4I8IA

Crystal structure of a duf4886 family protein (bacuni_01406) from bacteroides uniformis atcc 8492 at 1.50 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
DTIKVLAIGNSFSQDAVEQYLHELGEAEGITMIIGNMFIGGCSLERHVQNIRNNAPAYAYRKVEKDGEKTETRSMTIEKALADEKWDYISVQQASPLSGIYDSYKASLPELVNYIRERIGKETVLMMHQTWAYATNANHTGFKNYDQNQMKMYTSIVDAVKKAANLVGIKKIIPSGTAIQNARTSFIGDHMNRDGYHLDLTIGRYTAACTWFEALTHRNVTENPYSPEGIDPIHKKAAQMAAHNAILYPDKVTELTELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BACUNI_01406) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution
rcsb
source organism Bacteroides uniformis
total genus 92
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16227 DUF4886 Domain of unknown function (DUF4886)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4i8iA00
1FXWF 3KVNA 5HOEA 1IVNA 1K7CA 1DEOA 2VPTA 4RSHA 4K40A 1J00A 2W9XA 4JJ4A 4RW0A 1ZMBA 3U37A 2HSJA 4M8KA 1BWQA 1DEXA 1BWPA 4Q9AA 1V2GA 1JRLA 4K7JA 4K3UA 4JJ6A 5A4AA 3SLRA 4PPYA 2Q0SA 3BZWA 3HP4A 3SKVA 1FXWA 1ESEA 4I8IA 4NRDA 1U8UA 4OAOA 3DT9A 3P94A 4JHLA 2APJA 3DT6A 4Q7QA 1VYHA 4JKOA 1Z8HA 5JD3A 5BN1A 3DCIA 2WAOA 4HF7A 5CD9A 4TX1A 1YZFA 2WABA 1VJGA 1PP4A 3C1UA 1ESDA 3DC7A 4K9SA 1ESCA 3MILA 3RJTA 2Q0QA 3DT8A 4OAPA 1BWRA 4H08A 4IYJA 3W7VA 4LHSA 4XVHA 1WABA 2O14A 4HYQA 1ES9A 4JGGA 2WAAA 5B5SA 3PT5A 4DEVA 4S1PA
chains in the Genus database with same CATH superfamily
1OILA 2Z3ZA 4DWWA 3NDRA 1BDJA 1V1RB 3H7AA 3ADDA 3RTGA 1PEYA 2FVXA 4F1KA 4PONA 4GEKA 3GFGA 2ORYA 1PSWA 3R8XA 2K2QB 3IH5A 1G8PA 2BD0A 3OCYA 5SZIA 1A8PA 4CV3A 3WO0A 3H13A 1VCMA 2OZLA 4H1TA 1YUNA 4N54A 2Q3DA 3CLRC 1DU4A 4B2LA 3Q9NA 4D8WA 1IN1A 2VF2A 1M2NA 1SHTX 3BIWA 1QGAA 5CDSA 5KTTA 1CZOA 2GBPA 2HRCA 2QJFA 3CWQA 2J6HA 1NF8A 1Z56C 1YAJA 4PR3A 1E58A 3EWSA 3DMFA 3IQIX 4JX9A 4DJEC 3EVDA 4FYWA 4UNPA 1K89A 4RA9B 3E9RA 3A3PA 1CG6A 2X1HA 5CX1B 1WBJB 3HCPA 4TTQA 3EG9A 3DTNA 3KL2A 1JJIA 2JRLA 2YZNA 5TPZD 4JI1B 4XAQA 4ZIRA 1WXHA 2IH4A 3R3YA 4NCXA 4XWAA 4HWGA 5HGJA 1FOEB 2A0UA 3KQWA 3AFOA 1NUUA 4XGQA 1MO6A 5HGXA 3ILYA 1Q92A 5HCNA 2Y2VA 2DFKB 4PO1A 5B58C 2ZJ6A 1XCLA 3HXKA 1EZZA 3QV1A 1OXMA 3UW3A 3SU8A 2QT1A 3QF4B 4JI5B 4EHHA 2KLHA 4K03A 2QMUA 1JR3A 3ICPA 3F6RA 3S68A 5HQ3A 3BOSA 1AY0A 1PR1A 1N6KA 1VCHA 3H6KA 4AZTA 2RI1A 2WSBA 4CEJA 5H5JA 4N48A 4HGPA 1D2AA 2OBNA 2BKEA 3A9UA 3BH6A 3HDHA 4TS3A 5DYNA 2BM8A 2IYLD 4R54A 2PUAA 1QSGA 4UHJA 1T10A 3ZCSA 4NMWA 2HFKA 3B48A 4DSZA 1RQGA 4HGOA 4V0NA 1DV1A 3GFSA 2IS2A 3CS3A 1C9KA 1G4HA 1TXGA 1GTL1 1V4BA 1P7YA 1XSEA 2CZCA 3LPNA 2HTEA 3NPAA 4ITVA 4OJMX 2D1SA 1NT4A 3WL3A 4F8EA 3T3MB 2BFEA 1NG9A 3T4EA 1P1BA 3Q72A 4XEHA 4DCJA 3O82A 2JFGA 2YIMA 2FZ4A 3A05A 4QYTA 5BSWA 1YB5A 5JDIC 1F17A 1OFTA 2ZEJA 5IEJA 1FRQA 2IU3A 5C31A 3CIOA 5K1ZA 3TQSA 5CNMA 4ENWA 2FGKA 2QUKA 3WNZA 2QVXX 3D64A 4ZC8A 3AUSA 3HUTA 2QVGA 2VFAA 4CF3A 2F3QA 1RQNA 2OA0A 1ISFA 3UAGA 3GT0A 4C6TA 1UKVY 4JOQA 1IZZA 2O4CA 3WYBA 4PX9A 4EA6A 2F1HA 1ACLA 4BFCA 5BURA 5ETJA 1M1NB 1PNTA 1TEZA 5IK2A 3IBYA 1VMAA 3GL9A 3U7EB 3KX2A 3TBKA 2X19A 1BVYF 4YRRA 3ET4A 1YKGA 1NDHA 1KEPA 2PX6A 2VUSA 4XFJA 3VZPA 3QHAA 1E1DA 3RJ5A 2P9GA 5DNYB 4KR3A 3WHPA 4UMFA 1I9CA 2OV3A 4BZWA 1ZK3A 2DQYA 3LK7A 2H9AA 5I9MA 5THKA 1ZA1A 4OXIA 1MFPA 5HOEA 3N8DA 1B8PA 1JHRA 1GTZA 3SHOA 3TLCA 1IOLA 4QULA 4YX9A 5AM2A 1XAGA 1EG2A 4U8GA 2GZMA 3FSJX 2WIDA 3IQFA 4Q7KA 1RRFA 3L05A 4M9ZA 4MUBA 4WFQA 4WKGA 5CW1A 2ZJZA 4ZU6X 5BSTA 3ICEA 2AVDA 1TCBA 3HB1A 1HG0A 3MRXA 3I58A 1G8HA 3EFOB 1NV8A 1RI2A 4OM7A 1E1YA 2I99A 4S1TA 3WQRA 3AHJA 2E48A 1DUVG 3L9XA 4GSYA 5DJ5A 4B8YA 3OM0A 4I9UA 1V1RA 4K0KB 3FDZB 3G2OA 1T34A 2G1AA 2QZ4A 2WWFA 1YMQA 1XRPA 3K0EA 4H1UA 1ZUWA 4URHA 4UOEA 1Y48E 1M2OB 4KQ1A 4M8KA 4C2BA 1NVWQ 3WA7A 4GDFA 2NPIA 3B6KA 2A7QA 3TKAA 4B81A 1TL7C 1B23P 1VSQA 3NR2A 3P2MA 1KZ1A 1WA5A 3QWIA 3TRJA 3WJAA 1R4MB 4QUBA 1T2EA 1K4YA 1QH9A 2P11A 3KT6A 4NEQA 4TKLA 4XOIA 1MEJA 3LQRA 4ILEA 4A6DA 4CN9A 2AG6A 1WHSB 2JIRA 2GK4A 4DYHA 1YAHA 1XFAA 2ET6A 5JNLA 4E5PA 2RARA 4RLHA 4XLZA 1Z2PX 2AD1A 1J99A 2FUG1 5F2NA 1BYIA 3PA6A 4N82A 2O2EA 1C5KA 1D2HA 2WSMA 2BCEA 2X6RA 4CTMA 3G7UA 1MLDA 3DSRA 1MX5A 3PD1A 5K6RA 1F7UA 2SKCA 3HP4A 1C1XA 2J30A 4TTPA 1AK2A 3KB8A 5DX1A 4RK4A 3LXXA 1I24A 4TSRA 1ESNA 2ZRLA 2E5WA 3BBLA 3FPJA 4HUTA 5I5EA 1G64A 3HBLA 2XMCA 4FCVA 1Q0PA 2F4NA 1UDRA 1J7JA 2CYCA 3MWFA 3AESA 4CF6A 2OZKA 1VYHA 1RKVA 2HI0A 3QF4A 3W1EA 1TMYA 3G2IA 4YUVA 1H2HA 5AR1A 4FW8A 2R8RA 4I9GA 4LK2A 4CEHB 4BE9A 4H7IA 4BVKA 1OXUA 4IBOA 4UUNA 2E4VA 3A36A 5EIOA 1A8UA 2G4LA 3WO1A 5ENZA 2C07A 3LBYA 4ETWA 4WH0A 4ZKDA 1G21B 1PS9A 1F8UA 1SXJE 2C2GA 3B3FA 3DDOA 1XBTA 3KSRA 4BGDA 1ZIYA 5KYUB 2XSZA 3QX8A 1N5KA 4B6QA 1AD2A 5CFNA 5FUMA 1TKBA 3HHPA 3QLVC 2YIJA 3S81A 5A7HA 2ETXA 4MPJA 1GZ5A 1HT0A 1KHHA 5DHFA 2ZJFA 1TADA 4C7MA 2R4TA 4PLHA 3JATB 2PUEA 2WJYA 4RV5A 5NLLA 1GQYA 2CDRA 5TV2A 4J2TA 5DBIA 2Q1XA 2JJ2D 2XRYA 3SJBA 4PG4A 1T0JB 3COZA 4ETIA 1FYDA 1C3JA 2A14A 2QTZA 3KWLA 5EE0A 3B78A 1SKMA 1GDTA 2R8ZA 2YASA 1HDEA 1R37A 2WD8A 2QKYA 3D1VA 3MYRA 1WABA 3K70B 3NHLA 3K9NA 3NANA 2XXAB 1XRJA 2PK3A 3L0BA 3I05A 4QX6A 5C1PA 4ZI7B 2VEOA 2H1SA 4WXMA 5B1IA 1BQ3A 1ZGGA 2VYCA 3RKRA 1N2IA 