3T7JA

Crystal structure of rtt107p (residues 820-1070)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
250
structure length
237
Chain Sequence
TKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHSQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDVIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Regulator of Ty1 transposition protein 107
publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 76
structure length 237
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7jA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7jA01
3EF0A 4BMCA 1L0BA 3I0NA 4BU1A 3UEOA 4IFIA 1WF6A 3COJA 2ETXA 4Y18A 3K0KA 3UENA 3PXAA 3K05A 3L46A 3K16A 2K6GA 4IGKA 3PXCX 4JLUA 4N40A 1JNXX 2WT8A 3II6X 2HTFA 1T2VA 4Y2GA 1CDZA 2JW5A 3T7IA 2COKA 4U4AA 2DUNA 4ID3A 3PA6A 2K7FA 3T7KA 2XNHA 3EF1A 1KZYC 2L42A 1N5OX 4XPZA 1OQAA 3T1NA 2EBUA 3SHVA 4BU0A 3AL2A 3PXEA 3PD7A 3JVEA 1IN1A 3L41A 3T7JA 2M2IA 2EBWA 3PC6A 3OLCX 3FA2A 3SHTA 5ECGC 2ADOA 3SQDA 2VXBA 2R1ZA 3HUFA 2NTEA 3PC7A 1GZHB 2COEA 3I0MA 1Z56C 3K15A 1T15A 3QVGA 3PXBA 2E2WA 1L7BA 3AL3A 2AZMA 3PC8A 3HUEA 3PXDA 4OFBA 3U3ZA 2XNKA 2COUA 3PC8C 3SZMA 2EP8A 1T2UA 1IMOA 1T29A 3L40A 3QVGB 3KTFA 3K0HA 4XQ0A 2LE0A 2VXCA 2INGX 4BMDA 2D8MA 1Y98A
chains in the Genus database with same CATH superfamily
4DVJA 3S70A 5BV1A 2G77B 4P81A 3SPXA 3HGQA 3HHEA 4HH4A 1F2TB 3MUNA 4RADA 4Y2HA 1KJWA 1PZFA 4XM0A 5H3HA 4Y3UA 5DNVA 1O96A 1P4GA 3A28A 5C34B 1T2EA 5T8KA 3TTSA 4FFWA 1VE1A 1F20A 3H5WA 1R37A 3FMIA 3I8SA 5IAGA 1N4AA 4JR0A 5F4BA 1D9ZA 1BEZA 4Z0TA 1XBTA 4WDQA 3G9XA 1HFWA 1RRVA 2B1JA 5LMZA 4EX7A 2W2VA 2RAVA 4MAMA 3QBVA 2IYRA 3BWVA 3M3DA 1RXVA 1TL7C 3WG9A 2V4UA 1QTRA 5F78A 3OX4A 1Z5OA 4MPTA 3ABZA 3H1GA 4CMCA 5LOVB 4P3NA 1D6SA 3HB4X 4NCAA 3H9CA 3A1FA 4RA9A 3S0JA 3DC2A 4H9GA 1QZTA 3UANA 3RV3A 4IPTA 1W29A 1BE1A 4Y2GA 4L3OA 3T1VA 1Y7LA 3HC7A 3GRVA 4J16A 3T5AA 3DMDA 5AHKA 1JJIA 2JJ2A 1BZYA 2QOEA 4ABYA 5AW3A 3ZWKA 1JVSA 2QLFA 1GYQA 1T2NA 4EB8A 2XBMA 3NANA 3JXEA 3S8EA 2PX2A 4TLDA 5C37A 4EY5A 1FFAA 3WGOA 3D4LA 1J7JA 2AOXA 5F2OA 5LKRA 4G67A 3DWIA 4QOIA 3AI2A 4MI1A 2QVXX 2JJ1A 4RMJA 4ZANA 3ZI4A 1FFXA 1DAFA 1JA1A 1A88A 1HTWA 5BW8A 1PL0A 5IJ0B 5IYZB 2VEOA 2C7RA 1N77A 3HZRA 1VRVA 3OBIA 2QRPA 2PMFA 1XEAA 2XCUA 3DLAA 1WOMA 2B0JA 2VSOA 3PDUA 2SKDA 1BJRE 4WOJA 1LLQA 2C9YA 5L7YA 4RY0A 4DIFA 2CSUA 3Q0TA 3CZCA 2C96A 2CB9A 4D57A 4DLLA 1AKTA 2XR1A 4G9GA 2GHRA 1ABFA 5IT0A 4NPHA 4K6KA 1U65A 3KHSA 4FDLA 4HNUA 4J1NA 5IHXA 1CR0A 1CUUA 1KI7A 3S7ZA 2JGLA 5BURA 2DFPA 3U19A 2IWRA 2MOKA 1FTQA 3GO4A 3VR5A 4HLQB 1T9KA 4J7CA 2H54A 4ZWNA 4YRZA 5F4ZA 2JD1A 1R6XA 4OI2A 3TVDA 4QU5A 1PZNA 1C8VB 3C0KA 1A8SA 4KIUA 1PHRA 3GT4A 3L06A 4OQQA 5K0ZA 1T9GS 2LIPA 2X42A 2XVYA 3ZWNA 2GPBA 1I0LA 1J2UA 5BYAA 5MN6A 5HFAA 1FEZA 2FW1A 1DMSA 3Q12A 3S40A 4EG5A 1LZKA 1P2VA 1P6XA 1U0JA 1L5MA 2QTLA 4H16A 3GLRA 1OBOA 1TW2A 5AOCA 3MVEA 4P4LA 4JAVC 1TVKB 3UWOA 1ZUIA 1NV9A 1H6AA 1J06A 2PZGA 2PMDA 2QSJA 3TQHA 5TVKA 4CV0A 5EZYF 3K0EA 3NEJA 3F6YA 