5U4XA

Coactivator-associated arginine methyltransferase 1 with tp-064
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
AVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-arginine methyltransferase CARM1
publication title TP-064, a potent and selective small molecule inhibitor of PRMT4 for multiple myeloma.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2016-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5u4xA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5u4xA01
3HVKA 5FHQA 1D2HA 4Z2YA 2B3TA 4FP9A 5K0LA 1FP2A 1RJEA 5EEGA 4DQ0A 4ER6A 5BW4A 3R9XB 4PYIA 1N7IA 3HCEA 2E5WA 2FHPA 2P7HA 2ZLBA 3O7WA 4KIGA 4PIPA 4RVGA 5ERGB 5FCDA 4IKPA 1P1CA 2G1PA 4DF3A 3QV2A 4KWCA 5EIWA 4RTNA 3OU2A 3HM2A 3JWGA 4XUEA 2IH2A 2ZFUA 3T7TA 2UYHA 3LPMA 2XYVA 5M5BA 5KQRA 1F3LA 1VP9A 5F2OA 5DSTA 1KYZA 4P7FA 4IV8A 2Y1WA 1ZQ9A 5K0GA 2UZ4A 2XBMA 2OZVA 5K0EA 5G02A 3MTEA 3SX0A 4RTMA 2N47A 3T0IA 1ORHA 3M4XA 3KQOA 3M6VA 2DPMA 1O54A 3G2OA 3FYDA 4AX8A 3ELYA 3BT7A 3AWIA 3G5LA 2G8NA 3X0DA 1WG8A 4OQDA 3WSTA 1DUSA 2XYQA 1JQDA 2WA2A 2C7OA 7MHTA 5IH3A 4R8SA 3RW9A 3UA4A 1YB2A 2PVCA 3FTCA 4RTKA 2VDWA 3Q87B 1M6YA 3THSA 4QTUB 5U4XA 5E2BA 3KPYA 3CJQA 2JH9A 2JJQA 3F4KA 3LBYA 1XVAA 2IDJA 4GOOD 2G72A 1JQ3A 2H1RA 3VYWA 4PYMA 3SGLA 5EKUA 1KR5A 2NXCA 2PLWA 5FTWA 4R6XA 4PWYA 2PWYA 2PX2A 4E2ZA 3K0BA 2NNWB 1FBNA 3NWEA 1VQ1A 1NKVA 1G38A 4M38A 4V0RA 3DMFA 4IWNA 4AUKA 1XJ5A 3CCFA 5CVUA 1MJFA 3EEYA 3KQWA 2A14A 2AOTB 5D1HA 4QDKA 2BZGA 4YMGA 5MHTA 3TMAA 5HZMA 5E8JA 1JSXA 3V97A 3GIWA 1O9HA 1T43A 4FSXA 1P1BA 1XDSA 2FK7A 1Y8CA 2ZVJA 3C6KA 3EVDA 3R6TA 4OBXA 4B17A 2O0LA 3IV6A 3OFKA 4YUXA 1OR8A 5ICFA 2HR1A 1DCTA 2UYCA 5CCBA 1X1CA 3I5UA 1KIAA 4QQNA 3KQMA 4LWOA 3KQTA 3M33A 5EZQA 1AQJA 1MHTA 2JG3A 3O4FA 4C4AA 2O05A 2P7IA 3CVOA 1RI5A 4NECA 4P58A 4BLWA 4PYOA 5C0OE 4XUDA 5EC8A 2EJUA 2OB1A 2ESRA 1NW3A 2I9KA 1YZ3A 1JG3A 4PYLA 1RJGA 1NBIA 2HV9A 1ORIA 1I4WA 4HH4A 4P7GA 3ERCA 3UJAA 4GBED 3LDGA 5EMKA 4RTJA 3EVGA 5DPMA 5DM4A 4A6DA 3GO4A 3M70A 1FP1D 2C7PA 2VS1A 4GEKA 4V0QA 2G71A 1NW8A 3G2PA 3UJBA 9MHTA 3UWPA 5GIPE 5C1IA 1WZNA 3RODA 5KVAA 4FS8A 1L3CA 4IV0A 2V7EA 3LCUA 3HCAA 3REOA 4XUCA 1JSZA 4AZWA 3ORHA 1VL5A 5FQOA 4GQBA 3FPEA 3PFGA 3OE4A 2NP6A 5EIFA 5CUQA 2PWPA 1NV9A 5DX0A 1H1DA 5DTMA 3KHKA 2YTZA 2B25A 4K6MA 4OX9Y 5EG5A 4CWAA 5T6BA 2NYUA 3B3JA 5DTRA 1BHJA 5FWDA 4E2WA 4POOA 2AZTA 5LQRA 5GOZA 3LDUA 3NDJA 3B3FA 1QAOA 5HIJA 5K8VA 1SKMA 4RVDA 5FUBA 3OZTA 4BLUA 3TLJA 3E7PA 3BZBA 4AZVA 3ELWA 4PYJA 3UZUA 3DLCA 3OE5A 2P8JA 3UFBA 5DXJA 3EGVA 4MHTA 5HIKA 3EGIA 2NP7A 1AF7A 1B42A 3AY0A 3DOUA 2ZBQA 3CBGA 2CMHA 3LDFA 4X61A 2HTEA 2O06A 2AN4A 1SG9A 3TQSA 1G8SA 3CGGA 1KPIA 2XVMA 4FZVA 3MGGA 5EEHA 3OCJA 3OFJA 4R8RA 4YV2A 2VP3A 1M6EX 3GNLA 3KQSA 3EMBA 2IH4A 2ZBRA 2ZIEA 3DLIA 1RI4A 2OO3A 1UIRA 3T7RA 3OZSA 3T7SA 4GF5A 5HFJA 3TM4A 4HSGA 4CKEA 3DMGA 1P91A 3PX2A 3SVZA 2PX8A 1WXWA 2HMYB 3PT9A 4WVLA 5DRYA 4CTJA 4DM3A 2HNKA 3C3YA 4OA8A 2CMGA 5BP7A 3GDHA 2ZZMA 5EKXA 5HOQA 8MHTA 4KDCA 1SUIA 4OBWA 4QQKA 5LQUA 1NE2A 4RYLA 5K0BA 4E2XA 5JR3A 2QRVB 3HTXA 2ZW9A 4WXHA 2CKDA 2H11A 3KPJA 2IFTA 3SSOA 4C04A 5HIIA 1JQEA 3MQ2A 3IEIA 3KPWA 5E1MA 3BWCA 5CD1A 5FWAA 5K0FA 3BWBA 1Q0TA 2AVDA 2R6ZA 2WA1A 3LECA 5E2AA 2JHCA 2FYTA 4PCLA 1AV6A 3Q7EA 1IY9A 1PJZA 2B9EA 2AN3A 2ONZA 3A4TA 5F2NA 5LQAA 2UYOA 1RJFA 2AOXA 3M6UA 4HGYA 3P9CA 2I7CA 5T64A 2ZTHA 3A26A 1D2GA 1IM8A 3MHTA 3DXZA 4LG1A 2BM9A 4BP1A 4A6EA 1KYWA 3C0KA 1QAQA 3GU3A 3P9NA 1RJDA 4HTFB 2AOTA 4MIKA 5E1BA 2PBFA 3E23A 3MCZA 5B1SA 4EKGA 5ICEA 3LBFA 2JHPA 1NV8A 2ERCA 4E30A 5E1DA 3P9IA 1SVUA 2P40A 4RVHA 3TKYA 1O9GA 2C7QA 3HCCA 5E1OA 2YX1A 3NW9A 3EMDA 4HC4A 1N2XA 4RV9A 1KPHA 1UWVA 4PYNA 1JTEA 2G70A 4E2YA 5DX1A 3GRZA 3DTNA 3DULA 3GRRA 3JWJA 4YV0A 2IIPA 1NT2A 2P3QA 5IKMA 2YVLA 3PTAA 3HCBA 4E70A 3VSEA 5K0CA 2NXEA 3FUVA 3ER8A 5KQSA 2AOUA 5GP1A 2BR5A 3M6XA 3PVCA 4ER5A 2EFJA 2WK1A 3FPHA 5DLYA 2GB4A 3BGVA 3E05A 3KR9A 3B3GA 1ZHFA 3EVCA 3UJ9A 5FA8A 1QZZA 3TFWA 4ER7A 1EJ6A 5CM2Z 4PIMA 4X63A 4GC5A 1EG2A 5LQCA 3LSTA 5EMMA 1L3IA 2IH5A 3PFHA 3G2MA 3ER9A 3DXYA 1G6Q1 4QVGA 2OXTA 2AR0A 5EHIA 1I9GA 3A25A 4UOEA 3UBTA 1YF3A 1D2CA 2QE6A 3HA7A 3LL7A 4ISCA 4EKIA 4EMSA 1X1AA 1XDUA 2Q41A 5DRTA 2H00A 5EVJA 3UJ7A 4ER3A 3GRYA 4M7RA 3EVBA 2PX4A 2FRXA 3GJYA 3UA3A 2PXCA 2EX4A 3ELDA 1JG4A 1PRYA 2K4MA 4AZSA 3IHTA 4MWZA 4YUZA 1V39A 4FT2A 2ZIFA 3SMQA 4GC9A 5FULA 1G60A 5JUWA 2OB2A 1FPQA 2EJTA 1ZG3A 1AQIA 1XTPA 2YQZA 2C7RA 3KQVA 4LWPA 2GPYA 3BWMA 4RWZA 4G56A 5DM2A 2ZWVA 3NJRA 4C07A 1Q0SA 3HP7A 2I62A 4H0NA 4KRGA 4PGHA 4CKBA 4F84A 3C3PA 4LECA 4PCAA 5DXAA 5GM1A 2BH2A 3L8DA 5EHGA 5P8WA 3GGDA 4PYKA 3GWZA 4BY9E 3AXSA 2FPOA 1L1EA 3BWYA 3FPJA 1QANA 3DH0A 4GUAA 2CWWA 2PT6A 3FUUA 1BC5A 1WS6A 2VDUE 4FSDA 1VP3A 1NW7A 5FHRA 5K0NA 1X19A 4M37A 4YUYA 1R18A 3KQYA 3KQQA 5EMJA 10MHA 4BP3A 1SQFA 2GLUA 4RTPA 2AS0A 4PONA 2LD4A 1XXLA 2ZULA 5GINE 4E31A 5DX8A 2QRVA 4C08A 5GIOE 4Y2HA 5FQNA 3SSNA 4PINA 4L7VA 1EAMA 2ZIGA 2O07A 3B5IA 1ZGJA 1VIDA 2VZ9A 5DT2A 2IDKA 1G55A 4RTRA 5K01A 3VC2A 4E32A 3GRVA 4QPNA 3TOSA 1KPGA 3LX6A 1VPTA 3HVJA 3G88A 3G89A 