3T7JA

Crystal structure of rtt107p (residues 820-1070)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
250
structure length
237
Chain Sequence
TKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHSQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDVIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Regulator of Ty1 transposition protein 107
total genus 76
structure length 237
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7jA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7jA01
3PC8C 2LE0A 3AL2A 1OQAA 3SHVA 3L41A 1T2VA 3K0KA 3JVEA 4Y18A 2K6GA 3PXEA 2ADOA 2L42A 3FA2A 3II6X 3T7IA 3SQDA 3UEOA 2COEA 4IFIA 1Z56C 2EP8A 2VXCA 3PA6A 4U4AA 2AZMA 3PXBA 1IMOA 3HUEA 1L0BA 4BU0A 4BMDA 3PXAA 3PD7A 1Y98A 3EF1A 3AL3A 1CDZA 3T7JA 3COJA 3PXCX 3U3ZA 2K7FA 3I0NA 5ECGC 3L46A 3QVGB 3K15A 1N5OX 2NTEA 3HUFA 2XNHA 3T7KA 1IN1A 3PC7A 3EF0A 2VXBA 2COKA 2EBWA 2D8MA 2HTFA 2R1ZA 3KTFA 1JNXX 3K0HA 3PC6A 2M2IA 4N40A 1T15A 3K05A 4Y2GA 3T1NA 1KZYC 2DUNA 2JW5A 4BU1A 2WT8A 2INGX 1T29A 4JLUA 3K16A 2EBUA 4XQ0A 4OFBA 4BMCA 3L40A 3OLCX 3QVGA 1GZHB 1T2UA 2XNKA 4IGKA 2E2WA 3PXDA 4XPZA 3UENA 2COUA 4ID3A 1L7BA 3PC8A 2ETXA 3I0MA 3SZMA 1WF6A 3SHTA
chains in the Genus database with same CATH superfamily
4R8VA 4F4CA 2FW1A 5I9LA 1DEAA 4RTNA 2I9KA 3B6JA 3BFJA 4OXXA 4PCUA 3ZCVA 1O95D 2EW2A 4ND8A 3WAJA 1Z38A 3QUCA 4IXMA 2C96A 2RK4A 1QB7A 2ZDGA 2H7XA 3HZZA 1AXRA 3THRA 4HOYA 4QDJA 2ZXUA 2Y1GA 1ONBA 3H3XA 3PT5A 4MW2A 1XG5A 3H2IA 5TARA 4O4LA 4N5LA 1QX4A 1GHTA 4ROSA 3U48A 5DP2A 3L05A 1LF5A 5I9TA 1OZHA 2V74B 3R0XA 4MTLA 4GLOA 3OQOA 2ZI9A 1J33A 1Q16A 2YL2A 4YRZA 4P35A 3BJIC 3TPCA 3C1OA 2VEDA 3TIGA 2ILTA 2FNAA 2LNDA 5K0LA 4DBLE 1EK2A 3JVVA 1Q7TA 1W29A 4D5EA 3SC2A 2UU9B 1WEHA 3RH0A 3T95A 3GF4A 1KU0A 4FFDA 2WY2D 1KHTA 3AR4A 1O1YA 2FPWA 5IJ9B 3I23A 3CZ4A 1UH5A 1E2QA 1QFZA 4KSCA 4E51A 4YP0A 1E9RA 1KH3A 5IBQA 3RUDA 1YK0A 3R7NA 4MUMA 3GVHA 5KZMB 4DMGA 1QC5B 2O2IA 2KJQA 2POCA 3ZHXA 3R3HA 3RO7A 1QZTA 3KCNA 4QUHA 4N3GA 4FB5A 3EF0A 4E5YA 3M89A 1ETHA 1IU9A 1TM4E 1KDYA 3AOGA 5JS7A 3DO5A 4P98A 1MEEA 4Y98A 2XDWA 4FCCA 4TXMA 5EY5B 3VR6H 4DT1B 1ZIOA 4YV0A 1TRKA 4GKVA 5GIOE 5C7LO 1LDMA 2GNOA 3LYLA 2OHVA 1OR8A 2BCJQ 1B23P 3WY9A 3H9UA 4JBNA 3VR5H 4YLYA 2Y2VA 3VOBA 3IURA 1LBSA 2O2JA 2ZBPA 2X2PA 4MARA 5BRAA 3C1UA 4EI2A 3FIJA 4N6OA 1QGED 3L3BA 3GJRA 3VR3A 3JW8A 3SDSA 721PA 2QUJA 1UMKA 3TBKA 2YNMA 3T1QA 3O7WA 5FOXA 3WXBA 3AIIA 1NJGA 2Q5LA 3A3KA 4WVLA 5LD2C 1L5WA 4GWKA 2E85A 4KQ9A 5J59A 4Y1RA 3AU9A 5IDVA 2P6RA 3QY0A 1ADBA 2G7MC 3LX6A 1M2VB 5HGJA 4A23A 4M98A 1FDTA 3HCDA 4FJ0A 2M1ZA 3RREA 3EZXA 1Y6RA 3EVBA 2WF6A 4P84A 3I4CA 3S2ZA 2I2DA 3FYSA 1U2QA 1KQ3A 4JUCA 4MQ5A 1NI3A 1SWVA 4Z86A 1T1RA 1DEKA 1K3TA 1XYGA 3MWDB 3KSAC 2IYQA 4X44A 1L5SA 4BAGA 1DUVG 1GQRA 1VMKA 2JIRA 4J29A 1P2VA 1J56A 1U31A 2KI5A 1FFSA 3EQ8A 1XJ5A 4JEHA 4KXNA 3MXOA 4YCMA 1EDOA 3ZGVA 1Z63A 1SH7A 1IBRA 3R77A 1NR7A 3OJXA 1Q1EA 4O4IF 4LIPD 4P54A 2H2HA 2BE9A 2QX8A 4IVNA 4F92B 5G40A 4LJAA 3BCRA 3E58A 1OD6A 4FYHA 2HIMA 3KQYA 5EG5A 4CF6A 3BZWA 1PG0A 3KZKA 3SAJA 4C89A 1NNLA 3AWIA 2Y0CA 4E5UA 4TYWA 3L84A 4V0QA 3F6PA 3OH8A 1VSUA 1VP9A 2C54A 2I62A 2H7YA 2K2WA 3U7RA 1TCBA 1I6WA 1LGYA 1A5BB 4INOA 4X54A 5E7MA 4CM5A 3IEKA 4BRZA 4PO1A 1ADGA 2RIPA 2RHDA 3U6BA 4CF3A 2H6EA 3JALB 3UAXA 4QYTA 4CQJA 5KYYB 3UMMA 4PFQA 4R84A 4KOAA 5TS2A 3A6PC 4EEZA 1DS6A 1P4JA 2J1LA 1BQEA 4HJRA 2FZ4A 2DSTA 3ZHZA 3DMTA 2F1RA 1MX1A 1CQJA 1KAQA 1REQA 2FK7A 2O57A 4KQXA 4A8PA 5CA0B 4XIGS 5AW6A 2PFKA 2XE4A 4IMRA 2BHNA 4CMJA 6REQB 2GETA 4ALJA 1MN6A 5HX7A 4H3VA 4RA9A 3L6RA 5DWDA 3RVPA 5JV5A 2V0NA 5KTSA 1X1SA 2OLEA 1A72A 1NFRA 1OX4B 3E15A 5E0OA 3ZYZA 4UVIA 1USVA 1U99A 2C00A 2LDXA 3AR7A 4L4XA 1VZ2A 2CXXA 1AQ6A 4BEBA 3KUCA 3TEFA 3BSWA 1RVV1 2C4NA 2DQYA 5B7NA 4ZICA 1A9RA 5JD4A 5LUBA 1W85A 1W25A 4LXQA 4B81A 4KFRA 4X85A 4AURA 2I87A 3BJRA 3HDHA 3EFOB 3PNPA 5HZKA 1A7UA 3BULA 5DGXA 3FFBA 3VOSA 3HUFA 1VFPA 2ZJ7A 4P3YA 4PSDA 2ZIGA 2IEZA 3HDGA 4K28A 1KETA 4RPLA 3C5EA 3ENKA 5JVDB 4YDSA 1E96A 3UJAA 3AL0C 1TO6A 2JCVA 2WQZA 4FZJA 4O4IB 2PL3A 1JJVA 2DUMA 2LRHA 1I3NA 3A1SA 1C1YA 3HRIA 3GRZA 3E35A 4LCEA 5CVDA 3QMPA 1GGMA 3TXXA 4BBPA 1VE7A 1Q7CA 2PJZA 4JYBA 2ZWVA 1N3YA 2EW8A 2PEZA 4LMBA 4RLFA 4WA7A 3TEMA 5IDYA 3WIEA 3A1CA 4PS1A 2XCSB 4HH3C 1E7QA 3E7PA 4XEHA 2HCJB 4HPJB 1FJGB 1ODSA 3CLVA 2ZE7A 3ESYA 3GLQA 1KF0A 2L17A 1IZ7A 2PRSA 1FYVA 1SHJA 1XXHE 2EZUA 2P7IA 4A03A 2DX7A 1ZK1A 1PEAA 3IAFA 2C5GA 3DMYA 1IZ8A 1UBJS 1SCIA 3JQ6A 3WB0A 3B89A 4UBMA 2BF7A 2ZJFA 2HSDA 1XLTC 1ZJYA 3HNRA 4WZBB 1WDMA 5FOUA 4JT2A 1HNXB 4W7HA 4JGIA 1AU9A 2DQSA 5BVHB 5ALDA 4DREA 3G2JA 3V1KA 2CLCX 4AN4A 3FVTA 2PSHA 3ZVMA 4RZHA 1OFGA 3GDFA 2WUVA 4ER0A 1RWVA 1X7WB 5FL3A 1T9KA 3E0XA 2QV7A 2QN2A 5KYWB 5DNDA 2B8NA 4H1TA 4OYLA 2P1RA 3LA8A 3MS4A 4Q7EA 1EZ4A 1FJHA 4KKVA 4RLSA 5FRDA 2NU9B 3UJ3X 4B3DA 1NRXA 3T0FA 1J8MF 4OREX 2W71A 3IS3A 3RC8A 1OX4A 4MB0A 2WUFA 4PQGA 2I2BA 4Y3UA 4I1RA 2I76A 4XRRA 5BSHA 2P41A 3RRXA 3EWIA 1UJ2A 1G8KA 1VBFA 2W11A 4RSHA 1WIWA 4CLXA 4ZOLF 2RGNC 3D3KA 3HDJA 4IF6A 3R8FA 1UKYA 4MITA 4K0RA 3BCUA 1NATA 2ADFA 2L2QA 