4PGGA 5LZ4A 2WWWA 1E79D 3DXXA 1G18A 1ZGHA 3WK7A 1QTQA 1DT5A 1GILA 1ECGA 1RC1A 1M1NA 2P2DA 3HWRA 3MMSA 1OH8A 2ILTA 4WN9A 4A10A 5FWXB 3I12A 1Y1PA 4YYZA 4B33A 1SUAA 2HSZA 4MR7B 1Z2DA 3TGPA 3VTZA 2P7IA 3ZIDA 3ZBTA 2RHLA 1JEEA 2C3YA 2ZRBA 3N74A 1X80B 1XROA 1FB5A 1KYIA 2VPPA 2R7NA 3STVA 4GOMD 1E3WB 3BWCA 1YDFA 4GQIA 1JXOA 4ND7A 3D4NA 1TIKA 1E3IA 1ZQ9A 2O6LA 1G3RA 5CVJA 5SY9A 1M34E 1A04A 4IUBS 3VV3A 4HDSA 1JUDA 4IH1A 1ACJA 1P2FA 1G8KA 5JYCA 3VJKA 3D8NA 1QX3A 5JMPA 4EHFA 5ECYA 4BMSA 3DAYA 5EWJA 3U3KA 5AUPB 2ZRDA 2FDXA 3ABSB 3R5FA 2FR8C 1U9ZA 1P9NA 3U7FB 4NJEB 1U5AA 2IPLA 3LCMA 1ZW6A 2CL5A 1GQRA 4YRLA 4E2ZA 3C3PA 3GDOA 4TVOA 4PG8A 2GPBA 4CF5A 4K9OA 1MNQA 4B79A 3UFXB 3TUZC 5JBQA 4LYGA 4OGGA 2FX5A 1IWOA 1GPLA 3I9JA 4OOFA 4XI9A 1YZGA 1V71A 1R4MA 3BYZA 1E66A 1IWPB 5EJ2A 3S44A 2CXHA 5DNCA 5JD4A 3K6SB 1TVKB 3OLWA 4C5CA 4DSTA 3O3NB 4KN8A 5DYWA 1OT5A 4D45A 1CJVC 1DAMA 1NSTA 1YC2A 2CUKA 5E9WA 2EEZA 2PO7A 1QCCA 2IV3A 4OTZA 3HYCA 4ZYYA 3T8YA 1FRZA 2VQEB 1IB6A 3KQOA 3WLPA 3VC7A 5FNZA 2HFJA 1M54A 1KRXA 1NY5A 1YTUA 4C07A 5JTUA 1WSBA 1L7RA 3CPHA 3MLBA 4MV0A 2ZIEA 5TGDA 2VHEA 4WE3A 4URXR 1P73A 1QOZA 1GRQA 3FPAA 1LI5A 1QDUA 3KUKA 1ZS9A 5K3BA 1V43A 3AM5A 3U40A 4M0MA 1AKWA 2X0IA 1C1DB 4JL8A 1Z29A 4YCMA 3C8MA 2JCGA 3QE3A 1R0BA 2I2CA 1JR3E 3UK6A 3IHLA 1BZYA 1YFKA 4GR9A 4X3OA 4XGKA 4CQJA 1AMUA 3VV2A 2Z5FA 4P4NA 5BW6B 3FHOA 3VXKA 4CEHA 1TAGA 1ZJJA 4QT4A 1TZ2A 2C82A 2G70A 1U90A 5ICMA 3CPSA 1CFJA 2HF7A 3MILA 2X1LA 1G21A 5CBKA 3GHHA 1C0LA 3IIIA 5SV2A 1SXJD 4IDPA 4KQFA 1USGA 3I6IA 1DL5A 1U7ZA 2NVWA 2AOTB 4E3WA 2CJXA 4EY7A 2NO1A 1RE1A 4POOA 5F76A 1L5VA 3PXBA 5ICCA 1GEGA 1UEXC 1MZPA 3R0ZA 4NZZA 1I3LA 1JPJA 4QUAA 1NBOA 1TUBB 1PVOA 1KMIY 1ZRMA 3H83A 2ZUDA 3AHEA 2B5WA 3JATA 2OCYC 2OPHA 1PNVA 1KETA 2W7TA 3IMKA 3DEHA 4UZFA 3VPGA 3UB3A 4KITB 1HSOA 3VMFA 1FUYB 3WJ2A 2BGIA 2EC5A 4U1RA 1NBEA 3TZCA 1PQWA 2GYUA 5LMNB 1T9ZA 1Z4IA 5I7HA 1ZIXA 1T3GA 2HPAA 5K3SA 2Y1LA 2V3VA 2QUJA 3PD7A 1EFAA 5DNEA 4ED9A 1FFYA 2AA3A 4QO8A 1E89A 1OBFO 4RH1A 1L3CA 1V96A 1ZOPA 2VJPA 1JHPA 4Q1CA 3T9EA 4RV9A 2VP6A 5FOVA 3WGQA 3K72B 4Q18A 4JI6B 4PC2A 3I8SA 2PT7A 1D4FA 1GA6A 3ITDA 2V9CA 4RTPA 3T1QA 1EGAA 1FX1A 5EJ8A 3A6PC 1VE6A 4D9GA 2JEZA 2HM7A 3O9ZA 1NMQA 1XZMA 1F2TB 4UJ5A 4QEDA 4U8HA 5FWXA 4DMKA 4W9MC 3V1TC 1AKTA 4AY3A 4ZHSA 1IBLB 2VUIB 3G49A 3V4FA 2YOGA 5FR1A 5K3EA 1KAMA 4YXFA 1PQUA 2HBQA 3K35A 1E0JA 4GW3A 4JLJA 4QYWA 5LBIA 1MOPA 3SQLA 4BQRA 1QRAA 2AXEA 4LXIA 4TXNA 5F1KA 1E3WA 5F3RA 3DPUA 1JI3A 1DAFA 1G5QA 4GOJA 4ZHQB 1WTAA 2DG2A 1AKMA 4GE3A 3Q2KA 5EJAA 3RREA 4A16A 5K6AC 5ESRA 2H08A 3CXUA 3M9XA 5FL7D 1CRPA 1ID8A 5H80A 4HQOA 4ZAFA 4Z4FA 2ROQA 3RI3A 1TM3E 1BH6A 2XECA 3EIFA 3SLRA 3ZQ4A 5LYJF 3UBTA 2LCFA 1C8VB 3DHEA 2HUPA 5DSXA 3ROTA 3LDHA 2WHRA 1XRQA 4E08A 1EVKA 1YRYE 3GA0A 3ZEAA 3WICA 4ARCA 4YR7A 1J9ZA 2HMUA 2AJBA 2OBLA 1U8UA 2ONYA 3H2IA 3OAAA 1MPXA 3KHUA 3PC7A 4IOKA 4JHLA 3WGJA 3AHHA 5L7TA 2XTZA 2AWOA 3RYFA 2ZXFA 2BTQB 5EHIA 4BUJA 3UFXA 4A0RA 4Z4QA 1C29B 1JU3A 1KYYA 4YMUA 4YXWA 3ZOKA 4B3GA 1P29A 3WIUA 2PGJA 1AMOA 3WBFA 4IRUB 1NVDA 3V4SA 4L76A 4CYMA 5BP7A 1YB1A 4W5HA 3EXEB 3JYQA 3K6SA 2PUCA 5K0JA 3FR8A 4G0YA 4YP9A 5AW4A 3BMQA 3JU3A 5JOQA 4DYVA 1F3OA 4MRMA 1FNMA 4S2UA 4II2A 1LWNA 3DGFC 3K6RA 1LA2A 1P44A 5K0TA 1MQSA 2VBCA 1PEKE 3ABQB 3IHWA 5KTYA 3OKFA 1JH8A 3G13A 4XIGS 1XTUA 4AM8A 5J9FA 1FJXA 1XRNA 1GAJA 1PT6A 5KTSA 3UXEA 5E9QA 1EPUA 5EY5B 5C9ZA 4D6YA 2Q8NA 4DCCA 2O8VA 2JFXA 1K5DA 3E05A 2QPLA 1NL3A 1C1DA 1UDXA 2RGAA 3AEYA 3H86A 2CLDX 2EARA 2WVAA 3OE1A 3VH4A 4AMUA 4FMBB 4MI1A 4XB1A 5YASA 4BO0A 4CG2A 1GNPA 5I47A 5I7EA 3VYWA 1JR3D 1XEWY 5E6RA 4F2PA 2ZSBA 3MCVA 3CF6R 2G08A 2OHJA 3L0YA 4QVGA 4XKJA 5LXTF 4QIHA 1FBTA 4NWIA 4XM0A 4WPGA 5TSDA 1EVQA 4AUKA 1YOVB 5BSMA 4HAYA 2VJLA 1IEQA 4QHTA 4IS3A 4GWKA 3NZEA 2YDYA 5F5LA 2V3CC 2A5GA 1ORTA 2DT8A 4PXAA 3RAPR 1UBLS 2JARA 3DKPA 4PAWA 1GAXA 4EPRA 3A6GA 4G1FA 1BJTA 2GBLC 2P4SA 3K0CC 3NIFB 1PR6A 1TUBA 3L8CA 4EUFA 1OAKA 1QHNA 4H6VA 4PSVA 3U44A 2AGVA 2Z2ZA 4XWWA 1OLSB 1JHVA 3CZ4A 3UCFA 1JZSA 3ZGLA 5JFTA 2MSWA 1WDKA 3A0RB 3IQWA 4TVKA 3X1WA 3IVMA 2QR5A 1PKXA 4MKFA 1YHYA 2GM4A 1NVKA 1FSPA 3DTVA 4PWYA 3VVCA 2D54A 1QF7A 4BNMA 1EZ4A 1CY7A 3R9KA 2DWQA 2YYYA 4I1VA 1V11B 3C74A 4IDEA 721PA 5KPJA 5BQ3A 4KQMA 2XE8A 2RG7A 1MQAA 3EUAA 3FCEA 3IJEB 4EHDA 1D0VA 1TGYA 2AMYA 4L15A 4AT1A 4CU5A 5FA5A 4CKEB 4UFOA 2KBEA 3MFQA 3FBWA 1IUOA 1G8MA 2W22A 3DE6X 1U8XX 2QN9A 2O3UA 1W1UA 3MTEA 4IO0A 1WVGA 5GM1A 3QW2A 1KO7A 3R0IA 4XM2A 2O7RA 2ZB8A 4CQLB 2A5YB 2AXNA 2PZBA 2R44A 3V9AA 5IK2D 4C4RA 1HE8B 1F2TA 4DJTA 2OKGA 3UNXA 2EX4A 2QA5A 2XJ4A 1NR7A 3OHMA 3RYTC 2UU9B 4IHAA 1XZQA 1S02A 1Y37A 1CVLA 2AG1A 2D5AA 2WHXA 3AV0B 2ZYSA 2MU1A 3D8UA 3G2JA 4PFJA 1N1MA 4RTSA 1EM6A 2OXTA 4JOSA 1EK5A 2W0MA 4QU8A 4OREX 3SIXA 4C7XA 4ZHQA 2B8NA 2D1YA 3DF9A 4KG7A 1TX4B 1USUA 1OU0A 1JA0A 3HB9A 4Q7JB 1QFSA 4R2LA 1POXA 4Q7QA 5DW0A 5E95A 1KJWA 3D3JA 2ACWA 5GONA 1NE7A 1YS1X 2WR8A 5ENVA 5A9TA 1Z8HA 1PGOA 2R4UA 3FTFA 3CVJA 1S7GA 1R8JA 5HIMA 1OSNA 3HU1A 5H3LA 2YVAA 1YDWA 1CQIB 4UMEA 2GEVA 2GPAA 4ZTBA 5T41A 3BDVA 1H8HA 1XLTC 5MGBA 2OUIA 4QGFA 2EW2A 2IH5A 1Q57A 3LGAA 4V1CB 