1Y42X 4IDOA 4NEQA 2X5XA 3GAFA 4H60A 4F4IA 5C8YB 1XEWX 2VJAA 3P97A 5CVEA 2BJWA 4A8JC 4OLBA 2CDAA 5CH8A 4R1PA 5JAIA 1VKHA 1ZRSA 2PUDA 2MINA 1E5DA 1N0VC 5E2AA 3TLYA 5BSFA 1RQPA 1RHMA 2DCMA 3M6XA 5EPEA 3V2HA 5DWQA 1QE3A 4Y9UA 1MV5A 3CNLA 2DJIA 4MR9B 1ZA2A 4UHBA 5LWHA 5GIPE 1U2GA 4G0QA 4TL7A 1F6WA 2PXHA 2YCLA 3TD9A 1QYXA 2XUKA 5HRUA 5BSRA 1P73A 5DVZA 1GG8A 4RAQA 2WB4A 3FCEA 3PIRA 4H2DA 3HABA 2JCYA 2P75A 4MA0A 1Q17A 3H1TA 1IM2A 2O7NA 4HTFA 4P0TA 1KDTA 4OJQA 1JAXA 2ZJ1A 4DV2B 2EFDB 5IARA 3VPHA 4C7OA 2Z98A 1I1HA 3FGOA 5CNKA 4PZYA 4AG3A 4RAOA 3T52A 5ILOA 2Q2VA 1PDWA 2OQVA 3GJQA 4Y18A 3ILSA 1RI3A 4UTRA 2XKBA 4EW6A 3PNMA 3SHOA 4GKJB 2XGGA 3GBSA 3TFOA 1G5HA 1THMA 2JHCA 3S28A 2BGKA 3OT1B 3PP8A 2GF2A 1TIBA 1SHUX 1X7YA 3RKSA 1H2BA 2JGAA 1XQWA 2NUBA 1MX9A 3I04M 4QIHA 4XGIA 2PUFA 5K8CA 3T35A 4E2XA 2CZCA 4BAUA 1LBTA 2RIPA 4IJWA 3QKUA 4QOFA 1KQFA 4B5LA 3EZ7A 4JUBA 4R9RA 2QL7A 4KZPA 4KV9A 4TQ9A 1PK7A 1MABB 1GO2A 1B8UA 3KOXA 1WOYA 1AXRA 2ZB8A 4JVLA 4MK4A 1GXSA 1O7JA 2YZ2A 3EF1A 1H2RS 4HAZA 3GARA 1QTNA 1R88A 1OVMA 1AHPA 1F60A 3LVBA 2OAQ1 1A8QA 3ZD6A 1U81A 2ATIA 4F4UA 1P61B 1BIFA 1TA4A 3F7OA 5FHRA 3RIYA 5TF4A 4RPIA 2CXHA 1DAMA 5T7BA 4B73A 3IAM6 4B1FA 3QXXA 1IY1A 4TMYA 2VAPA 1PVVA 1WB6A 2GCOA 4ZZ2A 3K9BA 4LDQA 4L8WB 5AHOA 5H1YA 4LF6B 4DHEA 4AJHA 4NPAA 3DTVA 1T8PA 3C8ZA 2IYPA 4JLJA 3WGZA 1E89A 5BR1A 5CJJA 1EWQA 2H51A 4MYCA 2QSYA 1X2EA 4U3JA 3QFCA 3UY4A 5J23A 1Z34A 4YNBA 1K3FA 4Q9KA 1JIXA 4OLAA 1YU9A 1P2FA 2V3WA 4P31A 2JD2A 5EIHA 5FFNA 4K9OA 4CF6A 3RBXA 1XTPA 3ZDDA 4NKRA 1U0TA 3ZVLA 1D7AA 5BSWA 4L4YA 4AJKA 5IX8A 4KSBA 1GUAA 3SGLA 2ZWAA 4YJKA 1GZHB 3T5DA 1CY4A 3G0DA 5BQXA 3GN1A 2GN6A 1P7WA 2LR0A 1YQ9A 1L5SA 2GA9A 4BLRA 1T15A 1Y6RA 1V8DA 4IHJA 3HA2A 4MTCA 5GONF 3K0FA 2ADFA 1MRSA 1CD5A 2YXPX 4CI9A 2R60A 2D2EA 3E22A 3PXDA 2P9QA 2BFAA 3BFKA 5HRAA 2IF0A 4CM5A 1QS0B 2HH9A 3PZRA 1UMDB 2OL4A 1HA3A 2YMMA 4EF5A 4R01A 5C81A 4IDQA 3AGPA 3LGXA 1EUDA 2A1IA 4QDOA 4Q9NA 2Y1XA 3W5HA 4R54A 4CTJA 1B6GA 4PZAA 1T8SA 2AE1A 2O9JA 1GEGA 1DQNA 1IOWA 2X0DA 3NWJA 4CU2A 2N9UA 1Z2CA 1PKXA 3DA8A 3HY4A 4RPLA 2I34A 3SE7A 4XYEA 5B58T 3K31A 2DQ4A 1KI6B 4YDSA 2ZM5A 1I8TA 1DPFA 2I99A 4GGMX 1B8OA 4WH0A 3H2ZA 1XCMA 3GLFB 1RWVA 3A70A 5AKKA 3FVWA 1I4TD 3H6HA 3PQ4A 4JITA 3LKDA 1ZN2A 2OV8A 1ZL2A 1RJFA 2X8JA 3R8CA 2D2XA 2W2XA 3WO0A 1I6KA 3D8HA 4AS2A 2F4VB 2EJCA 4AYXA 3ZHUA 3EBLA 3WGMA 4WFKA 1GNQA 1TTQB 1LRKA 2XCOA 3E9DA 4C5AA 1JG1A 1F9EA 3WYGA 3B6EA 5DOVA 4N6NA 4FB5A 4DDMA 3NUZA 4BC0A 4WL0A 2PLWA 1K2VN 2P41A 1D07A 4XGRA 5L3SB 4JELA 5H82A 2HTFA 2MWMA 2VSQA 4IXNA 1FS6A 2GETA 2QVCA 3WLQA 5L3QA 5LPNA 3DD5A 3JAWB 4LVCA 5KWJA 3IDFA 4IHAA 2IOHA 3O4RA 1NW9B 2GSDA 3I8XA 1XDDA 4FE4A 4JXZA 1Z4IA 2JCXA 1OXMA 3HBAA 1QGUA 2R2AA 2WIJA 4L4ZA 4E6PA 1BH6A 1MVOA 1P9WA 1QYIA 1RE0A 1TIPA 3OCJA 4CEIA 2CMHA 3U9SA 1DAIA 4TN1A 4P6VF 4ND2A 3LRXA 4XUDA 4DMGA 4Q39A 4DV0B 4CG3A 1P45A 3P96A 5I7AA 2YYAA 2VDPB 3LGSA 4LOAA 3OU7A 1J8QA 2Q62A 1EHYA 3UMSA 1WVMA 2A5FA 3SM3A 1S3GA 1V1RA 4WLVA 5TY0A 