4L72A 2B5OA 1F0PA 2CLLB 4FDLA 4RFVA 1BEUB 4QDTA 4X20B 3JALA 3LDGA 5B2FA 4S04A 1LV8A 3TJZA 4I55A 2QUAA 3KT0A 3PQDA 4DQVA 1KY2A 2QX4A 1G17A 3V7NA 3WP0A 1QYXA 4Z3DA 4Q3NA 2QRKA 5B1SA 3ZU2A 1N1MA 1ZLYA 3ZVNA 4MS1A 2X6QA 2V03A 2L0XA 1H66A 3L07A 5CM8B 2ASVA 4IWNA 2FSIA 3BRWA 1GJRA 2ZTSA 1KFKB 2CYAA 4GOOD 1QGZA 4WOKA 1ZL0A 1J8VA 5GINE 1D09A 3EGOA 1GUDA 1XD9A 2G25A 1P6UA 4EH1A 3M6MD 2Y27A 5AM2A 5TGTA 4H60A 1YA8A 3RTCA 2LIVA 1X8JA 4JLSA 5DLYA 1E0AA 2I1WA 3CCFA 5HJEA 2VYCA 2PGNA 1EDDA 1JG6A 1L4YA 3EA4A 1XCMA 3OLWA 1N2ZA 3MA0A 5HF5A 5JD3A 3TQTA 4UTVA 1FA9A 4EFKA 4NK4A 4YC7A 3SXJA 1R8XA 1DKMA 1XZFA 2G9ZA 3F8TA 1ORRA 2CMKA 3RDPA 4UM9B 4D9FA 1SBQA 2O3QA 1QO0A 4WDQA 3NRCA 2IY8A 4CKCB 3W2GA 3TIVA 4CFYA 3AM1A 1PYGA 2GO7A 5BSVA 5LSAA 1JAXA 3PQ3A 4M21A 2FEPA 4M83A 4C9BA 4UKDA 3WK7A 2Z09A 3C0KA 2MR6A 4EBBA 1GD1O 4NZPA 2WHPB 3TTVA 2XXJA 5DEIA 3DSRA 2NPOA 3WMFA 2BGWA 1RXUA 2WA1A 1BAPA 1Z34A 2ZUBA 3NTVA 1VPLA 3FGOA 5L8VA 1USIA 4L57A 5JY6A 3R3WA 2FN4A 1PSWA 3OEEA 2PBLA 3H4VA 1RRPA 3M1AA 1GKIA 3WYCA 1HT2E 1R0RE 1V8BA 3F90A 3HKCB 1ZNWA 3L4EA 4FYIA 4ARSA 1QPBA 4PO9A 2XXBA 4AO8A 2V3VA 1CE8A 4C4ZA 2XRFA 3TRDA 5K6AC 4RD1A 3ZD6A 1HBJA 2GPTA 1OASA 4PQRA 1ZONA 4RK0A 4ZYXA 8ATCA 1U9ZA 1XVTA 3L93A 3O4HA 1WB5A 4WBNA 1EFTA 4TUYB 4FYKA 3WDSA 5CGQB 5EE3A 4N9WA 4MVJA 1A5SB 1GAEO 3PUWA 3GFPA 2Q3LA 4RHFA 1QIDA 1GA1A 1PBTA 1R0KA 4PO3X 3VUEA 1QQAA 4MDFA 2IX3A 4TS1A 2WJ4A 2O52A 1EG2A 4KHZA 1FLAA 3UANA 4N0QA 2ZIXB 3M3HA 2E49A 2H85A 1JT9A 1VIAA 2OO5A 2SNIE 2XNSA 2XMCA 3WE7A 3ZNOA 4ICIA 4F4FA 1N6HA 1A2QA 4IVQA 4CU2A 3BWMA 3CLSC 3T41A 2ZUFA 3HXOA 1NVKA 2VHJA 1MOPA 2O23A 5CX1A 1VL8A 3A1EA 5KYUA 4O2AA 3W90A 2I65A 4UE2A 1VJRA 5BQ5A 4FVTA 2HRCA 1CZOA 1E6MA 4UNPA 2A8YA 1QZXA 4KC0A 2MYTA 4NNPA 4MGZR 5K09A 1ZXLA 1RU3A 1QVZA 1JEYB 1JDZA 4QE3A 4G86A 3JQFA 4C0QC 3EDYA 1WV0A 2JAXA 5EIBD 1U0RA 1NWCA 5KHAA 2PS9A 4PX5A 5H81A 3FTFA 1M1YA 2VPIA 3EGCA 5JS1A 1L1EA 3D6UA 4GLLA 1K7FB 1WKBA 3DT9A 2FZCA 4HAZA 4IOKA 1PE0A 4TRMA 2QN6A 3BN3A 1GG8A 1KXZA 4GX5A 2G06A 3DHNA 4G5YA 3QOWA 2PZBA 4FQ8A 5G1OA 3C6YA 2ZI5A 2JH9A 3F98A 1PK8A 5EXXA 3WL8A 2AJCA 2IS2A 5F9HA 1L7NA 1DOHA 1P29A 1CRQA 4MVJP 1K6MA 1GRQA 3O84A 4RIHA 5ENDA 3R7LA 5LYJB 1OE0A 2WWGA 5KCMA 2PX4A 2TMKA 1BMTA 1C1DB 2Q1UA 3AQ4A 4JLWA 3VC1A 4B6SA 2Z8XA 2Q4EA 1G7CA 3N2NA 2JVIA 3OM8A 1PWHA 4J0JA 5CFLA 1ZIDA 3KEMA 1PFQA 2GK3A 3K1YA 1N78A 4E30A 3TOXA 4PVDA 1U1GA 1KH2A 2HADA 4FONA 5TIIA 4IWYA 1PD1A 3TQIA 4JNCA 2O7NA 1MH1A 5C5IA 1XMJA 1F1BA 1W0KD 3MJCA 1QYVA 2DFVA 3UJBA 1HFJA 4MVJM 4DSAA 4MW9A 4UEKA 2RI1A 3FFAA 4LRTB 5AK5A 1I4WA 3RB8A 3KSDO 1XZGA 3C5WP 5E4FA 5LIPA 1IN1A 3IR6A 1V39A 2B5VA 2R3SA 3R6LA 4IM7A 2FW7A 1NKTA 5A4KA 5FULA 2R1VB 2ZJZA 1HXHA 3KYDA 1LV7A 2P27A 1JJIA 1U8YA 3CVOA 3OP4A 5G3YA 4W6ZA 3AYXB 1E20A 2G5CA 1W2WB 2FU5C 3GLIB 2TRSB 2CJWA 2H00A 1O89A 2AYZA 3IVXA 4S12A 1KS9A 3FY4A 3QSYA 3CH4B 4GSLA 1I9GA 1PL0A 1QIHA 2ACWA 3HJTA 2O8DB 2HCBA 3KKMA 4JLJA 4ALMA 4Z1MD 4KIUA 3EXFB 3TLJA 2VKTA 3H4TA 4H6VA 1R6XA 1R0WA 1XROA 3EXIB 4AJIA 3TPFA 4C2UA 1WTAA 1MO2A 3PU6A 4F1JA 3EPJA 1MABB 4MVJI 3UA4A 2CXRA 3RRMA 5FUQA 5LFAA 3RSFA 1CJMA 1WUHS 3TD6A 4L8WB 1XMOB 3E82A 3CR7A 2DWOA 3TNDA 5F5NA 3O8OB 4H31A 3KOYA 4GNRA 2B34A 2ZT8A 4FXOA 1E3DA 3SBEA 4QLOA 4UUQA 3VX4A 2YFHA 3RG2A 4US0R 2XF8A 1GCOA 2G08A 4K6MA 2VXYA 3FCOA 3UGQA 3WICA 3VU9A 1V7PC 2PRYA 4M7PA 1L5FA 1NQUA 2V5UA 1EK6A 4QQNA 3J7AC 4A0FA 2A1TS 1U81A 2Q1YA 2V4ZA 4EI7A 3KEFA 1JLRA 1NP3A 2RGYA 1OFIA 1T2DA 4O6VA 2E2WA 3UB2A 1U7TA 4JB3A 1Y5MA 2P9TA 3I2GA 2ZRHA 3UJCA 4OLHA 4EJ2A 2GN6A 4Y7DA 1KGDA 2E5FA 1L5KA 1GSHA 2EWMA 5JCOA 1UOOA 4JA2A 3WNCA 3CNOA 4RMNA 2CVFA 4BBZA 4FZ5A 2G28A 2PZJA 1HDRA 4M0UA 2QGNA 1HNWB 3DE7X 1CG6A 2E1PA 3QNWA 4V39A 4IIHA 1NR5A 4B3FX 3ZCRA 1G9TA 3PWZA 1ZVVA 1DBPA 4JJEA 4RADA 3CNNA 1JLSA 3L92A 4L4UA 3PUIA 5COAA 3V4LA 4Q3KA 1PFGA 4UFNA 2X19A 1P33A 4GM0A 5T6MA 3LIPA 3V6LA 2GK4A 4PNZA 2JLVA 2B3TA 5IZ4A 5C37A 3H9QA 3BK2A 3KPUA 4U8GA 1IVNA 1D1QA 4DE5A 1NMXA 1M2NA 3I42A 3DPIA 3EJWA 3Q4GA 3GCZA 2H54A 3SQWA 2HA2A 1YU6A 2AFVA 3I6IA 4PSCA 1D9ZA 4UTZA 2E4YA 4NOMA 4R8MA 4G1UC 1T10A 2C83A 4U2FA 3KD3A 3GUZA 5IAKA 3M3DA 2PKCA 2QYHA 3KQWA 3P9NA 4LCBA 4A9AA 1JBEA 4NBVA 1NE7A 1VJ5A 1HG0A 3GD5A 5JS8A 1JEOA 3EARA 2H06A 5ITZA 3K5WA 2OYCA 4UAUA 2IS1A 1WW8A 2DWQA 3OM1A 1MC4A 4LZPA 3JYLA 4Q34A 4ABYA 4MQUA 3GZNB 1GILA 2ZCUA 2JK0A 1SG6A 3LWZA 4F91B 1SURA 3DOCA 4RZXA 1FYEA 1NWHA 4N47A 2PLAA 1UK9A 2G83A 3BWCA 5JAMA 1GITA 1KMIY 4Q9NA 2C7RA 4K26A 2PZGA 7MDHA 1AGPA 3G3EA 3L4BC 2VDNB 4WFQA 3TSCA 1NW7A 1ECGA 4FR2A 5ALSA 3I04M 2VDMB 2ZRKA 4RD0A 4AROA 1QH8B 3VZSA 1NNEA 2GBLA 2Q3DA 4PBTA 5KDDA 4NFSA 2I91A 2HMYB 2OL4A 4JENA 5L4NA 1CLEA 3LHIA 2J3JA 3B7WA 1EUCA 2VDOB 1MRSA 1YO6A 3VI3B 5I7FA 4C2TA 1SHLA 4WGGA 1EK0A 1KJZA 1OROA 3H5RA 1HI9A 2Q9CA 1ZSVA 4EI8A 4P33A 1OPRA 2SHKA 3AUJB 5L9AA 3HTXA 3VYWA 5JY1A 2UZ4A 2AFHE 3M5WA 2ZREA 1DQRA 1T6ZA 3SCZA 5DX8A 3UJDA 8LDHA 2RHGB 4JI0B 4IRMA 1G2OA 5EKUA 4C4AA 2QZ9A 3EUWA 1J39A 1KZ4A 1ORIA 2QQFA 2XRZA 3GW8A 1P0IA 3WYNA 1XZMA 3B5IA 3DP9A 4G0YA 4KXFB 4P86A 5CLGA 1QH0A 2PZMA 3HXTA 3GEIA 4PEVA 2RBKA 