3A7EA 3KPUA 5EMLA 1ZKDA 5F2KA 1WY7A 5GM2A 3VC1A 4YMHA 4E33A 4GOND 4X41A 1KXZA 1X1DA 1I1NA 4X60A 3IYLW 2Z6UA 3ELUA 1RI1A 1RI2A 3GXOA 5BXYA 3G8BA 2ZCJA 3KR0A 1EIZA 4HTFA 3GCZA 3TPZA 1G8AA 4GOLD 3UJ8A 4ATNA 2NXJA 1ZGAA 5ICCA 3SR4A 2BR4A 3EVAA 2XYRA 4YUWA 5EOVA 3CJTA 3THRA 3JWIA 1VLMA 4XCXA 5KYGA 4PGGA 3NTVA 2GA9A 3I9FA 4P7JA 1TPYA 3P2KA 3ANXA 2CL5A 4DCMA 3HEMA 3MERA 1DL5A 3OU7A 2ZSUA 5K09A 3FPFA 2YXDA 3P2EA 2BR3A 1FJXA 3SXJA 1NW5A 3HCDA 3MTIA 5CVVA 4KW7A 5E8RA 4M36A 3EPPA 5E9QA 3KR1A 5LSAA 3FYCA 2UYQA 4QTTB 4U7TB 5KS2A 3MAGA 2OPBA 5DWQA 2PXAA 3B7PA 4QDJA 4ZTBA 3E8SA 2JHAA 3FZGA 5BW5A 5K05A 2FK8A 1TW2A 3QOXA 4KDRA 2PGXA 3EEOA 3CJRA 1INLA 2I6GA 3I58A 4EK9A 4DZRA 2YUIA 5EQJB 2P3OA 2AVNA 2V74B 5CVDA 4BLVA 4DCGA 3P97A 2KW5A 5DTQA 5LQKA 3NMUF 2QY6A 1XDZA 4HRAA 3UJCA 4C06A 2PX5A 2XVAA 3LCCA 1R8XA 4C03A 3MCTA 5T67A 4MTLA 1SUSA 2PXXA 3LCVB 1JTFA 4RTQA 5DM0A 4RX1A 3KPVA 4FT4A 3FRHA 3PB3A 5CVEA 3TM5A 3DXXA 2OBFA 1BKYA 3LHDA 3PS9A 4OQEA 1L3BA 4O29A 2QM3A 5FA5A 3P8ZA 3I53A 1L9KA 2Y1XA 4Y30A 3G2QA 1P39A 1RI3A 2AOWA 4R05A 5FADA 5GWXA 4CKCA 2QYOA 2Z6AA 3KKZA 2OKCA 3DUWA 3H2BA 3R24A 3A27A 3G8AA 4DMGA 3S68A 4P7KA 5CCXA 4DKJA 3A7DA 5HEKA 3LKDA 2HWKA 3BGIA 3EVEA 2IBTA 3C6MA 2IBSA 1YUBA 4RVFA 4RTSA 1EQAA 5DSXA 1YFLA 1KHHA 3OPNA 3P71T 2EG5A 2P3LA 2JH8A 3K6RA 4AZTA 5EPEA 3DP7A 2BM8A 1XCJA 4QPPA 1EJ0A 2ADMA 2OY0A 3CC8A 1NBHA 2PV0A 3FUTA 3HNRA 3CKKA 5C9ZA 2YXEA 1Z3CA 1M0EA 2F8LA 3KR2A 1N7JA 3M6WA 4FGZA 5K0JA 3P2IA 1UFKA 3FRIA 4RTOA 2YXLA 3OZRA 2IGTA 1TW3A 2GAFA 3OU6A 3PLAE 3G7UA 2GS9A 2NXNA 3EVZA 3G5TA 3HVIA 1QAMA 3MB5A 4X1OA 5LQNA 1XCLA 3FUWA 2R3SA 5EZSA 2VDVE 3B89A 5LQJA 2AOUB 1X1BA 3LGAA 3V8VA 1VE3A 3KU1A 3DMHA 1SQGA 2P1DA 2PY6A 2ZBPA 3NDIA 3BUSA 4JXJA 3DR5A 3FUXA 4HGZA 4RSRA 2OYRA 3BKXA 5LR6A 2B2CA 2IPXA 4FR0A 4ER0A 4EVIA 1R6AA 2O57A 3O31A 2Z6QA 1JG1A 3BGDA 1BOOA 3ME5A 5H02A 4CTKA 1F38A 3QOWA 1YZHA 3BXOA 2DULA 4C05A 4CXMA 3AJDA 2ORED 3FTFA 5CIYA 3TKAA 1JG2A 4RTLA 2ZZKA 5E9WA 5HILA 2PT9A 3NVKI 5K03A 1R74A 2YR0A 3JWHA 1QYRA 3TRKA 4KVZA 2AOVA 3EGEA 2P41A 3D2LA 3TR6A 3EVFA 3LKZA 4KIFA 1R00A 1R8YA 3I64A 4YUVA 3NVMB 3FTDA 3R3HA 1HMYA 1U2ZA 3SM3A 3U81A 2PSSA 4YV1A 2ONYA 3HCFA 2B78A 2ZZNA 2PKWA 5DM1A 4F86A 4MQ4A 3GRUA 5ICGA 3FPGA 5CVJA 1JR4A 3HA5A 2FCAA 3RIEA 4OA5A 4PYQA 2IP2A 4HG2A 4GOMD 3SSMA 2AN5A 3UJ6A 1IXKA 4DA4A 3UJDA 2PJDA 4PNEA 1KP9A 1NW6A 3HVHA 3KQPA 3PX3A 2GH1A 3R0QA 5HIMA 4R6WA 4U7PB 3FTEA 5D1NA 3ID6C 3NWBA 3HA3A 2ZWAA 1VBFA 4F85A 5E9JA 1HNNA 1WXXA 2P35A 3AXTA 3BKWA 4QVKA 5EGSA 3P9KA 4EQZA 1YFJA
chains in the Genus database with same CATH superfamily
2QMYA 2V7GA 4E3WA 4B32A 2WUEA 4RHUA 4G1BA 2GEBA 2WMDA 4DQ0A 5IDQA 3E2PA 1PF7E 3VH2A 2E5WA 2X86A 4M3NA 4E4TA 3IUJA 2ZE8A 2J1LA 4KDEA 4KI7A 4AM8A 1K1EA 3O8BA 1CJMA 1LUAA 2G07A 3PQ3A 3K31A 1KO4A 1KRHA 1FYDA 1U2DA 3IT3A 1TRKA 3KXDA 2EOAA 1F3LA 2YZNA 2YZKA 3MD0A 2IY7A 4FMDB 3A1FA 5MFZA 4XDZA 3H5RA 5K0GA 4A36A 2P5SA 4W6ZA 4QAQA 1Z7GA 1HL3A 4KGVA 4A82A 2OZVA 5G02A 1BA3A 1QGAA 3I3SR 1NN5A 3LUBA 4M86A 4ZT2A 3RFVA 2O3RA 5LD2B 3AKDA 4BCCA 4D4LA 2QSYA 1DZ3A 1F7UA 1NIPA 3JD3A 4EHAA 3L3BA 5JS2A 5FEUA 1PR4A 2H5LA 3AWIA 4CIWA 2VXBA 1GYRA 2OSVA 1NVFA 1ANKA 1FDWA 1J2RA 1D2AA 3DAOA 3E9RA 3V4SA 4EY7A 5JAOA 2W8BA 1GSOA 5JXHA 3MOSA 1ZICA 2JCYA 4PG7A 621PA 4KR3A 4D42A 1I94B 2F48A 4OXKA 4TSFA 4E5DA 3MELA 2OHOA 4B80A 4W7IA 3GT7A 1ONPA 5GQSA 1GV1A 2RGBA 3HR7A 4WFJA 1JQ3A 4RCVA 1ZH2A 1JIQA 1ULUA 1J56A 2I7DA 4UBLA 5ERYA 5G0TA 4UNRA 4KN5A 1C9KA 5E3JA 3D4BA 1ODJA 1NKVA 3AC0A 3LPCA 5HZGA 3CH5A 3SIPA 1WD7A 2ZIXB 3PZRA 2QVCA 2UZIR 4RJTA 3EEYA 1E0KA 2Q1TA 4P3PA 3HJCA 2UVQA 5E8JA 3RDPA 2BGLA 4L02A 3GIWA 4F5WA 2FB9A 2Q4TA 1Q2XA 3AFGA 3DE0X 4QXPA 5L3QB 2M1ZA 4ZTUB 3DVQX 2XT6A 1Z88A 2X1VA 4UEWA 5ICFA 3F8TA 2RDMA 5A6VA 1WB9A 3I5UA 4K5QA 2O2EA 1Y3CE 2Y77A 1E7YA 4RADA 3KJZA 3MJEA 2XYGA 2I66A 3EXEA 2ZKIA 4COOA 4LDZA 3ZDXB 1FLVA 1C4WA 2V5UA 3BE4A 2A0WA 2QMHA 4HQ0A 1TYZA 2QDKA 4KVGA 1I80A 1UK8A 2PCJA 3RWOA 3U4CA 1P1RA 1I4WA 1JEYB 1MORA 2P68A 2Z4TA 1BXRA 2CN1A 4XASA 4XDGA 3FOZA 2COEA 1Z82A 2TMKA 2YW9A 3SS8A 2E87A 1OFUX 4DLKA 2QN8A 3F6YA 2IC5A 3JAKA 4MUHA 3TN7A 3R9IA 2WIKA 3OG9A 4DJ5X 4F91B 1GSHA 4F93B 1L3CA 5DB4A 2NO6A 3OOHA 3LCUA 4J07A 2XSZA 2QAGA 3ITEA 3UFXB 3ZTYA 2BJWA 5K4GA 2YJGA 1ZM3A 4JZKA 2PWPA 5TY0A 4LDQA 3FIUA 2ZEJA 4R2XA 4GKAA 1XNQB 3OFVA 2QD2A 3H2IA 4FIZA 1NN0A 3T1VA 4C9BA 2J0QA 1WD5A 2OBLA 2CXRA 4UPVA 5AI0A 3TMKA 2W6JD 2HY7A 3OEHD 4D57A 2EEZA 4LNUB 4HNQA 1TA9A 4OP3A 4H1UA 5FOTA 5I3ZA 4E08A 1I3MA 2OO5A 3ZR4B 4MW6A 1K4MA 3T1YB 4CTMA 3A0UA 3KC2A 2HJRA 4IGEA 3UZUA 4I6JA 2D1QA 4JLSA 1CSEE 4TZ6A 4PS0A 4V03A 3PNLA 4GLJA 2TYSB 1I3NA 2GZ3A 2EVWX 1MG0A 2B8EA 3EGIA 3MQ4A 1B42A 4L8WB 4PVCA 4RHYA 3WLHA 2D7CA 2YJ3A 4ZOCA 4MI9A 1ECPA 1G8SA 4IKOA 1ZM4A 4HQRA 4P4GA 1WUKS 4IHQA 4GX1A 2ZBRA 4Q4DA 2P0EA 3I8OA 1HQDA 2QRMA 5FT9A 1Y6QA 4OJYA 4HFMA 4ALNA 5IAKA 4OYHA 4QOIA 1OTXA 1Z26A 1H2AS 4ZAYA 1T10A 4WVLA 1JR3A 3UWOA 2HNKA 3JTEA 3ZW7A 4CGYA 1E3SA 2C4KA 2VVTA 4YJFA 1Q7CA 1BU5A 4EGCB 4ZZIA 5A2GA 3FN4A 1NE2A 1WR8A 1G19A 4AO6A 1GA6A 1T6ZA 3CLVA 