2FK7A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis, apo-form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
280
structure length
277
Chain Sequence
b'QAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methoxy mycolic acid synthase 4
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 102
structure length 277
sequence length 280
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fk7A00
2QRVA 2WA1A 3KR1A 3MGGA 5FUBA 1EAMA 1SG9A 4HG2A 3NW9A 2N47A 2IP2A 5JUWA 4PWYA 2PVCA 5EC8A 3LDUA 2QM3A 1JQEA 1ZGJA 4G56A 5EGSA 2P40A 2P7IA 3TM4A 2XYRA 1XTPA 3E05A 5EMKA 2QRVB 3LDGA 2HV9A 3EVDA 3JWHA 2EX4A 3KQQA 4P7FA 2XBMA 1M6EX 1WS6A 3UJCA 1M0EA 4O29A 5ICFA 1F38A 2IDJA 3EVAA 3CGGA 3LPMA 5BW4A 4V0RA 2GH1A 2PLWA 1L3CA 5EZQA 2VP3A 5EEHA 4HC4A 5EZSA 5ICGA 2YR0A 3A25A 5EVJA 5LQJA 1TW3A 2R6ZA 2YXDA 3EEYA 1MJFA 1AV6A 4GOOD 2ZCJA 4E31A 2ZULA 5FCDA 4C05A 2O06A 4E2YA 4IKPA 5E9QA 4CKEA 2Q41A 3UJ6A 2Z6UA 2O05A 1FPQA 1QANA 5IH3A 3UJDA 3KPUA 3JWGA 1MHTA 3I5UA 2G72A 3RODA 3TR6A 2ONYA 4E30A 2PX5A 2IGTA 2UYQA 5DX1A 4KIGA 4X61A 5EOVA 4CTKA 4QTTB 1R00A 3CJTA 3P2EA 4U7TB 5K0CA 2UZ4A 1V39A 2C7RA 2B3TA 2ZBQA 4CTJA 2VS1A 2EJUA 4HGYA 4ER7A 2IH5A 4KDCA 1P39A 5EMMA 4MTLA 2OYRA 3HTXA 1HNNA 4M37A 4PYJA 4AZTA 3HEMA 5ERGB 5CVDA 5K8VA 3TPZA 1SQGA 1X19A 3A7DA 5K0LA 4RTJA 4X41A 4AX8A 3KU1A 4JXJA 5DM1A 5K0NA 2UYOA 3P9IA 4YUZA 3KQOA 4PIMA 4DA4A 5K0BA 1XCLA 3G89A 3DR5A 5CVJA 2QY6A 3Q7EA 1RI2A 2PXXA 4H0NA 2IBSA 5EPEA 4HH4A 3QOXA 3P2KA 3HA5A 5KYGA 3I58A 1R8XA 3P9NA 5DXAA 3HCAA 3A27A 2JHCA 4X60A 4XUCA 4C4AA 2KW5A 2B25A 3OU7A 3IEIA 4NECA 2OZVA 4PINA 3VC1A 2G8NA 1AQIA 3A26A 5DSXA 3THSA 1NBIA 4BP3A 4CXMA 4E2WA 3OZSA 3M4XA 4E32A 3LX6A 5KQSA 2P35A 3KKZA 2I62A 2AOUB 3G88A 1BHJA 1WZNA 3SSOA 1KYZA 4B17A 3TFWA 2PWYA 3E8SA 4EKIA 5G02A 2PXAA 4C08A 3HVKA 4DKJA 2AOVA 5LSAA 1YUBA 1WG8A 3EGVA 4PCAA 1NE2A 4E33A 4C06A 5DT2A 5HEKA 2YVLA 3MTEA 2EG5A 2AOTA 4HRAA 4GC9A 3K0BA 3V97A 4ER0A 3I64A 3BT7A 2NP7A 1KHHA 4PIPA 5DRTA 4CKCA 2GPYA 5K01A 4QDKA 3CCFA 5K03A 2AS0A 2WA2A 4K6MA 4WVLA 3P2IA 3DTNA 4OX9Y 4GUAA 4XUEA 4OA5A 1UFKA 3PVCA 3RW9A 5D1NA 4YUVA 2ZIGA 4OBXA 3FTDA 4DF3A 1D2CA 3VC2A 3LKZA 2VZ9A 1L3IA 3OFKA 3G2PA 4YUWA 4BLVA 3M70A 5K09A 4F85A 1NW6A 2VDVE 3EVFA 4BY9E 2PGXA 3UJ9A 4PGGA 1DCTA 3HP7A 3REOA 1KXZA 1H1DA 1WXXA 4P7JA 4BP1A 2AN3A 5EIWA 3KQMA 2UYHA 2BH2A 5M5BA 3HM2A 1RI4A 3BGVA 3IV6A 5DXJA 4RYLA 3GNLA 4IV0A 3Q87B 3ANXA 3ER9A 3C0KA 2ZBRA 3LCCA 9MHTA 4RTPA 2PY6A 3GJYA 1O54A 3HCCA 3PX3A 3D2LA 2PKWA 1XDUA 3DUWA 3FPEA 5FWAA 2NP6A 3SM3A 1NBHA 3GXOA 2CMHA 5DM4A 4UOEA 4RTQA 4MWZA 2ZZMA 3P71T 1KP9A 3TQSA 4Y30A 2AVDA 1AF7A 5KS2A 1EQAA 2OBFA 2CKDA 3I53A 4R6WA 2HWKA 2BZGA 3DLIA 1IY9A 3GRVA 2VDUE 1QYRA 4GC5A 4RVGA 5U4XA 3WSTA 2UYCA 5EG5A 2JG3A 3M33A 4HTFA 3NWBA 5LQCA 2AN4A 1VP9A 2NXJA 2Z6AA 2BM8A 4OA8A 3SXJA 5HIJA 3P8ZA 3KR9A 4FT2A 1XJ5A 1JTFA 2PXCA 4FZVA 3EPPA 3FRIA 3FUXA 2ZBPA 2XYVA 4RVDA 1NW5A 1BOOA 5K05A 4R6XA 3BWMA 4MQ4A 3DXZA 3NVMB 5HIMA 4RTKA 3T0IA 3MB5A 1SUSA 2YUIA 2AR0A 5E2AA 3KPWA 4WXHA 4KIFA 4RVHA 3DULA 3KPJA 4FSXA 1JG1A 2FYTA 2QYOA 2ZFUA 5B1SA 4YV0A 1VIDA 3EMDA 3FYDA 3MCTA 2Y1XA 4EK9A 3EVBA 4KVZA 5T6BA 1KR5A 2B9EA 5HZMA 5CD1A 5EQJB 4X1OA 1ZG3A 2I6GA 3DLCA 3FTEA 4BLWA 4FGZA 4PYMA 1G6Q1 3SGLA 1ZHFA 2HNKA 3QOWA 2XYQA 5EHIA 3LCVB 5FHQA 5BP7A 3G8AA 3NVKI 5LQRA 5HFJA 4LWOA 2PX2A 2ORED 3UJAA 1FP1D 4FS8A 4X63A 2GLUA 1Z3CA 2ONZA 3BWBA 5GIPE 3V8VA 3GWZA 5K0GA 1BC5A 4M38A 3G5LA 2AN5A 3CJQA 3KQSA 3AWIA 3BZBA 3FTFA 2DULA 3SSNA 4R8SA 4POOA 3PFGA 3FPGA 1X1DA 3NWEA 2V7EA 3DOUA 4E2ZA 3UA4A 2I7CA 3VSEA 4FT4A 3FYCA 3LCUA 3BGDA 3FUWA 2AZTA 5E9WA 3GGDA 3CVOA 3G2MA 3EVCA 3GRYA 3B5IA 3L8DA 3B89A 3HCFA 3O4FA 2HMYB 2O57A 1JSZA 1NV9A 1VPTA 4YV1A 4P58A 5JR3A 3FZGA 5LQAA 2IBTA 1DUSA 1R18A 3KHKA 2FK8A 5GINE 2FHPA 2P3LA 2ZLBA 3AXSA 3FUVA 3ERCA 3C6KA 3KR2A 3OZRA 4FP9A 3UJBA 3VYWA 5LR6A 3R9XB 1X1BA 2NXNA 2YTZA 3DXXA 2PX8A 3B3GA 3THRA 2OPBA 4AZWA 4LG1A 2AOWA 2ERCA 2DPMA 1UWVA 4HSGA 2JH9A 3OU6A 3R3HA 2AOTB 4FR0A 4HGZA 4R8RA 3ID6C 4YMGA 10MHA 2FPOA 1YFJA 5F2OA 1R6AA 1Q0SA 2P1DA 3HNRA 4GBED 3M6WA 1WXWA 1RJGA 3HA7A 5CUQA 3GU3A 2PT6A 3ME5A 5GM2A 3U81A 5LQKA 3A7EA 1SKMA 7MHTA 5HIKA 3NTVA 1NT2A 1VBFA 3EVEA 2BR5A 1YB2A 1KPIA 4PNEA 1RI3A 1FBNA 2BM9A 1JQDA 4RX1A 1UIRA 4M36A 5EMLA 1IXKA 3PB3A 4V0QA 3OPNA 5HIIA 2F8LA 3BUSA 1G60A 1JR4A 1TW2A 3KQVA 4PYNA 1X1CA 4QPNA 2P7HA 1NV8A 1WY7A 3PTAA 2YXEA 1EJ6A 3GIWA 2ZWAA 3UWPA 1VQ1A 2QE6A 3G8BA 4KDRA 2JH8A 3A4TA 5E1MA 1YFLA 3DMHA 2VDWA 3AY0A 1NW3A 4HTFB 4OQDA 3G2OA 1ZGAA 3QV2A 2YX1A 5DTMA 5E8JA 3BKWA 5K0EA 4GOND 3BGIA 3TLJA 2R3SA 3TOSA 1U2ZA 4CKBA 1VE3A 4R05A 5DM0A 2WK1A 1JQ3A 3R0QA 4GOMD 3HA3A 5DRYA 5ICCA 1NW8A 2IH2A 3KQPA 3BWYA 2NYUA 4DCGA 2IH4A 3C3YA 2FK7A 2OY0A 3B7PA 3GRUA 2OXTA 3DP7A 5FHRA 2AOXA 3C6MA 3HVHA 3EGIA 4RSRA 5DSTA 5GIOE 4GOLD 1KYWA 5DLYA 3P97A 3CKKA 5E2BA 4M7RA 5DTRA 2IFTA 2XVMA 5FULA 1EIZA 1YZHA 5HILA 3CJRA 3T7RA 5FTWA 4RTLA 4DQ0A 5BW5A 3HCBA 1N2XA 5DX0A 1SUIA 1RJDA 1T43A 2ADMA 3E7PA 3NDJA 2ZWVA 5DTQA 2EJTA 1ORIA 4YMHA 1F3LA 3LL7A 3M6UA 1QZZA 4KRGA 1B42A 