5J5VA 5E4YA 1ODIA 1RHRA 4F97A 4YQZA 4E3ZA 4ZYTA 4CPDA 1OI7A 4KQKA 4QTUB 1N8KA 4WSOA 2QW0X 2OZEA 3PJFA 3NGXA 5DASA 2W6IA 2ODTX 5DSTA 4HX9A 2V7XA 2PVPA 4AMVA 1AUPA 5CEFA 2CC2A 4JOQA 1OGYA 1F5NA 3E0QA 2YZMA 4XFKA 1ZIOA 5IK2A 2ZG6A 4A3SA 2PZ8A 3LLCA 2Q3CA 1J97A 1V11B 2I6GA 2VF5X 3PC7A 4BIMA 4GQBA 4CN9A 3QNWA 5FX2A 2PU5A 3JARB 4FYWA 4IYJA 3TW6A 4JI5B 4KSYA 5DLYA 1FDWA 1D2RA 4LOHA 4JSTA 4CG0A 1RDFA 4CKEA 1XRQA 3E2MA 2JFUA 4WCVA 2R3SA 4MVXA 3QNMA 4BO0A 1MNAA 1RXYA 2H2IA 3DJFA 4HQ0A 1YE8A 4DCOA 4U6NA 3KVRA 2Z8YA 1GPKA 3RSHA 4LF8B 2Q5HA 3JWHA 2ODPA 4TWJA 4D3XA 4ZV4A 1ESMA 1NVFA 2MCFA 3K94A 4L75A 2WSLA 1C8KA 1X7XB 5FYDA 3VTFA 3ZHCA 3ZGLA 3U31A 3UMBA 4YUYA 4MYSA 4L50A 4LHWA 4M46A 1B16A 2UXBB 1CEEA 3PIDA 1I4WA 3RT7A 1GL7A 2FEKA 3C1TA 4B6SA 1UPAA 1VSTA 1T6YA 3DZKA 3EIWA 1ORVA 3BORA 1LUAA 1U3FA 2EXXA 2OFOA 3NVKI 3VKHA 2I2WA 2FSFA 5HUHA 3OE4A 1UPUA 1YZ3A 4ZHQA 2X9QA 4TYQA 3SDZA 3DHWC 1IOVA 1NOKA 3JQ9A 1PG2A 2D6FA 4RZSA 5FLXA 2ISCA 3E1GA 3GD5A 5BP7A 5F5NA 1E9AA 4F0JA 2R9VA 4BNTA 4UTPA 2GVDC 1Z07A 1A71A 1M54A 3H1EA 4RW0A 3SC2A 2WK1A 4W8HA 2YRWA 1WDLA 5JR3A 3LUKA 1EAYA 1XQ1A 4QDUA 3TQIA 1JB1A 1OW3B 4RV5A 1GDTA 5ALRA 2I4NA 4I81A 4LVNA 4Z2YA 1TRKA 4JLDA 4XVCA 5FIUA 2GZSA 2DBYA 3JATB 1JEQA 1LSOA 1TVMA 3CGWA 3ZZUA 4WNIA 3ZQUA 1A50B 4LOLA 3H2HA 2A0WA 4JYMA 4PLWA 4C76A 2YBEA 4MQ4A 4G9BA 3RGWS 4H15A 3QE2A 4GPAA 4ONEA 2Z5GA 3B6IA 5BN4B 2VNSA 3F4LA 4IP0A 3KQSA 3H4TA 4FEGA 3SLRA 2Y1FA 4A0QA 4ND1A 3VH3A 4NOKA 3QMVA 1CZHA 1Q57A 1UBSB 3GEHA 3RSOA 1DC6A 5ADWA 3KKNA 5F7ZA 1HYQA 1Z39A 2C9CA 3ZHBA 1JLSA 2HJSA 3UK0A 1Z0SA 2QZPA 1SVNA 2IHTA 3B85A 3S8MA 2EW8A 4KE8A 3NIBA 1PF7E 1TGVA 4F4CA 1BCSA 2A4KA 4FN4A 3AF5A 2RGCA 1VMKA 1ZH2A 1A1VA 2V7WA 5L4NA 3J7AC 1A2KC 4P58A 4XOUA 4E51A 2IEGA 2EKPA 2N3ZA 2M6KA 4G86A 4MR8B 3QLTA 2E21A 5DZSA 2BMFA 1DRKA 1TKRA 1XTVA 2BMWA 2WFLB 3I53A 3AUUA 2P9JA 3L5OA 4IVPA 4R84A 4CDGA 5DHAA 3THRA 2ZDQA 4GG1A 5E7MA 4QQNA 5D87A 2JF0A 1TYCA 2P6RA 3G1UA 1JPNA 1X1SA 3QPAA 4M7PA 3D3WB 4QOHA 1H66A 2CE7A 1LJUA 2JH9A 3SXPA 3WR5A 3GDFA 2NVOA 3M3PA 1ORDA 3DF9A 3QXHA 4PHHA 4BE7B 2ZEJA 3WGLA 7YASA 4IVRA 4IHJF 2Y77A 1QIMA 2ORIA 4J29A 4HUQB 4ZQHA 1F0KA 1S2MA 1V25A 1VGQA 5C3MA 1POWA 4YYEA 5CCXA 1MC4A 1MPTA 2B4YA 5LQMA 4JI7B 4LY6A 4CUKA 4JUDX 4OBBA 1CZRA 1E1MA 1YZLA 2VAXA 2V1XA 1GYPA 2ZE5A 2VZ9A 3PPYA 2QUZA 3GELA 4KRXA 3ZGNA 2XPCA 2ZRCA 1QAQA 4ZP1A 4M8IA 3G0BA 1KIAA 3GFTA 1E92A 1L8XA 2D1QA 1X0XA 2LNDA 2R1ZA 2YWFA 1DINA 3BXEA 3DJYA 1DKQA 2KMLA 1PL7A 2OMKA 2CNBA 2G7ZA 2C83A 2JD0A 2PL9A 2OAEA 3QKSB 4MJ3A 4QO7A 4QTTB 1PS0A 2I29A 3OZFA 3I92A 4XWKA 1AMOA 5DI9A 1SCBA 3KPWA 4TWBA 3VR5D 1YZKA 1NASA 2B69A 3QFHA 4G6ZA 4MNTA 1YVPA 5CITA 3LW7A 5J2UB 3UZUA 4X44A 4EY3A 2Q3MA 4V1CB 1EE1A 4YDQA 4ZTBA 4HWGA 2IYTA 3AT1A 2APJA 4EYOA 1YI0A 3QWIA 2ZIAA 3SZMA 2XNDD 4PO8A 3RI3A 3V48A 5EJ4A 2HIHA 3GNSA 3IUPA 4TQAA 5TJHA 4UM7A 2WF7A 5B5SA 1QHSA 4H6PA 4QEZA 4BKOA 6YASA 6CHYA 1M0WA 1I3MA 1NULA 3H5VA 1NJ2A 3GRCA 2OUIA 1RWOA 1LS6A 2PGXA 3P9YA 3RUCA 1H42A 