5U4XA

Coactivator-associated arginine methyltransferase 1 with tp-064
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
AVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-arginine methyltransferase CARM1
publication title TP-064, a potent and selective small molecule inhibitor of PRMT4 for multiple myeloma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2016-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5u4xA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5u4xA01
2PWPA 4QDKA 1EJ6A 4OA5A 3KPYA 3EGEA 5KQSA 4AUKA 1ZHFA 2PWYA 5LQJA 1Q0TA 4HTFA 5C0OE 3Q7EA 2NXCA 5K09A 2H00A 3Q87B 5DM0A 4P7KA 1ZGAA 4HG2A 4RX1A 4RTRA 3TFWA 1DL5A 3NJRA 2BZGA 4RSRA 4RVDA 3OE4A 5K05A 4M37A 3GCZA 3I58A 4V0RA 2ZIFA 3QV2A 4MQ4A 4LWOA 1I9GA 3BGVA 2AOTB 3S68A 1T43A 2OPBA 2QRVB 2FK8A 2ZSUA 3LBYA 4RYLA 2GB4A 5EVJA 3HVHA 2UYQA 1NBHA 4YMGA 3SSMA 3LHDA 1NT2A 1Z3CA 3UJAA 4KVZA 4EVIA 4C08A 2OY0A 3MTEA 4RVGA 5EZQA 4R05A 5HIKA 2HTEA 1G8SA 1RI2A 2I62A 2P40A 3EVGA 4C4AA 5E8RA 3G88A 1JSXA 5K01A 3MAGA 2PXAA 3FUXA 3MCZA 4LWPA 3LDUA 3KPJA 4U7PB 3TPZA 3GJYA 5EOVA 4HH4A 2OKCA 3P2IA 2F8LA 4JXJA 5CM2Z 4Y30A 3M6WA 3KR2A 3HVIA 3OU7A 1RJDA 3JWJA 3F4KA 5DTMA 1NBIA 2VDVE 5LQCA 3EEYA 3GXOA 3GIWA 2P3LA 1XDSA 1Y8CA 4ISCA 1ZKDA 2WA1A 1SUSA 4WVLA 3SGLA 2Y1WA 1X1AA 2B25A 1KXZA 1M6EX 4PYKA 4NECA 3FUUA 1L3BA 4EQZA 1D2HA 3FUVA 3GO4A 4R6XA 2AVDA 3P2KA 5BW4A 4PIMA 4P7FA 1AQJA 1QZZA 3LECA 4E33A 2IBTA 3DLCA 5K0LA 4F86A 3EVZA 4HC4A 3I9FA 4RWZA 4DA4A 2JHAA 2EJUA 5LQKA 4QDJA 3H2BA 4FP9A 4GEKA 5BW5A 3UJDA 4E2ZA 3IYLW 1RI4A 3AJDA 3PFHA 4PYQA 3B5IA 2P35A 1KP9A 2E5WA 2I7CA 3BGDA 5CIYA 2B3TA 4AZVA 4YUXA 1XVAA 1ORHA 1EQAA 1TW2A 4E31A 5KS2A 1N2XA 3C6KA 5CUQA 3GNLA 2P41A 4DF3A 1G38A 4PIPA 1FPQA 1H1DA 2QRVA 3B3JA 5DX0A 1ZGJA 3LL7A 3CJTA 1BKYA 5K03A 5FQNA 1I1NA 4ZTBA 2OB1A 5CCBA 1L1EA 4M38A 5EG5A 4MIKA 1JTEA 5T6BA 2ZWAA 3G5TA 3GDHA 4KIFA 5ICFA 4RTKA 4V0QA 2Z6QA 3T0IA 5GINE 2Z6AA 1SG9A 2FRXA 2B78A 2XYRA 3DULA 1R6AA 3OU6A 5FCDA 3T7RA 2XYVA 1YFJA 2V7EA 2NXEA 3OE5A 4FR0A 1N7JA 1KHHA 2VZ9A 3OZRA 2PT6A 2IPXA 3KQVA 4ATNA 4R8RA 3EVFA 3JWIA 5EMLA 2CKDA 2XVMA 3MCTA 4MHTA 5ICEA 2PLWA 5F2OA 1QANA 5K8VA 3BXOA 3WSTA 2IP2A 3HA5A 4P7GA 3TOSA 1NW6A 3BUSA 3M6UA 4CTKA 5BXYA 3NVKI 1YFLA 2IDJA 3C3YA 3K6RA 4OQDA 3EGIA 4FSDA 3TKAA 3OU2A 2VS1A 5CD1A 3KPWA 2LD4A 2WK1A 4P58A 3A25A 3A7EA 5EKUA 3RIEA 1YZ3A 2PKWA 2O07A 3EVBA 3FUTA 3UJ8A 3VSEA 2NP6A 1L3CA 2OBFA 3FPFA 1XTPA 4PCLA 5DPMA 4MWZA 7MHTA 1G6Q1 3CJRA 4U7TB 3R3HA 3THSA 4KRGA 1JQEA 2YXLA 3E8SA 3FYCA 5D1NA 1FJXA 5K0EA 3FZGA 4QPNA 4RTNA 4IV0A 2AOWA 3HP7A 1RJFA 3RODA 2IDKA 5EHGA 5DTQA 5K0NA 2FPOA 5HILA 2PX5A 3G8BA 3SSOA 3B7PA 3UJ6A 2Z6UA 3HEMA 4LECA 5K0GA 1G55A 4DZRA 4QTUB 2IH2A 2BH2A 1NW8A 3DH0A 2AN4A 4EKIA 3ANXA 3LDGA 3G8AA 4HGZA 2FHPA 1HNNA 1P39A 1JR4A 1RJGA 4WXHA 3RW9A 2YXDA 5DX8A 3E7PA 3GGDA 3CBGA 5CVDA 3REOA 3UZUA 5F2KA 1IM8A 3KQSA 5EMJA 2AOUB 3IHTA 4GOLD 1G60A 3A26A 3GRZA 3I64A 1JG2A 5GWXA 5DTRA 3PLAE 4X61A 5P8WA 3BWCA 5DRTA 2IBSA 2HR1A 1O9HA 3KQMA 1I4WA 3PT9A 4YV2A 3KPVA 2CWWA 4GBED 2CMGA 3HA7A 2ZLBA 3OFKA 2ZBPA 2IH5A 3B89A 4C05A 2HV9A 4E2WA 2OZVA 3DXYA 4CKCA 4M7RA 4CKEA 1EG2A 4ER6A 3A4TA 5LSAA 1X1CA 4X63A 2JG3A 2HWKA 5GOZA 2BM9A 3HTXA 2R3SA 5E9WA 4GQBA 4QQNA 1P1BA 3DUWA 5EIWA 5DX1A 3O7WA 2AOVA 4YV0A 3GRUA 5EEGA 4QPPA 3BWBA 2YXEA 4XUDA 2NYUA 5DSXA 5MHTA 4QQKA 3ME5A 3FTFA 2XYQA 2YTZA 2ZULA 1ORIA 9MHTA 5K0JA 2AN3A 3HNRA 3DMHA 2DULA 1M6YA 1QAQA 3M6VA 1VP3A 2EX4A 5B1SA 4O29A 1SKMA 2ZIGA 2UYHA 3NVMB 4R6WA 1G8AA 3MHTA 1D2GA 1INLA 3A27A 3FYDA 4PONA 4UOEA 2C7QA 5HOQA 4RTPA 4RVFA 1EAMA 4X41A 2JHPA 1OR8A 2O06A 4HGYA 3VYWA 1X1DA 2OO3A 4GOND 4DM3A 2ZBRA 5FQOA 3DP7A 2H11A 3LKZA 3DMGA 4C06A 2AOUA 4PWYA 3KU1A 2NXNA 2ZCJA 3KKZA 5E1DA 1KPIA 1JQDA 2ADMA 2ORED 1VE3A 4AZWA 1TPYA 4XCXA 2ZZNA 2AZTA 5ICGA 1HMYA 1SQGA 3M33A 2AOTA 3THRA 3FUWA 2JJQA 5DRYA 2PXXA 5FA5A 1F3LA 1L3IA 3P71T 2ONZA 5FHQA 4EK9A 3C0KA 3DOUA 4H0NA 5DT2A 5LQRA 3I53A 1JG1A 1KYWA 5G02A 1WXWA 5E8JA 4OQEA 1XDZA 2OYRA 4YMHA 2PVCA 5E1MA 1QAOA 3TMAA 4Z2YA 3BWMA 3PX2A 3UJ7A 3UFBA 4AZTA 2C7RA 2FYTA 3DXZA 3LCUA 4YUWA 2NP7A 4OX9Y 3KQOA 3NWEA 4YUVA 3TM4A 1NV8A 5HIMA 2IH4A 2P8JA 3UA3A 5KQRA 5EKXA 3M6XA 2H1RA 3DLIA 3O4FA 2I6GA 5C1IA 2C7PA 5FHRA 3TKYA 2GAFA 5DM1A 1V39A 4L7VA 1AQIA 5LQUA 3LGAA 4FZVA 5HIIA 2Y1XA 4BY9E 3KHKA 3I5UA 3M70A 1WXXA 1JTFA 1N7IA 4EKGA 3EVCA 3EVDA 3OZSA 2AR0A 2FK7A 3MB5A 5ICCA 1QAMA 3P9NA 4LG1A 3OCJA 3UJ9A 2NNWB 3BGIA 4BP3A 4OA8A 2DPMA 5JR3A 5HFJA 4E2YA 2G8NA 4FSXA 3LKDA 3QOXA 5BP7A 1AV6A 3G2PA 5EHIA 4PYIA 3TQSA 4F85A 5DXJA 2ERCA 2PXCA 2O05A 3QOWA 1L9KA 1R8XA 2QY6A 3P2EA 2G72A 1UWVA 4YUZA 4E2XA 5CVUA 2G70A 3D2LA 1P91A 4HRAA 4RTMA 2XVAA 2EG5A 3KQTA 5DLYA 5E9QA 2ZZKA 2C7OA 3CC8A 2P3OA 3P97A 4G56A 4PINA 4PYLA 5JUWA 3EMDA 3BKXA 5E2BA 5LR6A 5K0FA 1IY9A 3R24A 2AN5A 3DXXA 5CVEA 3EMBA 1UFKA 4ER3A 1PJZA 3HCCA 1DUSA 4GC9A 3HCEA 4YV1A 5EGSA 2HMYB 2Q41A 4KW7A 3ER8A 10MHA 2JH9A 5DXAA 3FRIA 3SX0A 4DQ0A 4C04A 3NTVA 2IGTA 3OZTA 5GIPE 4OBWA 2G71A 3LBFA 4XUCA 3R0QA 2ZFUA 3LDFA 1F38A 1R8YA 3GRRA 3FTCA 3T7TA 