3ASVA 3R7BA 2BTQA 4MYDA 4P93A 4HAVA 4CZ2A 3THYA 3EGIA 4LYHA 1FJGB 1QYIA 1OFVA 1T6YA 4TRRA 1SBTA 3FPSA 3PI7A 4MQMA 4YJ2F 2ZJBA 3QPUA 4I9NA 4I08A 1Q19A 1A9XA 3LQFA 4XTRA 5ER9A 3ZGZA 1RW4A 3EXEA 4MYTA 5ALPA 3TD6A 1VPDA 2FFAA 1VE9A 1WL8A 1A2BA 1C3OB 4RZQA 1C4XA 4JH0A 3NI2A 5GMOA 3E1SA 1G7RA 3UAXA 1AIPA 4C1NA 2BFWA 2OAP1 4MS4A 4O4LB 4FBGA 5FUBA 1GUBA 3I2YX 1KQFA 1K4KA 4OA5A 4YLEA 5SYAA 2BWJA 2OWDA 3R23A 3PQ4A 5A0VA 2VJKA 1QG6A 4W5QA 1JSCA 3ZQJA 1QZ3A 4D9NA 1KMNA 3A25A 3CSSA 4DIBA 7GPBA 5FA8A 3WVNA 1E4EB 1ZLYA 2PANA 2QN6A 4KRGA 4L6AA 1UEIA 4URYR 5CYOA 5IXYA 3PDIB 2YTZA 4LUCA 2ERXA 2D62A 3BE4A 3KZOA 2BZSA 4YQYA 1P72A 3T0GA 4KXFB 5HSGA 3GDHA 5JDIA 5AH0A 3JARA 5GJCA 1RXVA 4JEUA 3UXMA 4HYEA 3QVTA 2IEZA 1FU7A 1QGDA 1Z74A 3PEUA 3K32A 5CCDA 1I7DA 4CETA 3PYMA 2C5EA 2YY5A 5JNTA 2GN1A 3QP9A 2AFHB 1L4BA 1OASA 4Q4AB 2J87A 2ZDGA 3PRKE 4RVUA 1G21E 3B1XA 2R11A 3C3EA 3NHFA 1YOVA 3C8HA 2FRDA 2BH9A 3EEBA 4KRXA 4NBUA 1HKHA 1PL8A 5CNJA 5F2EA 2PSSA 3B8HA 4R69A 4R1TA 2XSZD 1TMGE 1ZXLA 5ALNA 1XHEA 1VSUA 2PG3A 2GF2A 1QIEA 1JBKA 3Q1LA 5H9VA 3MSCA 2Y0EA 5IDYA 2F2TA 2RGUA 5B55A 3ZYCA 2ZAGA 1L5QA 3VGPA 1LNZA 3JV7A 4LV6A 3O8BA 2DUUA 4RW0A 2H17A 3MWDA 2FNAA 2Q5HA 3T5AA 1YVEI 2WHPA 4M1KA 2HJWA 4DV2B 4RY0A 1K9VF 2CCJA 2OZPA 3CPJB 3V8RA 3DD1A 1EXWA 5IBCA 3FWHA 4DYDA 1JYSA 1F06A 3HO6A 3K53A 1T3HA 1YQDA 3HC7A 2BOVA 4K7JA 2JGMA 4ZO4A 3OZCA 1DMRA 4M1EA 3U26A 4HB0A 3QMWA 4G1MB 3ZWAA 5IWCA 1BA3A 3UWKA 4D4MA 4MGKR 4RHCA 1CQPA 1V11A 1UIRA 4JU9A 1WCXA 1IHPA 3HZHA 1FPMA 1ZWKA 2LKDA 2EQBA 4B83A 3VAZA 1QCZA 4H7PA 2H2WA 4I5EA 4JJGA 3VU0A 3PT9A 2HXGA 3WJ7A 4BUCA 1QORA 4Y98A 4Z2AA 2CXQA 4L28A 5DRYA 4ER0A 3ADPA 3G23A 2E49A 2GJAA 2YFKA 1KA9H 2QJTA 3BWMA 3GJYA 4O4IA 5T6BA 3COYA 1PTKA 1O8CA 2HHAA 2CMHA 1DRVA 1FUEA 2HY7A 2XXJA 2EV9A 3B82A 1AGPA 3JTMA 2CB9A 3DCNA 5BR7A 4CR6A 5C46F 3DTTA 4E03A 2PEZA 4MV1A 4HO1X 4UFPA 2X9LA 3QJGA 3WE7A 4FGLA 4KQEA 4RPKA 4ZCIA 4M60A 3GW8A 3Q8XB 1YMUA 1GTG1 4HS9A 5CT6A 3UJDA 3QKSB 3JRNA 3N6VA 3NIGB 3ENNA 4FUQA 4JEHA 3GRVA 3AEXA 4G9GA 4B48A 2I6XA 4OA8A 4HGYA 5DYYA 5LQSA 3WLJA 2R0QC 4AJ9A 3HWWA 1PJCA 2P5YA 4Y6GB 7ADHA 3ZJYA 1FLNA 2CCGA 5KCMA 5EIXA 4U39A 2OFWA 2AX4A 5EEHA 4EUEA 1KJNA 3FD8A 4MDEA 3HY4A 4GZ6A 4H1WA 4WFJA 2X6QA 5CHYA 2ZYTX 1DAGA 2WM9B 4KBGA 5JLAA 4WKBA 4V1CA 3L1IA 2VNKA 1OU4A 3G2MA 4Z6KA 2H48A 5IBQA 2W6JA 3AT1A 1FW8A 1NVMB 4D96A 3HG7A 1WDLA 3L6RA 4OHRA 4BKRA 1U0EA 1Q1BA 1ZHFA 3NDPA 4M54A 1KEUA 3H11B 3TZEA 5P21A 2MSLA 1J56A 1C3OA 1FL9A 2GZAA 2YL2A 2HA2A 4G1EB 4QELA 4EDFA 5K99A 3QLVA 5FHRA 3EW9A 3LVBA 4O4LA 2QRKA 1BVRA 2X8WA 1Q91A 1SUSA 4KO2S 3WGGA 1IPHA 5C5IA 1OLUA 2D00A 4QBFA 1ARZA 4R2IA 3WQSB 2XGSA 4OYHA 3WWEA 4B2PA 5C8VA 5LWQA 2ONKA 2G3YA 1M9NA 1NXOA 1E4EA 5H83A 2Z5LA 2QT9A 3PDIA 3L7MA 3E03A 3EGVA 2LXNA 4XVQA 4F4IA 4YV7A 1BW9B 3ZDXB 2V7GA 3FAZA 3PDWA 2VR1A 4R2HA 3PEEA 1DB3A 4GI5A 5HJ2A 1YL6A 3L92A 2QWXA 3WRXC 1MOZA 1Y6QA 1V1JA 1RQXA 2Q1TA 3G9XA 3LOPA 1NC3A 1XC7A 2ATCA 4LHXA 1LK0A 1UOEA 2RSLA 3NRCA 4Q4AA 4CFSA 4D0SA 1DOAA 1CJCA 1XUOA 3C5WP 4JX8A 4HAIA 2DP4E 3KR1A 4BB9A 5JMTA 5KSZA 5EUCA 1MO5A 4PO3X 4Z3KA 4UVDA 3H0EA 3QITA 4ADSG 2JF0A 5D3MA 7MHTA 1WMEA 1BMDA 1L1FA 2CEKA 3UVEA 5ICFA 3GC6A 4MNTA 4DR1B 1KI6B 4ZAZA 4DG8A 3NNNA 1VDZA 2FE1A 1E2DA 3GPBA 3D8SA 1VJ0A 5IS2A 4NXNB 1ZG3A 3AKYA 3T41A 4HRYA 4X7MA 2FPMA 3E5MA 1LBTA 2VJBA 3GV0A 3OZVA 1SULA 3PNLA 4B0OA 1CS4C 4RIHA 2Z8YA 1JF8A 2W5UA 5KNDH 1KFJB 1SELA 5CHEA 2FPXA 5JATA 2B78A 5K05A 3CISA 4WERA 2B61A 1VMIA 1QRTA 4YPFA 2XKBA 3RVOA 2TS1A 2O4UX 2WIAA 1KDOA 4LNHA 1DRUA 1QRUA 5C5DA 1GPBA 2FR8A 3AUUA 1YCHA 4E2YA 3F9IA 4G5HA 5EEGA 2LBPA 4I36A 2ECQA 4PRZA 2CJWB 2HLNA 1KPGA 2JI6A 3ZX4A 2B9VA 2FMKA 4QDZA 1SFRA 2BSXA 5KCZA 4R2MA 1I7LA 1EM8B 3P7MA 4LW8A 3JQ6A 1GG5A 4LYDA 3BEDA 4PIMA 1ZJYA 4LRSB 1XZHA 3VZDA 1HOXA 1N0UA 1MN6A 3BT7A 5LQKA 5T5QA 3QNUA 4ZGBA 4HEHA 1BFKA 1EVLA 1U02A 4NK5A 3LSTA 1KO5A 3GRUA 3DFFA 4MUEA 2OLEA 2YNMC 2VRWA 2QRNA 4JB8A 4HLQB 4JIMA 3RJTA 3ZWXA 4ZZ0A 5CVDA 2BJVA 2PSJA 3HBFA 2ABWA 4MO9A 3VNSA 4W99A 3AHIA 4MTCA 1H6AA 4KYVA 3EVGA 2EIXA 1E8NA 1XPJA 2F9FA 1RIIA 1T0UA 4KIGA 5FX2A 3ICQB 1KC3A 7YASA 3I45A 4EW1A 4RKQA 3TIGA 3GAZA 1YJBA 1TA0A 2AEFA 2O5CA 5JSUA 3O74A 3OAAD 2CVOA 2G4CA 2VXOA 4UDXX 3UGJA 1ZRNA 4YDRA 3GJ3A 3FUUA 2BZ1A 4PY2A 2I6QA 2PE5A 3OA2A 4IGAA 4RK6A 3J7AC 4B6PA 1V9LA 1G9SA 4YXWD 1BQEA 2A5JA 3DEYX 3A32A 3KG2A 4UM9B 3LUFA 3QA9A 5FI0B 3G82C 1SCBA 2OCAA 3BFKA 1EK2A 1MABB 2OXCA 4ZARA 2LW7A 3F74A 4WKOA 5TJHA 4MUYA 4YFVA 2IELA 1P18A 1KZ7B 4FLFA 4J1TC 1KEEA 1R16A 3SC6A 3FN4A 4GKVA 1E3MA 3P2OA 3PX7A 1SBZA 3GIDA 1U3FA 1ZNXA 3RADC 1X1BA 2GJKA 5K03A 4K9MA 3PUIA 1V3VA 4RTLA 3RODA 2QTHA 2UZ1A 3O8RA 3KZCA 4ENTA 2Y1XA 4CKWB 3LL4A 1R0CA 4X1YB 4AYTA 4ZQEA 3I9LA 5TVGA 3HKBB 2REQB 3H9JA 3LYLA 2PZGA 2AKYA 2C3PA 3E53A 3H5VA 3WBJA 4LDZA 1T0BA 3DM9B 2I9KA 1YASA 1BW9A 4NV3A 3W2TA 3FOZA 4WCDA 5KO2A 1MH9A 2J45A 4D46A 2H1HA 2ECKA 2GRJA 4FFVA 5F1OA 1Q7EA 3EULA 1GLNA 5TPWB 4Y7CA 3QFHA 1QH1A 3AR8A 5EQJB 5EINA 4HI0E 5ICGA 4MJLA 3C7DB 3EFHA 2VYFA 1JLKA 3GNTA 5C34B 1SH7A 1L7DA 1PX2A 1BD4A 3WNBA 1XALA 2VDVE 2X7JA 1DUIA 3MWEA 3SXUB 1I1QB 3R9XA 5HNKA 