2FRXA 3ORHA 1I9GA 4OQEA 4P7GA 3TRKA 2ZIFA 4GEKA 4C03A 1EJ0A 3M6VA 5CCXA 3UZUA 4CWAA 5CCBA 2G70A 5FADA 3PX2A 1G8AA 5HOQA 3LBYA 1QAMA 3M6XA 2CWWA 3CC8A 5E8RA 2Z6QA 4KW7A 1L9KA 3SSMA 4DZRA 2B2CA 3UJ8A 4F84A 4YUYA 1N7JA 5FWDA 5DM2A 2ZW9A 1VLMA 4IWNA 1ORHA 3LKDA 1RJEA 4PGHA 2JHPA 3FPJA 4FSDA 3TMAA 1FP2A 2PSSA 3HVJA 4EQZA 3UBTA 3KQTA 3FPFA 1L3BA 3DXYA 5EEGA 3JWJA 3ELUA 3MTIA 3P9CA 4EMSA 2NXEA 4ER5A 1AQJA 3OCJA 1KIAA 2YQZA 1QAOA 3PLAE 4F86A 2P8JA 3DMGA 2PBFA 3PT9A 2BR4A 4AUKA 3SMQA 5FQOA 3BXOA 4GF5A 5D1HA 3PFHA 2HTEA 4PONA 2PJDA 4PYKA 4ZTBA 5GWXA 4DM3A 4PYOA 2ESRA 4OBWA 1XCJA 4P7KA 3MAGA 1O9HA 5E1OA 3T7TA 2G1PA 1KPGA 2H00A 1YF3A 1OR8A 4QQNA 4LWPA 4QTUB 3TM5A 3H2BA 3G2QA 4A6EA 5EMJA 4QQKA 1PJZA 1PRYA 4RTOA 3GO4A 3SVZA 3T7SA 1G8SA 3EVGA 3TKYA 3FTCA 1N7IA 3O31A 4ATNA 2PWPA 5IKMA 4AZVA 1ZQ9A 1DL5A 5EKXA 3LGAA 4C07A 2C7OA 1R74A 1L1EA 2O07A 3ELDA 2JJQA 1XVAA 2ZZKA 3G5TA 3LECA 1X1AA 3KPYA 3LBFA 5F2NA 3FUTA 1FJXA 4ER3A 2CL5A 3NJRA 5FQNA 1JG2A 5T64A 2C7QA 1P1CA 4RWZA 3GCZA 3HCDA 2OB2A 3DH0A 2B78A 3HVIA 3LHDA 1IM8A 2A14A 1SVUA 4PYQA 4RVFA 5GP1A 4YUXA 5K0FA 4QVGA 4GQBA 3HCEA 3UJ7A 3RIEA 4RTSA 3OE4A 4U7PB 4IV8A 1ZKDA 4XUDA 3EMBA 3LDFA 3UA3A 1JSXA 1EG2A 2AOUA 2Y1WA 1P1BA 1XXLA 1TPYA 3MQ2A 1G55A 3E23A 5LQUA 5K0JA 1INLA 1JTEA 2P3OA 2O0LA 3IYLW 3R6TA 3G7UA 5EHGA 5P8WA 2JHAA 3GRZA 3MCZA 2I9KA 5FA5A 1RJFA 1Y8CA 2NNWB 4AZSA 3I9FA 2ZVJA 4RTNA 4E70A 3FUUA 3BKXA 3O7WA 5H02A 4E2XA 1D2HA 3P9KA 4QDJA 3DMFA 5CVEA 2IPXA 3NDIA 2OB1A 4Y2HA 4EVIA 1RI5A 2YXLA 2EFJA 3LSTA 1M6YA 3AJDA 3NMUF 2PT9A 3C3PA 1HMYA 1I4WA 5E1DA 3SX0A 4YV2A 3EVZA 5E9JA 3PS9A 4QVKA 4DCMA 5MHTA 1QAQA 3EEOA 1O9GA 2ZZNA 2GA9A 2PX4A 3KQYA 3AXTA 4C04A 3B3FA 3R24A 2IIPA 4ISCA 1I1NA 2E5WA 2IDKA 3ELYA 3OU2A 3CBGA 5DWQA 2P3QA 1VL5A 2ZTHA 4PYIA 4DMGA 4RTRA 4RTMA 3S68A 1Q0TA 1G38A 3MHTA 3JWIA 3ELWA 5GM1A 5KVAA 3ER8A 3SR4A 4Z2YA 5CVUA 5C1IA 2OKCA 2NXCA 2ZSUA 4PCLA 5CM2Z 5E1BA 3K6RA 1RI1A 1XDZA 3B3JA 2GAFA 2CMGA 3GRRA 3KR0A 4QPPA 1NKVA 2H1RA 3UFBA 2FCAA 2PV0A 2XVAA 5FA8A 5CIYA 2AVNA 3F4KA 3KPVA 5EIFA 5F2KA 4L7VA 1BKYA 2P41A 5T67A 1KPHA 2G71A 4ER6A 3EGEA 4MIKA 2GB4A 5DX8A 5ICEA 5KQRA 2K4MA 2V74B 5C0OE 1R8YA 3BWCA 2HR1A 4A6DA 4BLUA 4MHTA 1NW7A 4PYLA 5BXYA 1VP3A 3KQWA 3MERA 3FPHA 4KWCA 1XDSA 2ZIEA 1D2GA 3IHTA 3GDHA 2BR3A 4EKGA 1JG3A 2H11A 2OO3A 3TKAA 1YZ3A 2LD4A 5C9ZA 2C7PA 1P91A 2GS9A 1SQFA 3FRHA 1JG4A 4RV9A 5EKUA 3OZTA 3X0DA 3OE5A 4XCXA 5CVVA 3OFJA 5DPMA 8MHTA 5LQNA 4LECA 5GOZA
chains in the Genus database with same CATH superfamily
2NO6A 1EAMA 1PW5A 3CTMA 4BWYA 4OU5A 1RC8A 4HEA1 2HA5A 4J16C 1NVBA 4PLGA 1KEWA 1XTVA 1YU6A 1N7HA 2FPSA 1UJ4A 3ZDCA 1ZIDA 1USVA 1VLZA 2QR3A 4R2LA 1F3OA 2HV9A 2HHHB 3CRRA 3DOOA 3EVDA 2PUWA 1E66A 4FFRA 4K6FA 1Z7YA 3WMFA 4PWZA 1G291 1OFGA 2DBRA 4O29A 3DF7A 4EIWA 3RAPR 4LWZA 2B82A 3L0BA 5G3YA 4LK3A 4MJLA 2WWVD 4ND8B 2ODBA 3E9RA 4MW0A 4ZXFA 3L2OB 3C6XA 4NTZA 3RAJA 1D1QA 2ONCA 2G67A 1LK0A 1RBQA 3K8OE 2FPLA 4IH9A 1XT6A 4XB1A 1WSDA 2YHBA 2Z8YA 3FTNA 1EP9A 5ITWA 2BJVA 3G7NA 3RS2A 4E88A 3EFBA 4IKPA 3TR5A 2Z6UA 4MVCA 4WCVA 1L0BA 1UINA 2WM8A 2FB9A 3KJEA 1PLKA 4PHHA 3GPIA 1VE5A 4UHCA 5ALYA 2ZIXA 2DR0A 5FBHA 3ZVNA 4BBPA 1YOVA 3AQIA 2A0YA 1F5SA 2Y6UA 4G0UA 1OXXK 1PT5A 3QUTA 2P75A 4KFUA 1IWPB 2C0QA 4FFMA 5GJVC 2VF5X 5EQFA 2VNSA 2C8LA 4OSPA 3AEKA 1R0ZA 2GVZC 5HOEA 4IGAA 4JOBA 1NR5A 1U6IA 2GD0A 1KI8A 2W71A 5JFTA 3Q9UA 4Q01A 4OQPA 3UMBA 2P6PA 5E6RA 1JVSA 3CR7A 2Z30A 1XQ9A 3KZXA 4RWEA 1FU7A 1FMCA 1Y82A 1Z6TA 3A7DA 2P6NA 3LK6A 4M1WA 1E1YA 1MU0A 2IS6A 2AZ4A 3K70D 5J2UA 4D56A 3DEJA 3HB9A 4X41A 5B3AA 4JLSA 4MVWA 4ERNA 1F2VA 2Q8PA 3DEAA 5THKA 5DM1A 5CFMA 1TAUA 1ZSVA 3K70C 5K0BA 4V0KA 3PDIA 4UFOA 3AZQA 2PXXA 1W36D 3VYUB 1OILA 2I9PA 5LZ7A 4XYMA 1Y1KE 4DPLA 2JZNA 3A27A 2DVMA 5BPFA 1ZUIA 4XUCA 1SK9A 1RLJA 5K8JB 2B25A 3UPUA 2PRJA 5FBWB 3D6UA 5DSXA 3T0GA 2FFBA 5JCOC 3NHPA 4PR3A 2R68A 3ND7A 3OPYB 2I62A 4ZD6A 1AS3A 3GCXA 1KVSA 5EP1A 4LTNA 3TFWA 4RXTA 3UWMA 5L3QB 4YUAA 1M6HA 3I1JA 2EBWA 3RFUA 1VLLA 1Z13A 2Y1OA 4PRKA 3RS4A 1WG8A 1U3TA 2XRYA 3HBNA 3TI9A 4YRRA 3A2MA 3BZUA 1HFKA 3JY6A 4IJWA 3PC4A 3BWEA 1F8YA 2AOTA 2Z9BA 2NP7A 4B3SB 4PIPA 2D0DA 1BQEA 2O7SA 4HX2A 3OPXA 5JI2E 3EYAA 1OWLA 2HSWA 2VNAA 3N8GA 4K9MA 2FLVA 1NY6A 3A6KA 3CCFA 2MSDB 3BIOA 1X1EA 4PO8A 4LZZA 2XJ9A 4GMHA 4KK4A 1HDEA 4CLOB 5LOVF 3A28A 1PSZA 4OA5A 4BYMA 1RHUA 5JH7B 2A92A 4OBXA 5FP0A 8GPBA 1B74A 1R10A 3CG0A 3NNNA 1RAGA 2RH9B 2RHBA 2A9QA 5AJXA 3RB8A 2AG8A 2MSCB 1Z28A 1Q92A 2I2DA 3H2KA 1RC1A 5JSQA 2ZAGA 1NVAA 2V3VA 2JIZA 1EK2A 1WLYA 3FVQA 3MRXA 4JR1A 4N8EA 3SYLA 4EG4A 3Q0TA 1DCTA 2W2KB 3HP7A 1M1YE 4KZKA 2XLBA 3VJRA 3L7MA 3DV2A 5C8ZA 1WZEA 1WXXA 3GJXC 3RVLA 1Q95A 2EZ4A 4MW2A 4GE3A 1N0VC 2RI0A 5KYXB 1XU9A 1DKOA 3MXOA 1V8BA 2ID7A 2M1ZA 2BGLA 3DEKA 1KY4A 2XW6A 2Q1TA 2RHLA 2H1HA 4M1MA 3QP9A 4P0PB 2Q6VA 5AJTA 1CP3A 4ZVTA 4ZMSA 4YRDA 1D4OA 2P1RA 5JAPA 2V0NA 1BX1A 2EIHA 4DLLA 1PQWA 3N2GB 1QVZA 3ET4A 1XP5A 1KJWA 2HA6A 1ONOA 2QTBA 3BCRA 4D0LB 1YBHA 4IJ5A 4F5ZA 3DMTC 1AF7A 1RP1A 2UUBB 3P4XA 3JQBC 4MWBA 1BJTA 2BGIA 2PN1A 2I80A 1JA9A 3TTXA 1GJRA 