3B3GA 1XCJA 1YB2A 3DTNA 3GU3A 2ZTHA 3VC2A 1MJFA 1NE2A 3G2OA 4CXMA 4CKBA 2EFJA 2YVLA 3HM2A 2OXTA 3P8ZA 2CMHA 1DCTA 2JHCA 4Y2HA 3GWZA 2VDWA 3G2QA 3NWBA 3MTIA 5DM4A 1JG3A 3HVKA 1QYRA 1SVUA 1JSZA 2QM3A 4QVGA 4E32A 5FULA 3LCVB 3UWPA 2G1PA 5IKMA 3GRYA 3P9KA 8MHTA 2P7IA 3VC1A 3FTEA 4PYNA 2P7HA 1BC5A 2UYOA 3FPEA 2PX2A 1VQ1A 1NW3A 2BM8A 2JH8A 3FTDA 1BHJA 4KWCA 2PX4A 4R8SA 1MHTA 3KQQA 3CCFA 3CGGA 4QVKA 2ESRA 2YQZA 4ER5A 3HCBA 4DMGA 3ELYA 5HEKA 4CWAA 1PRYA 3FPJA 1UIRA 1D2CA 5FWDA 1NW7A 3MGGA 5T67A 3NMUF 3V8VA 4PGGA 3EVEA 1WZNA 4DCGA 4ER0A 3ELUA 2CL5A 5KYGA 3L8DA 4PYOA 2P3QA 2B2CA 3AY0A 1ZG3A 4FGZA 5CVJA 3DR5A 3P9CA 4IV8A 3HCAA 5GM1A 1XCLA 1JG4A 4RV9A 1O9GA 3LX6A 3OFJA 4PCAA 2GPYA 1VPTA 5E1BA 5GP1A 1VL5A 5DSTA 4C07A 1O54A 1WY7A 2BR4A 3SXJA 3V97A 3AWIA 4YUYA 4GUAA 4C03A 3ORHA 1R00A 1WS6A 3CJQA 1P1CA 3CKKA 3KR1A 4GOOD 1IXKA 1VBFA 4IKPA 1FBNA 2AVNA 2WA2A 4PYJA 4RTQA 5CCXA 3UBTA 5EC8A 3BT7A 4KDRA 4GF5A 4QTTB 3SSNA 3ELDA 3KPUA 4HSGA 2YX1A 2XBMA 5HZMA 2VP3A 1R74A 3M4XA 3TM5A 3P9IA 1EIZA 5H02A 4GOMD 2PSSA 4BLWA 4ER7A 4F84A 3EEOA 5CVVA 3K0BA 4BLUA 5T64A 2K4MA 4E30A 3HVJA 2YR0A 3JWHA 3TR6A 2IFTA 3IV6A 5GIOE 2GA9A 2ZVJA 3R6TA 2QE6A 5FUBA 1X19A 2IIPA 3C6MA 4DKJA 3B3FA 1RI1A 2GLUA 2N47A 4M36A 1NV9A 3AXSA 5EZSA 5HIJA 4AZSA 2KW5A 1KYZA 4FT2A 4EMSA 2I9KA 4X1OA 3EVAA 2PX8A 3PFGA 5K0CA 5U4XA 3LPMA 3ER9A 3KQPA 1ZQ9A 2OB2A 4MTLA 4BP1A 3SR4A 2UYCA 3FPHA 1KPGA 2YUIA 4E70A 4PNEA 1SQFA 4IWNA 3TRKA 3AXTA 3PS9A 4DCMA 3KQWA 4AX8A 5GM2A 2FCAA 2ZIEA 2ZZMA 1VP9A 2PBFA 5EMMA 1TW3A 4FS8A 2A14A 1B42A 4POOA 3EGVA 1SUIA 3G89A 2PV0A 4A6DA 5EMKA 4HTFB 3GRVA 5EIFA 5FTWA 1Q0SA 2NXJA 1KR5A 2R6ZA 5IH3A 3HCDA 3LSTA 2QYOA 4CTJA 2EJTA 1M0EA 1XXLA 5K0BA 2PGXA 5LQNA 3ID6C 3BKWA 3SVZA 4RTLA 4B17A 4RTJA 3PTAA 2B9EA 4BLVA 4PGHA 2GH1A 4KDCA 3E05A 1KPHA 2AS0A 2ZWVA 4P7JA 3T7SA 3U81A 3EPPA 4X60A 3PVCA 1AF7A 3ERCA 1JQ3A 2O0LA 1XDUA 1X1BA 3NDJA 1NW5A 1R18A 1WG8A 1NKVA 2O57A 3TLJA 1RI3A 2PY6A 3JWGA 2UZ4A 3R9XB 3G7UA 3E23A 1YF3A 3OPNA 3BZBA 3IEIA 5FADA 5DWQA 1BOOA 4RVHA 3PX3A 4RTSA 5E1OA 1YUBA 3KQYA 3CVOA 1FP2A 4OBXA 2ZW9A 4XUEA 2PJDA 3FPGA 3ELWA 4PYMA 5E9JA 3NW9A 5LQAA 1FP1D 4FT4A 5FWAA 2HNKA 3KR9A 5C9ZA 2VDUE 2BR3A 3NDIA 3KR0A 3LCCA 1XJ5A 3FRHA 5EPEA 3SMQA 5F2NA 2P1DA 2PT9A 3BWYA 3MERA 5FA8A 4GC5A 3UJBA 3HCFA 3MQ2A 3UJCA 3PB3A 3UA4A 5D1HA 3C3PA 4A6EA 4K6MA 5E2AA 1KIAA 5KVAA 2ONYA 3G5LA 1EJ0A 5EQJB 1VIDA 3DMFA 3O31A 3SM3A 1RJEA 2BR5A 2AOXA 4RTOA 2GS9A 1YZHA 3X0DA 2ZBQA 5DM2A 3A7DA 3HA3A 5M5BA 1RI5A 4KIGA 5EEHA 1U2ZA 2V74B 1VLMA 3G2MA 5ERGB
chains in the Genus database with same CATH superfamily
4P93A 5GGXA 2NN3C 4D4LA 2O5VA 4W5WA 1W93A 1XA0A 1QJCA 1VFNA 4OHXA 1BDHA 2Q29A 1H3NA 4PPGA 1ZY2A 5EN4A 2PFGA 2PMFA 1AB6A 1M2NA 4G0XA 2Y76A 1FU4A 4H27A 5LVAA 2H4HA 4O4HF 4A8JB 3QW4B 3H2ZA 1NP6A 3NALA 4Q93A 4C5CA 4OJQA 2C7GA 3I58A 2P67A 2QRJA 4CKYA 3N8NA 2NU8B 4Z8YA 1JB9A 2R96A 2I03A 1HWYA 2AX3A 1G1AA 1NZFA 3JX9A 4GYYA 4JOBA 1D0IA 1F2DA 4JEIA 4S1OA 4L9SA 3RRZA 1JHUA 2W7TA 4R40A 4C89A 2C2HA 4MVXA 4PC2A 4CMEC 3SSMA 1N33B 5A3SA 2ORVA 3UJAA 4B73A 3LSYA 3MTEA 3QM1A 1Q5PA 4XYBA 1G2QA 121PA 1PN3A 1SCIA 4JIMA 4H17A 4FHEA 1Y48E 1ZIDA 2ZRCA 1A4IA 1CY0A 2FN7A 2W43A 5JVDB 4LWPA 1JT9A 4A4DA 4IUCS 2P4HX 4B46A 3PKIA 2F8LA 3OF5A 3D0KA 4L4XA 5CFOA 1FMFA 5LIRA 3TRHA 1UKAA 1MZPA 4V02A 3F4KA 2O5RA 4X1KB 5LQCA 3L0IB 1GUAA 2HTFA 4YCMA 5CAEA 2D4AA 2ZJ3A 1QYXA 1KXZA 5ALGA 1U3CA 1D2HA 1IBCA 2B21A 3I6MA 3I5MA 2RI1A 2JAPA 3AUSA 3OMXA 5TARA 5B30A 4QQRA 3HU5A 5F1KA 1FYEA 4KOAA 2WDZA 4JBGA 2PGOA 4X7BA 4B5KA 2VQ3A 2O3UA 5EE5B 1QGUA 4BBZA 4FFBA 3BHMA 4GEKA 1SXJD 2O8CB 4J4HA 2IVFA 4N5DA 4Q9DA 4BRZA 1ZI9A 3NVAA 3R41A 4Y6OA 3U4QA 3I04M 2E5WA 1QPGA 4NE2A 2Y9PB 1IVSA 1BWRA 3OX1A 4OKSA 3FWPA 3PV0A 1FRZA 1JHRA 2FX2A 3WDSA 2JIZA 4MYTA 2ZB3A 4CUJA 3R77A 4Y67A 3GG2A 2XCLA 4DIBA 3CLSC 3O9VA 3BD9A 4KK4A 4NU8X 1J00A 1M83A 4HUJA 4GXQA 4LI3X 5FI5A 4YQZA 2ABWA 4C0BA 3GH1A 1QP7A 1GZ4A 2PUVA 3NJ4A 1I4OA 3UYLA 5IC5A 1BDBA 3VXKA 1MOQA 4PNZA 2NO1A 3H9UA 1KDYA 3QLEA 3L4KA 1Q74A 4JIGA 5AVUA 1CZUA 3WYAA 2W6MA 2I1WA 2HIAA 2RGCA 5E7MA 4FR0A 5I9BA 1GGKA 2C2KA 3HCRA 4AMBA 3O1LA 5A5EA 1RCFA 4M7PA 4G9BA 4I1IA 4K2AA 1TO1E 2P68A 5BVHA 4UFOA 1EFVB 1QGED 3FMVA 5ICEA 1UPFA 2FOXA 1IWBB 1F20A 3OICA 4OLFA 3FTPA 2ASEA 5AVWA 2NLOA 4MI1A 3AL3A 2W6NA 5LJLA 1P1JA 3HJBA 3CUWA 3ZTTA 3BUSA 2GZ1A 4BQQA 5IM4F 4YAFA 3WYEA 5HIKA 2VYNA 4PLPA 2IYZA 1QK3A 1QNLA 1PGPA 1U9IC 2A5DA 1H2XA 2DJ5A 1QYCA 2C59A 1Y6FA 3U4MA 2GCPA 2B4AA 5DYWA 2W2QA 5CRIA 2WWTA 4BC1A 2O07A 4I55B 2JIQA 2O2HA 1PD1A 3A2LA 2H2HA 1H8ED 3B2EA 2VAMA 3PKZA 4DLAA 4RDIA 3AVWA 2J5XA 1MIHA 1KFBB 4R68A 3SYTA 1ZL0A 3L6CA 4MGHA 7MHTA 3C24A 1C9EA 1JQEA 2P9HA 1XK7A 3IAAA 4G1EB 2G4VA 4JSTA 4P4SB 5CFNA 5K0EA 1LPBB 5ESDA 3LZ6A 4IHQA 1Z4NA 2I8CA 3K9QO 3KK0A 3KQHA 5DHTA 4RMNA 1P4JA 2FVXA 1U94A 2JKZA 1JKXA 5FYDA 5TF0A 2XUQA 1VMAA 3GR6A 2EW8A 2HHJA 2UXCB 3CGWA 3SSOA 1PGQA 2EU8A 2UYYA 5DWVA 3TLKA 2IOYA 1NR1A 3HEMA 4JLOA 4DZRA 1PZFA 2FN9A 4WLNA 3GGPA 3ZI0A 3F67A 4EYOA 3C3CA 1E1CB 1V9CA 1LSOA 3HYSA 2DT8A 2HA5A 4WXHA 1I5OA 2F1OA 1RWBA 