4I8IA

Crystal structure of a duf4886 family protein (bacuni_01406) from bacteroides uniformis atcc 8492 at 1.50 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
DTIKVLAIGNSFSQDAVEQYLHELGEAEGITMIIGNMFIGGCSLERHVQNIRNNAPAYAYRKVEKDGEKTETRSMTIEKALADEKWDYISVQQASPLSGIYDSYKASLPELVNYIRERIGKETVLMMHQTWAYATNANHTGFKNYDQNQMKMYTSIVDAVKKAANLVGIKKIIPSGTAIQNARTSFIGDHMNRDGYHLDLTIGRYTAACTWFEALTHRNVTENPYSPEGIDPIHKKAAQMAAHNAILYPDKVTELTELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACUNI_01406) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 92
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16227 DUF4886 Domain of unknown function (DUF4886)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4i8iA00
1JRLA 3P94A 4HF7A 4PPYA 4K40A 4K7JA 4Q7QA 3MILA 5HOEA 4OAPA 4XVHA 1ZMBA 4Q9AA 4K9SA 4H08A 5JD3A 2APJA 1BWPA 1DEOA 1BWQA 3W7VA 1VJGA 4HYQA 5BN1A 2O14A 1IVNA 4M8KA 3HP4A 4RSHA 4IYJA 1J00A 1K7CA 3C1UA 3DCIA 1ES9A 4TX1A 1PP4A 4JHLA 3DT8A 4JJ4A 3PT5A 2W9XA 3KVNA 1WABA 2Q0QA 4LHSA 3U37A 1ESCA 3DT6A 5CD9A 4RW0A 3DC7A 4K3UA 2Q0SA 3RJTA 4NRDA 2VPTA 1U8UA 1Z8HA 4JJ6A 1FXWA 1ESEA 4JKOA 5B5SA 4I8IA 1VYHA 1FXWF 4OAOA 4S1PA 5A4AA 3SKVA 1YZFA 3SLRA 1BWRA 4DEVA 3BZWA 2HSJA 1ESDA 4JGGA 2WAAA 2WAOA 1V2GA 2WABA 3DT9A 1DEXA
chains in the Genus database with same CATH superfamily
3HLKA 2NXWA 1S3GA 2J3IA 5ICEA 3AG5A 3DWEX 3O1LA 2IYSA 2II6A 2VG8A 1DE0A 1Q44A 5TPWA 3OLVA 2WZDA 5C52B 5BWLA 4J03A 3LCVB 2CVOA 2B5WA 4RZXA 3RS4A 3ENNA 4GRIA 2YUTA 4B7ZA 3V2GA 5BQOA 1ZOOA 1L5YA 4DBLE 4JEIA 1MJFA 2WW8A 4BE4A 2YZ7A 1ZGCA 1E5TA 4X6UA 4N0PA 1AA9A 4CJXA 4KFSA 3S4YA 2PDAA 3LXXA 1G8KA 1P4HA 3N2GB 1HYGA 4JJIA 4OJNA 1U9CA 2P0YA 3AEQB 2I2WA 1IHPA 1YKSA 2FSIA 3IQEA 1K9SA 3OZAA 3SX2A 4Q12A 3M8KA 3I1YA 4W5NA 4UU7A 1T4CB 2PH1A 2UUPA 4CT0A 3HCCA 3VU9A 2A58A 3PD0A 4C2TA 1IMOA 2OZPA 1G8GA 4EPYA 4GM4A 3NTOA 4YPOA 4M7PA 4PCUA 3QA9A 1IXRC 3H9GA 4B6QA 5L40A 3EARA 4PQGA 4Y9TA 4M22A 2HHCA 1J00A 3S70A 3ITKA 1GA6A 1ZNWA 4HN4B 4LI3X 4K86A 1W19A 3N1UA 3DW3X 3FTQA 1KSGA 1JFSA 4R54A 1OA0A 1RR6A 3AVOA 1QP4A 3JQGA 3FWNA 3MCVA 5K8IA 4URUR 1KA9H 3ND8A 1K88A 2NO9A 3A9UA 3GT4A 3K6SB 1CZRA 1PP4A 5B36A 1TTPB 4HN2A 3DR3A 1Y7IA 4PBSA 1JEOA 2IRWA 5HOQA 3G8BA 5F23A 1EXMA 2OP1A 2XQVA 5H3LA 4YT8A 2D1RA 1V4BA 2OCDA 2QVYX 1WMEA 3U81A 3E9DA 5JOQA 2D0PB 1KY4A 1R9NA 4IH4A 2BEKA 4QREA 4X6XA 4CLRB 4J0JA 4AKIA 1TD1A 1BA2A 3P2EA 1E1QD 2FJPA 3NOXA 4YMIA 5C7OO 2C2MA 3KKLA 5HQJA 1WR8A 1AO3A 1XMVA 3HDYA 2XYRA 3NCTA 4L9RA 4MUHA 4TTSA 3BE6A 3SU8A 5BMVF 5JZ9A 3BMQA 2PWAA 1Y6GA 3OZ7A 4BBPA 3FPLA 4MW0A 2W2PA 1GNLA 5EXPA 3W05A 5ERYA 3TKYA 1RKVA 4ZVMA 3RS7A 1G0OA 2X8LA 4QQKA 4NENA 3TD6A 4EVIA 4B09A 2OXFA 3KJEA 2QRNA 3K3PA 4CL8A 1N6PA 1UBUS 4OYRA 4B4OA 4FFWA 2C9OA 1MOQA 1EFKA 5CA1A 3M7IA 2J30A 4KO2S 5ELLA 2JGFA 3TLJA 5CFQA 1E20A 1P2DA 2QY6A 2V7PA 4XASA 4LGYA 1RYFA 3JRNA 3K1YA 4CETA 1XNJA 1M72A 5DP2A 4Y6QA 1M2HA 1IG0A 2W8BA 4H0CA 1A0OA 4X1YA 5TMPA 2ODBA 4MVJH 1DWUA 1MZPA 3GFPA 1BGXT 5AIBA 1C1XB 1LPPA 4MKFA 2I4OA 4V2IA 2JGRA 1B76A 2V7TA 3AUTA 3H84A 2UVQA 3OF3A 4G5OA 1J49A 4RUKA 5PGMA 2QAGA 3W6OA 1CY2A 4K05A 3MNFA 1QHHB 4U6NA 2BFDA 2RJNA 2HX1A 3TNYA 3CUVA 2W2KA 2JI4A 3DUFA 3Q3VA 3BK7A 3DT9A 4JP8A 2QBYB 1USWA 3HU3A 4YIKA 2NO1A 3PCXA 4UZEA 5CYOA 5LLDA 4TWAA 3KVVA 4HR7A 2VH5R 5CNKA 5KAMA 1ZW1A 5BNWA 1DFHA 1KF0A 3E7FA 4JP1A 4PBRA 1CUSA 4AJNA 5TGDA 4R8KA 2Q3HA 2WWFA 4L0MA 3N0WA 2UUAB 3NVKI 1J33A 4IIDA 1VE6A 4NNPA 4HI0E 3HYLA 5HEKA 1YZQA 1NW6A 3H5LA 5GPBA 3EC2A 3G88A 5DDIP 3AILA 3C6BA 4FDMA 1G5PA 2EDCA 2AEMA 1PRYA 4GXRA 3VC7A 3W0LB 1NY6A 2VVTA 2VDWA 5DNWA 4PG5A 5HIMA 3RTBA 3LLUA 4UU0A 4HTFB 1A2BA 2ZUUA 5I7EA 3TAHA 2Z4TA 5ERXA 2QRMA 4PG4A 4G4SP 3TXAA 2VTVA 4X90A 2HIGA 3JASA 4HMOA 2HNKA 4HEA1 4JL5A 2A0FA 4KVGA 5EWLB 4ALMA 3F6SA 3KR2A 5AW0A 1VYUA 4IWNA 6REQB 1M54A 4B4UA 4YONB 4CKWB 1ZY2A 1QQ7A 2AW3A 2G88A 4DN6A 4FOPA 1VE7A 3Q3HA 1XL1A 2Q4RA 1CUIA 1JHPA 4ZIRA 5L3SA 2I3ZA 2HA6A 4IL5A 4EO7A 5ALRA 4PAGA 4LCBA 4TMTA 4AJLA 8AT1A 1YVDA 5A3VA 2P7IA 3CYFA 4HWRA 5DNCA 2IZZA 1C9EA 5KNLA 2RGGA 2J5BA 3K15A 4X95A 2BISA 4B82A 2FJUA 2HLDD 1L5KA 2RH5A 4PQFA 5T8KA 4YAUA 3GLHB 2HIAA 5I7OA 1JZQA 2FHSA 2H4JA 2ZJ3A 3A3NA 5DLPA 4BU0A 2E37A 2VRWA 3A06A 1DV1A 3JR7A 3NT5A 3ZH9B 1R0CA 3JARB 1R6TA 3BK2A 4GQBA 4I19A 3KYDA 4P2BA 4WFJA 1XZAA 4YI5A 1OJLA 2ZYIA 5F2NA 3JVDA 4J7AA 1IN5A 1SM4A 1VLZA 4Y9UA 2WU8A 3NHJA 2YQ5A 2AJTA 4MCAA 1DC7A 2WJHA 4FGSA 1BE6A 2O7NA 4I50B 4X63A 1C8VB 3O73A 2PN1A 4KJZA 3VFDA 1QHGA 1EX7A 2IU3A 4X6YA 1E6MA 5FR1A 4NY1A 1SOAA 3ZHQA 4YAGA 3RJTA 3EGWA 4IOLA 2VSNA 3AEUB 1FSPA 5F4ZA 3F7NA 3HCDA 4X9XA 3TLBA 3WMFA 4ZCTA 4C3ZA 1Y33E 1ACLA 4RJIA 2FPRA 4FCWA 2V1XA 4EL0A 3KCQA 4LYEA 1IAVA 1Y1LA 5IUKC 2A4KA 1V95A 4ROSA 1DG3A 1Z17A 4WXRA 3ZN2A 5TV2A 3JWGA 2GTHA 3IP8A 3TNJA 2QZJA 1YIAA 1AQ6A 2IHYA 1PLLA 4B8WA 2FVYA 1LK5A 1YDEA 2G9VA 1AKQA 4TKUB 2J4DA 1ZCZA 3QELA 2EDAA 3E9MA 2C88A 2FN9A 5KEIA 4WLUA 1E7QA 3AJ8A 4YCSA 2DG2A 5J5AA 2AVDA 5H4HA 4C6TB 1YAHA 1Z35A 1GEGA 2XB6A 3U3OA 2AFHA 2TS1A 4YHBA 3GX1A 1KOJA 1Y5RA 2H4FA 3I9NA 5LJLA 4B7AA 2OGZA 2JLSA 5HS4A 4XQEA 5FPHA 1I7PA 3EVAA 2D3WA 