1RYBA 3ANTA 3B3FA 3QU5A 1E2LA 2V4MA 2B5OA 2O3QA 3ODGA 3U4GA 4DM7A 4LJSA 2OM6A 3UK6A 4GBED 4JP1A 1RCFA 1G63A 4Z1OA 4RSMA 5HIJA 4H1UA 3FFAA 2DGDA 3A05A 4PBRA 4DLXA 2IGTA 1UBLS 2PLRA 3V1UA 2OFXA 4CHTA 1YJCA 1H9AA 4YB8A 2AC4A 2OXCA 3NGMA 2ERYA 1KE1A 5JVDA 1J5XA 4HDCA 4TTVA 1R6DA 4YUZA 1LI4A 1XDZA 2UV8A 3J7TA 3PKZA 4DSZA 3TRIA 1VA5A 4KHZA 5BSTA 4F3TA 1QVAA 1I3OA 3ASVA 3R5KA 3UCXA 1H23A 4R4JA 2WM2A 3HRIA 3IOCA 4Q9AA 1N9GA 4UNPA 1MIOA 2FZGA 2NOAA 4RVUA 1PFWA 5FI5A 2CW5A 2R4UA 3G9TA 3JQAA 1KZ1A 2W2KA 5B12A 4A0HA 4L8FA 5C46F 2BHSA 2DFDA 4I50A 2FSUA 2HJWA 2RHRA 5TF0A 3TIXB 1UAYA 2ZCVA 3DMRA 3CR8A 3TQSA 3TL6A 1I36A 2IPXA 2BFCB 3REQB 4ZCMA 3OZSA 1V8BA 5A05A 4PN3A 4E7PA 4H4EA 4WN9A 3HO6A 2W93A 3RFTA 1JPJA 2MYUA 1YGYA 3Q6IA 3O2SB 4HATA 4FDUA 4N0PA 4MVWA 5EE0A 3ZU6A 5AD1A 4ARUA 3L6BA 4ALIA 1EVKA 1GTVA 1NU6A 4J91A 3R6GA 1J2RA 1SBZA 1YSCA 3QFFA 1F2VA 3HKDB 4EKEA 5I7WA 1JP7A 5KYYA 3OIFA 4M83A 3PXGA 1Y6JA 4AO7A 3Q3CA 4FZJA 5ARCA 4BB0A 4ZN6A 3FXAA 2YN0A 5C52B 1PJZA 2VH2A 3ORYA 4JBNA 4QYWA 4CNBA 4S3MA 4EH1A 2O2DA 4L5IA 2OWEA 4Y0VA 3PDIA 3N0WA 1EFPB 2WUDA 4YCMA 5AVQA 2JLVA 1O8CA 3S2GA 1I30A 3DE4X 4AS3A 4TUYB 5AQ1A 1ACMA 2ZVPX 2LDXA 2NSJA 2P62A 3ACDA 2WIBA 1ICEA 2JIDA 3IVMA 1QO7A 3HDGA 2SHKA 4IKOA 1ZI9A 2ZWOA 3ABSB 4WESB 4LC1A 1U1GA 1CFJA 3M1YA 2X6TA 4P34A 1EH5A 1W46A 5ITSA 3AI7A 3GMDA 3ZY6A 4QLBA 1WPQA 1XHEA 5E3JA 4A5OA 2ZJ4A 2HFKA 2B4RO 1XDSA 1GLVA 1ZJ6A 4BNLA 2NXJA 4QNNA 2IDJA 1RP7A 2NW6A 2IDKA 3QVGA 3N3AC 4WLFA 1XJWA 3MGCA 4M1YA 4ZHQF 2Y71A 3G2KA 3GPDG 3R5XA 4O02B 5ESDA 1WCIA 3LWDA 4P4UA 3MCVA 3X2SA 1Z4KA 2I55A 3SYMA 3O8CA 3H8SA 2XUGA 5BSHA 4C1NA 1TQ2A 1CUHA 4OMCA 3ZLBA 3NORA 5HTOA 4RVCA 5CYFA 4H35A 2VQSA 4F5WA 3PI6A 3MOSA 2IS6A 5KVVA 3UA4A 1CUYA 1SA0B 1T29A 4EEKA 2RI0A 4B3TB 4FTWA 4CCSA 4Q7QA 1FP4B 1KJJA 4ZQIA 1KO7A 1SCAA 1MEEA 2GD1O 2O8FA 3PFKA 5LCXA 3O4VA 3ZY2A 4OBXA 1LCIA 1XFAA 4RVNA 1Q95A 1R6VA 2BFDA 2C4WA 5KQRA 1ZCBA 3AV0B 3GDOA 4YIKA 1T1JA 3OP4A 1M9NA 3DBLA 3OA0A 2AX4A 2HSWA 3ACCA 4HDSB 4I6GA 4IO1A 2QBYA 4KK3A 1E5QA 1T0HB 2CFSA 4Z99A 1TO6A 2AW5A 4QUBA 2JGFA 3WRWA 3C3BA 1ENYA 2QLNA 3N05A 1D2MA 1PWHA 1X3LA 2R5FA 3JTEA 4RSRA 3MWDA 2G83A 5DGCA 5B7GA 4KKVA 4WY8A 3KQNA 5DLPA 5H83A 4JX9A 5JJIA 3M9WA 4BV9A 4DRXB 1E94E 4BYMA 4HRVA 3TCNA 5DHFA 1QFJA 4Z9YA 3ZZ1A 4AFNA 4FX5A 1O97D 3AO0B 1E9DA 2A6PA 4YECA 5JFGA 3FLMA 1GRQA 1NQXA 3F9IA 4OMDA 4AY3A 4QX6A 4JJIA 5KOYA 4Y7CA 3I6IA 4MW0A 1KEKA 3RVBA 3PZBA 2F17A 1XMJA 3KQPA 4D8WA 1W85B 5TMEA 4O1IA 3W2TA 3LPNA 4CZ2A 5DGIA 2V6BA 1Y1KE 2PKQO 2P11A 2EL9A 3IALA 2BR4A 3B1VA 1ESZA 4BLQA 1VZ2A 3FPBA 3BCRA 2PH1A 5M2QA 5HCNA 1HE5A 4MJXA 4HEA1 1T9GR 2NU7B 4ALJA 2XRMA 4DWWA 3PTAA 1YZQA 1GRCA 2E4XA 3H87A 3HE3A 2QRUA 2CLHB 2VAWA 4RTMA 4OQEA 1HQKA 1CZUA 1PR1A 1OZGA 4MGHA 4BWVA 5BO5A 1LF0A 5JTUA 3SZOA 2D0DA 4EARA 1XIVA 1ZXBA 3U0BA 4UTXA 3ROXA 1SOAA 3KUKA 5AW1A 2YJ3A 4XOIA 1B26A 2FRDA 3LKZA 4XYMA 2J0QA 2MJLA 2W2QA 3LH5A 1EK5A 1DQRA 5JUWA 4QRHA 2N0SA 1SC6A 4WXHA 1DARA 1AKQA 2EQ5A 4X85A 2P4HX 