2EF1A 3DQQA 3E7PA 3NC4A 5AVTA 4UUNA 4TT3A 1KBQA 2VF7A 1G20A 3ESDA 5FTMA 1Z4QA 1C4KA 5E0KB 3PNBA 4JASB 5H82A 4P4NA 4TSFD 4NQZA 4AJOA 4NOJA 4R4JA 4IHJB 4AJEA 3EDQA 1A5SB 1CPYA 1J2EA 3I1YA 1LI4A 4Q5IA 2I5PO 2ZI9A 5T4HA 5CB4B 1DAKA 5P8WA 2AUNA 2E6KA 2Z30A 2V7QD 3BWCA 1IU9A 3C45A 2YIVX 3JQBA 3QI2A 3GCXA 1EE1A 4J3JA 4PHCA 1IUPA 2XGMA 5IANA 2OWEA 2XZDA 3OA0A 4N8SA 2CMGA 1YRBA 1QYDA 2AKYA 4W8GA 2VUSA 3WGKA 1L7EA 4CM9A 2JLZA 2IU6A 3I04A 5LSAA 2A9VA 5KYUB 1I5RA 1E5TA 1XK6A 4U00A 1ZESA 2BGRA 5IT9A 2HB6A 4DMUB 3QF7A 1TYDE 1P1BA 2X3UA 1H9AA 2PA0A 3ETCA 1A4UA 3T34A 4DIUA 1H66A 2P6OA 4QPPA 2BRUA 3F9IA 3R5TA 3UK6A 1LWOA 3FROA 4XIYA 2P78A 1BH6A 4ETIA 3SBOA 3I5AA 4G5YA 3MTQA 2ZULA 3KWMA 4J1TC 2P91A 1C3EA 1V8DA 2QTGA 3FD8A 4YMSA 1SHTX 4DCPA 4MAAA 5B1SA 3CUVA 5J4VA 2W6JA 3CY6A 3L82B 5B36A 2X8BA 1NC1A 5JHGB 1OT3A 4YMLA 4JU9A 3WC4A 5HCIA 3AIOA 3PHIA 1C29B 1PU2A 2Z2KA 4KN8A 5J59A 4RTPA 3FHOA 1LRKA 3GJ5A 1USGA 3QFTA 5HE8A 4YRTA 4Q1VA 2PKQO 4IBOA 1CRWG 1F2TA 3CHYA 3ICCA 4D9GA 5F21A 5AKXA 4Z4EA 3CIOA 4KU4A 4BTLA 3U49A 4GX0A 4PWYA 5PNTA 4G37A 2AUTA 3DFFA 3B70A 3OI7A 4OHWA 2IS4A 1OU4A 2ADMA 4WJLA 3HNPA 4GXTA 3TNFA 4NXMB 1EFHA 1W8IA 4CGZA 5DJ5A 3IMGA 3U5TA 1OC4A 2QI9F 4AN1A 1NQVA 5I7HA 3IHLA 4IDAA 3LD9A 1YOVA 2CEKA 2Z0MA 1LGYA 4UAGA 1KNXA 3D0RA 1KY5A 2QTCA 1O94A 4DJJA 2FAXA 2AI3A 4AROA 4AZTA 2HHAA 3BFKA 1WU7A 4HRYA 4IH1A 1MQAA 1SIUA 3THYA 1N6HA 3GFSA 1JU3A 2CW5A 4RK5A 1RP7A 2J5RA 4Q9HA 2HNAA 1UK8A 1QP4A 2HRDA 3AGQA 3COPA 3RB8A 5M3BA 3OOSA 3RVQA 4JT4A 3IOBA 5DI9A 1CWUA 5A3VA 3TI7A 3DLIA 2FSVA 2IY7A 2P4SA 3AZQA 3C16C 3LQ4A 1V48A 1DO0A 1Y5MA 3OJWA 1DKNA 5DM1A 1QHHB 3WJ1A 4F0JA 1FMJA 1KK2A 2JBHA 2IVZA 4L4RA 5BORA 1GG9A 3BJZA 4B6QA 1LPAB 1W0KD 4FC7A 3O3CA 5FTNA 4REQA 2JI8A 4UPDA 1W88B 2H52A 4RPKA 4BP3A 4XVUA 5TDHA 5G4KA 1AN0A 1GCIA 1ZI8A 4E5YA 4TLDA 2EDAA 5KQLA 4BBJA 3V2GA 1A27A 2EARA 2TMGA 4BCBA 3CNEA 4LCBA 3FNRA 3MJFA 1M8FA 1YJXA 1ZW1A 1I2CA 5EZYB 3WGJA 5AW2A 2EJCA 3K0AA 1HFJA 4L4ZA 1TOAA 4IL5A 2HWUA 2ZJBA 3EK2A 3D6VA 4N18A 1AZTA 1LBSA 4MS4B 3FLEA 2YMPA 4YASA 2LVBA 4IWXA 1AM4D 2Q5JA 4OAOA 4RS4A 5J2TF 1B6TA 4LK3A 1NOJA 3LQKA 1GAJA 1U1DA 9ABPA 5IW8A 5C4MA 4H3SA 5D01A 2A0FA 3FGZA 3UIEA 5LR6A 2ZYSA 3OQIA 1N5IA 1PZXA 4DMMA 4C0QC 1I7DA 4XTCS 1NJ8A 2P6UA 4H7KA 4BU1A 2FW1A 4OUDB 3ICQB 2WUVA 5DXAA 1XAGA 4MROA 3HFGA 5A5VA 1QQBA 4JZKA 2QU7A 4JB0A 4XSHA 5DP1A 3S55A 4DDTA 2CDNA 2D3TA 1KJNA 2CK3A 4D0LB 1LB1B 1UOQA 3H2GA 2AD5A 1VZ2A 2IYYA 3OZTA 2H8GA 4OBWA 4FC6A 1J0XO 4S05A 4X8HA 1ZK0A 1V5EA 3DTNA 4OOFA 3ND6A 4WL0A 1DQNA 3OM8A 3KB1A 1ZGHA 4KQJA 4D92A 4DCUA 2EFJA 2EC5A 4BMOB 1Y3BE 1FS6A 1ADBA 2VDWA 3NWBA 5IFKA 4RW0A 5IT4A 1IULA 4YRCA 2C4NA 2QM3A 1DPGA 2FX3A 5I9SA 4ZGGA 1LBHA 3AUJB 1Q0ZA 3P9KA 4V1CB 1Z5UA 2GXQA 3D6UA 5JAIA 5ALLA 3FTEA 3L6OO 3SQNA 1GTMA 5EIEA 4V0MA 1IC6A 3MRXA 4HLUC 2ZR8A 1X8JA 3RNLA 3UV7A 1EUCA 3LUJA 2G08A 3OOJA 4AKEA 1UM9B 2ESRA 1L4NA 3HKBA 2WU1A 2E6UX 2ZP1A 3CYFA 2UVDA 1GPUA 4ALJA 1JXQA 1LRLA 4MV9A 3C43A 3TX2A 2ZGVA 2PR7A 3GLSA 3MGGA 5DCWA 2BMAA 2FWMX 3C3MA 4IVPA 5T67A 4P0PB 2Q07A 2Z56A 5HW0A 4R9VA 4KEAA 2WLSA 2P4QA 2QLBA 4MP8A 3F4BA 4EPWA 2LCFA 3KSRA 3L79A 3CWQA 4MVCA 1E0AA 4YAGA 2F3QA 4LI0A 4CLOA 4IZHA 4E15A 3VM6A 2BSXA 1U80A 1KE2A 3Q2KA 3QG5A 1CR2A 3TBFA 4CUZA 1I6LA 4ES6A 5K3OA 3WSWA 3AW8A 5DYIA 1I2BA 3L4BC 4NCKA 2FTKE 3LX6A 5F52A 5E1BA 2V5VA 1BXKA 1RWWA 3HN6A 3NGMA 4HZGA 4F04A 9ATCA 2WB2A 1VL0A 4LF4B 1R6TA 2A9RA 1J0BA 3NH9A 4P53A 4BQRA 2HCRA 2Y1DA 2XEXA 1MO4A 4JBLA 5J3JA 3U7QB 1PJLA 2HRZA 4JXXA 2AVNA 2VTVA 2WUFA 2V0NA 2V55B 3IRUA 4NZPA 3P0HA 2C20A 2ENWA 2OVFA 3K16A 4MKIA 4BB5A 1QLHA 1A5ZA 1E0DA 4HQKA 3GXBA 3SSNA 5DH9A 1ZH6A 5E6RA 5FBHA 3BIWA 3OZCA 3ZKWB 2YX1A 5BSGA 2AEFA 4XEHA 1PLKA 1U3GA 1T4BA 1DWPA 1EIZA 2OHHA 1L7DA 3ZX4A 1YV9A 4G4IA 3HJHA 1OIXA 1T9KA 3PXAA 3UK1A 1DKMA 1PG2A 1M1NB 2CHQA 1ZISA 5DDIP 1OHHA 4ZVTA 4Z4IA 4BX9A 1JU4A 3JWHA 1LI5A 1FFSA 1XEXA 3W3ZB 5HJ7A 2ZSAA 5GGYA 4NCBA 2QL5A 3FVQA 4R71A 3TNYA 1X19A 1M76A 3IELA 1WHSB 1BVYF 4XH9B 4IOLA 5DWDA 3V8NA 4A1FA 3A31A 1J21A 1JJBA 4DPKA 4RZSA 4ZOLF 3S27A 4EMSA 1Q91A 2PU7A 4GYWA 4HP8A 4YJGA 2YV5A 3JQ6A 4WY2A 4N47A 4AY4A 5K0CA 2HU2A 5HKKD 1I10A 2AHRA 1H6CA 2ODAA 3Q72A 2JGLA 3WLOA 4ZYWA 1UT8A 3TQFA 3ENWA 2YMMA 1NVFA 3HWRA 2NZUG 4HDCA 1NXQA 2JNWA 4QXRA 1AUXA 1NRXA 4ABTA 4L76A 1X7WB 1VLZA 2JAXA 2VSOA 5DLQC 3WV4A 1E7SA 2I6XA 1VP9A 5LP6C 5KYWA 1TW3A 3L1UA 2G76A 1B42A 4R1UA 3MJ4A 3PXEA 2HREA 3BXEA 4GI2A 4MDHA 1YHZA 5HF5A 1ZI6A 1X9HA 1FFBA 1OSNA 4RD4A 1IMOA 4OBEA 3W6ZA 3GRFA 1PJCA 2KS6A 3RBXA 6ABPA 4ROSA 3EQ2A 1JLLA 2F9FA 1HO3A 2HIHA 3N7UA 4KWTA 3U9TA 3ZQ4A 4DT1B 3WLRA 2ZAYA 4QJ3A 2SCUB 5BN3A 1LLFA 3GJZA 3JRWA 2A4KA 4YGXB 3SVZA 4RTLA 3SJZA 1SZPA 1XU9A 2HK7A 5AJXA 4MQEA 4MP3A 4AKIA 3T7SA 1FYWA 3GJXC 3IEKA 1UDWA 1QGAA 1LJUA 3M34A 3MS4A 3ORSA 3PRHA 2O0LA 4LBWA 4LDPA 4U6SA 5DBGA 1SCJA 4TWJA 1P1RA 2ACVA 3TIVA 4AG6A 2G8LA 1C7JA 3DLTA 2WU8A 3IUSA 1KI4A 5LB4A 2J32A 3TLJA 3WIDA 3WWOA 1HT1E 5BNIA 2OMKA 3G7UA 1AQLA 3NHRA 2MWMA 3EG9B 4JZYA 5DW3A 3K9LA 1QF7A 3RFTA 4AZ0A 1CUEA 2XRZA 4IS2A 5BN4A 1NBEA 1YO6A 4BO4A 