3UMVA 2XD9A 3HTXA 3OE1A 4ND8A 3DNMA 3IP1A 1E3IA 5GJBA 4AG3A 3FWNA 4C6HA 3ADOA 1N2CA 5B12A 4NH0A 3BE5A 1M34E 1O58A 2QOEA 3PUZA 3KB2A 2HF2A 5E2AA 3BH0A 3VYSB 1AV6A 2D5CA 2R6DA 1PJZA 2I22A 2RKOA 2Y1LA 4M9ZA 3PFIA 1M33A 5ALUA 4KWEA 3ET4A 2CE7A 2C29D 2GD6A 2JZOA 4C21A 2YIJA 1LS1A 4CR7A 2ZTHA 5BY2A 3PYMA 2JEYA 4P38A 1V8DA 5AUOB 2VJLA 3PHJA 1GPJA 5BQ3A 1QAQA 5KJ6A 3STXA 3COZA 4I2NA 4PV7A 1DAPA 2HTFA 4URYR 5EXPA 2AFRA 1PX2A 1CJCA 3E23A 5DNWA 2ZSKA 3K2IA 5AVOA 3L0BA 5KKAA 3W4JA 3NX4A 4F8YA 3MBOA 1ADCA 1B0PA 1R6TA 3ORFA 1IE3A 1T8WA 1J8YF 2AQ8A 3DNFA 2A57A 3I8XA 3BGSA 3JD4A 4HGRA 1TCVA 5JYCA 4CIVA 3UPUA 2DT8A 2ID7A 1SU4A 4JX9A 4QLOA 2FF7A 1BX0A 5BSRA 2H48A 3QELA 3IQEA 4KXWA 3F9IA 4M9RA 4EZEA 5CFPA 1IN7A 1G6HA 3FZEA 3PJFA 4R68A 1U5BB 1QU3A 3G6KA 3P94A 4JB3A 1RWMA 1RWQA 2DWPA 1E8NA 2P3QA 2R60A 4FVTA 3RJMA 4WJKB 4YC7A 3JQGA 3BMOA 3M89A 2F1KA 2ODQA 4X6XA 1G6KA 2EL7A 2NVUA 4FMCF 3G8CA 5K0CA 2AMVA 4P4TA 4WESA 4LN1A 4G0OA 1E3TA 5CAEB 4C88A 5F4ZA 3ER8A 2XB2A 2YFQA 3AVXA 2GB4A 3MPOA 3LZDA 4ZQEA 4YRNA 1UPCA 5H9VA 3DVLA 2DKOA 4DQLA 1CUWA 1S8FA 2G6TA 5LQCA 4L3WA 1JQKA 1Y33E 2BGMA 4LHZA 1XNHA 2BP7A 2XCIA 5JS1A 1RQ2A 2IH5A 5DI9A 3RVJA 4NONA 2XGJA 1R5NA 3K35A 4AWBA 2AR0A 2INGX 3Q2OA 1YA4A 4K6OA 5I8PA 5IZCC 5KZMB 2HIAA 2W8BB 2WSIA 3C39A 1MD9A 3IVRA 2ZYVX 1U63A 4ER3A 1XU9A 2GN0A 2PWAA 3DOJA 1K7SN 2WIFA 3EYAA 1SQ6A 2FRXA 3IELA 1DCKA 2GBGA 4MA5A 1JIXA 1PRYA 3EEQA 3ONDA 4QPDA 1F8YA 2QW1A 3B2QA 3GN2A 4TWZA 4YJHA 5JARA 5FULA 1G60A 2YIMA 1UXHA 3B3AA 2VNJA 4ND6A 4PFKA 4WN3A 1XTPA 3GVHA 3LO5A 3COVA 1F14A 3G3EA 5A7HA 1NOJA 1P5JA 2VAWA 5T4EA 3VR3A 1X8KA 3UG7A 5A2QA 4KN9S 5LYYA 3MT0A 1B00A 4JP8A 4WGFA 3HR4A 4HT3B 4EA6A 1W1WA 3AVTA 1R5OA 3FDZA 2WTUA 1L1EA 3DAHA 4UFPA 5EY5B 1ID1A 3WLPA 4ZN6A 5KKNB 3B13B 3EPKA 2PT6A 4WZ6A 4IIGA 3FUUA 4RPCA 1D03A 1BKDR 3OIYA 5CW2A 2BDEA 1UPBA 2JLYA 1KYTA 4MTCA 10MHA 1GGFA 2O8DA 1C1HA 2DSNA 3AUXA 5ALTA 2HQBA 4AK9A 5KNBH 3CIFA 3FSGD 3ZKWA 1HTBA 3U4HA 3U4MA 3S7ZA 3ND8A 1GLGA 1RAIA 4F4CA 2FLKA 1VLQA 4PINA 2I2BA 1PLKA 2CLCX 1PR1A 4MGHA 1RWKA 2VEDA 4BN4A 1FU7A 1RYHA 1MJHA 2M9MA 3RJ9A 2O8CA 3JAKB 3OQNA 4M2LA 5BQ5A 2GPTA 3ASYA 4YGYA 1ZKDA 3T9DA 4DMFA 3WBFA 3GRKA 4S1VA 2XXBA 1SBTA 1Z6QA 3SICE 4B34A 1Y82A 1YVUA 3PDIA 2WY2D 1L4KA 4XQCA 1MX1A 1ZIPA 4L7QA 5KEIA 3TLCA 1V2GA 4IWYA 4JIMA 1VI5A 1Y1KE 1OLSB 3I1YA 4R51A 1U8YA 1H8EA 4BB5A 2GT1A 2XYRA 2C99A 2YZGA 3ER6A 2HJWA 4YJ2A 2CHEA 3DWGA 3IP7A 5KYNA 1A77A 2XNCA 1RR6A 4L9WA 4U7HA 3ST7A 1EESA 2Y1OA 3EISA 3GLHB 3KV1A 3CKYA 3ZUPA 3QY0A 2VP5A 2QM0A 3FRJA 2FVYA 4G0XA 1ZNZA 1X7YA 2D2FA 1PE0A 3R0IA 4DQUA 2AKYA 5F3DA 1RABA 4DY4A 2SNIE 1JBEA 1Z4QA 2W8ZA 2ZSUA 1I2AA 2IW1A 1Z6YA 3I5AA 4PC3A 3UUEA 4DWWA 2RGCA 3G5UA 4ZRNA 4ICIA 1BMQA 1XNGA 3KELA 3N2GA 3PUKA 4RJIA 4XWAA 4Y6SA 5AQ1A 1ECBA 4CF3A 3EPPA 1IJKA 1TQ6A 4A2QA 1W4AA 3NIWA 3NUQA 3AQIA 1FS5A 4KXYA 2FJ0A 1DLIA 4WOPA 1LLQA 4Y9DA 3RREA 2WYOA 3UC9A 4GR9A 1Z2NX 3ESQA 4FI3C 3QEOA 2BGWA 1ZPDA 2PXAA 4DYHA 2B5OA 2HQ1A 2J31A 4YJFB 2EIXA 2PQ6A 1TW2A 3TAUA 3OJLA 1FDIA 3NZEA 3VSBA 2I7TA 4ND8B 5DHQA 4HZUA 2ZBGA 3CPHA 3S27A 2ZB8A 6Q21A 4BX0A 1Z56C 3RS5A 1JR2A 3GBVA 1HDYA 1N2CB 1W0KA 1Z13A 4KXNA 4MHSA 6NULA 3HSSA 5DM0A 1MAWA 2CLKB 1FJGB 1GUZA 4C2AA 3PNOA 1DRJA 4FC7A 4JXZA 3TLGB 3GAMA 3GX1A 4TQ9A 3CX3A 4L16A 2VA8A 3L1UA 1OZ0A 4R7GA 5LQDA 3PD0A 1X1TA 2II6A 4OMDA 1L7QA 1V9SA 2V7BA 4JOSA 1M1ZA 3H2BA 3EAQA 4YYZA 4IQ8A 1P61B 2NG1A 3VDQA 4LZPA 4D8YA 5DJ5A 1M2KA 2IEAA 3LKDA 3BGIA 3LWZA 2O0HA 3IE0A 1N36B 1EQUA 1HQKA 2HM7A 3EXAA 1WLSA 3V7YA 4H6WA 5KQPA 3RO7A 4NU8X 4BYGA 2YRWA 4FS3A 1XTZA 3IUNA 4DEXA 3K6RA 3LDAA 5G40A 2B4TO 4LGVA 3B6JA 3MJDA 4ZI3A 4TLMB 4H3SA 4Y0AA 4HMPA 1X3LA 2REOA 4DOMA 1JKXA 3LKBA 4EP1A 4AY6A 2BGKA 1D9XA 4NSNA 4LE1A 5IHPA 4TS4A 4B3TB 1HDEA 2ZI6A 3G79A 1O6GA 5JQWA 4B9AA 3KL2A 2QW8A 3IIIA 3A1WA 3WJ2A 3JQGB 1Q6ZA 1NOIA 2HBYA 4KAXA 3PD1A 4KR7A 1SCQA 1OASA 1H4VB 3BD7A 2RD2A 1LNZA 4KXXA 2ETXA 3W5DA 3OEED 4Z7QB 3LGAA 4IGAA 3DMHA 4CFZA 1PNRA 2V6FA 1VG1A 2VRWA 1SM4A 2WHYA 3F6CA 1WV1A 1ZUHA 3AGPA 4EJSC 5JYBA 2VLBA 1Y1LA 1RFGE 4IH9A 3JWEA 2O57A 3C70A 3KKQA 3MD9A 1PNVA 5JS6A 1XEFA 3VX4A 2HDNB 1OI2A 4MH0R 3CH7A 3HDYA 1C2TA 2Z04A 2BGJA 4IMIB 4OM8A 2JLUA 1B14A 2QORA 2X0NA 3F3SA 4EGFA 3B51X 4O1HA 3D1JA 2PPLA 5A4MS 1B74A 3BM5A 3GCWA 4C4TA 2XNDD 1CRQA 1V1MA 2YR0A 3OT4A 5ABPA 4X0EA 1XA0A 1AGYA 1UBSB 1E4YA 4AVYA 1ZJ6A 4MGEA 2H7YA 1B73A 3FWPA 2PMEA 1T1SA 2HC9A 5AUPB 4Q1DA 3DMPA 2CEKA 3WB0A 4A3SA 1AUVA 3TL2A 1SC3A 2IZZA 3HA5A 4YXFA 1PT9A 2BE9A 3PXBA 4E09A 5B3JA 1UXKA 1JVNA 2A1TS 3WLMA 1ILEA 2Y1FA 3I2GA 5A6SA 4ZV4A 1NW6A 1ZMRA 4HAWA 4NFSA 3WK9A 4D8VA 1JN0A 1NC1A 1RQGA 3PUYA 4IUCS 4BBJA 2WWRA 5LFAA 1IULA 4OM7A 2DHCA 3NWBA 5D1NA 3W1VA 4DUGA 2MYPA 1KVSA 1EP3B 4DADA 4TVKA 3FF1A 1AZLA 2D13A 4PR0A 3ADCA 2OPHA 1CR2A 3T7AA 5KSOA 1EM6A 2O8DB 3WRXA 1RWVA 2WFZA 2ZVPX 1I1OA 3RS8A 3TD9A 2HCBA 1EVKA 4DLBA 4QQ8A 4RVGA 4PQFA 4HB3A 4CV3A 4ZHSA 5JC1A 2LIVA 1ZC4A 3B1VA 3LQQA 4H35A 4JJFA 5GV7A 3N2KA 3A6DA 1WB5A 1WZCA 4J16A 4MINA 5ENZA 1MX3A 4YJKA 3WBKA 5L40A 5CYPA 2PR2A 4RKRA 1RYZA 3Q72A 1GZVA 4O1IA 