4DLXA 2D54A 4WNAB 3U1TA 1VPWA 3OE7D 4BMCA 2I2AA 3KVOA 3AETB 2RHOA 1BCRB 3M4JA 4I4TF 1BOFA 1H3EA 2NO4A 2OG2A 4ZXFA 5HW0A 3RAFC 1VJ1A 2YCBA 1T25A 2IUFA 4NFYA 3Q0TA 2EJBA 1IUKA 4E2XA 2BAGA 3CO0S 3QKUA 2ZUTA 3TEJA 2C61A 1NNI1 1IMJA 2R8RA 3MF4A 2GBLC 5IPFA 5KWSA 1OAAA 1V71A 2XTAA 4GI7A 4ZQFA 4HEA1 3H2GA 3KRTA 3PNBA 3QU7A 4FEYA 4IUBS 5I01A 3AVXA 2BMVA 2A5YB 3O75A 3DLTA 3TAUA 4CKWA 2SKEA 2G77B 3T1HB 1XP5A 2BZ1A 1SCNE 1MB0A 1JZSA 2PWPA 1WCIA 1OWPA 1I1NA 2BJWA 1LSOA 2J9FA 3P0RA 1LK5A 3Q10A 2NUAB 2ZE5A 4FS8A 3UGJA 5JOQA 2IW1A 5LQUA 2PD3A 4G5HA 3URKA 5GZ3A 1TJ4A 3UY4A 1LNZA 3KV1A 3CF0A 3GWGA 2QBYA 3C3MA 2AFIB 1RI3A 3HG7A 1A98A 5CPBA 3VOTA 5C51B 2XKKA 1BSVA 3IAS6 1C81A 2BVNA 2PLWA 2QMUA 4QECA 4X7MA 2XWQA 1S8NA 4J1QA 3ETLA 4Z0NA 4X71A 3UXYA 2P2CA 3I8XA 2C9ZA 4QBTA 4X3OA 5EP4A 4RHCA 3W06A 2DB3A 2IPMA 3EUEA 1ABFA 3VH4A 5GVSA 1BCSB 1VYTA 3NIFB 2XEDA 4L9SA 1QAMA 4Z51A 4E0BA 1A5TA 2SICE 3H75A 2BI4A 1A2BA 3JYOA 4V3BA 4RJJA 2VSXA 4FGZA 4GI2A 4HGRA 4PHTA 1LPNA 2QNBA 4PE5B 4DNPA 1ZAKA 3JQ8A 1Q7RA 3UK0A 4BU0A 4ZI5A 3OQPA 1QHSA 1OZAA 3VAYA 2ZATA 3LKZA 1E9SA 3E5NA 2O50A 1QS0A 3EG9A 4N4AA 4FEGA 4CQMD 4Y8VA 2VQ3A 4JVMA 4QUKA 2RAFA 4IQ8A 4A1FA 4BQRA 1N0IA 1U3CA 1VSTA 1LJ8A 1YZFA 2X1VA 2ZGVA 3PRJA 3ZDCA 1II0A 1JWLA 3C6MA 3ESAA 3H9EO 3TO5A 2YYSA 4R9SA 3W5JA 1CV2A 4RJLA 4TLCA 3U5ZB 1NPTO 3RFTA 2QVGA 4HJXA 1F2TB 5AXCA 2GKSA 3Q2KA 2GD0A 3DMPA 3S8MA 2JLUA 2ZZMA 2QJOA 5DBOA 3BDVA 4V1CB 2B9EA 5B3LA 1NUTA 1UF9A 5JC8A 1I33A 5KYXA 3U5TA 2OWEA 5FTMA 5DJ5A 4FYWA 3VPGA 3VDMA 4UTOA 1T5IA 4OQXA 4TZTA 3LZ6A 4NMHA 3JARB 1U28C 4KSBA 3KR0A 1AK1A 4M86A 1B6GA 1ZRHA 2CFTA 1C9KA 2Q8NA 1QR6A 4URUR 1QFMA 4Y6OA 5IULC 2H7CA 4NXNB 1KZHA 4G8CA 1Q7EA 4BQFA 1YL7A 2WAAA 2GZMA 2XT0A 1GPUA 4G0ZA 4NBLA 4EYSA 3IAM1 2VTBA 4IDOA 4N3NA 3RAJA 2R5FA 1OGIA 3QU4A 2C3UA 3KKOA 3MJSA 4QASA 3LRTA 2A9JA 1DIHA 2WBLC 5B1IA 3ZQ6A 5JT1A 1QTRA 2O8CA 3AUXA 4K8OA 4RQBA 2QY9A 4YWHA 1U5BB 4G8BA 4BP1A 1DCKA 2SECE 1QCZA 4Q93A 1Q2UA 1LK0A 1SY7A 5BSKA 4W7IA 4BP9A 4B9AA 2Q2OA 1DLIA 2I8LA 2OV2A 2A33A 2Z08A 3FSJX 2ZRPA 3OZUA 5I3ZA 5JAIA 2FPLA 5BYAA 5HS4A 2ZIVB 4M7RA 1FQOA 1NQAO 2XZDA 3UM9A 2D5BA 2YFKA 2ZPTX 1P6QA 1K6JA 4IVRA 4UW9A 4JI1B 2NG1A 3T3PB 3WYDA 1XL1A 4DB4A 2H4ZA 5AM0A 5L6LB 4C08A 3QKRB 3SYTA 1GNPA 2EFHB 2H1LA 2WAXA 2ZSUA 3GK3A 4FKBA 3L8DA 3RABA 3U3RA 4EW3A 3T1TA 2O2SA 2GZ3A 2ETXA 4Q3EA 4P80A 3RBAA 2J3IA 5IK2A 1PF7E 1XWIA 3SHTA 5A03A 1XQVA 2ACKA 2YJ5A 3W8EA 1M67A 2QMZA 3NGMA 1NW8A 3AEXA 5IG2A 1LQUA 5J23A 3T4UA 3K70D 3C3XA 4KVGA 2AT1A 5CFRA 2VDWA 2GAJA 3B7GA 4WESB 3K6SB 3IP3A 2X15A 4MQEA 4PLGA 4BX0A 6CHYA 3KXLA 3NWBA 3RS3A 1Z0DA 1Q17A 5ADHA 4AJEA 1DB3A 4GNKA 3BSSA 5AJYA 5ALMA 2NU8B 1Y9EA 1X13A 4XLLA 3SU8A 2IL1A 3ZNQA 1PHRA 1RLJA 2MSWA 3B3GA 2OCXA 3DYVA 5P21A 5IC4A 2I0FA 2OKGA 2CHGA 1F8UA 4LK2A 2IITA 1GLGA 2J87A 2XVAA 3KU1A 4KWCA 3DC2A 5DK4A 2HDOA 1R88A 2FWMX 3CPJB 2CNWD 3HCPA 3G0DA 3M9LA 4RGBA 4BOYA 1CF2O 5KX5B 3K70C 3L6OO 1BYUA 2V45A 4MOWA 4GU5A 4E21A 2P67A 5BUSA 3K0FA 2PHZA 3IUEA 4AF7A 3THWA 5I4BA 2W2NA 3PDWA 5EMJA 2EEPA 4NPCA 3TQCA 4GICA 4EB6A 2XCTB 1P74A 1X39A 2C07A 2YY6A 3EIQA 1HE1C 2QXUA 3GROA 3QEKA 4RQAA 3SHWA 3U49A 4DDUA 1P1KA 4FYYA 5NLLA 5DYTA 1NT2A 1NVGA 1K5HA 3LWDA 4PQYA 4B7CA 2Q2NA 3ROMA 2HM7A 4CMIA 1IQ0A 1AKNA 1UZNA 2RGEA 4HLUA 3SBOA 1P7VA 4QFBA 4OUDA 2OESA 2WW8A 4HWSA 3ZXXA 3LIIA 1EP3B 4MI3A 4QYMA 2W43A 2DF8A 2GHTA 3MIZA 4HAUA 3C8UA 1DJQA 3HO6A 4TWJA 4Q4HA 2JKVA 2R86A 3IOEA 1JHXA 4MKHA 4R3NA 4RSRA 1MXFA 1V26A 2Q6LA 3GBPA 2VVTA 3PHCA 4P36A 2BGNA 5JZMA 1W19A 3PR3A 3AXSA 2ZYHA 2PD6A 1I1OA 3LXMA 3QTBA 1JNXX 4C30A 1Y37A 2VYNA 2V7WA 4GGMX 1QNLA 1P7YA 1E1CA 1O5IA 2VYVA 3L7KA 1O54A 3AFHA 4IIGA 1ZSNA 4KBYA 2PUJA 16PKA 2I3ZA 3QFTA 5DB4A 2CJXA 2GAAA 4OHOA 1DWQA 4OBXA 1FFAA 1I3OA 3H2ZA 4R2JA 5I8ZA 4C06A 4KNYA 3O1HB 1NBMA 1AO3A 3KJZA 3AGPA 1JQEA 4BLQA 3U37A 1B6TA 2XMBA 1ZKMA 3BAZA 1CQWA 1F12A 2XMRA 2GA9A 1PP4A 4F38A 4O3MA 1LS6A 3EYWA 3TIFA 4LECA 3LQRA 5CW2A 2B4AA 5JSZB 1JKIA 2QN3A 2V58A 3NS7A 3LFTA 2PH5A 3IVCA 5J2UA 2BEWB 3O2SB 3CF6R 3PUKA 1H2BA 1YBAA 3LCMA 1RAHA 1KO7A 1R0SA 1XKTA 4KFTA 4QC2A 2EV9A 2EGUA 3E8XA 3EHDA 4X8MA 1H2YA 1R6UA 1EB9A 4L51A 1PTJC 1DRJA 4Z99A 2R97A 4ND5A 3R0QA 3OKFA 3LPCA 4GF5A 5CVEA 5F73A 4HTAA 2BKEA 3W5SA 3OFVA 4YRDA 2QJTA 4ERXA 1CYEA 3TRJA 2WF5A 4CI9A 2NQTA 2O3UA 3MOGA 4W5JA 2G1KA 2R5NA 4IOMA 3B6KA 4I14A 4KYTA 4EJSB 4F60A 2IPAB 4KI0A 5AJZA 2BHSA 3LJKA 1P19A 4WK0B 2HK9A 1DAOA 2EQAA 5EE0A 4CGYA 4EG1A 3C3AA 1ND6A 3SLGA 1ZNXA 1FSGA 5LMUB 1V8OA 4A26A 3HLYA 4AS1A 1JS1X 1HE3A 4RVDA 3B9BA 1L1FA 3LDUA 1O95C 5KAMA 3J81A 4KNWA 1PHPA 4KAFA 1QV9A 5KSZA 1Q1GA 3K0KA 2ZQYA 4KQ2A 5E2IA 4O02B 1WETA 1PEYA 4BE9A 4QICA 2OAQ1 3RCBA 4FUTA 1LF0A 1WAMA 5DI3A 2XZOA 3G7NA 3CXRA 2GTPA 4YO8A 1T34A 3W1VA 4YT4A 2QA5A 1POXA 4P32A 3NIGB 3IMKA 1D6NA 2VJDA 4YMGA 3LUGA 1BNCA 1E62A 3WDKA 3R4CA 4YMIA 2FW6A 3V97A 2VJBA 1QH9A 1QORA 3T5AA 2BKXA 2HV8A 1KZGB 1X0VA 1N92A 4QWMA 3RIHA 1GSOA 1KYXA 2B25A 3EJ6A 1L4BA 2W93A 1AUPA 1B6RA 1XE3A 4CF4A 5JZOA 4CYMA 4W8OA 2GEBA 3NVDA 2NTVA 4LVOA 4TL6A 1G2IA 2J59A 4TWZA 4O4JF 1ONNA 1E7RA 4LSWA 