4YAUA 3ETJA 3WNCA 3DKRA 3FPGA 1FP1D 2BGLA 1XZAA 4H7FA 5DEIA 1OGIA 1R8SA 4Z0NA 5C9ZA 3EXG1 5KC8A 3EPJA 4P4UA 1CF2O 1MGOA 3KR0A 3IJ5A 1SXJC 3IP1A 3V8RA 3GJTA 2C58A 3KXPA 3KZOA 3W7BA 2G1UA 4ZCIA 2ORYA 3I6QA 1NONA 3M1YA 2NT4A 3AEKB 3ANMA 4D0GA 2BTQB 1ZH4A 4JL8A 1R10A 1MOSA 2MSEB 4FCTA 1YA4A 4HWPA 1RQPA 1DS6A 2G88A 3CG4A 1NNUA 3CMCO 3O83A 5G0UA 1WUYA 2DGDA 4LGVA 1VIDA 4S1NA 1DEKA 1JL3A 3UAWA 2NUPA 3OQMA 1WKCA 4F7WA 2ZBQA 1I51A 1N1GA 2V6JA 3KYDA 3ETHA 4JSYA 3SEZA 3SPXA 4HAWA 1C7EA 4HB3A 3LP8A 1H8HA 2IUFA 4RXMA 4B4DA 2GJ9A 4RPJA 2XSZA 3LCRA 3ZS9A 5KU7A 3OM0A 1ZVJA 3FOBA 1UXIA 3RAEC 1GILA 4F1JA 2X1MA 1S7GA 3DOFA 1IQRA 3A4NA 4AM8A 1D0VA 2QIOA 4M0DA 4RX1A 2AFHE 1UM8A 3QKTA 5KNBH 4C4OA 3P0IA 4ABYA 1WXDA 3K1TA 2C29D 2CNBA 3FMIA 4OP3A 1LQUA 2FGJA 3R7LA 4BV2A 3K9NA 5TE9A 2TRSB 5LJIA 1AS2A 1E3JA 3EQ7A 2B8NA 2XUHA 5K2OA 2QAIA 5ER6A 1RYFA 1BS1A 4FQ7A 2FI1A 3QKSB 1FYFA 1P1FA 3PC6A 5HRAA 4G5FA 1XD2A 2GYVA 1YMUA 1D8AA 3WKBA 1QYWA 1NMQA 3EGDA 1U2SA 4M0CA 4M8LA 2FETA 4LEIA 4DMKA 1JMYA 1UJ5A 5CVCA 4U7PB 3DL0A 2EP8A 1L7NA 3ABRB 1ODCA 4FW9A 4KYVA 4HVAA 3CPSA 4L78A 3BQMB 1E9FA 1M2JA 1TMGE 2YJ6A 2BF7A 3FHJA 4RZ3A 3ZIUA 3PPIA 3NDRA 3VJKA 3AINA 3R0IA 4F2HA 4P0TA 2AC7A 3BRQA 3IVAA 2J6HA 1QKJA 2R1TB 1VBKA 4NV3A 2GTHA 4XGKA 5TF4A 3RSFA 2D7DA 3T7JA 1PWZA 2CHFA 2Q3FA 1PT9A 2UVPB 4NPHA 1FX0B 1XN4A 4QU0A 5DCLA 3RTDA 1HNZB 3A6ZA 3L8FA 3V4OA 4NATA 4RE6A 5TVGA 5I4BA 4E33A 1IOLA 2IBTA 5JBQA 2ZIZA 3GEIA 3DHEA 3F7NA 2ACEA 3R7DA 2GBFA 2KBEA 1P0QA 3VR4H 3A3KA 4DDMA 1PAUA 1F7VA 2LDXA 3WMEA 2PQ6A 1XDDA 2A5GA 1YXMA 3PYMA 1XJQA 2DPYA 2HCFA 2V8BA 2RKWA 1DKOA 4OSOA 4EEZA 1V3QE 3RBVA 1JEAA 4JLNA 3CQ9A 7MDHA 2I7CA 1NP3A 3STWA 3UT0A 4M1MA 1M7GA 4A8JA 2Q5HA 3FVVA 4AZVA 5JS6A 1J9GA 2NVOA 3BPSA 2XMBA 3VAYA 2ECFA 3WGGA 3DDUA 2RCNA 4JSRA 4TLEA 4Y7CA 3KYBA 1FPQA 1KERA 1SZJG 3B3JA 4LBVA 3RS0A 3DTVA 1QO0D 3LL7A 3NORA 5IC4A 1SHKA 3DDNA 2WABA 3ULKA 2OXRA 2J3EA 2IYWA 4B74A 5CCBA 1OZAA 4HSEA 4UUOA 3K20A 1A04A 1WV1A 1WXEA 3ISVA 2ZBVA 1X39A 1JR3D 2KLBA 5BSRA 1S1MA 2REOA 4NWIA 1CG6A 2B78A 3DULA 4XQ0A 5KYNA 4CKWB 2XD4A 3FNFA 4IS3A 4DMCA 5JVDA 5KYYB 3OE5A 3KQLA 1XFDA 4HYEA 4O4JB 1YJAA 1HZZA 3CE9A 1PHRA 1QZXA 2YHBA 3LC2O 4IJUA 2QW0X 3ZGOA 1U4NA 2G82A 1JH9A 2PUCA 2OBYA 3ZWAA 2IPOA 3LYUA 5TNXA 4MHTA 1J56A 3UWSA 1XYYA 4EZIA 1V6AA 1NQOA 4H60A 2VH2A 1GA1A 4Q19A 2XNHA 4F5YA 2D2VA 1V47A 1NVTA 4TLMB 3TE7A 4AY3A 5DGIA 4AUMA 1YR7A 4UU1A 5B4UA 3BL5A 1JIVA 2WHRA 4C0LA 3X2EA 1SBCA 1YTLA 4MICA 1KDZA 3OHMA 5JANA 5I7UA 1W0JA 1Z7BA 4UNPA 2REBA 3II6X 4KG7A 1TYBE 2FPMA 3DO5A 5ESRA 1G291 2EFYA 2GUGA 1PNVA 1HNXB 3IAM6 1EDZA 2DHRA 1OZHA 2GFIA 4P5DA 3OQNA 1QTRA 4BFCA 1PEAA 4XGRA 2C9ZA 5CP8A 1XTPA 1MJNA 2FF5A 2MSCB 3DHWC 4GMGA 1Q7EA 1OGJA 4U7TB 1I7SB 1V37A 1FVFA 2JFXA 1RRCA 1RJWA 1P1HA 4JLKA 1W85B 4GL2A 1RJFA 1PYGA 3F3MA 2BCGY 5H4HA 2I6UA 3IPLA 1R27A 3WICA 3SQXA 1UK9A 2AEJA 5A1TA 4HDNB 3DDZX 4QFBA 4LMAA 2WTNA 5HILA 4BNNA 1RKUA 2ZI7A 1J2RA 3QMPA 1TRKA 1XHEA 2YCBA 3HVRA 2IHZA 2HJHA 5EQFA 4YR7A 1I4LD 1NW8A 2YZKA 4Z7QB 3NNNA 2AN4A 2JEOA 3CRZA 3DL7A 3QMMA 4IQGA 5JAOA 1NR7A 3G8AA 4CEJB 4RFSB 2GEVA 2PGJA 2HNBA 3F6CA 5AHRA 5A05A 5JY6A 1OB2A 3CNHA 3CBGA 3EEBA 3Q3JB 2C84A 3E0XA 3NHMA 3L8MA 1LPPA 2FQYA 3QBTA 1SUDA 5D5QA 1DB3A 1J06A 5EHNA 2CHUA 3LY9A 2FPPB 2JC3A 3ZY6A 4XQ9A 5K8LA 4X61A 1O6BA 1C4WA 3C8MA 4A2WA 2GRAA 2WF7A 3L84A 1IXRC 1G8HA 2IIQA 4NK4A 5GONB 3RSHA 1T0UA 3Q6IA 4MULA 1WCIB 1DFHA 3CM0A 2O4UX 2X6TA 1H6DA 1QQ6A 4JP2A 2RHGB 3OA2A 4NI5A 4YFVA 2MSWA 2WMYA 1FYVA 1X1CA 1XQVA 2OO5A 3AVQA 3DJFA 3HC7A 5GY7A 2BM9A 4LJ7A 1OA1A 3HVUA 2E48A 2TECE 4QQNA 3LLMA 4HZUB 4O33A 3WLFA 3ANTA 4NKRA 4B3MB 3S0JA 3AVYA 3TVTA 1R4NB 4I55A 3KFLA 5H7XA 2M6SA 2WM9B 4BAZA 1UJNA 3B5EA 4E3ZA 4H7IA 1YVDA 1XR3A 3T9FA 2PH5A 3NM5A 2PT5A 1GCUA 4P4SA 4I14A 3UAGA 3KALA 3NHWA 4DLSA 4NZ9A 2HJWA 1S3SA 1SURA 4XSGA 1W52X 4DA8A 5D85A 3L1HA 3WB9A 2UYHA 4B7UA 1R6DA 2J4DA 5HWSA 2WT8A 4LZLA 1G4AE 3I6ZA 2I2CA 5DU2A 1N3BA 2C4HA 3I12A 3ZG6A 1FSSA 2BOVA 4YO7A 5IEBA 4UNRA 3TNJA 2CWDA 1E1CA 3VU0A 1MC4A 3IA2A 3OPYB 4QKQA 5I45A 3BTVA 2O20A 3CSUA 1CR4A 1Z07A 4HAZA 1PS8A 1X1DA 2OO3A 3FWZA 3NP9A 3S8YA 5FO1A 3OJOA 4D0NA 1EKXA 4FN4A 4KLCA 2VUTA 3RPEA 4C0WA 4CCWA 3BAZA 2YWHA 2XLBA 3SVLA 5IRCD 1F6WA 3CZRA 3RS7A 2ORED 1IPHA 4IHJA 3IALA 4AZWA 1OX4A 4EYSA 4U2CA 4FDVA 4UVIA 1RR6A 1YS7A 1YJCA 1HMYA 2R2AA 2RGNC 3F8WA 3QMVA 1Y42X 4IJKA 4KH1A 4WXPA 2J0VA 5FFFA 5HCUA 6REQB 1QG6A 1W35A 4FU0A 4Y2JA 1QCCA 1JFRA 1TMKA 1AHIA 3ADKA 3AW9A 1P1KA 2QUJA 2D2EA 3AHJA 1EPUA 1A1VA 1FJGB 4IGAA 1EGAA 3DOUA 2BFNA 4B87A 5DT2A 4G5HA 3RJ9A 3CMMA 1GZ7A 3EUFA 5KYUA 3B1JA 2FHSA 3TMAA 3UJ7A 1J0AA 1ICIA 1G8YA 2C7RA 2X0JA 3DBLA 3JSAA 5KQGA 5MN6A 3IMKA 3MZ0A 2R4UA 5COAA 5KKCA 2NSLA 5TGDA 4EW2A 3A8TA 3WQSB 4IRXA 5DYNA 4ERXA 2IH4A 4H6PA 2NTNA 2OHIA 2WF8A 4OLAA 3I61A 2NPOA 4O1MA 2A9OA 1LQTA 3EIXA 1LDEA 3O8BA 3K0HA 1V39A 1Z37A 3NKFA 3OZUA 4NS4A 5FPYA 2PNFA 4ZVMA 2GPJA 1TF7A 3KHKA 4R83A 4XWOA 4RD3A 4XGIA 5CNKA 1N7IA 4MUIA 3OTQA 2NO7A 2VHTA 3UW1A 5D84A 2HMAA 1Z0FA 1NRIA 2EKZA 3IIJA 1OFTA 4Z9YA 3H17A 3VZSA 5HM6A 1L7VC 