4I8IA

Crystal structure of a duf4886 family protein (bacuni_01406) from bacteroides uniformis atcc 8492 at 1.50 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
b'DTIKVLAIGNSFSQDAVEQYLHELGEAEGITMIIGNMFIGGCSLERHVQNIRNNAPAYAYRKVEKDGEKTETRSMTIEKALADEKWDYISVQQASPLSGIYDSYKASLPELVNYIRERIGKETVLMMHQTWAYATNANHTGFKNYDQNQMKMYTSIVDAVKKAANLVGIKKIIPSGTAIQNARTSFIGDHMNRDGYHLDLTIGRYTAACTWFEALTHRNVTENPYSPEGIDPIHKKAAQMAAHNAILYPDKVTELTELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BACUNI_01406) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
total genus 92
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16227 DUF4886 Domain of unknown function (DUF4886)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4i8iA00
4K3UA 1V2GA 1WABA 1JRLA 3DC7A 4HYQA 2WABA 3DCIA 3MILA 3DT6A 1BWPA 1FXWA 3RJTA 4NRDA 1K7CA 4S1PA 1FXWF 2W9XA 3DT8A 4JJ4A 1ZMBA 1BWQA 1ESDA 2Q0QA 3BZWA 4K40A 3U37A 4M8KA 3PT5A 5CD9A 5BN1A 3SLRA 1ESEA 2Q0SA 3SKVA 4XVHA 4OAPA 4Q7QA 1IVNA 4TX1A 4JKOA 3KVNA 4JGGA 3C1UA 1DEXA 1VYHA 4IYJA 1DEOA 3P94A 4Q9AA 4JJ6A 1U8UA 4H08A 1ESCA 2WAAA 4RSHA 4PPYA 5JD3A 1Z8HA 4DEVA 5HOEA 2HSJA 2VPTA 5A4AA 5B5SA 1YZFA 1VJGA 1PP4A 4HF7A 3DT9A 2WAOA 4K9SA 2O14A 2APJA 4RW0A 3HP4A 4K7JA 4LHSA 4JHLA 3W7VA 1BWRA 1J00A 4OAOA 4I8IA 1ES9A
chains in the Genus database with same CATH superfamily
5AJYA 3ZTWA 3KXKA 3ZPXA 1QNFA 1J0AA 4MYDA 4UUQA 1ZC3A 5HBGA 3TVDA 3QFRA 4EH1A 1HFWA 1HE1C 1X38A 2H1LA 3D7KA 1JMKC 1EGMB 1U02A 1SOVA 2XGMA 4B4OA 1DAGA 3K71B 2WHEA 5LLDA 4KO2S 4U2BA 4WFIA 4AQYB 1E6EA 1XVUA 2W2MA 1IN5A 2IYNA 3EGIA 2ZYDA 1NOJA 3BSWA 5E1DA 3SCZA 1JYEA 2Y92A 3WL7A 1G6Q1 1O95A 1CE8A 3NH9A 4J0GA 2YJ5A 1B6TA 1DKNA 2FSIA 1WO8A 3Q3IA 3F6YA 3QE9Y 4YIHA 5LYJB 2OKGA 1JR6A 1RHRA 3MQFA 1Z5WA 1SB8A 2DZDA 2WB2A 4OI2A 4M60A 4TRRA 2Y1FA 4RH3A 1ATIA 4PCAA 3H5LA 4NSNA 3LV8A 1WHSB 2W6PA 4DMRA 4AJHA 1UEXC 2QQFA 4YUAA 4R16A 1RCUA 4JDPA 3Q8MA 4DYVA 2P9JA 5JZMA 4OHPA 4XDYA 1UOQA 1RQPA 1RYFA 3F71A 1X87A 4PGGA 2OFPA 5DISB 4KJXA 2FGJA 4Z2AA 1OVGA 5D5PA 1EDBA 4Y2JA 1NUHA 3K8OE 4L8LA 4N5IX 2R4QA 3VUFA 1PT9A 1A8QA 1Z5NA 9ATCA 1EWVA 1R8QA 1GLNA 3EZXA 2E4AA 2VT6A 4XVHA 2YC2C 1UZNA 1Z7YA 3K1YA 5JSHA 5BNIA 4MUJA 3GQBA 1E2PA 3AFGA 4GE3A 2BMWA 5IJXA 3GLGA 3AH8A 1TZ2A 2G7ZA 4V1CI 4EY6A 1OB2A 2A1TS 1V8PA 4Z1MD 1TADA 1YNSA 3L7YA 4NY1A 5AI6A 4CKBA 1USIA 1AQYA 1M7HA 1GN9A 2AX3A 3LX5A 4KKVA 3WB9A 5CXXA 4RTNA 3GLQA 4TMFA 4ENVA 3NBZC 1P4SA 4PBSA 4R40A 3RHSA 3V4SA 4EO9A 1JTEA 4UTPA 2BHSA 4L5YA 2J30A 1DEHA 4JOBA 1IUPA 3ESXA 1IDOA 3SX2A 4PLFA 5BQOA 2CYCA 3A9UA 1P39A 2JEYA 4IDHA 2JCGA 4OUDB 3K92A 3U31A 4BFTA 4JV5B 1ZKMA 3C8DA 3OU7A 2ZPUA 4HATA 1T91A 1FLDA 1MEJA 4F12A 5K2OA 3MRVA 4YYEA 5TGTA 1TDJA 5LZ4A 4GLLA 3LZCA 3KFVA 2QRLA 721PA 1DV2A 2YVLA 3EZ7A 3LNCA 2VRCD 4UTZA 2GK6A 5BNTA 5CCEA 1WQ3A 3GDWA 2QR5A 4RY9A 5HOQA 1DLJA 4E03A 2X8AA 1P1KA 2W5UA 3NOXA 4BLPA 5JDIC 4MHTA 5EUBA 2XZPA 1GRQA 2OMEA 2WUFA 3M6FA 3PTLA 4KRGA 3TKYA 1HQKA 3C5WP 1SC4A 1WVMA 5K7SA 1ZK3A 2FWIA 1J8MF 3K0CC 1NVWQ 1Q7TA 1EVQA 2C20A 1SHUX 2IIQA 2OBLA 3PSAA 3ONEA 1YTLA 4YONB 1C9KA 3HEBA 5DLDA 5AWFC 5FLXA 2B8TA 3IV7A 3PEWA 3IFSA 2QRGA 5HDBB 3RFXA 3MQ2A 5FI3A 6PFKA 3SMVA 3SQLA 2C78A 4I4LA 1SIOA 3EZLA 5DM0A 1CQPA 2FSHA 3L7JA 4HZGA 5IKMA 2JCYA 4DS3A 4F9TA 2QPTA 1J23A 2MR5A 1JQEA 1K06A 3C3CA 3D6MA 1P1FA 2BHLA 3H8SA 3HCPA 4R69A 4BLOA 3ELDA 2AH5A 1PJAA 3CWCA 3RVNA 3SXPA 5LQUA 2WF9A 3T1OA 1MZPA 1YDWA 2IOQA 4HN9A 2JLSA 3EY9A 4YUVA 1DJPA 2ODPA 2P9HA 4MLPA 3R4VA 3F8SA 3SEFA 1US8A 3B9PA 1BWSA 3KYJB 1ZX1A 2WSSD 3I5UA 3RT1A 1F8YA 1QC5A 5CK5A 4OHBA 3A6KA 3I6ZA 5EIHA 1Q7BA 4BCDA 3ETDA 2H4HA 1L8QA 1QHFA 2R8EA 1CDZA 1K6EA 3FIUA 3L1UA 3OUUA 3KWJA 4L57A 4ZTUB 3HA3A 4QJ3A 1KYQA 1Y4SA 1KK0A 1O2DA 1PBTA 5CB4F 4JVSB 4U7GA 3OE7A 2VBGA 4POOA 3VGJA 2OFWA 5CH3A 1MENA 2ZSKA 3ORFA 4NYIR 4BFXA 4F5EA 1NE2A 3VPBA 1AHIA 2C5HA 2HEGA 3BH0A 1PWZA 2W6IA 5HPYB 4IGFA 2H1SA 1R9NA 4I55B 5GPBA 1WPRA 3E7XA 2C0QA 5ESWA 1COWA 3RU7A 1IHXA 4YCDA 1Y6GA 2I3DA 3A2MA 3QBVA 1T4GA 3V8PA 4F8YA 1X7WB 1PEYA 3UFXB 2XB4A 3RSLA 1IY9A 1GRCA 1YDFA 1FDIA 1WCV1 2G5PA 1H2HA 2EIHA 1Z5OA 1DDOA 5IARA 1PG0A 1YDMA 2DP4E 4YI5A 1TM1E 4UM9D 1VMKA 1OJ7A 1OT5A 4MROA 3BH7A 4OXNA 3MC1A 2JI7A 2V59A 3INNA 5BRJA 3TGWA 2HIGA 3CISA 2JGRA 1YMVA 3K8QA 3ECAA 3ZHSA 1OAOA 2IY7A 2VP3A 2XYRA 2W0MA 3HKBA 4DSNA 3GH1A 2IE0A 4UJ3A 5GGXA 3ZD6A 3PC4A 3DKRA 1MZVA 4GRAA 3DW3X 5AJXA 5HG0A 4DSUA 1Q95A 1P0IA 5ED4A 3NHBA 2Q2WA 1UBTS 5DNVA 3MOSA 4A2PA 1DAKA 1S9HA 1ZYUA 2ZJBA 3EFBA 3E3MA 4JJ8A 4JLSA 4Q4HB 4YFYA 1HR0B 5CCXA 3QMWA 1QKIA 1A3CA 3I52A 3ER6A 4ZZ0A 1Q1AA 4WLUA 3TQFA 5ALRA 4DABA 3PF9A 1MCZA 3DVAA 3URKA 1R66A 1AA6A 4Z2YA 1IUOA 3P2EA 4LXIA 4X1IA 1JQAA 3KUKA 3FKSD 2G04A 3OTQA 4ZZIA 3EX7C 1EWYA 4ECAA 4JUDX 2EW2A 5A4DA 2NUBA 4M6WA 1NFQA 4QICA 3WP1B 2CLEB 2H7YA 3BFXA 1DBVO 1YZFA 3T5BA 4F3KA 1KEEA 3EW7A 4Y2XA 2NPOA 2V4MA 4BNXA 2JK1A 3E15A 3UT0A 1UAGA 2F67A 3F73A 1HWYA 1QVRA 2WJZB 3MYRA 2UXBB 4YUXA 1NI4A 1GNTA 4KEAA 4XWOA 2QU8A 5JTTA 2VUIB 4C4PA 4BPBA 4I5EA 1D0IA 1C4WA 1O54A 3RVQA 4KV7A 1TEVA 2AFHA 2NWQA 3LA6A 4WZBA 3MRTA 3RFVA 3L6UA 4ZICA 4OXKA 2OFOA 4Q7KA 