3KT6A 4ZO9A 4AJ9A 1UK6A 4JLBA 3S2YA 5J63A 1CRLA 4NLLA 3AK4A 4CIWA 2MSNA 1GKYA 2FPPA 1NXOA 1O57A 4J1SA 3OMWA 2FFRA 2E1PA 4TWAA 3EZYA 2WTEA 3HWRA 5BW6B 2GKSA 2VCEA 2X8LA 4N1AA 4L4XA 5EMNA 3FN4A 1F0NA 4FT2A 5FBQB 3V7WA 3WNZA 5KNCA 2CLOB 5LP1A 5JSKA 3FRIA 1IDOA 2I54A 3LSYA 1EDZA 3D8BA 4KPUA 2FSHA 2IIQA 2JEZA 4N5HX 4CUZA 3AG6A 1OE0A 3RQIA 2P0EA 3BWMA 3OLZA 1QGOA 5DMXA 4OUDA 5JWOA 1FNDA 3N8HA 2B20A 2YN2A 2WG0A 1M72A 4RVHA 4G1UC 3OKPA 3TLYA 4ZEXA 2QRPA 5I9IA 1O7JA 5EZ5A 4AZ0A 4Q4JA 1HM5A 1F7UA 1BNCA 3OY7A 1L5LA 4UCQA 2FE4A 2ZYDA 2VPQA 1KR5A 2QAGA 5DZSA 5BO5A 1FXWF 3IJEB 3MIIA 4BNMA 2Y2VA 1M5TA 3RSSA 2AEFA 2O2DA 5JCZA 4PSCA 5CFZA 1K66A 4HNAA 3A1SA 2FX2A 4KO1S 5HCUA 1YR6A 1ORVA 1G5RA 1FTNA 1AMOA 2F1JA 5HP4A 2BRUA 1E8MA 2VG8A 3HKDB 4HDQB 3NNDA 2JLWA 2R4QA 3BQMB 4I50A 1GPWB 4TN1A 3ULKA 1CERA 1JPUA 4RC9A 4X63A 1M7BA 1YZUA 3BWBA 3EIXA 2ZVDA 4FFDA 4ACAA 1QPGA 1VI5A 3D3WA 4D4JA 2WIDA 3GNSA 4PHGA 2IYEA 4WLOA 5DCYA 1HRDA 5KTTA 4JXKA 4M0FA 2C9DA 4I36A 3UT5B 1K63A 5CB0A 4RV5A 2QLBA 1ZGCA 2HADA 2WAMA 4YJFA 1BN6A 3GWGA 4WL0A 1U0TA 1JDVA 2WAYA 2FW1A 3CVOA 1J5PA 3B89A 3FHCB 1HY3A 3TDMA 1IWOA 4MCAA 4MW6A 4L74A 2WFMA 3DZKA 5J4YA 3ERCA 2JEYA 1BQ3A 5INTA 4IDBA 5EJGA 3DXXA 2Z2KA 1IG0A 5AKIA 5BVGB 2OPBA 1KMCA 1XTZA 2R00C 4N82A 5ALRA 2WWGA 2AOTB 2YJ5A 1V1RA 3A6EA 2X6TA 1SU4A 1XMSA 4TZTA 3OICA 4Q6WA 2FWNA 3ZWOA 1MT3A 1PR3A 3MSCA 1JNYA 1G3MA 4GBED 3E82A 2QG9A 4Y2GA 1UZLA 1BCRA 1M0WA 1T1GA 1ND6A 1E6EA 2AZDA 2XTNA 3A7EA 4LAFA 4ANFA 2GRJA 1L2TA 1PR2A 1JKIA 3ITEA 2NVOA 3OECA 4HDNB 1U99A 4XI9A 1L7VC 4DBLE 1UC9A 2NTVA 4FGJA 3TZCA 2CY0A 2F55A 3NVAA 1Z47A 2GYUA 3BE4A 2O8CA 1CNMA 2XTJA 2C1EA 3OZDA 2Z6VA 3DKRA 2LKCA 4JODA 1FY2A 5DSZA 1CZLA 3K5PA 1TT5A 1JR4A 3H4MA 2YCLA 1B3BA 1PCXA 3KHSA 5A5GA 1UK8A 2O5RA 1JDSA 2A8YA 2VZ0A 2YXBA 3MWFA 1YMQA 2AEEA 2J6IA 4HATA 4XIFA 4EAQA 3B7WA 1EJ6A 1UKAA 3G2HA 5THXA 1ZM2A 2IZ1A 2W0SA 3IERA 4I9GA 1N3IA 1NURA 3ONNA 4M1TA 4IDCA 5CM9C 4AF8A 2PSEA 2AQIA 1RAEA 4QOEA 3ZQ4A 1ML3A 2JFHA 4UZEA 3KOMA 4L9AA 4C4RA 4XIYA 3K6SB 1ZGAA 5IBCA 1W94A 1EP1B 3BKWA 4Q3BA 1P5HA 2I8LA 1C30A 3KEGA 2R3SA 1TCCA 5EZ6B 3CPEA 5K8VA 1NBAA 3AO0B 1KDZA 4GOMD 1V16B 1BS2A 1EZ1A 2BRUC 1K0FA 1A95A 1R6XA 4G9BA 4JJIA 4RHCA 4E5DA 2IH2A 4KFCA 4CU2A 5CH8A 4FIDA 4E5MA 4F4CA 3DLBA 4DT1A 1UP4A 4KQKA 3CWCA 3BEDA 4XTCS 4MCHA 3GFOA 5GIOE 5JNUA 5KEIA 4E5VA 1I4EB 1KFEB 4CDNA 2IYLD 4PQGA 3WV5A 4EZIA 1DS6A 3CRMA 4CKEB 2VO1A 3H8VA 1EIZA 2NSYA 5BW5A 1P4RA 5CIWA 2CNNA 4DQ0A 4RTLA 5BR1A 1JR3D 3FNRA 3UTDA 1FLDA 3AHJA 5D01A 1FB5A 4ESVA 4TWRA 4IEIA 1KOGA 2ZS7A 4TL6A 3PGLA 1F3LA 2D54A 1IQUA 2QNBA 1DRKA 3TQQA 5JYCA 3G02A 2HLPA 3M6UA 4P7GA 3WBKA 1OJ7A 4GEKA 2C29D 3TOCA 2DPLA 1OWMA 5E38A 4BVFA 3DTVA 3RE1A 1J4AA 2G70A 3W34A 5IDQA 3ANLA 4B2YA 2WWTA 3LUPA 1VMDA 3LBYA 2NU9A 1WCXA 2CWWA 4UEWA 1YIOA 3TNYA 2ZRBA 3OCCA 2Q3LA 3SSMA 3O0TA 1DMRA 1KMMA 2M1XA 2ZJ3A 2NYAA 3H2SA 4BQPA 3AEQA 3ZE8A 2CVZA 1HDIA 3AP1A 4XVHA 2YV5A 1XZJA 3RU7A 2YL2A 4WUVA 4DJTA 2ADOA 4ZVQA 1SOUA 1C3XA 4MUNA 1AKVA 3G13A 4X0EA 4IUCS 2P8JA 1GLNA 3E2MA 1T5LA 1R2QA 3CUTA 4FMCF 2GPBA 3RS8A 3SDZA 2VXYA 3TBFA 5BNIA 5GWXA 1SB8A 2WWFA 3MD9A 4KQGA 1D5CA 4YCAA 3HKEA 1YS2X 2FMXA 2Z83A 4YDQA 4RXMA 5F3RA 3WB9A 3C8MA 4MUJA 3JYQA 1UC5B 3PXCX 3C85A 5AJHA 2AXPA 2WINI 3IB3A 3UAOA 5CPFA 1L8AA 3NHKA 5L3SA 1T36B 1HWYA 1T8TA 2ZJ2A 1ORDA 4TL7A 5JH7F 2ZIUB 3EAFA 2VT2A 3GO4A 1FL9A 4BKUA 3COZA 3R3WA 3OMLA 4LZAA 4ZJPA 2J5KA 5CBPA 1A5TA 3ISTA 2QSYA 1N5OX 2BE9A 1H2FA 1KH3A 3LVQE 4L8GA 3S81A 2H59A 2JFGA 2VHJA 2HRZA 2WFAA 2ZXEA 1C1DB 1GZ5A 3ELDA 4GZMA 4RZHA 4WK6A 5HZHA 5G3ZA 2WWXA 1M8GA 1PNQA 4CR7A 1KVQA 4MITA 4ZEVA 3OD1A 1EP3B 2IVFA 2R86A 5CA1A 4ICIA 5F3WB 3L07A 3DH0A 3LV8A 4V3CA 4W8OA 3K9QO 4R9SA 3E18A 2FJPA 3S8YA 1JKXA 3E3MA 4N3BA 1Z37A 4L27A 4NH4A 5D5QA 4DMRA 2IY7A 1OX4B 2GN9A 2J9GA 2ZAOA 1EFCA 4H0CA 5JNRA 4LJ8A 1JTEA 4H1UA 1DO2A 4TGLA 1I4DD 1W8DA 3LC0A 4LF7B 1NX9A 4FGLA 1FVFA 2I9KA 4QUKA 3FXAA 3F8TA 4PFQA 3ABRB 3FYUB 4RH0A 2IXFA 2FRVA 1KEVA 3O7MA 5I7AA 2FPXA 4HAXA 4KODA 1FFDA 1IH8A 4OJQA 1D2HA 3ETDA 3RKSA 3H99A 4DVGA 1E18A 1FFBA 3Q7IA 1UOQA 2G9ZA 4D4HA 3SKXA 4GX0A 1ULTA 4MPTA 1F1JA 5FBLB 5K8UA 4EG0A 1AHNA 1E7RA 1Q2XA 3AX6A 2YZGA 2JLQA 3KC2A 1U0LA 3JAWB 4XWGA 3BWXA 5CYPA 4RCZA 4KQ1A 2ZBDA 5LUAA 4IDQA 2GJ9A 5DEOA 3VVLA 3LUBA 4QFDA 1JGTA 2WNHA 4HJRA 3B7GA 1ZU4A 3A1CA 5IFKA 1T4MA 3N2KA 1L5VA 3RUPA 3R24A 2M6KA 1Z2PX 1HSZA 1IONA 2PTHA 3O8NA 5EWMA 2I55A 1LDMA 2GPSA 3H97A 4KWHA 3HL4A 5CGZA 4DLBA 1JWBB 5CP8A 4RTMA 4RTRA 4C6HA 4HUQA 2PUEA 1T3TA 1GUYA 3GUCA 2WNIA 3GPCA 4IIUA 3VC1A 3WDKA 1RLIA 3OZ7A 3P0HA 2B1QA 4MV0A 3ZDAA 3U3JA 2AE1A 1E2UA 3M4YA 5FA8A 3FG9A 5I45A 3DOHA 4XFJA 4R1QA 4H15A 1V2GA 1XELA 1UBMS 1GPJA 4D57A 3EXFA 1WE2A 1SCDA 5AI5A 2OUIA 4IDFA 4N0DA 3L43A 4ER6A 2RC6A 2QJOA 4UHDA 1C9NA 1A9TA 2K4MA 1D6MA 1Y1PA 1SIBE 3A6DA 4MQFA 2JCGA 2WD7A 3A1TA 2QAIA 4MHTA 1EVKA 4D81A 1E1QD 1L5NA 3QMVA 4D41A 1H5QA 1PL8A 2ZBGA 2B35A 1HRKA 4ZDJA 3IEMA 5T8KA 1JMVA 3GDHA 3KUKA 3ORRA 4ZJZA 2H11A 2OO3A 4WNAA 1F2DA 4K9PA 5JANA 4Z0TA 2C8VA 1WIWA 1SU7A 1XU4A 4ZHQB 2QRMA 4RV9A 1GTZA 