1YQ9A 3EASA 3K15A 1CU1A 3O4JA 3N9IA 3PE6A 2NADA 1TYZA 2REQB 3QFRA 4FSXA 4F3TA 1H5UA 3HDVA 5EJ2A 1F4PA 1AV6A 3ZV3A 5FOUA 1ZQ1A 2QNRA 4FHCA 1P0FA 1B8PA 5BV0A 4QYSA 4XD2A 5LXTF 4EUEA 1R8XA 2W6CX 1LZLA 1E3WB 3IHKA 4NPCA 2HYDA 2X23A 4PRLA 1CW2B 2W2XA 3Q3HA 4NEHB 2G70A 2WD9A 1ZBDA 4RK1A 2Q49A 4X6UA 1JEDA 1XE3A 3Q7PA 2POQX 4LNAA 4HHEA 2RONA 3RQSA 4PYLA 4TXLA 5CM8B 3BKXA 4D02A 3QVJA 4TL7A 3RYTC 2XYGA 3E15A 2B1JA 3R24A 1I14A 1V1MB 4DWOA 3ZNPA 3CKYA 2GEBA 2EYQA 5BWOA 3F5QA 3WL4A 2DBRA 4WJZA 1Y6JA 2PT7A 4EPXA 1DV2A 4Y1RB 2W8ZA 2XWJI 2PKQP 1SN7A 4KQCA 3S99A 4V38A 1MQSA 2QR2A 3OTGA 4I6GA 1H5QA 5FI0B 1Z7WA 2PWAA 4X1IA 3KVVA 5K4AA 1R8YA 1A9RA 3MTJA 1AS0A 5GMOA 2DMRA 5C3UA 2O0HA 2VG8A 4PO1A 1ZWKA 2F8SA 3PEFA 1KY4A 1YOBA 3EYAA 2J9FA 2DFNA 2I2WA 4N82A 2CJYA 1UH5A 5CJ2A 2JHCA 4Y2HA 2C1XA 1VIVA 5K5EA 1NJGA 4NZZA 1QYRA 1E62A 1JSZA 1KAGA 1ZJJA 2BGIA 4ZO8A 1XZLA 5AJWA 4D0RA 4TRJA 1CBUA 4FIZA 3T41A 1W88A 3I0NA 1TYAE 3S2ZA 2PX2A 3WGUA 1VQ1A 5LLSA 3K6JA 4EHAA 3KQQA 2YQZA 2E55A 1B74A 3AI7A 3O2QB 4O2AB 4B82A 2XWPA 2ZUVA 3CNBA 3E8MA 3DXFA 3FPJA 3KJGA 2IEDA 2CHGA 4X91A 5ARDA 3SLRA 2J5QA 4BUCA 5C7LO 1ILEA 2JFHA 3QEJA 4IR7A 3D31A 4LBYA 4M46A 4MS4A 3I6YA 4IP0A 4KACA 5C1BA 5TLSA 3L8DA 1L9XA 1NBWB 1JAIA 5ED4A 1BEEA 1MKYA 1QVWA 1YJBA 1NI3A 3KE8A 3W77A 3OCCA 2CLIB 4NZYA 4DG8A 3WHPA 3HLYA 2XNCA 3S7TA 5IEJA 3DUFB 4HKTA 4MR7A 2Q0QA 1JG4A 2BI7A 2CXRA 2HT6A 3TW4A 1DKRA 3RSCA 2I1VB 1U8CB 3LUAA 1XD9A 4OUDA 2GPYA 4UXIA 4CMIB 4XWKA 2V7TA 3V97A 1GZDA 3PD7A 2PS0A 4D4HA 5C8VA 1YMQA 4GZMA 5WRFA 4ISBA 4X8LA 4G1VA 3LO5A 1WS6A 1IXKA 2HBYA 2WA2A 3K5HA 3FIUA 1OB5A 1U2DA 2C07A 2B4TO 2X13A 5LWQA 1P4AA 1PR6A 1CZHA 3ELDA 2BJWA 3V7WA 1MJ5A 3GI1A 3H7AA 4BFWA 5EIOA 2GN4A 4KE9A 2VJMB 2V7BA 4EGCB 1IHOA 2AE2A 5T64A 1H0KA 1DRWA 2VLIA 3M6LA 2RHBA 4CU2A 3AOEA 3W1WA 4EA7A 3W3AH 4E46A 1D0SA 5L3QB 4G5QA 1L7BA 1IG3A 3RVPA 1DMRA 4QRIA 3QE2A 1N6IA 3C6MA 2BY4A 4OXKA 1UM9A 5EZSA 3BC1A 4LJ9A 3FBWA 1O6CA 4HH0A 4OHUA 3T4EA 3D6HA 3FHTA 2X19A 1P18A 4ARVA 4S04A 4RAQA 1RM4A 1FVXA 5BYJA 1G20E 1J70A 2GCEA 3K94A 4FGWA 4JYPA 3QEBZ 1P8AA 3AVXA 4H16A 2MSDB 4MUMA 2VUIB 4EM6A 1FTWA 2YUIA 5K3BA 2QAJA 3ZEIA 3U44B 1UZLA 4FQ8A 4U8HA 2OHVA 4N3GA 4AN0A 2C9CA 2YOHA 3PEWA 4L9RA 4MO9A 4OHYA 1UJ2A 1ZXBA 2P8SA 2G5GX 1B1AA 2A14A 2FPKA 1OT5A 3AH8A 1U1EA 1WF6A 2JB9A 3OZFA 3SC3A 1O03A 4KQXA 2OV1A 3ZDCA 1PJSA 1TGYA 4TV8F 1YZFA 1F8XA 1DWOA 5EFZA 4GU5A 1JWBB 3IQDB 1L1QA 1II9A 4DSOA 4RTJA 4K9QA 4Y2XA 3F6PA 2B9EA 3E7FA 3U7QA 4DR4B 2BGNA 4L9AA 1HFWA 1P81A 1KZGB 5KTMA 2JBAB 4DV0B 2PV7A 3SZUA 4UTVA 3L6EA 3IJEB 4I1PA 4FYJA 4R98A 2O2JA 3QPWA 3U48A 4AURA 1YF3A 1K89A 1T2NA 3KAKA 4LDJA 5EE1A 3L4EA 3C7KA 2VOEA 3BZUA 2QRGA 3ZU4A 4AMYA 1Z45A 2PUWA 2PYIA 3EAQA 2AR7A 5SZJA 5IBCA 1IL0A 1UPCA 2KMLA 3HRKA 2AH5A 1AGYA 1Q7TA 2YS6A 3R5FA 1PV4A 4O63O 2B82A 1Z36A 1K3UB 4DMRA 1WHSA 5D5PA 3KB8A 1W9HA 2VDUE 2TYSB 3BCSA 5FTLA 1KI2A 1DGQA 4CI0B 2ZT6A 3ZHQA 3KZXA 5F1OA 1ZN9A 2V3WA 1YQDA 1MB3A 2QMEA 3MQ2A 4BC0A 1AXGA 3UA4A 3KUXA 1IHXA 2QRNA 1SHUX 3BJEA 1N8TA 2OCKA 3I9MA 3IAM1 3SCZA 4YCAA 3T6KA 4F2DA 1XA4A 2O3RA 2GZ3A 4IQFA 1EVYA 2MYTA 3B6ZA 1OTHA 4RTOA 4U39A 4Z8XA 2IW1A 2QX7A 5F51A 1GGMA 1X7WA 4FZRA 1RI5A 3KRTA 2OK7A 2XWBF 1OFVA 4EELA 3FPSA 4N41A 2O5CA 1UBUS 3WDMA 3OIGA 1NKTA 1GR1A 3AO0B 2EKBA 2PWYA 3KKPA 4URYR 4QOEA 2V1XA 3Q7EA 3CZPA 3RS4A 3VUEA 4CL0A 2Q9BA 2D5AA 3PDJA 3ROKA 1E2QA 2PMBA 3MBOA 2PQMA 2EHDA 3FDJA 1DTSA 2XT6A 2SCUA 2JLCA 3GL9A 1BGVA 1VI2A 1NMYA 4R81A 3MD0A 3CX4A 4GOKA 1MO3A 1S3IA 1Z7YA 2OPBA 2QRVB 3ZPXA 1Y6GA 1RXVA 1FP4A 2RJOA 3AILA 4LYJA 5DCUA 1COWA 3EYWA 4WLVA 4TS4A 1ZXXA 1I1HA 2R6R1 3FMFA 3HVHA 4I9GA 4JC8A 3P2OA 4RQTA 1S01A 3TRIA 4Q9NA 2OY0A 4ITUA 4ZU6X 1LDMA 1HX7A 2W5UA 3EG9A 4OUKX 1E99A 1NWCA 5FNVF 2NUTB 2N1BA 3FUXA 3MCZA 2V7VA 3GOHA 4ZV9A 3ZHXA 5I4CA 4JXJA 5IKEA 4HL6A 5SY9A 5DTMA 5AM4A 1E5LA 2C00A 3RSOA 3GRCA 1QWOA 3EC2A 3IBGA 2IOQA 4WKCA 3PUYA 1SUSA 1U8FO 2H7YA 1ZD1A 2BONA 1RZUA 2BTQA 1IB0A 2QRHA 3W2FA 3JQBC 4P34A 4UKDA 1CP2A 1JBEA 1OKKA 3LECA 4UMVA 4D9MA 1IHDA 2CZGA 4YRKA 1EDEA 3VGJA 1T8UA 1HQDA 5I7WA 3V7NA 1FTGA 1I1QB 2Z8XA 5KTSA 4MCHA 3D5EA 1ML4A 1RPTA 2E18A 1R5OA 3VV2A 1LFAA 3U13A 4CIAA 5ANRB 3IQXA 4YP7A 4DY6A 5M7EA 3GYBA 2IOFA 2HAEA 3QK7A 1ULSA 1J2TA 1WX1A 3FF1A 3QPUA 1DO8A 4R1QA 5AUPB 5JH7B 3IEXA 4YACA 3L5KA 4RUKA 3V4FA 2SHKA 2FSGA 1Y0BA 2W2OA 2BFCB 4H77A 4J03A 2VPTA 4PXSA 3O6VA 1WB5A 4TV9F 4J4BA 4ALIA 4GZLA 2NU7B 2OCIA 2VH1A 1EGQA 1RFGE 1Z7EA 2R8OA 5JLJA 1EYZA 2PZLA 1TK9A 3RV3A 5TY0A 2G9VA 1FFEA 4MPDA 3MXTA 3Q5DA 5JO9A 3P0JA 1JFVA 2QRUA 3I3OA 3W5HA 5BQXA 1LA2A 5F9HA 1A3CA 4RC9A 4RTKA 1FVOA 3CEMA 5KIAA 1WRBA 5G0VA 3T0IA 2CXTA 5IVHA 2P6RA 1L7AA 1VE6A 2XYRA 3R23A 2C4TA 3A1TA 5H68A 3ZC3A 1J22A 1WPRA 3IMCA 1TU0A 1ESZA 3H2JA 1Z16A 3N6VA 3OCZA 4V0ME 4KR0A 5EWMA 1XI2A 4H2DA 3TLEA 4EVSA 4KQMA 1GTL1 4B4UA 3X44A 3CEAA 1VHLA 1UAAA 2O54A 1AKYA 2XVXA 5B1IA 3A6KA 3GAZA 4OAPA 1QANA 2ZE5A 4BNZA 2UVPA 1NHWA 2E0IA 1FX0A 4B6SA 5I4IA 3QXGA 3F5MA 2B4KA 3M2PA 4K28A 4FQ5A 2OC9A 1MH9A 2C82A 1H2HA 2WZQA 3K4PA 4CMAA 4IZIA 1EE2A 2Z9BA 3JQ9A 3OU2A 4MVJI 