2VUUA 5BW8A 2KE5A 2XTAA 2VDRB 3SM9A 1KJQA 2W4IA 3B1JA 3MXOA 3LW8A 2IODA 4C0SA 3RC8A 4IHJF 3ICWA 4RKEA 1VMKA 3V1UA 2PKQP 2VJYA 3DW1X 3KKNA 3D7LA 2P2SA 3OCWA 4HNSA 4RVCA 5ECGC 1TRKA 3ZBPA 1LC0A 3FNHA 9ABPA 3HA3A 2HSWA 4FFOA 2W6OA 3LTEA 1ISMA 1Z28A 3ZCVA 5FRDA 1PJBA 4YT4A 1KYVA 4YRFA 3VDQA 3DTVD 4G0VA 2PGIA 3LFTA 3HV2A 2IHYA 2VH5R 2J41A 3OJCA 3ZQKA 3OFNA 1P7CA 3WYFA 3EQ9A 2IF0A 2H7CA 1VJ1A 1NJ8A 1T8YA 2VVTA 4PS0A 3RIHA 4EJ2A 1LU9A 1GPUA 1ZRSA 2OD7A 2VQ3A 4RY9A 3AF0A 1P0CA 5ISMA 1HT1E 4D74A 1ZD5A 3CZPA 1G20B 3M6VA 4F4FA 1F6WA 1FUUA 4L02A 4HEA1 3VFDA 4FYVA 5HCUA 1SMKA 1FU8A 2NQ2C 1IQ0A 2OO3A 3E27A 1CS0B 2AYYA 3ECSA 3GBSA 5JRJA 2K7FA 1CUEA 2FR1A 5KC8A 1JAIA 3V4VB 5AW5A 1GZ6A 4KFRA 2P30A 2NU7B 5CBPA 1DAHA 2VAPA 3H9BA 1IATA 2NYRA 3E0QA 2OFFA 5BW5A 4KMMA 5E3IA 1OH5A 4I4IA 2F62A 3VMMA 4MS3A 2JHFA 3W5VA 2AZXA 2ZB3A 2GEFA 1BCRB 1BMTA 3RQSA 1AH2A 5KWEA 1A4XA 3ME5A 5A06A 4GPEA 4U3JB 2V8OA 1WY7A 2FSIA 4BRUA 4PSUA 3TW0A 3X44A 5CTAA 2FZEA 2XKJE 3C1OA 4Q9JA 3T1NA 4XPIA 5AW8A 1QU2A 1HEIA 4EIWA 2IZOA 2XUPA 4JL6A 4RPJA 4EGCB 2BC9A 1CUFA 3KVYA 3V32A 5A0TA 3PB3A 5TX7A 2HO5A 3UYLA 1W29A 4RVGA 4R9VA 1KZGB 1FLDA 2P4QA 1WO8A 3MT9A 4IIEA 1TTTA 1GHTA 3EDMA 4IDFA 1VI5A 4WESB 5EZQA 3VO9A 3BN3A 4HZUB 4PTLA 2SBTA 2PYIA 4D9MA 4GC9A 3JW8A 4Q01A 4D92A 4QSMA 5FTWA 5BNFA 3FY4A 1MABA 3FSGA 4R2XA 3ZW8A 4B4OA 2F48A 3DWEX 4ZJUA 3LP5A 2P27A 4K1XA 1REQA 1M5RA 4GZLA 3NCHA 2B37A 4MV5A 1IJEA 2Z6AA 4NCAA 3OPQA 3H9UA 2NTVA 3SZLA 4R8SA 1V1MB 2HLDA 3F5QA 4CM1A 5A6VA 1E9SA 4NJOA 3GWZA 2GBLA 3PWTA 3K0CA 4MP8A 2ON6A 3IA2A 4EEXA 2EZTA 4OB6A 3V2UA 2PUJA 2GN4A 1CZRA 1RZ3A 2DPXA 3I32A 3DWGA 1PKEA 2B8WA 4JWKA 4CI0B 1PGPA 2REQA 4A0HA 1Z16A 2NPFA 3LH5A 4RULA 4JQOA 2VT3A 1Z73A 1KI7A 3BZWA 3IAFA 1E9DA 4LCJA 4TMYA 4EFNA 4ENVA 2FMTA 2ZJ1A 2RHGB 1ONSA 3E5RA 4HVTA 4NULA 2ZUVA 1IRIA 4R1NA 4A6EA 2AFHE 8OHMA 3EVEA 4CT0A 4PNEA 1Z6AA 3BFJA 3GT3A 1U94A 4BFSA 2BMWA 3DNMA 4LOLA 5EXDA 2I6SA 4D8TA 5TPWA 1GARA 2HF9A 4PLPA 1RXCA 3JR7A 2OESA 4HD8A 3JQBC 2ZITA 1D6JA 2FSSA 3EC2A 3EXG1 3MAGA 4P3YA 3UWPA 4K26A 1BX3A 4KC0A 1ZK1A 4KLCA 3TPFA 4C01A 1PHPA 4PC1A 2Q9CA 3HSKA 3K96A 4XUCA 2XTJA 4QWMA 4CIWA 2FWRA 4KQHA 4WJKB 5FBRB 4ZN6A 1IE3A 4L3OA 2DB3A 1T4CB 3FETA 4UE2A 3I73A 4G4SO 4TQGA 3F73A 5BN5A 4FE7A 5EXXA 4HMQA 4X7BA 4UHEA 1EBFA 1ZD4A 3EA0A 4DLBA 4NXMB 2C0PA 2ADOA 3B13B 2J32A 3QVMA 2AUMA 3ECCA 1C0PA 4CM7A 3KQVA 2C3OA 1JV2B 4RVNA 4OQ4A 3NRJA 4Z7OB 3L1HA 1Z0UA 1EA7A 1DAOA 2VLBA 4O63O 1C0IA 4EFKA 1T5SA 2XYQA 1ORDA 2OGZA 2O7SA 5I4CA 1IBRA 1K68A 5DGTA 2W2NA 3N0TA 2DGDA 2L19A 1LKZA 2SECE 2ZBGA 1Y3DE 3LC0A 4MINA 4PZ9A 4RGBA 4WLUA 3TMAA 4XRRA 1VMDA 1QM5A 1YACA 3DPIA 3HRIA 1EHYA 3I92A 4JLDA 5F4ZA 2JFUA 5AESA 5B6IA 2D06A 1R2QA 1DC4A 4BVFA 4ZVSA 3PD0A 3B20A 5HKLA 3E7WA 2J46A 4PW0A 4OLAA 3STXA 2QRUA 5AOCA 1NXPA 5IULC 1Y9JA 3HHEA 1SZDA 3K5WA 5ER6A 3ROQA 1GKKA 3MOIA 4FGUA 2ZRPA 4KR6A 5IAGA 2NU7A 3A7DA 4HNGA 4JJ7A 4LF5B 1Z35A 3M6WA 4KGVA 3DL0A 1NQVA 5TEVA 4QUHA 4IIDA 4C0LA 2BV3A 2Q5EA 1LPAB 2VHCA 3ITNA 1JE1A 4L74A 4D4HA 1BCRA 3I1YA 3E9NA 5IHXA 3CT6A 4JT9A 3A9CA 3LGSA 4M1OA 1FCJA 3QXCA 1N2EA 5KNBD 2JFNA 4U3JA 4G0QA 2UUBB 5A6SA 3T7RA 1MRZA 1VM6A 3I37X 3TQCA 3IL2A 1DO2A 1N3LA 3UUWA 2JEOA 3HS3A 1RJFA 4U63A 4ALIA 2FZLA 1V8BA 3QE2A 1XDSA 3WB0A 2J3HA 5K8JB 5L4NA 4HLCA 4NVRA 5I4IA 1EUCB 1UXJA 2JD1A 3MWKA 4QE3A 4S1OA 1Q77A 4AS3A 4AZ0B 4U2GA 3EXG2 4OYRA 2JGEA 3PHLA 4QYIB 3U2QA 4ZTUB 2Z56A 4D6XA 4M9UA 3WIOA 3GZJA 1VBMA 4CU2A 4B6OA 2HO4A 5ITZA 2W6JD 3GDWA 2CW5A 1DI0A 5FYQA 3RBXA 3X1DA 3TN7A 2W2KB 4TV8F 2XUOA 3F46A 4MQUA 2BLLA 4HK4A 4WBNB 1IM8A 3GDFA 1D8TA 4LMPA 4O2BF 1CLUA 2GVDC 4MLCA 1YE8A 3ZV5A 3W1WA 3GH3A 2MMCA 3GGCA 3IURA 1Z39A 4ARZA 2DERA 3HBNA 3D5TA 1UFQA 2H29A 2ISSD 2W2TA 2ZGVA 5DV9A 5H0IA 1UC4B 5JC1A 2ZIXB 3NNDA 5K4AA 1YFLA 5LXTA 4N41A 1XJQA 4FHEA 5ALDA 4DLZA 3BHJA 1ILWA 5LM3A 3TFOA 5EJFA 2FP4B 4TRMA 3ZQ6A 1WUYA 2C4WA 3R7WB 4CQMB 1LH0A 3FBTA 3NVDA 3TBFA 4CWAA 3NFYA 5LDHA 2PL1A 3L6CA 2ZIWB 2WAOA 3LWZA 5F23A 1AHPA 5CLFA 1A9SA 1PZXA 2PZJA 4LYJA 2N42A 3WNCA 3RUDA 4L5JA 2X3FA 1MV5A 3O2QB 4LXUA 5KVQA 3M33A 1PFWA 3VVLA 2NZVG 4JT2A 2R86A 5T7BA 2WUFA 3V3KA 4HVCA 1EP3B 4TMTA 1Z4OA 1L4UA 1LJUA 3GA7A 4I5GA 5BYKA 3WIEA 1N3IA 2Q0HA 3HVKA 4YDHB 3NM6B 1MV8A 3O6VA 4H3SA 4ND3A 4B76A 4EPTA 3E8XA 5AT1A 2HIAA 4QBIA 3L01A 4R8LA 4D80A 1L2TA 2AR9A 2D8AA 1SVSA 2TSYB 3G5UA 3ZKAA 2JCSA 3EIXA 1UKEA 3A31A 3CC8A 3MBKA 5B37A 1Y82A 4H08A 1UJ4A 2EZ4A 3Q5GA 3WNDA 4GBED 3WLEA 1NXTA 3ACBA 4Q1VA 4URFA 3LP8A 3UC5A 5IYZF 4ZK2A 5KWVA 5LN1A 3B3JA 3K6KA 4UEKA 4LRUA 4E5UA 2I1WA 1YR3A 5TF4A 4E7OA 3G9UA 3MUOA 1E7MA 3LIIA 2ZB7A 3B9QA 1JQ5A 4IIVA 2EWWA 3QYJA 1ODIA 1TU0A 3CU5A 1YO6A 1L9KA 2XE6A 4NYMR 4TTAA 4KHPB 4PTYA 1KMHA 1B2RA 3JWGA 1VFPA 3PYXA 3KQKA 1WP4A 4GYYA 1B76A 2G77B 2X9VA 2DFDA 1D1PA 1NVUQ 2XVYA 3D6NB 5GZ3A 3PFNA 5AIBA 1L4GA 4BO1A 4R1QA 4W5TA 2DPMA 3LECA 2G09A 4NCIA 1ATZA 3X1ZA 2GUWA 1RQPA 1BCSB 4KI7A 5KYYB 3K0HA 5NULA 4UM7A 2WM2A 1MBZA 3LUBA 1L5KA 3RU3A 4C08A 1B42A 2O2YA 3VTFA 3Q88A 2NUPA 3OE5A 2DPHA 3ESAA 4AULA 2F43A 4IDQA 4XCQA 1OYWA 3EH1A 4V3CA 3RUHA 4E13A 4D4LA 4UU8A 1GR1A 1RXSA 2X0JA 4G0OA 