2AMLA 1PVDA 3RNOA 3UMJA 4EA8A 3X1YA 4B75A 2WWRA 1YI1A 1KMMA 2C58A 3A05A 4J7XA 4B6EA 3DMTC 2QMUA 2CMFA 2V03A 3ENZA 3CTPA 1NXVA 4U6SA 1CUYA 3LO5A 3HRKA 4RM3A 1ZGHA 3ZDYB 5B55A 5ALMA 4ZCQA 4J76A 4DMMA 4OY3A 4L8YA 1SD5A 3KKPA 3MT7A 1BTOA 2VTVA 2QXTA 1NBAA 4V2IA 1UBKS 3ZWXA 4ER7A 3MJHA 4NBRA 5M7EA 1CJCA 3MJEA 5FOXA 4BMPB 1XEXA 2UYGA 1L5MA 3GGSA 4KOEC 2G71A 4NE9A 5HF9A 3RANA 1G2PA 1C5KA 4Q9DA 4YRNA 4RORA 4N18A 1NUSA 2IRWA 1G20A 1CS0A 1N1EA 3CVOA 5GM1A 4CF3A 1X9HA 1NVTA 1U9YA 4MQFA 4CM7A 5CFLA 5KJ6A 3L7LA 4EKDA 2PUCA 2UYHA 3L5KA 3BIFA 3QKWA 4FWBA 2XWQA 3B2EA 2C0PA 1XD9A 2FW9A 2ZSFA 3FSGA 4HX9A 1Y4AE 4I1VA 4BJHB 1RJ9A 2CUNA 3O8QA 4GKBA 1FYDA 1XK6A 5DHSA 5A05A 4D9FA 3QYFA 1SRQA 1UKBA 4CMHA 5FORA 2NSLA 3M9XA 3H2SA 3QTLA 3LLMA 3FFAA 1DIOB 4IDAA 3TLEA 4E1BA 2XJ9A 1V1RA 4LSMA 1ENOA 2HDNB 1LDBA 2L0XA 4CEHB 4ZK6A 1Q0RA 1CUUA 2FGKA 3DNMA 1O0BA 1GTJ1 2VNAA 1R0SA 1Q0UA 4QDUA 2J4FA 1S8OA 2VEDA 2QLLA 3QKIA 5AW8A 3W78A 3TTVA 4WN9A 4HNUA 4KHZA 3FFWA 5JJLA 4TTSA 2GI4A 4P22A 3F5MA 1HNNA 1T1RA 2VS1A 3R3JA 3L8HA 4QE3A 4V0ME 5EI5A 3LXMA 5A04A 3NP9A 3H05A 5IUNC 1IUKA 4HGPA 1BFKA 1WSWA 5CW2A 1E60A 5DTIA 1N0VC 1FXUA 5AKEA 3GGJA 4OAQA 1LPMA 4BV8A 2BPOA 3EVFA 5C81A 1A7JA 1EA5A 1IOVA 4RGBA 1R9MA 3CX7A 1QH8A 4HH0A 3C3WA 3RWBA 3ZXSA 3JQGB 4ESEA 2CNBA 2VDWA 2F9LA 3IERA 4M9SA 4DCCA 2W6NA 4G8CA 1NG9A 5AK3A 4GPEA 3KV1A 3DYBA 3E05A 1J97A 4DJ5X 3RR2A 3B52X 3KJEA 4YCCA 4XIFA 1GN8A 4BKUA 4RZUA 3HA7A 1V1MB 1B6RA 1II9A 3AYXB 3HL4A 5LDGA 2IPAB 3C3JA 3TQQA 4HLNA 3HPQA 4E12A 1SCQA 3CONA 2AQIA 2POCA 2SBTA 2WF7A 3IAAA 4AJEA 1RWBA 3DM9B 5LLTA 1EVJA 3DHYA 4FJ1A 2X23A 4K1LA 2BV3A 1QJCA 3DKIA 2NPIA 3S27A 2LCQA 1C2TA 3EWNA 1RRPA 1GA6A 2OFXA 2Q3CA 3C3EA 3C1OA 3L7AA 1WTCA 3MZ0A 4QNNA 5JAQA 3RVKA 1ML4A 1DBSA 1E9SA 2JZOA 3HLKA 5D3MB 1WTAA 3I04A 4HHEA 2HF9A 4BKOA 2JK0A 3IQXA 3M9WA 3G9QA 3ZQ4A 1QK4A 2HGSA 5KJCA 4FFPA 4P82A 5CU7A 3IRVA 4PO3X 5TMBA 3RBVA 1QANA 4TRMA 1YS6A 4QVKA 4XFDA 4DC9A 3KXLA 5DI3A 3OAAD 5IBPA 3Q0IA 4MR8A 3RIYA 1GUFA 2H5IA 2IP4A 1MW9X 3F5DA 5IABA 4L16A 3R8CA 1H23A 3D4OA 1DG3A 1X13A 3PTZA 3MRSA 2I9PA 5TQVA 1DZIA 3TD2A 4TROA 1C1XB 1O94C 3H0KA 4L1KA 2VDUE 3QSYA 1E3JA 1JDSA 1C3OB 1N57A 4OHXA 5ESDA 4DQ0A 1T0IA 3ORQA 3PKIA 1IEVA 2H07A 1YBVA 4LFAB 3M6VA 2WNSA 2OK7A 2WJPA 1NJ8A 4FIDA 1LTKA 1XRSB 3N2KB 3PFFA 3HK2A 4XZ3A 5T8KA 5A9SB 3LBAA 1IZ8A 3IV6A 4CN8A 5IKEA 2VYFA 3NX4A 4RLQA 5FOUA 4GI5A 1OH5A 1D4AA 2OGWA 2LBPA 3PRJA 2ZE8A 1XQYA 2AEEA 1WR8A 2WOOA 3UGKA 1M5TA 3HJNA 1F2DA 2QN6A 1I6WA 4LF6B 1Z88A 2WC1A 3DOJA 1PFYA 1KBZA 4UUBA 2YFKA 4GZMA 2C2HA 4G4JA 1ZAYA 1AN9A 1PR2A 1VJDA 3G5LA 4NCIA 4RACA 3IUQA 1XT6A 3H7AA 3TZBA 1RMQA 1S3SA 1ZVQA 4NH0A 3K1JA 1LFAA 1GM5A 3T3OA 2OXEA 2YHIA 3ZHXA 4M1EA 3QXSA 2AOUA 2ZBDA 3B1FA 3DWEX 2DXIA 1G9XA 2I8LA 3RVBA 3ANMA 4OAPA 4CKXA 4DV1B 2HU7A 3O4FA 4DTIA 4RTSA 1H6BA 2AHOA 1C50A 1L9KA 1AB6A 1KU0A 3V6LA 1L7PA 2EYQA 1U3UA 1J0BA 2QRUA 4LK3A 5AXBA 3WQRA 5M34A 2W58A 4FB5A 2XQKA 4FSXA 3RS2A 3WGIA 4M1OA 4EEXA 1TTPB 1HDGO 2GB4A 4NJEB 3A3OA 4JKOA 4B79A 5IAAA 4NWIA 2OY0A 3K70B 4E6PA 3WWCA 4EB6A 5IT0A 4J0QA 5KQRA 1Z75A 3UJ8A 5FBKA 1UPAA 3K9CA 4Z86A 2BT4A 3TBFA 4I4CA 1C14A 5FPYA 3WWOA 1YKSA 4MPRA 3ZQ6A 5JYBA 1OFVA 1RM5A 2VDKB 1WY5A 4EUKA 2WSBA 1U8UA 3KKQA 1ESCA 4AZ0B 1NXQA 3NWEA 4PYJA 1GPMA 5B6PA 1K89A 1LX6A 4TUYA 2ONCA 2VH5R 1CEQA 1GA4A 3TDKA 5H83A 2C9YA 2H4WA 2ZDHA 3D2LA 3MK31 1G21A 1ATZA 1PJLA 3P0FA 2QS9A 2PXCA 2WSLA 5LYYA 4BO1A 3K05A 3UWSA 2GZHA 5BORA 5KTTA 5CURA 1PCXA 4J0DA 1GG8A 1VCMA 4KL8S 1QMGA 2OLKA 1FY2A 2EXXA 2OLEA 3FPCA 3PHBE 5KCMA 2UDPA 3DYIA 4KFCA 4FNGA 2NW6A 3RUHA 1N2BA 1K8XB 2ZSHA 1R37A 2IOHA 4ZC8A 3EVNA 4K9SA 1E4YA 1KI3A 3E2IA 4B7UA 4DVJA 3CVJA 2YVAA 3LOUA 4RBNA 3ZWYA 5IDWA 2DMRA 2CV0A 2M6SA 2EFYA 1J90A 2JHAA 4C9BA 2J3DA 3ICCA 5EIFA 5EKUA 1ISMA 4J1NA 5JROA 1AS3A 1FFBA 1W4ZA 4J2OA 5DFAA 5JNSA 4ES6A 4KXVA 1JFLA 3A8TA 4ODIA 2N46A 3ZWPA 2NYVA 4EZIA 3GVXA 3B3QA 3I23A 1QHHB 4HQRA 2C4NA 4L0DA 1C80A 3E9NA 2G1PA 3R4CA 4U2DA 3THYA 3P0JA 2HOQA 1QCDA 1RKVA 2RSLA 1G7SA 4FHFA 4IKPA 2HRBA 4Q9LA 2B6NA 1KWGA 2BTOA 2LDXA 4Y2VA 4ZKEA 5HQ3B 3L8EA 4FE7A 1OIVA 1D4FA 3EDOA 3FX2A 1XU4A 3JQ8A 5FR1A 5KHLB 2ACWA 3K4QA 1GKKA 2C9ZA 1T2DA 1KPHA 2HQRA 2Q5FA 4RDHA 2JIDA 3AJ8A 3JRWA 4DADA 4L9WA 3WIDA 4ABYA 1E8NA 1Z4OA 3PHCA 1UANA 1MTOA 1QE5A 2BBWA 2LWIA 2R1VA 3H5NA 2VP2A 4HDOB 4UBOA 3RJTA 4BWVA 1SIUA 3EQ6A 2OL4A 2I4MA 1MRNA 3UJ3X 5FWDA 1GARA 3H8JA 1EX7A 2TMYA 3N8NA 2HK6A 3DOCA 3PWKA 3RS8A 2DFPA 1M0SA 2XI4A 3KYBA 2EJTA 4G0ZA 2Y6VA 3AJAA 3K5HA 4HH3C 4PZLA 4TKLA 3DDWA 3RUCA 1ZK0A 5EUQB 4UE2A 1UPTA 2PUHA 2QEQA 3L7OA 1UOOA 1PFQA 4FKMA 3LX4A 1A82A 1MT3A 1PHPA 3ECCA 3G5TA 1SXJA 1ZK1A 3JATB 4GSYA 1N6HA 5A0FA 2J0UA 1S96A 3WLOA 3GR6A 4UHBA 2DPXA 3P96A 1MQ9A 3QEOA 1ZGBA 4UEOA 3DDHA 4B33A 5ICSA 3HC7A 3GLIB 1F0KA 3DD1A 3ZD8A 3ZWMA 5AUNB 3EK2A 5FNVA 4UBIA 1JVNA 1A5AB 2IYRA 1EVZA 2C7OA 2B8JA 3I2FA 4BBJA 5LU8A 3OJXA 5CH5A 1A27A 2BFBA 3LRPA 4PFJA 1JHAA 3IT3A 1JXQA 1ZEJA 2GZRA 1ULZA 1XTJA 2C7GA 2KJQA 4X64B 1T5SA 3BMCB 5FH9A 1IVNA 3EN0A 4LK2A 1WUYA 4DLXA 4JC4A 2PZGA 3WTCA 3AEKB 5SYMA 1M2EA 4DIOA 1R8YA 1N9KA 1VHLA 5TDHA 4XM0A 