4O2RA 1RPZA 3OLQA 4OGLA 1GUYA 3ETNA 1QH1B 1GCOA 1HEIA 3EVBA 4ZK6A 3UJ8A 3MK31 1BJKA 1CVLA 1F4LA 4RZHA 4UBJA 5C35A 4QOGA 3TBHA 2WNSA 2UZ4A 4L8FA 4WADA 2Q0SA 2YXLA 3E8SA 3KJQA 2Z1MA 3CWZA 4FGJA 1AN9A 5MFPA 4P86A 2WFLB 4NHOA 3VR5H 2VFAA 4P84A 2X5OA 1SKMA 1Q17A 2PZKA 5AIAA 3W1EA 4AQYB 4EG6A 4C6TB 1K5HA 2GX6A 4LJ5A 3TXXA 1R0YA 2GTPA 1WULS 4WLEA 4KPEC 4PICA 2PYZA 1OE0A 2A9KA 2DHDA 4EY5A 3MJCA 5EMNA 5DHAA 2LUOA 3GVIA 3M6IA 3OZVA 2NSYA 4EH1A 1IY8A 1OLXB 2Q5CA 3SJAA 1U8XX 2A1UA 5KYYA 2GF9A 3A1CA 4O4JA 1EFCA 2XUAA 4O6VA 3JATB 1JVNA 4FMPA 4D3SA 2ZRHA 1TUBB 4PXYA 2C95A 3AJ8A 4TZTA 5AT1A 2IBSA 3DFZA 1AKRA 2Q6KA 4DW8A 4FOSA 4MLCA 2Y1LA 1KWGA 1ECJA 1V5FA 2HF9A 2IUYA 4V1CA 1H65A 4YRPA 1F60A 1R7RA 4LVNA 4NAVA 3OTWA 2O2GA 4P3KA 2AN9A 4BRUA 2F4NA 2FG7C 3A4TA 3KT3A 3BHNA 1NKSA 1PYDA 1SCKA 2BMWA 2RH5A 2WVGA 1MW9X 1JIQA 1NUHA 1KQ3A 2ZVPX 5AJZA 3VI4B 5F3WB 5JALA 1Z0UA 2DPLA 1VI6A 2O52A 5T7BA 2AOVA 3IEUA 4H1UA 4I4TF 5FTJA 3GRUA 3QNMA 2WG1A 4HDKB 3OX3A 4ZVLA 4BNVA 5KNBA 1TEZA 4RJKA 4TVKA 3ZBUA 3N2KB 1JFSA 3D8RA 1JKJB 2N3ZA 3TTYA 2XITA 4A0RA 4PRZA 5TQ2B 3RAFC 1ORIA 1ETUA 1T8YA 2O1SA 2VXOA 2XB6A 1W85A 1XL0A 1P7VA 2VXYA 4DLPA 3BD8A 2QTNA 1VP3A 3IGFA 2X6QA 2C96A 4OHOA 3ZEAA 5GZ3A 4RJJA 4Y8VA 4UE6A 4R6WA 1EB8A 4X71A 4Q15A 5JI3E 5DULA 4KFTA 3EW9A 1BX1A 2QTVA 1L4GA 4PHTA 3SS8A 3DZKA 3BWXA 4XB2A 5AHXA 4G8JA 5IC6A 2J3QA 3IIEA 2Y99A 1OR8A 3WNZA 4K9SA 4GXNA 5C5DA 2BISA 2O7NA 3RG2A 3I2FA 4QULA 2D1RA 4H7JA 3NOOA 3VPHA 1JZTA 3QE0A 2Q4DA 1N8KA 2CF5A 2QAGA 4WOBA 4O59O 4D2IA 2FPPA 4MGEA 3UHJA 3IIIA 1E7MA 2JI4A 1KE1A 5EJAA 1NLFA 3UJPA 5ITSA 3LOQA 4FPXA 5GONA 1O95A 3B1XA 2PXXA 2QVYX 4XVHA 2RK6A 3VR4A 1WCIA 2OR3A 3IDZA 2R5NA 3WK4A 2EHJA 2G3YA 2FWIA 5CFLA 1SC4A 2ZUEA 2JJMA 4ZPJA 3EFHA 2ZDGA 3G1UA 4PAQA 5AICA 2B5OA 3T12A 1YGPA 3C8UA 4OQEA 1YHYA 4YTEA 3KLOA 3RS3A 3SDSA 4M1EA 3RFVA 1V5GA 2OSVA 3B1YA 4HZUA 1H2AS 1Q3HA 5AXDA 2HSDA 1SUCA 1IZZA 1R4NA 4P4TA 2MOKA 4TN5A 3DV9A 1VL6A 1WHTA 1E2DA 1T8SA 4TVBA 1VYVA 3ODGA 2P8JA 3WRVA 2IOFK 1IXZA 3R7NA 1ZK3A 1YC5A 3IDOA 1GNVA 1YS4A 5BV1A 3W2IA 1VJ0A 2AQ8A 2ZWIA 3LGAA 3LRTA 4DG9A 3H65A 2IEZA 1WTAA 3IFSA 3L0SA 3A10A 1JTFA 3EIFA 5EHXA 2DRIA 1JHZA 3MMXA 3TCXB 1SCBA 2Y1OA 3DVAB 4N0MA 4N54A 5IDWA 1Y8QB 3DPIA 1P0CA 5BOSB 1FNSA 5CIWA 5HFJA 5DHFA 2BFPA 2CDBA 2IQ5A 1SC9A 4PLCA 4LWQA 2JAUA 3OPYA 2EV9A 4ZMRA 2Z09A 4RHXA 3AB3A 3VHRA 2QE7D 4Q1DA 1C8BA 4TM7A 5E6UB 5CFZA 1M6HA 1K66A 1JDUA 1A5TA 1LVUA 1Q21A 2QL9A 4CDMA 1G18A 3ESCA 1A9PA 3PNQA 2EG5A 2JGDB 2I1LA 1IUOA 4H1VA 4PG7A 2C7OA 3FNBA 3BA6A 4GKAA 4GPBA 3UJHA 6REQA 1BH2A 3DOJA 3M8KA 3EHEA 1WXQA 4GYJA 1NVGA 4S1PA 2G1KA 1VB5A 1ZK4A 3CH4B 3NT5A 3GEDA 5D6OA 4JJEA 4H1TA 5IWAB 3W8EA 1OFIA 5LQMA 3ZJYA 2ILVA 3NTVA 3X1YA 1HYGA 1W2WB 3AKZA 1FDWA 2JIBA 1PX0A 4DTIA 4C4TA 1ESDA 3JD3A 3CZMA 1E69A 4OM7A 2H7CA 1NAIA 3GU3A 5JNLA 4GP7A 3BTOA 1OWOA 5KJFA 3UB3A 3G9UA 4DV3B 1MJFA 2UZAA 2VTEA 4QYWA 1WXHA 4MTCA 2P5TB 4RD0A 4N7JA 5E3JA 2OWDA 2F7SA 2QN1A 2O8EB 1QTNA 1TM1E 4CE6A 3GK3A 1H1TA 4NESA 3UWPA 2I6FA 5LMNB 1B0PA 3UC9A 1JT2A 1N0WA 3RK0A 4KR6A 3GDGA 5FBQB 1OWLA 5H59A 1J8VA 3HY4A 3L0OA 4G86A 4WK2B 4D56A 4HAVA 4I19A 2REQA 1BHJA 2ZRAA 5E4FA 3WADA 4AB1A 1IBMB 1K8ZB 3BE8A 4Y9TA 3I2GA 2QRQA 5HQ3B 3OZXA 4YRSA 2ZU6A 1AO0A 1T6XA 4TUYA 4LTDA 2YL2A 3SJUA 1XOIA 3SMVA 1B8OA 5DGDA 1RXIA 3Q6NA 4EGQA 3D1LA 3SJBA 2UDPA 3TW6A 3R74A 4S24A 1KF0A 1ECLA 1P7PA 3O4HA 4TROA 4C9BA 1CX9B 1I4DD 1BXRB 2HI0A 3B1FA 4QJ5A 4MRRA 4YALA 1PS0A 4TKLA 4EO9A 1V1MA 4L51A 3RYCA 2VNHA 3SS9X 1GPWB 4ME6A 1Z2OX 1U8EA 3ZWBA 4AO6A 2OENG 2Q46A 3MF4A 1AMNA 4Y1RA 3FZEA 3KYJB 1E79D 4HXFB 2GDZA 5BSKA 1R6XA 4C03A 1KVTA 1DAIA 1GT91 2AHOA 2QQFA 2V3CC 1VCOA 3HCPA 3OCXA 3H9GA 1XNGA 5CCDA 5FOVA 3PDIB 4Y2QA 3T38A 4NEQA 4GF5A 1UC8A 4B8YA 2PGDA 1U2GA 1QV9A 4MP6A 5K0SA 3HSYA 2CZQA 1AB5A 1E6WA 2CJFA 2FMXA 3PCXA 1G0OA 3SIRA 3LE8A 3WHIA 4F84A 2GZHA 3OETA 4LTMA 2ZB8A 4MAFA 4UVHA 4C4XA 3K0KA 2WE7A 3LVFO 5G1OA 1WVMA 4A0SA 5GIOE 1SCNE 3QGMA 3DAGA 3FGNA 1E63A 3HRHA 1DAOA 4BNJA 5DP2A 4PAOA 3CR7A 3PQ6A 4UC0A 1FYDA 1NV9A 3R20A 4O2AA 4OU4A 3ZD9A 5F4BA 2F3RA 1AHNA 3ZQUA 5CXQA 4YRDA 3KQPA 1Y33E 3IB3A 3RRJA 1KK1A 4G2NA 4BQPA 5IAKA 4HYTA 3FPHA 5BPFA 4LF6B 2BBSA 1L4FA 3BJIC 4UASA 5H70A 5LUBA 3G2KA 2VCYA 3WFZA 4JKOA 4BZQA 3O8OA 2PZ8A 4NCNA 4XX1A 1YS2X 2W0MA 5C1DA 1DADA 3E3LA 2Q5IA 3HB1A 1KYIA 4OHFA 1E58A 2HYIC 4E22A 2IW3A 4PLVA 1UEXC 2NW6A 3LX5A 1MV5A 1MNAA 3V4LA 3NHKA 4CMKA 4CMIA 3BXPA 4IYRA 3VPDA 3JVEA 4D41A 1IPEA 3ZYZA 4JJKA 4EHBA 1LDBA 3LT5A 5L6MB 2ZJZA 5GQSA 4A8JC 2A1TS 4QUDA 3U1TA 3W5IA 1PGJA 4F56A 4FEEA 3ERCA 4IOMA 3KJFA 3OFVA 3ANNA 4Z54A 1WW2A 1EGMB 1CY8A 4BQIA 1R18A 1KJJA 1YRQA 4RHUA 1IJFA 1NKVA 2WWIA 2XUPA 3BN3A 3TOCA 2ZVDA 1Z6TA 2QX9A 3VU1A 4BMZA 3AR7A 5KYXB 4ZRDA 2VHVA 3BZBA 2JHFA 2A0KA 2XQKA 4LKOA 1VKRA 4CGYA 1AC5A 3BBLA 2BKXA 1D6MA 3IPXA 3UOAB 3PUJA 4YMVA 5L3QA 1RC1A 1I1OA 2A5FA 3P9QA 1PX2A 3QJYA 4K26A 2HLDD 3C7AA 4LJ8A 3C98A 5C7OO 4DLYA 2WM2A 1CQZA 1I01A 5EPEA 4TMXA 4RV5A 3BWYA 1O0CA 1VYHA 1XPRA 2YJ4A 2WNHA 2ZKIA 5AO9A 2ZTMA 5L7TA 2HA2A 1G2IA 3JY6A 1R3DA 4ZFNA 2DETA 3MIZA 