1CNMA 3TOVA 1RE1A 2B1JA 2N3ZA 4EUKA 3ZHRA 4TXMA 3N5CA 4YYEA 4A5SA 1QZXA 4C0KA 1U0OC 5AT1A 3VSAA 2OV1A 5CTAA 3WGUA 3E1KA 2DJIA 3V9PA 2PL9A 4K6GA 4YFYA 2CZQA 2OAGA 5CVCA 1NBME 1WG8A 2QN3A 5KTTA 5JSHA 2I2XB 1F3OA 2WKPA 5D5PA 1XEWX 5FL7A 1Q0ZA 2HW8A 3UAGA 2DWCA 2O2GA 1PT7A 1RKQA 3DZDA 3ICWA 3IKVA 3K9GA 3FVRA 2H06A 3R5JA 3G2LA 2EKBA 3ORRA 4NULA 3VO9A 3LBYA 1E9VA 3GFOA 3W2HA 3AOEC 1UZAA 4ZKEA 1ZQ1A 2C5EA 3U9LA 1UDRA 3SGLA 1M72A 2YJ4A 3M2TA 4JFRA 2BZ1A 2DFKB 4LSGA 4TRJA 4YK7A 3PLRA 3NDBB 2KSQA 2PX2A 2B34A 2GN2A 2D2XA 1GTG1 1E1NA 1PJLA 4WASA 1TAHA 3SDBA 4V0RA 3EW9A 2IZ0A 4FYWA 1MJFA 4LXYA 4NBTA 2EHJA 3IDFA 2QR2A 3E35A 1SKUA 2LVBA 1RM0A 3TX2A 1RQLA 2G83A 2I1WA 2O2ZA 3WV4A 3NI2A 3MLEA 3C3BA 5EYPA 3W5IA 3ZWCA 5FAKA 1IN6A 1R6XA 2XUFA 3C6KA 4BO3A 1LF5A 3ZQJA 4Z4HA 1V7QA 1X87A 2AGVA 4MV4A 1X1CA 2DSTA 3DCYA 3THWA 4LWOA 1N4DA 1JJ7A 1F48A 1YO6A 1RQNA 4NECA 3F7TA 1JRLA 2WVJA 1Q12A 4GG1A 4GPZA 4JUBA 1ML3A 1MTOA 2A9KA 3FFAA 4OI4A 1ESEA 1W4CA 5I7FA 2LKCA 1IPFA 3AKZA 1N77A 1NW3A 1CUGA 4PXSA 1X0VA 2OR3A 2PYZA 2JAPA 4R3NA 2P6PA 2ZAMA 2DQKA 2ZRGA 4FXPA 4HN2A 2BHSA 1O5IA 3NJ8A 3TGWA 2E18A 1WU7A 1T2EA 2PKEA 3KJQA 2C7PA 1UDBA 4DR5B 3VKWA 2ZIAA 1H8HD 2J5KA 4RJJA 5BSMA 2PGNA 2JLWA 4L8GA 3F97A 3FOAA 3HBAA 5HK8A 5K0TA 3LP8A 4XUCA 3WDSA 3NQ41 1AKRA 4W1SA 5EP3A 4B75A 2HJ9A 4B0PA 2FZKA 4BJ3A 3L8ZA 1KERA 2RGAA 2ZJ0A 3PYXA 4MEAA 3TZQA 3ENKA 3ONVA 2PZJA 4B09A 1RAEA 1WPRA 2HU5A 1JHUA 4HEJA 5IYZB 1MAVA 5LQRA 2LCQA 4J2HA 1ECFA 1E2EA 3IAM1 1LPPA 1TOAA 4FFDA 3IGFA 1LS6A 2YZMA 3QTLA 2UAGA 5SYMA 2J6IA 2IU3A 5JANA 1XTRA 3N8IA 3PHLA 1NVMB 4IIBA 4PCVA 2IT1A 3OLCX 5FAXA 2ZUTA 2OECA 4ND5A 3I2IA 1SUWA 2REQA 4US1R 1Y4UA 2ZBQA 3LP5A 4BWVA 2E4UA 2EP8A 1U8FO 4JHLA 4N3NA 2DKFA 2O06A 4EAQA 1K6XA 4TL9A 3S1AA 1KPIA 1JIVA 4PU0A 3P0FA 2NZUG 3OFJA 4R8VA 4UEQA 3DB1A 1NLMA 5U9CA 3TGPA 3MYYA 4HYQA 4NE9A 1P1FA 2X76A 1SCIA 3HGTA 4FQ7A 3T7RA 4DVJA 4FGKA 1TZCA 3K6SA 2EGGA 3WO1A 3ZWXA 1WXWA 3C4JA 2EV9A 1WKBA 4XQEA 3TS1A 2FPKA 3T99A 4OJKA 4ZZ1A 2WINI 4G5RA 4P3KA 3R7FA 1LTHR 1GRNA 2J0UA 2ZSIA 5B6IA 1M2GA 1E59A 1VE9A 1XXHB 2PLNA 3AHCA 1ZI6A 1P18A 2D00A 3KB8A 2BEKA 1V8PA 3ZV5A 1OH5A 3L40A 2MYUA 1Z6GA 3IBCA 2FMFA 1V1RA 1EB9A 5FJJA 4P5PA 3M0EA 4D4MA 3M8KA 2Q5LA 3W5AA 2ZAOA 3NBXX 4WBSA 1Z5NA 2J6HA 1R6VA 1I32A 1XQVA 2QAGC 3SFVA 1HE3A 3PUIA 4H2DA 4TMWA 5F7OA 1LDYA 4BO7A 1HX7A 3SJ7A 3D7RA 3RC7A 3OT1A 3MTAA 3WDMA 4ZGWA 1TM1E 1A2BA 1TX4B 4AXXA 1BQ3A 2CJYA 2WE8A 3WYFA 2V97A 1Y9AA 4HDRB 1F9EA 2QD4A 4OGWA 4DGSA 2DBZA 2PRYA 3CZRA 3O92A 3N3AC 3GLGE 1KGDA 2F2TA 4X1YA 1G5RA 1JU9A 9GPBA 3DBVO 1YQUA 2OO5C 4DA6A 1QP0A 1I30A 4OQZA 5F33A 1CUHA 4R7TA 1SRRA 2PH1A 3EWNA 1BWRA 2LRHA 5BNTA 2B99A 4PO8A 4OSPA 2R751 4Q3CA 5K9ZA 3HHEA 2DUMA 4D26A 2FN3A 1I7QB 2HREA 3GFSA 1CEXA 3I9V1 3R9KA 1J25A 2Q2OA 2J6CA 3F1KA 3MIIA 3D8NA 4GYYA 3TJRA 4DXHA 1JUDA 2GYVA 2G4LA 1QK5A 3U09A 3DC2A 1GCIA 1RBQA 1V95A 3K0HA 4I08A 2EQ5A 4BLRA 2IA5A 3OD1A 5E4JA 3BXEA 5A3QA 2CHVA 5BWNA 2J9GA 1D8AA 2G7MC 3Q0TA 4L5IA 1U7XA 3FB4A 3I73A 4ITUA 4MP8A 4NARA 2GCGA 4OQLA 1CX9B 2WWWA 3N2KB 3LGXA 2G6BA 3IUEA 5HF5A 3BRSA 3TLKA 1SA0B 1KMMA 1KTVA 2BR5A 2C7BA 2H31A 3DVAA 1L5OA 1RHUA 3O75A 4L5CA 3D54D 2C0CA 1EBUA 1LDBA 1QRDA 1ZHFA 2OC9A 3EVCA 4ZODA 1QZZA 1UMDA 3OAAD 4ZQCB 1JYEA 3DCIA 2PUAA 2CFRA 1AA6A 2ZETA 3I9OA 5BNWA 1L7PA 3WWYA 1QWOA 2IEBA 3PYLA 4B82A 3C7CB 1RZUA 2OLEA 3P9ZA 1CZOA 1PK9A 2ZBFA 2GOYA 4II2A 5EHIA 1RQ7A 2CXHA 1Y3FE 2GN9A 3KZMA 1AC5A 2VJDA 4EKIA 1YCGA 2FWJA 2HHLA 2W93A 4OHRA 3VYUB 1XDUA 1RW4A 3CRVA 4JLOA 4BLTA 4JLNA 4BMPB 4HNRA 5EWMB 2ZPUA 5ALGA 1XZJA 4OB8A 1GL7A 4QXAA 3QU4A 4FCWA 3UW1A 4L72A 3VOSA 4CEJA 1M73E 3UA3A 2QTMA 2EX4A 2W83A 1JG4A 4FMBB 1KDRA 3KNZA 3FMPB 5AVZA 1GDHA 4RV5A 3NRJA 2X9LA 4R2LA 3B1FA 4DTCA 4OCZA 3H5AA 4UMDA 4U9UA 3INTA 4P5EA 1FPQA 1B4DA 1ZG3A 3RUCA 1EZ1A 2DPXA 2JBWA 1JXOA 2B5WA 1P7VA 1YGYA 1QYWA 4MR8B 3EG9A 5CCEA 3HP7A 4QJIA 4PNHA 4KO1S 4Y7DA 4DRXA 3I4CA 3STYA 3MJFA 1ZI8A 1ZH8A 3RSGA 1K6IA 3BCSA 2ROQA 2B0CA 3L7KA 4UBNA 1JZQA 4WK2B 1QANA 1ZN7A 1BGXT 2JIOA 5KTRA 4DIDA 4JX8A 1J90A 3QVGA 2X14A 4TUYF 1B7GO 5CDFA 4BGDA 3THWB 1JLKA 4ANFA 1E66A 1AXRA 1OPXA 4GMXA 3DE7X 3GA5A 4REMA 2FWAA 3F98A 1GL9B 2Z5VA 3U7QA 3LA6A 3VA7A 1L4YA 5KOJA 1HURA 3VU1A 2LD4A 4K9KA 4LNHA 2PFSA 1ODIA 1J2EA 2WABA 5JRDS 5DX8A 1G8MA 3PGA1 5KB3A 4LF8B 3CNHA 5AJXA 1E1RA 1G0OA 5KNLA 3FYSA 2V8BA 2UYYA 2JCBA 3H9JA 1MPXA 3K0EA 2NQ2C 3OM8A 4FFWA 2XDQA 4DQDA 5DT2A 1C8KA 5CA1A 3B1YA 1Z5UA 4M9SA 4YAWA 5JC8A 3VC2A 3TZKA 2IS1A 4Y2JA 4F5ZA 4Y8VA 4CIYA 2AKAB 1VE6A 4BDTA 5KNBA 3CEAA 2HNAA 4YMUA 2C4UA 2C95A 1GPDG 3V4OA 1AKUA 2HCRA 5IEJA 2O8EB 3TEMA 3ROGA 1VSUA 3ZLVA 3CW8X 4N5DA 3TQIA 3SOZA 2ZJ1A 3CH6A 4ZXPA 2YVQA 4JR1A 1T0PA 2O19A 4QL3A 1H1LA 1DRUA 4JEMA 1CU1A 2VNHA 3FROA 1HM5A 1GY8A 1MVOA 2HRBA 3ESXA 4RE5A 3ZCUA 2I91A 4JB2A 1ZCFA 1OOEA 3OURA 4IJ5A 2JI4A 5K2OA 2JGMA 4R01A 2YINC 1IXYA 2IV3A 4OK3A 2NUPB 4FYPA 1A8IA 4YY3B 3AB8A 3IUYA 3I9FA 4K1XA 2A5DA 3ANXA 3DYBA 3DE3X 2Y4OA 4OAPA 4UNQA 1LTKA 3RTCA 2V1XA 4J90A 2REQB 3VU3A 4A2WA 3FPFA 4JLWA 1FJXA 1RQRA 3HNOA 3EZNA 2FR0A 4Y1FA 1V8BA 