1MO2A 1JLLA 4NENA 1XTQA 3WNQA 3S2EA 4ZPJA 4YREA 1FNMA 2OENG 1SWWA 3DONA 1M8PA 2J9YB 1ZM3A 1X1BA 2HDOA 2ZBEA 2F9FA 3C48A 4ZRDA 2VEOA 2W4MA 3T1QA 1P8AA 1J6UA 1QHXA 1T5IA 4KG7A 1CY2A 3LGAA 1CULC 3GCXA 4OJMX 5DN6A 2HBYA 1EI9A 5TS2A 1P4JA 5LOVF 1I5EA 1JLSA 2VK2A 4H7DA 4AS1A 4R3WA 4NJOA 2V0CA 3M1YA 2OCPA 4TL9A 5EEGA 3DMNA 4K03A 1JDZA 2JKZA 4OF4A 4OU5A 3VPDA 3WYFA 4EGQA 3MLAA 5KQLA 2XWPA 4EHNA 4EVSA 1DX4A 1BA2A 1L7EA 3BJIC 4GMKA 4S0XA 1LPBB 3PUHA 2DH6A 3KLNA 1EUCA 4NBWA 5ALHA 1VLQA 1Q1QA 1PDOA 4BVEA 2C94A 1ZL2A 2Q21A 4OOEA 2QVYX 4CUJA 2OORC 3SC2B 4JITA 1IHDA 1MPTA 5I8WA 5I9LA 1THZA 2C77A 4CW7A 2XRYA 2BKEA 3DMPA 3GCZA 4L76A 1SCBA 1VKJA 5E4YA 4KPFC 4P35A 3WI7A 5JBIA 1SG6A 1MDFA 2GEKA 2X9QA 1V5FA 4FB4A 5IYZA 1Z8DA 2BGMA 1E2EA 1H0SA 4K3VA 5TPWB 4Y2PA 5ETJA 4JQZA 2HJSA 4UREA 4C30A 3NVDA 4RFVA 4RJ2A 5TARA 5EJMA 3O31A 5K09A 3TE7A 3R6LA 2GCIA 2ACVA 4V1CB 4JC0A 1X0VA 3CLRC 1CZLA 1JTVA 1A1SA 1NE7A 1OWPA 1PT8A 2WJGA 4H1HA 4HGNA 1F0YA 2WPDA 3B8HA 1LX7A 2Q1TA 1PO7A 4BP8A 3MS2A 5AVUA 3BWMA 4RD3A 1L5GB 3BX1A 4KU4A 2HL6A 1HNWB 4ZO4A 4IJWA 3EXFA 3D8UA 2HK8A 1KSJA 4LZOA 5GZ1A 1NMYA 1I1QB 3MJSA 1FU4A 4TSRA 4H35A 2Q6TA 3TW6A 5JCXA 2RH9B 2ZUVA 3ETEA 1JFTA 1FVOA 1YNOA 4FGJA 1FVXA 3V00A 5CA0F 3FR8A 5CA1F 4YCLA 1SR8A 4XRRA 3T5AA 2IUEA 3RG8A 3O5AA 4WRRA 4AD8A 5A6SB 2I99A 1QCYA 3QVJA 3ETCA 3Q3GE 4X6LA 1HDOA 2H5JA 2ZSJA 4A92A 2PLNA 1LW6E 3LZDA 2BGRA 4I4TF 2OCIA 2ZOSA 3DBHB 3U37A 3A1VA 4CM4A 1VSVA 3VU8A 4BBAA 3N2YA 1O4WA 2JAWA 4HWRA 1FMTA 3I92A 1DKMA 4QYIB 5IU6A 5K99A 3K0HA 5IZCA 1M67A 5JFGA 3U39A 3T5GA 2MINB 3LX8A 2HWKA 1BH6A 1DADA 4O2BF 1X1EA 1X92A 1Y8QB 1E2HA 2J48A 3B2NA 3DKPA 3DHWC 1LXCA 1IG0A 1RFLA 3NC0C 3L8DA 3T9EA 2CFSA 3QXHA 1R8XA 5FV4A 3W1WA 5I9NA 4H0FA 4K6OA 4EO7A 4MMYB 1G3RA 1R0YA 1T9GR 1RI3A 4JDUA 4YJ3A 3PUZA 2EWMA 4C0XA 2DJIA 2V7EA 4HVTA 3C5CA 3W2EA 5CVTA 1A97A 5K6AC 2C3OA 4GKVA 4NH4A 2DBZA 4BATA 5FPKA 1MX3A 4BFLA 1PX2A 3FTDA 1N6OA 3JWPA 3KR0A 4NK4A 4O2LA 4DAOA 3FJOA 3TSZA 5KTSA 2VTDA 2AFIE 4OM7A 1KEVA 4JI2B 3SFVA 2OILA 1U7WA 3K3PA 3GMSA 4CWAA 2WTUA 3QVLA 4Y2UA 1OLOA 3IR5A 1Z6YA 3V8QA 2EKBA 2PANA 2FUEA 3WRXA 2O9JA 5KB3A 2HUPA 4E7OA 3JWJA 2ZXEA 1V5GA 3VUEA 1XMSA 2JFYA 1P9LA 2Q8PA 3LT2A 5J3JA 4B80A 3GO4A 1ETHA 3O91A 1SPBS 3PFIA 4K9QA 2KS6A 4PFKA 4ZEVA 4EY3A 4WGFA 1FLVA 2OP0A 1AQLA 4WUTA 3G6WA 3U4IA 2Q3FA 4V0SA 3GJ5A 1WMEA 5KNBH 5H80A 3ZTYA 2YFQA 1DINA 2X2OA 1MABA 3IVXA 4XRGA 1B2LA 1YQWA 3LUPA 2GEJA 3OD5A 2GZ1A 1P1BA 5MDHA 1R0KA 4P58A 1E3SA 1IM2A 2HPZA 3A1CA 4RTLA 2EP7A 8ADHA 1HSOA 3Q3JB 1CUIA 1F8UA 4N01A 4RJKA 3WYDA 5CEFA 1JN0A 1R15A 2QLBA 3NDIA 3QU9A 1IMJA 2VJQA 4BZXA 2HRRA 2ODEA 1GEGA 2WJAA 5DGHA 1WB5A 1CUGA 1V7PC 2OHXA 5FYQA 3DO8A 3EAQA 1MJNA 2EBUA 3EFOB 3NHFA 2KLBA 1FFEA 2Q0XA 3A31A 3IDSA 3H6GA 4QBKA 1G6KA 1GGFA 3EQ2A 5I9TA 2ZYIA 4UCXA 3H5AA 4EI7A 1ZU4A 4KSBA 1YQDA 3COVA 2N3ZA 4E11A 4WCFB 2HC9A 1P1HA 2O5EA 2HZBA 2XUKA 3ESYA 1FFAA 5LP1A 2GHTA 4K6CA 5ALWA 1DAOA 1H8EA 2X2EA 4KLZA 4TYPA 2MMGA 2XMDA 2XMCA 5LYJA 3X43A 2C9OA 4N0DA 3C45A 2A30A 5IM4A 2DTEA 4P4SB 4TTRA 3T7RA 2OPHA 4BP1A 3GUYA 3SHFA 1HOXA 5J2UB 1SXIA 2KMLA 1A0OA 3JS5A 1UODA 1XZMA 4CKZA 4REMA 2XMPA 1JV2B 2HNKA 2CZGA 4P7BA 5BYJA 4LISA 1ML3A 4CRWB 4NS1A 2PKQP 2Y2UA 3FWHA 2W6ZA 3DZCA 5JMTA 3UMMA 3ROEA 3KDAA 3MSCA 4TGLA 1KSGA 4C14A 2QMOA 1RXVA 3IDAA 4FLMA 3ND9A 5AFSA 2W70A 4C0HA 4H7KA 4XD7D 2GF9A 4E4RA 3O92A 5LZ9A 1LI7A 4WJLA 1HMPA 5FKJA 1K1EA 3IDQA 3G0HA 2LIPA 4LTMA 2VK4A 4UNPA 1L7BA 2PV7A 2QWXA 2FLWA 1A76A 1WA5A 3E3OA 4WXPA 4ZHQF 1KJ9A 4KZPA 2XUIA 3BBLA 1CRLA 2Q1WA 4TXNA 5G0SA 1VIYA 3VC2A 1E3MA 3HU3A 4O08A 1L3IA 2CLLB 2H65A 4X0EA 4YRPA 3UKDA 1QZUA 1BN6A 5IDYA 1UC9A 3SEAA 3ZBQA 3RT7A 3MRXA 4KWCA 4DCJA 2PVCA 4QUIA 3OFND 2AFVA 3FZEA 1SC6A 3FBWA 2EQBA 3KOOA 3P2IA 2XH8A 2Y93A 1IZYA 2AF4C 3V42A 3RBXA 1Z73A 3GJ4A 1DFIA 2V58A 1SCAA 2R85A 3I53A 3D1VA 1E9AA 3FOBA 3KJZA 4OHZA 4TS9A 3IUEA 4OUDA 2RHOA 5CYGA 4K9KA 1N2JA 4XCQA 4PZDA 1ISRA 3QHPA 1UMCB 1EK2A 4CTKA 2G7MC 4QD3A 3R5KA 3W8FA 4URXR 2AJTA 1CQXA 1E92A 1OLXA 1VOTA 3NHMA 5IZ4A 4J0CA 1QYRA 1UWCA 1VLLA 5D6NA 4C0AC 2IXEA 1FS4A 2REBA 2C29D 3MT8A 4RVCA 1WE2A 4X7MA 1ZOIA 2QTWB 4J2TA 4PS1A 1TO6A 1DIGA 1PNQA 1R5JA 2GCOB 1RI5A 1ZD3A 2XWSA 3E70C 3HR8A 4UVHA 2BEVA 4WI1A 1Y42X 3KYIB 1TT7A 3KKNA 3B7GA 4E1AA 4DDTA 2O14A 5FLKA 1KOGA 3WGHA 4OLAA 2ZJYA 2W8BB 2XCTB 2Q9CA 1T5OA 3OJOA 2R8ZA 1N1MA 2B4TO 2FFRA 4G1VA 4UCQA 2CKDA 4FC6A 1O6CA 4FLFA 3SJBA 3WMXA 1TMKA 3BD9A 3R3HA 5JAPA 2VQEB 1MC8A 1WCWA 2WUEA 3KYDB 4HJRA 4C43A 2MSNA 1Z0JA 3L8YA 4P53A 1M34B 1P61B 1RLTA 4GUDA 3LI2A 1WBBA 1OTYA 3CLTC 3DOUA 4NZZA 1SVWA 4W8OA 1M1YB 1BRMA 4QLBA 2IHTA 4RTJA 4O2AF 4EPVA 2HMWA 4L7QA 3UWDA 1L7NA 2H17A 1WABA 4OQMA 2PIAA 5AICA 4XJVA 2YJGA 3WLHA 2P3QA 1ZIXA 2YCBA 3UBTA 1AK2A 1N5IA 3UWOA 1CJMA 4HAVA 4OU4A 1GSHA 3ON5A 5HKKA 3FWZA 1AS2A 2WNIA 4U8GA 3DZHA 4FYPA 4HDKA 4M99A 1JA0A 1IIBA 4IGAA 3AUFA 3H1AA 3MD0A 4AXXA 1DT5A 5FOWA 2JIBA 2VBIA 2Y27A 1CQIB 1VM6A 2WDZA 3QIAA 4PHFA 1DOHA 1RACA 3T9DA 1T6XA 3GEPA 1R12A 1VE9A 1A2QA 3NQ41 1DEAA 1OYWA 4UVGA 1NJ2A 2FSFA 2VJBA 4HZUA 1O6BA 5KX5F 4W1SA 1V8OA 5BT9A 2D54A 1Q2XA 2GEBA 3MTBA 1Y1LA 