5BP7A 1RMYA 1PZEA 1KFEB 4H3SA 1MRZA 4NXMB 1FVXA 5GPBA 1QFXA 2WJYA 3H04A 3GUHA 4R1SA 1FRFS 5J2TB 3ZY6A 1PJ2A 1KJQA 2VLIA 3KOXA 3MTDA 2BBSA 4EVRA 3PFKA 4HDKB 2BBWA 4UCFA 5AKJA 4ZRDA 1E89A 5CB6A 2ORWA 3UB4A 2XECA 2IKSA 3NXSA 4F1WA 2IYFA 4KE8A 4BWGA 3FGZA 1DDIA 5EKSA 5MGNA 1Z2AA 1F2DA 1W59A 2VXBA 3MTIA 4AMVA 4B6RA 3AHDA 3N0VA 3TG2A 1UJ6A 2EZ4A 2PBRA 2HTFA 4ILKA 4N9QA 1U9JA 4HRAA 4JOQA 1NXWA 1GGJA 2H2GA 3VAZA 2YIDA 3G8AA 1N0WA 3HDVA 4K9MA 3DMDA 5D5PA 2WVHA 3WMRA 3GJ8A 2D1TA 3ETHA 3MAGA 4I9HA 1XWWA 3QPCA 4UNSA 1IN5A 2Q49A 1T0PA 5HKKA 3KR9A 4KX3A 1IN7A 2JHPA 1GZ3A 1P6XA 4XPIA 3FUWA 4G25A 1K2WA 4YACA 4YAJA 1R6TA 4HAWA 2ZS8A 4X9XA 1UJBA 4EJFA 1XP8A 4OMFG 5IEJA 1AIPA 1QGOA 4MV4A 1NLYA 3KUKA 2H4WA 1D6SA 4G26A 1NVVQ 4UOQA 5DT2A 4US2R 1VL1A 1SO8A 3WOVA 3JQ7A 2FJPA 1MJGM 4KLRA 3W9UA 2EDAA 4K88A 1EFVA 3G0HA 3GARA 1A8SA 3HVKA 5TC4A 4O5OA 1JJ7A 1IHXA 2H1VA 3UT5A 2JLXA 2HT6A 5KSPA 2WTMA 3VR6D 4YHHB 5HKLA 3RRBA 3ZZUA 2IEDA 1BKDR 3OOWA 2XYQA 1N1DA 1XTSA 4YHBA 2HLNA 2VHTA 2VP6A 1U7DA 1CY0A 1DFIA 2QRMA 3PEEA 3UENA 3HCEA 3B3JA 4A5SA 1TW3A 4Y9DA 1KAEA 1YOVA 3FI0A 4EG4A 5TRTA 1C9YA 1CUCA 4MQ6A 3C39A 1L7BA 1MJFA 3SC6A 2AN4A 3E9DA 3HJBA 4IH1A 3LUBA 3CR3C 4OHCA 2YMLA 1L5OA 5EGSA 1IIBA 2P9FA 3G5LA 4FYXA 4LK3A 2Z8YM 3FLMA 4B75A 1DBRA 3SHOA 1OX6A 3A7EA 4FC7A 3TCKA 3I2KA 3TTYA 2GEFA 2CHFA 4BUZA 3MW8A 1ILEA 4UU1A 5TQ2B 2II6A 4TT8A 3EGEA 4DMLA 4ENSA 5A3QA 2AN9A 3D4NA 5TMBA 4IV8A 5CJ2A 1L7OA 3CRW1 4DR4B 1KRXA 4IDPA 4F6RA 5JVDF 3VUFA 2JD1A 1IDN1 2XLCA 2X4IA 4OYHA 4BNZA 2QW0X 1M5UA 1ZH0A 3W2EA 4LZJA 1HO3A 1Y7IA 4J16C 3CH7A 4UMVA 1ZCZA 1GTVA 3TQQA 3GJQA 4KIGA 2W5UA 1ISIA 2R25B 3CG4A 3P97A 4YI3A 3DVAA 2MINB 2YW2A 1PSZA 4D43A 3HM9A 3IOCA 3OTHA 4KIFA 2PCJA 1J0DA 3VPSA 3GUCA 3LP8A 2GA8A 2BFPA 2X3YA 2ZJAA 3CX6A 3HHPA 3PXAA 2ZSBA 4LYAA 4XM0A 3L8FA 4WCFA 4WTOA 4LN1A 1GU7A 5IAOA 3TFOA 1T5DX 1N2CA 3RVMA 3U44B 3PCXA 5LMZA 4BMZA 2WUDA 2B36A 1AGNA 4E33A 4C87A 4HV4A 2ONZA 2I6SA 5DT9A 1MUUA 5EFOA 4FR5A 3K8YA 3KJQA 2CZQA 4EMBA 3VZBA 5HIAA 2CL0X 2VCYA 3CEPB 2PUTA 2AF4C 1QV6A 2BFMA 1WO8A 2ZZKA 3ESZA 3NU1A 4A27A 4DCPA 1NMEA 2QL9A 3NIDB 1UPUA 3E2MA 2OD7A 4LDAA 3MMZA 4HF7A 1JA9A 3SEAA 4BQNA 4D80A 4EDFA 3DLBA 3RS8A 4GI3A 3T12A 4QPDA 1PLLA 5A0TA 3QKSB 3HCOA 5DK6A 1VJDA 3QEOA 4J7AA 4GD3Q 3DBVO 2UXDB 3K2EA 3K8OE 5AIAA 1XK6A 5EC8A 3RK4A 3S5UA 3GVIA 5B58T 1O5OA 3O1IC 1MW9X 1U3DA 4RF3A 4OI1A 1HZJA 3HCBA 3JQ9C 2YWCA 4OM7A 2GB4A 3OTGA 1CR6A 1XMIA 5FO1A 2A92A 2PL1A 4EK9A 2O20A 4G5GA 4B3XA 2Z5LA 2G9NA 3VKVA 5LQJA 2Y77A 5CHYA 4OEHA 1JEQA 1QIFA 2DQZA 2G0NA 1L7PA 1MGPA 2C42A 2WFAA 3PF9A 3A4TA 3TW6A 3I4LA 1OA1A 5JPDA 1BGXT 2IOHA 1UK7A 4LVCA 5KCZA 2J5KA 4CFZA 3DTTA 3NT4A 3W7AA 3NLLA 3LQYA 3V3KA 1GVNB 3C8HA 4MO9A 2A6PA 1U6KA 2GBCA 3K1ZA 3N70A 3ZIUA 3ZHTA 3MWJA 4CHTA 2FPMA 1HLGA 3OLCX 1GTG1 2IHYA 3H8VA 4JOCA 2W42A 1IJKA 3NM6B 4BNKA 1VHDA 1ZW6A 4NMWA 4DV1B 1OY1A 4M1KA 3IJPA 2WJ3A 1KI7A 1DFGA 2VT2A 3WWDA 1LLQA 1XRQA 1WZ2A 1R10A 3JY6A 1B3BA 3N0XA 4ZREA 4BNVA 3JAMA 4I8XA 4KGXA 1P91A 5K03A 4C04A 1JKMA 4ZCSA 1ZVKA 1W87A 1XHEA 4I4IA 5K8UA 1W5AA 1KO8A 5BYBA 1PNRA 4KO4S 1IY9A 1DSSG 1X2EA 2WVAA 3MSXA 1E2HA 3HABA 2D4AA 4R3UC 1FX1A 1AD2A 1ZY2A 2HHJA 1M2KA 4YASA 3G1TA 1NA5A 2R6GA 3RYHA 1WR8A 5EJMA 1WKVA 3P27A 1IAVA 2AE1A 4NYJR 4OTZA 3SR3A 4CLRB 5BN5A 2B1JA 3ELDA 1FXUA 4M0MA 1Q0LA 1JQ5A 1S3SA 4L2IB 1CVRA 4OV6B 4B17A 1T9CA 2A3NA 4U2DA 1FMTA 1OBOA 4QTYA 4CLRA 1BO6A 2Q5JA 2YH2A 1JQBA 3KIPA 1FTQA 3UXMA 4NC9A 2IIBA 1A8IA 4MB2A 4JI5B 4JITA 1Q1NA 1W96A 1KTVA 3CRQA 3ED5A 4MPJA 3VYSB 3AF2A 1NPYA 1TB4A 4Z5XA 3B52X 4DIBA 3L1UA 5A5DA 1Q74A 1CP3A 4KFCA 3IPAA 5LL6P 2F00A 1TCVA 1TECE 4UM7A 1MORA 1QTIA 4KN5A 1U1CA 4DDKA 1U3UA 4D44A 5BR7A 1TFUA 3C6KA 1XZDA 2VTKA 2HJVA 3GCXA 3M6UA 3QW4B 2GCPA 3MD9A 4IJQA 1NW9B 1QO7A 3CNBA 1UEIA 3PLRA 1QGUA 3PQ7A 4G5FA 4G1MB 1XTJA 4Q02A 4UVEA 3SD7A 1UMDB 3NWPA 3QU9A 4HCJA 3NDRA 5FPQA 4H6XA 2EFGA 4IIUA 1GQFA 4KUHA 2BL4A 5JC1A 2QTNA 3G9TA 2P9QA 2GK6A 4LRSB 3PBKA 2YDXA 4M1TA 5LQDA 4LFBB 3WLQA 5EHNA 4K9SA 1G42A 4NZYA 2GN2A 2QRGA 4OMCA 3R3JA 5BPHA 4ARUA 3B1XA 2VYFA 5LLSA 1MC1A 4DCCA 3O8CA 4O2BA 4PW0A 4UU0A 3WHIA 4LTNA 3EDOA 4BC0A 4C78A 5HGXA 1XTZA 5I9MA 3WZ2A 1LJLA 4CQMB 3MXTA 2PUWA 1HKUA 5ALPA 4ZVLA 5C1OA 4QDZA 2A84A 3EWSA 3QX8A 3OE4A 2Z2ZA 2HY7A 3QJGA 4IH4A 5JWOA 2GEVA 3KU4A 2F3RA 2ZT7A 4WXPA 3TSYA 3K1JA 1OTXA 1GPAA 3F7OA 2ATVA 3I09A 3USCS 3EXEB 4KE7A 1F60A 1EESA 1ABEA 1M5TA 1K6EA 3NT5A 5ECDA 4KO3S 4KVAA 4MUHA 1RABA 3M7IA 3N8HA 4GOND 4HZUB 3WIOA 4F72A 1XQXA 2QUBA 4IR7A 1D2AA 3SNKA 4HH1A 1ETUA 4AULA 2B7BA 1EWTA 3DS8A 2QMYA 2RJOA 5TQ0B 4OHYA 1Z2CA 4MWDA 1J06A 1T2UA 1C3VA 4MV7A 5HIMA 2QM8A 1DQSA 4YUAA 1Y1TA 4R1LA 1C30B 5LU9A 2RJ3A 2VHCA 3EDQA 4H2DA 4MWBA 1Y8QA 5ILQA 2YIVX 3PNQA 4QM6A 4Q0MA 1TF5A 1QM5A 3VHXA 4J1TA 4BX3A 2BFEA 2OWDA 4F46A 2BFCA 4QOJA 5IC5A 5ELMA 2ZVQX 1P3Y1 4OHKA 4P5PA 4MXDA 4RLHA 5BRNA 2QTRA 3RVQA 1JMYA 4IDHA 4TQ9A 1T5TA 1RXIA 4INJA 2NXWA 3GJTA 3CN7A 5FPYA 4OJQA 3F6SA 1WOYA 1UJ4A 2IEYA 3IUQA 3L1IA 4KO8A 1ZH6A 4D3SA 3LU1A 5LZ9A 5AW1A 5BN4B 1DJOA 3H0KA 4HDQB 4QEKA 2HJHA 4GC9A 2OCAA 4ER6A 4JXXA 