4F91B 4WNYA 1OI7A 1RLOA 3G5LA 3DMFA 1B73A 1L5SA 1MPTA 2AOXA 1UBCA 1MPXA 4GM4A 3U44A 1M0WA 1UINA 2VNJA 5T8KC 3A1EA 2QZ4A 3WLQA 4J3FA 5KQMA 1ISMA 1TTHA 2C2BA 4EPVA 1X7XB 2WVHA 4Q4HB 2W6OA 3DOEA 4JV5B 1TZJA 2K2QB 2PH7A 1NM5C 2BJHA 2XNDD 1GQOA 1KDVA 3TI9A 2G25A 3UMGA 4NARA 1V45E 4HG2A 1NBOA 4D4IA 1JTVA 1QHSA 3DS8A 5KNCH 2QXYA 4DR5B 3T3OA 2PX6A 3V1NA 3OE4A 3ZR4B 1SZDA 1GGJA 1QH9A 4V0RA 2FGKA 4BLPA 1NVMB 1XIVA 2C03A 2YICA 2H18A 2BHSA 2ZSUA 2JBAA 1N6OA 2V6FA 4WUTA 2GB4A 4RABA 5JYEA 4J6FA 1KAOA 2CNNA 1YA6A 1QIMA 1EHIA 3K6KA 1QFJA 1IH8A 2UYQA 2OZLA 1C9DB 1KAEA 2PUTA 4K05A 3V8EA 3VRHA 4H3KB 4RSGA 3BMNB 4V03A 3F3YA 5AOAA 4C29A 5KDOA 3IESA 3UWMA 4YDHB 3Q3GE 5E9AA 2P9QA 3CNQS 3ASUA 5BWNA 3F2VA 2QUBA 1T0PA 1SNYA 3PWTA 2PRZA 4N5MA 3ABIA 4WZZA 4XLZA 5CM2Z 1T1RA 3AYZB 3E9YA 3FMPB 2G6BA 5CX1A 5F5LA 1DP4A 4L27A 4YRAA 1ZH2A 3EEYA 2HA7A 4ZAXA 4DJDC 1PTJA 4M0PA 5IG2A 1VRVA 2HU7A 1NASA 3MOGA 5AQEA 4GOXA 5KX5B 3IERA 2HOQA 3FUUA 1WDKA 1E18A 4LBZA 2VAPA 2AC4A 3UB4A 4K0RA 4HB0A 1OYOA 3RYFB 3KDAA 2GYUA 1HQYE 1OYVA 3RFXA 5EERA 1QF6A 4OOEA 1EINA 4AUNA 2O3SA 1IZ0A 3CLUD 4DRZA 3AKCA 1AT1A 3HJUA 1VSTA 3UJDA 4D99A 4LFAB 2Q6IA 1ZNWA 1XTBA 4ZDKA 4QD3A 3PFHA 4BTVA 1K8QA 1YI1A 2XLCA 3GNTA 4PYQA 4HEA6 1XPJA 5EE0A 4C7KA 1YBAA 4S1VA 3WBFA 1K7XB 1K6IA 3A6PC 4Q05A 1KI7A 1MP0A 3OURA 1W48A 2QQEA 1PFKA 4MQFA 1RNLA 2I4IA 4U0JA 2D1YA 3O1HB 1LV7A 3DZJA 3PJDA 1A2QA 1YBFA 3QX9A 2QRVA 3CUEF 4ZQEA 3EXEB 3MUOA 5B57C 3GLGB 4X3PA 3STYA 4Q0MA 3SNHA 3WE7A 3EW7A 1ICEA 4ILEA 3I8SA 1XMXA 2WVAA 4KV9A 4Y7DA 4FJ0A 5FLKA 3SXUB 1U2TA 1L1EA 2P0EA 5CA0B 1XP5A 1JAYA 1H3FA 2E89A 2ZWAA 3CN9A 1L7XA 3FR7A 3W3AA 2Q1UA 4W1SA 5ICFA 1T3GA 1SC6A 5ECYA 5LKAA 3PEYA 4P08A 5CK4A 1GEGA 1EWRA 1Q0RA 2XW6A 1RLMA 2NUTA 3DEIA 1N5KA 4E6PA 1YQWA 3G13A 1NF3A 1DEAA 2O19A 2XQIA 2WAAA 3PXUA 2RKOA 1K5PA 3EXHB 5FUVA 3ZZ0A 3OO0A 4W7SA 1RHJA 1BAPA 1NATA 2YIMA 4KQ6A 2PT6A 5BMVB 4UHBA 1ZCFA 4DLLA 3MOSA 5J1TB 5BRAA 2YYYA 3EVFA 2XVMA 2YFYA 5KPJA 4ZIRB 3FTNA 2NZYA 3HKEB 2AI2A 2PLWA 3IHWA 4I1YA 2V0CA 4UZSA 4XQGA 1LZKA 1POXA 2ETVA 1I6MA 4TYPA 4B44A 4W5NA 4WXRA 2IP2A 1Z6ZA 3BK7A 2GK6A 5CB6A 1ECFA 1CVIA 4BMSA 2C2MA 1YWGO 2OM2A 4CR7A 2LD4A 4CM7A 1E94E 1YKFA 2I2DA 1YZ3A 2F4VB 1NDHA 5K3EA 5AW1A 4PWZA 4KMMA 4OG2A 1KR2A 1WDWB 2G9UA 4KJXA 5BWLA 4FN5A 3R2JA 2G07A 4JHXA 1UBNA 3WDLA 3HADA 1EG7A 5I01A 1S2MA 1T8WA 5J40A 3BWDD 4O1IA 4RTNA 5EKSA 5TQJA 2QV0A 1E2FA 4O4HB 1TEXA 1F8YA 1V8ZA 1T2VA 2NO5A 2GBLC 3L7KA 4DM4A 2BFCA 5HR5A 1Z4IA 4B32A 2QSUA 1EFPB 2IEYA 3M4JA 2NU7A 4WFKA 4PZZA 2W2LA 3UHAA 2JD1A 3HFJA 5K7SA 1EEHA 4W5OA 3T0FA 4OX9B 1A8HA 4NDNE 2E9SA 3EVTA 3I01M 2C5BA 3NKLA 2CF6A 3CNNA 4RD2A 3ZUGA 3A4YA 2JIOA 2IL1A 2G5TA 2RHDA 5DX8A 3GGDA 5BNTA 1XX6A 3DKIA 3DW3X 4JYCA 3UZUA 4EJSB 4EECA 1KFCB 4DYVA 2B2NA 5JNRA 4NK5A 1UF9A 1TKBA 3AKDA 1Q14A 3D4BA 4UHHA 3WISA 4XVQA 4TVSA 3EGCA 4QUIA 2D74A 1XYVA 1HK7A 2PUDA 1IVNA 2YN2A 4ZRMA 3OEYA 4YNBA 1XSEA 1C7RA 3GP3A 3OX2A 4DTCA 5GZ1A 4JY7A 1LD3A 3KELA 5AK0A 5K6AC 4GP9A 3QZUA 3TLAA 4XD7A 2Q7OE 1AQUA 2IH5A 3M3PA 4DM3A 3DDHA 5ER9A 2OZVA 4G5SA 6AT1A 5IFLA 2H08A 3WXMA 1E96A 1GYQA 1EFRA 3DMPA 1DKPA 4YJFB 5HVNA 2JG3A 4BFSA 2GILA 3EC7A 1UWKA 4JVLA 4PX9A 2I7VA 1QH1A 2XYHA 4J8PA 3OMWA 4M87A 1FUYB 1HTWA 1MT0A 4WD3A 1FUIA 3IT2A 3V1TC 5KMGA 5ALEA 5DSXA 3ZY3A 4EW1A 1YZYA 1GFSA 4UBMA 1CRZA 4MVJF 1H2EA 3U3OA 4JI4B 1S96A 1E4EB 1QV6A 1K92A 2HPVA 2WAXA 4LZWA 2PSDA 5L3ZA 2WFLA 2DAPA 1Q83A 1I3MA 4O29A 3HJCA 4BWYA 3QG1A 4R1OA 2Q28A 4UDOA 1HM5A 4B6PA 1IXSB 4DCCA 1WEKA 1SB8A 1BFDA 1TU3A 4UVGA 5AKHA 3TR5A 4UOEA 3JZDA 5HOQA 3CA8A 2WU0A 5AK5A 2Z3WA 2H51A 2V65A 4KL8S 1SG0A 4KQFA 1CK4A 2O06A 5HKOA 5AM0A 5CM9C 2QJWA 1GXSB 4NJOA 3BBPA 3E5MA 2WIBA 4M89A 3RJMA 4IIVA 1OBVA 1OLXA 2Z9CA 3KS9A 4N5LA 2H11A 3LKZA 4P22A 4JJZA 5JC1A 2XTMA 1M1UA 5FD8A 3NH6A 4AX4A 3JATA 2X42A 4Y1EA 1TUBA 1TPYA 2GCIA 2I4TA 3MLEA 1CUAA 4IDGA 1GG2A 4XCXA 4XCVA 2X7JA 3L8CA 1JALA 2DR0A 2G7MC 2VRCA 3KAQA 3ADDA 3ZW9A 4NZMA 2FZGA 1QHIA 4PX2A 5DLDA 1A2BA 1E6LA 4U7GA 4X8MA 1K4YA 5EP2A 4EF6A 1DIAA 1QH8B 1Y98A 2XGOA 3IQWA 4S3MA 1JJAA 1QK5A 4Z0HO 1YFZA 2G7ZA 1AKVA 5JC8A 3PHCA 3QLVC 4OYRA 1HE1C 1PW5A 2C99A 5AHOA 5SYMA 3RU9A 2EX0A 2PUAA 2AZXA 1J25A 1B00A 4MPRA 4L16A 4QUAA 2YFKA 3GVPA 5JJCA 2C5GA 4HDKA 5LMUB 5CJJA 1C41A 2QP3A 3AF3A 4HLNA 3TM4A 1RJ9B 2C7BA 3N2KA 4F3YA 5KAPA 5TQ2A 2B30A 1RAHA 3C6BA 3TKYA 2FJUA 3I01A 3ZHYA 4C7MA 5EXSA 1U8ZA 1NLMA 3F4LA 3A06A 3ORYA 1EDBA 2WM3A 3KWFA 3VDXA 1WXXA 2FFQA 4YWHA 4YA6A 3ZVKA 4UPEA 3EVDA 4NBTA 2X7HA 4LPSA 5A5GA 1ZOIA 5E7QA 4I5DA 1POWA 1Z06A 2XPCA 4K6FA 4HDMB 5AKEA 3E9EA 3HB5X 1JHMA 2DCMA 5D6NA 5AOCA 1LPMA 4EX6A 3ZVLA 5C1OA 3EIQA 1HMPA 1NDUA 2YWCA 3OQJA 1G64A 3C5HA 2CXSA 4AG3A 1VXRA 3G2PA 2GKOA 4O02B 3JALA 3P20A 4FYMA 4RIGA 3UT5B 4RHCA 2O05A 4AMUA 3TTUA 2ILTA 4Q03A 5B3JA 3AVVA 5KOIA 4BVBA 5KB3A 2HMSA 2Q0HA 3JZIA 4U7FA 1FU7A 3AVTA 4BLOA 1ZJYA 5JYBA 3ND5A 1RW4A 1NVUQ 4G56A 1DBQA 1M2FA 4YBZA 1FW8A 4N5NA 3ZJ4A 3OZAA 4PQGA 1M66A 3RM3A 1C8LA 5HBGA 2HEIA 2I76A 1G8FA 3CUSA 5B1YA 1B8UA 4AWXA 2J59A 3CZCA 3DEAA 2QTTA 2VRNA 4GX2A 3TZ6A 3RUDA 5BYAA 