4L15A 2X19A 4EY7A 3IBSA 3LUJA 1U6KA 4KXNA 3I4LA 2W48A 3RSHA 1NN1A 5B12A 1X7WA 1XYYA 4FYHA 4RYLA 2AOVA 5AJWA 3HBMA 5FX2A 1FRFS 3N2GB 1KO8A 4B6GA 1SB9A 1SXPA 2Z9CA 4LJ9A 5AK5A 5E7MA 5REQA 1OI2A 2DY1A 4HPXB 4DDVA 4XGKA 2B9VA 2CMKA 4B4KA 1U2EA 5BMVB 1GL3A 2JHFA 3VZQA 3NPMA 4FGWA 5I3CA 2I6SA 3HKCB 4ONEA 3OM0A 1D4ZA 1SZJG 5ANRB 3V7FA 1P6QA 3FBTA 1Z2CA 3HI6A 2IU0A 3R7LA 4YCJA 4Y1GA 1DE0A 1S7CA 2A9JA 4JGBA 4GD3Q 2PIDA 4Q7QA 2ICAA 1BROA 3CZ5A 4A6XA 4DW8A 3LE8A 4ZVTA 4EW2A 3SC4A 1D04A 1Z6TA 2OO5A 3MFYA 4IX1A 4UBNA 3O2SB 4EO4A 1KOLA 2WVAA 2QTTA 3H9BA 4DWJA 1I6KA 3KK0A 4EA6A 5E8RA 1CX9B 4WXYB 3BIOA 2DCUA 3UKJA 4LF4B 3DCJA 5B2FA 5T5QA 4QREA 4Z4EA 3WDSA 4TLBA 4B6FA 4WNYA 1ZWKA 4IXMA 4C7OA 1N4DA 1QYXA 4B0OA 2YV2A 5ECWA 4KNWA 4LZLA 3HNRA 3U09A 3C7KA 4KCGA 3LQ2A 5AKGA 1VIVA 1MFPA 1XEWY 1VBFA 4PPYA 3EIHA 1E5VA 3IUBA 5H8WA 2J6HA 1J8FA 1MT0A 1ZLXA 1IYZA 3BCSA 1ABFA 2FZKA 5C5DA 2JH9A 4R9UC 4PZYA 1EFHA 3TAUA 3FCXA 1UJ5A 3KZVA 3MT9A 4TZTA 4HXGA 4J29A 3BSFA 4X85A 1GL9B 1KYTA 2QRKA 3AR6A 1QGED 3DR3A 1P75A 5KYXB 2W37A 2X15A 3TLBA 3VHLB 3N2EA 1QO9A 1IY0A 2X1VA 1XJCA 3NWBA 3UEOA 4EB0A 4EG3A 3DL7A 4V0KA 3T6KA 3TIIA 1KVQA 2ZWMA 3DO6A 3NCHA 4TV8F 4BNDB 2J7PA 4DQLA 2O8BB 2JCSA 1Y3AA 1YS4A 4RDXA 3AESB 2L2QA 2B94A 4MQUA 3RRNA 4I46A 3Q8LA 1C3EA 2PX0A 1RWOA 2A1UB 2IIVA 4HQ0A 4JD5A 1XJ5A 4LHSA 3SKYA 2EU8A 3GNLA 1I4OA 1YRHA 2X6QA 3E7WA 3AR8A 4P3OA 4JX8A 1X15A 2NGRA 3GN2A 2EZ8A 3NC1C 1UMDB 5CLQA 4YXFA 4W5QA 3N5CA 3JSXA 4OO3A 1G42A 4XJTA 3FBGA 4DLWA 1DHTA 4D92A 1V2GA 1FUIA 4PZAA 2RKOA 4BBPA 3DMHA 4DG5A 5B4VA 3IXMA 3X1XA 1T2CA 3R24A 2BDEA 2XSZA 4BC1A 3TRJA 5L3VA 4HNVA 4JLOA 5EIAA 4EWLA 1ZC4A 3MCZA 1TLFA 3ZZNA 1A9YA 5C46F 2MTBA 2GX6A 3KRTA 2JJMA 4MQEB 3TF5A 3M34A 2IL1A 3RS4A 3K9NA 3L6BA 4Z0HO 1O87A 1XX6A 1DBIA 4ZO9A 4C2TA 2FN8A 3RTAA 1J5EB 2XYVA 4X8OA 3OTWA 5B57C 3K6RA 1OGIA 1EGAA 3LXRA 2AI1A 1RXUA 2Z9DA 3E2PA 5LZ5A 4UBMA 1VGRA 3MBOA 3R77A 3PDUA 3TNYA 4MR9A 3B53X 3QHQA 4A8JC 4CEHA 3B38A 1E2UA 1H2EA 1VL0A 3HJHA 3I5AA 1WDWB 3JVUA 5FOSA 3I61A 1AH2A 4YDSA 4JBLA 4XYMA 3TCNA 5LLSA 2C4MA 1E1RA 3G9ZA 3MTIA 3T94A 4MWTA 4OK3A 2WSYB 3B85A 4Q9JA 2ZYUX 3D54D 3I64A 3EHDA 4DKXA 6GPBA 5DHAA 4MV6A 4XJSA 3V1YA 4CMCA 1ZMXA 2EJCA 5BNZA 3NIWA 3U7GA 1M1NB 3H3JA 4FU0A 3OIUA 5LQDA 4CT5A 3SJCA 2O3JA 1U3DA 3CRNA 3D4BA 4QHTA 4F45A 5CFZA 1MNQA 4Y1FA 3B70A 1NVMB 3CF4G 1THMA 3NIGB 4JI3B 3S29A 3ZHZA 2HSEA 4FYJA 4EK9A 1JKJB 1MW8X 3JQGA 2R5FA 2VYVA 2XLCA 1ITZA 4X65B 4UNSA 4LOLA 5HIJA 3ANXA 2GNAA 3BHNA 1YQQA 1EXMA 4RVHA 3E8SA 3ZI0A 3MHPA 3WB1A 1ZIYA 3OOHA 2O06A 3V7YA 5ADWA 3MVEA 9ABPA 5KSZA 3SDSA 3KE8A 1ZH2A 3W6PA 4YH1A 1A8UA 3GAAA 5JFOA 1F48A 1KI7A 4INAA 5AHRA 5IUJC 2Q50A 3DWGA 1D1QA 2HSWA 1DDIA 5HM8A 3KDSE 1LW7A 1RJWA 2NXEA 1UJ4A 2DWPA 1CP2A 2XUAA 2PUFA 3BXEA 3EH2A 3I39X 4PRZA 5I9BA 2WT9A 4EL0A 4LNHA 3OFJA 2PGXA 1UBJS 1XJQA 2O8NA 1F12A 3IAFA 3P9NA 4G25A 5A71A 3L6CA 2CEAA 5C8DA 5D3MA 1T1SA 3LC0A 4BFUA 4GPBA 2Z2JA 3GEDA 4RENA 3N0WA 4CVNA 5IKXA 3BWXA 1T5HX 3MWFA 4IUDS 3DLHA 4Z9FA 3WIOA 3A14A 1G1MA 4DKJA 1Z7GA 4XH9B 2GPNA 2IEZA 1M6VB 3EA4A 4Y2YA 4I8IA 1ADBA 2YNMD 4R1UA 3OQ1A 1E6KA 2D13A 3JCZA 2V7QA 3AL2A 1FNSA 3T35A 2NU7B 5HK8A 1GU0A 3ABQB 1DQRA 1WZNA 4Z4CA 1C3OA 2QVGA 3P52A 4LQCA 1KIFA 4N40A 2RHTA 1BA3A 1T3TA 4D8VA 2JFHA 4UM7A 5ITZA 2I4OA 2JH3A 3N2KA 3CVXA 4G5HA 4LRSB 2PG3A 3PHIA 4YJ2B 4AS2A 5A9SA 3ETHA 3DS8A 5HGXA 5CYPA 1AX9A 2HFJA 5SZHB 3RFUA 3RYIB 4Z8XA 1MQAA 3ESDA 3HPRA 4G63A 1SZPA 3G7UA 1YWGO 3R6GA 1UXJA 4NF2A 5ECYA 4WFQA 4MV0A 3M3DA 1TVKA 2J0QA 2ZTSA 1ND6A 2B61A 4G56A 3UTCA 4Z0NA 3SVTA 1VHJA 2YMQA 3FOWA 4F71A 1PIWA 2J87A 3FUXA 4MUIA 4NEGA 1VBMA 3IC5A 2F3PA 4R1OA 4GOJA 3VOAA 2A84A 2VPPA 4J75A 4AL4A 1OXKB 1TUGA 2FPGB 5FL3A 1E89A 4YP0A 221PA 1A8IA 4RD6A 4BAGA 1B1CA 3KTFA 5CBPB 2V4UA 4EMTA 4FTWA 4I0WB 4OA5A 2Q3LA 4XWKA 4D44A 2VHWA 3H19A 4WMLA 4MUGA 5FUBA 2VZ0A 3GUCA 4GUAA 4MS4B 2IU4A 4L27A 4OLFA 1D1TA 2DB3A 1Q0SA 3UJBA 1E4EB 1HX7A 2VAVA 2MCFA 2IPLA 1J21A 3SXUA 1VCHA 2Y1EA 3PJDA 4N3NA 3IOMA 3F5QA 3F6EX 5JC8A 4A6PA 1Z13A 3LL4A 1OAAA 3M8KA 4KR0A 2H48A 1O4VA 4W7SA 3OEHD 4DCMA 1MXFA 2H6EA 3BWVA 1LLUA 1Z26A 1YCHA 4N76A 1X1RA 3DFFA 5D3QA 2RHHA 5LXTB 3GLHE 4LVOA 5LZ7A 4HAWA 1H8HA 3T7IA 3DD5A 3N2NA 4PG5A 1A4UA 1L5YA 3GEHA 3VO9A 4G0YA 5KDDA 1PL7A 2PZKA 1J7JA 3C7TA 3H5VA 1YTUA 2ZSUA 1AOXA 1IQRA 1JVBA 2GUWA 5K3DA 3X3HA 4RVNA 2GZ2A 4BMXA 2PZBA 1SCIA 3T5DA 4B4WA 1NX9A 4LF9B 3L4KA 2JS7A 2OV4A 3KPVA 3ZD7A 4DR6B 4JC5A 3MB5A 2NSJA 3D3WB 3VH3A 3ESQA 3G2PA 5FHRA 5BSHA 3S7TA 2W6QA 1FB5A 2ARKA 2PKQO 3A4NA 5JS8A 2YIDA 1Z06A 2JIRA 1JWAB 4BVHA 1KSFX 2C3MA 5EKXA 4Y6PA 2NUPB 3IRUA 2HF7A 3CYFA 4WKCA 2BJHA 4R0VA 1DJLA 2IY9A 4F86A 3D4LA 2ZS8A 1NJFA 1H1DA 4E33A 1XYVA 3BTUA 4KQFA 4MUHA 1X2EA 3EVEA 4MQMA 1BKSB 1SKQA 2FPXA 2NZVG 4IVPA 4IL5A 2OQIA 3SOZA 1S4QA 1IK4A 1ZH8A 4RELA 3AONB 3TM5A 1G3IA 3C41J 3JYPA 3K6KA 5DW3A 1Z6QA 4RZSA 3TCKA 3UHFA 4KO1S 2QZ9A 4MMZB 5C2JB 4XVQA 5EJ9A 3LU1A 1FX0B 1SKAA 3QI2A 5CRIA 2X8LA 1G8AA 2WJYA 1B2RA 4RV4A 4AZSA 2DKOA 3URMA 4I3GA 2J59A 2PHZA 3BWEA 1PV4A 1BMFA 1HZJA 1OC2A 2QMHA 2B8NA 2QN2A 3CHYA 3NT4A 4FNOA 5A4JA 1CNEA 4QU9A 5HQ3A 