3MIZA 4ND6A 3RYIA 1T8TA 4RTNA 4AY6A 2O8BB 3GG2A 1EB9A 4W5JA 4ZCQA 1GVNB 1FLAA 2CLEB 4YAEA 3SFZA 1E2LA 1BDJA 1CT9A 1Y6JA 4DEYA 2VRNA 2JNWA 4X1YB 4XB2A 1T8RA 3Q3JB 4B85A 2C7BA 1QIEA 1MGPA 3RJMA 2G4VA 1Z0UA 4HYEA 1QYXA 3L7YA 4KLCA 1G8JA 1TECE 3BBPA 4MB6A 4UXIA 5GVRA 3SZLA 5BSFA 5HZGA 2VP2A 3FZEA 4CMJA 3DOCA 2C0QA 3GJZA 5ECWA 2HSDA 3D6UA 5AR1A 1OYVA 3GGSA 4BEJA 1UKYA 1IQRA 3MWLA 3WK7A 3CX3A 3DAHA 2XWPA 4OB8A 4IILA 2DFNA 2P79A 2XYQA 2ZJ6A 3DUWA 2EX1A 2PGOA 3TM4A 2BKLA 4RZQA 2IH5A 1N3LA 1R37A 4QM7A 1HDZA 2ECOA 2IEZA 3IHLA 1E58A 5FBKA 4BFSA 1AB6A 3H65A 1RZUA 3WSTA 4UZSA 1P2TA 1YI1A 1K7CA 3I37X 4NHEA 5JS7A 5K6TA 1P19A 4P31A 1IYZA 2BUCA 4EJ2A 4XQCA 3X0DA 3WZ2A 3H2JA 3OJLA 3GEIA 3I62A 2NU9A 3CH5A 4OLJA 2C2XA 3N87A 3ICQB 2HPAA 4S1VA 3K70D 5K0EA 1ZXLA 2EVWX 5DTRA 4B0OA 4WLFA 4KU4A 1J70A 1TJNA 4GBJA 2P6MA 1TFRA 2VT3A 2VUHB 3ICCA 3UENA 2JJ1A 2QTAA 2J6IA 2EKZA 3AUXA 1E3WB 3M1YA 4MV0A 4QDXA 3WYNA 4JI0B 1FB5A 3FBWA 3QE4A 3T5CA 1SCDA 3ZUGA 1M1NB 1IUNA 2HK6A 3EB9A 4ER5A 2J1LA 2PKQP 4JK3A 1TIBA 1KDYA 2PZLA 1R4AA 3A32A 3KFXA 3Q8WA 1AS2A 4QUJA 2JLUA 2QN6A 5BSGA 1HEUA 1MOZA 2DWQA 3M6AA 4TRRA 4F97A 5DP1A 1Y6FA 3GGOA 1VTKA 2RGRA 4D26A 4MVJE 5GJCA 1BS2A 1K7SN 2IUSA 2ZBGA 4FIDA 4AU1A 1ZJWA 4YUYA 3IPRA 5E7JA 4W5WA 3TQQA 1TVCA 3QY9A 3UUWA 1ZL0A 5DJ5A 4GLOA 1KQGA 3IAAA 1UIRA 4XIGS 5J4VA 3GOHA 3W2IA 3AEUA 2ODWA 4CM7A 5LYJB 2Q5CA 3CLUC 4HJRA 1LVUA 1AV6A 1E59A 4DCNA 2A78A 2Q5QA 2W2XA 1VP9A 2RAUA 4DMMA 3LY8A 4EFLA 1P7PA 1O8BA 4YXWA 3RKUA 3FNGA 3IT2A 1R0XA 4DXAA 1KMCA 1XBTA 1ZJ5A 2JKVA 2OZVA 1DQZA 2OC9A 3HH8A 1ZN7A 3TW8B 3FSEA 3U17A 1MB2A 2PL5A 2C5AA 3ZHSA 1VJCA 1DEAA 2QD1A 1YR8A 3W2FA 4Q3NA 2L2QA 1L4FA 2D7CA 4ISBA 2IV7A 3TTTA 2QYSA 5FPKA 1J06A 3QX3A 1PTKA 1ULUA 1XVAA 4M36A 1A71A 1UJ6A 1CQXA 5EHGA 2CDRA 2G1KA 1FNBA 2Z3ZA 2HSEA 5EJIA 3TLKA 4E1BA 4ARVA 5K4HA 5MFZA 5L4LA 3LC0A 3W8RA 1GZVA 2R5FA 2HEGA 2ZRCA 4MS3A 3TW6A 3DXYA 3TPCA 3P9PA 3A11A 5HRCA 3K5WA 2B7CA 3NUGA 5C1PA 4ZOLB 1UPUA 2SKCA 2H6EA 1OTYA 2XTZA 1Q16A 1U8TA 1YDGA 4HDKA 3TEMA 4JXKA 4K87A 5FUMA 3BFKA 1O0CA 2XCQA 1ABFA 1GL3A 3ZBPA 1ML4A 4EIWA 1KI8A 4RMGA 1W0CA 1XC7A 4DBLC 2VHCA 1XMQB 4R0MA 4HTFA 1N3BA 4U9HS 5D1HA 2QE7D 2IQ5A 3CNQS 4U9UA 3ZLBA 3MT9A 2QTTA 4V1CB 5TPZD 1GLVA 3LTEA 5AW6A 2AJDA 4NYIQ 3UEOA 1VMIA 4WEQA 3HBAA 1FW6A 1U0RA 1WXGA 2JVIA 3I6BA 3LA8A 3LIPA 4GVLA 4R01A 3SZUA 1D3AA 5HA5A 1XWFA 1PEYA 4GOLD 4REOA 2O1XA 3ELWA 1UDCA 1XYYA 2QHXA 4R7GA 4CIBA 3BGDA 2NXJA 1QHIA 2ZRNA 2FDXA 1SVOA 1SMKA 2H00A 3PP8A 3ZE9A 5CBKA 1N33B 2ATXA 2EHJA 1TRKA 1RJEA 3PRHA 1FUYB 5ED4A 3UPUA 4NARA 4ALJA 1ULAA 1Y8ZA 4DV7B 4UUNA 3ZY3A 4NK4A 1ZRSA 2HBRA 3O91A 1RPJA 2QX6A 3TCKA 1T2AA 2EF0A 2VNHA 3C41J 4JBLA 5IH3A 2VK2A 1LPSA 4XUDA 2IZOA 3MJFA 3TSWA 2QQGA 3AFGA 2W83A 1FNDA 1G4UR 2IPMA 3VOBA 4C6TA 2E5LB 1E2BA 1GT91 5AKLA 1NDUA 2Q2VA 1R4ZA 3DUFB 2KJQA 3QZUA 5ALZA 1JAYA 3NAMA 4Z1MD 1ESNA 4FDAA 3QLJA 4IDNA 2OR3A 4MW6A 2OV8A 4O4HF 4OL9A 3M3PA 2EKDA 1BN7A 3BJZA 1PYOA 5IANA 3AI2A 4L95C 1MNQA 3NIWA 2RGNA 1ML3A 2WJ3A 4ESEA 2QXYA 3MJ4A 2VPTA 2WG0A 3NAZA 1UWLA 2CLMB 3N2LA 3V34A 4HEHA 3PUVA 5JYCA 2OQRA 1ADCA 4CM4A 1I7QB 2R5WA 4AW9A 3IO5A 4A0GA 1N2OA 3BIXA 4ZEWA 1PZMA 3RU7A 2JJ2A 2Z5VA 3P0FA 2XB9A 4HDAA 4TSRA 1SCNE 2WD7B 4LZZA 2IHTA 1QV7A 1RKXA 2JFQA 2N46A 3BEOA 4YCDA 2HDNB 1PSWA 5AJVB 5GOZA 3M82A 2B4KA 4FFOA 3MF4A 5I7UA 2LUOA 3WP0A 4PZ9A 4BNXA 1TUBA 2GYUA 3OP4A 4IAOA 1CY6A 1KRHA 5T4BA 4AJIA 4QQRA 3LGXA 1EDOA 2YFYA 2X86A 1FMJA 2HSWA 4Q37A 5DCWA 3G2IA 3QPVA 2OSBA 4WCFC 3WLQA 2RG7A 5FD8A 1JU9A 1P45A 1U7HA 2IHUA 2IS2A 4MUFA 1X7WA 2HUPA 2BMDA 2VPPA 5A06A 2EF1A 2G5TA 1KEEB 2SNIE 2VWQA 1XZNA 2XEDA 5AHRA 4A0SA 2C2OA 1CJVC 1Z15A 2PKEA 1FP2A 3GMIA 3MJSA 4B31A 5LSAA 3H0EA 4PLHA 4QHSA 3WK5A 4CCSA 1FDUA 2FF5A 2IWHA 2G25A 2XQJA 3LBIA 5I9SA 3C7KA 3UH0A 1EWQA 2CCGA 1XOIA 2BGMA 2X8JA 2O2DA 4Q9HA 4A10A 4BVBA 1KP2A 4IGEA 1CBUA 2WYIA 3AVQA 2GFHA 2WD8A 2Q5IA 3FBTA 3EBOA 3N76A 4MPRA 4OLFA 2BDTA 4Y2SA 3VKVA 3O03A 5LMZA 4OXYA 1TA9A 3D2BA 4GZMA 4ZJPA 1GARA 3VU9B 1C2TA 1NE2A 2X1MA 5KO2A 5BNTA 3QP9A 3HADA 1G3QA 3Q5EA 2X8AA 2OO5C 4HGQA 4V03A 4BIIA 4DTCA 4OP3A 3ZI7A 3Q3EA 3UJ9A 4ARZB 1D2NA 1EWVA 5H59A 2CWDA 1O6CA 2BL4A 3QXCA 1Q11A 2PKCA 1YGYA 4U2CA 2OA0A 3DYVA 1QH9A 4MR9B 2WWXA 3NTVA 5FWYA 4XDHA 2A1TS 4Z1OA 1FS6A 1QOPB 3WLSA 3HUTA 2FPUA 1AQUA 3R0ZA 1AK9A 3GLKA 3Q7EA 1QDEA 4L4UA 3AHGA 1QH8A 4A92A 4O25A 1WJGA 1CQZA 3LU1A 2V03A 1J1UA 3IOCA 1EXDA 2PUVA 3OKPA 4RVHA 3IEVA 3WJ2A 4U3JB 4OF4A 4RF4A 1SXIA 3LK6A 5BYJA 3MA0A 4AJEA 4BMNA 3LL4A 4EITA 1CUVA 4UVIA 3ILSA 1FFYA 2KWIA 3R0JA 3ANTA 4YP9A 4ZEVA 2JLYA 1GGFA 2OAGA 4PGFA 4TSKA 2GD6A 2FQYA 3NKVA 3M2TA 4Z7QB 1WPQA 1NFQA 3R3UA 3UHJA 2WB4A 4KLZA 3O6VA 1GUDA 4OB6A 3UB3A 3ZEAA 2MSCB 3AHIA 1EJ2A 3U3RA 2PKWA 5HTKA 1OBCA 1S5PA 1VE5A 4V39A 2C3PA 3LZCA 2G09A 3MAJA 3SYTA 3O8RA 2OLKA 3GUZA 1B26A 2R60A 3VDMA 2G9UA 2C3MA 4UUOA 3EFHA 1KHTA 4PC2A 2FEPA 4UFOA 3FKSA 3EH2A 4Y6GB 4ZI7F 4LUCA 4AZ3A 3GJ0A 2QM8A 3HRKA 1JDPA 1J8FA 1CRZA 1I80A 2CVFA 4X93A 4EPWA 4FS8A 4FMPA 3K5PA 4TV8A 4U7HA 5CRIA 6REQA 4Z51A 1D4AA 3DR5A 4B76A 1N4DA 1UXKA 1ZG3A 3NU1A 4RZHA 3R7FA 1NW9B 4CG0A 1FQWA 