5EKUA 3X1XA 5BWCA 4J03A 3CG4A 1K1EA 5FUBA 5ADHA 4YPOA 3NIWA 3KYDA 4QT0A 5DTEA 1O58A 4MQBA 4Q03A 3C1TA 2FZ4A 5C32A 3DBVO 5H4GA 4WK2B 5EC8A 5J2UF 2C4VA 3H2JA 3VHLB 1ZGJA 2VJMA 4CM4A 3GA5A 4YJHA 2COKA 3NT5A 4R2HA 1E5DA 2EX4A 4UVHA 1CQJB 4KQEA 2RGXA 4A8PA 4C0XA 4EJMA 4U0KA 4PZZA 4DXAA 4QRHA 1IWBB 1E92A 2NU9B 3DVAB 2PGOA 3PFBA 3UQYS 3F3SA 4G26A 1A5ZA 2WIGA 3MUOA 3ENWA 5EZSA 3N59A 1KFJB 1PR4A 3BTOA 3DZIA 4NU5A 5EZYA 4DR2B 1QV6A 4RACA 1XWFA 1QP4A 2DJIA 5JNSA 2PSDA 2BFCB 1QOZA 2RHTA 4RKEA 4C43A 1UKEA 1VCNA 3I6YA 4CKEA 1OD6A 4IXNA 1Q0LA 1JHMA 5CMLA 4Z0NA 5FO0A 3JWGA 3FMPB 2P5UA 2BFAA 2G72A 1ICEA 1NKSA 3LPCA 4YQYA 2WOJA 3D4NA 1EK5A 3LQYA 2E9SA 4I3GA 4INPA 4B79A 1V8DA 3FOAA 3P5SA 4MA5A 1T5HX 2CHQA 4A2WA 2MYPA 3BRWA 3KNZA 4GWGA 3EBLA 1D2AA 1UFRA 4CDRA 1KI9A 4M7PA 4O2RA 2D74A 3N53A 4AUEA 4ER7A 4QJ3A 5H81A 1W49A 5F9MA 5A6SB 2OLEA 1SXJA 3BMQA 4M37A 3FDZB 1N5LA 4O2AA 1ZOLA 2OGSA 2ZE5A 3NASA 3TLBA 4BFLA 1X19A 1O9BA 2GWRA 3HN6A 3IO3A 1BAPA 4RSHA 3IVRA 4B6SA 4CN9A 2IEYA 5SY6A 3WLIA 4G9GA 1ARZA 3GDGA 3CUVA 5ABPA 2C42A 4GAEA 4QNNA 4WBNA 4FDVA 3URKA 4EG1A 5FPYA 1J1UA 3OWOA 1M6NA 1Q11A 3OO0A 5AP9A 1F14A 2HCFA 3UNXA 5CLLA 5KYGA 3LYUA 1JI3A 5HW0A 1R8XA 1U0NA 1SUFA 5CA0B 1O08A 2X58A 3FYUC 2CDAA 3JQGB 4XR4A 4YCBA 4MUFA 2LZ0A 1QRSA 1E5XA 1LPPA 3GLHE 4E32A 3D8UA 3SHFA 3ONWA 3UXEA 5KQSA 1LW7A 2WJIA 4Y6PA 4Q9DA 2NZJA 5AW6A 2FCRA 1GA6A 3BIXA 4YS6A 5B1IA 2LW7A 2QG6A 4AC9A 5A3RA 4CEHB 3V4LA 1SUAA 4DJAA 1GGHA 3FKQA 4GD3Q 1XN4A 1DAIA 1AXRA 1XZPA 3ILHA 4KZPA 4RLSA 2IYUA 4I8DA 3NHUA 4Z8XA 4NFLA 5DT2A 3SHWA 2CNKA 1ACMA 1J49A 1IBSA 2J9XB 2XOKD 3QVJA 1FX0B 2CXPA 1KHHA 5JDIA 4LRUA 1DQNA 2DLNA 3F5SA 1K7SN 1NXVA 2GPYA 4U9IS 2H85A 5ULLA 2IOYA 5JADA 3W2GA 2RGAA 4NZMA 1TTTA 2GF2A 2WA2A 3KOXA 2BW0A 1VXOA 3P2IA 4JIMA 2WJZB 4WVLA 3K9WA 1JJVA 4ESOA 1SURA 5KIAA 3QE3A 3WLMA 2NWQA 4X1YB 4CLDA 1JWAB 4YO8A 4UFNA 4BX0A 1A1SA 4D02A 1Q0RA 2O14A 3ZGXA 2G9QA 4L78A 4J3NA 1O2DA 2F8MA 3UWDA 1ZVQA 4PGAA 1I32A 2PZKA 3OC6A 1LPSA 4XGRA 5DLPA 5H9WA 2BUCA 4ZI5A 3VPSA 5TIIA 2UYHA 3R0ZA 4D4LA 1OROA 3QXGA 4PZAA 4QYTA 2DECA 5AJZA 3T3NA 1B1CA 3T3MB 1KL7A 3GMDA 1MG0A 2BTQB 4UHKA 9MHTA 4EY3A 1E79D 1T8YA 2DAPA 1FNSA 2FWMX 3OFSA 3DUWA 4DJ5X 4RA9B 1W4BA 1TT5B 1GUFA 4DCUA 3PF8A 2EATA 4KMSA 1WBDA 2ACKA 5I9BA 3B3AA 2LDBA 4V1CI 2YCBA 1J7JA 1DEHA 2J3QA 3UK7A 4LJLA 1EVLA 2P5YA 3EH2A 5AJUA 5A3JA 2EGUA 1KWGA 3ANTA 4R6WA 4MP6A 3DLIA 3UMFA 3VZQA 4L72A 2P2YA 2IOQA 1AUVA 4RVGA 5I7OA 5D3KA 3ZE6A 4HB3A 4IO0A 4NH0A 3HDVA 3DV0B 3W6ZA 1C9MA 1MC4A 2Q62A 2R1VB 4GRIA 4KFTA 1FJ2A 2W6JA 4PS1A 3LS2A 1GCAA 1U0OC 2JNWA 2PLRA 1QRUA 4HJXA 3V55A 4UNRA 1J09A 2J9RA 3ZI7A 1L5WA 2CXNA 3DAPA 2EXXA 3SP1A 5CURA 1XNJA 1X39A 3K2IA 3V3TA 3ECAA 2JGKA 3KCNA 4ZAVA 3LFHA 2I2AA 1JEDA 1H6DA 3BJZA 2IHNA 1SUBA 1MAWA 2OLJA 3TQOA 3IUPA 4HFNA 2OMEA 3L9XA 2V5VA 3V8NA 4JBGA 4B4WA 4CG0A 5LNK6 3SVTA 5CHYA 2X86A 3KPWA 1C2TA 2I99A 3RHSA 1G4UR 2GI4A 2ZKIA 4YV0A 3AERA 1VLQA 2FW6A 4HFJA 4O33A 4ZAYA 2A94A 4B46A 1WD5A 5ALWA 1QF9A 4DRXA 2YIDA 2QGZA 3NKFA 3NTOA 2BHLA 4LZWA 2PIAA 1WCIB 4RORA 4UAGA 4N6OA 4BNUA 5BNFA 2I6GA 4WH0A 1S2DA 3R0VA 4W7IA 4A9AA 1ZI8A 3AFNA 1AHHA 1KMIY 3H1PA 1EG7A 1GQSA 1JXMA 2GCNA 2CLDX 4TX1A 3F8WA 1E5VA 3C1UA 4GVLA 3UOAB 3WL6A 1TEVA 4EB3A 4W5OA 1MAAA 1JNXX 5AKLA 4GEGA 3VC3A 2ONZA 2IEAA 4J7XA 4OLHA 3U4MA 1R12A 1O5IA 4P9NA 1EJ2A 3OEHA 4IDPA 4M22A 1SOWA 4EB8A 3D7KA 1LJ8A 3DB2A 5EWLA 3O90A 4REMA 4OMUA 1K9VF 5TMEA 5E6SB 3IEVA 5J5VA 1M5RA 4GBMA 2VC2B 5IX8A 3NWEA 3CLTD 3S6JA 3SHQA 3VSEA 3FYCA 4UBLA 3BGDA 1K8XB 1LNZA 3O4FA 1V7ZA 1NVVQ 2HMYB 5DHSA 3I2JA 4L0MA 1XVTA 5JSFA 4DB4A 2PKQP 5HE8A 1V71A 5J2TA 3TD9A 3Q7RA 4MB2A 2PMWB 1WDWB 2J3LA 2OA0A 2ZIWB 1TFUA 1O96B 1KI3A 4OSEA 3CT4A 3S1SA 3UTCA 3PGA1 2W2QA 1B0ZA 4MB0A 2E3JA 5CVCA 5GOTA 4C1NA 3DQQA 5K5EA 2V0CA 2P2LA 1J7KA 2IHYA 3KAKA 5K51A 4S0XA 4FR0A 1R3DA 4EH1A 1FQWA 4XWKA 1T36A 1X3SA 4DNPA 2FA9A 4KO8A 2WWRA 4XOUA 2QVLA 4REOA 4F3KA 3QG5A 5K99A 1OH6A 2W93A 2QUKA 1G4AE 4YGXB 3VKUA 3VR5H 4CNBA 1X2BA 4WZ6A 4Q4AA 4UC0A 5FBRB 4WDRA 4CL2A 4GXQA 4UCFA 4AMZA 5T6MA 3U81A 4BFTA 4E13A 1SPBS 1ZEMA 2GTHA 3L0ZA 2WSBA 3IAEA 4IIVA 4Z1MD 4CKWA 1TKRA 1VBFA 2PUFA 4AY5A 1TVKA 4LNUA 4NSNA 2XNSA 2QT1A 2KYRA 2NPFA 1WUYA 3LXUX 3EFEA 1UIRA 4KQIA 3LQQA 1T29A 2HQRA 1GZ3A 3GBPA 3K5WA 4MUIA 3RJ5A 4TUYB 2IVZA 4BCDA 1PJ2A 2O3SA 4G0MA 4BZZA 3T5CA 2I5PO 4EKYA 1YI8A 4O4HA 4X6LA 5G0SA 2X8WA 4UU1A 4DJEC 3QVOA 1FDRA 4CCYA 2AFIA 2C3OA 4QNRA 1XFAA 1R0YA 3VVBA 4MVJF 4GZ5A 3KSDO 3RUEA 4Q3AA 3UC9A 1EUYA 4EUFA 4E15A 1G9XA 4HLNA 4OQDA 4C3VA 2K2WA 4OHOA 1YAJA 2P2DA 3AUSA 3ND5A 5G0UA 1G8MA 1U94A 3IEUA 3DFUA 5JC1A 4NMLA 4KL8S 1U2ZA 1QZTA 3TOSA 1BYUA 1QFJA 1FDOA 4YPVA 4C2TA 2C4KA 3CKYA 1W87A 1W85B 2FW8A 1N6NA 2EC5A 3I04M 4N5LA 5DRYA 1NW8A 4AJPA 1L7MA 3OHPA 1R6BX 4REQB 2XB9A 3BWYA 3LAWA 2AX4A 4G1VA 4WESB 3QBJA 4PO1A 2FK7A 5ANRB 2ZYUX 4MQ5A 1ECGA 3DP7A 2IC5A 4DCPA 3EGXB 3OAAA 5JCXA 5TLSA 4ZZ0A 3LY9A 2V8OA 5LU9A 2QMYA 5C8XA 1KBQA 3CKKA 4M0MA 5CW2A 4M7RA 3VTAA 1VYUA 1VSBA 3S44A 4I4LA 3WLAA 2NSLA 3GJ4A 2P0AA 1NNSA 3L04A 5F64A 1OIVA 3IVCA 4LXYA 