2VQDA 1YA6A 1IBMB 1E6MA 3NG1A 5LVAA 1UC8A 1QH8B 3T3IA 1B74A 1QHSA 2GJSA 2P8JA 2XCIA 3L1JA 4O2AA 5HPYB 2BH2A 1Z5WA 2YWEA 3L5OA 4UXIA 1GKYA 1T43A 1U5BB 3THXB 1U9IC 4OK3A 1VLHA 4ZVPA 3JYPA 3BE6A 1UQTA 4KMOA 1Z7GA 2FPOA 4RJLA 3WWZA 5F98A 4JAVC 5L4SA 4LQCA 1N5IA 1OA1A 2ZYIA 4EKYA 3PHCA 3AI2A 4MKRA 4IEFB 4A1FA 3HJFA 4OATA 4HNTA 3GQBB 3ZV4A 1P2UA 1EUCA 3FWZA 1SG9A 4P35A 2KX7A 5ALKA 2FW9A 1ESMA 2ERYA 3WLFA 3WLQA 4F04A 2JATA 3GLUA 3HN7A 3ZYZA 2YMQA 3N2KB 2Y1OA 2QD3A 2UUOA 2YHSA 3W6UA 4OI0A 3WRXA 4WY8A 2W6CX 4FSXA 2Q1YA 4JGIA 2QLTA 2YN0A 4HN9A 5E3JA 2R6HA 1FTGA 4MUIA 5BRJA 4XDGA 5DTQA 3QHPA 4WBNA 4HKTA 1WVIA 2HSEA 3I34X 4RQUA 1ZK0A 4N3GA 3OU6A 2ZBQA 2AF4C 4AZSA 3QSYA 3RABA 1JB1A 2WDPA 4F9GA 1NKSA 3WLSA 4PZUA 3SAJA 1J5XA 3EEOA 3GELA 3KPJA 5DVZA 3K9FC 1X7ZA 4QGSA 1F8FA 2E4WA 1SWVA 2YYZA 5G0WA 5HUJA 3GCXA 4JZYA 1DNPA 3ZJTA 2XYGA 2GHTA 4A6PA 1L7EA 3ZGVA 4AAYA 3ADCA 1HDRA 4QXRA 3ZWCA 2FJUA 2E9SA 4EY8A 3USES 3R7WA 4CQMA 3QOXA 1QNFA 4BNZA 1XCOA 3DMRA 4UZEA 3GROA 2E6UX 2O0HA 2QTCA 1UBSB 4BV8A 3KKMA 3HR8A 4BNWA 3OO0A 8MHTA 1U6KA 2VJDA 1KRWA 4JWTA 4MB0A 2ZFUA 4JB0A 2X0EA 1HF3A 2BFMA 4X60A 2GD1O 4LJ5A 4DXAA 3GXBA 3AYZB 4C5BA 3FX2A 3M1YA 5BNIA 1PW5A 3C24A 3KOOA 4UTXA 1WX1A 1FP1D 4IX1A 4LHSA 2P4EA 1IOWA 3AUYA 4UUBA 2XE4A 2HBZA 2OENG 2DUMA 4EW2A 1RYNA 1EEXB 1GEEA 2ZUUA 3BSFA 2R7MA 2A6PA 4Y2QA 2ZSIA 3OQJA 5LOVB 3AU9A 4LY6A 3CSDA 1Z0IA 3HK2A 2JZNA 4GS5A 1ZCZA 3EQ8A 3ZJ4A 5EJ5A 2V7EA 1EQAA 1E2LA 2RC5A 3DMNA 4PRKA 3IUSA 3A4MA 2KSQA 2YNMA 3VKFA 4F12A 2VPWA 1BN7A 4OLBA 2WKSA 1Z06A 2JFFA 1S3FA 2XQGA 3LCUA 3LQKA 4G41A 4RPGA 5AK6A 2YBEA 4TUYF 1DEOA 1MC8A 3HZOA 2VWHA 3G0GA 1N9GB 3OFND 3PXCX 4MV6A 3S2YA 1IN5A 1I1HA 2QXYA 4BFXA 1IN7A 3AETB 2YHIB 2OORC 1W8DA 2WD9A 3VR3A 2HRBA 3IPAA 1BMQA 1GQFA 3S40A 4ACBA 1POWA 2VT7A 4KQ9A 4WEQA 4DA4A 2CD9A 1VKOA 4MWGA 1AK1A 3OX1A 5TIIA 4HN4B 3FNFA 3DO8A 5GP1A 3NP9A 5IG2A 1YHZA 3SDSA 3KS9A 3LLUA 4KWIA 4RF2A 3IDQA 1YVRA 1BCSA 1DTEA 1T8RA 2YJGA 3KCNA 5DNAA 3RU2A 3OIWA 5KYYA 3LAWA 1PWZA 2ZIFA 4GVPA 1MNAA 4QDJA 1N9KA 1UXIA 4NF2A 3FLAA 1K7EB 3LE8A 3SHVA 2BKLA 1GU7A 2P9BA 1QQTA 3R0JA 4NP6A 2EIHA 2P69A 2IW3A 5LNK1 3QWBA 4QICA 3C8DA 3QU5A 1YDHA 4OF4A 5KSPA 3B53X 3L4SO 2ONJA 1Z4JA 3ZHSA 4B7AA 4JI3B 2GYWA 2FXVA 2YXLA 3ISJA 1U5BA 4M8LA 5CIQA 3I5XA 3THXA 4IIJF 1QZXA 4Y2PA 4XGIA 1K7XB 2AHOA 1C3VA 3BQ9A 3PIDA 4QPZA 5REQB 4F5EA 5CGZA 4KN6A 5CA1B 3Q9SA 1RWVA 3DKIA 3I28A 2WYOA 2ZQYA 3GQBA 2QIPA 4Z4HA 4FDUA 2PT9A 5CW2A 1J0CA 3M70A 1AQYA 2R8EA 1YS9A 1FS5A 5GTDA 2V1UA 2BVNA 3UXYA 3TG8A 3I2GA 1UPBA 5SY6A 4MI9A 3CEJA 2QN7A 2UV8A 3ZWOA 4DR6B 2R1TB 3O31A 1X0XA 1EHIA 4UM9D 2DR2A 1OXBB 2LUOA 4KQXA 2P77A 3FSGD 3BF7A 1WSWA 1M2VB 4BOYA 1H9AA 2HPHA 3H4MA 4NH4A 5KDLA 2WBLC 5CFZA 3G68A 3ER9A 1UWLA 4ITUA 3CRZA 4RABA 4I1OA 2HNAA 4INJA 4X91A 1JEOA 2WZQA 1SQGA 2C5BA 5DDIP 4MLZA 3ZHBA 2FX2A 4LV5B 3UQZA 4CHTA 1JX6A 1USWA 3M5WA 4MLDA 2HLDD 3EIOA 5DHRA 4JFRA 4A2CA 3UUEA 1FF9A 2QV7A 3FYHA 4XFKA 3RSGA 2EJBA 3OFSA 4B85A 3P9PA 2VS1A 3JY6A 4UAVA 3PRJA 3CZ5A 2K7ZA 2WEKA 4WK6A 1NIPA 2GARA 3I5AA 4AJPA 5MN6A 2G88A 3A4VA 1L5HB 5ALFA 4MGHA 2XZPA 4MLPA 2I2XB 1H5QA 2JGJA 3GVCA 1Q22A 3RB8A 2JDID 3SDZA 2JLYA 2MHCA 5ELXA 1N2GA 2IDJA 3F6EX 4L2IA 2CLMB 3W1VA 4Y0AA 1GPWB 4IOLA 3SC4A 4DQUA 2Q3HA 4MQBA 2NQ8A 3UZUA 5ITSA 3MTAA 4J91A 1AUXA 2RK4A 2IYXA 5GQSA 2VSOA 3GZNB 3PXDA 3RASA 3U3DA 2X9NA 2OBBA 4F92B 5ALUA 3K20A 4NV1A 3BRSA 2CWWA 3TE6A 3ST7A 1RRKA 1PR2A 1CY2A 2BGWA 4HOYA 1MC4A 4AJIA 3BAFA 4OYLA 3LK6A 5DEOA 1L4HA 1WAMA 2Q46A 3R3XA 3IOYA 2COEA 2UYOA 1SUWA 5CAEA 4JSYA 1ODCA 1OBOA 4AW9A 3KQHA 5K0SA 5GADl 2H16A 3R5XA 3T3PB 3OECA 4KQKA 4OBXA 4JU8A 1OCEA 3SVTA 2BTOA 2AFVA 3ZI0A 2YV4A 1XZCA 2ZWPA 1LWOA 3AKCA 2I7TA 3UFBA 2XTNA 1S96A 221PA 1VRCA 4J7UA 4NYIR 4ZV7A 3RNOA 2EP8A 3CNNA 4MP6A 4TKZA 2XRMA 3WYNA 2RBKA 2JGAA 4NL4H 4FMDB 2PV7A 4EKGA 3H2SA 1N9GA 2LDBA 3L7JA 3AETA 2X76A 3KD3A 1CDDA 3OLZA 2GAIA 2A9FA 3IDZA 4Y1FA 3UOGA 3VKUA 4BO4A 1J0DA 1HZZC 1KU6A 1XZKA 3HCBA 1T4MA 2PH5A 2JIQA 4YI5A 2WOJA 4GI3A 3WDSA 1YVPA 2I2DA 4XLTA 4FVTA 3IEMA 3PITA 5B1SA 1A88A 5CB4F 1P7WA 1NNI1 1SHLA 2XUZA 3RNLA 4B3BA 2B82A 2YOFA 2WWGA 3TCXB 2XCTB 4I50B 3D1JA 5K0GA 1M8KA 4F4CA 1G5TA 2Q0SA 4IEEA 5DWQA 2QBYA 3DF7A 4R41A 5JCXA 5I3CA 1ZLXA 5JZVA 1Q20A 1S8NA 2HMSA 3EEQA 3W4KA 2W48A 3OQOA 1VHQA 4XD2A 3U60B 3ETNA 5KYXA 1O5IA 2R00C 3EE6A 3HL4A 5A6SB 4BV2A 4WAUA 3IR5A 4NYMQ 4EYEA 3ETCA 3CTPA 2HA7A 4IMJB 1R0LA 1R8YA 1CDZA 4CUJA 1A4IA 1RLTA 1WCIB 2CDCA 3HNPA 3EWNA 2HIGA 3SF0A 1I9GA 3OEYA 1LK7A 3MC1A 2C8VA 3S2IA 3ZW9A 3U5ZB 4KXXA 4UDNA 2ZRIA 2OILA 2GPNA 3OOSA 1HEYA 1Y42X 4IJ5A 4QODA 3NONA 3PEWA 3WFZA 1SOMA 3CNEA 1OBCA 1E5VA 1PWYE 2GRAA 3D6MA 4FONA 2VK4A 4LS3A 4U4AA 4CM4A 3FLMA 1C0EA 1JSZA 9LDTA 2C7OA 3HDJA 1YBFA 5DO9A 4X45A 4O59O 5F1PA 3AEKB 3W7BA 3DDHA 4D4GA 1YONA 1B14A 3UUGA 4DUGA 1Q83A 1R0KA 1Q16A 4DLRA 4IIXA 1KJ9A 1SPBS 2GERA 2R1TA 1U0JA 4LCBA 4OQPA 4QG7A 2E4XA 1C8BA 3HN2A 2UVPB 3GGDA 3JQBA 3GOHA 2V7XA 3DVAB 3HNRA 1DG9A 1FTYA 2F8LA 2HT6A 3A9TA 4O1HA 3WGHA 5AVTA 2GQ0A 1WXWA 4KOAA 3R7AA 4DV7B 3VHRA 2XJ9A 2AOVA 2ERCA 4WLFA 3H4IA 5JAUA 3DEIA 1KIAA 4Z8YA 2HNKA 1A9RA 1U8EA 