1NPYA 3D0OA 2ZPAA 4ETNA 1K06A 4C04A 2WQZA 3ZIDA 3D6TB 2VYVA 4NMXB 3B48A 3OQBA 2AWOA 4RNDB 3WIEA 4BIIA 3HY6A 2C77A 2OXIA 2IU0A 3T3PB 3VR5A 1AQNA 3GEGA 3RC9A 3A32A 3IULA 4CHGA 3G2OA 3VC3A 3CNLA 1KO8A 1YCFA 5DYYA 4DGQA 2WWGA 2F3TA 3O03A 1ABFA 4D26A 3KNZA 2G1PA 1RM5A 1IE3A 1YD7A 3I34X 4FUTA 2EWVA 3OAAA 4JVSB 1SVNA 2XIQA 2ZRGA 3FWHA 4QUHA 3DVAA 3L6UA 3FH0A 1U4SA 3WIOA 3WGTA 3TD2A 1U0SY 1Y8QA 3G1WA 5E3HA 5BOSA 2A4MA 5ICMA 3RUPA 3DEZA 4HWTA 3UHPA 3FFBA 4EB3A 4R8SA 4LRUA 2ZS8A 1M8JA 2A59A 3ZCPA 3ZW8A 4R2JA 1T9ZA 4X20B 5IX8A 3TL3A 2AF3C 2BKUA 1Q7BA 1K88A 1Z5WA 1FFHA 1KJIA 2HDWA 1RHUA 2Q1SA 1HOXA 5E6UA 1TCCA 3AB8A 5C37A 3ZWWA 7ADHA 4ALNA 1U1IA 2JGDA 2P3QA 5HUJA 4ZU3A 1BRMA 3KG2A 1C9YA 1JQAA 3WJ7A 4G01B 2ODWA 5FL7A 3NX4A 3MCWA 2CCGA 4YRJA 3RR2A 4GWGA 2J48A 3UXYA 2JI7A 4KIWA 4WZ6A 3LK7A 4XOUA 2ZPTX 1E0KA 4IO1A 5DSTA 1AMUA 2BTOA 3H11B 4Q48A 1H2ZA 1Y5LA 4XPIB 4JX9A 3WWDA 1WA5A 2BEKA 2QEQA 3FKSA 4G2TA 4ND1A 3ZHVA 4URXR 4P83A 3ZJVA 1FY2A 3BGWA 3GJ3A 4KAXA 1OBCA 2XH8A 1KIFA 1TJYA 4MMZB 4QLAA 5T4BA 1GL3A 4TKMA 1ZRNA 3DCNA 5AVRA 2XBMA 3ZLTA 1MTOA 2IOHA 2BHTA 4GOMD 4V0KA 3KZMA 2I29A 2CJPA 2OLJA 1XMOB 1ZWLA 2YS7A 2Q2WA 3HXOA 4C3ZA 3PIDA 1WCWA 1RKXA 1I80A 5A3JA 3TL2A 4J07A 5CJPA 2IFTA 3GJ0A 5CR9A 3IR6A 2JFZA 3CZQA 4IZ6A 5TQ0B 1XMVA 1T5TA 3UCFA 2XECA 3WYFA 4Z99A 3J81k 1GZ6A 1NU6A 1VE7A 2PKCA 3GLFA 3SHQA 1XTVA 3NDPA 4URHA 5HQ3A 2EKLA 1K3TA 3EVAA 3G0GA 1URPA 5EL0A 2QGNA 5B5SA 1SD1A 3GH3A 3D7KA 2C83A 2IPAB 2O48X 2ZPUA 3AHEA 1FNNA 4GX5A 3FFWA 3BILA 3L01A 3O73A 3TJZA 5J2TB 1CDDA 4DIOA 5JRJA 1D9ZA 1XA3A 2E82A 2O1EA 2WU4A 3JSXA 3OKCA 3IKTA 1LRJA 4HQOA 4HEA1 5B3AA 1QDEA 2PBFA 1XNQB 2VPPA 3WKDA 2R6AA 1GLVA 2PL1A 1YGYA 3MJTA 1BKSB 4R9SA 4BVAA 1OFHA 5JATA 4N7BA 5LNK6 3E3NA 1UFOA 4W8OA 1DAGA 5A4IS 3TG2A 1FXUA 3CO5A 1NBAA 2X3FA 1I24A 4B2LA 4A0GA 4Y6RA 3WMRA 2VQFB 1QIDA 3LSTA 1FFDA 2EJTA 1YZGA 4PPQA 3RVBA 5K0BA 2PGXA 2W11A 3H8WA 3IBTA 5G41A 5THXA 1X1SA 3VR6H 1U0OC 4Z1MD 1WB9A 3QEOA 1BJRE 1FDIA 2DPGA 3E05A 4UE2A 4BVLA 1CETA 3NS7A 3SIXA 1RFLA 3K9CA 2P27A 1XRSB 2HBQA 3RO7A 2H6EA 2O7VA 4QLBA 4BX2A 1OGYA 4OB8A 4LXGA 4EKNB 1JDBB 2YZNA 3UH1A 1QC5A 3LXXA 2AKAB 3BF8A 3EDMA 1VCHA 4A7PA 3OPNA 4ANFA 1Z26A 4DC9A 5DWQA 3JTMA 2WSSA 4FFWA 3FETA 2C7VA 2PRJA 2DB3A 3CONA 3DT9A 5BUZA 2HCBA 2IC5A 2R7NA 3WA7A 2ODBA 4LXTA 3CVXA 2FE1A 4QOJA 1NQWA 3ZLJA 4BO3A 2AG1A 1WQ3A 2R11A 1FTSA 3HKDA 1U04A 4LY9A 4WERA 5DNEA 3NDIA 4X0EA 3CLUC 2DZDA 3UJ3X 3VJMA 3ZIAA 1AHPA 3U6BA 1EVLA 1Y1RA 5CYFA 3E22B 2WWYA 1WW3A 3UJBA 1IQPA 3FF4A 3OT1A 4JL6A 2J7PD 3KKMA 5E2AA 4IEEA 4M98A 1SBZA 1VIAA 1F5NA 1B6GA 2OCXA 3ZWDA 3O31A 1RJEA 2W2MA 4JELA 2WJGA 2CHEA 2X22A 5B2EA 1RCTE 1YACA 1WWKA 4OLHA 4DQDA 5GOTA 5CG1A 1C7ZA 1C3XA 3ICEA 3JQ9C 4QDKA 3ET4A 4RIIA 1E2UA 1EAYA 2P9BA 2O5EA 2DTEA 3QVUA 4US1R 5B7PA 4FYVA 3NB0A 5C0OE 5ES4B 2INGX 4K9RA 4WVFA 4QPCA 2PMWB 2BZGA 3QPVA 1ODKA 3MINA 4M37A 4NDZA 3OF3A 1R50A 3HZZA 3QV2A 4MQ4A 5C46F 3QFFA 3JTEA 4M1KA 4RF5A 3RSGA 1T43A 5LP6F 4RYLA 2F6RA 1JLMA 2CBXA 4L4UA 2C97A 1XZJA 3BWVA 2C88A 4EY6A 5A04A 2VT6A 5TS3A 5KYXA 3C1TA 3NV7A 1Z4LA 4FYIA 5ALOA 5JMWA 1IN7A 2I8AA 1VBNA 4IICA 1CT9A 4BZPA 4CT5A 1KOJA 4YRZA 4RZIA 3G2LA 3R6GA 3SBEA 2PXAA 1PFUA 3TINA 3KXIA 3H84A 3PWZA 3FNIA 3GJYA 3FWNA 4JUCA 1BW9B 2GXSA 4QELA 2H3HA 1JP7A 4R0NA 2AUMA 3C1UA 1MDBA 2JJ2A 1RJDA 3QLJA 2MDTA 5FPHA 3JYNA 3WSVA 3H9QA 4Z9AA 3GIWA 1BHQ1 2NPIA 4FK8A 4D74A 4AWBA 1XT6A 5BXQC 3OJFA 2Q3LA 3BICA 4X6YA 2BM0A 3THOA 2A84A 4PYKA 1KVUA 3EQZA 4GKBA 4R7ZA 2ZOSA 4C3UA 3EPHA 3V46A 1A82A 2BI4A 2XB9A 5E7IA 5KTNA 4KLRA 1PWYE 1T1EA 3EIUA 4CG2A 3PIIA 1QZTA 3HZOA 4HFNA 5IMSA 3EZFA 1T1GA 2VZ0A 3L8HA 1N5OX 3ZWMA 1CQWA 1EP9A 3TQOA 4I8DA 2R6HA 2ZYHA 1X7XA 5KOJB 1Y8ZA 4LAFA 3ZWCA 3F8SA 3GUCA 3HGMA 3NQ41 3JD0A 3WGLA 2O8EA 2DWQA 4A5OA 3BRSA 2GJ8A 3NC0C 1LH0A 4YUXA 3VOBA 3H97A 3GRKA 3ONVA 1N2XA 4DF3A 1L1FA 4LJSA 3C5WP 4CMJA 4FEAA 3MYYA 4I2NA 1F2VA 4UTPA 1ISPA 4KMRA 3Q7IA 3RVMA 1RWOA 4AO8A 1M1ZA 4HATA 4R84A 4F9EA 2D4HA 4TZ0A 5EG5A 3BMNA 5EJGA 4BLSA 5JSUA 1KU0A 4KH0A 1UODA 1YI8A 3IMFA 5TPWA 4F5WA 2J1LA 1C4OA 4V0QA 3PJEA 1PVOA 4UOQA 4HGQA 4V39A 4EF5A 2AW3A 3KKEA 1VXOA 2P75A 5A9SB 4ZT6A 5C5EA 4EA6A 2QX8A 4LYYA 2ZVQX 2VZ9A 5ILOA 4LY3A 3HABA 3ICVA 4MYRA 4FOTA 2C54A 3OMLA 3QWBA 2JDIA 3BXFA 2A78A 2FKNA 5GZ6A 5HXAA 1A7JA 4HUTA 2J0QA 3IT0A 2PSHA 3L0YA 5K8VA 5KX5A 2I0FA 1W4AA 1U9CA 3SIPA 4NNOA 3D2CA 4YT2A 3I2HA 4TMWA 4TQGA 4CTKA 1BA3A 1EVIA 1JHAA 5I4KA 3C3YA 4J29A 1W44A 3DPUA 1NZJA 3PGKA 4I6JA 4NENB 5KCMA 2BTEA 3RYFA 1E2KA 3O91A 5AI0A 1YQGA 3RVLA 5JPDA 2R62A 3ZCTA 1MO6A 1T6YA 4P58A 4C5AA 1EXVA 3RC7A 1J09A 1PJ4A 2WRZA 1XLUA 3L4SO 4WACA 3F5SA 4MS1B 2CLCX 4A15A 3G6WA 1Z5PA 2DFVA 4UD2A 3K5PA 4GMFA 1WP9A 3RS2A 1NOIA 2R8XA 1VKNA 2WILA 3HBJA 4KRGA 2ZRQA 3N5KA 1QIEA 1JQBA 1TXGA 4RQBA 1JEEA 4DUYB 5EJ8A 5D3QA 1OXSC 3AUFA 5EE3A 1V11B 3TNDA 1KDTA 2RGRA 2QE7A 3H9JA 2GGSA 1R0KA 1NXTA 1OCEA 2W2VA 4EO7A 3EXEA 1OWNA 4WHMA 4F71A 4Z7NB 3GLGA 4CU5A 3KE9A 5IYZA 3LGXA 1B8NA 2HL6A 4B80A 5CA0A 1USWA 3ONEA 3UAYA 3OZ7A 5JPCA 1EMDA 4Q3BA 4HGZA 4E21A 4C5BA 3E8XA 3RW9A 4DXAA <