1TQ8A 2NTNA 2PTHA 4M9QA 4OQQA 1G1AA 2YWDA 5ICFA 1AKEA 3GOQA 4JLSA 2JGJA 1OT3A 2YWRA 5F9HA 2D1YA 1MJGM 1XQXA 2GYYA 1W4RA 4XDYA 2VH2A 2QM0A 3DFIA 3PL5A 4BQSA 4Z4EA 2A88A 1QP7A 1HURA 3ZWVA 2ZUVA 1B0UA 2ZB4A 2JAXA 2LR0A 2X23A 3OPYB 3ITDA 4MP6A 4D7AA 2CMKA 3NHYA 1MJHA 3NXSA 1K4KA 4IMJB 1XVUA 4X3PA 4K26A 2PANA 3T7CA 1SIWA 3FRHA 3H8SA 5DTJA 5C8XA 2CBGA 4Q6WA 1KJ9A 3DE3X 4B6EA 1YRQA 2QSJA 3DWGA 2P91A 1A4IA 1P44A 4HEQA 1FTSA 2Q0HA 5DVZA 5FOTA 1IB0A 1U7XA 2Y4OA 3QU2A 1U1IA 4K40A 4NU8X 2JBAA 4I5IA 1A9QA 4F11A 1RMTA 5CA0A 1E1KA 4PYJA 4TV9B 3V55A 4FZ5A 3ZZTA 4KIWA 3M6LA 3N8GA 2O2XA 2ZT5A 4PLYA 1JH9A 1Z4MA 1RJ9B 2Q1SA 1Y5LA 2CJYA 2OC4A 3I6QA 1CR0A 4RVFA 4G5QA 2QMYA 5EUQB 1ONBA 1PV4A 2WDPA 1I2BA 2X76A 4DNXA 1CJKC 3R3XA 1QFZA 3I9FA 4WN9B 2FX5A 2BZ0A 2W6QA 1OC4A 2DHQA 3FHTA 1EZZA 3HY6A 2XD4A 1L2TA 4A27A 3HBNA 3TQFA 1UK6A 3V4OA 4L9SA 1BMDA 5EGSA 2VTBA 4BZQA 2CNNA 2VHYA 3TFOA 4RSHA 2A9JA 2B4QA 3SHVA 5HF8A 1IB6A 1N2SA 5FI0B 1PJ2A 3QLUC 1WZUA 2CNDA 1LWOA 1QONA 4Z9YA 3UAOA 4BNUA 3MTAA 3W3AD 3ROZA 4CMEC 1ST2A 1ZBDA 3I34X 3B1FA 3V4FA 3B3JA 1HFEL 2QX8A 2UZ1A 3TDMA 2E48A 3VTAA 1VC2A 4B32A 2NUBA 4XLLA 4H6PA 4EW6A 3VZCA 4ER7A 2IS4A 1IJKA 2FFJA 3DONA 4TWZA 2AOTB 1BHSA 2O4CA 1ZJYA 4M7OA 4MQUA 2EX0A 5KKNB 4NQRA 3W06A 2CXQA 3FGNA 3B82A 4E2XA 1YE8A 4NQZA 4BNIA 1C29B 1TE2A 3HNRA 4EWLA 2W2QA 5LMUB 3BCSA 2EJVA 3BM5A 2DH6A 4Q15A 3ZWWA 4CU2A 5DW0A 3TUIC 5G2OA 4DXHA 1NVEA 1CUBA 1NUQA 2F1JA 2PH3A 3HJAA 2O3SA 4K9MA 4KVAA 4BZXA 6YASA 4RIGA 2Q0SA 2IE0A 4P82A 4DIEA 4YXWD 4CM8A 1PEKE 1F7UA 4ALLA 4C4TA 2QUIA 2OCKA 4ZYVA 1MNAA 1WDLA 1KERA 2W43A 5JCJD 3MPUA 3L0IB 4BO2A 3ZX5A 4YXFA 3MERA 5KTPA 4JROA 3T54A 1R1DA 4GLJA 4K6GA 4OHKA 4W7HA 3UC5A 4B2LA 1LSOA 1CVLA 1XB2A 3TQIA 5COAA 4DMHA 1XHEA 4GLFA 3G2NA 4Q4HA 4YHHB 2VAPA 4INJA 2JI8A 4K9KA 1ISHA 4GMFA 1LF0A 4BGEA 4P80A 4C3OB 2R66A 5CB8A 3EG9B 2BBSA 4KK3A 3UGJA 2B35A 3QBVA 4ABYA 4ZCIA 3SZOA 1Z8NA 2WVJA 3ZHTA 1Y4UA 2HU7A 1YZFA 3GCZA 2I9PA 1OR8A 3U4CA 2ZPUA 5F5XA 3WRYA 3VR0A 2GJAA 4OSOA 2VDMB 3ZHZA 1VI6A 3OCUA 5IM5A 2QMQA 4D42A 5I8PA 2R6ZA 3EFOB 3GG9A 3FTDA 4N47A 1EP1B 4CQMB 4WUVA 4C2BA 1DBIA 3ORSA 3WHPA 2NVOA 3C3JA 1CK4A 5AHXA 1MO4A 1TXGA 3D2CA 2Y4NA 5C5IA 3KZCA 4KXMA 1PGPA 3CG4A 1DTSA 3NNNA 1T24A 2DQYA 1BQ3A 1L3IA 4FXPA 1KO5A 3F8TA 4MRMA 3WK6A 3KHUA 2DX7A 2WK1A 5ARBA 4FX2A 4QGAA 4QC2A 5AHWA 1SHLA 2WICA 2ZRPA 3GLHA 5AJUA 4ES6A 1EZ1A 2DBRA 1E89A 1W5FA 1FF9A 1YFZA 3CRRA 4FEEA 1PZNA 3RABA 3UHFA 3ABOB 1A82A 3I28A 3PNQA 2WP0A 2P27A 3QWBA 2H06A 4GDMA 3T1HB 3OBBA 3OQVA 4LPSA 3K2QA 4Z3DA 4CQLA 1WOMA 3AX6A 1ODJA 1U0LA 2GMWA 5JRZA 4RDXA 1NWCA 2JK1A 2VDUE 2ALJA 1GEEA 3OFVA 4KGDA 2XWSA 4P4SB 3G0HA 1A5AB 2BFBB 4F21A 2O7QA 5LNK1 3GFQA 3OP1A 2B2CA 4ITVA 5CLQA 1LWNA 1RD4A 5DX0A 1Q1ZA 5TARA 5JH7B 3NBMA 4WVFA 2XHZA 4KE9A 5IK2D 4J90A 2HWXA 5JHHB 4L28A 5A5FA 1P0IA 4CUKA 4NS4A 2X3FA 4NESA 4P7JA 1SUAA 4ZQHA 4H3KB 4BNMA 1QK3A 4BNJA 3DLBA 1S3FA 3IBCA 2B94A 3K2EA 3EZ6A 3T0GA 5K6AC 1TVMA 2EX4A 2CE2X 3LP5A 2HQ1A 4V2UA 2IW1A 4A0HA 5HZHA 2O3TA 3JQPA 3UCFA 4YCJA 3WFJA 3TG2A 4JODA 1JDUA 1NUPA 1GO2A 4X1KB 4ZA2A 4MVJI 3SXUA 4NMLA 2AQIA 1EPUA 3OZUA 521PA 4L57A 2IYTA 4D56A 1NLMA 2OAQ1 4UD2A 1XLUA 2XZPA 3BDVA 4UXJA 3VVLA 4DLZA 4D1YA 4BKUA 3LRTA 2Y9MB 1K3FA 2B98A 2VSYA 3ER9A 1P2VA 5IMBA 2ZDQA 4H1TA 3WK9A 2X40A 1CFZA 5LXTB 1T8YA 3EDCA 1VE1A 1V7PC 2PIDA 3A1NA 5TF0A 5BOSA 1HKUA 1MVLA 3BTSA 4QE3A 4YJGB 3H6KA 4YAKA 3R6DA 1EFVB 1XROA 3GAFA 2FVXA 4FZJA 1H23A 1JFFB 4I8DA 4JR1A 2VDPB 4CCAA 5KQMA 5ALUA 4EHHA 1GZ6A 1JU3A 2IEIA 3BHMA 3V1KA 1IVSA 1H3NA 3HGQA 1LW7A 2P2LA 4N0QA 5DBOA 2F3TA 4KODA 3K8ZA 4NICA 4ZEXA 4C7OA 3UWOA 2JF0A 2VNAA 3A6HA 1WP9A 3LT5A 3JQAD 3ZIAA 1L1EA 2GN4A 1R6DA 1L4GA 2FXVA 2VF4X 1KMHA 2Y3IA 3TS1A 2PS3A 4HEJA 1X80A 1KIMA 2A1UA 3RS2A 4ADSG 4CR6A 4J7XA 4UM5A 2JGNA 3PFFA 4KUHA 4P3XA 4R81A 4R9NA 2OB1A 3WGNA 2BJWA 2XAAA 4MUIA 3RHFA 4JASB 4QGHA 4H4CA 4M8SA 1X7ZA 2FEOA 1BXRA 2ACKA 1AUQA 2BE7A 3OZDA 3NHAA 3O4JA 2YDYA 4TTVA 1FMCA 2WSYB 1SO8A 1VA4A 2W6CX 1EE9A 3WGJA 1NF9A 2VNKA 4R7TA 3IVCA 1KZGB 4EECA 1FNNA 1ZVQA 1J9ZA 3QPDA 3RTGA 1ISFA 5IYZF 2OORA 3E03A 1G66A 1SNYA 2E6KA 4AO6A 4S1OA 1UBTS 1HNWB 1W87A 3CQ9A 2DFPA 5ARDA 5IKOA 1VCMA 4GSKA 2YHUA 1RE1A 1H5QA 1TJYA 1QCDA 1UMDA 1WW2A 2PXAA 3LQQA 3IP3A 2AX3A 1NTOA 1MUUA 4AICA 4RZIA 2F90A 3W9BA 5AQEA 3EY9A 3QLEA 4RTKA 3O38A 4Q7LA 1GZ4A 3DDZX 3D59A 2V7UA 3KZOA 4TL7A 2B8WA 4X8OA 3RUAA 3RVJA 2RAVA 4O4JB 1B42A 3FCXA 3F71A 1ZYUA 1IRXA 1ZRNA 1LDMA 4IQFA 2X6QA 3GFSA 5U4XA 3W9SA 1X39A 2ZSKA 4H59A 4XDGA 1X9IA 4RV5A 3I04M 4TV9A 2QRVB 3ICOA 1YR1A 1OD6A 3AKCA 3JYLA 3TIFA 2J3MA 4H7EA 4L1KA 4U4AA 4YRCA 2C2WA 3T99A 2EG5A 2I6TA 3HM9A 1YL6A 1OAAA 4ZO6A 2ON6A 3G5AA 4CM9A 1ENOA 1QQAA 3I09A 3HKEB 5A4MS 1NUSA 3PXBA 5LKAA 3SJAA 4IIBA 3JQDA 2R0QC 5AI0A 4B7XA 3EZ9A 2PX5A 3JD0A 1XHFA 2EZ9A 2QLFA 4ZEOA 1C1YA 2GPSA 3VH4A 2OCBA 2XT0A 3DJFA 3SHOA 1WUJS 1MXHA 2PVSA 1AU9A 2IHZA 1HG0A 1OGJA 4FN4A 4J0FA 4G1FA 4QU9A 2HMVA 3K2BA 3TVYA 4FLFA 4EGJA 4FDVA 5CFNA 3RVNA 3FYHA 5EPUA 3U7RA 4MI3A 3H17A 5EWJA 3PX2A 3TG8A 1N3IA 2JFYA 2YWJA 1S89A 3COPA 3FZQA 3NBYC 1FDRA 1UJ5A 4G5YA 1OREA 2NGRA 4P7FA 