2HQOA 3VPCA 4AZVA 1EWRA 1P31A 3BBPA 3QQ5A 2CMGA 4WUTA 3TLEA 4JQSA 1OLXB 1EQ2A 2Q62A 3TKYA 3HL0A 3KYDB 4QAQA 2FCAA 1H69A 4ZEWA 4COKA 3ILSA 3COSA 1LY1A 2ACKA 1QQ5A 2WJIA 1RXEA 2JBAA 2XGGA 4O2LA 4XIYA 4FOTA 4AY5A 4CIAA 3D3KA 4W5RA 2C8JA 1L5HA 1MDBA 5KDDA 3QVGA 2JNWA 4C4XA 1SVWA 2K6GA 1P5RA 2MWMA 3Q9LA 1LGYA 2GN6A 4CNBA 2YQ4A 4HPWA 4KLRA 1ST3A 1RNLA 1JYFA 1OI7A 1QLWA 4K6CA 3NKFA 3NOVA 1CQXA 4C29A 4Q02A 2XBMA 3ABZA 3GZNA 5EIFA 1I36A 1JMVA 1FRFS 4RSHA 4FS8A 4XUDA 5D87A 5TT1A 4JBYA 1J00A 1LNSA 3C3DA 2OGSA 3GEIA 3M6LA 4OMCA 3RVRA 3V6MA 2GXQA 4CT4B 1U7PA 1QAOA 4V0OA 2UVQA 1C0KA 3K73O 4RIGA 2GYVA 3T4PA 2B6HA 1TYAE 3FDFA 3NGMA 4RHTA 4C4ZA 4DLLA 3LJKA 1M1YB 5BVHA 2C9MA 3TPCA 3BH0A 3KZKA 4BLTA 3EHEA 1ORRA 3SZRA 3GJ6A 1NQTA 2HSDA 4ESHA 1VL5A 2DWOA 4F56A 1P74A 2OGTA 2V7PA 3L3BA 3FHJA 1UZLA 4ZO6A 2R62A 4L4YA 1T2FA 3SP1A 5JISA 4WADA 2VDMB 1EX7A 3D6AA 4YQFA 1FJ2A 1Q15A 1SU8A 1V7PC 1TA9A 4BGUA 1SKYB 1UFRA 1XXHB 4ALJA 2Q3MA 3EGOA 3U3OA 3V2HA 5L4LA 1KTIA 3EUWA 5CG1A 3KQTA 4TLAA 5EKUA 1NQOA 3ANLA 4JV5B 2ZYGA 4RCYA 1U4SA 2ETVA 3C3XA 4PLVA 4BX0A 4D0NA 1ESEA 2QYSA 3C14C 3ID6C 4X20B 4R8RA 4RM3A 5AKLA 4F2DA 5IW8A 2DEUA 1KOJA 2ZZNA 4HZGA 2O3QA 1P1JA 1ZXXA 1GU1A 1RPAA 3TX2A 3WGLA 3MUFA 3UGTA 1X7DA 4I50A 2EERA 1E98A 2Z6UA 1TVEA 2PY6A 1ZI6A 1SHUX 2YZMA 4C05A 3F5DA 1ZH0A 1NQ5A 1Z12A 2GGSA 3G5AA 4Z86A 3P0IA 4DMGA 3QNMA 1V3QE 3NPMA 2XKAA 5HILA 2VDQB 1E7WA 1XZNA 4ON9A 1JDBB 1HLPA 1Z88A 2V4ZA 4HPXB 1LLDA 3LUAA 3ZHQA 3FIUA 2ID7A 4MVJI 4F38A 1TAUA 1TO2E 4BO2A 3QVWA 4DQDA 1BN6A 4Q34A 3KLOA 4PGFA 1W1WA 4FILA 4OQLA 4ER3A 4D3ZA 5JJLA 3HJUA 4B3MB 1R0ZA 4HAXA 1LNQA 4HQNA 1L8LA 1E9FA 1F9AA 1TK9A 4JODA 5JAHA 1MJHA 1MVNA 3M9WA 3P2KA 1GYPA 3HVIA 1PFQA 5FBKA 5D3QA 3LDGA 1Z8DA 4GXQA 1BE1A 1JQLB 4YBRA 4EYQA 1M72A 2VA8A 1PJTA 3EBLA 1OV4A 3OZGA 4TMZA 2C0QA 3G1UA 1IAQA 4WFKA 1MAUA 2C4TA 1EJ2A 4L08A 3S1LA 2PJZA 4PZAA 4UUQA 4AJ4A 3ZKWB 3GLIB 2RAUA 4I2NA 2BBOA 3LZ6A 2IEGA 2C0CA 3KOYA 2XZLA 4ETMA 2GXUA 3ZBQA 5C4GB 3TCKA 1ECJA 1E94E 2PMWB 2JL1A 1WULS 1IVYA 3DVAA 4KRYA 4NG5A 1T0PA 3SZMA 2LR0A 4YAFA 4GUAA 4AWAA 1Y63A 1Y1QA 1XMPA 5CDYA 4A8JC 2PBRA 3ENQA 1U3TA 3EDOA 1RMYA 4L9WA 5B7GA 2VCYA 1MG0A 1NUHA 2H2HA 4N01A 1D5WA 3HCWA 3MCWA 1PHRA 2LKCA 1JB9A 3KYDA 3PNQA 5H1YA 4BGVA 1ZNWA 1PN3A 2FPGA 1GJRA 1II8A 2GCOA 4FDMA 3GMIA 1YA4A 2OHOA 4CQMD 3WLKX 4R1OA 5PNTA 4RE5A 2H9IA 4EY6A 1T8TA 4UNNA 4U7DA 4V0RA 1AMNA 3EJ6A 1N6OA 7REQB 3DDWA 1RYMA 1IQPA 5DHPA 2RJNA 2VC2B 4XWTA 3BB1A 5FPQA 3P4YA 3A14A 3EXIB 4GOKA 1FUIA 2I4RA 5CJ2A 1P0PA 4V2IA 4M4SA 2JKZA 5CLIA 3KCQA 3SS8A 4C21A 3PL1A 4JLKA 5FWDA 2GBCA 3DE3X 4HFRA 4YJHA 2G9UA 3SI7A 3VH3A 1CJBA 1W4CA 4L4ZA 1I5OA 1TF2A 2IITA 2X2OA 1HDZA 4IXDA 4Q1AA 4C04A 1D7OA 1CULC 1N5MA 2R65A 3C6ZA 2REOA 3Q7SA 4RZ3A 1M1YA 1R9MA 1E32A 1Z7YA 1MXFA 2FEWB 3BERA 3PC3A 4XCVA 2IEYA 4MRPA 5AKXA 2NTEA 5ED4A 1KWGA 3HJHA 4WTOA 1UPFA 2JIBA 2VTBA 4GBMA 2HK9A 1EK0A 4Q05A 2XAUA 2YNMD 4UEWA 1M6EX 4O02B 3U4GA 3UT6A 4E0BA 4R0MA 5EJ9A 3QE9Y 5IF3A 1U9IA 3BIOA 3AI7A 4URUR 5FXMA 2G0NA 3UOAB 2IVFA 4BRSA 3VISA 1XXHA 4G1CA 3KKKA 4QNMA 1XTSA 3KZVA 4MVYA 1ZJ5A 3VR3D 2JC3A 1UODA 4LJYA 2A78A 2I91A 1Q84A 4KK4A 3SSMA 3KKLA 1W73A 4Q4JB 2Q6OA 1ZO8A 3EMVA 2C9OA 3ZU6A 1UBMS 2V3WA 1A4UA 4MJ7A 4X20A 2D0OB 4B43A 2I29A 3A9RA 5JAPA 4P53A 2O19A 1YZNA 2X58A 4Q1BA 4ZI7F 5EIEA 5CVUA 4XVCA 4GBGA 1BXGA 3OQ6A 3P9RA 3AWIA 4RH0A 4NYIQ 4FXPA 5HWSA 1BKSB 1G3UA 1V5EA 4W6QA 4MPPA 3DP9A 3B2NA 5DCUA 3PVCA 5IUKC 3ELDA 1WOYA 1UR5A 1WQ3A 3OLQA 4HMPA 3NBAA 4ZCTA 1U7TA 4GECA 3G8AA 4PRYA 4F06A 3FFTA 4JN6B 2E1RA 4RIEA 5DOZA 5C3MA 5G1NA 4FI3F 1VJRA 4A1OA 4BGEA 4F5WA 5KNDA 4XUEA 1D4OA 3ICVA 1E2MA 2I3AA 5HKOA 5AQEA 5LC1A 3JYHA 1SKAA 4UNRA 4DARA 2V1XA 1MT0A 4CG1A 5B36A 3G02A 4XX0A 2H5IA 3E2PA 5T64A 4MV7A 4E33A 5KMGB 3O5AA 1GD1O 3ETJA 4C7BA 1UANA 1WB4A 2YC4C 4LZJA 1UK9A 3ER8A 3H5RA 1I8TA 2F8MA 4Q37A 1AUOA 5LZ2A 2BMEA 3AG5A 4HJXA 2IYEA 3UMGA 1QMGA 3ZKWA 4BKOA 3E2IA 3GLIA 4Q9KA 3BGVA 4AI6A 2Z3VA 1OIXA 2O3RA 2A67A 1C4OA 1UKAA 4H31A 2IKQA 3CJRA 4M2LA 4EW3A 1MUUA 2HWYA 3MTIA 3ND5A 5E7JA 2OZVA 1K97A 1G2OA 4CLXA 1K0FA 1ONNA 2A59A 3DMGA 3ORFA 2MCFA 4BAGA 1ZK2A 1CZNA 4O3MA 4HRXA 3FR7A 3WFIA 4ZO7A 3FOEC 1EKXA 2XEDA 2NIPA 2ZBEA 3GRCA 2J4CA 3IUPA 3M9LA 1U7DA 4LOIA 3WL7A 4QWWA 1UPXA 2EZ9A 3VYTB 2RGCA 2H4JA 2WNIA 4OLHA 4AK9A 4B6GA 1U31A 2HYDA 5BT8A 1R0WA 2ZVQX 1YZLA 5AM4A 4QYMA 3C6YA 3TIXB 3FKQA 5F21A 5CD1A 2OHHA 5K09A 2W2OA 1SHJA 3L8GA 1JALA 3C5CA 1JFSA 3AW8A 2D1QA 2FUCA 2FR0A 2IDZA 3FYUC 5AM1A 3UJ3X 3KUDA 4UTRA 5CT8A 1NN3A 4XB6B 3NAZA 1NVAA 1ORIA 5MHTA 3V80A 4HWRA 4JP5A 5CT4A 1DBSA 5E9JA 3RRMA 1P3Y1 2IV2X 3EXIA 1OBVA 3K3PA 4CM9A 1C7QA 1RI4A 2HA5A 4AN0A 4ZGWA 2W2LA 2ZZMA 5F9FA 3A6HA 1JI0A 2OHVA 2EP5A 2CCKA 2IHVA 1LVUA 1ZBQA 3UWDA 3VVMA 4K05A 2FW8A 1I0IA 1QWOA 1ZJ4A 2WKPA 3AR5A 1NNEA 3KSMA 3U16A 4MUFA 2KM1A 2Z30A 5C2JB 3DHYA 1WMAA 4QT0A 4DNFA 1UDBA 3W5IA 4AMYA 3EYWA 4BUZA 1FDOA 1Q2UA 3CEAA 4JI4B 3JWIA 3OSUA 3ZLBA 2FPLA 5HF6A 5DM0A 2GKGA 3DMPA 3I4CA 5K5EA 4KKVA 1WY5A 3TZBA 3G9ZA 4B8ZA 1U1FA 1SY7A 1ML4A 3MT8A 5CP8A 1IBKB 1MORA 2H3HA 2FEMA 1T13A 4MDHA 3CUWA 3FUXA 2A9RA 2FFHA 3DW3X 2FN9A 