4E70A 1DUVG 2YHIA 4NE2A 1JLLB 4LDRA 1ARZA 4GZLA 4GZ3A 2J6HA 3VR5H 4RZHA 3U4QB 3WYAA 3VYUB 4Q05A 3A31A 4F11A 1W8DA 3F46A 2W6ID 3MJSA 5FADA 5KOJA 3ZGYA 5DGDA 3K71B 4KOAA 3P45A 1P7YA 2VK4A 2YICA 4HRAA 5ERXA 3UJ7A 3MGGA 4JKYA 1JIKA 4TLCA 2IQIA 1E1QA 4TLAA 4M38A 3R8XA 3ZE0B 16PKA 1E2PA 3FMOB 3WK5A 4HZUA 4EL0A 4YGYA 5IK2D 4KYIB 4C04A 1GARA 4IBOA 5K8VA 2O2CA 4B4WA 2G9ZA 3L4BC 4LBZA 2NUAB 5FOVA 3WDMA 4CQLB 2VTEA 1KYTA 4OHRA 4DLAA 1XTKA 2BFOA 5IAJA 1FDSA 1TIKA 2DE0X 2CHGA 1Y4SA 1Y89A 2R47A 2WYHA 3FCXA 1G20A 3UXYA 4KPUA 2AFIE 3DZCA 4XVQA 4LX8A 3HWWA 2NV0A 1M76A 1PZXA 3KQLA 1E1KA 4HEHA 1HE4A 3QWAA 1F12A 4Q3BA 5DU2A 2CJWB 1VSUA 1YHNA 3FZQA 3TNDA 4KLNA 3ZWPA 4JQZA 5CA1A 5M7EA 1EVEA 1KDZA 5A03A 2QB5A 3ZE9A 1VZ3A 1BFDA 3THYB 1Z74A 2PAAA 4EF4A 4KDEA 1ULBA 2CHUA 1S3FA 1MO2A 4XB1A 1XG5A 1YQWA 2DTDA 3GUUA 1Y6QA 1K0UA 1ZZEA 3LCVB 4I50F 4IIUA 4Q6WA 2HSGA 3CS3A 4DY6A 3BZBA 5B6IA 1N78A 1QG6A 3JAKA 1XCBA 1OBHA 2X9LA 2EIXA 4MV5A 5E1BA 4DG9A 3D4IA 2JCVA 3T3GA 2RGWA 1DGQA 1O03A 1OCEA 3HYRA 1T24A 2IPMA 2VUHB 1A7UA 3WYCA 1GSIA 5FTLA 4N65A 4RY9A 5K0NA 4C6RA 4U2FA 3FFWA 3DBIA 1UINA 2QROA 3N2IA 3CZ5A 3RVDA 6REQA 5JIBA 3FTFA 3JWEA 1P2DA 4HNRA 3A6ZA 4QJBA 1OBCA 3BTUA 1ZWLA 3EFEA 4H3VA 1JI3A 1WABA 4V3BA 1YV9A 4ZOLB 1BQ4A 4K9SA 3HRHA 2AOWA 2DKFA 4JT2A 3PNQA 3FBTA 3EGXA 3NRJA 3P20A 4K28A 4MA4A 1V5FA 1YR2A 3UV7A 3GJ0A 4MH0R 3ZKAA 2QA5A 3HP4A 3OX2A 3VNVA 3IB6A 1X8LA 4UHDA 3T7IA 3PTZA 1B0UA 3C3WA 1HTBA 4AJPA 3VISA 4YJGA 3F8SA 1BFKA 2B1QA 1FMLA 1PLKA 2VP3A 3LU1A 5J58A 2ZUFA 1O57A 1EP1B 1P3JA 3GUCA 1JEAA 5CA0A 2P2NA 3WISA 1UBTS 2Q9CA 4R81A 1AH2A 4WW0A 3U17A 2W71A 2X0KA 2FKAA 4Q34A 3WLSA 1Z0FA 5EWLA 3ZWBA 2XF2A 1E3EA 1IG3A 4P33A 1WLSA 2XWJI 4O2LA 2JHGA 3EXG1 3V34A 2V98A 1XP5A 3RRNA 2QQGA 1Q83A 2R6CA 2VZ0A 3NCHA 4OYRA 1HLGA 2XUJA 3EQZA 2C2GA 3NYIA 3OH8A 5C5DA 4OXQA 5FA8A 4Y7DA 2ATEA 1KK0A 3CVJA 4PGFA 1N6IA 2C2ZA 4RLHA 1SKYE 1KC3A 1DAEA 4RXUA 4JLVA 4MARA 2Q3DA 3KHTA 5E6RB 1O4VA 3SR3A 3OC0A 5F33A 1BHJA 3IUJA 4EYGA 1NSFA 4L4XA 4Y2QA 1G17A 4FPXA 4ZPJA 4PYIA 5FHQA 3FM9A 1DO0A 1PD0A 2C82A 2L18A 2NTEA 4CIWA 4MWCA 4KITB 1F4PA 5KEIA 1YONA 4PC3A 3VKGA 1KJQA 2KYRA 1YA6A 1I5OA 1FLAA 1TKCA 5E0OA 4AN4A 1DDOA 1SPXA 5BW4A 3FB4A 2WNIA 3CNOA 1TU4A 1MXHA 4QL3A 4HEQA 3FFBA 2D1RA 5IDVA 2JK1A 2FWJA 3O95A 1I9GA 1T34A 2XJ4A 3ZJYA 2P69A 1NJ5A 2AJDA 1XZFA 3E4CA 3VDMA 1PSDA 3NHYA 4F1WA 1M6VA 3FNHA 3ICPA 4EW2A 1OWPA 2QL6A 2Z4RA 6AT1A 3IURA 1X0VA 5K99A 2BHLA 1DT3A 2J9XB 2Q4RA 2IUEA 4D3FA 3SIXA 1HRKA 2ZIEA 1PJAA 1VLLA 1N3BA 3E3NA 3ZHYA 2HIGA 2PSFA 4IQ0A 5ELMA 2G80A 5FUBA 4EIWA 4K9QA 4KVAA 2ZJ6A 4PGMA 4QLOA 3PX3A 2PWYA 1CU1A 3SDSA 3VUEA 4WY2A 3KZ1E 4XW2A 1GLGA 3S27A 4AWBA 1ZGHA 1DVRA 3CVUA 1RBZA 1CDOA 4TVSA 1K8QA 2IP2A 1AK9A 2VDUE 3E27A 3HFRA 4QATA 5JDCC 3OY2A 3QF4A 1UANA 3OJCA 3HYSA 1KEZA 2AFIA 1U90A 2LVBA 3RU3A 5E6SB 4ZCTA 1IUNA 2I2BA 5G1PA 2ZBRA 3QYAA 1CHDA 4YO8A 2IXTA 4L0DA 3THXA 1NBAA 1LJLA 1QH9A 3CHYA 1Y63A 2WSIA 1JDZA 4E3WA 4O2RA 4DA4A 3GRZA 4AVYA 1JU3A 5C8DA 