2F8TA 2F64A 4KCGA 3VX3A 5ITZB 5KX5B 3ZJYA 4BRUA 4L75A 3ETEA 1VG9B 3ZNNA 1R3DA 3WLRA 3RRNA 1E2KA 1C5KA 1S96A 3HVRA 1SUCA 2QUAA 2WRZA 3ECSA 4LYFA 3C3BA 1HT0A 2IF0A 4IRMA 4MJ7A 1ZUWA 5DB4A 4C4YA 1P4GA 3MAAC 5JQGA 3WRVA 4UBLA 2A0XA 5KNBD 2G36A 4DRXA 1HEIA 5BORA 4J1QA 2EJCA 2Q7DA 4E31A 2Q1TA 3FAKA 3WHIA 5L95A 1YDHA 1Q0QA 1QOZA 1S8OA 3K0BA 4L6AA 4QG7A 5FL3A 1FQJA 4AXBA 2C9BA 4IDDA 3IAHA 3QFSA 4Y2UA 4EUNA 1KSFX 1TAHA 1YKFA 1I2DA 1WPGA 2PX6A 4E70A 2HGZA 4N5DA 3ABQB 2Q50A 4BEWA 4UVEA 1A9XA 2IHKA 1QBKC 3A6KA 3UAXA 2SCUA 2ZUFA 1Q0RA 1TTQB 1JJBA 4GBMA 3SNKA 1TK3A 4NZPA 3OPYI 2VATA 3VU0A 5CVTA 4C4SA 2FZVA 3F3KA 3ZWMA 4ZGGA 4Z7OB 1BVRA 1CU1A 1N5IA 3U44B 1KO4A 4UEJA 4PC1A 2V4UA 3PTZA 5TEVA 4ICIA 4RTRA 5BWNA 4IXWA 1XCGB 2GFQA 5THXA 3B36A 3V8NA 5LP1A 4M89A 3H1FA 3KLMX 4JZKA 3JAWA 4RZ3A 4YASA 3OX1A 3ZDFA 4C2AA 1M5UA 2WSLA 4U5XA 4N7BA 4CNQA 4E08A 2DBYA 2GJ8A 2V3WA 4C6SA 4F12A 3TRHA 2ZR9A 4O2AB 5BR1A 5IMSA 2Z3VA 5CT9A 3GXBA 2MSEB 5JECA 3W5DA 2FKAA 3ABZA 3OM0A 1CETA 4KG7A 4NEQA 1ZIOA 3D8RA 2MTBA 5B3JA 5HRUA 4O59O 4JQCA 4NJEA 1DIBA 1YQTA 4G86A 4I4TB 3CNHA 1AK2A 1GU1A 2UZ0A 2CF5A 2H4ZA 3O9VA 1R00A 4KIGA 4FOSA 4EPRA 3COZA 1PJ3A 4TLDA 3LP8A 2UVPB 1MPXA 5T6BA 5JLJA 1UAYA 2OHIA 3DMRA 1S02A 2XGGA 2XGSA 1ZM7A 4IHJB 2H5IA 5FORA 2P9BA 3HO8A 4ATNA 3ZW9A 1M2KA 3E84A 4BWYA 3W04A 5E1OA 6LDHA 1E3TA 2LXNA 5JWHA 1QKIA 2QTFA 3U4HA 3D02A 2KMLA 2DOKA 1NXOA 3KPJA 4QU5A 2NUTB 2OBXA 1IZ9A 5G0UA 1H2ZA 4U7DA 2VZ9A 3NT2A 2BOVA 4EHIA 2I6SA 4E12A 4XWKA 1KYIA 3EIUA 4B4DA 4MX8A 1NI5A 4UMDA 4EI7A 2Q3LA 1XZ8A 3K9FC 3OIWA 2ZVDA 4YR9A 4LYAA 2XADA 4Q00A 4LNUB 1Y5MA 3FYSA 2YBEA 1BE1A 3IGFA 1Q17A 3C6KA 1JTEA 3GZTB 3SEFA 1ZOPA 3AERA 4QUDA 3QEMA 2J7PD 4KH0A 3IURA 1D09A 4DBVO 2ZLBA 4W8OA 5C3UA 3UBMA 1R5NA 3AEKA 3TXXA 5LQCA 1J24A 2DFDA 4K2AA 2OGSA 5KTNA 3LPNA 1RRVA 1H9BA 1BNCA 2VK4A 3HRIA 2C1XA 2AXEA 1TEVA 1KAMA 2B7LA 2Z5FA 3N2NA 3QVWA 4OHVA 3PRYA 1IFXA 5AW2A 2SICE 1Z82A 3VDXA 3ZQUA 1GN8A 2ONZA 4X1IB 2IYQA 4YBZA 4E09A 1XLWA 3KR9A 5I7RA 4OBEA 3WKBA 3MG9A 5EEGA 1XAGA 1VQ1A 3UUGA 1K6MA 4RKQA 2Y1OA 3A1DA 2G04A 3DLCA 3GLIA 3RVPA 4CQJA 1C3VA 1FY2A 1A77A 2Q8PA 4JP5A 1TU4A 2HCFA 2O5RA 1CX9B 2L19A 2EZ4A 2WTMA 3DV0B 3EIQA 4G2NA 4XEUA 1E6LA 1SB9A 1IEXA 1VIDA 3L7DA 3TRFA 3GPDG 4KO8A 3RRFA 2XKJE 5B5SA 5BYAA 1FTYA 1LLDA 2F48A 1GYRA 1LK0A 2FX2A 2P8JA 1EWTA 5FLEX 4TYMA 1R8QA 4IUCS 3AEQA 5FH9A 3LS2A 3SN6A 1YE5A 2W2NA 3BJIC 4Q39A 4WXPA 3HA5A 4EJ6A 1DQNA 2X8BA 4JWKA 4LXYA 5IAKA 4WFQA 3UCXA 4QULA 2HM7A 1G5HA 3LUKA 5TLSA 1LY1A 1A7UA 3PGMA 4YMTA 2YN4A 1Z73A 3L8MA 3TR5A 1VHQA 2BTQB 1C3LA 2JASA 2HSJA 2YINC 1RFGE 2JBWA 4OI4A 4R16A 4DA7A 2X9GA 3MRTA 5CX1B 1SKUA 5F73A 5FFFA 4IV5A 1SHTX 3DZDA 4JGGA 1O1YA 4MLZA 4M0PA 5DASA 5L45A 4MWBA 2R25B 1XEWY 4ZN6A 2AC2A 1NBWB 4MW2A 3ADPA 2V98A 3HDVA 2DF8A 4OQEA 3PC6A 3IIKA 1YC2A 4Q9LA 1Z06A 5EKUA 2NNLD 3O0TA 2L69A 3E23A 2WKQA 3ZHOA 2HMWA 1T43A 2GTIA 3EBLA 3IJEB 3EQ2A 5CFPA 3NCHA 4W9RA 3FWKA 3RQSA 3K0FA 4E5MA 1GZ7A 3HU2A 3IHWA 3G2HA 3QVMA 5I3CA 2HMUA 1O94C 1K89A 3A3KA 1LDGA 1WUYA 2I3DA 2YHIA 2C0PA 4HKTA 1WBBA 3LRXA 2E4WA 4U7WA 2C8JA 4BUJA 1EU1A 2B8EA 2YC2C 4G24A 4M0DA 1GCAA 4M88A 1NQUA 4I4NA 4P08A 2WV9A 4WCFA 3IV7A 1F2TB 2D5IA 3V8MA 1U99A 3T3IA 2VHZA 2GCPA 5FIUA 1TYAE 1WTAA 5B64A 1GFZA 5I9MA 1DO2A 4YUZA 3QKRB 4S1WA 2XJ9A 2GPWA 2BCJQ 3LKZA 3R6GA 1PUXA 3NT4A 1V0JA 4YJKA 2PZGA 2DRIA 3OUZA 1FYDA 5HBGA 2F1RA 3I2GA 4ID3A 1U6JA 3EC7A 2I80A 1SK8A 4I99A 1XELA 2Q9AA 1UAAA 1HQDA 2QUZA 2YRFA 1G5FA 3C8HA 3DXZA 2G0NA 2IYOA 4IFTA 4WTOA 3LD9A 3AF2A 2QN1A 3L1IA 2RONA 3GJ7A 4TLLB 1NHGA 1SXJB 1N6HA 4YWHA 3ZIAD 4ZI3A 5C1DA 1OAOC 1EM6A 2DP4E 2H18A 3BD9A 3BIJA 3URKA 3VJMA 2HMTA 1FFWA 2X2PA 4AY4A 2H11A 3N2KB 4L9AA 2GZAA 3RTCA 1HMYA 4COKA 1FFAA 2O3JA 2C4NA 4AP5A 1NRJB 3ZU4A 4GOXA 1NASA 1S01A 4LISA 4ARZA 2V1UA 3EZNA 2IHBA 4ZP1A 3BXPA 1BMQA 3HI6A 3HGTA 5FYDA 3TE7A 2JIZA 3U3ZA 1ZQ1A 3MOSA 4RNDB 1Y4DE 1GZ5A 1YCHA 1SCIA 4E6EA 2Q6KA 2OENG 3R7BA 4BVHA 1GRRA 2P9FA 2KM1A 3HR7A 1X77A 1YI8A 2EEZA 5H3CA 4Q1DA 4XJTA 1YMVA 1L5VA 1R50A 2BW0A 2YYZA 3DAOA 2E4YA 4LZOA 1Q2XA 2DY0A 1JIQA 5CG2A 5JJKA 2FN4A 3I1IA 3TJZA 1Q95A 1KAQA 3NIDB 1YUNA 2BEVA 1OC2A 3ELBA 3KLOA 3M1IA 2WLSA 3KALA 3OIFA 3PCTA 4RPIA 5E2IA 4DGSA 1SHZA 3JQ7A 4NH4A 1N36B 5BWOA 1CIJA 1SR8A 4J43A 4K9PA 2QPAA 3GJRA 4X20A 4INZA 3PD1A 4OQFA 1YRBA 1D2RA 1OFUA 4TKVB 5E9WA 3Q6NA 1FTGA 1L5WA 4B47A 1PNOA 1XZDA 4QTXA 3QMVA 5HGXA 4IIXA 2O8FA 1Y3CE 2GCEA 2X77A 4JELA 5CNMA 4H3HB 1MH1A 1NW4A 1T36B 3IXMA 4QARA 2BGGA 3QU5A 5LYYA 1TLFA 1WKCA 3QVVA 1DIOB 4PQRA 2DGDA 3K9HA 4UQOA 3IBGA 2O2ZA 5L8VA 4YC7A 4TS4A 1KQNA 1X74A 4BQNA 2HBYA 2HSGA 4I55F 2LCQA 4DM4A 1USIA 2WHQA 1BU5A 3LVBA 3JS5A 3AO0B 4FONA 4BDTA 5K0SA 4AMBA 4P0PB 1PWEA 5B3AA 5AVQA 3AYXB 5LJIA 2R8PA 3SSAA 1AXRA 2ICAA 3P20A 1DC6A 3AIMA 3EG5A 4PPYA 4V02A 5LBIA 1PHRA 2AIRA 2ZIEA 4BX9A 3LVQE 1YRYE 4RD6A 1W25A 1IWPB 1D7OA 2R6HA 2CFRA 3PI6A 3QXGA 3RIXA 1G7SA 1NOIA 1O6BA 4UJ3A 1ZRHA 1CYDA 4OYLA 3U2QA 2YVUA 3M9WA 2UYCA 1SD5A 1U2PA 4R2XA 5GJBA 5CAEA 4FYYA 2NW6A 3STWA 1RDFA 2ZYUX 1YR9A 3RI3A 4I1OA 2UVPA 2XGMA 3L92A 5IKMA 3AR8A 4KNWA 2FR8A 2XZDA 4B2IA 5A6SA 