3BRQA 3HCWA 3DEIA 1QZUA 2ZRAA 1SUEA 4US0R 2QLJA 2Y2UA 1J97A 2A35A 1O5TA 3GJXC 4Y0NA 5AI9A 1JILA 2HB6A 2O14A 2ORYA 4ZT4A 2I4LA 3WHPA 1GQRA 4MQ5A 4WCVA 2A9OA 2GVZC 3NEJA 2XMDA 4MPDA 4QTTB 2YOHA 1P33A 1OIXA 3BXFA 3DOFA 4D5GA 1YVEI 1UANA 3FGNA 5D5HA 1Z36A 1U3GA 1TJ3A 3U2QA 1BMFA 4NNPA 2SKCA 2B7CA 2QRUA 3I58A 5FUVA 4MWSA 3ELBA 4F9FA 2RB5A 5BN4B 3K1JA 2ODWA 5FKJA 2PBRA 3VOTA 4HNAB 1LLDA 4YJ3A 2XUOA 5T67A 1C9NA 2OKGA 1XZHA 5IJAA 4TYYA 2PXHA 4EO4A 3H5NA 4ZREA 2VRNA 4HGQA 1ATIA 3NUGA 4U1RA 4B8YA 1YJCA 4B3CA 2OXEA 4Q15A 1W75A 4D0LB 3PGXA 3AR2A 5AK5A 1I7PA 3EIHA 5PGMA 4BNZA 2KM1A 2IODA 3QE9Y 4S35A 5CPBA 5F5NA 4XW2A 4DJEC 3QEAZ 1NTOA 4H7DA 5LKRA 4XWTA 3G8AA 1XIVA 2QRHA 4RSMA 3S68A 1FL9A 4HDSB 4OB7A 1RBMA 3WOVA 3RVRA 4G9EA 4PS1A 2DC1A 3P9SA 4OBEA 1IPEA 1IQUA 1M2WA 3A05A 3WL8A 2PRKA 1DAEA 2ISSD 3MS7A 5FTMA 1DKPA 4B3DA 1KEKA 4RTSA 5BMOA 4MRMA 5C4MA 2O3QA 3P71T 3IHWA 1YRWA 3THXA 4XD7A 3K72B 1P81A 4JI3B 4P82A 5LZ5A 1IQPA 5C8YA 3AR8A 2Y1EA 2P4HX 1F6DA 1YNOA 2I3ZA 1UDAA 1Y81A 1DRKA 4B4VA 2GILA 3AF0A 4EENA 4OLFA 4Z3DA 1JU3A 2D4HA 3IFSA 1T9BA 4YBZA 2IGTA 4I55F 3F47A 2IYQA 3FDIA 5BT9A 3QVOA 3MB5A 2QEQA 2WU3A 3FUWA 5ISMA 4LZZA 4B3GA 1XD8A 3KVNA 4O59O 5EE1A 5TVGA 3IAAA 1E5DA 2G17A 4RPJA 2DQ4A 2G0AA 4B83A 3NIFB 4RPKA 1YJAA 5SV2A 3Q41A 4YRPA 5A4JA 2G5GX 4Q24A 4XYBA 3ZW9A 2FP3A 5LNK1 1J23A 2HSWA 3H0EA 2YWJA 2I03A 3TLMA 3WK4A 4E12A 2NMVA 4B3BA 1JVSA 3MUEA 3FCAA 4NABA 5TPZA 4E13A 2BKEA 1OPRA 2AFIE 2EJCA 2XQIA 2WT4A 3NS7A 4ZEVA 4L5AA 4RJKA 2WIAA 2WIJA 4S1NA 3AERA 3MUOA 3ANNA 3HFRA 1ZONA 2BGGA 1GTMA 3RYTC 1PZXA 4IW3B 1CXZA 1XZMA 3OWXA 3MW8A 4E5NA 2JI9A 2VNSA 3H1TA 3PWTA 2RHDA 4FGSA 1W4ZA 4MJLA 2P41A 3BTOA 1MEJA 4M8LA 1PVVA 5DK4A 2I3GA 4V0LA 3I2HA 1R00A 1XD2A 1O0SA 2IIVA 1PTJC 3RSFA 4OLJA 2B7LA 4IV5A 2B4YA 6REQA 3ZIDA 2AEFA 4ZQFA 5HVNA 2I3DA 1J7KA 1CEEA 3EG9B 4HG2A 3V2GA 4CKZA 3UG6A 5SY9A 4DRXB 2IYPA 1JHOA 1KYVA 3GEHA 4TTVA 3T5BA 3ZCQA 4PNEA 1JFSA 2FMKA 1VI2A 3KCNA 2HIMA 2WZCA 3R0QA 4XCVA 1OLXB 2BIFA 3C3EA 1RXCA 1QHHB 2D0DA 4G8DA 2A88A 4QYIA 3A14A 4IDGA 2AIRA 4B6EA 2P9ZA 2OHHA 1WXXA 1E1MA 4A7PA 4RVUA 1BDJA 1Y89A 3C4QA 3M3HA 2LNDA 4XB1A 4ZOLA 5FHQA 3RI3A 4CL3A 5BSWA 2F8TA 3U7QB 2B3TA 3K6JA 4MUFA 1NVBA 1PS0A 5KOJB 2XUQA 4MCJA 1YT5A 1JEAA 3STHA 1UODA 3KUUA 2DE0X 4NDNE 2WSSA 4OQFA 5ERGB 3FWYA 4RIFA 1XCPA 1RDFA 1R37A 4RH3A 5FNVA 2XA2A 3ZWAA 4F72A 3Q0IA 1E79D 4NLLA 3QV2A 4BFSA 1K88A 3HRHA 1Z34A 3UK1A 3FLAA 4O3FA 3ZU2A 3LD9A 4Q4JA 4U7DA 4C6RA 1KTIA 2UUPA 2HWXA 2EZ8A 3LPMA 3H17A 3RVSA 2CV0A 4BZQA 3HI6A 4R40A 4X64B 4K03A 4EO7A 2RH4A 4M22A 3T3PB 1B8NA 1JU4A 2EW2A 2JANA 4BLQA 5AW3A 5K0EA 1C1YA 4JJ4A 1YVPA 1G42A 2FOIA 3OHSX 4FBMA 4FGJA 3K2BA 3OIGA 5HGJA 2JFBA 4KXUA 1K2VN 2CHQA 3HACA 5JNTA 3SBXA 3OPYA 2O52A 3CSUA 1LPAB 3QHAA 3TL6A 3HXMA 2FVXA 4EATA 2JARA 5EE9A 3R74A 3UA4A 1M67A 4K0RA 4UZSA 2I9PA 4LX8A 1Q5PA 1QH8A 1W9MA 4TKUA 5CNMA 1WZ2A 1GKYA 4A1OA 1N2IA 4EPXA 4K28A 1IEQA 4BMYA 3BMXA 4CFYA 1GADO 1N6NA 5TS2A 1L1FA 4D99A 5CPFA 4EGAA 3CXRA 4MVCA 4PPFA 4Y2SA 5B3JC 5F7ZA 4ZVSA 2RI6A 4C0HA 3O6VA 4FYKA 1GSAA 5JQGF 2O2HA 1W29A 4RENA 1ZD1A 1RKVA 3EC2A 1XZAA 4D9MA 1IN4A 1Y5LA 2W6OA 3TMAA 1SD1A 1TTTA 1GPMA 1JSXA 1U5CA 3BSYA 4D3FA 1QGUA 4QULA 3NNNA 3WV5A 1XMQB 2RGYA 1N6OA 1R0BA 3E3OA 1VLZA 1FIUA 3PNPA 3RPEA 1Y1RA 3NAGA 4KE6A 1H2HA 2FZ5A 1E6KA 1QNLA 1UXIA 2VDKB 4LY6A 4MRVA 4QFBA 5F3RA 3WRXC 1Z15A 3ANSA 4D45A 2UXDB 4WADA 5DYTA 2PS0A 2Y66A 3GEDA 3L4JA 3ZQ4A 4H31A 4LXXA 6CHYA 5KU1A 2R68A 4KPEC 3L93A 1FFHA 2VO1A 1ML4A 1GG9A 4BNNA 2JJ8A 3H86A 4NP6A 1JR3D 4R2HA 2ZUUA 4TTPA 5E7MA 4EHIA 2VPQA 4J16C 4BO9A 3HU3A 1EUDB 3OCXA 3PVSA 4N3AA 3V1UA 4NEGA 5JSFA 3GPBA 1P17A 2Z2XA 1WXHA 1RXSA 2QRQA 4PG4A 1Q0LA 2G77B 4YASA 3UJAA 4EF5A 3P9PA 5KJ1A 3WA7A 4CMAA 4CQLA 5FUWA 3ETEA 2VPWA 1MB4A 3L0SA 3UTCA 5ALJA 2DUWA 2NM0A 3A6KA 2QMEA 5GIPE 2YMQA 2QTNA 1R66A 2OXFA 4Q6WA 4IV0A 2DBQA 1WDTA 3N6XA 1TMOA 4DIFA 3PDHA 1U81A 4AZWA 1SZDA 3AUJB 2ZRPA 4H1TA 4JKIA 1PNQA 2F62A 1NV9A 2FAXA 4X3OA 6GPBA 1L5FA 5FBRB 1FQOA 4XR4A 3GFRA 1U2SA 1PUJA 5DNDA 4MRMB 5JPIA 1GPYA 2AZTA 1YS4A 2ZR8A 3GD5A 3KTFA 1YS1X 1ESCA 1LV8A 3PE4A 3QFRA 1FRZA 5HIJA 5KWVA 4KYUA 3THXB 1F0PA 1NMXA 1T36B 4LC1A 1XGKA 1GPKA 3NBYC 2IYUA 2QRGA 3HLYA 4RVDA 5C8YB 1TVKA 2WJ3A 2X0RA 2FWMX 1KI4A 1PAUA 5EJ9A 2R5WA 1Y63A 4Z51A 4FI3F 1DDGA 1SEVA 4RC9A 1ZOPA 1QE3A 3TAHA 3ZZTA 4B3MB 2NP7A 1TADA 2GZMA 3MT7A 4JYMA 5LMZA 3U3DA 4LAFA 2HRRA 4UHFA 2QWXA 4HDOB 2WR8A 5TEVA 1JHYA 1NI4A 5AOCA 2ATEA 3H4MA 3OKPA 1OUMA 3FDFA 1YIAA 1YQGA 2W11A 4BN0A 2PJZA 2BCGY 4AQ7A 1TKAA 3C7TA 3SF0A 1ZS9A 1NRXA 2Z1DA 3T7SA 1NURA 2P30A 3DMGA 2B4RO 2FOLA 2PVPA 3FCUB 1ZNXA 3VTAA 1E92A 1TD9A 1SCDA 5C51B 1RMQA 5BP7A 2PNFA 4RYDA 1G2IA 4TZTA 1GCAA 4BO5A 1KY3A 2CNWA 4HFNA 3Q8LA 4NJMB 1DI0A 4RZ3A 4L6CA 4LC0A 3KAJA 5JR3A 2FR1A 4KH1A 4X1IA 1P2SA 1TFUA 2QY9A 1W88A 5BYBA 1JQEA 1XALA 3KJIA 4N5IX 3PDWA 3VAYA 1BXZA 3S1SA 1OV6A 2R6R1 1BVRA 4AUNA 3IQGX 2RK3A 4JJAA 5CT6A 2R6ZA 4P4NA 3VR6D 2JHCA 2FYTA 2QXUA 1P7CA 1ZJ4A 1A71A 4YRFA 4Z3OA 3NKLA 2AJLI 3PC8C 5JADA 4JI7B 3PG5A 4KODA 1RM3A 2VCHA 1H0HA 3DP9A 2MOKA 1GU0A 