4BJHB 4X66B 5E9AA 5CVTA 1RABA 1U0RA 2TMDA 4Y6LA 3BPSA 3MRVA 1KMCA 3AHFA 4GP6A 1RWKA 4Q01A 2ONJA 4DMKA 4EHAA 4RFVA 3N7UA 4IUBS 4R8RA 5L4LA 2CKMA 3L46A 3NEYA 2B20A 5LMNB 2YW2A 1Q77A 2M98A 4W7SA 1E2QA 1IDN1 3STHA 2FPOA 3GFGA 1SHTX 2H29A 2HEIA 4RGQA 3BHJA 5DOZA 5T4EA 1SBTA 2OV6A 1ODSA 5IBRA 4YYZA 3B2QA 2GFQA 1R4MA 2ZUWA 4CETA 1M0EA 3GEDA 5DDIP 3HUTA 1HOTA 1H0SA 3EVDA 1IVSA 5JJ5A 4IV0A 4EW1A 1U2DA 4KRGA 3JQAD 2VT2A 1SKAA 1PSWA 4PPGA 1O5IA 5T4BA 3TSZA 5JECA 4O3MA 1KQ3A 2OC9A 3IBGA 1J09A 3EFBA 4B7ZA 3FSJX 5CU7A 1D1SA 1XO1A 4YMUA 1W76A 1QP0A 2NQ2C 3ADOA 4W5JA 1N3LA 3IVCA 2PRSA 4LYHA 3ILXA 4OXKA 3QKTA 4RF2A 1OASA 3QV1A 4L74A 2J33A 4N47A 3C4JA 4S1WA 5L6MB 4RVHA 4WZBB 3NAMA 1YRLA 4D98A 4N12A 5JXIA 3R6WA 5CLLA 5AQEA 3BAZA 1F0NA 2Y1GA 4RKQA 4JHXA 2R6DA 3G2QA 2QZ9A 4LISA 2C92A 5FUVA 5IAAA 2VWGA 4P83A 5FI3A 3E7PA 4ZMSA 4Q3DA 5DWDA 3X1ZA 3DNPA 4UE3S 4C7XA 1R0LA 3H8WA 3S5JA 4LI3X 3PXUA 2V54A 3D6JA 1OAOC 1RFLA 3PUJA 3BMQA 1KE2A 1TQ6A 1CJBA 1T3GA 3H16A 2AR9A 3SQDA 2EBHX 5HX7A 1AB6A 4JJ8A 4JI8B 4L2IA 2PU7A 5HYVA 3GFQA 4IJUA 4I3GA 3E48A 1KO4A 1Z56C 1BDBA 2E4ZA 3KXPA 4X54A 4Q3NA 1E2HA 1FYXA 1RQXA 2AN5A 4HWTA 4BB5A 1HC7A 5CA1F 1UC5B 4QEKA 1E6WA 2V7VA 4FZ3A 4RY8A 3ROPA 4ZPXA 4DNFA 4OQMA 3D8UA 4OI1A 1FFGA 1U8XX 2AZMA 3E3AA 2Y1EA 3G5MA 1IRXA 3L07A 4P92A 4OXNA 1E7RA 4F85A 4PG8A 3V4RA 1IK6A 1O2DA 3MCUA 3MRTA 4OGKA 4TS4A 3HBFA 4UULA 1JFSA 3TNYA 3CA8A 4NXMB 1YK1A 1KI2A 4AURA 4RD2A 4LF5B 1P39A 1ZJZA 2DTEA 2O8EB 3PUZA 4MEBA 4PLGA 5ARDA 3MT0A 1AF7A 2JLAA 4U63A 1GAXA 3B2NA 4DN6A 1EHCA 5K9ZA 3CRZA 3GEIA 1Q84A 3VPCA 5HK9A 1FNDA 2QR2A 2HRRA 5EWMA 2ZRAA 4BVKA 3P9SA 2FPLA 4C7JA 1GGVA 5GGYA 2LE0A 3O1HB 2INGX 3H84A 5KJEA 1N3YA 2OQ2A 3WWZA 3VHQA 2YVLA 4OK3A 2QRHA 1RM5A 5IXSA 3V4LA 3MIZA 1FRZA 2OO5C 1XTJA 3NHZA 2MSNA 3GX1A 1IZ9A 5IJ9B 3QUSA 2H17A 3HLKA 4JB2A 4RD6A 3NG1A 4OKIA 1BA2A 1CQZA 3FUVA 2J48A 5DXAA 2B92A 3IMGA 3K9GA 3UC9A 5FXMA 3C5VA 5JRZA 3N8NA 4OHBA 4E1VA 2D1FA 2IHBA 2PFGA 3OTIA 4XSGA 5IMSA 1JR4A 5CA0F 4Y6PA 2ZFUA 3OZRA 2D5AA 3RSFA 2GBIA 4QHTA 2FP3A 3U4MA 2R25B 1XX6A 3W7VA 2G0AA 3HSSA 5UKDA 1C7EA 4G5RA 5KHLB 1ZW1A 3W9UA 1TO2E 1BDHA 1JTEA 2WWGA 5K3FA 4RVGA 3B8EA 1SUIA 1PJSA 5D3MB 1KMNA 2GF0A 1OUMA 3JR3A 3UMFA 3G0CA 2ZRHA 4O4JB 2AC7A 1W2GA 4DZTA 1UT5A 5B3AA 1RYMA 3D2AA 1C0IA 2GCIA 3G59A 2ZSJA 3D31A 3MAGA 2NVUB 2PD3A 5D5PA 3CVYA 1C7ZA 1LQ2A 2WD7B 3Q3EA 4RQAA 4OAQA 4J0CA 2F9MA 1V0JA 1SN7A 2BCJQ 2NV2B 1JEOA 5C8YA 2O52A 5JMPA 2CUNA 1IMJA 2W37A 1V45E 3SQNA 2FPGB 3JVEA 4L9SA 2VOJA 1W1WA 3DL2A 2JANA 3K9WA 3V2GA 1J24A 5ANRB 5ALLA 5LBUA 3RVNA 1QH8B 2F43A 3T06B 4A0RA 4BVFA 4F2GA 2FVYA 4OV6B 1D2HA 4WI1A 1R0RE 2VUSA 1ST2A 2XXJA 3D6TB 1Z33A 2RGNA 4RHXA 3I2HA 1FXWA 3C5HA 2B8WA 5HE8A 5BYJA 4UEKA 5HEKA 3V9PA 4RPCA 5DNCA 4DV4B 1YWGO 4XCVA 2PT9A 1Z6QA 1ES9A 1Z4LA 2M1XA 3DEKA 2VYCA 2AXEA 1JQEA 3MQFA 3RVRA 3GRPA 2EGGA 3UAVA 1PBTA 1YUNA 3GMIA 4X1KB 4B8WA 4MB6A 1UCFA 2EKDA 2LD4A 3L0YA 3N53A 1TQ4A 5TPWA 4MVJE 4YUAA 3THWA 2DPXA 3SC3A 1LBQA 1L5VA 3DV0A 