4JP1A 1XCMA 4L73A 1B8OA 3SY8A 4YAFA 3ZJ5A 2EDCA 1VL2A 3FW1A 4RJTA 3NYRA 2UZAA 2QRPA 1N7GA 1YAHA 3F49S 4IX9A 5IW8A 2IOYA 2P5TB 1ZA2A 4OFWA 5HBRA 5JSKA 4ZYXA 4Z54A 3RSQA 2VC2B 3ILVA 4DA6A 3LVBA 4KAXA 4K0RA 2F17A 2PJDA 3IAS6 1OX4A 2YXDA 1I7LA 1XHFA 4OXQA 5K51A 5IDXA 4ZAWA 1A9XA 1O5OA 4C6TB 1P29A 1AK1A 3M49A 3ZR4B 3ZQJA 5ARDA 4LYEA 2IS2A 1E0JA 1EBUA 2DQZA 4OG2A 2IGBA 3TW4A 1GU1A 2LVBA 3Q7EA 1OW3B 3RAEC 1ZMBA 1SOUA 3THSA 1ISHA 6LDHA 3TN7A 1ZMTA 1W7AA 4DQUA 1VKRA 4TVSA 5CX4A 2CHQA 1E9VA 2JKVA 2I5PO 4IILA 4XIYA 4F93B 1KK1A 3SE0A 1I7DA 2GNOA 4OB7A 6AT1A 2I1WA 3AT1A 2PO5A 3PNLA 4QXPA 4X97A 4KXQA 1K63A 1JJ7A 2NU8B 5KNLA 2UVDA 3QOWA 4NYIQ 1E7WA 1HYEA 1ECFA 2D0OB 1NBME 2J4DA 2O8EB 1VKNA 3MMPA 1EZ1A 1VPTA 1KFEB 1I5RA 3VZSA 1V71A 1ZUWA 2UYYA 4J4TA 1RKQA 1DX6A 3IDOA 4QRIA 1DKQA 4OB8A 1DIHA 3UV6A 1JDTA 3DE5X 3AIIA 4PAWA 3SC3A 3LLVA 2EZ9A 2GEUA 1EQAA 3AEKA 3GJSA 4LYHA 4M3NA 4NQRA 2PGLA 5AM4A 4GBJA 2VNSA 3D7NA 1W5TA 4RF5A 4YP9A 3SF0A 4Q93A 1Z68A 2Q62A 1K8RA 3D7MA 2JLBA 1EWRA 1FYEA 5EIBD 5CLHA 2P68A 4US0R 1G8MA 1S4MA 1XXLA 1PNOA 1ONBA 2FMUA 1YK0A 3HYNA 1Y81A 2CXXA 2L19A 2NZXA 2XODA 4GP7A 1A9SA 5DRTA 4N9WA 1K97A 3JZIA 4OJYA 3VPGA 4GE0A 2DPLA 3ILSA 3MD9A 5FTNA 2F6RA 2LRHA 4OQQA 1EEXB 3KOYA 4I5DA 1KNQA 1N2IA 1P2FA 2NTVA 3K7EA 3LLUA 3PFNA 2IY8A 1E9EA 4XTRA 3AINA 3CR3C 5CT6A 4WXRA 5EIOA 3WGKA 5JD3A 3VKHA 1N92A 5BSWA 3IE0A 2R6CA 1AQ6A 2VPTA 3ZWDA 5LOVA 3RU3A 1O97C 1D7OA 1ZONA 3BRCA 3UNXA 3TDNA 1M7BA 1XLUA 2B69A 1SA0B 2Q3HA 4EG4A 2IGTA 2Z6QA 3SVZA 2QV7A 3DBIA 2C92A 1YKGA 1T1GA 3JAKB 1H6DA 3VBEA 4K6MA 2C1ZA 2JCXA 3OHPA 2VQDA 4AMUA 4O4LF 4IEEA 2W2XA 5FFFA 2ZBGA 3SC2A 4B76A 2V6MA 1CJKC 1YL7A 3BEDA 4J91A 1QKKA 4JN6B 1W9MA 4H7HA 5BXYA 4JT4A 1H3FA 2YTZA 1GIAA 1F4VA 2QVBA 2X3YA 3IKMB 2EGGA 4NFYA 1I24A 5SZIA 2YKGA 1WXDA 3K96A 3DB2A 5GV8A 2PWAA 3C43A 2PMDA 4RXUA 3UH1A 1KE1A 2Q4TA 4II7A 4P0PB 2HPHA 3DWIA 1JHPA 1YFKA 1ZCJA 3IUSA 3L4SO 4M1MA 5IN5A 3SU8A 3RVOA 1SC9A 4V1CA 4A6DA 1K92A 3SIXA 3ZI7A 1SHTX 4LS3A 2PKRA 2XX3A 5IAKA 1JEYB 2H2HA 2FETA 4URVR 3H2JA 2V6GA 3WNZA 3MTAA 2HCJB 4DCPA 3MN1A 4PFQA 4E14A 1BE6A 4BGIA 1IBMB 3D2CA 5BR4A 3DQZA 8ABPA 1KO4A 1WXWA 3LHKA 4D8TA 5B6JA 2PH7A 2VK8A 3L07A 3V7NA 5HR5A 4I14A 5ECGC 4OXXA 3D7LA 3P0EA 3HA5A 1QBKC 4YBZA 3OESA 5JEEA 3CRMA 2Z95A 1DLIA 3DWFA 1KFJB 4BV9A 2IV3A 2AYZA 3JYOA 3PHGA 1J2YA 3GGOA 4GLBA 1M8JA 2B2NA 5FADA 3ZX5A 2MSDB 4BX3A 1JZQA 4Y7DA 4GYYA 1NW3A 4Q00A 4D4LA 3V4RA 2V7XA 3UZUA 1UQRA 1DX9A 1O0SA 2WRZA 3RB8A 2F90A 3C7DB 2VPIA 2WFMA 3A11A 4NPHA 4GYWA 5I7OA 2CY0A 3DBHA 2Q0QA 1WU7A 1ZJ6A 1BCSA 1Q1NA 2NQ2C 4MW9A 4U7DA 1FX1A 2UU9B 3H8WA 2ZCVA 3D59A 2R6AA 3WGNA 1ZBDA 3WY9A 2ZYHA 2GYWA 2JVKA 3O83A 2WQZA 3SKXA 5DU2A 5F1PA 4ZP1A 2FEXA 2R6ZA 5EXDA 4RPLA 3O9ZA 3KQWA 1EQUA 1B76A 4MWCA 5C1BA 3EASA 3IEVA 1JL3A 1Y8QA 4REQB 1TAQA 3PFBA 3DEFA 2TMKA 1XHEA 1TAGA 5D2CA 5SYAA 1K2WA 3UC5A 1PI3A 1SCUB 2NX2A 3DAOA 4M87A 4MDYA 5E7JA 4JBHA 3WGTA 5LP6F 4R2IA 1QIKA 1RAEA 3U4MA 2CL0X 3AI1A 1KI6B 2G83A 2I6GA 2QORA 3K0EA 1DC5A 1L5NA 4LCBA 3R3XA 2EP5A 3FPGA 3PP8A 4NPAA 1NYLA 1Z7EA 4R05A 1PG2A 4XQGA 1SBCA 4IWNA 4CHGA 4CLRB 3M1AA 4I9NA 5IXYA 1NBMD 1QRDA 3OWOA 4B5KA 4GWGA 4M0LA 5JPDA 4JB8A 4FXPA 4O3MA 4J6EA 4EG5A 3H9GA 3NANA 4UATA 4A03A 3KYCB 2VF5X 5HZKA 2XR1A 4FOOA 5DLYA 4OKNA 5KMGB 1HE4A 2AUMA 4O2RA 2UUAB 2XE7A 2FWAA 4D79A 3PEYA 1DG9A 4A8TA 4CKWB 1SHKA 3DPSA 2I2WA 1I80A 2ECFA 3HLYA 2ODQA 4RK7A 5DGTA 2GGSA 3F3YA 1Z8HA 3BL5A 4FCTA 1TXGA 4FGSA 4ZREA 4KK3A 5BWCA 2GZMA 4IIUA 3WIUA 4B3GA 2FMKA 4GLFA 4ZOLA 3ZHOA 3C1AA 1WDLA 2CLIB 5D86A 3WYBA 5KWIA 3CNHA 3U7IA 5I5GA 3GUHA 3RW9A 5JYCA 2ONJA 5ED0A 1P77A 4OYHA 3AVXA 5EZQA 3GD7A 4AY5A 3K6SA 1JR3A 3GPDG 1LU9A 5L4SA 4P84A 1R2QA 1AKUA 1RWNA 3ZUGA 1VGQA 4HEHA 1PJ8A 4AROA 5DTEA 3AEQB 4RADA 5HKBA 2BMEA 2P3SA 2CYAA 3P9KA 5JFTA 5IH3A 1UBCA 3L0BA 3ZU5A 1DJOA 1NZDA 4C6HA 4Q82A 3CBGA 4JVMA 1IQUA 3L05A 1N2HA 1TQ6A 3JQ9A 4MV1A 5G53C 3U56A 2AKEA 4K3UA 3JWIA 3EAGA 4WCFA 4LDQA 4OFZA 2KYRA 3AIKA 4XPZA 1XD2A 1A8PA 4L4XA 3USES 1T0BA 4WESB 1K2VN 2YRWA 5EUCA 1BNCA 3BJEA 2EKZA 4GL4A 3I9V6 1H5UA 1IY1A 2HCRA 1NLFA 2PL1A 2V74B 4P4SA 1RQGA 2Y1GA 2Z6VA 3DXFA 4QJBA 1V8ZA 5JOQA 2DQ4A 3S28A 4W9NC 1EUDA 4B6JA 4N8SA 1PNVA 3B6EA 3WGOA 5MFPA 4JT9A 4P8RA 1HL3A 4II2A 4BTLA 4MINA 4LXHA 1H1LB 1R8SA 3H3FA 4H0NA 4H4CA 3E18A 5FJJA 2R60A 3ZK9A 3AZOA 2WWTA 4RPKA 2N1MA 3AWIA 4OL9A 4Z3KA 2XUQA 1J07A 3LPDA 2ZJ5A 5EMLA 3P2JA 1T9HA 3D9QX 2DFDA 1JIQA 2FKAA 1REQB 1PWYE 1VKHA 1UZUA 2R84A 4WASA 1OASA 3U3XA 1Y8ZA 1EGQA 1EJBA 3IBFA 3EMDA 3OZCA 5B7NA 5J47A 2FQQA 3G2HA 3JXEA 2ANCA 3L8MA 2BCGY 4R1NA 3RTCA 2QJFA 4BUZA 2ZKIA 2Q27A 3VYSB 2Z04A 5JD6A 1L7VC 4N6OA 4ALKA 3KT3A 4XGIA 4FYIA 5KYTA 1AHHA 4MI1A 3OH8A 4EGSA 1KZ6A 4DNXA 1UPFA 4ZT4A 3EODA 5EJEA 4NL4H 2Y3IA 2B4RO 3OICA 1NPYA 2DUMA 4QGGA 3WK5A 4PG6A 3WL4A 1QHSA 3KB2A 4OQXA 3FTCA 5LMNB 3IKJA 4LJ6A 2X8JA 5TSDA 4UUOA 1AKEA 1TCVA 4ILKA 4R2WA 2Y68A 3BWCA 4F56A 3E9ZA 3HYSA 3PLRA 5IC6A 1KZ1A 2ZROA 1IUNA 2GM4A 3ZC3A 1U3CA 1M2WA 1UMCA 1NN0A 3F2IA 1A9OA 5TQ0A 2O6HA 2OZVA 3FNBA 3LYLA 5CIQA 3WMGA 2XZOA 3RC9A 5JSZB 5AOAA 4AZTA 4RAQA 4Y3UA 3CMCO 3H75A 4N47A 4AF6A 