1T3ZA 1CUZA 4L08A 1NX6A 2Q6TA 1U7TA 2A86A 3CBQA 3DXZA 3W9BA 6REQB 2PO5A 3NH9A 1DT5A 1H6CA 3CLTC 2JGLA 3A1CA 4NVRA 4RKFA 1PWYE 2H2IA 3HDHA 5H70A 4H27A 5BN5B 3AEQA 2H17A 4JENA 2HDWA 4QDOA 5JAPA 1BJKA 1USUA 1KJ8A 3JD0A 4HYYA 1T4DA 5H3HA 2C54A 1DADA 4MKRA 3C3KA 3P9IA 4WZBB 4BWGA 2F43A 2P40A 4AXBA 1FFAA 1YB7A 3OP1A 3L8MA 1GJRA 4JDUA 1RRFA 2CFTA 1UDXA 3NW9A 3WR5A 1LVGA 4D8TA 4ID9A 3Q10A 4TV8B 3T3HA 1SB8A 3E27A 5HRCA 1LRLA 1SBNE 5IBQA 5I9LA 3O26A 3HWWA 3I09A 3KYCA 7GPBA 5FH9A 1YRBA 4AY3A 2CY0A 4RVNA 2RGUA 3LK6A 4Y9UA 5IM4A 1NT2A 2OYSA 3QZUA 3V7FA 4YNBA 3BMNA 3ZCVA 3PTAA 4R9NA 2JEZA 3F74A 1VDMA 1GL3A 2QTCA 2ZG6A 4Q4JB 4MARA 2L19A 3MXOA 2FEKA 2C88A 1VKZA 4KMRA 1BW9B 1FYWA 1RVDA 2BF7A 3LFUA 5GP1A 3VU8A 4LBVA 4KQXA 1H42A 2AK2A 2FUEA 3EIXA 4ER5A 3NCHA 2AG1A 5FA8A 3W8EA 3ORQA 1WMBA 3IIEA 3JAMA 5KOIA 1ZVVA 1N5LA 3AHGA 3ETHA 4G4JA 3V6LA 2GFIA 1CUSA 5EJGA 1PWHA 1V4BA 2I7XA 3ZY4A 2VDQB 2DY0A 3NHUA 1BD4A 3EZGA 2XKBA 2XODA 3ZCXA 4AMGA 4X7BA 1N5KA 3QWAA 4L4XA 4DZZA 5JNRA 1RRCA 3UQZA 4BRZA 1PNTA 2W2LA 3F7OA 4O4IF 3Q1KA 3KWJA 4AYWA 4D3XA 2FSIA 1VGQA 1Q7BA 1QH8B 3GLRA 3CF2A 1KEPA 4OTZA 3UC5A 2VQDA 2PV7A 3EVBA 1XTUA 4DV1B 1MPTA 2QN9A 1Z7YA 3QW2A 4ZIRA 4DY6A 1IRXA 4L5YA 4EDHA 2HGZA 4YQEA 1E18A 4MW0A 1CZLA 4PRKA 2Q9UA 4L3OA 1KQOA 4U02A 5TT1A 4NG5A 1E5VA 2BF4A 4G67A 4M9QA 5TEWA 4HEA1 4Q5IA 1IVSA 1E5QA 3UKJA 1AQIA 3GJ6A 2HJHA 1H4SA 4PM4A 3BPSA 3KQVA 3MZ0A 1RIFA 3PFWO 5H82A 4ESEA 3W6NA 2Q0SA 4H0NA 4F84A 4E21A 5CXQA 5KJFA 4B7XA 4KRGA 4CLHA 3I72A 4B74A 1BN6A 2BSXA 2R11A 3K53A 2VJQA 5HP4A 4A91A 1ZOIA 3UJPA 1M2EA 3EA4A 1YVDA 2E7ZA 3PVZA 2C94A 2ZR0A 4Z0PA 1L5HA 4WWHA 2VDUE 3LT1A 2HDHA 4NI5A 4OJNA 5K0NA 1T6XA 1KYXA 2XEDA 2RGNA 2AJ8A 3JATA 4WCFB 1XZNA 1NAHA 3RTAA 3ZHTA 4UD2A 1XXLA 3KALA 4W8HA 1GZ3A 3PCTA 4JN6B 1DIOB 3HH8A 3IR7A 3EZFA 4ZFNA 1GZ6A 4P35A 4RZSA 4MQMA 4FM9A 1OJLA 3CG0A 1DELA 4NTZA 5FQNA 2QTAA 3KZVA 3TIIA 4FOLA 1OHHD 3TPCA 4C4PA 1UAAA 2O07A 3N07A 1FQJA 3DAFA 2IDKA 4N65A 1RXWA 1XG5A 4O2AB 1FUYB 2RHOA 2IXFA 4J0IA 2FU5C 1SUDA 3EXFB 2I0FA 4KLAA 1KPGA 2JJ1D 5KMGB 1N9KA 1W0KD 3WNCA 2Y4NA 1KMNA 3E5MA 2J3KA 2IYNA 1ITZA 3GJZA 3M5WA 5F2KA 5K2MA 3K92A 2Q3MA 3TGLA 4V24A 2QX9A 4NESA 2EZ4A 4BAUA 4E0BA 1Z4PX 2IVFA 2VKQA 4IJMA 1J70A 3H11B 1ICEA 3I6YA 4RXTA 4D56A 3ELUA 4A26A 1SMKA 3EPLA 1QQBA 3FMIA 1UMCA 2XCUA 4HCJA 4CIAA 4GVPA 2ZDGA 1D1SA 4Q3OA 3UATA 1J9ZA 1ISJA 1A5SB 3TRHA 4PZYA 3UOWA 3DOEA 4B85A 3IOMA 4FFBA 3M4YA 1GIAA 4A0QA 3D4OA 1G5IA 2GJ4A 3GQBA 3TH5A 1C0IA 1FFBA 1TU4A 1UFRA 3HJGA 5TQ2A 3GLHE 3JWIA 4U6NA 1X7ZB 1YJBA 1ZDMA 2VG8A 3FFTA 3OFSA 1VYTA 1Q3HA 4H6XA 4I2VA 2QD1A 4J3JA 1TVKB 4CU5A 4B3XA 1OFVA 3AUFA 1UP4A 3NTVA 4B5KA 4UW9A 3ML1A 5G4LA 2Q4EA 2F55A 5LN1A 3R7SA 4L2IB 2YXDA 3WJ7A 3RHZA 1ZNYA 4EJ0A 3HKBA 2DFLA 3L7DA 1O95A 2I2CA 4X00A 1O5OA 2ODEA 3A3KA 4KW7A 5CVVA 2H3HA 1QHSA 3NHYA 4HXFB 4UU1A 4FUTA 5D84A 3ZXYA 1Z38A 1DC4A 1M66A 2I8CA 2FW8A 3WGZA 1NJ5A 2WJHA 5TPWA 3P7MA 3NBQA 1KEVA 4B2IA 1EFRA 1US8A 4QOFA 3HBNA 1JR3E 5CITA 2OHXA 4ZTBA 4QDJA 4X62B 4I8IA 4A2PA 5IAJA 3PQ8A 2AC4A 4MQFA 4AS3A 3GB9A 3JRWA 2L0XA 3ULKA 1AS2A 3FB1A 3L02A 1SK9A 1UK7A 2YUIA 5FOSA 4YPOA 1MNQA 2YN0A 4YRTA 1XTQA 1TM4E 5JVDB 2F3RA 2AT1A 1N2CE 2IF0A 2PX5A 1W88B 2ZJ8A 3AONB 3KKKA 5E2IA 3HDGA 3GAZA 1VDZA 3WLEA 1C3XA 2LZ0A 4M0KA 3Q8MA 3OMWA 4NOKA 3IPLA 4RX1A 3TD6A 1Z29A 1GAJA 2VYCA 4EYSA 1W5FA 2AI2A 4FDMA 1BVUA 2JHGA 4EFNA 2EKLA 3UGKA 3QVUA 2R8XA 2PT7A 1ULAA 3OH8A 5JZBA 3NHMA 4HB4A 1VZ3A 1KS9A 1L9KA 3R7DA 3KLNA 4DREA 1QHNA 4LTDA 1UK6A 4R1OA 3KKZA 3IIKA 3BIJA 2F64A 4WINA 1JDTA 1GTL1 4IF6A 2ZTVA 4PANA 1YZYA 1S2LA 3ODPA 3D7NA 1L5RA 3B78A 1MFPA 3KHSA 1Z0UA 2J3HA 3LK7A 1QVZA 3V8RA 3AEUA 3WGOA 4BEVA 1U4SA 4L8LA 1RKBA 2HCFA 3C6MA 2RB4A 1J20A 1N1EA 2HK7A 1GPUA 3K8OE 3WY9A 2YZ7A 1B8UA 3JQAB 3D6TB 3ZWWA 1TTPB 1YFLA 3EC7A 2HZBA 2GKGA 4CM9D 2P3LA 1GCOA 2X9QA 1QMGA 2G1AA 2D06A 3HCPA 5IBRA 1W59A 3DZBA 1GRVA 5K20A 5CA0B 1HTTA 2CFIA 1Z2EA 3WGVA 1C1XB 4EG7A 1I2DA 3CX6A 3ZGYA 3B6IA 4Q4AB 3KYCB 1W36C 3GGGA 2Y71A 3WVNA 3CX7A 5AXDA 4ARSA 3LC7O 3OU6A 1R9JA 3W9UA 4C0AC 1P2DA 3ROKA 1VFPA 1XZGA 3MMSA 4W5RA 3NWPA 1LC3A 5AVXA 3EBLA 2V0NA 2PFKA 3OKAA 1FVXA 2ZI9A 4R9UC 2VHVA 5BR1A 3O1HB 3M6MD 3WKDA 5K6RA 3EOAI 2HRQA 1EFHA 2PT5A 4YRLA 3AFOA 4D5EA 1XHFA 2GF2A 2P2GA 3SJAA 2Z2YA 4J1NA 2AA3A 3OIDA 4RMJA 4F11A 4QATA 4M1YA 4MW1A 3PJRA 2XOEA 2W48A 2V1UA 3PRJA 1RLMA 3QOWA 4RK1A 3LOPA 4GM0A 3U1BA 1CTQA 2ORED 2YBDA 3E8MA 5JFTA 1OROA 2PL1A 3VJMA 3WNQA 4O2BA 5CDUA 4Z9FA 4RTLA 4CV0A 3ZHXA 1GXSA 5M2QA 4WK4B 3SAJA 1D5CA 4JS0A 3FPCA 5FL7D 3GFTA 1CUYA 4WKPA 3CLRC 5EZYB 1I1QB 5F98A 2XYHA 3G0BA 1KEWA 4YQZA 1NY6A 3DVRX 1R6BX 4E5PA 4GQAA 2AB0A 4MPJA 2NYVA 4TYMA 5CLQA 4ZCQA 4BFLA 2A1UA 1HFJA 4F9TA 2AQIA 4GAEA 5A0FA 2WAMA 5KJEA 3FPGA 3VU9B 4F7DA 3L5OA 3X1DA 5D3QA 4U0KA 3HLKA 4PYQA 3TQCA 2Q9CA 3UJ6A 2V7WA 4UHHA 1IXKA 4B45A 3RARA 1SXHA 4KR2A 3RU7A 1M0WA 1E9AA 4EEXA 3C5VA 3FNHA 3O8OB 4P83A 1T8PA 1YCDA 4TLLB 3FTEA 4Y7CA 5I8ZA 3H2JA 3D3EA 3K9WA 3RSLA 4GYJA 1JZSA 1G7SA 1E69A 1G5HA 4EQZA 5DGHA 2E82A 1WNTA 3U7EB 4TMFA 3CVVA 3W8FA 3S8MA 1KSGA 4FB5A 