3F73A 1RRKA 1VHLA 2RJ3A 4IFEA 5DNEA 4Q3KA 4KDFA 3ZK8A 1JI3A 4OGFA 5JY6A 2X7XA 4UTOA 4LWZA 1RM5A 4ARUA 2ZWMA 2WJ4A 1SVNA 4LCEA 3OICA 4CT4B 3FUVA 3FYDA 4LW8A 2FSFA 5FLYA 5JS1A 5J5VA 4BNGA 4NG4A 4G0NA 3HLYA 1N5KA 1VGVA 2EV9A 2I8CA 3I9MA 4UE6A 2X6RA 3FUCA 3WBFA 1P2BA 1POWA 3AHFA 4I8XA 2B3TA 2GDZA 4BKMA 4YRDA 1OGIA 2CXXA 3LT0A 3QPBA 1SQ0A 1FLDA 3E35A 2F9FA 3GP5A 721PA 1WV1A 1C7QA 3CKKA 4RHTA 1EFTA 2FEWB 3SYNA 1I8TA 1QHEA 2VJBA 3HVUA 3VR6D 5JR3A 4GGMX 3KKMA 3ZWOA 1UOEA 1TJPB 3JPYA 1IHYA 2D4HA 2Z04A 1NJFA 4RZ2A 3CO5A 1XAJA 1P77A 2V7GA 3BH0A 4KGVA 4OHPA 1S2GA 2P4QA 3DHEA 1ZD9A 4UPEA 2VP4A 3KOUA 5IJAA 3DCNA 3D1LA 2JLRA 2CLKB 3WFIA 5JPIA 4RW0A 1M2FA 3L7BA 4PW0A 4TLBA 3ANLA 5JANA 2RI0A 4B1FA 4DMGA 3HWSA 3EBPA 3RC7A 3QQ5A 4MVYA 3PL1A 3TECE 1HF3A 3PQ6A 5DI3B 3QA3E 1YTUA 3E7XA 3M4NA 3R09A 5A71A 5JMTA 3HKCB 4ZI7A 2IVZA 3MCZA 4R1PA 5FCDA 2YWFA 1DTEA 4MB0A 1QH1B 2GBPA 4AO7A 4JT4A 2IY8A 4LDZA 4BPRA 1MIHA 2X9NA 4NDAA 4MS3B 2HQRA 4PLZA 4YJHA 4Y2RA 5KQRA 1QNFA 3PGKA 4UTNA 2OB2A 4EG3A 5BQ5A 3I5UA 2O0HA 2YHIB 4NZZA 4Y2TA 3C3PA 4DHEA 1IY2A 2LIPA 2CK3A 2DPLA 2HO4A 3N6RA 5HMLA 1AUXA 3ZK9A 4E3ZA 4WOBA 1EG2A 1N2IA 2VXOA 4L6CA 4DPKA 2DU8A 4PPQA 2YZNA 2VS1A 1JN0A 3WQQA 5IX8A 4TXHA 3BWBA 1UC4B 4NG5A 4RLFA 5KOHA 4WZAB 4U02A 2ZI6A 3IDSA 4LYJA 2GEFA 3OC6A 3RNOA 5SYAA 4E1AA 4G0PA 3L3BA 3B3FA 1M1UA 3SOZA 5IF9A 2CZGA 4ZPXA 4UHEA 4ER3A 5JFTA 2OE2A 2C7RA 1GQSA 3BD8A 4QDZA 1N2JA 1RM4A 3ZKAA 2DJ5A 3DBLA 4R31A 1ZONA 1W8IA 2ORYA 4J3JA 3C3EA 1O54A 4E2ZA 2I4MA 3B6ZA 4AMVA 1H4TA 3IBFA 3OCXA 3KXKA 5CNJA 5EUBA 3MPOA 2VHUA 4NP6A 4F3CA 1W46A 3L8FA 3ZHYA 2XB2A 1LCIA 2Z5LA 1Z7YA 3EQ8A 5AW5A 2FFBA 4O4HA 3PV0A 3TSAA 4N76A 5I8WA 2ZDHA 2XCOA 4KIJA 3PC4A 3PC3A 4NMWA 2YJ4A 2D2XA 4AFNA 5HP4A 3SJUA 1QP0A 4UXHA 1II0A 2P6NA 1OPXA 2PWYA 1P9OA 2E4ZA 3AHEA 4ON9A 4ZTUB 1JKFA 3X3HA 1QIMA 1COZA 4IH1A 4BVGA 2PNFA 5B6JA 2PIAA 1U2QA 1GUFA 3EQ6A 2P62A 1KVSA 3FNEA 3OH8A 1D6MA 3QKSA 4MKRA 2N0SA 4P86A 1EINA 2NVWA 5FKJA 1K4YA 2CL0X 3NM4A 3V48A 4ZHQF 4KQKA 5CPBA 2JIQA 1XMSA 4HPJB 3OKFA 1H2YA 5CT6A 3WNZA 5K1ZA 2V9ZA 4I08A 4JB2A 2K4MA 4QQNA 5CUQA 3S99A 5KMGB 3IMGA 1WTCA 2DTXA 3VZSA 2FPPA 4CFSA 4YJDA 3E5NA 3PFNA 4KX5A 4ZDKA 5NLLA 5HIAA 4X62B 2I76A 4BFYA 4DUZB 2GM9A 3ZJUA 2QEQA 4N3AA 3U13A 2ZI9A 3MZ0A 3RIMA 3CVUA 3WLAA 1H2RS 3HC7A 1AUPA 1BEEA 2J59A 1A9SA 2O0KA 4LIPD 1LFAA 6CHYA 4C06A 1NOJA 4RKEA 3PHBE 3AH8A 5HKKD 4KE7A 4M1YA 5C18A 1NOKA 1Q7TA 3RSHA 1NQVA 4LJYA 4D9NA 1SCAA 3P9NA 3GA0A 4PO8A 1QYDA 3IJPA 4RVGA 5FQNA 4CGYA 1TIKA 1W0JD 1F2DA 1UBJS 5ALDA 2CLOB 2LCIA 5K0GA 1KFKB 3UFXB 4ZYXA 3CF2A 2C54A 4WGGA 3HFRA 4MKGA 4N1AA 5EGNA 1NZFA 1JPUA 2AXPA 3QPCA 5F12A 4HEA6 4EKEA 4P5EA 3IELA 1NX6A 3PK0A 3A05A 4UDNA 2IITA 3OJWA 2AD5A 2CCJA 3ZE2B 4R2KA 2QRQA 3CZRA 1LBSA 3UHPA 3N5KA 4JJ6A 2ATCA 1L8XA 3C45A 1NW3A 5CLGA 3QPAA 1SBHA 2JZCA 3CONA 3ELDA 3I3SR 4FYPA 4LJAA 5F2OA 5F1YA 1EFVA 2R6R1 2QRLA 2W2VA 4X8HA 1GFIA 2ZYSA 3M1LA 4NNOA 1FCJA 2H0RA 2IP4A 3K0EA 4PYRA 5FA5A 1KBQA 5K8UA 1FP1D 1LVHA 1JILA 3MT7A 1PBNA 1SOWA 1TM1E 5T5QA 4L8FA 4DE5A 5HQ3B 4P3PA 1AB5A 3R9IA 2CUTA 3G9UA 1X1CA 3EGOA 4EKNB 5DEOA 4KQJA 2FF7A 3ZZNA 1E92A 2ZUWA 2IXEA 2XUGA 2K2WA 2CJWA 4MGIR 3RSCA 4B9EA 1P6QA 2ID4A 1UJCA 4AM8A 4LDPA 1N6LA 1WUKS 1Y7PA 4ONEA 4UE2A 3U3KA 2K7FA 2FV8A 4YMLA 1NJ6A 1P7WA 4NMXB 1RXEA 3RK4A 3C4VA 1NLUA 1J90A 1V3QE 3Q5GA 3TL6A 1LI4A 4D5GA 1JRLA 1BE8A 1T91A 2WHXA 3H1BA 3P9YA 4HB3A 4JYBA 1WY7A 3R3YA 4LDNA 1W0KA 4UQPA 1L0BA 4I55B 3DE1X 4RK5A 3PLRA 3H86A 3DHNA 2R8RA 4ZREA 4CE6A 4EUFA 4CL2A 1MF7A 4MITA 1SC1A 4TVOA 2VZ0A 3SJBA 4IW3B 3GAZA 1Y4AE 4ZICA 4BN0A 3NFRA 4D4GA 3Q4GA 1IBRA 3JD1A 4C5AA 4M1TA 1E3SA 1CULC 3A2MA 3S7ZA 1NRWA 1YHYA 3FNQA 2XIQA 2CXPA 3I01A 4IIFA 1FS5A 1RIFA 4TWRA 5I3ZA 2QGNA 4BJ5A 3IA7A 4JUIA 2X0JA 1E2GA 4P35A 4WY5A 3CPJB 2HTEA 4MHOA 2Q21A 1PK8A 2HF8A 2RIRA 1IJEA 3CEMA 4PZUA 2O0JA 4CPDA 1OOEA 2CXRA 1XK7A 1JLRA 7AT1A 5FOVA 3EXFB 5EZYA 4TLCA 3FPHA 2B92A 5AW9A 4CKBB 1E5LA 2AQKA 3G13A 4DLYA 4HFJA 4U9IS 2ZM6B 1WXQA 3NAGA 1D2EA 3ME5A 4A2CA 3UTCA 3QHQA 1LBTA 1TVEA 1VLLA 5FOSA 3AVUA 2YXBA 4DMUB 5DM2A 4ZDIA 1A2QA 2ZRBA 1K68A 2ZRKA 4F4IA 1VJRA 4NFSA 2J6BA 1OT5A 4JH0A 5BSMA 2DHEA 4MW4A 5CJPA 1XCMA 2WTEA 4JI8B 3FA2A 2C2GA 1QM5A 2QUHA 2WWIA 1NXWA 1UODA 1FVFA 4QBIA 1U2GA 5E2BA 1ZSVA 5J9FA 3TKLA 5KWEA 1VIVA 3HNPA 3VBEA 1RZ3A 3MHTA 1IZ7A 1Q7GA 3AKEA 1ZIYA 2WOOA 4MV1A 3ZHVA 3B6KA 4ILKA 3Q7PA 2C59A 5AKIA 4B3CA 4EA8A 5LM3A 1QFYA 2O3RA 4DV2B 4NVRA 4H60A 1IOLA 2QM7A 3MW8A 2IHNA 1MT0A 1N6NA 1Z0SA 2Q2OA 4HT3B 4F38A 3DNFA 1AQYA 4EYSA 1U0SY 8ABPA 1RKBA 2EBUA 3OWOA 3QOYA 1YQDA 4HQ6A 2Q4OA 3QLVA 2IU0A 1HWYA 1P1KA 1G6HA 4BASA 1QB8A 1L1QA 1P9RA 2OHHA 4KL8S 4FYHA 5FUWA 5CYFA 1RC1A 2BI7A 3ER8A 1NMEA 1IHUA 2SCUB 5INTA 2P40A 1IQUA 1CUCA 3QNWA 3QJYA 1E7MA 1GAQA 4IVQA 2CNBA 3L8YA 1X1RA 3PWSA 1ODCA 1VLJA 3KBOA 1Q20A 1UBKS 1D0IA 3WRWA 1QRUA 4P3OA 3WIDA 2Y68A 4D8TA 2ZREA 4M3NA 3EA4A 1U3UA 1U11A 3C87A 3K53A 4JWTA 1RPZA 1XO1A 1EWYA 1RVDA 1SPXA 2HB6A 3ONNA 1YBVA 2GHQA 4NKRA 5EJ7A 2P5UA 3EAGA 5JPCA 2Y1DA 4FYMA 2XRMA 4MQFB 4NR0A 5JIBA 3FVVA 1D1QA 4KK4A 1E3LA 1NU8A 3IERA 4BAUA 1Y1RA 4GMKA 4HLQB 4ZO4A 