1Q84A 2D2EA 3RE1A 3AV0B 2I6UA 1CUEA 3PWZA 3WRYA 2WKQA 5ARBA 1XXHB 1SRRA 3JQ6A 2GLUA 3RLFA 5H9VA 1U0OC 3I1IA 2YOGA 3GRYA 3VM6A 4QL3A 2DE0X 3LX6A 1Z0UA 3K9GA 1I5OA 4M7RA 4RD1A 3AF2A 3SAJA 1VP9A 3D7RA 3V3KA 3ZH9B 5C8YF 5T4EA 2GBIA 3CPSA 2D0DA 3S2FA 3QUAA 3JY6A 5JNRA 5FI5A 4UQLA 3FD8A 4RA9B 3W5SA 1B43A 5K45A 4UFNA 2F43B 3HU1A 4LGMA 3OIYA 3TXXA 4Q1CA 1M34A 3B13B 4QHYA 4NYJR 4ZV7A 3EIFA 5CPBA 2BLNA 5KINB 3W2HA 1F7VA 3D2BA 3OOEA 5BN3B 1M1YA 1Y7PA 3P97A 2TMGA 3ZYCA 4C6SA 2OCLA 2WIGA 3AW8A 1AQUA 4PYLA 3K2IA 4TXMA 2QOEA 1ZH0A 3FE2A 1CFJA 4OYLA 2BLLA 1KMHA 1YZHA 2X86A 3PQ7A 1ELOA 5EQFA 4NZ9A 4A1OA 4DWOA 5B3AA 2A5FA 2OAEA 4KIFA 5BRAA 4KOAA 2CDAA 3ONWA 4BMZA 3MXOA 4HGQA 4KWIA 1XNRB 4RO0A 1IJFA 1BS1A 1EK5A 1E5XA 1H0KA 1O95D 2CZCA 3CRVA 1TVCA 1RQ2A 3C6QA 2WWHA 3QVMA 4OQNA 4W5HA 2RB4A 4MVJP 1PYOA 2JDIA 4FCCA 1NNI1 4LWQA 3U7HB 3QVTA 1FXWF 3L40A 4C01A 2GN4A 3EPHA 3B9BA 4YP6A 4A27A 4ZJPA 4JIMA 5ELXA 5DPMA 3KPUA 5J63A 1GCAA 5CB4B 2COUA 4HTFB 3WWDA 5ITWA 3ELUA 1JT2A 2YYYA 1RC1A 3N53A 1MNAA 4NAVA 4BXOA 3N8IA 2JEZA 1IZ7A 5BPFA 2VHXA 1SY7A 3SFZA 5LJIA 3WK9A 1SK9A 1GSAA 2XQGA 4QRDA 3ASYA 3MYYA 2ZRLA 5DHRA 4DR2B 4CTMA 1XUOA 4QUKA 1KIMA 4Z51A 5F5XA 4MDEA 3L9XA 1A98A 5EWJB 1WXFA 5BMVA 5JNLA 4DLVA 5CDGA 2P6OA 1BFUA 1ESEA 2VNHA 3FRHA 3GAZA 3HKCA 1Y8AA 3QWFA 3CIFA 1SKYE 3VTAA 5HRAA 4F4DA 2QHXA 1NVKA 4IUCS 4D6XA 1E9FA 3ZHYA 1AHNA 3QY9A 1ADCA 1C41A 4WOJA 2ZS7A 1AZWA 4X7RA 3SLKA 1QO0A 1H1TA 1M1ZA 1W1UA 2IV7A 4Y9UA 1LK7A 4HPWA 4KYTA 1GKLA 5C18A 1SIBE 3P2YA 4C0JA 1KDPA 3DSRA 3VR1A 4RTOA 1ZPDA 3EDYA 3IE2A 5KSYA 4ER3A 3U81A 1QF7A 2XE4A 2I7XA 4FK8A 5HXAA 4KXUA 5C7OO 1AQJA 3S2ZA 3EMKA 2QYTA 2FPSA 3LYUA 4YAOA 2ENUA 5FOTA 1TEXA 2HIMA 4RK1A 4BRWA 1B0AA 4TMVA 1ODLA 3GA7A 5C5CA 1J2RA 1Z45A 3L6RA 3BE5A 1H3NA 3TVTA 3D64A 4C3OB 1N6RA 2P2CA 2FJ0A 2PFSA 2RKWA 4N54A 1G38A 1YSCA 3AFOA 2WI8A 4ESVA 4PV7A 3X2SA 3AR5A 1K7SN 5ER6A 2AFHE 4WZBE 1YCGA 3K8YA 3L6DA 5ALNA 2VXOA 4OL0A 2V6BA 1Z15A 3MS4A 4UXJA 4DPKA 5KYXA 5A06A 3J81A 1NVFA 2O8DB 1SOAA 1VJGA 1JEJA 2RJOA 3ME5A 3L8CA 1ORVA 4MQ6A 2A2ZA 2FK8A 3I0NA 2J0VA 1ZUIA 4ZVOA 1R4AA 3FRIA 4D6PA 3P2MA 1JPVA 1NVAA 3EEOA 3L1KA 3NETA 2O8BA 2Z2XA 1FTGA 3A4LA 3AESA 3IEMA 3TI9A 1CEYA 1K5DA 2XNDA 1GNQA 2VJCA 2V1UA 5E2BA 3DPUA 1Q21A 1UCFA 3NALA 2CKMA 4KR7A 1YOVB 1PT5A 1IVYA 1UMDA 2BP7B 1BO6A 3QWIA 3UMFA 4EJ6A 1O6ZA 2VSQA 3LUKA 5KREA 4E5PA 5J40A 2M98A 1G20E 2A0XA 5GP1A 4EUHA 3F6PA 2OZKA 3QNMA 2IDMA 2D2VA 2P75A 3DFMA 4IZHA 3G8CA 4AP9A 5DOVA 1JRLA 3LHSA 2PZ8A 5FHQA 1VJRA 1XTKA 3WMEA 3FPEA 2NAPA 1I6LA 2G77B 4BTVA 4DIBA 4INZA 4TYNA 3DH0A 1FLNA 3O7MA 2QF7A 3CEAA 4MQEA 1EFPA 4X92A 1E1CB 5JCOC 4TKUB 2DHDA 4E32A 4NOMA 3BA6A 1YJXA 3FMOB 3GLUA 5KWEA 3ADCA 3MGBA 2Q6IA 5H7XA 1ZNQO 4FGLA 3ZCTA 1A4RA 1I4TD 1NRWA 2Y1OA 2I1LA 3EEYA 4NBNA 3RI3A 3UMBA 3EZ6A 1QIEA 4QT0A 2XUZA 4UPDA 2R1UA 2Q07A 4A16A 4YRMA 4ED9A 4PX2A 2VKQA 1YB6A 4PPFA 2VYNA 3CF6R 2W6ID 1U7DA 1GXSB 2GXUA 4B3MB 2QL7A 3AX6A 1L5HA 1E3LA 1SU6A 3QXJA 4ZQCB 3X1DA 3TWOA 1UPCA 1COWD 1WZUA 2EJVA 2HLNA 4PCUA 3GGGA 3RK1A 4AIIA 3RKSA 5AQ1A 4MI6A 2H4FA 1KH1A 1I6MA 4NBLA 4EW6A 4YR9A 2P1ZA 3A6HA 3K1AA 3PXEA 4RCZA 3SG0A 5DNAA 3UMGA 4EENA 4HDSB 4JZYA 2GXAA 2F7SA 2XKBA 2BFOA 4HEJA 2GBFA 1JPJA 5F98A 4EG8A 4LF5B 3DR5A 3JZAA 4DF3A 3IP6A 1O3YA 3QPVA 1XLVA 3AXSA 1M1XB 4IIYA 3A2NA 4L2IB 4OP1A 1KQFA 3SEZA 4A15A 1H2ZA 2W2OA 3KHSA 1JJIA 5B7GA 2ZI7A 2OCXA 4TMKA 1O08A 3OCUA 4MP8A 4N0PA 3IV9A 1BDBA 1V25A 1NW7A 4GF5A 1LBSA 3PWTA 2X4GA 1JKJA 1TK9A 1Z5PA 2QYOA 4PE5B 1JKMA 5FTKA 3EQZA 3D02A 3CO0S 3B3GA 3AJEA 5EJ4A 3RK4A 3MGCA 1EUZA 1I2BA 2JFFA 3FLMA 3W9UA 3B7PA 4J2HA 1OA0A 1V5IA 2X0NA 5IJAA 3C4VA 4LBYA 1TFRA 2ZWAA 3BOSA 2OYCA 3SSAA 5JNUA 5CEEA 1WNFA 1HLFA 4RHCA 1PJZA 4ENTA 5C5EA 5BSMA 5L51A 4I3FA 1JSXA 2LP4Y 1D2HA 4CI0B 3KJNA 4EA7A 1V35A 4Y9DA 4KE7A 3AIMA 3QF4B 1T8WA 2P79A 2ZK7A 4LJ5A 1GNSA 2WJWA 5L3QA 4YJGB 3OPMA 3GOQA 4M55A 4CF4A 2JFVA 1IHUA 4RSRA 5JH7F 4MS3A 3PC7A 3LRTA 4AMZA 4PO8A 1OLSB 2OXCA 4W5JA 3VNQA 2QA5A 4Y0VA 2JHPA 2HA5A 3OF2A 3RIEA 1MR3F 1XR3A 3IAHA 1OV6A 1ZQ9A 4HNAA 1M2VA 1M6VA 2RHCA 2D5AA 2D1FA 4FT4A 4CKYA 4R1SA 3KTAA 2VHTA 2WSIA 1W96A 3U7QB 4MUFA 5BVHB 4CBVA 3AB8A 3O0DA 3PHLA 1QG4A 3IH5A 1Z3CA 2CMHA 3AC0A 2IHZA 4NXNB 1BGXT 5KUTA 1E2QA 1LBTA 3NMUF 3IQIX 3MWEA 2NU9B 4N5MA 1TYAE 3TR5A 4DL9A 1RYNA 1NJSA 2CUTA 1X7DA 2SECE 4L08A 3MNFA 2H2DA 2VT2A 4MJ3A 1HORA 1HDCA 1RABA 2NYUA 1XZCA 2IF2A 4MVJM 3B9RA 1C9JA 1UDAA 2NACA 4Q37A 1BWPA 5HTKA 3V4FA 1KAOA 4AX8A 2GK7A 3JQDA 5L3SB 2WF6A 3HEAA 1DQNA 1CY1A 1G1AA 2QTCA 2F1JA 3HCEA 3OLWA 4IJKA 1LB1B 1MD9A 2ID8A 4FQ5A 2R8OA 5DNWA 2Y1WA 4AFNA 3PQFA 2NUAB 1CUCA 1N78A 1HKHA 3PZRA 1CERA 2R2GA 3FSGD 4ZVLA 2FJPA 4R4JA 3SLGA 5LP6C 1NMEA 5D1NA 5D7BA 4BIMA 2XOXA 1WB9A 1U8EA 3PSHA 2J9ZB 1BN7A 2BEWA 3D3JA 2IYYA 1W0CA 3M4XA 4LE0A 2FZEA 3RDPA 3INGA 3D0OA 1NJ5A 1QX4A 2FPGA 1G9TA 2YZMA 1AIPA 4XIJA 3WQSB 2XCRB 1PD0A 3M6IA 4DLTA 1YV9A 4GFDA 5DXFA 4QWMA 1W4RA 2XVAA 5CBPA 5IVKA 4BQOA 1F1JA 5L7TA 2P0EA 4TL8A 4IDQA 3KZKA 4UEJA 1EINA 1TKCA 1UFVA 1JIUA 1MN6A 1RFGE 2SHKA 4WZAA 3JZDA 1GUAA 5AK6A 3NUZA 3OHMA 1I7PA 4XD2A 5BSEA 4MK4A 1E4EA 4Q1EA 