4Q21A 4IJMA 4BIMA 4PICA 3SS9X 2QZSA 5AVQA 5KKCA 3R41A 3V7NA 1Y8ZA 1QZZA 1NQUA 1DIHA 1Q1NA 3EG5A 3UN1A 5CFPA 2XUIA 2VSOA 3QYAA 4P1ZA 3WA6A 3VR4D 5CT9A 5IUJC 1E1KA 4CQMA 2E21A 2WMNB 4LSGA 2HA3A 3OKFA 2I76A 3OD5A 2IV2X 3SC4A 4CIVA 1ZJWA 4LNAA 1LPBB 5GJCA 1LS6A 3N5KA 3R8FA 1RC0A 4UAUA 2RBGA 1YRWA 4YALA 1VJRA 2EKDA 4RQBA 3NHYA 2X8BA 3DPIA 3G9ZA 3LHIA 1B8PA 1JV2B 2EBHX 2H8KA 1BVUA 1VJTA 5K1ZA 3DWEX 3IOCA 3EXG1 1FP2A 1JBQA 3HYNA 3R7DA 1J8MF 4ZAGA 1XQWA 2JF0A 4OLBA 3VYRB 3AWDA 2HPZA 2BLNA 3EODA 1GRCA 1EFHA 4GKAA 4DE5A 3B2QA 3ZY6A 1ZICA 1WCYA 4FW8A 4RZSA 1TJNA 4Y0NA 2J7PD 2BR4A 3ZWNA 1KO8A 3PNPA 2DUUA 3CB2A 3IIEA 4QUAA 1AKEA 5KJ1A 2I6SA 3KM0A 1P17A 1ZN2A 3GVIA 3RFXA 4YAGA 4OBWA 4G6ZA 3W5SA 4F97A 1CJSA 1O9HA 2PLNA 3PC2A 2G1PA 2H00A 3SE7A 4GZ3A 4QTUB 4ARUA 3DL0A 4M55A 1PFUA 1PZXA 4BTEA 4RESA 3SVZA 3WTBA 1PFGA 1ZHHA 1F4VA 1PN3A 2E85A 3BJRA 3FTCA 3U6BA 2PZLA 1OTHA 3OLQA 3SC3A 2FP4B 5KX5A 1CYEA 3OA0A 5JDCC 4ON9A 1P8AA 2VDRB 4C07A 4YX9A 2WSIA 3ZWWA 1GDTA 5KAMA 4U39A 4HGPA 2NU7B 2HYIC 1FYEA 1J25A 4RFVA 3MJCA 4AF6A 2B4TO 4FXOA 2D7JA 2AG5A 1T5IA 4BZXA 5T64A 3UXYA 3HWSA 5AW2A 1FFYA 1IMOA 3M6LA 3L0OA 4RWZA 3GCZA 4X85A 5JFGA 2F1HA 1MIHA 2CD7A 4TXJA 2GERA 1VLHA 3HVIA 3SS8A 2QN7A 5AFSA 4E5SA 1PX2A 1QHNA 2Q3MA 4YUXA 5JQGF 1V5WA 4GQBA 2WB2A 3ZZUA 2HHCA 5CTJA 5JAQA 3HUDA 2IOFK 4DRZA 1H0KA 2C96A 4L75A 3SE0A 5EIEA 1VKOA 3T9EA 5HIAA 2D59A 2PL3A 2VCYA 2ZUDA 4K26A 1OA1A 1H3FA 4RHEA 4Z2AA 2I2FA 4KI7A 3BXFA 3RU9A 3GRZA 1M9NA 2R1UA 4C5CA 4DDMA 1Y8CA 4AZSA 3VBCA 4HDCA 4XVRA 4YV7A 1DKMA 1XGKA 2BMJA 4E2XA 1M34B 1LVHA 4K28A 2XYGA 1KEUA 5CVEA 1MW9X 1D2EA 3H11B 4FDMA 1QCZA 1UC4B 1U7WA 1XD2A 3OSZA 5SY4A 1VBMA 2YXLA 3DAOA 5AM1A 2JKYA 2JL1A 3G0CA 3GFGA 3O9MA 4MLPA 4N76A 1I4WA 1J8YF 3ZD8A 2ORVA 2FWJA 3D6JA 1SXHA 2W8BA 3RV4A 3LQFA 5A9TA 4HAZA 1LI5A 3CURA 4OHZA 4WX2B 4H4DA 2OHGA 4PO3X 5DKFA 3IXLA 4JT4A 4DY4A 1XCOA 2NVWA 4ZCIA 1Q50A 5JG7A 1IK4A 2XF8A 5LM3A 2HIGA 2WTBA 2E5WA 3ELYA 1BE6A 3R9WA 2RAUA 2JGEA 1PZEA 5DWQA 4U5QA 4DMGA 3OVMA 2XRMA 5KVAA 1UOPA 5K0TA 1EZ4A 2PM8A 1NL3A 2I6XA 1UQTA 3TW8B 1TTHA 2W98A 2B1IA 4R1PA 3OCXA 3T5GA 4ITUA 2JI9A 1PVDA 1SHLA 1DQYA 4E03A 2YJZA 4IGFA 2UZ3A 3P2JA 5LJIA 3HHPA 3NHLA 5KOHA 1V48A 4A15A 3U7JA 2VUIB 3NTRA 4XD7A 5IAOA 2FEWB 1R8YA 3SD7A 2GHIA 3O8OA 4ZANA 1SULA 3OFVA 2FN4A 1ZD2P 3UGJA 3WGVA 2HA4A 2Y1DA 4V03A 3GJ7A 4RHUA 1OV4A 3K53A 4QM7A 3BTSA 5WRFA 5EL0A 1Q1BA 1AZTA 3A1VA 3LOPA 1JG3A 2WSSA 4F91B 4J0QA 2VPPA 4TMWA 3WWPA 2OP1A 1PF7E 3FVWA 3MJDA 3N8IA 4HEA6 4Y0AA 5ITZB 4YH1A 3H0KA 2MCFA 4B3JA 4D79A 4LPKA 1G21A 1SOMA 3PC7A 1GFZA 1KZ1A 5E4TA 1WD7A 1ZU5A 2V7QD 1F51E 3HCRA 3KR1A 4Q19A 4BN0A 1NLMA 5F35A 2N75A 2CL0X 2JVIA 5AH0A 1ZWKA 2QM3A 1G3RA 1ORTA 1Q0PA 1TTQB 2VP9A 4MW7A 3FFXA 2WUVA 4TKMA 4WPGA 2ISQA 5EJIA 4B84A 4CU5A 2VYVA 3KQQA 4CQMB 3PUKA 4N6NA 4IY1A 1NMYA 2BCGY 5ICFA 3W90A 2GX6A 1E60A 2HU7A 3QK7A 5ES3A 4H6WA 4B8WA 1QYXA 2C83A 1TK2A 1QQAA 3GN2A 4HC4A 2ONKA 2YR0A 5CT5A 1GKLA 1TW3A 4MX8A 2IX9A 4CF4A 1HV8A 3JARB 4TV8F 2HO5A 4NOKA 5BYJA 2WJWA 4JV5B 5B4UA 2JPDA 1EDEA 2O06A 3I6IA 4DJJA 4NZZA 3K9HA 1UBGA 3K2QA 1Q0QA 1WHTA 2B61A 2QQ0A 3B51X 1FPQA 1QANA 2HWYA 2X8JB 5IKOA 3T06B 1XJ0A 3UJDA 3A0RB 3VFDA 1HK7A 3EQZA 5IVKA 1JVBA 1OCEA 2JW5A 3V46A 3PKIA 3M5PA 4NBTA 1K6EA 4Q1BA 1XU7A 2IGTA 2OT3B 2X9NA 1Y6RA 2VK2A 1SD5A 1E98A 4UNNA 1R00A 3P2EA 1U7OA 1WSAA 1D3AA 3GY0A 1NVVR 1AKRA 1ZKMA 2X40A 5F52A 1L7BA 2ODWA 2VBIA 4B7AA 5KTNA 1GGMA 3DO6A 1PZMA 2RGGA 2A9FA 2QM8A 1GU0A 3LLUA 1TYCA 5BYBA 4EPXA 4AZTA 4DDTA 3R76A 4J49A 4F3CA 3UAYA 2I2WA 5C1DA 1OWNA 2XNHA 5T41A 2GJKA 3WHKA 4UZFA 3JVVA 1G1MA 2JDIA 1H8HA 3AF0A 3T61A 3LTNC 4R40A 4LXGA 3AY7A 4YCMA 2VBCA 3I2KA 4JVMA 1IPHA 2XAAA 2HMWA 5KYWA 3QMMA 2WJ3A 1ZYUA 3DR5A 1YZTA 2IBSA 5D86A 3TIFA 3I58A 1CCWA 1ZAYA 3ORYA 1JI0A 2BHTA 2BEVA 4RLHA 2PLAA 5B58T 3PQ6A 1YS7A 5CXXA 2VJQA 1GQ2A 3B1XA 4KQXA 4NOMA 3RVOA 5JEDA 1E6KA 1ZUWA 2BFFB 3NHBA 3SXUA 4BPBA 1DIGA 3I4LA 3M4XA 1XCBA 2G9NA 1C7IA 2YHIA 4BQOA 5AVYA 3BMOB 4AD8A 4TQ9A 3W6PA 4XKJA 3ZJVA 2SKDA 2EL9A 5IK2D 2JCSA 4RK5A 4UBNA 1ZZGA 1KI1A 2Q4RA 3IIIA 3U60B 2GHQA 2MSWA 3SHVA 4F2HA 3FWKA 2JH3A 1WHSA 1PS0A 1YUBA 2WSLA 3I0NA 4C0KA 2HA0A 2UAGA 1R0RE 3MLEA 1DRWA 4FR2A 4OL0A 4DIEA 1J00A 3EEFA 4I66A 1RKBA 3R09A 4HNSA 4OGGA 3ZGOA 4AU1A 1LDYA 1CR6A 3BF8A 4PG6A 3WMWA 1SBNE 1J39A 3FPBA 1ECBA 2C9YA 3QA3E 3BSYA 1D8AA 4FBGA 4MW1A 3RTDA 4A0QA 3MT9A 1FNBA 4GRDA 4L8WB 1MJNA 5D1NA 1BWQA 1E7YA 1KTVA 1MZVA 2Z4RA 1KYTA 3CA8A 4O1MA 4EMBA 3VC2A 4DMHA 4AQ7A 3KCQA 1JJAA 4HP8A 4KWTA 1IIBA 4IVRA 4OY3A 1DRVA 4YUWA 3HG7A 4Z3DA 3OCZA 3R7SA 2YZ7A 1NW6A 2CKMA 3OEYA 3EVFA 3NHFA 1V4VA 2AI2A 3QF7A 1ODTC 3VR2D 1LFAA 5IKEA 4JP8A 1A7UA 1NRWA 2VKQA 3EW9A 3P0JA 4AJLA 4C14A 2QT0A 1FP4A 2E48A 4AT1A 1I6WA 1LF0A 2Y68A 1E2DA 2QLJA 1PWHA 4B4DA 4CQLB 3RUCA 2APJA 2HMSA 3BBPA 4DDUA 1NBOA 1NU8A 3KK0A 2CFCA 2WP0A 1LK7A 1NLUA 1R0CA 3O03A 2AH5A 2XA1A 4GLLA 3QEKA 3VDNB 4YMLA 3LC7O 1QG4A 2WNSA 4F4DA 3QVVA 2ZSHA 5IJWA 1EX7A 3ZBPA 1XK7A 1KP9A 3C5EA 5TEWA 4AJHA 4HT3B 1E5LA 5J4VA 3MCUA 5TGTA 2H9YA 3FGOA 3L5KA 2FPMA 3DDCA 3T5TA 