2DERA 1SIBE 4ZVSA 3G9XA 3DGEC 5TQ2A 4C20A 2FUNB 4AKGA 2O2CA 3PPYA 3ZQKA 3H1PA 4KQMA 1B76A 1KJIA 1F3OA 4G4GA 4IO1A 1JKJB 4Q01A 1GYPA 2EIXA 4U63A 4F86A 3WRXA 1FMCA 4FKZA 3FCCA 2PK3A 3FLEA 3QYPA 1D7AA 1HZZA 5AVJA 3KEGA 5F98A 2ZRLA 1CF9A 2OSBA 3ABRB 3I6YA 3KYCB 1CLUA 3VJLA 4JVOA 1GPH1 4LXTA 4J0IA 3PK0A 4FJ2A 3HY4A 4CM8B 4YCNA 2ZRQA 2D13A 2X8LA 5DHQA 3OLYA 3UWMA 4OXYA 2FZGA 5L4LA 2R8XA 2DHRA 2JJYA 4ER5A 3ERCA 3NZEA 2VEOA 3WAGA 2PMFA 2R4UA 2QU7A 3ADDA 4ZVTA 1RZRD 4CM9D 3UWKA 2JHGA 4CTMA 1R0LA 5JRDS 4CIAA 3C8ZA 4YUVA 1M3SA 1YQWA 3FOEC 4AJ9A 3RSZA 1YGYA 1K7EB 2AYYA 2ZWMA 4JQYA 4K2AA 4TTTS 5FTWA 1XZIA 2VUIB 4Q1CA 4CN8A 2ZRGA 3FRJA 4POOA 5L7TA 1E9DA 1O2DA 2EXXA 1N25A 4Y6SA 4ENQA 4D8TA 3IRUA 4ESOA 3JVIA 1JIIA 1B14A 3ADPA 3HCFA 1GPJA 2XGOA 4TV9A 3C3CA 4OXIA 4UFPA 1K0UA 5AW2A 4ACBA 3RJ9A 2QVZX 2P6MA 4JQZA 2R6HA 2OZKA 3PUJA 4L0DA 3STYA 5BO5A 1K6IA 5KYGA 1I6KA 3BA6A 4MO2A 1G20A 2VF7A 3KALA 5DNVA 4M9CA 2FMHA 3ZDRA 4MUEA 1V16A 2CL7X 4HGOA 2XE8A 2XOXA 2VK2A 2X8AA 3LOUA 4TL8A 2XQFA 1QZUA 2C7BA 3IQIX 3L1HA 3MRSA 1ZD9A 2VAVA 3OQHA 4NZ9A 3CC8A 3ESDA 4XQ0A 3TD2A 2FWJA 5ADWA 2C7VA 1ULHA 3Q5DA 1UBGA 1EFAA 3EPPA 2B8JA 3OPYA 3OJ0A 1JDTA 4BVKA 1Z26A 2WVJA 3S8YA 3X2SA 1B8VA 3U3KA 4X1OA 3H87A 5LLDA 1ISFA 1TFRA 1U2ZA 1VYVA 2H16A 1U0OC 3AEUB 3EF3A 3RJMA 2PAFA 3O2JA 6GPBA 2WA2A 4P81A 3IVAA 1KFCB 1G5FA 1YTLA 2VRWA 1DC4A 1JAYA 2BGGA 1NP7A 4FX2A 1BMQA 3ILSA 4PYJA 4IXNA 1IJBA 3FKJA 3LAWA 4BXOA 4RC9A 5M3BA 5TJ9A 1P4HA 5C8VA 2Q41A 5C8ZA 3KJEA 2GF9A 4MKIA 4QO8A 2HA6A 2QLBA 2OMEA 2X3UA 2XF2A 1TT7A 2Z2KA 3BD6A 1OBVA 3LY7A 5D51S 3VTFA 4RJTA 2J5QA 3I73A 3HWX1 2YWJA 2B61A 1YB7A 2LE0A 2X2EA 4C0WA 1SXGA 3HJRA 4ES6A 1BX3A 3WGUA 2VXOA 1CY8A 1OH6A 2R60A 1C1XA 4TVBA 3S27A 3E1GA 2K7ZA 1Z7YA 3P5BA 1FB5A 2O48X 1FW8A 3QJ5A 4DRXA 5B64A 2BHTA 3D0OA 1MENA 3WMEA 1LSJA 4OB8A 4Q4CA 3BDAA 4ZVKA 4NLLA 3GJ4A 4GLFA 4DDMA 4WLNA 1SUDA 3C74A 3KZ1E 3R44A 3COYA 2M6KA 4MRNA 1UDCA 2WD9A 1IXRC 3IR5A 3DE4X 1QQ5A 1ADCA 1ZSYA 2FE4A 1QWOA 5FFMA 2VSNA 4PPGA 2Y3IA 2I8CA 2PKYX 2Q6OA 2BMFA 2WP8J 3QXJA 4MR7B 5LZ2A 3S81A 1OLOA 2FP4A 3G5UA 1H2EA 2GCOA 1ZMTA 3CX4A 3MUNA 4L9WA 4YBRA 5DOVA 4B40A 4ZWNA 2Z9BA 2VBGA 3VU1A 4HXEB 4DXDA 1TADA 4JVLA 4ZAGA 4HLCA 4ZZIA 1ORVA 1YZQA 1CRPA 2EX0A 1FYXA 5IP5A 3PFIA 3HY3A 3BIOA 3ZCPA 3K32A 1XBTA 1BWRA 2DUJA 2EERA 3X1WA 2FQXA 1YQTA 3GA5A 4U7GA 5HDBB 1WMDA 1SUFA 1WM1A 3C7DB 3KZNA 4L8VA 2JHFA 4IQGA 5ALXA 3AVTA 1M73E 1WU8A 1PFKA 3GCDA 1D0VA 2BGKA 3MCAA 4LBZA 1TIBA 5E1DA 5T4EA 4DL9A 5HP4A 4I6GA 4H3KB 1ONSA 2P3LA 4TOIA 3S2IA 1AA6A 2JCBA 4H1HA 2NSDA 5AI5A 1HWYA 3DNFA 3TQOA 4Z4FA 4Q82A 2TYSB 4D45A 4NYIR 1XA4A 4LXYA 2R8OA 3K9NA 2PU5A 3L02A 3QBEA 4FI3F 2AK2A 1GGHA 2DCUA 4MIKA 5AT1A 2C3MA 1SKBA 2Q0SA 3JQEA 1WXEA 1CUHA 4IMJB 3PJEA 4RS4A 5HMLA 2Z43A 4LW8A 1MQ8B 1V1MA 3LVBA 4QXRA 3QPWA 3HP7A 2BMEA 3NC0C 4QYIB 3WGTA 3WNQA 4DANA 1WDKA 3AEQB 3NNSA 1YR1A 2VQEB 3AOEA 1NOIA 2LPMA 3SOPA 3WO1A 1NIPA 1R9NA 1GAWA 1SB8A 3D8TA 2IZOA 2A1UA 1VIMA 1DQYA 1QQ6A 1VHLA 5EIAA 3QBJA 1C1XB 1JDJA 3OPYI 2HLHA 3PNYA 5EUCA 1H69A 1YI8A 4L95C 2PKQP 4Q4DA 2AKYA 4MW7A 3O83A 5FORA 2RAPA 1O6ZA 3MWLA 2VFAA 2IUYA 4B6JA 4BDTA 2F55A 4OUDB 1AKUA 3IA2A 1U2DA 3DVRX 4QEZA 2Q0HA 3DZHA 3RC1A 5CPFA 4FILA 1B41A 3Q7QA 1JHVA 1H2AS 4G36A 3M4NA 4D8XA 2ZWAA 3KWJA 3IIKA 4OLJA 4L73A 3GA0A 2ZPAA 4ZMRA 1JNYA 2P40A 4LBWA 5F77A 4YWJA 5KSOA 1J0BA 4LOHA 1RRKA 4OI0A 2OVBA 4UBNA 3STTA 4HNRA 3CQ9A 4DGSA 3H5TA 1JVNA 4ID3A 3NEJA 4JMLA 4ZYTA 4XYBA 4K9LA 4DM4A 4EDHA 2VHVA 4E13A 1XXHB 4PWYA 3M6WA 1RQ7A 3OJCA 3F9CA 4CMKA 3IAM6 5IT9A 4K9NA 4CMGA 3Q40A 1FVOA 1ORTA 3CRMA 1LI7A 4CNBA 2UYOA 2NU8A 5IARA 4KPYA 1P1RA 4V0SA 4ARZB 3ACCA 1N7GA 2WM2A 1ORHA 2G7ZA 3U56A 1UP7A 4XARA 1W4CA 3IT2A 1DIBA 3IUSA 2WJGA 5CDYA 2IBMA 4JBXA 5G0WA 1RM3A 2JZNA 2YC4C 3EDRA 4HATA 1Q83A 1THGA 4Q05A 2VDWB 4WESA 1G20B 1UKVY 1V41E 1V8DA 3RF6A 5DNUA 1V5GA 1Z5OA 3TX2A 3GRVA 4D9JA 1N8NA 3DH0A 5KJ6A 3KP1A 3QELA 4WKBA 3R3YA 3NALA 1E61A 3EZ9A 1FYWA 3QM1A 4JWKA 4XUDA 1XL0A 5J43A 2A4KA 3T3DA 5EVJA 4JLMA 4IG9A 3U7IA 5G1NA 2FGKA 4HMPA 3ZK7A 4REMA 3PDIB 2HDWA 3DMFA 3NHZA 1IN4A 1T8SA 2Y05A 3W5BA 2VNJA 4HVAA 3OG9A 1WG8A 5L53A 1PN3A 1UT8A 3RTEA 3CLTD 2WJAA 5EQTA 1J70A 4WKNA 4WRRA 3L18A 5EGNA 3VZCA 2CXQA 5L3QB 2FPUA 5EJ9A 5HRCA 5C81A 5HZMA 4NEGA 5KC9A 1GUFA 1U3GA 3HCNA 1VG1A 1YZKA 4MQ4A 4GXRA 1ENYA 4OKNA 1XFAA 4DLBA 2Y0DA 4WBSA 2QW8A 1AGRA 3ANMA 5FTNA 1VHQA 3SEQA 1TVKA 4QREA 2O8CB 1X9IA 2EBHX 2GVZC 3W0LB 3G6WA 4BB5A 5CIQA 3W2HA 4G8JA 2G9RA 4GX2A 4GXQA 3O91A 2I7DA 4B3JA 4I2NA 3KZVA 3VR3D 5CITA 1MC5A 1TLTA 1WW3A 2YZNA 2O3JA 3QPBA 5BWOA 3V6MA 1HM5A 2YUTA 1IZ9A 1E3SA 3IHLA 3PC6A 5KQRA 1JR2A 4LXGA 1JH8A 3VSEA 4D99A 3KXKA 2VYVD 3GQVA 3CLTC 4KLCA 4GKJB 2BY4A 5A3RA 3VV3A 3EXHC 4ARBA 5EJEA 3V8QA 4DCTA 3TFQA 3U9SA 4YUZA 1APBA 1KMHB 2EKDA 1JHUA 3QOYA 4MV6A 3RS5A 2WIKA 2C99A 1FMLA 1RYNA 3F6BX 5CR9A 1NQWA 1K6XA 3V4ZA 1RR6A 4U6QA 4ZOCA 1V25A 3N2KA 2B4YA 2NSJA 2AZTA 5AJWA 3I76A 2UZ0A 2VPYA 2X8BA 3FMPB 4G1BA 4XXHA 1J23A 4GX1A 1JSRA 4WKGA 3SZGA 1PLJA 1XDBA 4QZVA 5L7WA 1BEZA 1W4ZA 1RI2A 4IZHA 2E48A 4O4JB 1Z16A 1JWAB 4X5OA 