4HYQA 1IN4A 2RHWA 4EGQA 3SVLA 1NMZA 3QY0A 4XVHA 1TYDE 5CTJA 3KR0A 5EP2A 1A2OA 4ACAA 3B82A 5IG2A 3RU9A 3KYCB 5EA2A 3DVLA 4AZTA 3DOCA 1N2XA 2UDPA 4R6XA 3I4CA 3E0XA 3BZUA 4ZDWA 3K1AA 2CEKA 1U2PA 5ALYA 2EJVA 1M2HA 1V48A 2J9FA 1OLXA 4U7TB 4ANFA 5JD4A 1U7XA 3UW1A 1X86B 4RPGA 1E1QD 4KLRA 3ZCSA 3HYNA 4ER0A 1YZNA 4KQ2A 3U49A 5L40A 2HRCA 2BP7B 2A5JA 4RF4A 4RWEA 2CCKA 4GMHA 1JKJA 3D6AA 3ZHSA 2ZYGA 1P60A 3IERA 2B9VA 2PD6A 4JOSA 2WHPA 4GX2A 5SYMA 1G38A 1SK8A 2B4KA 3V4FA 1VI5A 4I8IA 4RVOA 3V8QA 4IG9A 3Q5DA 1KIFA 2QORA 1XLWA 1QLWA 3NLLA 1NGSA 3HO1A 4HZIA 1KMMA 4ED9A 1AK1A 2P0YA 3X1WA 4RPJA 4CEJB 4QPCA 5KC8A 3OUTA 4LHSA 1NMXA 3G82C 3RYCB 1AA9A 4U2CA 1C4XA 1E96A 3I76A 4Z1MA 1K8ZB 2WICA 2CE2X 1J8MF 1JIJA 1VBKA 1W5EA 3BRWA 2QN6A 1DBQA 2DETA 2Q8PA 2YQ5A 1CVIA 1EFCA 3BIWA 4GOOD 4RVSA 1J70A 5CPFA 5K03A 2MTBA 4HDNB 1ULSA 2HMUA 2QL9A 4PZLA 5FOQA 2A86A 4BFCA 3GLIA 4YBZA 1DTEA 1UDXA 4G1FA 1I0IA 2N1BA 2Z56A 1NSTA 2JFBA 2JFZA 4G07A 4NENB 2IS2A 1U02A 1WD5A 5FOSA 3NWPA 5CLGA 3UNXA 1C3OB 1Z2DA 4U9HS 3AU8A 2NTJA 3NDPA 3IDSA 4U4AA 4U7FA 3JZIA 5LLDA 1IEQA 1ZI8A 4MLDA 1T0UA 5LDGA 3O5AA 1XE3A 1WBBA 1H94A 1ISIA 2YV2A 2QAGC 4XVRA 2I1WA 5G4LA 5K51A 4C4YA 4CKWB 2QMQA 4FI3C 1QE5A 3O4HA 4HYYA 2PX0A 2WJGA 4R71A 3WNCA 3D0RA 4FK8A 4HGRA 1MB9A 1XCLA 3WLPA 4AX4A 5I5GA 4XR9A 5CCEA 2JZOA 4G9EA 1V35A 4WZ6A 1NF3A 4BE9A 3NU1A 4JQSA 5JLAA 2AWOA 1FYVA 3INGA 4YAWA 3O38A 2G8LA 1UWLA 2X9NA 4PG7A 2GO7A 3WIOA 2IFTA 3CVVA 3QTLA 3FFXA 1A9YA 1DBRA 3C39A 3GRUA 4NBUA 4WZZA 5AYVA 4OUDA 3DAFA 4B3BA 5CLFA 4AY2A 2ONKA 2ZSFA 2H7YA 4M8SA 5L3RA 1Q6YA 1SKBA 2C0PA 1DG3A 1HLDA 2YXLA 5ENDA 3G7NA 3ZV3A 1RM0A 2DUJA 4X41A 1BU5A 2FPIB 4EATA 2CVZA 1U0GA 4W99A 1NN3A 1XL0A 4IIVA 4JDUA 4P5DA 4H08A 2FJ0A 2J3IA 1ZD8A 4GICA 1JHUA 3GQBA 2CXSA 3LQKA 2WA1A 1V9SA 3HDYA 4ZD6A 1UK6A 4GDMA 4JN6B 4ENTA 3WFJA 4MV9A 4FGUA 2NU8B 2WEKA 3PGKA 4Q4HA 1DWPA 2QTAA 2R97A 4M4SA 5LA6B 3AEYA 3LSTA 4N7RA 1ZRMA 2AKYA 2WTNA 3JW8A 4Z3OA 2QLTA 4IIDA 1DX4A 2Y27A 5J47A 4LBVA 1ECCA 3TX2A 4OQYA 4DPKA 3WBFA 1V4BA 5DM60 3PT9A 3R6TA 4FUQA 4MVJA 4IZ6A 4QU0A 5DTJA 3GGOA 3PC8C 5CLHA 3L49A 1UQRA 2ZK7A 2ZUEA 1WCV1 4XIYA 3A3OA 3LBFA 1MQ8B 4GAEA 5C3UA 2LP4Y 2QUKA 1H5QA 3BCHA 3GT0A 4C4XA 3VHXA 4G4SO 1HDYA 1O89A 1VKOA 1S2GA 3YASA 3PL5A 1ZP6A 2J85A 1TJYA 1FQWA 1RLMA 2YZGA 2PR2A 2EF0A 4N82A 5CEJA 1OC2A 2WJAA 3E7WA 4LDNA 2PKEA 5K0FA 2EKQA 1ZIYA 1ULUA 4LVOA 2VI5A 4OHXA 4JJKA 4R3WA 4FDAA 1OBVA 2WT9A 4Q1VA 2QR3A 1ZGGA 3BMOA 1E4VA 3G5UA 4J9VA 4HL6A 3T7CA 3UICA 3WL4A 2DBQA 1QAMA 1YZGA 3E9MA 3B53X 4WUTA 1RC1A 2ZYAA 1VLQA 3Q98A 1JSXA 3NC4A 3MS7A 1V4VA 2QYHA 4QAQA 4UVDA 4AJ2A 4ER3A 2R2GA 2Q3JA 2IY7A 4KIFA 1M5RA 1R9MA 5DHUA 1Q0LA 1Y4UA 1ISGA 1WMEA 3F6CA 5KQLA 3HFJA 1JKMA 1AU9A 5THKA 2FLWA 1PYOA 4C78A 2H31A 3OEED 4RDHA 3MTJA 4BZWA 2OBLA 3ZCRA 1O08A 1NXTA 2UYQA 3PC3A 1Z7GA 4MROA 3DWFA 2QVBA 5EQDA 3Q2IA 1P0IA 1UEIA 5EOVA 1WVIA 1J0DA 1PO7A 4J0EA 4BUJA 4TKUB 3H2KA 1QTQA 1IHYA 2DG2A 2WHXA 2XWSA 2QYTA 1PR3A 3A9SA 3K09C 3VR4D 2PKCA 4R5MA 