1EM8B 3HGTA 4GM1A 1F1BA 4AZ3B 1AGRA 4R2XA 3NATA 1KAMA 5BSFA 4CCWA 3S2IA 2JLQA 1E5QA 1M6YA 1KKMA 1VLHA 1HPLA 2FPPB 4A8JB 3B1YA 3Q6IA 4EKEA 4TPKA 5KVQA 4LJAA 5EP4A 4ZDWA 4RQBA 1S01A 1VJ5A 3ENNA 3KQTA 1Q5PA 2WF8A 1JGTA 1XTUA 2CXQA 3BGDA 1E2IA 1H9CA 4BTEA 4MW6A 5HRUA 3EDCA 3OO0A 1DXQA 2RGWA 2DRIA 3MA0A 3USZA 1BGVA 2K7ZA 3NBUA 5DM1A 2HLHA 2QMZA 3ABZA 3DF7A 1J2TA 4QOSA 3UUWA 1RPZA 3D0QA 3GV0A 5FUWA 2XBMA 1XVTA 3Q15C 3H1TA 1YQEA 4PYKA 1PZGA 2IF0A 3D3WA 1O57A 1PFGA 4KP7A 4INJA 4I1IA 4DEVA 3CCBA 2HNBA 4QPNA 3C14C 1QIFA 2F1HA 3OCJA 3O95A 3TZLA 1QGOA 4RFLA 3U4QB 1G8GA 1IHPA 4GR5A 3QENA 4HRVA 2XBLA 3RRXA 5L40A 2O1XA 4HFRA 3UMVA 4L07A 3SC6A 3REQB 2VFAA 1T4MA 2BFEB 1KEUA 5FBQB 3B3FA 2EWWA 1YE8A 1V26A 4AJJA 2C1XA 4UNQA 3QX8A 3WLMA 3DQQA 4GGOA 4EUFA 3FZGA 1IXRC 1ZINA 2VDNB 4X8LA 2HJRA 5TPZA 4C4YA 1WMBA 2XYGA 4PX9A 3RNLA 3CY6A 1ESZA 1U3GA 3HP4A 4RQUA 2WU4A 3SJ7A 3LK7A 2AMVA 2E1PA 3ZUPA 3FDIA 1JDVA 1I9GA 1TL7C 1UINA 3IR6A 1FX0A 2XAUA 4PIMA 2O23A 3BD7A 1U0NA 5F9FA 1QFSA 7MDHA 2ZTVA 4KQ2A 4LNAA 1TRKA 3EXEB 3LO8A 1YU9A 2YY5A 1Q19A 2HA7A 1FFHA 3F7TA 1XP5A 1KO1A 2ZJOA 2QTNA 3R20A 3LIIA 3S2GA 5JWHA 1MXHA 1CW2B 2OBFA 3DEZA 3SZ3A 1KKUA 4YQYA 3W8DA 2ZRKA 3C7AA 2GTPA 4MJ7A 2B78A 3EGVA 1VPWA 1DG1G 4MRMB 4C6TA 1GG2A 2X9VA 1Z8NA 2AD5A 1CFZA 5CA0B 1Z29A 1JQ3A 4MHOA 3UQYS 5CA1B 1SUPA 4X7PA 2Z4TA 1ABEA 1JT9A 1K27A 3MGAA 2VWGA 1E64A 2R7LA 2C42A 2WP0A 2YUIA 1QDLB 3EH1A 2G6BA 4RPJA 4K46A 1J09A 5I4CA 4MKFA 3ZY3A 1Y4DE 1Y1RA 4TYWA 1C1YA 2J9GA 1PQYA 4KQEA 2VDVE 3TK1A 1FU8A 1KA9H 4I4TB 4OFBA 4D2IA 3A6DA 3EVAA 3HWWA 5JC1A 2VOJA 3VNRA 3O8LA 4MV5A 1DRKA 1EGHA 2Z3WA 3E23A 4ND8B 4UC0A 5FBRB 5KYNA 3F3MA 2YV3A 4FYYA 1VXOA 3I3OA 1C81A 5TV2A 4P0QB 1NW4A 4JY7A 2X58A 3LQFA 3O4HA 4Y2SA 4ACBA 2GMWA 1H65A 3NGLA 1R5NA 3OUTA 3NS7A 4O2BB 5E6RB 1HGXA 5HM6A 4HH4A 4K28A 1IWOA 3I37X 1KY4A 5K4GA 5FJIA 3MELA 5ALIA 4W82A 3K9FC 3HCWA 5FPQA 4PXAA 1A7AA 1A9RA 1XRNA 4QTUB 4J1QA 3GVCA 1JEQB 1Z0IA 3NTUA 2CNLA 2PMCA 3I05A 2CB9A 3KQMA 2VAMA 1QGZA 1Y4ZA 1TW2A 3QLJA 5AQEA 2OOKA 3FHOA 5IASA 1Y1TA 2JL1A 2XVYA 3BRQA 1NMZA 1UK6A 1HV8A 4IFIA 1XEFA 2QNBA 3RU2A 5H9WA 5JZVA 1RAFA 1WKBA 3QV2A 4HLUC 1UEIA 1EXNA 1VJTA 2H1VA 3ACDA 3CUVA 4MUXA 4PONA 3T4UA 1Q15A 2VQSA 4P4UA 4Q6BA 4Q9KA 1XKTA 3GROA 3IEKA 3C2QA 2B83A 2NZ8A 3N9IA 3JQPA 3OF5A 4TLLB 1T1EA 3LL7A 5AP9A 4GEGA 1UK7A 1CR4A 2OO7A 3AMVA 3GARA 3KVYA 3LDFA 3LDGA 2EFJA 1X9GA 3N75A 4FEAA 2I2AA 5IAEA 1ADFA 1PLLA 1S3FA 1GT91 1GVHA 2O7SA 3DJFA 4CPDA 3DUWA 3E61A 2FZLA 3HFGA 4W5OA 4FFSA 1WSBA 3CKYA 1OZHA 3B2QA 4US1R 3JR7A 4JYAB 4P34A 3THOA 2O05A 2RGRA 2DQYA 2GPWA 4PLYA 5H3CA 4CMKA 1Z3IX 1KJJA 4ARZB 2QQ0A 3E5MA 4IRUB 5FWXB 3A3NA 2QUAA 1S9DA 1GPKA 3EVTA 5CLJA 5JISA 3RROA 3GLVA 4PQRA 4Q47A 1YGPA 1QFJA 2ATIA 4KH0A 4QDOA 4MPJA 1DXYA 2AZXA 2JANA 1K5GA 4TS4A 5DGXA 2GYUA 1HFJA 3JPYA 3T15A 4BAUA 4GT1A 2WMYA 1TF5A 1VG1A 2JGIA 4GP9A 5IAJA 3WR5A 3X1ZA 1BVHA 1COZA 4MGHA 1K68A 3W7VA 5FD8A 4E5KA 3FFXA 3P26A 2NP6A 2X40A 1OGJA 1BXGB 4G3XA 3NWJA 1LRKA 1JEYA 3BD8A 4QFCA 4X41A 4MI9A 1R27A 2HQOA 4NLLA 3SR4A 3OEEA 3RFTA 1JI3A 3NASA 4KMRA 3WWYA 5KHOC 5LUBA 4G5OA 2IITA 4D80A 4HQLA 4FGUA 3ZE0B 2FW1A 1JFSA 3HY4A 3OZRA 2OCAA 3CVVA 2ZIFA 4D4HA 2PH3A 2GBLC 1ACLA 1QIDA 3K72B 3L84A 4IIVA 4FDUA 4RVGA 1XTRA 4BQPA 5A0TA 3S55A 4IBOA 1P4RA 1WXGA 2GLTA 4J0EA 1RWVA 5KO2A 4UUMA 1MA0A 2BFFA 5D85A 2DFVA 4PWZA 1TCCA 1JFRA 1UXHA 3DOHA 2ZVPX 3M1IA 4AUNA 1E9CA 1K7CA 1TMGE 2NSHA 4JLAA 3VSEA 2JI8A 4TWRA 2Z6AA 2R6FA 1STOA 4I6GA 4LQDA 4FMDF 4L9SA 3NEJA 1OI3A 4LJKA 1KDTA 1P18A 3GJRA 1U5BB 3L5OA 5JS1A 1T35A 1UUFA 4YCMA 3QPAA 2W42A 3DUFB 1AM4D 4KUHA 3VRHA 4ZMBA 1SXJD 3R9XB 2QAGC 2EFDB 1KPIA 3B60A 2Q28A 1MB4A 3PT5A 1Q0HA 2C8LA 4HCJA 1YULA 4PNPA 3QUBA 1I4LD 1PKXA 2V7BA 3EXHC 3LG2A 4H7PA 2EYUA 4REQA 3CH4B 4U5QA 1EZ4A 4M9QA 4HGOA 3RIMA 1EX1A 3F98A 5A3QA 4DV7B 3UAGA 1TPYA 3DP9A 3RKRA 1SCUA 2JFBA 1VMDA 2ZU6A 3TZHA 4DLKA 1GQFA 4NI5A 1BVUA 4ZHQB 2P6RA 1A95A 4AECA 1QR6A 4H7JA 2G72A 4F38A 3U1BA 3BXOA 1T3HA 5LA6F 2R9VA 1MB3A 4CLRA 4W7IA 4PWYA 3DTVA 2EC5A 1N3LA 3QE2A 4B3DA 2AXQA 1E61A 4A73A 4PANA 1JLRA 4MA5A 3KYCA 5AKYA 4JWTA 1PHRA 3UF0A 4BLSA 5KDLA 2XQFA 2IYTA 2QSYA 1S8AA 4Q3EA 4R2LA 5DTRA 4E3WA 5I3ZA 1OF1A 2HMVA 3QPWA 1RLUA 1WMDA 2XTJA 4BQQA 1DL5A 4QNMA 2WJ6A 1N0IA 4CKWA 2OCYC 1UIRA 1H2YA 1QVZA 1RXYA 4K2AA 4ECEA 4OLBA 1XALA 1H85A 2XHEA 4MPTA 3KQOA 4CG3A 5AUPB 1EGVB 5DN6D 1NC3A 1E7SA 2EW1A 1SG9A 3A9RA 1G5PA 2GR9A 2IXTA 2P9BA 4DT1A 4XVRA 1I7QB 3IUNA 2L42A 3CZRA 1LFDB 2XE8A 2J31A 4ZOAA 1WUHS 3PXGA 3BBPA 3PUIA 1T4BA 4QUGA 3DMRA 2Y4NA 1ZM7A 2O19A 1JEAA 4MRVA 2PPLA 1C8KA 2C3YA 3Q3CA 4GZ5A 5HDQA 3A7DA 3RJ5A 3TINA 1BDIA 1PGNA 2CXTA 2Z1MA 1PDWA 4BB9A 1M2KA 4ITVA 3X1JA 4AUEA 1KGDA 2QY6A 5K8CA 1AN0A 4C4TA 3TAHA 4HF7A 1FVHA 2H2IA 3L1IA 1Z33A 1CLUA 4JJFA 1Z7WA 2LXNA 1QGUB 2DPYA 4O4HF 5G41A 4DJFC 1UMKA 1KY2A 8GPBA 2R86A 2QJRA 2AOTB 4IVQA 4NESA 3EPKA 3C6BA 2ZR0A 1K3FA 3P20A 4EHKA 3LVRE 4CMJA 4F2DA 1NZJA 3A1NA 4WK0B 1AKRA 3KZ1E 2BFWA 4KREA 3NT5A 2O59A 4IIJA 1YS7A 2YC4C 2QTHA 3N0XA 2GJ4A 4IQ8A 1QHIA 2WF5A 4O2AB 3CN9A 4FKBA 1SBNE 1EK0A 1LC3A 4NFHA 3NBXX 1QUEA 4DCSA 5CEJA 