3AG6A 5AHKA 1E4YA 4E5NA 2Q2WA 3GMTA 2LD4A 4Z99A 5BQPA 5CFOA 1XNQB 4Y67A 2IXGA 5K8VA 1W2GA 5FFNA 2FLVA 3F97A 4DREA 1PO7A 3AF2A 1FTSA 1V39A 1RCTE 1XHLA 3ISVA 4MHSA 4EZIA 3U4CA 1CXZA 1HZJA 2ODNA 1FDVA 3B3QA 4M7PA 3RC2A 3DLBA 2C59A 2JFYA 3BJZA 1M83A 3OQMA 3RPEA 3EGEA 3VZBA 2PKRA 1YCGA 3DVRX 3RSQA 2VDJA 1KQNA 4NQZA 5GOZA 4AXXA 4N7BA 4DN6A 4NBLA 4EHBA 4BC0A 1TEHA 3GP5A 5AVOA 4UDYX 1SQSA 3R44A 5FUXA 3RWOA 4WLEA 1BYUA 5LMCA 1UAAA 1KAGA 3FCOA 3WL4A 3EDCA 4RCZA 1ZGCA 4G0XA 3SR0A 2J0UB 3E84A 3FKSA 3QF7A 5LD2C 4YLYA 4M8IA 4FZJA 3KLNA 4HGNA 2CJYA 4S12A 3LS2A 5COBA 4CKYA 1O54A 3N5CA 3H8WA 1O96B 2YYSA 1KK3A 2P5TB 1IVNA 1VLJA 2W2MA 3MD0A 2PUGA 4C7OB 3L7CA 3JVIA 1AGRA 5TQ2A 2ORIA 4KGZA 1L5MA 1JAXA 5GONF 3KLBA 3GFBA 3V34A 1O0BA 1N1EA 4N3BA 1LS6A 3KKPA 2V9PA 1GO2A 2O8BA 1TQHA 2BFAA 2BUCA 3KKQA 3HR4A 3U4AA 4PZEA 4P3PA 3PX2A 5FNVB 3UJ9A 4F46A 3D6VA 2QDKA 4P4SB 4DUGD 5JAZA 4RJTA 3ROPA 4X7PA 1OZGA 3RAFC 1MC5A 2BAGA 2HL6A 4RPIA 4FHGA 3REFA 2XZTA 4HN2A 1DDGA 2XWQA 5DYTA 4ND8B 4TLMB 4WZZA 1VLMA 3Q2IA 4MRRA 4YP1A 1NAIA 2I1VB 2RGNC 1C30A 1T15A 1NMXA 2GZHA 1YZ3A 3TTWA 4D97A 4HQ6A 2Z2IA 2XCRB 1PGJA 1M1XB 3VU3A 1JFFA 1GZUA 1ZEJA 2IOHA 2PMKA 3ZE9A 3C6XA 1JPVA 5LLSA 2BMFA 1G6Q1 4MV4A 2GEUA 5DLYA 3TLXA 2QP3A 1CEXA 3K09C 1JHDA 3OWHA 2CZGA 5EVCA 3L0ZA 5FIUA 4QTYA 3W8RA 3I9OA 3VRHA 1LTHR 3W6PA 2GFHA 4GM0A 1XCGB 3N76A 5EZ5A 2C58A 4RVOA 1JW9B 2HCTA 4X54A 3TL3A 2I66A 3PUKA 1QYDA 3D3EA 4KQJA 4PGMA 5IC5A 5FF9A 5KJ1A 1SCDA 2IU4A 2BI8A 3QQPA 3H2BA 3RROA 1V0JA 3PZBA 4I5FA 2B4KA 4C2AA 4YAUA 2OQ2A 1M2GA 2WU8A 2WFAA 3Q5EA 2GAAA 4OP2A 3EAGA 3RRJA 2VJMA 5IJ0A 2X13A 1YQWA 2HJGA 1K92A 2IZ5A 4K0RA 5J43A 2CT8A 1GNQA 1HZZA 1HGXA 1CTQA 1LZKA 2A4MA 3TNFA 1J22A 4XYMA 4DDKA 3MINA 4OFXA 2COUA 4E94A 2ATIA 1K6XA 3AJEA 3B7WA 3C39A 4KBYA 4Y0NA 3OCVA 1ABFA 3TSYA 4G6ZA 3FFXA 3NT4A 4JB2A 3RK4A 4TZKA 3U1VA 3ZD8A 2B4QA 3KAKA 1E4VA 1M1YE 8ABPA 4L0CA 4G2TA 1GNLA 3I9V6 3PFIA 1RR6A 1D7AA 1V8ZA 1SVOA 4C0HA 1T2UA 2YFQA 2QVYX 1U1EA 3DKVA 2R00A 1XE3A 3I2KA 2NYUA 1SQ0A 4HXEB 4QYSA 3CSUA 1K5PA 4J1SA 4S0ZA 3QKRB 4RADA 3TLGA 4QOFA 4JR1A 2BJWA 4MUGA 3NATA 4HWTA 2B1GA 4AS2A 1SKYE 2POCA 5TMPA 3HKDA 5D1HA 1XXHE 3BE8A 4CXMA 2I80A 4J2HA 3OTOB 2BFBA 3I3SR 4Y2HA 4YAJA 4N0DA 4YMSA 3I6ZA 3B5JA 1D2CA 3WXMA 4YUAA 4BS9A 4ESVA 5EL0A 4WZAB 2YQZA 3BTVA 3LM8A 4HDMB 4ABTA 2WNHA 4TN1A 1FFWA 1JEAA 2GZ3A 2QW1A 2V4MA 1IM2A 1EWKA 2VDUE 5HM6A 3H1AA 1I10A 2CV0A 1RDFA 3AONB 3OUZA 4HTFB 4M21A 1GGVA 3CKLA 4X63A 4MB2A 1JKJB 2NSYA 1TVCA 4FEAA 1IBSA 1BSVA 1SOVA 3ZXXA 4Y9TA 2C5GA 5EXTA 5C0OE 3SVLA 2ID8A 4Z3OA 5HA5A 3CVXA 1ODFA 5FA6A 4A4DA 3E48A 4O4IF 4UXHA 1Q3TA 1RHUA 1AKUA 1YGPA 1XEAA 1I7PA 1L5RA 3QBEA 1CW2B 3NGLA 1JPUA 2PS1A 4BU0A 2IJGX 5F73A 4FE3A 2WP0A 3EPPA 4N7MA 4RA6A 3IBGA 4GO1A 3F0TA 1IXRC 1P2SA 2C2BA 4L5YA 2J0UA 3MTJA 2AV6A 1HXHA 1KOFA 4XR9A 4F2WA 2RHTA 1ECCA 5DTMA 1XTKA 2ZSEA 1O96A 2PQMA 2DAPA 3PK0A 2VHJA 4P3OA 4RYDA 4QO7A 3V8VA 2Y1WA 1D04A 1F9EA 3EUFA 1WXQA 4LISA 3N3BC 1BE8A 3AIOA 3Q85A 2G06A 3C2QA 3E3OA 3OU2A 1CK4A 1L6IA 3IUQA 1CD5A 2Z83A 4Q12A 1W1IA 3L4KA 5FNVA 3GLIE 1BAPA 3WBKA 1V26A 5B57C 1IOVA 4WXHA 1CDEA 2CMFA 2G72A 3QYFA 5LDGA 4PEVA 4E21A 5A4AA 2JCXA 4GLFA 4ISBA 4QATA 1V6AA 4K9NA 3RTAA 1ECBA 1MOQA 2X14A 1S2MA 2Q9BA 1GZ4A 3ITKA 3W5BA 1JNYA 2PT6A 3EZFA 4HC4A 4EDHA 4MRSA 5EKTA 1NJSA 1DO0A 1P4HA 1RFLA 1SEPA 2B0CA 2DBVO 2FSFA 2SCUB 3GVPA 4MJXA 4PSKA 1SB8A 2AC2A 1GUAA 1O95C 2WM8A 3G1WA 4J90A 2IXDA 3I53A 4NRDA 4UUMA 4D0RA 1J8YF 1NQWA 1NW3A 4WQMA 4J3NA 5BMVB 1DBVO 2ZDHA 3F4BA 5J2TA 1E9EA 3HDVA 4A73A 3P5BA 1IY0A 1SIOA 3HLYA 1E1RA 4JZKA 1Y5IA 4NPCA 4RBNA 3L4BC 2G36A 3VHQA 5TR9A 4G1BA 1X7XB 3D7KA 5DU2A 3HJRA 1A77A 3JALB 3AEZA 4YMWA 3L8ZA 1B3BA 3ONFA 4NMHA 5KJCA 3H6HA 2X0KA 3SXJA 1TFRA 3QEMB 4M6WB 3RVLA 1CEEA 1ZOLA 1DS6A 2Q2OA 2JI4A 4MAMA 4IKEA 2PD4A 4X71A 5A5EA 2XDQB 3WB9A 2BBWA 3AI3A 2EU8A 1PSDA 2X8JB 4JP1A 3BILA 1TD9A 5AHRA 4JQZA 9MHTA 1K4MA 5C8DA 1CJKC 3HRHA 4TZ0A 3LX6A 1IN6A 1WXDA 2GCIA 2R8XA 3COVA 4KAAA 4URWR 3VNRA 3THWA 2PJRA 3H4VA 4C6HA 3ZY4A 3ZTYA 2EYUA 1E1MA 3C16C 5LB4A 3H16A 3TRIA 5IJ9A 1X13A 3ZR4B 2OMKA 1DP4A 3HI4A 2XXBA 4ML3A 3W5CA 1KE2A 2XYHA 1AM4D 2ZT5A 2R7AA 2PUDA 1GNTA 1WDMA 2ZIVB 1NFFA 3OIGA 4M1QA 4UHFA 2QSJA 4Q5IA 2IGBA 2GD2A 1Q5PA 3BD9A 1GFIA 3N5KA 2C04A 3P26A 5ERGB 1SBNE 4U2KA 4UOQA 5HRCA 5LLTA 1XVUA 4TSKA 4BVEA 2KPOA 4F11A 2QDXA 2QZZA 3EMBA 1V8DA 3C45A 4RX1A 1Q1ZA 2FWBA 1KH3A 3L7BA 2IYAA 2Q6KA 2DKNA 3G2KA 4G8JA 5DBEX 2ZYRA 4H60A 2PLRA 4AJJA 1I1NA 3O4IA 2HCFA 5MFPA 4WZAA 3ZHZA 1YBMA 1DINA 2PRYA 5FYDA 2IFTA 3G6WA 4IF4A 3VVBA 2CNBA 4ZYUA 5HJ5A 3IB3A 3IMCA 1DUSA 2FG5A 2PS3A 1A0OA 3FOWA 3RQIA 1W4RA 1WCYA 1XOIA 1FE8A 4HTFA 2LTAA 3CUSA 1D09A 1JKJA 2FCRA 2ZPAA 3ND7A 4L0DA 1SIUA 1EU1A 1TYBE 1P3JA 2DYKA 2IZ7A 2WSSA 3JQPA 4OHWA 3D4PA 1NY6A 3QUQA 2QQGA 4AY2A 1V5IA 4J0JA 5H16A 1VOTA 3MOGA 4JOCA 1JR4A 3TINA 4HGQA 1S8AA 4B4UA 2HV8A 1TTHA 1ZITA 1FDIA 1Z8FA 1CF4A 2J4DA 3F2VA 2VT6A 4WGGA 1U5CA 1FC0A 3P20A 4FR0A 4B71A 3RVMA 1Z6PA 4DC9A 3S2ZA 4CL0A 1KS9A 3DZGA 4A8JA 5EJEA 3CH4B 1JMYA 1K06A 2RC6A 3GGGA 3SSOA 5KNDD 3HY6A 4PNHA 5FJIA 4FW9A 1IH8A 4D82A 2GBIA 1J1UA 