3N0WA 1Q0QA 3SKYA 1E9RA 3IVMA 1FFAA 2I55A 2X5OA 4ZTBA 3JQEA 2JLVA 2X4GA 4QTUB 3BF7A 3HR8A 5ENVA 3RUAA 5H82A 1NT4A 1E4OA 1WKBA 4HXGA 1RBQA 3BL5A 4IZ6A 5FNZA 4L78A 1V5WA 5C4MA 5CLQA 2AFHA 3F71A 1I3KA 3UHPA 5AQ1A 1LI7A 1A9RA 2PQ6A 1KOJA 3K6SB 4LI0A 1Y7TA 2IYQA 2A6PA 1PJRA 4RLHA 2VDVE 4EHFA 1TEHA 3PFKA 2BGGA 3ZH9B 1XC7A 2FK7A 3UV7A 3GJSA 4PYIA 4G9GA 2B9EA 1MX3A 4RK6A 1S8OA 2OZEA 2O2CA 2P4HX 2PD4A 1FQJA 2A8YA 3CWQA 2PVCA 3RGWS 2KMLA 4F4FA 5J23A 5L4LA 3IVXA 1SIOA 4LG1A 5FA5A 4KLNA 3RIEA 3HJGA 4QOHA 2PSEA 3WFZA 4FJ1A 5CA0A 5CEFA 3HFJA 4AY5A 5CVTA 1DJMA 1G291 3RS2A 4A91A 3S0JA 3EIUA 3IT1A 1ONOA 1TZJA 4YRJA 4ASUD 4QX6A 1SEPA 2H08A 3D3JA 1K3TA 4FHZA 1NYQA 2FLWA 1CR4A 3KAJA 2NYVA 4O4HA 3T5MA 4QQFA 1XD2A 1T15A 1Y0BA 1XAJA 1XEWY 3L8YA 4EG7A 2WU4A 2HLHA 5IM5A 3REQA 2QA5A 4HX9A 4MV4A 3FCEA 2IXEA 3V8PA 5T6BA 1RLJA 1V25A 4A0HA 1Z12A 4P4UA 4EGJA 5BURA 2HIAA 2VTKA 4JOQA 4AZ0A 3KEMA