1XU7A 3NO4A 4WESA 5KNCA 3NHLA 4MV4A 4UTXA 1KJ8A 2HRZA 5CNIA 2P6PA 5KC9A 3HBLA 2QY9A 1SUCA 4MV3A 3TJRA 3L3BA 1NIJA 1AV6A 4DCTA 3MS7A 1W36B 4RF4A 4D3FA 1NGSA 2C9DA 3KSAC 1MGOA 2JIMA 4WNCA 3Q87B 4FYXA 2AT1A 1DCFA 2B92A 1RLOA 3BJZA 4NONA 5EHNA 5EZSA 1J70A 2H2WA 2ZVDA 1KDVA 1F2UB 3ODGA 4D9BA 4JLKA 5J2TA 3ZXYA 4I3HA 3QFSA 3CWQA 3STWA 2B3DA 3F67A 5KX5B 1MX9A 4DCNA 2O7NA 2R47A 4PEVA 3WO1A 2P9QA 1W44A 1JAIA 1F9EA 1GTRA 1OXBB 2IBMA 3B6ZA 1P45A 2B1RA 3PNVA 4L22A 4AURA 5B3KA 3OQVA 2H4ZA 2XOKA 2A6PA 3E58A 1REQA 1VCIA 1NY6A 1ORTA 5H70A 3B5EA 4BECA 2IYUA 1EFCA 1L3CA 3OHSX 2WPNA 2WLTA 3GJ6A 4JCOA 2GLXA 1GA1A 2CLCX 3IQZA 1BXRB 4Y8VA 5CM8B 2KHZA 3VO8A 2SCUB 1J1ZA 1A7KA 1GAQA 1MB0A 3QP9A 1AXEA 3PIIA 1KPGA 4ZVSA 4E2XA 3H42B 3DZDA 3E3LA 4HNRA 1M2GA 2KI5A 3PL5A 1OPRA 4I81A 3O8DA 1R6DA 3OA2A 2C04A 4EQZA 1ID1A 1CUSA 3DAPA 1L4BA 2QQEA 2C5AA 1HRKA 2DFKB 2WA1A 1BEEA 1UJNA 1GNRA 2JGDA 4FX5A 4UMVA 1XTIA 1XZLA 3ZVKA 1P1JA 1VXRA 5M3BA 4Q66C 5T6MA 3B82A 1NXWA 4RSGA 3RSSA 3UW3A 4EF5A 3OIDA 1FRQA 1WZCA 1IEWA 4ZCLA 4CR6A 1OWLA 2DG2A 3DLAA 4HT3B 1HDRA 4JKIA 4EAAA 1U5AA 1KIAA 1NSFA 2O20A 5JQGF 5LMCA 3RIXA 1JXAA 5BQFA 1FFXB 5KSWB 3DKKA 1XTZA 2VAPA 2XB8A 4NMXB 5JSZA 1BIFA 5HJ2A 3PC2A 2OWEA 5KNDA 4HZIA 4ZTBA 5K6AA 3SYLA 4RFSB 1XXHA 1XAHA 4N03A 3I01A 5AHKA 4MIKA 4N0MA 2G6TA 1EVYA 1R4MB 1DJMA 1FUKA 5CDHA 5K03A 5EE3A 1JA9A 4PSDA 5C8VA 4KLNA 1ECGA 2GDJA 3NW9A 1Y0BA 4B3RB 1ZJ5A 2Y99A 2ZJ2A 2QDKA 4L6CA 4A1FA 5EWLB 4JI6B 2IDZA 2FSVC 3BE4A 1DSSG 2ZJ7A 5CMLA 5IAOA 1CF9A 1QYVA 1FK8A 3OY2A 4RA9A 2Z8YA 2YYAA 2J07A 3H1PA 3JRNA 4ZGBA 1TF7A 3GJ0A 5FTWA 3BWBA 3R23A 2WIBA 1P2SA 1XCPA 2FPKA 5IAGA 4B48A 2YQ4A 2HF8A 2G8LA 5BR8B 4S12A 2YXPX 4UVEA 5EA2A 1EA7A 1UH5A 2QTVB 5DYIA 5CCDA 1KQ3A 3VTKA 2Q9UA 2ZT7A 1K98A 4ND4A 4EAQA 2ZIAA 1W46A 3L6OO 3VU0A 5IMSA 3S3TA 2CHFA 1I3CA 4FFRA 5CX1B 2MYUA 2H4JA 1Z56C 2IODA 3AKCA 3ICVA 3MXTA 4JOCA 2FWPA 2DKNA 4XPIB 2OA0A 3ZWNA 1RZRA 1WPQA 1TRHA 4OQ4A 3WK6A 1FPQA 1TIBA 1VL8A 2XPCA 2VZ8A 4PIVA 2IUSA 2JJQA 4XA8A 4OJNA 3DLBA 1Z82A 1H8ED 4ZTZB 2VHUA 1X8KA 2HPVA 2ZTHA 3S5UA 2DHCA 4GMHA 5CBKA 4NV1A 4UASA 1ODFA 1OUMA 2XWBF 4RJLA 2V6FA 4MRAA 5CB4A 1Q17A 4FW8A 4HTFA 4MJLA 4CDNA 2WTAA 4BX8A 1O5IA 1WS6A 2RARA 2AXPA 2O57A 3FGNA 5ALYA 2B36A 3V8RA 4JJ4A 2JZNA 2QYSA 3ZS9A 4DMKA 1MJGM 3SD7A 2GVDC 2JI9A 3IJPA 3TG8A 2VAWA 2W2TA 4M38A 4DSTA 5KOIA 5HF8A 1T0JB 5FTLA 3CGGA 3NTOA 4EX7A 4ZAYA 2F48A 2PA3A 4K9NA 4JQCA 4MTCA 5A9TA 3TQRA 2IKQA 1T25A 3V97A 4B82A 4AB1A 4QGFA 1N8NA 2P2LA 3P9XA 2OAQ1 1KHTA 3PC3A 5H02A 1XZHA 1G4AE 2P2NA 3PQ8A 3TRHA 4AM8A 1OFTA 1YHNA 4V0RA 3O1IC 4DG9A 3ZIDA 5E9AA 1O9BA 4E7PA 2ZJ8A 5B58T 1NU8A 3BKXA 4MTLA 1JG4A 3IPRA 1TGYA 5BVGB 3TL6A 5K3OA 4M4SA 3AUXA 3Q7TA 4KGZA 3ND6A 3UW1A 2GTHA 2EV9A 3HA2A 2RE8A 3DQPA 1L4YA 2HADA 1MKYA 2WAXA 1F8FA 2CT8A 2X0IA 1L4LA 4MITA 1WDTA 4QOJA 4WNAA 2ST1A 3IT2A 1MU0A 5L9AA 5CB6A 1GT6A 4KE6A 1JAHA 5C3UA 4AG5A 1I3NA 2X1MA 2J32A 3DE1X 4OBXA 5EXSA 4CM6A 3U7FB 4D9CA 5LL6P 1N77A 2VI5A 2IW3A 3JVVA 5LZ2A 4XVUA 4KRYA 3A1FA 5ALVA 1XN4A 3A6ZA 3D81A 1E7RA 3JPWA 4UM9B 2A9KA 4NOKA 4GZ6A 1JHRA 1GPH1 5MF6A 4L8VA 1ODTC 3L0SA 4YASA 4Y2GA 4BRZA 2CXNA 2E0IA 4ZVPA 1G19A 2BTEA 2O8DA 5ADUS 2YFHA 5EPEA 4D3XA 3C6MA 2IYZA 3TTSA 1K7XB 4ENQA 1L7OA 4YACA 4CUZA 10MHA 5GGYA 4HWKA 1Q44A 1XA3A 5ENVA 3ZV3A 1SM4A 2XLBA 4L3OA 4EJ0A 1LJUA 3WK7A 2PLRA 1U9CA 1V1JA 4OGWA 4CM8A 4NU0A 3CR7A 2PZAA 3E0QA 4HAZA 4XX0A 2GPTA 1GG5A 4RC9A 3NG1A 1EBBA 4MZDA 3NOVA 5EXEA 3AP2A 3ETJA 1YOVA 1FMLA 2YMLA 3I6BA 4L6IA 2P91A 4J7UA 4P33A 4ZXFA 3VI3B 3HXLA 3TJZA 1XZIA 4DCGA 4I50A 5J23A 2XNCA 3K9HA 5CVJA 1FNDA 5JNVA 5DGIA 1XLTA 3K9WA 2ZQZA 5GZ6A 5SICE 3GZTB 2ZSAA 1PR0A 3EWSA 2UYQA 2JLRA 4M0PA 3LMKA 5LU9A 1ZI9A 4QLOA 2JASA 2VO1A 3SQMA 1KDOA 2ZRGA 4EB8A 1PEDA 3RS7A 2PJUA 1E1CA 4HB4A 4C1NA 4INOA 2YNMC 5HKKD 1BYUA 2Y6UA 1LF5A 4ZOCA 2FRDA 2ZRDA 4BCBA 2V5AA 3HEMA 4BS9A 1JBQA 3DC2A 2QVZX 1DC3A 4JMLA 1CUFA 1VI6A 3WGYA 4EMSA 6YASA 4C2UA 4JI4B 3KVOA 4PAQA 2IYVA 2XW6A 4IRXA 3QWAA 4LWPA 4V3CA 4BLQA 4G89A 2QD2A 1JU9A 2QPOA 3K9BA 3T4EA 4J0JA 2QM0A 3L0DA 3TOCA 1Y4UA 2A57A 1D9ZA 2D5IA 1B16A 3DT8A 2WJVA 2P77A 2RH4A 3EEIA 1R6XA 3QJYA 3NHJA 3G3EA 4PNZA 2X0FA 1ZN2A 4ZJYA 2KW5A 3N2LA 1DC8A 3JD1A 1ZOOA 1TD9A 3IB6A 3EUAA 3O84A 3IIJA 1E2MA 2YICA 4ZQFA 5G3ZA 2NIPA 4RIEA 3SZUA 2WHYA 2ZM5A 3CCCA 9GPBA 2I91A 2DFTA 5BV0A 2DT5A 5ENDA 5AVRA 1KR5A 1W88B 4WUVA 3E9YA 2GYVA 5K8IA 1CC1S 5K0EA 2C5LA 4WKPA 3ZDEA 3I0ZA 1ZK2A 3NHSA 1E3EA 3BHIA 4EF4A 3RPEA 1Z2EA 3RASA 5A4MS 2AQ8A 4GU5A 1N5MA 1IAVA 2FF7A 4NMLA 3C3BA 5HJ5A 1I10A 3WBKA 2WG0A 3HDVA 4Q01A 1YR1A 2V3CC 1Q92A 2FRXA 3WG9A 3F5FA 3Q9NA 4FYMA 3UB4A 4LMRA 3WO0A 4U7FA 2VDPB 3ILXA 3L9WA 3W1EA 5GIOE 4Z3OA 4PPGA 4MWOA 2FPRA 2YWDA 2HREA 2ASEA 3ADKA 4QXAA 2IXFA 2HCTA 4NBSA 5A1TA 2I2DA 4IV8A 2YL2A 3W2FA 4NARA 1P60A 3GRPA 4YJDA 4N5HX 5KOJA 3S81A 2PGDA 2AJCA 3FZQA 3CEPB 2BI4A 3UYLA 3SYKA 3UJNA 1LV7A 1U4NA 3OT1B 1LJLA 3WAKA 2MYNA 3KAPA 4GWKA 1UBFA 2GPSA 3BDAA 4DZTA 4LQ4A 4YALA 3EGDB 3UJHA 3PUWA 2IXDA 4YJGA 2WIAA 5EGSA 3OPYI 5AOBA 4GX5A 5FP0A 3TLXA 1M8FA 1A9ZA 2ZBVA 3ZGLA 1UC8A 5AVYA 4CR7A 2JG3A 1OLSA 3W3AA 2OO3A 3ZVRA