4EW2A 1DXOA 3ONVA 4E4TA 1J99A 1V16A 1QANA 5L4NA 1YA4A 3OU2A 2YKGA 1I14A 1YK1A 4W1PA 1Y1TA 3D0KA 3DFKA 4DPMA 4QVGA 1SIBE 1HFWA 1IG3A 4HH0A 2XMCA 1E9AA 4OQXA 2CLCX 1YJXA 4E4RA 4ZVTA 4KRGA 4RVOA 2UZ1B 4E6PA 2PKQO 3GDFA 1RJFA 1XD8A 4UAVA 2VWPA 4LDRA 2OXTA 3WMXA 2XXAA 4E14A 3O5AA 4IIJB 2ENUA 1DIGA 2Q3JA 3LPLA 3AVVA 3FIUA 3BB1A 4M98A 3F4LA 1ZJ6A 2ZAOA 5ALEA 1KMQA 2RBKA 4QWWA 4RETA 4AX8A 3L0OA 3NP9A 4ZU3A 2PGAA 1ZM4A 5B6IA 1H3FA 3I83A 3KETA 1WCV1 4WKPA 3ZV4A 5TGZA 1P0PA 4IHJA 1EVJA 1IQPA 2NZYA 2ZUDA 2WIDA 1Z5NA 3K1TA 4IHJF 3O84A 2CT8A 4ENPA 4FC6A 5CR9A 3QENA 1IEVA 1WMBA 3KTOA 4JFRA 2EBWA 2I4IA 1BX0A 2PX8A 4L8GA 4JJFA 1PUJA 1MD9A 2IPOA 2MDTA 1ZH2A 1HDOA 1GP2A 1H5UA 3MMNA 1TQHA 2AFVA 2M98A 3QNUA 2QIPA 1IVYA 4B35A 4O4IA 4K5QA 1V35A 1NE7A 4LZAA 5LOVB 3KUUA 1MRSA 2CNWD 1Z6PA 4CV2A 3HACA 1KRWA 3A2LA 4TSFA 4TMXA 3LDGA 2GS9A 2Z1DA 4INAA 4H7DA 4JLNA 5JSKA 2NO6A 3RVDA 3UGQA 4JD5A 3L18A 3LLCA 4JP3A 1JU4A 4UEKA 1SKYB 5FDFA 4F86A 4R98A 2Z4RA 1E3WA 1NP3A 1YB1A 3OEED 4FU0A 1SD2A 5D6NA 4WD3A 4F9GA 3GK3A 1MVOA 3K9QO 3F47A 2W22A 3NR2A 4OJTA 3G0DA 1IWOA 2HNBA 4QTUB 5AXBA 1HDCA 3AM3A 3BA6A 3KU4A 3C8DA 3MB5A 3JW8A 3VOSA 3HCWA 3TOVA 3GF4A 4QAJA 1L3CA 2QV7A 2RG1A 2XE6A 5FBQB 2F55A 2CNOA 2EATA 1EFDN 3TNDA 2XWQA 3KT6A 5G0TA 4XAQA 2AN4A 1Q7BA 2WJ6A 4HRXA 4XW2A 2RD2A 4OSEA 2XR1A 1U3CA 3VZPA 5IT4A 4HAOA 4TMWA 4QTZA 2WUDA 1M33A 3INTA 4QPPA 2PGLA 4JUAA 4PSUA 4AJ2A 5DBGA 621PA 3N05A 4B45A 2ZWPA 4BNHA 3B60A 4PY2A 1FLNA 2PUWA 3UOAB 1M83A 5JFGA 1NRXA 1U3TA 3ZCUA 2G82A 4L6IA 3RFXA 1QR6A 2BJHA 1GPAA 4YRLA 3ZK7A 4BCCA 5K8CA 5LIRA 3THRA 3MWEA 2PWBA 2XE7A 3DL7A 3T3NA 2HFKA 3DMNA 3GH1A 3L4JA 2ZQZA 4WFKA 2ONJA 4C08A 4FFBA 4EG1A 2ZE8A 2OD2A 4OGKA 5ALWA 1UM9A 3IEIA 1JTVA 1RLJA 3PEUA 3INYA 3AGQA 3V6MA 5JNRA 3JQ7B 4C01A 5KVVA 2QD3A 4DUPA 1O4WA 3MUOA 2Y1XA 1O5OA 1PJQA 1D2MA 2B5OA 1JQBA 3B1XA 1KU6A 1XQYA 3BHIA 4QJ3A 5LQUA 5AKGA 3NG1A 3ON5A 1TA0A 2JG3A 1P73A 1XTJA 3IH5A 2YVQA 2BKEA 4FFPA 2BT4A 4WL0A 1NL3A 4A2PA 3RV4A 2X4DA 2OV3A 3EIXA 3FDZA 1A3CA 1J22A 4M1EA 3W90A 3JRXA 3DEZA 4M0KA 4C0HA 4F6LA 1X7DA 1DQRA 4KMMA 5CIQA 1DBWA 1R8SA 1G63A 3FYUB 3OIGA 4YQFA 5A0VA 4HXYA 1J8DA 4OFWA 2NVUA 3EFOA 2I3AA 1VG8A 3FJOA 1XXHA 4GUDA 3ZD9A 4KR6A 5LQNA 1PX0A 2BEJA 3KQMA 2X9LA 3TQOA 5B12A 4JBYA 6ABPA 2X3UA 5CM8B 3ADDA 1MDBA 1FDTA 1NU6A 2ZW9A 1CY4A 3OT1B 3SIXA 2P2DA 8MHTA 2G4CA 2J9FB 4B44A 1RHQA 2VJCA 2PTGA 4TKLA 1YGPA 4L2IA 1NUTA 1PJLA 5EXSA 4OHRA 3WO1A 3JQBC 4IX1A 1WQ4A 1SN7A 4GNKA 4LF8B 3GLSA 3MOGA 1M34E 2JANA 4R69A 5K3SA 4QEDA 1E69A 1MB3A 3IEPA 5AUPB 3U7HB 4CF3A 3CUSA 4HYQA 5K05A 4O4JA 4BX3A 1ND5A 2RBEA 2FZEA 4DV4B 1DVRA 1GNQA 2OM6A 5CEJA 3GU3A 4O4JF 4UUMA 1F14A 5JE8A 1AKTA 2AV6A 1IWBB 2VZLA 4HDKB 1NDQA 1L7NA 3K0HA 3HCPA 2HJGA 3QNMA 3EJ6A 1G9TA 3COWA 2AD1A 3AKDA 3Q0IA 1Z47A 2F9MA 1KEWA 4YJFA 5IJ9B 4C07A 5C1IA 4R0VA 1J25A 1I6WA 4NZNA 5LDHA 1GXSA 1SQSA 3CZQA 4IEIA 1OAKA 2A9VA 2DR0A 2R6CA 5ENVA 3UHOA 3UM9A 4A16A 4X94A 1YS1X 1GNRA 1VKJA 4AMGA 1JAZA 2O2HA 3FTFA 3IQDB 1Q91A 4ITRC 1ZLYA 4AECA 1PG0A 2OHJA 3DFUA 2C7QA 4CLDA 1OLUB 2G70A 3JQAA 3WLJA 3WL6A 5K2OA 4MVJF 4ZT3A 3DE0X 2GN1A 4BVKA 1U80A 3QTTA 1AOXA 3CPHA 4LHSA 4BPBA 4IQ8A 3P26A 4RA6B 4XCXA 5FNVF 1A72A 5KPJA 5EHIA 2QMOA 3MHPA 3UJDA 1KEKA 3ICPA 4PRYA 1RI2A 3L7CA 4NSNA 4EJSB 3HYNA 1IY9A 4YNBA 7MHTA 2JGLA 3LQYA 5IM4A 1Y7HA 1E0SA 5JEDA 3F4BA 4F8JA 1VJTA 2DUMA 2QX9A 3JASB 1J9GA 1DP4A 2ZJZA 2GBIA 3FDXA 4GXQA 3BH6A 4OL0A 1FJHA 4Q6BA 1T5OA 4CZ2A 1KMHB 5GTDA 4RXUA 1OFUX 3TKAA 1NBIA 1ID1A 3O95A 3NEPX 5C8YB 4BY9E 1WXIA 2ZBVA 2VDWB 1QQBA 3N07A 1G20E 1S1MA 4ODIA 4ZRMA 4EAQA 2WT8A 1WE2A 4D97A 3B9RA 5FWDA 3CXRA 3E2MA 5HRAA 1BKDR 1Y1SA 4D8YA 4RY0A 3CZ5A 3QKIA 3DYBA 4HNRA 2E18A 1GPUA 4P7BA 4GS5A 1M1YE 3HA3A 5IZCC 4DWVA 3VH2A 1MRNA 2VHXA 4NE9A 3PQFA 1E9SA 3BJEA 1P29A 3CRVA 4KDRA 1HSOA 3QKUA 4R83A 1YRLA 2PAFA 4LC1A 4YDSA 2E3JA 3V8BA 8ATCA 5F7XA 3ROKA 2W70A 1XPUA 1WNTA 2O6LA 3ZUPA 1XTKA 3GBSA 5BT9A 1IOZA 3RROA 3NHWA 5EFOA 4I1RA 3UK7A 1V2GA 2H59A 1S1CA 3F98A 3MS4A 2GZ1A 4F5DA 1KORA 2X19A 3SEQA 4CM3A 2F8MA 2HMAA 1HNZB 1ZN8A 2ACVA 2DCUA 1OIWA 1GPDG 2ZE7A 4W1RA 5EWMA 4BZPA 4PZYA 1TFUA 1ETUA 4XGQA 2XXJA 2IIQA 1Q0HA 3RVQA 3P4YA 2TMDA 2CFTA 2NPIA 1PKEA 3BD7A 1T3SA 2WVHA 3OZSA 3SLKA 2HR1A 5LQJA 4CF6A 4IIUA 5C9ZA 2Y76A 1U2GC 3DAYA 3BFVA 1R27A 1VB3A 3L7JA 3RQIA 1NAIA 1F20A 4HBGA 2B2NA 3WS7A 3KEQA 1MQAA 4GX2A 2AYZA 5GONB 3WLNA 4C04A 5HUHA 3E82A 1U02A 3S2ZA 1BYIA 4HS4A 4WRRA 4F56A 1THGA 2ZWOA 5TNXA 1QTRA 1XP5A 1BQEA 4JNKA 4F45A 1HE5A 3LOPA 3G2KA 5DHQA 5J5CA 3RYCA 1L4EA 2AZDA 1T15A 1VPWA 1NYRA 3IIEA 3LPDA 5C80A 3DKKA 5KWSA 2GCGA 4HSGA 3LT1A 1N1DA 2RH4A 3DMGA 5TMEA 4EENA 5JW6A 1R0BA 3KUDA 5K0FA 1FYVA 3TVDA 1Q83A 1VLHA 1Z5PA 4EL5A 1TAGA 1SD1A 2JAOA 4IVNA 1W6RA 2HRRA 4XD7A 1W1IA 2M1ZA 1EH5A 1DINA 3M5DA 4ZXPA 3H3FA 3S2UA 3VR3A 3WY9A 5DOZA 5BWCA 2FQ1A 2ONYA 3A4MA 4GNRA 1J39A 3FY4A 4X71A 2PGNA 4MK4A 4W5OA 2PBZA 1KP9A 4ZVLA 3TL2A 3EFBA 4K03A 1IN1A 1N9GA 3OFSA 5DRTA 1TT5B 1N32B 1J23A 1Q21A 5HCIA 3D1JA 4V38A 5BW6B 4TRNA 1XEXA 2Y0CA 2Q28A 3H05A 1J2YA 1KGSA 2ZJBA 4TQ9A 3MC1A 4MI1A 1BC5A 2Y05A 5GY7A 3UYLA 4DJ5X 1JDJA 