1SG9A 2A0WA 2OBYA 3D3EA 3ILVA 4BFSA 3PLAE 1SGWA 3LT2A 4ZYUA 2BGRA 3IEXA 4C7KA 3TW0A 4JJIA 3KO8A 4HQOA 3WGHA 2ZP1A 1FP6A 2NTNA 3ND8A 3IKLA 1SA0A 3CLRD 3CTPA 3VRHA 5I4CA 2I67A 3FYUA 3MTBA 3EX7C 4PLVA 1EFRA 4HDSB 4RDXA 3KJXA 1YR3A 4UZEA 2PFGA 1WXGA 3RG8A 4PBSA 3HFJA 2AN5A 3VHXB 2MJLA 1Z4KA 1P1FA 2Q4TA 1OBFO 2MDTA 1RPNA 2N42A 4OU4A 1DDGA 2EVWX 4Y0VA 3OFJA 1KI8A 4ZDIA 5C80A 1JDVA 4FJ1A 4URXR 3ROFA 1IM2A 3B9PA 1EFPA 1PW5A 4L0MA 4WDRA 3DVLA 5FUWA 3HUTA 1XQ1A 2QORA 5BVGB 3M6VA 3P0FA 3SJUA 3BMOB 4GR9A 2XZTA 4WK2B 5F76A 1J90A 1JDPA 1H0HA 2R751 3H1BA 2I2XB 3AV3A 3TZEA 5C7YA 5AVYA 5M29A 5JG7A 4J2TA 1QJCA 3QX7A 4ZRNA 5A9SA 1N34B 3SBDA 3CMCO 4HRVA 5T3UA 1C0KA 3LVRE 2RSLA 1HY3A 1Q50A 3SX0A 4EP1A 3Q7PA 1PKEA 2WYHA 3OPMA 5IABA 4MVJE 4DJEC 5K3EA 1JN0A 5FBWB 5G53C 3ODGA 1TEHA 4YRGA 3IULA 3TW8A 5FDFA 3KKNA 3AZQA 4OHZA 5SY4A 1FP4A 1TA4A 3OFSA 3HBFA 2I2CA 2VJYA 1U9YA 3AT1A 3QHPA 1A0OA 1LSUA 5E9WA 1RLTA 1JYSA 4KXLA 4MGEA 5BOVA 3RR2A 2WG0A 3MMNA 5K0EA 4C7JA 4CMAA 1RXEA 2J41A 2Z3WA 3HVJA 3HZRA 2G8NA 4AYTA 1P9OA 1DV1A 2Y8EA 5AM3A 4RY2A 5FAKA 3GT4A 4YGXB 3CUKA 4L02A 4GE0A 4UNNA 1IY1A 3LX8A 1NW4A 1H85A 1QRTA 2GN9A 4R2HA 1N5JA 4KYVA 2RHMA 4ENUA 4D4MA 3E8SA 1AX9A 2Z57A 4J1NA 2G0AA 4QRIA 2FG7C 4WNAA 2J6HA 4Y2SA 1RM4A 3WIBA 3WLMA 1RJFA 4BFXA 2V6BA 4IV5A 4FQ7A 1UBCA 1ZGGA 3DKVA 3IKTA 1YR6A 1R0XA 1FDOA 3HP1A 4DG9A 3DD1A 3NVAA 3NHUA 3LHSA 4UBKA 4KQKA 4RGVA 1H8EA 3TVDA 2DKNA 1N5DA 2QZPA 3BGDA 3L8ZA 5CT4A 3AFNA 4EUSA 5DW3A 4JASB 2W48A 2QSYA 3C3WA 1I7LA 3K05A 1NYRA 3K9WA 4H6PA 1WCV1 3ZZMA 4U02A 4TSRA 1VBKA 1RI5A 2O2ZA 2OFPA 2DPGA 1E6UA 3FUVA 1K63A 2R8BA 1A96A 4GLBA 4F3KA 3EIOA 1NLZA 4AWXA 4EJ6A 1EUCB 1QK3A 2HIHA 2PQ6A 2CLDX 2WPNA 2X86A 2I7TA 3NC4A 3OT4A 1FTNA 1E64A 4JLUA 1QYDA 1Z2EA 5IN4A 3D2CA 4ASUD 2HBQA 3CVJA 4NESA 4HWKA 2EJCA 4O1HA 1J9EA 4FDMA 4D41A 3GI1A 4LKOA 5FJJA 3RE1A 3GRPA 3K9CA 4V2IA 1U94A 5HUHA 1M6YA 1UQTA 3DCIA 3IEIA 4YRAA 2FDXA 1WD5A 2ROQA 3DTNA 4IDAA 1F8GA 2NU6A 3EASA 4KN9S 2YMQA 4DJAA 4OHFA 4I8DA 1QCDA 3UAZA 1MPXA 5EWLB 5H7XA 1C3JA 1N5MA 2DEUA 3BIFA 5LQSA 1QKIA 2QS9A 3JATB 4QTUB 1KEEB 1KJ8A 2J85A 2H2WA 4Q9AA 2I5PO 5KNCA 2YS6A 4KP7A 4MYTA 2D1QA 2FRVA 3DFFA 1DAEA 5CM9C 4YDHB 5J1TB 3UOGA 2EWWA 1V8FA 5ITZB 4CLOA 3GFGA 1NUHA 3K2QA 4IIEA 4UAJA 2FF5A 1D5WA 4A6DA 1HMPA 1L4GA 3ZOKA 2XUDA 1H42A 2Q4BA 4FYJA 1UBSB 2DVMA 2C2ZA 4POAA 5F1OA 1JTVA 1IEQA 3ZKAA 5BW8A 4WY8A 3NHBA 3UWOA 4DKJA 3IBGA 3UMRA 1SK8A 2H1HA 5A62A 1DOAA 3PC8C 1QNFA 4YRLA 4KEAA 4ENWA 4XYGA 1VJ0A 1U3VA 4DV2B 2Q2VA 4DUGA 2I54A 2IRWA 3BRSA 3PEYA 5FR2A 2XWJI 1SUEA 4LTMA 4Y1EA 4HX2A 4YROA 4BVEA 1VDMA 1PL6A 4HQLA 4YCBA 1BIFA 3NHPA 2XOKD 2JASA 1E9VA 5A04A 4ZARA 5CYGA 3KQSA 1ICEA 4P3OA 3G13A 5BSTA 2HHCA 4LV5B 1LU9A 1DMSA 1XD2A 2EW1A 2PRIA 2ZBUA 4PC6A 2YFYA 3DQZA 4TWBA 2QG6A 2AG5A 4H59A 1E6EA 2R6FA 3R9KA 5GONA 4NIMA 3VU3A 2CHUA 3DBLA 4C6TA 4P4LA 4JYZA 1WCWA 2FLWA 5BWMA 1G8MA 2G6BA 3QU5A 1WJGA 2VDLB 2DFKB 4RZUA 4UQOA 5DXFA 2RMKA 5CCDA 1QE5A 1ZK3A 1RSZA 1H0RA 5K0ZA 4KQ6A 3DLAA 1GNTA 3O90A 2HZ7A 1Y6ZA 2JEOA 4PGMA 4E22A 1YULA 3GMDA 3W3AH 2VWGA 1A9ZA 1JQJC 3VSAA 5DW0A 3K09A 4I1YA 5K2OA 5JH7F 4LF9B 4G09A 4A3SA 4ZOAA 5I7SA 5I5EA 1T8UA 2O3SA 4I4CA 4LS3A 1ST3A 4MQFB 4YREA 2DHCA 4F93B 1GQQA 1DTSA 3TRKA 1ECLA 4GZLA 4KQJA 4DWOA 3E61A 1N2CB 2EQ5A 4HYQA 2A0KA 3ZZTA 2TMGA 3WV5A 4L5BA 5KTTA 3PLNA 4MCAA 2AFIE 4MEBA 4OSOA 2WT9A 4NCHA 1YBFA 1KFJB 1G8HA 2O0JA 2APJA 2F59A 3ENWA 5IBPA 3ES9A 1CDOA 2IYNA 3RC3A 4MRPA 4BQQA 1YIDA 1ZOOA 2IHBA 3F46A 2BGMA 2GJKA 2ZROA 1AGXA 4AIIA 4I5GA 2CJWB 2P4EA 3T5TA 3TDNA 4HNUA 1YHNA 2JFXA 3MCZA 4I50B 5LA6B 2V7UA 3QOFA 3LLCA 3S7ZA 3VVBA 2G71A 3N2LA 1VGQA 2FDCA 2HL6A 4R9UC 4HZGA 5BSRA 4DPLA 4L5AA 2XDAA 1RVDA 3LS2A 4CCYA 5CVVA 2H1OA 1I3KA 2QMQA 3T5BA 1GADO 3ITEA 3UYKA 4NE2A 1J1ZA 4AX4A 1XTVA 3QUBA 4TTJA 2BN4A 3THYA 3A1TA 1FVFA 3GIDA 4M0CA 2X7HA 2XUPA 1I2MA 5G0UA 1BX0A 3TR6A 1GL3A 3OTOB 2NP6A 1FJ2A 4M1WA 4GYWA 2UZ3A 3GLUA 3BWBA 1BXRB 1Z47A 1HL7A 2Q6KA 5BMVF 4N3CA 1BW9A 1YVRA 1A9OA 5A2QA 2E4WA 4Q39A 4OQMA 3ZKWB 4IGKA 1QQBA 4MGIR 2UZAA 2ODTX 3AESA 1XK7A 3C4VA 4PG5A 4DJTA 4FEEA 1U02A 4UUNA 4Z49A 1GL6A 1KMQA 2GHRA 1PLKA 2AWOA 4FHZA 2WE7A 2CDAA 2E37A 2OCDA 3A1UA 1TE2A 1G8AA 3A9SA 2WQ6A 2AH5A 1WSBA 4BN0A 5KBYA 1BE6A 3VBEA 1KAGA 4BQEA 3PZRA 1EXVA 5KNCH 5AQEA 2XUQA 3UT5B 3QVSA 1U7PA 4R31A 3TDKA 4Q7QA 4U9HS 4DCVA 4TQAA 1DG3A 1PT5A 5JDCC 5TEVA 4HPXB 4JJKA 1UC5B 1BA2A 2O5RA 4IHKA 1H4TA 1PNOA 3ESCA 3ORHA 5E6UA 2GR9A 3DO6A 4B0PA 3AF5A 1ZUWA 4ZVMA 2X9NA 3AFMA 4GWLA 1DBIA 3IOYA 3H9CA 4TTIA 4ZI7A 2HW8A 1DOZA 3UFXA 2CFRA 1P9LA 4JA0A 4HDMA 3UK6A 1NYQA 1Q15A 2OB2A 2WJIA 4BMXA 4EYGA 1M2JA 4NMLA 4LRYA 1W5TA 1AH2A 1E2GA 3IFSA 1ODLA 3FFWA 1X19A 3EMKA 4EAAA 4EYKA 2FVYA 3V1YA 2GJ8A 1ZBQA 3I2JA 4JBYA 2NXCA 1GDDA 1SHTX 3WL5A 1PJ3A 3B7PA 4QGAA 5JI2E 3T99A 2R6R1 5KIAA 3MM4A 3OO0A 5GADl 3QVUA 3A2MA 5KYUB 2CT8A 4CL3A 3E3OA 5HHTA 4QODA 5K4AA 1WVIA 3A3NA 3IIJA 4A0GA 3WQHA 5BUZA 3IPYA 2C7GA 1CDZA 2FMUA 1GAXA 3KD2A 3CV3A 2PS3A 4HDRA 3MCUA 2QE6A 5JXHA 3T3EA 5KNLA 2F17A 3ASYA 4AXXA 2VT7A 4C7VA 1W34A 4B3GA 1NT4A 3KB2A 4YCDA 3V7WA 3COPA 1U0BB 