4ND4A 3OZ7A 3IOBA 3FYTA 4IDGA 3GBPA 4JLSA 5U4XA 1DWQA 4E11A 2FRVA 2O8NA 2CF6A 3JS5A 1N2JA 4MK4A 4CLHA 1T5IA 4DUPA 4JI7B 5D3ZA 4Q9IA 3PFBA 1IM5A 3TX6A 1A1SA 4L16A 4TV9B 3I52A 3ZIUA 4S04A 4UE3S 2FWIA 4PZDA 3GLSA 4EUSA 1YQXA 4Q4CA 5ICSA 2EQ5A 3ZV6A 4YPOA 4B73A 1Q7TA 2WLTA 4OB8A 4QPNA 5FEMA 1J2EA 4WXEA 5G4KB 1T8SA 3TEJA 3V7UA 4CCYB 4FB5A 4UBOA 3NRBA 5LQJA 5SZHB 1V6CA 5J2UA 2XBLA 2XQFA 3KD2A 4QRDA 5K8IA 4YO7A 3PKZA 3RS7A 3S6JA 4AYXA 2JLVA 3AOEC 2GPYA 4RY2A 4R71A 1ZHHA 3KXIA 4BQNA 1GCGA 3AUKA 1YR7A 2OD2A 3JZAA 4AG5A 1YJCA 4C4AA 1XPOA 3MJFA 3G9QA 2SCUA 3S5UA 5I48A 3CZRA 3TTTA 2AG0A 3KE9A 3GZTB 4LJ7A 4MVJP 1I30A 3CF4A 3TI7A 1E9CA 1Y3BE 2VHZA 1SCAA 1S8OA 4CE6A 1KYWA 1PBTA 2QS9A 1NE2A 2PRJA 3AJ9A 4BNFA 1T9HA 4BNVA 3DOFA 1NI5A 4H1VA 4EGQA 5BWMA 5EUBA 4MUMA 3H4TA 5GV8A 3D3WB 4O2RA 3DZCA 2EHDA 4WMLA 4OY3A 4YJGB 1X7XA 3SOPA 5BNTA 3T4XA 5BSKA 4QXMA 5CR9A 1VPEA 1N4DA 4OYYA 1X0VA 1VGVA 5IABA 1E2FA 1RHKA 3QEMA 1U0FA 4OQMA 1I6MA 5T3YA 1UZNA 2QM8A 4TQUS 1RC8A 2Q1SA 3Q40A 2EW1A 1AQIA 5JZOA 1MKYA 1WIWA 4CM9D 2XUQA 1UWKA 3G5MA 3QVJA 3TQIA 2RGGA 2YKGA 3OO1A 1MIHA 5DPMA 121PA 1NUQA 2W2LD 2Z95A 3PRHA 2IY8A 3EC7A 1ECLA 3DL7A 3VKWA 1BHQ1 1E1QA 1FJHA 2YY7A 2W2QA 3NHZA 2D0IA 3QVXA 4KN5A 3PFGA 4AP9A 4YRZA 4OLFA 1ZN2A 2PAAA 1GRNA 3STWA 1ZM3A 2D5BA 1SC9A 3BSWA 5H8WA 2AOUA 1Z18A 4IFBA 1KXZA 1NXVA 4LRWA 5GIPE 4MIKA 2ZAIA 1DC3A 1LPOA 3ITEA 1NNSA 3O8LA 3QMPA 4G81A 2W93A 1PI3A 4UTVA 3EGDB 3OZDA 1E92A 3S2FA 2NMVA 2W58A 4FWBA 4R1SA 2DFLA 4M3NA 2E4UA 5T67A 3FSEA 1VG1A 2BM0A 3S27A 4LN1A 3UMVA 2D5CA 1IXZA 3V4OA 2HBYA 5LD2B 5K3OA 3RS9A 4EKDA 4B3HA 2X5OA 4LJ4A 1R18A 1GSIA 3AL2A 4BECA 5BY2A 1I4TD 2VPXA 1XMXA 2JI7A 3M83A 5DHQA 4M1ZA 4QFCA 2LRHA 1A2QA 1EINA 5H02A 3CX4A 3ZE6A 5LIRA 2CN1A 2OCKA 4M76B 3WDMA 4PICA 3VPFA 1P4JA 4RTQA 2VNHA 2HHCA 1LJ8A 1QCYA 1W5SA 1JECA 5KQSA 3EPRA 4MIOA 1DG1G 3DBVO 2XY4A 2QMHA 3MCAA 3Q98A 5FADA 1PLJA 2FV8A 1EUYA 3GQVA 2A30A 3A4IA 4G63A 3C1TA 1Y7IA 2WK1A 3FZQA 3MN1A 3F6SA 1GG2A 4RK0A 4A92A 1LV7A 5EP4A 3H1PA 4LKRA 2MINB 2OOKA 4QQKA 2ECFA 2PUFA 2AG8A 2YIVX 3WGZA 2IBTA 1AA9A 2EJTA 2H2GA 1CUVA 3C5VA 1Q12A 1EWVA 4I46A 1VG0B 4K46A 1E2PA 1II0A 4V0SA 3J80A 4MB6A 2QTMA 1PK7A 3FG9A 4IAOA 3FKSD 1XCJA 1XTVA 2HMTA 2X4DA 1TDJA 3A2MA 3K0AB 4YCCA 3V4RA 1DWOA 5HS6A 3AM1A 4KO3S 1T3SA 2HA0A 2P9QA 2B7BA 2MOKA 2MYPA 4EYKA 1WZCA 3IUBA 2C4VA 1IY9A 3H9CA 4HFJA 3SQWA 2PMCA 1PR3A 3L93A 5AP9A 1JDUA 4I0WB 3FYUA 3QY0A 5CK4A 4YFYA 1EH5A 2IVZA 4V0KA 1Y7PA 2H7XA 4JYCA 2AUTA 1COZA 4BAZA 4BO6A 1HM5A 3NJ4A 2DM6A 4GOND 3OBBA 1G38A 3ONVA 5G4KA 3TAHA 3OJ0A 4MZDA 1BDMA 2NZ8A 1ZZEA 2O1SA 4REQA 4BU1A 1YK0A 2PPLA 3MK31 1KL7A 1NX6A 3MQFA 4DRXB 1SWWA 3CFYA 1FUKA 3KALA 4NCJA 5CVVA 3B60A 2FMFA 3LBNA 5D7BA 4EYGA 9ATCA 3ZNQA 2ONCA 3AIIA 1VJGA 3MVEA 3AGQA 4MI6A 4NARA 1EIWA 1GTRA 2H7YA 1BDHA 1MEEA 5AVRA 5FBZA 4O1IA 3KZXA 4P3NA 3MEQA 4RELA 3MUNA 4BX8A 1Y8QA 1I1OA 2FUG6 1HE1C 5KHOC 1S3IA 4JJFA 4R83A 5KYVA 1N6LA 3E81A 4R81A 3MBOA 1VPWA 3W4JA 4B6SA 1S7CA 5FTNA 3GLHA 3D8BA 2WNSA 4YJFB 3U7HB 3LMKA 5AD1A 4MCAA 2OK7A 1S89A 3U7JA 1Q0QA 2QX7A 4JC4A 1G6OA 4YJGA 5LFAA 6ADHA 2QLFA 1TVMA 1ZUNB 4TWJA 3GRFA 4MPDA 2XF8A 3WLTA 3F4LA 9GPBA 1CRZA 2I4TA 1PGQA 3K8ZA 3PT5A 1ZIOA 1ONBA 4YHHB 3OF5A 5DN9A 5IKOA 1JG3A 1SUFA 1MG5A 5DFAA 3UH0A 1DKLA 2ZR9A 1N8SA 4UM8B 2FETA 1T4BA 4BJ6A 1T8WA 4D2IA 4GKBA 2AEJA 3MS2A 2JFPA 4MVXA 3GRZA 5EE1A 4ZD6A 3RFCA 4D56A 5EZ6B 3KR9A 3NHUA 3D02A 3SD7A 4DIEA 3JWJA 3W4IA 1GRVA 4BKQA 2HKIA 3HV0A 3WLLA 2Q2NA 2AR7A 5DCLA 2WTUA 1TZKA 1PK8A 4XCXA 4YI3A 1JG6A 1KP3A 1XYYA 2N1BA 2OB1A 5IAOA 3EAQA 4L6IA 3F8TA 3KJFA 4TL6A 2PKQO 1XJ0A 2BKAA 2QVLA 5ALZA 1FYFA 2H0AA 4Y9UA 2YJ5A 4K8OA 3QUCA 1PR9A 1F2DA 2Q49A 1WHTA 3R4VA 5E4TA 5AXBA 2ZE8A 3CJQA 3VDMA 4P31A 1KYXA 4TVSA 5FFFA 2NG1A 4H7KA 4IF6A 1AHNA 1J39A 1Z5VA 1TQ6A 4WZAE 2UDPA 1P2DA 3JWEA 1RQLA 3A1UA 3O83A 5K0BA 2C9YA 1O9BA 1TCAA 4IUDS 4DQLA 1E6KA 2WG0A 3EN0A 3PNKA 5D86A 1N77A 3HYRA 2NW6A 1XVTA 2C8KA 2Q45A 3A58B 1NATA 3EZYA 3PLRA 4RWZA 3BMCA 1I80A 5B3JC 2N47A 2UYYA 1I3KA 1Z6ZA 4ZEMA 4A0GA 4UFNA 2AMFA 3NBYC 1JMKC 2I54A 3AQ4A 1QYRA 2QRPA 4ETNA 3DNFA 4GX1A 4LVUA 3ZEIA 2TMYA 3P96A 5E1BA 2DH5A 4FFSA 5EGSA 2RHWA 1O6GA 4ZYZA 2JHGA 2JIMA 3UGQA 4TWAA 3OCUA 2BGGA 1GRRA 2PS9A 1YQUA 3CZCA 3H8SA 3ADOA 5E1MA 3HACA 4NU8X 5EP3A 3WGTA 1L3BA 5IT4A 4JKOA 4N1AA 4AMGA 3CUKA 4YV1A 1F0KA 5HKBA 3HP7A 3B1KA 3L46A 4EYOA 3DBOB 1U0BB 5LP6B 3O0TA 2BL4A 2I78A 4IZHA 3WQQA 4QASA 5K7SA 4HLNA 1II9A 2RJ3A 4K9RA 1EDOA 2BPOA 3L6UA 3SYRA 4PYQA 4KMRA 2J0EA 1QR6A 3PEYA 1V3UA 2E4AA 1RLMA 3SR3A 1WMSA 3KJQA 3OKAA 1NN0A 1OFHA 3CN9A 3PF8A 1NVFA 4F45A 1W59A 3E5NA 1ZOSA 2GZRA 2FY8A 3LO8A 5TNXA 3ANMA 3LA8A 3K8OE 5CRIA 3CZAA 4JC0A 1QV6A 1AVTA 1EUDA 2J3MA 2QPTA 1G5RA 3QXHA 4JBHA 5L6LB 4MYCA 1SU4A 1GADO 2O7QA 2WJ3A 3CWZA 3QI2A 4DRXA 4P3XA 1XLVA 4JBIA 1Z08A 2C9CA 2GBGA 3T9BA 1RSZA 3MGKA 1HE5A 4ZDIA 5AXDA 1H2ZA 3SF8A 4JJAA 3CT4A 1Y1TA 4JCCA 1C7FA 1Z5ZA 4I4LA 1AB5A 3THOA 2A0WA 1B6TA 1H23A 3AH8A 3LCRA 5EFZA 3C4JA 1G3IA 3G8BA 5BN4B 3Q3GE 2H1RA 4UUAA 1QOQB 2XMGA 1FNDA 1Q1NA 1SCQA 3KELA 2OBYA 4BJHB 2BZGA 1GLVA 2O0MA 3Q1KA 5FPYA 2IV7A 1T1GA 2P6OA 2Z5GA