2Q6VA 4RTRA 1E9FA 5C4IA 1F4VA 3CY6A 3GFFA 4PAWA 3AM4A 4G8BA 1CD5A 4OGFA 4EYKA 4CKWA 1W0CA 4D25A 1YR8A 1GUBA 3D3WA 4V3CA 4P2BA 3LO8A 4HNGA 3V32A 1E2DA 5JEDA 2Y1WA 3ROQA 2OBMA 3O1LA 1QCCA 1O97C 1OGJA 3TW8A 4GI3A 2JBAA 4Z9YA 1V48A 1RAFA 1AX9A 4RTMA 121PA 4AKGA 5DTIA 1C3OA 3X2EA 4IIJB 3O3CA 5DULA 1O54A 3BT7A 1TTQB 1JWLA 2DQSA 3QU9A 3V7NA 3RAEC 4PX2A 1MJ5A 4MDYA 1UBRS 1FX0B 3U6BA 2HWYA 3SJZA 9ABPA 4R8SA 1P7PA 3CWCA 2M32A 4GBJA 3MJCA 3W79A 2R7NA 3ZYZA 3OVMA 2C2MA 1Y5IA 1ISRA 3THSA 5T5QA 1UBHS 3G0HA 4N48A 1V3VA 2C4NA 1KO5A 2JH9A 2IDJA 2W6MA 3F4KA 3FGOA 3NEAA 3ON5A 3ESAA 3LC1O 4ZCRA 4JB8A 3CLTD 3IP8A 2GAJA 3N75A 1VMKA 3LPLA 2H9AA 4TYQA 5KYWA 2YICA 4E88A 2IS2A 1Z4KA 4QBKA 1ACMA 1QGOA 2JVJA 1WPGA 2PWYA 3E0XA 2AMLA 2EGHA 3K16A 2IOHA 4HXEB 4RF2A 3MGCA 4AN0A 5FLXA 3BDVA 5LA6A 1W8DA 1PWEA 1JFFA 1CLUA 4J6EA 3KQWA 3FTNA 1BFUA 1DC6A 2QPTA 4JZYA 4S1WA 1LB1B 1ZUNA 2H4WA 5AKIA 4D9JA 2WV7A 3GBSA 1KOLA 4CTOA 4EYQA 5TMDA 2X6TA 1P8JA 1VHJA 5L95A 1M5RA 2YFHA 4WOJA 2VHJA 1PKXA 1VKOA 4UUAA 5TPWB 2FPGA 4B17A 1J0EA 2YHAA 5J23A 3ZGZA 3MINA 1US8B 3GV0A 3U3ZA 1TIBA 3ZE1B 4LJ7A 2HR1A 2ZR7A 5T41A 2BFMA 1OWPA 2B1QA 4DG9A 2ZI3A 2NTYC 4IUBS 2XB9A 4ROTA 3COSA 4MQFB 1PHRA 2ZUFA 1Z4JA 2AZDA 3SNKA 4IP0A 3NNSA 3GGJA 1OBFO 2ESRA 2OB1A 3DZIA 3P9XA 4H16A 2Y0PA 4I6EA 3SX4A 4BL5A 1T9GS 1DKNA 2BTQA 1ABEA 2QLTA 3ZGLA 3G59A 4D74A 5H59A 1PJ2A 2F9FA 4D4KA 1YCHA 3HBLA 3KQKA 1UM9B 5CTJA 5CLFA 2IWRA 3CSSA 5E4TA 1CY8A 3OTOB 1WA5A 5E6UA 4GX5A 4J3NA 4TMKA 3KOUA 4FYYA 2A4MA 2CFOA 3RAGA 1A8SA 1G20A 1SG6A 4RQAA 2LWIA 3N8DA 4Z3KA 2AHRA 2JVIA 5GOTA 5ALFA 3DAGA 4MV0A 4FS8A 3U4GA 4FEEA 1NFQA 1IN5A 3D2CA 5FBKA 1ZFNA 3K30A 3UMYA 1Y5MA 1KZ7B 1ABFA 1FA9A 3MTJA 4DM7A 4Z4IA 2PKYX 1QH1B 5DTMA 3TL3A 3KHKA 4PBSA 1M6WA 1TU0A 1HA3A 1AB5A 3QWHA 1CIVA 4WDRA 1JEEA 5ER9A 1FC0A 5T6BA 2NYUA 2O7QA 3I2FA 1CERA 4PTLA 4CW7A 4YRKA 5HOEA 1E61A 4MMZB 4EHDA 3D7LA 2NUAA 4TQGA 3TW0A 3VSDA 3MMNA 2PMKA 4JBYA 3GFQA 1JF8A 3LKVA 3HU2A 2N1BA 3W5VA 2J5RA 3IUQA 4YB8A 2MWMA 3INYA 4EMTA 5MN6A 1CRZA 1I6MA 2PRZA 4I99A 1ONSA 3DOUA 1XEXA 5TNXA 4O4HA 4X61A 5AW6A 4WKBA 2FP4B 1U04A 1DAOA 5FOQA 4I1UA 4CT0A 2KB0A 1R9MA 2ZRFA 3B9QA 3R6WA 4R2MA 4KGXA 2OVFA 2R6JA 3EQ7A 4MAMA 5FV7A 2HA4A 4EG8A 2C1ZA 3EMBA 2C58A 3HM9A 1T9GR 1QH0A 2IUTA 3E9QA 4URUR 1UIRA 2JAQA 3EJ6A 4JMLA 3R3XA 1C0PA 3CUWA 2YV3A 3QIVA 5EL0A 2PD3A 1VA4A 1O96B 5KQMA 4UATA 1OGYA 4E5KA 5MN4A 4MVJH 3WO0A 1EX9A 2GHRA 1ZVQA 3Q88A 4CODB 1DE0A 1TVMA 2ACWA 2JLCA 2G28A 3C85A 2CKDA 4ZQBA 4EKNB 5TLSA 1OJ7A 4NCHA 4B33A 4DDUA 1K7EB 2QP4A 3MQ2A 3K1AB 3IEIA 3KP1A 4DKXA 4W7HA 2W0MA 5E7IA 1H6BA 3KB6A 2V59A 1GXSB 5FWAA 3NBUA 2NSDA 2HD4A 2XY4A 1TAQA 4YJ2F 1TEHA 4RF5A 2RGDA 1I6KA 3JYHA 3PGVA 2ADFA 4G5QA 1JHPA 1J09A 2F3TA 3TNDA 3W6UA 2QW0X 3ZU5A 5LQAA 1GGVA 4GH5A 1J2UA 5FRDA 3A26A 4LOKA 1YFKA 4CG2A 3WGLA 3IV7A 4M6WA 3RHSA 3V3KA 2RJNA 2AYZA 4K87A 3BBLA 4A6EA 1YV9A 1S4QA 2MYNA 4H15A 1U0BB 4Z99A 3V4FA 4DXAA 2RGRA 4U2CA 1T2CA 5LMNB 2GI4A 3OQOA 1U7PA 1BQEA 1V43A 1N0UA 1REQA 1XMJA 4IVPA 3B1KA 3FTPA 2JGDA 4UU7A 2GSDA 1NZFA 1HY3A 3KZOA 4BNKA 3SQLA 2P90A 2MT9A 2ZJBA 2WUFA 4CCWA 4HC4A 3H75A 3PXDA 3FAKA 1ZEMA 4XTCS 3AHEA 4MPRA 1WTCA 2DJ5A 5BUZA 3UWMA 5JPCA 2EL9A 4MMXB 2IHUA 3RT9A 3JWJA 4BMDA 1VGVA 2IIPA 4B71A 1THTA 3TR0A 4BX8A 4YROA 2YVLA 2QLFA 3UUGA 3LPAA 3H3FA 5JV5A 4IIVA 1MG5A 2GN6A 4R1TA 4KFCA 5KTYA 1IZ0A 4CKWB 1GYPA 1XD9A 4XYGA 1YSCA 4UFNA 2NXEA 3D3WB 4C7MA 1E1RD 1RWOA 6ADHA 1LEHA 2EFJA 1RHRA 1YONA 1FUKA 3H5LA 3A1DA 4J1TA 3L4SO 4DG5A 1FFXA 2H2AA 2R85A 4EOGA 4FE4A 5IK2D 1K89A 1TCAA 3T5PA 1PNOA 1R3DA 2PX0A 1C3OB 5D3MB 4KXLA 2IYSA 3O2QB 1CJSA 3OZCA 2EQAA 2PRSA 4WVFA 3G2MA 1AK2A 4UUBA 1G6Q1 1QHYA 1I9GA 2XJ4A 3A25A 5AW1A 1MNAA 1KZ9A 4DR2B 3EXHA 2HMSA 1WPQA 1VMEA 4F92B 3LBAA 5DRTA 3TNFA 2NU8A 2GEKA 4NS1A 4C0SA 5HKAA 2OUKA 1RJWA 2ST1A 3FYUA 4RIGA 3VNBA 4C2BA 4BNIA 3GCDA 4GYKA 1QP4A 1YJQA 2C8VA 4F5YA 4LX0A 2R6AA 4GLOA 1J9GA 1KH1A 1Z8FA 2JJMA 3AR4A 4RF3A 4BEBA 2QUBA 2R4UA 1RFLA 2VSQA 3C48A 1GPBA 1T9ZA 1M75A 1IWBB 1G2PA 1MQ9A 2SECE 2VOJA 1ONBA 1PV2A 4Q3BA 5ESDA 1JFVA 2ZRKA 4NPHA 3SE0A 5LA6B 4LZNA 2GPYA 1JFFB 1GSIA 4HVLA 2NTVA 2X3UA 1FX1A 3HO6A 2I62A 3JQDA 4E5UA 1C30A 1OWNA 2WICA 5FI5A 5JD5A 3EFBA 1YUNA 1ZUNB 3QENA 4G89A 4BNMA 4B76A 4DHEA 3B7WA 4AUMA 3EGWA 2FUCA 2H57A 2FPOA 3ECCA 4X3PA 3V2UA 4PRZA 3ZU6A 4ZYLA 3R3ZA 5BSUA 2FPGB 5EGNA 4CBVA 1W36D 4OFWA 1JMYA 1A72A 1E9BA 3FJOA 5DMXA 4ZC8A 4RKEA 1YZLA 4D6XA 1QOPB 1IJEA 1IY8A 2XCLA 3Q9LA 4UHDA 1VM6A 1IL0A 3TLEA 1PSWA 3KQQA 3WX0A 2AUTA 4BNDB 1RQPA 5FPPA 1RIIA 3EUEA 4N82A 3LUHA 3EIWA 5FBZA 1O6CA 1W30A 5JCPA 2ZSHA 4FW8A 3EGDA 3ROFA 2OGSA 2ODPA 4C08A 3LVFO 4RVOA 4ED9A 3S6JA 1JALA 1EVYA 1C0KA 1ZZGA 2ZIGA 3PEUA 4KAJA 3X1XA 4TWIA 2GTPA 2F8SA 3RYFA 3PR3A 5KNCD 1FMFA 3KSRA 2ZDHA 2P6NA 3KE9A 1GCGA 2WFLB 2HK8A 3T5DA 3TOSA 3HVJA 4CMJA 1QOQB 2G7ZA 3LUJA 4BMSA 4TKVA 4KR9A 3TTUA 1G0NA 2H5JA 4XZ3A 5GM2A 3KD3A 2ECFA 4XTRA 3VR2D 4RY9A 1RXEA 1U7DA 4PLHA 1KNQA 3RKUA 4MVXA 3V2IA 2V7QA 4UM9D 2DGDA 3AILA 4Z0NA 3CLRD 3LCMA 4GOLD 5K3DA 4ATNA 4D9FA 3FCCA 1N32B 3VYRB 4BV9A 5JTTA 3PNYA 