1XEXB 2D7CA 5ICEA 3C15C 1WVGA 1CJVC 3ZY3A 2JGDB 1NFQA 1L5HA 3OURA 1COWD 3TLGA 1Q57A 1T8RA 1XQ6A 1VRVA 1NVFA 4PZYA 1YZVA 1NRJB 3EGIA 3RWBA 1SEVA 4ZI7B 2QTGA 2GVNA 4GZ3A 3ZX5A 5IBCA 1HDOA 1V45E 3DC7A 1O97D 3KWMA 3IT3A 3NHKA 3QF7A 5CLIA 4WBNB 5IXYA 3PJRA 4H7PA 1XRSB 3K0HA 3HNOA 3ZV5A 3HPQA 2P2NA 3MUFA 5BR8B 3DJYA 4TSFD 2O8BB 1KEUA 3N6RA 4RK7A 3HJAA 2NUPB 1GR0A 4QYWA 4UC0A 2YXLA 2G36A 1RHRA 3FPSA 2J33A 4MS4B 1J5PA 5E4JA 1R8QA 4BNYA 3ORYA 1WHTB 3CRVA 3BXPA 1ZIYA 1AS3A 2QPLA 2WJ6A 2BFFB 2ZRIA 4MJ7A 1M6WA 1KZ7B 1L6RA 3A58B 2QJWA 1J1UA 2XXAA 4R69A 1TAUA 2IH5A 1Z33A 1SVMA 4BGVA 2CMHA 2XQGA 3M5CA 2Q3JA 4DMCA 1P2FA 2CKMA 2PY6A 2H1RA 3CIFA 1YZNA 2EWVA 3G8CA 4MW4A 4R9VA 1JP7A 5BORA 4XOIA 3FPAA 1GVHA 2DR0A 3PTLA 4G5RA 4QQ8A 3I3OA 4INPA 4KNVA 5KYVA 4CW7A 2FR8C 4CKCA 2WIJA 1OU4A 2K87A 4FWBA 2W0MA 1SXQA 2V6GA 1V37A 3WMXA 1X8LA 1QE3A 2EF1A 2W2LA 1H5NA 1Z8FA 3NDJA 3OC6A 5CB0A 2FTKE 4ZEXA 4ADSG 1ZC4A 3PYMA 4MGKR 4B85A 2QGFA 2Q29A 3TTTA 1E1RA 3C85A 4YT2A 1BXKA 3HI4A 4G63A 4P0PB 1T35A 1L5VA 4EA6A 4XDGA 3BE5A 2CLFB 1R37A 4PNPA 3KS9A 5C1DA 1O94A 3Q2IA 3SICE 3VC7A 1WBJB 3Q7IA 4DLWA 3Q8KA 2ID9A 1SC4A 3ETDA 2I34A 3GPDG 4GW3A 4RD6A 5JCOC 2IZ1A 1GN9A 2IUUA 3VSCA 2NZXA 1RKQA 4EQ6A 1USKA 2J0UB 1A4UA 3JQBA 2FVXA 3ZE1B 4ZHQF 5GZ1A 2XUFA 4BPBA 4JJ7A 5SY6A 3WMWA 3MWYW 4NG4A 3FPBA 1CPYA 1EAMA 1X94A 5IHPA 1NKVA 4JGGA 3HBMA 4TM8A 4RVFA 1LW7A 1YRHA 2GZAA 5ITVA 4RGQA 2GXSA 4TYNA 2R4QA 2H2AA 1VXOA 3MERA 4AJOA 3ZQJA 3KEQA 2YRWA 2P5SA 3HN7A 3LHKA 2WHXA 4G5XA 4O33A 1FOEB 5AKHA 4BNNA 4G1FA 4URVR 4K40A 2XMGA 2NUTA 1RBMA 4IRXA 3WBFA 3OZAA 5C4GB 4EIWA 1RYYA 2HJWA 3DCNA 5K4GA 1IMOA 3LO5A 3CZ5A 3T7EA 2AG1A 3HWWA 1AKWA 521PA 1B1AA 2B20A 3DXXA 5JDIA 1LKZA 3DMNA 2DBYA 4LC0A 4GI5A 4C6TB 2C78A 2HFJA 4B46A 2HAEA 2VR1A 4ENTA 3ORSA 1B16A 1WXHA 2AHRA 2VH5R 3HB9A 4ZZ0A 3HACA 1QKKA 2QAGC 3RKUA 4PZPA 1Z82A 1VC2A 1F48A 3FNIA 3DMHA 4KCGA 4EFDA 4WJLA 4CMIB 2NTEA 1PUXA 2O6HA 4FTWA 5K51A 4QLBA 5IT0A 3EVZA 2GHIA 3CPHA 3INNA 3RIMA 2B7LA 1H6BA 1TUIA 4MVCA 4H1WA 5JYDA 3UW1A 2YWFA 1LQTA 4OXRA 5A9TA 3THWB 2YC2C 1LW6E 5EE1A 3A3PA 4GMFA 3ZCUA 4J94A 4JXZA 4QRDA 5B7QA 3KTFA 4V0ME 1J99A 4C22A 1HYHA 1DTWA 1UT6A 3PNVA 4UDOA 4BMSA 4G3XA 4E88A 4B3RB 3ABZA 2H3EA 5F51A 4OLBA 3FTCA 4M1MA 5BMVB 2PT7A 2Q3FA 2HNBA 3HXMA 3THSA 4F4DA 5LVAA 5ECWA 4C0SA 1AO0A 3G5TA 1OIVA 4EJMA 2HU5A 1HC7A 5ALIA 4EHFA 4QKQA 1TA9A 2IZZA 3ZG6A 4M8NE 1WMSA 4ZOLB 1KEEA 1OH5A 4L85A 4Q24A 1A04A 3JATA 4XW2A 2RHHA 1IHYA 1V3UA 2NVUB 2DFDA 1P44A 1TQDA 1SU6A 7AT1A 3QX9A 2Y67A 1G0NA 1I13A 5D5QA 1R5JA 1T0IA 2C92A 2GARA 4DIOA 3VO9A 4G41A 1GFIA 5C5CA 1YE5A 4JZKA 1RI1A 4P31A 4LWQA 4TYMA 5H16A 4I2VA 1GXSB 1PR0A 2IVFA 3H5NA 5AO9A 5C5EA 3QG5A 3MNFA 4GVPA 1H5UA 3N7TA 1TF2A 2WDPA 3CZAA 3HBLA 1H8HD 1G2QA 1XMVA 3IAAA 5TVGA 1IK4A 2D7DA 5CYFA 4WI1A 3EIEA 4Y30A 2IEIA 1ST2A 4JU8A 3NCHA 1U8UA 4RMHA 1RJDA 1WLSA 4KXUA 3OJWA 1IULA 4MKXA 1RWBA 4JEMA 2UZIR 4X60A 1ENOA 5D3ZA 3O6VA 2XEXA 1JALA 1JR4A 1K8RA 2ZSKA 4AZ3A 4EUNA 3FBWA 3DWGA 4M9SA 3F47A 2HR1A 3IV9A 5F4ZA 3UMBA 3ICVA 2Q6VA 3NNDA 3OQ6A 1N5KA 4ZQGA 1BS1A 2V7TA 3HCWA 2XVZA 4XVQA 5TMEA 1XU7A 3RYIA 4ESEA 1Q3KA 4JC8A 2BLNA 1ZGHA 2EL7A 3F3SA 4JX9A 4RPJA 3EAGA 1DKOA 2A0XA 2H4YA 1SNYA 4ZK2A 2YIMA 3BD7A 3BA1A 2X5JO 3LUCA 2G1JA 1JE0A 1Z68A 3VZDA 4BVFA 1RM5A 2NSHA 2V6IA 5CA1F 3HI6A 1YCHA 4J8PA 5LQNA 3L1KA 2FQWA 5CNMA 4XVCA 2YS7A 2COEA 1SWWA 2JHAA 1P2UA 2OM2A 3KDPA 2IE8A 1TMOA 3NVMB 1OJLA 1N2EA 4B3BA 3IIMA 1AK9A 4TMXA 1SQ5A 1VI2A 1EP1B 2MMGA 4H7EA 1Z56C 4BMOB 2GEDA 5BUCA 5K9ZA 4BBJA 3U4QB 3JU3A 1E79A 2IYRA 5IX8A 4I9FA 4BAZA 3JQBC 4ZJUA 4WXHA 3E3AA 4GECA 4AZWA 2X0EA 5AM4A 5FWYB 5KYKA 3THOA 3G89A 4CDRA 4J0KA 4NABA 4HDCA 1MQ9A 1O94C 4UUPA 4YJ3F 3CW9A 4JLNA 1WABA 2IDMA 3ZHSA 2VZEA 2XUZA 3NOVA 1I01A 5GOTA 3WKEA 4LXXA 1KYVA 2CNKA 1PS0A 4RTPA 3ABIA 3D6HA 5A9SB 5EIHA 1KHHA 5B1DA 3ZHVA 1EUDB 2WYUA 3CRRA 4FSHA 1VE1A 1E9EA 1EYZA 3AW8A 2QOEA 2WZCA 3BXGA 3RANA 5KTMA 2XGSA 3L6BA 4H4CA 3KKLA 2AOTB 3GIWA 3HKBB 2JLCA 4P82A 1NVAA 1N33B 4GGOA 3LZDA 1W1IA 3ICWA 3BRCA 1AQIA 3IXQA 2XQIA 1JA1A 2H9YA 3HKBA 2AOTA 2HTEA 2QPAA 4KQFA 4OQQA 3VPHA 2WM3A 2NVWA 3BFPA 3WWPA 2A5DA 2O8EA 4BX2A 2HRBA 3LY8A 1RNLA 1UKBA 1WULS 1GZSA 1SCQA 2OBXA 1T9AA 4DGQA 5MN6A 2HA4A 3H86A 3TECE 1SA0B 3SOZA 4W6QA 4EO9A 2EBFX 1NVMB 2DAPA 3D2LA 5FO0A 3B78A 4DUYB 2DSNA 1BWQA 1T9ZA 1QP0A 4EHLA 3GG2A 4LAFA 1VYUA 2VJMB 4Q19A 2YWHA 4D25A 2VYND 1YRBA 3OEYA 4S1WA 3ONVA 4Q9KA 4C07A 3D5TA 5EAIA 4OBEA 4OOEA 3R5SA 5DGDA 3B3AA 4I7EA 2WIGA 3EMVA 5LP6B 3DXYA 4LTDA 3NIWA 2XDQA 1Z6ZA 3MMSA 4UM8B 4XPZA 2IPXA 4P3XA 1WPXA 3TNFA 4BJ1A 1RYEA 4DAOA 5IYZF 3U4QA 2NOAA 2NWQA 1YE8A 4L28A 1KMHA 4M1EA 3U7JA 4XQGA 1HPLA 2CD9A 4TN1A 4R1PA 1QHFA 5DLEA 3I6BA 5T7BA 1UDXA 4J76A 4NAVA 1XRNA 4WAUA 9ATCA 4MYDA 10MHA 3ZLTA 1U65A 4OJNA 1NOJA 2W2KB 4DC1A 2H5JA 1WMFA 5K45A 3BCHA 4QDXA 2QD5A 4KRFA 1O58A 2VRCD 3TB4A 2CUTA 1CB0A 1EGHA 1G60A 1YSCA 4R54A 3KQTA 4Q37A 4WXMA 1MLDA 3COWA 5DVZA 5T64A 2Q5IA 4DR5B 1E3JA 1JYFA 1E3EA 2VJNA 2YZGA 1MQSA 3KHUA 3L7CA 1ZDMA 3AH8A 2J3KA 3RYIB 3U6KA 1Z15A 4MUKA 4ETIA 1NAHA 2HBZA 4ALNA 1XKXA 