2F59A 5IABA 2E5LB 2QTLA 1XZLA 2W00A 3GEDA 4F92B 4FE4A 5HBGA 1QCYA 4R98A 2FPRA 1ZJYA 2MYTA 4ZAZA 2CJWB 1U9IA 3GGOA 5DWVA 3DONA 2R97A 4L51A 3V4PB 5F77A 3BPSA 4NY1A 2B83A 4F1JA 5FUXA 3SQMA 4XVUA 5ICMA 1ZH8A 5M04A 1KR2A 5LL6P 1B6RA 5KWEA 1XQXA 5JZSA 4ENRA 2YBDA 4RA6A 1U1IA 1NW5A 3KUXA 3BH6A 3JPYA 2AT1A 1G8HA 4YBRA 5K05A 3Q15C 3C3EA 2D2FA 1VHDA 1T15A 5FORA 2I1WA 3RVSA 1ODLA 2QN3A 5AM3A 4RTKA 4EBFA 4ZVRA 2H51A 3GUYA 4HL6A 5E2AA 1YU9A 2R8PA 3DL7A 1MRZA 3NYQA 4P4NA 3SU8A 2VEDA 1TX4B 1GY8A 3N8DA 3PR3A 4S1PA 3GZTB 2O2GA 2DQKA 5J5CA 1KJYA 3RIYA 2C7BA 1TDJA 3GGSA 1IJBA 5LLSA 4BQIA 5K3CA 1HZZA 4U7GA 5HZMA 3CMMA 3BAZA 2XKAA 4I4TA 1WLSA 4Q4AB 3B5JA 1FTYA 1VLVA 3Q9NA 1FZTA 1ZW1A 5BSHA 2Q29A 2XE4A 1E2JA 1NMQA 4JC5A 1BCSB 1K9SA 1PKEA 1QV7A 1Z62A 4KX5A 1MFZA 4DA0A 1PYGA 4MRSA 2PD4A 5GTDA 1YS1X 1Z7WA 4EO9A 1N2CE 2ZBVA 5FIUA 1NQAO 3AQ4A 1AQUA 4OHKA 2CLHB 5DB4A 4LI0A 4J3JA 1GQOA 4KIJA 4GNRA 2DEUA 1K5DA 1NLYA 2AW5A 2RHJA 2YMLA 3K0HA 3MBIA 3SEFA 3SSNA 3ADBA 3NHAA 1BIFA 4LYJA 4G23A 5L7YA 4EMTA 4LWQA 2ZYIA 5K3EA 4V2IA 3OQIA 4UEQA 3K94A 3EVCA 1JSZA 1NV9A 3PUVA 5A9SA 4BO7A 1A2BA 3MRVA 2D0PB 1R18A 1XZBA 1UJ5A 2OM2A 3S5JA 4BZQA 5FBVB 1UJCA 3V8QA 1YB1A 4N01A 1JBKA 5AVOA 4B3HA 5IF9A 3TW6A 4DADA 4O4LF 1S96A 2K6GA 4X6UA 3NC4A 3I9OA 4YRIA 2ZRIA 4FMBB 3GGGA 4MKFA 3R7LA 3PSAA 5ALIA 4BTLA 2VUUA 1PTJC 2O2YA 2OC4A 2ZJ8A 1A9ZA 1RAHA 3BMXA 3EIWA 4IHQA 3TLKA 4CTOA 4E11A 2D5AA 4AY3A 1OZAA 5CM8B 1WDTA 1C7RA 1QFMA 1VG9B 1R6AA 3R1IA 2RK4A 3HNRA 4PBRA 1WXWA 1KAQA 3L1VA 1FE8A 3DCIA 1GPDG 2CFOA 2P4QA 3KYCB 3TN7A 3I32A 2G5CA 4BO1A 1XCMA 3AUFA 4DLRA 5KDOA 2BYTA 3D02A 1IOZA 2C7VA 3OZFA 3AVTA 2X2OA 5FOVA 1U3FA 5AVVA 3SIPA 4P3OA 4MIYA 2C5SA 2QTAA 3E22B 5F33A 5AD1A 1XDBA 1D0IA 2DH6A 2CL6X 3H9EO 2F8LA 3PF9A 1TYAE 4OQFA 1QFYA 3GFTA 3B9PA 1Y4SA 4B4UA 3HDHA 4XQEA 4ZHQA 2MR5A 3BSFA 1J42A 2VHYA 4G5YA 5EIBD 3TE6A 1EHYA 2LE0A 3BMNB 4P4GA 4ILKA 3GN1A 3CEHA 2FZ5A 3F78A 1VQ1A 3MWYW 5EKTA 3W6UA 4JX9A 4KR2A 1UKVY 1W2HA 2IYNA 2X0JA 4G65A 3GFVA 4R83A 1HNXB 4Y2XA 1LXCA 3CUUA 3KEQA 3MTDA 5C8VA 1IPFA 1EX9A 2PYIA 4P7BA 5DBFA 3VPGA 1XJCA 1EI9A 3NZEA 4FFBA 2PT5A 4LRXA 1XA4A 3PGXA 1UPXA 3TRIA 4YNBA 3NBYC 1N2BA 2E4UA 3V7UA 5BSEA 4IJVA 2JLYA 4U02A 3UGQA 1I01A 2JFQA 2ODTX 2M32A 2CK3A 4NONA 2NYUA 4WNCA 4GGOA 2IH4A 3LQ4A 3T94A 3GRUA 4KBYA 5L7TA 2VI5A 3LWNA 1V16A 1I9CA 3V1UA 4FEEA 4GOLD 4URWR 5IZCA 2W2MA 2BD0A 3VVMA 3V4ZA 3JQ7B 2IFTA 1HMPA 5HILA 1F48A 2CB0A 1I1OA 1D4AA 2LDXA 3CJRA 4NEQA 2QXYA 4IHJB 4KNVA 4NIMA 4F9FA 1E3EA 1IJFA 1MN6A 5LA6A 3IAFA 4DNQA 1JDZA 3HY6A 5EUQB 4C4SA 2GM4A 4YRJA 1UXOA 3Q88A 2ZKLA 1YC2A 2ZJOA 1SH7A 1U1CA 1Z5OA 1LDBA 3MCAA 2E4VA 4YHBA 2HIHA 4HNHA 3ZZNA 2OR3A 4MQMA 1CR2A 4DA8A 3MGKA 4LGCA 4XGIA 1ESZA 3AT1A 5FNVA 3RVNA 3I9V6 5JNTA 2ZRAA 2QTZA 2QW0X 3L8FA 2D5LA 4PAGA 2XZLA 2EF1A 5BSRA 3TJZA 2QX8A 3SMVA 1SVMA 1K4YA 2R60A 2ZW9A 2IEBA 3E7DA 1OYVA 4JQZA 1RJEA 1I2MA 1DCFA 4BVKA 1A69A 4TVOA 3GMSA 1OKKD 3VC7A 3GFSA 5HGJA 4D42A 3VVCA 1DFHA 1KI4A 2Y4OA 2H9IA 1GUZA 1M2FA 4B4VA 4EMSA 1G7TA 3M6MD 5IULC 4QYIA 1U11A 4GOKA 1YTUA 5TPWB 3CHYA 5KYUA 4G84A 4AM8A 3TECE 2VK1A 5KTSA 1JHAA 3GL9A 4J6EA 2VZLA 2Y67A 5ALKA 3DMTA 1CY0A 1NATA 2ESRA 4PYOA 3W3AD 1OW3B 1OAOA 3ITNA 2EQAA 3IX7A 2QENA 2J41A 1BFUA 3CUKA 3WIVA 1Y7HA 1GSAA 1E62A 2JK1A 2Q0SA 2PZFA 1FUIA 2BHNA 3F6RA 3TQFA 1YF3A 4DUGD 3A6GA 1T4DA 2JGRA 2A0WA 2XMDA 3DOCA 4Y6RA 5EMJA 2VPXA 4QQKA 4B8ZA 3ZJUA 1U02A 3RLIA 2D00A 4P92A 4QE3A 5KVVA 4K81B 4O4JF 3RUIA 4BLOA 2PWPA 2XVZA 2FF7A 3KB1A 5HRCA 1GKUB 5IKMA 5HCIA 4KJZA 1YQEA 5T5QA 1VSQA 4KO3S 2XODA 3LGAA 1V4BA 2H7YA 3QUAA 1ZONA 3RC3A 4OYHA 4NNJA 1GPH1 4K1LA 2Y0DA 3G5TA 2JC3A 4CMIB 1X1AA 1RLTA 3C3BA 3NTQA 1N92A 4IYRA 5EI5A 2ACWA 2CMDA 3IOMA 2FOLA 1PHPA 3GJ0A 3DZCA 2YHAA 1XRRA 2VSXA 2HBQA 2JIZD 1SU8A 1SKBA 4A2QA 4F5DA 4YUYA 1GCIA 4RTSA 4G67A 1C4KA 3RSZA 4K9NA 4CM1A 1GL6A 2Q3JA 1DC8A 3VU3A 1MVOA 3KU4A 3PVZA 5I4CA 4AO6A 4F5EA 5E3HA 3OZBA 1INLA 2QM7A 5L3RA 4AECA 2COUA 3FOBA 4JGBA 2WQ6A 3L40A 3K09C 1HYQA 2N1MA 3Q11A 4EFMA 5A7FA 1DVRA 3KQUA 1FDWA 3ZLVA 3NC0C 1KZYC 2F9LA 3QVLA 3BKXA 2J3MA 1CUSA 1DXOA 2GHTA 3VMMA 4C29A 4PR0A 1MBZA 1A9XB 3KOOA 4HN9A 3DMFA 3LT0A 4QJIA 2IPXA 4R68A 1JJ7A 1E3IA 2C4NA 4BDTA 3M81A 3EWAA 1YQTA 1Q12A 5ENDA 4DIDA 4BVJA 3WB1A 2J4CA 5E4YA 2WKWA 2Z4TA 3O92A 3GLHB 4ZKEA 3S1AA 2CDRA 2C2MA 4BFYA 5IT5A 3S8EA 4EI8A 1QRTA 4KE9A 1TT7A 3KQYA 2W83A 3Q85A 4V0MA 4BJ5A 1N2CA 2NO0A 2QP3A 3PQ7A 5I7UA 3WLQA 1L7DA 1XVUA 4XVCA 3BCSA 1J2UA 3ZU4A 4J3FA 1QGDA 4L6IA 4OKNA 3N2KB 2J08A 1I6KA 1Z2NX 1TNDA 4F2WA 1MENA 3LG2A 3SR4A 1DV2A 4WT7A 5LZ9A 1SZPA 4INOA 4HYYA 1R6UA 3D6VA 4YYZA 4E09A 2H1RA 1VHQA 3LX5A 5HRUA 1R0BA 2QRQA 1YMUA 2ZJ1A 4ZT4A 2Q9AA 4L7QA 2ZEJA 3ENKA 1CB7A 1FEZA 5JMPA 2AMYA 3UC5A 3CZAA 3I9JA 2FETA 1GQYA 4RVNA 2KE5A 2I6FA 1GTL1 2EW2A 2HR1A 5H83A 1MB0A 1E3JA 2AKYA 2ZBUA 3WLKX 4XD2A 1A2QA 1JJIA 3H17A 4FZ3A 4IF4A 4HPWA 3FLEA 4EB6A 4MPJA 3DPUA 3GJQA 1Z0ZA 1Z3IX 3DFZA 1MB9A 4LRSB 2B92A 2DQSA 1X8JA 1UL1X 3IFSA 4QSMA 4R16A 3CVXA 2JIQA 1D6SA 3GEIA 5C8YB 4R1MA 3OLYA 2JI6A 3UT6A 1HTWA 2DY0A 4B7ZA 2N42A 4UEKA 