3P4UA 4I4LA 1E8MA 3LGSA 5ESRA 1AGPA 3IEUA 2Q1SA 1T5DX 2W71A 2YFYA 3ABOB 4PZPA 3GLFA 2F1IA 2XLBA 4WL0A 4YCAA 1C1DA 4J3FA 5DU2A 4CM5A 5MDHA 3MTQA 2DHRA 3KQUA 2HSJA 4E07A 1N8SA 4KMSA 4XD7D 1K8RA 2IS4A 1XK7A 2EG9A 2ZYSA 3ZI7A 5KSYA 2WU8A 2KYRA 3MERA 2XR1A 3IMFA 3N2EA 3TTWA 1XEXB 2PAAA 4DV7B 1WDMA 1PFYA 1YAHA 4TL8A 2O20A 2VOEA 1HGXA 4TPKA 1BFDA 5AVWA 3T35A 5E8RA 2QSUA 4OUDA 1GU7A 3A3PA 1F7VA 4IIHA 3VPDA 2HXYA 1QS0B 2PDAA 3LVBA 4KQEA 3TR5A 2RGNC 2A8YA 5HQTA 4PZZA 1U3TA 4DQKA 4MKFA 4WA8A 2YV1A 3MAGA 4CN8A 2VSYA 3E8SA 4G36A 4DSTA 4BE9A 1ZM9A 2P4SA 2PGLA 3OPMA 3WL7A 2LV8A 4KDRA 1UZLA 3EEOA 2HA7A 3KHTA 3DT9A 4ZEWA 3U4IA 1NXTA 1XZPA 2WHXA 3RC1A 4FHDA 4BJHB 1KKUA 3HP4A 5CVDA 2R1UA 4D6PA 5B7QA 2FXIA 4H60A 4HRAA 4ARIA 2DRIA 1O97D 2H4ZA 2O9JA 1R8XA 1G9SA 3H2HA 3KL4A 1Z0AA 2JBHA 5F5LA 5A4FS 4DV2B 4BPRA 1QX3A 3EGXB 1JTFA 5JD4A 1QB8A 4RELA 3HB4X 1I7LA 4HXYA 4HFJA 1L3BA 4HDMB 1ESMA 5ESXA 5FA5A 4N01A 4NCXA 1VZ2A 3LNCA 2AC7A 2OHVA 2XTJA 1PKEA 3NFYA 4V38A 3VYVA 3WQRA 5AW2A 3GUZA 1USKA 2XXAA 2FPUA 1G18A 4CDNA 4H4EA 3I61A 3D64A 4D9BA 3FCXA 3EE6A 1QV6A 5AKZA 2OOSA 4NMXB 4BX9A 1PO7A 2MU1A 3KOWA 1U8XX 2PKRA 4UE3S 2JGDB 1E9RA 4C4RA 2VH1A 3BCUA 5KVSA 2JGJA 1WB4A 3D3KA 4BQSA 4QPPA 1VL8A 3KEQA 3ZHZA 3U80A 4RHXA 1AUQA 5FUXA 5AFSA 3TBHA 2IZ6A 1Y8QA 4N8DA 3MMZA 2AMJA 4QSMA 5B4UA 1E8DA 2A7QA 1OXMA 1T5SA 4AY4A 3V80A 2A5YB 1O8CA 1PK7A 3D8SA 4I1VA 4QUHA 1WQ3A 2GS9A 4KAAA 5CLGA 4EH1A 2RAFA 5SICE 2IEIA 4ERXA 2OD9A 3V8VA 4P3YA 2FDRA 4QO7A 4JK3A 4AN1A 2MSKA 4KPGA 2PY6A 5ALOA 3BRWA 1DARA 4ZA2A 4CKBA 2B0JA 4J2TA 3L79A 4F3RA 3CGWA 3M1IA 5LR6A 2FG7C 1TAUA 4GZ6A 3F5QA 3DL0A 3BDAA 3N28A 1JXAA 1H85A 3KVRA 4GOXA 4Q7EA 1L7OA 4E1VA 3IEPA 1D6NA 4RQUA 2UZ1A 5C1BA 4F4IA 4M1KA 2OM2A 4GE3A 2B8TA 3QI7A 5HR5A 2DULA 2OEPA 4FQ8A 1BJRE 3FTFA 2YXPX 3EXHB 2UXBB 4COKA 2ZBEA 3OBIA 1QTIA 3TUZC 2XCRB 3ABQB 3JX9A 5DASA 3CRNA 1NUPA 4RGVA 4JSRA 1DQNA 5FLYA 1IZ7A 1EQ2A 1T3SA 5D3ZA 4HNSA 4HI0E 2NZ2A 1R9NA 2O6HA 3DPUA 1JLRA 1LX6A 1OILA 1S89A 1A4UA 3CF4A 3GH3A 1AKMA 3GI1A 3H65A 4YUVA 4W9MC 3X3HA 2ZZNA 1M2FA 5AHXA 4TVOA 3A32A 5EN4A 2OQIA 4EB6A 4IDDA 2JA1A 3EUWA 1EWQA 2CZGA 3V48A 2FCAA 3GOHA 2LR0A 4J0DA 3ZUGA 4OLAA 2NO5A 3FYTA 3HKEA 3KHUA 2NV0A 5T57A 3RAPR 3ONNA 1EINA 4ARCA 1EE1A 5JMPA 3GZTB 5KSWB 1XJWA 3OKCA 2AFHA 4XSGA 1A50B 1XLTA 3Q7RA 1HLDA 2CCGA 3TOXA 5JDCA 5AKXA 1KEZA 3AY3A 4CM7A 1XZLA 3KVOA 5CDFE 5ELXA 1Z5GA 3AXTA 3EW7A 3HJNA 5EGSA 3OA2A 2X0IA 4DA0A 3CISA 5BSVA 3BX1A 1RJEA 3Q98A 4OQQA 4RIIA 4ER6A 3TRFA 2DZDA 4LE2A 5IEBA 1FJHA 2A9FA 2FHPA 3WP0A 4IHKA 1N33B 4L85A 3L9WA 1CYDA 3W7BA 4QTYA 1PQYA 2XQFA 2G1PA 3JQ7A 4DF3A 2IHYA 3QLVA 4M8IA 2XNHA 1RP1A 1V6SA 1RM4A 2ZVQX 4U9IS 1EVLA 3IR6A 1YBFA 4ZRDA 3FNGA 2GHTA 2GF0A 1EWVA 1QO0D 3A2MA 1DS6A 3RGWS 1WCWA 2DLNA 3OCVA 1GVNB 4JUFA 4ZMSA 4TKVB 1QVRA 1HDGO 1U1GA 2F1HA 1EWRA 4U8HA 4RMIA 2N47A 1IG0A 3R0JA 1J00A 5BN3B 3ZVNA 1B15A 1NUHA 2R8BA 4V1CI 5I7VA 4YRSA 4W5TA 3FVVA 1HDOA 1HF3A 3CUEF 3IEKA 1N9GA 3OUZA 4XJXA 3WSTA 4JSTA 2OLKA 3C3DA 2GTIA 3HZZA 3MMPA 3NV9A 2AG0A 2CWDA 4KO4S 5AW9A 3RFTA 4MVJM 4MRPA 1GGEA 1T25A 4U7FA 3TTYA 3KYIB 4QTUB 3T9FA 1GV0A 4HAVA 4LHYA 3CJQA 1QF6A 4I8XA 4PHTA 3ZS8A 4KFSA 1WMEA 5IZCA 2ZRHA 3QVTA 4KYIB 1C1DB 1O3YA 3MGAA 2QUZA 3DMTC 2FQWA 2F9MA 1H22A 1OT3A 1PFUA 2PLWA 3G5MA 4LYFA 4R6XA 5DV9A 4AZ3A 2F90A 3ZX5A 4D44A 3BCHA 1FDUA 5K6AA 3WHKA 2NNWB 3AY7A 2C9ZA 4RO0A 3ANLA 1XRRA 3ZV7A 3O2NA 2ON6A 3G0DA 2D3TA 1E9SA 2A14A 1EUQA 3SXUB 1VA5A 2BW0A 3FLEA 4XGKA 1P1JA 2FSVA 4OUDB 4DLLA 3H7AA 1U31A 4MDEA 3CUUA 3LJKA 3CO0S 3D8BA 3IPXA 4X84A 3H13A 3OFKA 1W73A 3RSOA 2H63A 2P65A 5JDIC 1O1YA 2Z56A 4FK8A 3KQMA 4LTMA 4RAQA 5AVVA 2ZYIA 5FA6A 3RSHA 4JEHA 3RG2A 1CF4A 2Z2ZA 3FWKA 4FR5A 4IZOA 5ECYA 1N1MA 3IKLA 4KYVA 3MG9A 3PPYA 3L6UA 4H3VA 4PYOA 3QMMA 3WB9A 1JLLB 4MB6A 3HV0A 1FXSA 1OBHA 2TS1A 3IVGA 4PSUA 3OPQA 2P8SA 5IAOA 5KWSA 3IAHA 5JCOA 4KHZA 2YJ5A 4QNMA 5CFZA 3L0YA 1H0SA 2CNWD 1VIVA 3LQ1A 2OCGA 2WWHA 3FHJA 4Y6GB 4YMSA 1S3GA 1E0JA 1IEVA 5DW3A 3IOCA 4P7GA 1PV1A 2ZPAA 3DD5A 4GBED 1OY1A 3IIJA 3LDGA 3RWBA 4A6DA 5TXGA 3EFOB 1NVTA 3GO4A 4GDFA 3FH0A 3GUCA 1L1QA 2O5EA 1ZH0A 3GDGA 1OMOA 1KOFA 2HSEA 1K6MA 1WZNA 2CXOA 1K0UA 4N7JA 4B4UA 1NG1A 3T5CA 3C1AA 5BYJA 5FTNA 4ZHQF 2XT0A 3WLAA 1VL5A 2O2DA 3FPEA 5CBPB 3O2SB 4BO1A 2GK7A 1JQAA 3EDOA 4LYGA 4DV5B 1RMTA 1UQTA 4XEHA 2DU8A 3DGFC 4G0ZA 1MVLA 3LT0A 4D9CA 4GWLA 4AAYA 1BHJA 1V9CA 2SKDA 1ENZA 2OUIA 3KXPA 1DHTA 1NQUA 3KD2A 4RK7A 5GOZA 4DJAA 4E7OA 2NN3C 3BHNA 3RFXA 1C4OA 1DEAA 3AKYA 2QTVA 2W2OA 1K4KA 4QRDA 3PIDA 4F6LA 1XCBA 3VDXA 5IAAA 1MX9A 1SD2A 3K0FA 2JA2A 4DILA 1NJ2A 1KYQA 1GA4A 1DQYA 3ZJTA 4WUTA 1JPVA 3SU8A 4MHTA 4PPGA 2C9OA 3IAS6 4MKHA 1YC2A 1EP9A 5C7LO 3PFFA 4WAUA 4CUZA 3SXPA 5BNIA 5CFOA 5H3CA 4O4JA 1LV7A 1TQ8A 1AVTA 4O25A 4CTNA 5JLJA 5FI3A 2WFAA 2DERA 4J9UE 2VSFA 5CA1F 3RLFA 5EP2A 1R0RE 3GP8A 4KH0A 3L77A 4LOJA 1A0OA 3K6KA 3H9UA 4U7JA 4G97A 1XQ9A 4XVUA 1KVRA 3U6KA 3ZGOA 2YNMA 3I1IA 5EWLB 3R41A 5AOBA 2ZZMA 3ES9A 1MO6A 2CJPA 5EE0A 5HOQA 1P5ZB 2O2YA 3TINA 2ZYGA 1IM5A 5G1NA 5SZJA 5K0BA 1WUJS 3ILYA 4R41A 2IFTA 3SSOA 5HIIA