2LVBA 2Y1FA 3NHFA 1AUXA 3AR8A 3WLOA 2ZAYA 3LRXA 1Z5UA 2JFQA 4RPHA 4CIVA 1VQ1A 1DT3A 2Z4TA 1M34A 3LW7A 1VXRA 3GV0A 1PV1A 1VPTA 2MIIA 3L1JA 3MWEA 3NHMA 2X6TA 4LOIA 4MUIA 4B3CA 1SB9A 3KB8A 1AUQA 3GH3A 5J3JA 2H4FA 2KWIA 3NHLA 1NM5C 1OC2A 1KBOA 2QLFA 1EGAA 3NHYA 3AVQA 4WL0A 2A1TR 2QP3A 4OK6A 1L4LA 3EYAA 2D6FA 1Z5VA 2GESA 3D2BA 4XQEA 2JIBA 5DIZA 2JARA 3DG9A 4Q9IA 5J2UF 3BBLA 1YVPA 5BWLA 4XIYA 5K0CA 4PGGA 4HX9A 1RKVA 1JLLB 3DWEX 4MR9A 3LI2A 1XZEA 4ONEA 1QB8A 3V8VA 3IVRA 4BLOA 2HA7A 1YT5A 1HRKA 1ZI6A 3X1YA 3A8TA 3OQNA 1HR0B 4W9RA 4BNJA 3PC7A 4QM7A 2HEGA 3DEFA 4CODB 5JNLA 1QIIA 3W78A 4ZYVA 1AKMA 4BNHA 1QPZA 3UCEA 2NO7A 4LYFA 2LIPA 1TKAA 3RT1A 1QHIA 3B6ZA 3FWNA 1EEXB 2N0SA 3T4EA 3SJBA 5A4MS 2DY0A 1VBMA 3O9ZA 4W1PA 4RF4A 4MYRA 3GFFA 2J3QA 3RSOA 3MT8A 3X1XA 3HEBA 4LSMA 2R9VA 4L76A 1YGPA 5AOBA 1ZI9A 2D2EA 4WE3A 4Y2GA 2ST1A 1H3FA 3EEIA 1UAAA 3BQMB 2LTAA 3F8WA 5H9VA 3U7HB 5DRTA 5JMTA 3EISA 4AWBA 2PGAA 1PZMA 2OLKA 5DN6D 1QDEA 4I55F 2Z8ZA 1DCMA 2VZ0A 3B6MA 2XCIA 1KEZA 5ERGB 5E3HA 1QIMA 2DU8A 4DEVA 5LWHA 1VKJA 5E7JA 2WTAA 5EQFA 3PEWA 1NBOA 2ZYWX 1PYOA 2ICAA 1TK9A 3U4GA 4DLKA 1VE3A 1OLXB 3V1UA 4R0NA 3RFCA 2OHIA 3EY4A 2ORVA 4FBMA 2Y92A 8GPBA 1S1CA 2AYXA 1O97C 1XVLA 4P2BA 2ONCA 4GGPA 3CT4A 3NBAA 3VQTA 3GNLA 1QO0D 1UFVA 5JRZA 1FTSA 1C4WA 4BNDA 2NVOA 3CEJA 5G0TA 1N9ZA 2RI6A 2XNKA 4F3TA 3OIGA 1TQ2A 1KYQA 2CFOA 2QZSA 2NYUA 3P45A 3H4MA 3TLEA 1S2LA 5A7GA 1XO1A 3AEQA 1SUSA 5IKXA 4ZDWA 4ZCQA 4LDPA 5CYOA 2D06A 5EFZA 2ZJ2A 2AFHA 4BKPA 4F11A 2H1IA 3EIWA 3MB5A 4GEGA 3Q3HA 1YJCA 2WG2A 4I4LA 1L1QA 4AJ2A 3SSNA 2QWXA 5JSHA 1DZIA 4MYUA 1AB5A 5FA6A 4BV3A 1X80B 1E18A 2Y1KA 3E7FA 5DYGA 5A0VA 1I30A 3M70A 3CU5A 4TTSA 1N2XA 1DPFA 4FHCA 4AS2A 3KE9A 4JCOA 2Y0PA 3PKJA 4L9RA 3K5PA 4TKMA 2PYZA 4KODA 4R71A 2DHDA 4D1YA 1N2BA 2H0RA 1ZN8A 5E8RA 1W73A 1CS4C 3OJEA 2QJRA 4ZEVA 3QMMA 4DCJA 2J0UA 2BTOA 3X1JA 3T3OA 4IEEA 3FHOA 4NOKA 1WUKS 1IOWA 5B58C 2XJ4A 1I7SB 1YVUA 4X8HA 2Q99A 3K0CC 2D0PB 1YC2A 1XRPA 2V6JA 4FW9A 4MMXB 4PC1A 3SQDA 3V4PB 3E9CA 1CEYA 3UEOA 3G2NA 4RAOA 2MWMA 2FPIB 3UPDA 2LGJA 2IEBA 4RHYA 2CBXA 3TZHA 2B4KA 2QF7A 3Q9SA 4DR7B 2O8DA 2C95A 5KJCA 3WS7A 3WFZA 3RBVA 4DJDC 3IL2A 1KP9A 1C7IA 2JIZD 2CEKA 2H8KA 4M76B 2P3QA 2XNDA 2VCHA 4RTMA 1W9MA 2ADMA 1KIMA 3DLHA 4MLDA 1IBMB 4FMDF 1E1DA 4D0LB 1KAMA 4AD8A 1WSAA 5BT9A 3VPAA 4QEDA 1H4VB 1Q0UA 4GP6A 4HQRA 4N6NA 5BSWA 1XYYA 3PFGA 2YHBA 1R50A 3OE1A 4PFJA 1BE0A 4UNQA 1E2NA 2F64A 4ZU1X 1Z73A 4EMUA 2GN4A 2WWVD 3GDGA 2GZDA 3H8SA 4MKRA 4NV1A 1SK9A 3IELA 4FN5A 2H2DA 3NJ4A 2E1RA 4LOAA 3DOHA 3MTAA 4O1MA 4F2HA 1UWCA 4IX1A 4L27A 2OP0A 1NURA 1T9GS 4X6LA 3T7KA 4MV8A 2I9PA 1E5QA 2NNWB 3ZU5A 2FEWB 2YN0A 1WZNA 5EZYA 1XJQA 3LT0A 3ZS8A 4F97A 3JYPA 4J7UA 4IDBA 4QU8A 4RS3A 4UNIA 3T06B 4M22A 2IPOA 1I7PA 1M1YE 2FSGA 3ILHA 4GSKA 1RCFA 4GMKA 1BHJA 1C1DA 1NNSA 1YZGA 1Z6QA 3L0PA 1Y6FA 3IODA 3BERA 4AG6A 1OCEA 4OM8A 3V2GA 1Q0PA 1RKXA 4RMGA 2QX6A 3KAQA 1U1EA 4U2GA 1SC1A 1VLJA 2EATA 3AKYA 3QF4A 5BQOA 2O8BA 3IUYA 1U7UA 4FXPA 3NUQA 1E59A 2AQIA 2O0LA 5JQGF 5F1YA 5C53B 4MRSA 3JD0A 4PCAA 3EIUA 3KDAA 3AI7A 1BWPA 2ATEA 2FZVA 3K16A 4Q1BA 4JT9A 4Y2UA 1I4OA 1M1YB 3PUXA 5B3AA 2E55A 4BQIA 5CFOA 5KTNA 1GAJA 4C4XA 1RAIA 1PQWA 4F5WA 2I4RA 4N3AA 2XB2A 1JHQA 1JPNA 2XMSA 5DTMA 1WUJS 1YQ9A 4PLFA 5CNIA 5BR4A 3RWMB 2PVCA 1MFPA 4OQPA 1W0KA 2CNBA 3ORRA 5AQ1A 2BELA 1SN7A 3N0WA 4LRXA 1QMGA 4R6WA 5EIBC 1PEDA 3QHAA 2FMIA 2Q46A 2DPXA 3LQFA 4BEWA 1P4AA 1YONA 2IZ0A 2P68A 2QT0A 4DHEA 4XZ3A 5EOVA 1T5SA 4PPFA 1EM8A 4RY0A 4DJFC 1V9CA 4XLZA 2IYEA 2NM0A 2X40A 1GFWA 1US8A 1OWNA 3EK2A 5IS2A 1WBBA 5IAAA 1SXJB 1ZU5A 3I8OA 3LUHA 5CRIA 5JXWA 1M7GA 1SKUA 5JFOA 1QG2A 3I83A 3PUHA 3TW4A 4N39A 4JB2A 4KQIA 1Z4LA 1T1SA 3QP9A 2WWRA 4IFTA 2F9LA 2VDQB 4FX5A 1V5WA 1OVMA 5SYAA 1Z18A 2VP4A 3CVYA 2VN8A 1J09A 3ECSA 1J5XA 4ACAA 1RLOA 1F4LA 3DKPA 3JVEA 5U1PA 1PGOA 1VHWA 2BUAA 2XOKA 3PIRA 1NHWA 5KI6A 4A0HA 4FC6A 1TU0A 3OZVA 4I50F 1M6VA 5DPMA 5LA6F 2PX6A 1X14A 1D0SA 3OJLA 2FG5A 4FGSA 4BRUA 1RRFA 1C8LA 2OFWA 3A11A 1X38A 1U9IA 1IJEA 5T3YA 3A9WA 1T3ZA 2IXFA 2MSNA 5F3RA 3K9FC 2NZWA 2RKOA 1GPMA 3DCYA 3NG1A 4FP9A 5IN5A 2FXVA 2O5CA 4IBOA 4XWTA 1NL3A 3WXMA 3HKCA 3D1JA 4JJGA 1V5IA 2ENUA 4YB8A 3DDZX 1ADFA 1U0LA 4NULA 1Z6GA 3BFXA 3FYCA 2OC4A 4WASA 3EOAI 3FNEA 1Q0RA 2Q3CA 4CJXA 5I45A 5M04A 1VI6A 1G20E 5HM8A 5CH5A 2V59A 4Z1OA 5JW6A 5JAQA 4ZO6A 4ZT3A 3OQIA 3JAKB 2IOQA 4BKRA 5JMWA 2X9GA 1I2AA 2JLZA 1GTL1 2C2MA 5TGDA 2HT1A 3HJFA 3TPZA 1R4MA 1HT3A 2JFBA 4JSYA 5GV7A 3IOMA 1ATZA 4LUCA 1K5GA 1AVTA 2D5AA 3E1KA 4G5OA 1EMDA 4RFSB 3MJEA 3WGQA 1CY4A 4JB8A 2C5AA 5I48A 2NV0A 2W6MA 2WAYA 1EUYA 2BFBA 1E92A 3GFVA 4TXJA 5ARBA 2I4TA 5BN4A 2OK8A 3BC1A 2A1IA 1MTOA 2P0AA 4HYYA 4LI3X 1OLUB 4MWZA 3G2OA 1LPSA 2ZQ5A 3Q85A 3LP6A 4LJ7A 1ZZEA 1QHYA 1Y1QA 4ZODA 3T1NA 1J2YA 3EMBA 5BRJA 1EM6A 4L50A 1Y5IA 1U2GA 3AEZA 4QPJC 1HT0A 1L4KA 2FJ0A 5H5JA 1VIVA 1CDDA 2IGTA 3K9LA 4MS1B 3DLPX 3UMJA 1YTUA 5F2EA 5ALTA 5FIUA 1W2HA 1YBHA 2VJAA 2B94A 2FOXA 4RIEA 2QMOA 1DX9A 2VP0A 4UPDA 1Z4NA 3KVNA 5I3CA 1S4MA 4KK4A 1G8GA 4UEOA 3WJ1A 1MF7A 3WB2A 4E70A 2Q4RA 4GBGA 4F9EA 1NSYA 2ZUUA 1K66A