5GONA 3PEUA 4P38A 4DC0A 3ZUPA 1DNPA 2DG2A 3WYGA 3IP5A 2P4EA 1G63A 5GOZA 3EQ2A 2VTBB 2Z3ZA 2WT8A 3GARA 3WLLA 1UANA 2AV6A 2N47A 3FWYA 1VA5A 5HWSA 1MAHA 3HN7A 1KC1A 1S4MA 1JQEA 2F1OA 2ZJYA 4G56A 2P7IA 3VR3A 1WAMA 4YLYA 5FTNA 4HDSB 1XRNA 2DERA 1T6XA 1QDUA 2ZR7A 2ICAA 4QUJA 4CL0A 4D4IA 2PUVA 3K15A 4PLYA 4EM6A 4PN7A 1ZL0A 5CU7A 1Q19A 1F4LA 1U5AA 2RGYA 2GH1A 2VDLB 4XVQA 3W9YA 2IZ7A 2OXRA 5EZQA 4YRKA 2NV6A 4WKOA 4BX9A 4EEKA 2PMKA 2XMZA 3OF2A 3EJWA 4TTQA 5A3QA 1JYSA 2ZBFA 3A1UA 1OFIA 3KXKA 4ZQIA 1TXGA 4TYMA 4HFMA 3OX1A 3EG9B 3MWGA 5BNWA 1P44A 1QYVA 3CLTC 3BIWA 4UNSA 3GDFA 2RI1A 3QE0A 3E9CA 5LLTA 3O95A 3L1IA 4YMWA 5AR1A 3DWFA 3I8OA 3IKJA 3IMKA 1VPDA 3AM5A 3HFGA 2A5LA 2YQ5A 3PQEA 4CF3A 1FUEA 5EOVA 3CJTA 5K0CA 2EX0A 2IXDA 1V39A 1I7SB 2L69A 1JS1X 4C0QC 2WC1A 1AZWA 1C4WA 1P0MA 3IDSA 1QSGA 1QP0A 1OLSB 2JAWA 1VIAA 3I1IA 4IGEA 2ECFA 4KDCA 4CLOA 3HMKA 3FB1A 1E7QA 1L4EA 2WMDA 2Q2NA 3PI7A 4RK6A 3LHSA 1GNVA 5H68A 2WE7A 3C5CA 4WN9A 1D2NA 1U0EA 3N07A 1L5KA 4Y2JA 3DEZA 4BMCA 4IDGA 4YK7A 2BFMA 3ZNPA 1T91A 2A78A 3CV3A 4AZ3B 2PKXA 4PG4A 1JLKA 4AX8A 4ZZ1A 4JXJA 3RJZA 4Y2PA 3TZLA 1M8FA 2Z5GA 4BCBA 4CCYB 1OQAA 3CMCO 3LUHA 3OLXA 4L3VA 1KZ7B 2GFQA 1E9RA 3MA0A 3GJ3A 3PTZA 4IFTA 3RNOA 1MQ9A 5CXSA 3LCRA 2QD5A 4WZZA 2WEKA 5BVHB 1AKNA 2VQ3A 2PSFA 4V1CB 1QTNA 4RGVA 1CUWA 1WBBA 4J1TA 4RVUA 1Q7TA 5ITVA 2OSVA 2QN8A 5G4KB 5H1YA 2OZVA 3AR2A 4PAMA 3K9BA 2H2FA 4MK4A 4P6VF 4C7KA 1NKTA 3M6AA 5SZJA 2MU1A 2BH9A 4UQOA 4PX2A 2NTYC 1AK2A 4AKSA 4KR6A 3P19A 5JD3A 3LP6A 4HMPA 4ZT2A 2QVCA 3WKDA 2V0GA 4J91A 2A4MA 1DX4A 4QXRA 3DKPA 1KK3A 4LZLA 3RAEC 4RQTA 4DXHA 1NNEA 4JB8A 4DIFA 3BMCA 5A5DA 3HKBB 1QONA 1X1RA 2PKEA 5H8WA 4QU8A 5CB4F 1YO6A 3MTEA 3LM8A 1Z22A 5ILQA 5F2EA 5KNCH 2AXEA 3A9SA 5ENZA 5DRTA 4PLVA 3KUDA 2HXYA 2DOKA 3AI3A 3INNA 1NQXA 4L1KA 4L4YA 5B53A 5JWHA 4OX9Y 5AK6A 4A73A 4JYCA 2A0UA 3HV2A 1I7QB 1GZDA 5CFOA 5I4IA 4UQLA 4O8CA 3A6JA 1ZRHA 3HU1A 5AI0A 4DF3A 4CIDA 8AT1A 4IVQA 2OXCA 3GFPA 1FW8A 2KBFA 3V2HA 5F1PA 4GI1A 1JDJA 2CLMB 5ALXA 4O8ZA 5IEJA 1KK0A 1ZRSA 1KXZA 3PNYA 3BH0A 2B1JA 3DE6X 2I3ZA 3WRXA 3TG2A 2XQIA 1MEOA 4CKXA 3BTVA 2PUAA 1ACJA 1JU3A 4Y6LA 2DU8A 3O9ZA 2C2GA 3E58A 1NN3A 2F17A 1NHGA 4WHMA 5HF8A 2CSXA 3OJEA 4N40A 1E1CB 5LBTA 1XDUA 2I67A 5DGHA 4B32A 4DLAA 5DM4A 1E77A 4D8VA 4NAUA 3WR5A 3MFYA 4LF6B 3KZKA 3CF0A 1PAUA 2XGGA 2H5IA 4QEZA 3L4KA 3PD7A 3QITA 3KVNA 4V0NA 5KS2A 4DCJA 1DPFA 3IULA 1KK2A 1UDAA 4WDQA 3VR4H 3DZGA 4CMKA 3O26A 5JZBA 2WJPA 4D4GA 3U09A 4LXIA 4YASA 1QK5A 2OCLA 2WM3A 1N2JA 4H4EA 3R5TA 4I1UA 4ZI7A 2UYCA 5CB6A 1L4YA 2QJRA 3MC1A 1GGEA 4JVOA 4PAQA 4EHJA 2H2AA 4OA8A 1W44A 1GRVA 1NUSA 1AUOA 3HO8A 3KR9A 1GYRA 1X8XA 3PVSA 4RMJA 2PHZA 1U63A 5GONB 2ZBPA 4RVDA 4B81A 2X19A 1CUVA 4G5XA 5BOSB 1SC6A 2RCYA 4W8GA 5J9FA 3EWNA 2WJYA 3ZTYA 2FVYA 3SCZA 5DNUA 4RD1A 2OQ2A 3I5XA 1JEYA 1X70A 5J1SB 2QB5A 1AD2A 4K86A 1QLWA 1HOXA 3C97A 4HYEA 4EPYA 5CJPA 4EW1A 5AXDA 5B1SA 5C3UA 2CJYA 1HOTA 5KWJA 1NYQA 2CV0A 3PQ2A 4MO2A 4WN3A 1CWUA 3F7MA 1TLTA 3S4YA 4HGRA 4YRBA 3NXKA 4R84A 4MA0A 1ZG3A 4N7RA 3VSCA 4Z49A 4GMXA 4O2AF 5FDFA 1ZH0A 2VJBA 5FJIA 5IJZA 3FKSA 4E12A 4NMXB 1OAAA 1QYDA 4ND6A 4BNNA 2JFPA 3HYCA 3UJAA 1LI4A 3LBAA 2OCXA 3CTPA 4IW3B 3E4CA 1C7JA 4B47A 1Z34A 3GFQA 1CRZA 3PA8A 5L45A 5B6JA 3EF3A 4FC6A 1Y42X 3GNTA 4JC8A 4KLZA 3WYBA 5BV2P 3KQSA 3W79A 1ILWA 1B0AA 3AWIA 3BZWA 5BVHA 2HIAA 4V1CA 4K88A 1KGSA 4RMHA 3HADA 1RM3A 5EJ7A 3B48A 1OFVA 3DMPA 2IKSA 1IQRA 3PUHA 1MQSA 5HQ3B 4MLDA 2ZAMA 2VDWB 3RU3A 4GQAA 4QGGA 4TRNA 2Z43A 1N2ZA 1Y5RA 2GK4A 4UAVA 3CZPA 4YCNA 4NARA 1Z6AA 2GN6A 3EQ9A 2P9EA 3CW2A 5T4HA 1GPMA 2RGWA 4MW9A 2DPMA 1TRHA 3TLMA 4B31A 1A7KA 1B8UA 1UWVA 2JAQA 2O2ZA 3BE5A 1NM5C 1U5CA 2AKEA 1WMDA 2BL4A 3ID6C 5FWXA 1SEVA 4C4PA 4AI6A 1AGPA 4JB3A 2Q5IA 2LWIA 4L2IB 1G41A 1SQ6A 2WTXA 4QATA 3U49A 3COWA 3NTUA 1W88B 4DIKA 4EYGA 4GKJB 1NF2A 4OJKA 3D7SA 3DDSA 5JFOA 4W9RA 4R5HA 5D3MB 3DHEA 4FNMA 5JECA 4G1MB 2O6HA 2GAJA 1W4AA 4WKCA 4WLUA 3RIXA 2F3PA 1GTJ1 2O8NA 2W48A 5KDDA 1ZJ5A 5FEMA 1IBCA 2IYFA 4KAJA 2QRZA 2SCUB 3EWIA 1KH1A 2BT4A 2Q6LA 2BHRA 2WZDA 3W1WA 2FSSA 1N6IA 2EQBA 2PU5A 5ERXA 3DBRB 16PKA 4D80A 1A97A 1TADA 2D2XA 2V98A 1UDWA 3M34A 3VPBA 3WXMA 2YICA 4TLDA 2QIOA 1NN1A 4BNGA 3RVBA 2V97A 3HKEB 4LE0A 2Z2IA 4FWBA 3AVWA 2X3FA 2O5CA 3BWDD 1WY7A 1IIRA 1W4RA 5AM4A 3KFVA 1OX4A 5LB4A 2VJDA 1PQPA 1TYEB 3WAGA 1F5NA 4TMXA 4K03A 2HPHA 2BGGA 4KDRA 2JH8A 3J80A 3D8SA 4KDEA 2RB5A 3CX8A 3M9XA 4B8YA 2GSWA 1MEJA 2XEXA 3ROQA 4A8TA 1T1EA 2DSTA 2LR0A 2R6AA 3OA2A 4IJ6A 1W36B 1KDPA 4K9LA 1C8VB 3TUJC 4WZAE 3NIFB 5IXYA 5ECWA 3SX4A 3CPJB 3ICVA 1DHTA 1HA3A 1TUIA 2GT1A 5HFNA 2VK4A 4GU5A 4H3VA 4ERXA 4I50B 4ZI7B 1DBPA 3LNCA 2JKZA 2Q50A 1KMNA 2SKCA 1APBA 3ND6A 1Y5MA 1SXJC 2OY0A 4KTVE 4OB6A 2OXTA 3RJ9A 1JIXA 1V8ZA 1J99A 4KVGA 4Q7LA 3LYAA 1EHCA 4PTYA 4DABA 2WR8A 3W2FA 1I0IA 5FULA 1MFPA 2V7UA 3IT1A 1PVOA 4V02A 4FTWA 4UVEA 3W5BA 1AU9A 1Z15A 3NBKA 1RJDA 3WMGA 5DTQA 2P78A 4COOA 1RYMA 3FCOA 3X43A 2AC7A 3WFIA 2I6QA 3BRWD 3HR8A 2JIRA 3LL7A 4HAOA 1OBOA 3ZS9A 4YCJA 1VDMA 1GPNA 1T2NA 3ZZ1A 2G3YA 4Y6GB 4IUBS 3TSYA 1K92A 4IHKA 1ONSA 2F4VB 