1IHOA 5KHOC 5B58T 3MWDA 1UDRA 2ZIWB 4ZPJA 3VXKA 4AS1A 2FY8A 1RYBA 1NMQA 4ZCMA 1X1EA 3WFZA 2P2SA 4RKYA 1N2CE 1GOTA 1NPTO 2C7VA 3TFQA 4LOKA 3VBCA 4HH1A 2PSHA 1QDLB 1I3NA 3BWCA 3H8VA 5DE3A 3ZPXA 4ZI2A 5DYTA 5KNDA 4DIUA 4PO1A 1JAXA 1OI2A 2UU9B 1A69A 5JSZB 5JXJA 1M9NA 2JFVA 5I4BA 2E4XA 3P0IA 3MRSA 1IM5A 1K6JA 1CDEA 3WADA 4AUEA 3AVWA 2FOXA 3IAXA 1T2UA 1UH5A 1TU0A 3GLGB 2CGEA 1KXJA 3QEKA 2X5KO 3M0EA 4G0OA 3BA1A 2DWCA 1FTQA 2ZUTA 1SXQA 4BJ1A 1AMNA 1K98A 1WUHS 2HWKA 1WCIB 4LQ4A 1UZAA 1XG5A 1AX9A 1F2TA 3RS9A 3V7WA 4G0YA 1PBTA 4DYHA 2ETXA 5FBLB 2B6HA 1KZ4A 3QU9A 5C7IO 1VHDA 4LDAA 3VYSB 5KIAA 1I5OA 5D1NA 4GAEA 1YZGA 3NOQA 2CDCA 4FHFA 5CIWA 1J7JA 2CB0A 2NT4A 1OTHA 3M3DA 1XA0A 4J2HA 5FI3A 1ID8A 2P1DA 2COUA 2BE9A 4EATA 3KG2A 4UNSA 1T4BA 1TLLA 4GRAA 3K8YA 5CMLA 2I1QA 4IEFB 1VMDA 2GLXA 3HKBB 4TYYA 4CGZA 1BJTA 1JLKA 3DLIA 2QTWB 3GEEA 5C1OA 1WAMA 4U6SA 1N6IA 2GZDA 4C03A 3FNBA 3L4KA 4PLVA 2YL2A 2QNIA 2J9GA 2XCSB 3MJEA 4AY5A 3JV7A 4WEOA 1AVTA 2J33A 3KKNA 4E5KA 1UMCA 2DQ4A 3PDJA 3CNEA 2GAFA 4JQZA 3RYTC 1QG6A 1ZI8A 3UJAA 2I4LA 3WYBA 4F7DA 5BQFA 1ZI6A 5JXIA 2HD4A 1QVZA 2A0KA 2DE0X 4C21A 3ZWBA 1HYQA 1SVSA 3VKFA 2C1ZA 1XE3A 2BMEA 2PX0A 2W2LD 3EXG2 3O47A 4R1OA 1WCYA 2PKRA 4PNHA 2Q6TA 4D45A 3V2UA 2PFKA 3RSOA 1B43A 3BB4A 2W6ID 2F62A 2A0WA 1I4WA 4JVMA 1A2KC 1LGYA 2CFOA 2XIJA 3PE4A 3FHCB 1H6AA 4CBVA 3DDNA 4IHAA 4IO0A 2RCNA 4LRYA 3GLIB 3DCIA 4ENWA 1B41A 3ROTA 2ACWA 4RPJA 1CDOA 2F2TA 4MR7A 4CR8A 1VMEA 3P4UA 4US0R 5E1MA 4S04A 3WTCA 3FOEC 1ZINA 3ZGYA 4EQ6A 1E2UA 5GIOE 5CCBA 1ZU4A 3CWCA 3EW9A 5F1PA 1RRGA 3RAGA 3WV4A 1BMFD 2BZSA 4KPFC 4DM3A 5B1YA 5JD5A 4QVIA 4HWTA 1BVUA 4PBTA 4PXAA 2B4YA 4JZYA 4M6WB 3BWMA 1NV8A 1VJDA 3UK1A 3NATA 4G85A 1U5CA 1XDDA 3OPXA 5DO9A 4UUPA 4QEZA 3D6TB 5TB5A 4PSAA 1Z33A 4O2BB 3QEMB 2PM8A 4OI2A 4UFPA 1MH9A 1CE8B 1SBQA 5KVAA 4JLMA 1T0BA 5IZ4A 2I7DA 4E7OA 1ADGA 1LS6A 1XT6A 1N5JA 2AZTA 2OORC 2Q2WA 4WIAA 4US2R 5JXGA 3OQMA 4DUGA 3VHQA 4CEIA 4DQDA 1KY5A 1XDUA 3DE6X 2AB0A 2GN0A 3N74A 3IR7A 1Y1KE 4G1MB 1NXQA 4GO1A 4P33A 5JWRA 2R1VA 3OF5A 3QW4B 4YRQA 4C0LA 2V0GA 2HHLA 1R8JA 2ZRJA 1Z0AA 4D82A 1MEOA 4FFNA 1JHDA 3NYIA 4GE0A 4JQSA 3GCDA 2QROA 4MGZR 1RWNA 1RHMA 1E2IA 2JIDA 4JENA 4DLPA 3RJZA 3TTWA 3BE8A 4GMXA 4M21A 3JY6A 3I45A 2FA9A 1Q3TA 3M83A 1Y9ZA 3PFCA 5I6DA 3VNUA 4KYTA 3S1AB 1MENA 2ZIUB 3KK0A 1G9XA 3B70A 1EJ0A 4QNRA 1PL8A 2H2GA 3VGJA 1DHTA 2NN3C 4D3XA 1P39A 4IDCA 1I13A 1ORHA 4GZ3A 2Q9BA 3GFBA 5IJ9A 4BQQA 3NWEA 2HIHA 2A35A 3ORFA 2G9QA 3MWFA 1R5OA 3O92A 4IJ6A 4XM2A 2MMCA 4UBJA 5JI2E 4A0FA 3AI3A 2HGSA 4HQLA 3KJIA 1P18A 4AJ4A 4F5ZA 2BP7A 1Z2DA 1HQYE 3A9SA 2OHVA 4YRTA 5BYBA 4FPXA 4DIMA 2GCNA 4GPZA 1DDGA 4Z0NA 3Q40A 3L06A 2R751 1P2UA 3BE5A 1HYHA 3OU6A 4HGPA 3WNCA 3VC3A 5SYNA 2VIIA 1EGMB 4Y9DA 3SBOA 1H85A 1E77A 2WG2A 2R4TA 3Q41A 3RVKA 2HK8A 4DZZA 5JXWA 3D0QA 1P7YA 2OLEA 2HZ7A 4CTMA 1WETA 1E3QA 1JECA 3KYBA 5EEHA 3HCBA 1M7HA 3B2NA 2H5JA 1Z26A 1QS0A 3IMKA 4OFXA 5D87A 1WZIA 3BTVA 4GX1A 1ZCBA 4OUDA 1HMPA 3AWDA 4F6CA 3B5IA 1KK3A 3LXUX 4OV6B 2JFGA 3EPRA 4LC0A 2P9ZA 3E4DA 4LHXA 4GOMD 3FFXA 5A2GA 1HRKA 1KAOA 1GD1O 1E9DA 1Z4QA 5CBPB 2POQX 3MMPA 4N5HX 3DTYA 2C2KA 4BB6A 3OC0A 4E1VA 1YL5A 2HF9A 4P5DA 1SBTA 5D7NA 2PV0A 5AI9A 3E58A 1SUBA 1Z2EA 2GPTA 3AOGA 2Q49A 1U98A 1LBIA 2PAAA 4QXOA 4K1LA 4IUDS 4Q4AB 1VPDA 3PVCA 1OROA 3EVBA 2AQHA 4QPZA 2COKA 4F3RA 3MSXA 4HAZA 4PFJA 2I67A 4ND8A 2IDMA 1P17A 1NVKA 1OX6A 2J3LA 3K35A 2HDHA 4IZ6A 4TX1A 1MQSA 5ALQA 3Q7QA 1H8EA 1NKVA 2EWVA 2ZB8A 3DT8A 3EEQA 3R5FA 4EKIA 3L6BA 1LX7A 2WAYA 1D9ZA 1OE0A 4QVKA 1V5WA 3KO8A 4URYR 3T12A 3M6IA 2E4UA 1L5QA 3UJCA 3WZLA 4B48A 1UJMA 2CSUA 4CKBA 3DVRX 4JLBA 1I2AA 3CZ4A 4P4TA 1K5GA 4AKTA 2B21A 2F00A 2FW7A 1MC5A 2GRJA 4W5QA 3IRVA 4DA8A 3DC7A 2WZQA 4LS3A 3UKDA 5IPFA 4LVOA 4RF2A 2NWQA 1FFSA 1GHTA 4IO1A 3EULA 1U7ZA 1UPCA 4HGNA 1J56A 4UUQA 3F97A 2WF7A 3UVEA 1TEZA 1XRPA 4PC7A 3OSZA 4Y2GA 1KS9A 1XALA 2AF3C 3FYCA 1EK1A 4Q4DA 3KPVA 3ASYA 5B2ZA 5JSYA 4DBZA 2XUPA 1XF9A 2CUNA 2NT3A 3AP1A 5EP3A 2NSLA 2GKOA 4IV0A 1Q0PA 3CCFA 3KXDA 4KWTA 5FJIA 1W36B 1UXGA 5E8JA 1CJSA 3HVJA 3AR7A 2NADA 1KTVA 1SHKA 3KKPA 1R9GA 3G49A 4QRHA 3UATA 5TJ9A 4E5PA 1QS0B 1BN6A 4LJSA 4O4LA 5JD4A 1JG2A 1QU2A 3ZCTA 1JW9B 3NTXA 1L4HA 5FOXA 4HNQA 4M0MA 3TLYA 3FDIA 1XR3A 2RDMA 5BMVB 4PX5A 1BX1A 1D5WA 1VE3A 2DUNA 1S7GA 1OFIA 2Q6IA 1FFBA 1Q2UA 2V0NA 3Q85A 5JMPA 3CVWA 1LX6A 1G5RA 1GCIA 2VSQA 2XCRB 4PZCA 2CWWA 3OF2A 3FFWA 3LPCA 3M9LA 1YZKA 3QVSA 4X97A 3WISA 4BOYA 2XKKA 3PEYA 2Y1CA 1MT3A 3BMNB 1CUAA 2ZR0A 3LFHA 2VF8A 2Y99A 2H9IA 5CK4A 3TTSA 3OZWA 2W98A 4EVSA 3H9BA 2K2QB 2A5JA 2CUZA 5FOQA 3D8TA 3QX7A 4B9AA 2DHRA 2RFLA 4HVAA 1A76A 2V6JA 4HGYA 3CN7A 3Q1LA 4EY4A 2IDJA 1ZD5A 1TZCA 2KW5A 3QXSA 3AR2A 5FO1A 1X92A 4BC0A 2O8EA 1KEEA 4EG4A 5BN5B 1E1LA 2GCOB 3KL4A 3KVYA 4TZ0A 2Y6UA 2GHIA 2HRBA 4R1MA 5DIFA 3S2GA 2WNHA 5JCXA 5CAEB 4PEVA 4M4SA 1E1DA 5AOCA 3LY7A 3NPMA 1U7UA 1W4ZA 3EXHA 1ZU5A 4N3GA 3VH3A 5AVRA 3GLVA 4KVZA 1T0PA 2Q3FA 1BOFA 1TYBE 2FSGA 1OLXB 4GZ6A 4OAPA 4TWBA 4M60A 5EIHA 3REQA 3JD3A 3TLCA 1XCJA 4X91A 2QLNA 5BR7A 3CC8A 4ISCA 4MMXB 3TNFA 1XPOA 5MHTA 1ZVMA 1DSSG 2PGIA 3FCCA 4LRXA 2H17A 3OQIB 