1AXGA 3SJBA 1XMIA 2G4CA 2BF4A 2R66A 1TIPA 3Q5EA 1GG5A 2CUKA 3HA2A 2EBUA 2V3WA 3LD9A 3VPHA 3WMRA 5HOQA 1N5KA 1JR3E 2BDTA 2ANCA 4Y1EA 4RD4A 2VJCA 2VA8A 3LNTA 2REQB 1TLLA 3LMKA 3Q10A 3X1KA 1IZYA 2EZ9A 5K45A 3G7SA 2IYOA 4X3CA 3HYTA 1KOJA 1RT9A 4PGHA 2BSXA 2QPTA 1SUEA 1UQUA 3KQTA 3I2YX 2QBYA 4KQ2A 1E3DA 4BFCA 3SQLA 3OCJA 2WQ7A 2FUG1 5KSWB 2WWHA 4H7DA 1PP4A 1XLWA 3B6JA 3G6KA 2H7CA 3SN6A 2Y8EA 2WWWA 3P1JA 4L0CA 1KYYA 4CW7A 2DB3A 4KQJA 4YN3A 4TVSA 5B64A 1D9XA 4YREA 4PONA 2IODA 1DBSA 4Q66C 2GBIA 2GZAA 4CR8A 4YAUA 3O82A 3L79A 4BVAA 3L7OA 3PUZA 1DC3A 3GLUA 5B7GA 4TSRA 3H2BA 4J29A 1QKKA 3UUEA 3PEWA 1HR0B 1WF3A 2XOKA 3A4VA 3T7SA 3IUJA 3L5OA 1N7IA 2I4OA 4I46A 3UCFA 1THGA 1GITA 3JAKB 1TUGA 1M6VA 1UXHA 1ZQ9A 5I3CA 3K6SA 4LKRA 3N58A 2WU1A 5EKXA 4AY2A 1VB3A 4FE3A 4KVAA 4YPFA 5A0TA 1CW2B 1U0HC 4J94A 1C30B 4N3NA 4XIJA 2P79A 4EABA 1G7CA 1P3DA 1X7DA 4D6YA 1R8JA 4DV7B 2XVYA 4DVJA 1S1MA 4S1NA 1XTBA 2Y1EA 3EIQA 3NHRA 4N7MA 4RPHA 5HF5A 5TMDA 2YN0A 3EEIA 2HM7A 3S99A 3BSSA 4HGNA 2QQFA 2V45A 4LGYA 4FUTA 1E6LA 3GJ6A 1IATA 1UMCB 4U7PB 4A8JA 1GG9A 1P9LA 5IS2A 2JCBA 1BSVA 4N39A 1CY8A 1E8DA 1T0IA 4G0YA 1RWWA 2QRNA 2NN3C 5LQUA 3EK2A 2L19A 2W2LA 3WGLA 4D2IA 1IVNA 1RXIA 1SQSA 3K5HA 1RPZA 4C30A 4YAEA 1RAAA 3E3NA 2W6QA 4BCCA 4Q3DA 2D1YA 5JSUA 1H8ED 2WFLB 2ZG6A 1KGDA 3FDZA 3OJWA 2GRAA 4O2AB 1EGVB 1JRLA 3KXIA 4LUCA 2XCLA 3RVKA 4Z6KA 3B2EA 5ELXA 3BG5A 1HDXA 1X1TA 1J9ZA 2WYWA 1JKJB 3TWOA 1YRLA 1U3WA 2YKGA 1IHUA 3ABQB 1OHHD 5BN4B 4EVSA 3I12A 5LIRA 4LZOA 3B13B 3KJQA 3P0EA 3AMVA 3FNGA 3C7DB 4PZPA 2B1GA 3NDPA 3DZBA 1C7QA 4JCCA 2XWPA 3AFHA 5JJLA 1SKAA 1F0YA 1DELA 4GIBA 4OL9A 4HYQA 2IIPA 2ZM6B 3HVUA 3QJ5A 1I1NA 3QWAA 4L5AA 1JTVA 4LE2A 5FF9A 3ZX5A 1YDMA 4L8LA 1BWPA 1XA0A 4JB2A 4XPIA 4PYIA 1W0KD 4XX1A 3W77A 4MWEA 5HS6A 3PXUA 1Z36A 3BBLA 2D2EA 2QOEA 4UTXA 4ND3A 2AI3A 5LZ2A 1OWPA 3K71B 4QULA 3MOIA 3CLRD 2A0FA 2AL7A 3HC7A 4EITA 2CMGA 5A5FA 1PYOA 4P4LA 1Z88A 1VHLA 3ZY2A 5CIYA 3PBKA 5BQXA 3A11A 1GO2A 3JZMA 3OX3A 1TMOA 3RVMA 3WNVA 4A82A 1V6SA 4LXTA 4R0VA 4E1BA 3Q6MA 5IXJA 5JC8A 2R6FA 4X9XA 4MGHA 4DFDA 5IPFA 1RRCA 3H65A 1ISFA 1NIPA 3PU6A 4LHWA 3RI3A 4GH5A 4MYTA 4IOKA 4O2BF 1Z6XA 2V5UA 2OBMA 3WYDA 1J2EA 4KITB 2OOKA 4G4GA 1OC2A 1U3UA 2OAEA 3EASA 2HQBA 2F90A 1F2UB 4MUKA 3I8XA 3WNDA 5JBNA 4FZJA 2IW3A 2GS9A 1SQFA 4PSUA 3QIAA 1G20B 1ZISA 4FX5A 4IINA 3RJMA 3ROTA 5MN6A 5BUCA 4QDUA 4UPDA 5CVVA 3F90A 1AIPA 1E1RD 4L50A 3R75A 4MRNA 3MGGA 1LLUA 4WSOA 4IZ6A 4YI3A 4JKIA 4OGKA 4D4MA 5AW1A 5LFAA 2DH5A 1ZITA 3K20A 2J67A 4R5MA 3S2UA 2TMDA 3UGKA 4DQDA 2XGJA 1DSSG 1P2VA 2AIRA 1W25A 2JRLA 1V2HE 2DUWA 3GAFA 2PTGA 2PU7A 1ILEA 3IAS1 1QF6A 1FXUA 1GXSA 1ZMTA 2FWIA 3K9NA 3JD3A 2E1RA 3R0IA 4H1HA 4UBOA 2IDJA 1U0FA 4YIKA 1RMQA 3AEUA 3C4JA 3PDCA 1QQ5A 2ZUSA 3UHJA 1EP2B 1UBFA 5BQ5A 2QAJA 3V80A 1NR1A 3EVTA 1VJ5A 3B53X 4ZQFA 2YXDA 4KH0A 1ZUNB 2VCHA 1QIJA 3ADPA 3LQRA 3K0KA 1K8QA 3QNMA 4GOOD 2R44A 4O4IA 3U6KA 4AROA 3DV9A 1QYIA 4DMKA 2XUAA 4W5WA 2GR9A 1OF1A 3UJ6A 4DJFC 2JA1A 1Z68A 1SELA 3KB6A 5FTMA 4C7VA 1FSZA 1R6TA 3ETCA 3GHHA 3RODA 3UVEA 1SQ0A 4WJZA 3H5AA 4CTKA 4K2HA 2QK4A 1B2RA 4U7TB 2FMHA 2OUKA 4KMMA 4W5JA 5FUVA 3QQPA 2VS1A 4RSMA 4N8SA 4NV0A 4RH3A 1NASA 2NUPB 5AK5A 4R3WA 4ASUA 4OX9B 3RK0A 3JYLA 1P39A 3ER6A 1OXUA 3BVPA 4ARCA 1KDTA 4HRXA 5MN4A 4NDAA 4YT2A 3AHEA 3GYBA 3OPVA 3T1VA 4LY3A 4AQDA 3M5DA 3V4RA 2H5JA 2OHOA 1O97D 3FTQA 1HF3A 4IV5A 4CG3A 3K4HA 5B58C 1WCIA 4XM2A 5AHRA 3KU1A 1HC7A 4M9RA 3VAYA 3L7CA 1VECA 2Q4DA 1KJZA 1HYBA 4Q7EA 1RWOA 4WIAA 3P2KA 3GEHA 3HA5A 3HQ4O 2ZR0A 5EZYF 1VL6A 1EVJA 2WB4A 1JJBA 1BZYA 3RTBA 2E7ZA 3WI7A 1C0LA 4BFSA 1RRGA 1HQDA 2YFYA 3K30A 3DNMA 4PCVA 2C61A 4WD3A 1YA6A 3PCRB 4OXRA 4KHZA 3FCYA 4PQEA 3GPBA 3K0AB 5KTKA 3KKZA 4NCBA 3LW7A 2NPIA 1X86B 3QVWA 1P5RA 2ZVPX 3OQNA 1WM1A 4S12A 5G02A 5A62A 2FZKA 1T9ZA 2VP4A 2PXAA 1EH5A 1XZ8A 1BMQA 4JVNA 3JRNA 4B5LA 2RGEA 2NV0A 4XJVA 5TT1A 4IKOA 2GXAA 2J46A 1N5IA 1NRJB 2B8NA 3OSUA 2JIMA 1ZK0A 2B30A 4J7UA 1LVGA 1FQKA 4QC2A 1BRMA 4MINA 1NONA 1ICIA 1FLAA 2OCIA 3F3KA 4FKMA 5TNXA 1DQZA 3ES9A 3RTCA 2NUTB 4G89A 1KBZA 1RHMA 4QUIA 4MKZA 3AHFA 4IF6A 1ITZA 2AJDA 3NP7A 3LKZA 1GCUA 3OZEA 4FOPA 4A1FA 4FOLA 2CLCX 2J9ZB 2XD9A 3G2PA 1A72A 4DR1B 5P21A 1KKLA 3CX3A 4RIIA 3VTFA 4IICA 1NFQA 3DKKA 2OE2A 2XCQA 3PPYA 2RJOA 5B36A 1SFRA 1LDNA 2BFCA 3FFTA 3FWPA 3PT5A 2A5YB 1ZX1A 3NR2A 4UE2A 3WBJA 2AN3A 1IEWA 2Q5QA 1LBQA 1RNLA 2FSUA 1WV1A 1CUBA 3GVPA 1TVKB 1V4NA 1T4CA 3PJGA 4K6KA 4LNUB 4NWIA 3RG8A 1SG6A 2JAXA 3K5IA 4UE3S 2Q27A 3X44A 3LCCA 1USIA 3GJSA 3HCWA 3E35A 4DRYA 1BWSA 1YT5A 3HCCA 3MWJA 5JY1A 1O4VA 4I1OA 4IX1A 2DWPA 3U7HB 5DLEA 3DD1A 5K6TA 1EX6A 2IY8A 2J7PA 4FN4A 4AP9A 4EP1A 4G5HA 1EK0A 4XCVA 4Y30A 1S8FA 3UMSA 2WU0A 1EQAA 4IMIB 1KZHA 4EHBA 1HDRA 2EHJA 3JSXA 4IGKA 4QICA 5JXGA 3WGNA 6CHYA 1IY9A 3PYXA 4TMZA 2P2GA 5A2GA 4W1SA 4LK2A 2VPZA 4UEJA 1J0BA 4WINA 3G23A 2NO7A 3B8HA 2VT7A 3FPAA 2AFHA 2CBGA 2FN3A 2W6IA 2BM0A 1PSDA 3NWBA 5DH9A 3U3MA 2Z6AA 3LUKA 2XQJA 4NPAA 5FNVF 3V6LA 3Q1LA 2J0UB 4IVPA 4Q9LA 2A1TR 1CNEA 4L6AA 5LZ5A 3WO1A 5JMTA 2WFZA 3H87A 1KDVA 3TTTA 1PJTA 2NNLD 2ZI5A