2IX3A 5DSXA 5GV8A 2PZBA 3HY3A 3I58A 4IIEA 4AJPA 4D44A 3EWSA 1RACA 5B4VA 1P60A 1L1RA 2GLTA 3L82B 3O3CA 2EFJA 1I4LD 3ESYA 1O9HA 3K6RA 4DIKA 4Q4LA 1D1SA 3IP7A 1I3MA 4BMZA 5AVWA 3ZE6A 3FGZA 3IP9A 4R6WA 2PJDA 5K3AA 421PA 3GW8A 4H31A 4TGLA 4NAUA 3V8PA 1AV7A 4LC9A 3RYIB 1XEAA 3ENKA 4A2WA 4MIYA 3RBXA 2UXBB 4AF8A 1G291 2RAPA 1GA4A 3OESA 3Q9UA 1RKQA 1YS9A 5EJ9A 3R74A 3BFJA 4H3SA 1PUIA 1BEUB 1CUFA 1RS0A 2BI4A 3A36A 5GJWC 4X61A 2ZSFA 2X0FA 4C7JA 4B17A 1CNMA 3DT6A 4RHYA 1V5GA 3N8NA 4BFZA 3QFTA 1SU4A 3PVSA 1XEWX 1UMKA 5ICSA 1CIPA 2ZSJA 3O3OB 1L8AA 5L3VA 3ISVA 4ACAA 4B74A 2NP6A 9ATCA 4MVWA 4G9BA 3CBQA 5LUBA 2IBSA 1TYDE 1HNXB 5EE0A 2FW0A 1V5FA 1JF8A 4DILA 4FBLA 2C61A 2PRSA 1SZJG 2PH7A 1OJ7A 2MR5A 4II3A 1NVUQ 2WFZA 1GTG1 1WP4A 3R3ZA 1OB2A 5C8YA 1OYWA 3CR3C 3RADC 1THTA 3KOYA 4FFDA 4AMUA 2BFEA 4PPNA 3WNDA 1R88A 3HE3A 1PT6A 4AYWA 2FUG6 1L1FA 4CFYA 4EW3A 4C43A 4EZIA 4MOWA 2E87A 4LE2A 1AZTA 1OFGA 2QJWA 3AF3A 3N8HA 2DYKA 3GROA 2YY7A 4XI9A 3UFBA 3KZXA 2Y2UA 3GAAA 4GPD1 3F46A 2Z6QA 3R5JA 1OTXA 3LPAA 2I7TA 1GNTA 4A03A 2QMEA 1Y8AA 1N8TA 1DAIA 1EKXA 4XOIA 4HVTA 3WB0A 2V7WA 2PQ2A 3UMGA 3PNVA 3G0GA 1NN1A 4HNSA 4WNYA 4ZTBA 2O1SA 4UNIA 4UDXX 4MYUA 3VQTA 2MHCA 3ZXYA 3LNTA 2OHFA 5IDYA 2QJRA 4HB4A 2XYGA 5F2EA 1E79D 1GTJ1 3T94A 5IVHA 3LCUA 3SMVA 4ECEA 2P77A 1RJWA 2KBEA 4IDQA 4NFHA 2H3EA 3ZTWA 3GT3A 2A1IA 4L9WA 4URVR 1FX1A 3NS7A 3HJTA 2VYFA 3NKLA 5BN3B 3ZKWB 1R9MA 3NWPA 5ECGC 2XUOA 1N34B 4TMVA 1WXDA 1AIPA 1FMLA 1ORRA 2F6RA 2DMRA 2CLFB 2WYOA 3GELA 4M76B 4PQYA 3ZOZA 5IVDA 1EFPB 2ONCA 2QTZA 1YVEI 2QKYA 2XNDD 3R6TA 2D1QA 1RE0A 2LZ0A 2EKPA 4M0UA 4OJMX 4ZDWA 3ZCQA 4ZTZB 3M70A 3PE6A 3QTLA 7MDHA 2XOXA 4CQMA 5KINB 3WWOA 4M2LA 1P62B 3QLVC 4Q4AA 5CA1F 4CEHA 4NCBA 1JSLA 1BD3A 1XQ9A 3QEJA 4XXHA 1AKRA 2PMCA 3EEBA 4JI5B 2R6AA 2ZYWX 4E51A 4U63A 3TLGB 1K8XB 2A3RA 1N6OA 3A6ZA 2APJA 4W1SA 5LC1A 3ZE7A 1M74A 1PR0A 1YULA 3IA2A 1NNI1 1O6ZA 3JQ9C 4IG9A 1QSGA 4IJMA 4XR9A 3WKEA 3HA2A 3D7SA 3MMSA 4LMBA 1YS6A 2OG1A 3BTOA 4L4SA 3ILXA 5MFPA 5BSVA 2FGJA 1RCFA 3RC3A 4LOHA 5BXQC 4ZOBA 3PNOA 3ZQKA 4Z2AA 1T1IA 4M1ZA 3H3XA 4EKYA 3VR2A 3HCOA 4O4IF 4A0QA 1EK2A 1ES9A 2GCIA 2PZKA 1Y1QA 4W7SA 5HG0A 3K8OE 4OI1A 2HLDA 3AU8A 3SNHA 1X8KA 1FFXB 3E22A 1ZGGA 2C99A 5HQ3A 1CVIA 3AJEA 2QVLA 4Q4CA 3TZLA 4PZLA 1SBZA 3GCWA 2Y8EA 4DS3A 4C4XA 2IL1A 5ABPA 1MX1A 3W2TA 3L43A 4JBHA 3W4JA 5K3CA 3T7DA 2W00A 2WM3A 3GR6A 3IBSA 4LDJA 1OXMA 1RYNA 1K8QA 3E1GA 2IEGA 4EG8A 2BSAA 1NJ8A 3QVKA 1D2HA 3X1JA 4HAVA 1JBKA 3KQWA 1R2QA 1VBMA 4O3MA 4S2UA 1WF3A 3DVAA 2JZOA 3JATB 4D02A 1JR2A 1T2VA 3HYTA 1OW3B 4EYGA 4WZBA 5FL7A 1MTOA 5FA6A 3NEYA 3PENA 4OLBA 1H4QA 2JFFA 1FP4B 1K66A 3L6UA 3ROEA 3EMKA 1MB9A 2BFWA 3H5AA 1SH7A 3AHCA 4YEDA 3KQQA 3QLUA 4WKBA 1K2WA 1N3YA 2JFWA 1JQ5A 3R4VA 2CJXA 2VP0A 4G6ZA 1TLTA 1HFJA 4OOFA 1M75A 3TXYA 1OX5A 3G79A 4DQXA 2WJAA 3ZU3A 3SM9A 3USES 2CV2A 3SHWA 4FP9A 3M5CA 4JJ8A 1EX6A 3HUDA 1Y48E 2GBCA 2J85A 4LXUA 3Q9NA 4EGAA 3U6KA 1OBFO 4ZCSA 5KZMB 2NLOA 4EJSA 5K8TA 2PLFA 1P31A 3WGGA 4JC4A 4TSFD 3LYLA 1QCCA 2ZE6A 3KYCA 3QUAA 1ZK0A 4OYHA 3IOBA 5TE9A 1HFKA 4H18A 1AH2A 5FOUA 2ID8A 4ZARA 4UDYX 2PCLA 3D6JA 4G01B 1WHSB 1C3OB 1AKYA 1ZH0A 3BRCA 3HG7A 4QJBA 4TYPA 4IVPA 5CD1A 5DT2A 3SFVA 4MVJP 1HT2E 3HWX1 5SYMA 5IJ0B 2ZYVX 3C6QA 5K03A 1XDBA 2RGUA 5SV2A 5CB6A 4YN3A 4N49A 5DYNA 4WOJA 3I2YX 3K9NA 4MICA 1E63A 1FDVA 4YP7A 4F6RB 4GWGA 3ZS8A 3PS9A 4FSXA 4PLCA 3LW7A 4MQFA 4X8MA 1D9XA 4KFTA 1TUGA 5IEBA 1E2PA 3RANA 3EGEA 2J0UB 3HGMA 2O20A 4KFRA 4QOIA 5P8WA 5T8KC 2YMLA 4DDWA 1I9GA 5H68A 1XZHA 4MP8A 5C7YA 1H9CA 1LD3A 3R3VA 5IKXA 2BFNA 4TLMB 2WJPA 2HREA 4X7PA 1G21A 1KR2A 5I7WA 1VG1A 2GEDA 3B51X 1COWA 3N0XA 4P2GA 1GKKA 3HFGA 4WXEA 3WJ7A 2XOKA 3A6PC 2JJMA 1X15A 1JXMA 3JQQA 2GZ2A 2IZ7A 1J9EA 2Z95A 2G76A 5GZ6A 3DDWA 4G84A 3ZV7A 4CDGA 5LZ9A 3HJFA 2FPSA 2I0FA 3I5AA 2PQ0A 3DMTA 3O1JC 2IZ1A 3GLFE 2N42A 3P7MA 3M89A 2VDNB 3NQ41 1CFJA 2YIMA 3AM5A 4G4SO 3GVIA 2O2YA 3SIRA 2PRJA 4RH1A 1Y3IA 2GBLC 3PBKA 4O29A 5BURA 5M34A 1ZDMA 2IPLA 1U9ZA 4X54A 5HFJA 2YW9A 3FLAA 1WB5A 3QQPA 2G71A 3CH6A 3EGXB 4U7FA 4P7KA 1UP7A 1XTBA 1TCBA 4EGSA 3I6MA 1CP3A 2XZLA 4JX9A 3R7LA 5TPWB 4K8RB 1F3LA 4D2IA 1KY2A 1F2UB 3WL5A 4QELA 4EHJA 4PHTA 1OWLA 2ZYHA 4QFCA 2PQMA 2W9XA 1NP7A 4N5NA 4F04A 5GGXA 3IVAA 2ZTVA 1CHDA 1JLMA 1VJ1A 3IUEA 1PWXA 4LE1A 3B9QA 5EMLA 2W2TA 4MXDA 2XMBA 1G59A 4X24A 1NYQA 4Q18A 3FPAA 3ZE0B 3R24A 1GZDA 1IEQA 1IC6A 3O7WA 4M9CA 3ROGA 4WY8A 1P0CA 2R9VA 2VCYA 3IEXA 4TQUS 7YASA 3LBNA 3TOCA 2IODA 3HBFA 3OCYA 4YFYA 3V9AA 1JS1X 1NVVQ 1D4FA 1HDEA 1L4NA 4YACA 1JYEA 2YCBA 3THYA 4ASUD 5JNSA 3EVFA 4MW5A 4DUYB 1FSGA 1II9A 1ACMA 4URHA 1ZH8A 4QFDA 3WE7A 3QYFA 1W93A 1CEQA 5BSKA 4B5KA 1FVOA 4HNAB 3BMQB 3RGWS 4EJSC 1IRIA 4PAQA 5JG7A 1XSEA 1ECCA 1V48A 3AMVA 3WMRA 2J32A 4B2YA 2F43A 5U4QA 2PWZA 3UB2A 4MUEA 1JQJC 5JAOA 3D3KA 1YZLA 4DDHA 3S0JA 1NXVA 3UK6A 3E9ZA 5IC6A 2A6PA 5FHQA 1KZHA 5L7WA 3H19A 4S12A 1O6FA 3IBYA 4BO9A 3B89A 2JGEA 2X8JB 4OXRA 3SSNA 3CLTD 3W8NA 4YA6A 2O59A 3AB7A 2DBVO 4KN8A 4BUCA 3IUJA 2FI1A 2R68A 3WYCA 4ED9A 4MR7B 1A4XA 1QLHA 1DBSA 3CEAA 4MPDA 4HAIA 5JJLA 4J3FA 1EVKA 1KYXA 2BMAA 3QF4B 1OXKB 3TTXA 4EHFA