5EN4A 4F3NA 4CQJA 2IDZA 2CNNA 3QMMA 4DMMA 3VI4B 5SZKB 3AJDA 1E1CA 1FXWF 3ILHA 3ZQJA 2OZVA 1SU8A 1EVYA 1NW4A 3ZBTA 4RPKA 4AB1A 1TJPB 1AXGA 3ZDYB 4QGFA 4DPMA 3BA6A 2Q21A 4YMHA 4BPBA 1UFKA 3SHVA 1NDQA 1UMCA 1ZIDA 3WLMA 1GZ7A 3KM0A 4JL8A 4BO4A 3NVMB 2Q50A 4LYEA 1C50A 3HJRA 5LQJA 1RLOA 3ZCXA 2IYNA 2BEUB 4J3JA 4FWBA 4BXOA 1CS0A 1Z7YA 4RIIA 1U9JA 3A9UA 1ICIA 5ICGA 3E7DA 2WU0A 2OZPA 3QRWA 1BDJA 1R0KA 1SU4A 2FWBA 4QUAA 1XNQB 3DTTA 4RNCA 2QRLA 3QMWA 5F3DA 3ED5A 1WKVA 3ME5A 4MO2A 2R4TA 1TCUA 4DT1A 3VJRA 1YKGA 2YFKA 4NNPA 5KKNB 1RYZA 4GI2A 4R1OA 1J1UA 3AUKA 1N5RA 2A7XA 2GX6A 1OXUA 4CV1A 3GU3A 4JYAB 4UARA 1UUFA 1GUFA 3OE5A 1G42A 1WG8A 2HWUA 1AQYA 4ICIA 3NZEA 1WO8A 4FGJA 1FFDA 4L57A 3WZMA 2H7XA 3KFLA 2C4UA 3KQMA 4CLOA 1G4UR 4BPRA 2EZTA 3L84A 5F51A 1K5GA 3PFHA 1SIUA 1S3IA 2MHCA 3LQ1A 4FYVA 3L8CA 3CW8X 4PZ0A 2Y1LA 1J00A 3PQ8A 2DJ5A 1RXUA 1E0DA 2XVZA 5F2KA 1SVLA 2WFMA 3WK9A 4AD8A 2PVCA 1JKFA 3F2IA 3I72A 1FIUA 4O25A 3C3KA 3VVMA 1CX9B 3T61A 1YR3A 3OFJA 2JKYA 5EKXA 1FYFA 3B9QA 2C0CA 4J6FA 3G2OA 4MHSA 1R66A 2HRQA 5EJ8A 2P2LA 3IIIA 4EUNA 2IHYA 4DBVO 5KDDA 5GP1A 2ID7A 2FQQA 4I5GA 1WEHA 2PFKA 2R7MA 3I9FA 1L4YA 1F8XA 4EGSA 1CJKC 3A3PA 4WNAA 5K01A 1SVWA 3MWLA 1F8FA 5C35A 1ZGBA 2C2HA 2ZU6A 3F7MA 3EH1A 4XB2A 4WAUA 2OHXA 1M66A 4RX1A 5EMJA 3JQBA 4AC9A 1ZGCA 4HC4A 2PANA 2RIRA 2HV8A 3LW8A 1WAMA 1UWCA 4K1LA 2OSBA 1R0SA 1GTL1 4GMKA 4KYVA 2B0CA 2XWQA 3U3OA 1MMFB 4LWQA 1D1TA 5AUQA 1A77A 1ADJA 2BGTA 2B25A 4FHZA 2ZM6B 1J0AA 3D3KA 4TVBA 1W5SA 1W4AA 3RRXA 4EMTA 2PVSA 1E18A 3JPWA 4P3XA 1SOVA 1NP6A 1QDUA 3TDKA 4BX8A 4UM9B 1E1RD 1MTZA 3FOCA 4HGYA 4MVJM 1Y8QA 1C7FA 1OAKA 3FSGA 4MCIA 4X3PA 1N2JA 4GS5A 1NVBA 4P1ZA 2C8VA 1C30B 2HC9A 3HU2A 1U2EA 1F8GA 1K6XA 3NPAA 3R7FA 4BBAA 4ABTA 2H2HA 3K6JA 2A88A 1ZO8A 1OPXA 4PANA 4O33A 4UEWA 3DGFC 1MGPA 3HCNA 1QO0A 2ZYHA 2OFFA 3ONFA 4ENVA 3HNRA 4DF3A 2X4LA 1T1EA 1X42A 2J46A 4XKJA 2O3TA 3F98A 2P91A 5AKJA 3AJAA 2GCOB 3AIMA 1GGKA 3H05A 4D0RA 5IT4A 1OH5A 3BFVA 4GQAA 4RTOA 2P7IA 3FTEA 3QELB 4WDRA 4LFBB 4LXQA 2OHVA 2OV2A 4GL4A 4TLMB 2O6LA 1HGXA 3DKRA 2X0FA 4QYIB 5F2NA 3KOYA 1TJ3A 3ETDA 3LIIA 3ND9A 5K0TA 4ZEOA 3RJ9A 2AZTA 3QYJA 1OTXA 1E1DA 1O94D 3I5XA 1CJVC 3RO7A 2EEPA 5CYGA 1SCIA 3A1EA 4MYUA 4YMGA 2R8XA 2PUAA 4REQA 4MVJF 4QG3A 3QEOA 3N2NA 3LHIA 2ZU0C 2GS9A 2Z3WA 3C6ZA 1KGDA 4MUAA 3ZE2B 4XYLA 2JB9A 4DNOA 1DKMA 2IW1A 2HCRA 2HZ7A 3T5MA 1NBEA 1E20A 5CB4A 1TZKA 2JJYA 3NDRA 1RKUA 3R23A 2A94A 5MGNA 2RG1A 3LKBA 3MXOA 3O91A 2CZGA 3AVOA 3IA2A 3BQNB 3DCJA 4KXWA 1JQBA 1HG0A 3O8DA 1J56A 3TN7A 5E8RA 4D46A 2R48A 2A9QA 3I83A 5D6NA 3ZZMA 1KMHB 1LTQA 3ZR4B 4U2GA 1PVDA 3KBBA 1GPAA 3Q41A 1ZOOA 1WDWB 1GVHA 4GYKA 3ROZA 3P19A 1QLHA 3HFGA 4NARA 5DBFA 2FMIA 3PR3A 4BZQA 2HCBA 1OJ7A 2W00A 1AF4A 3E1KA 3RLIA 2EJTA 4Y9SA 4B0PA 2O5CA 2MMCA 1J25A 4JKIA 3UMMA 2NP7A 1X1QA 4S12A 4AJEA 1RBQA 1L4KA 4BO2A 2W4MA 3TS1A 5JH7A 3P0RA 4P9NA 4AUMA 3EVAA 2PGIA 4CR6A 3KQTA 4M7OA 4JI4B 3CSDA 3HZOA 4EG0A 1EU1A 2IE0A 4JEIA 2I78A 3ASYA 3OLWA 3PX2A 3JRNA 1HH4A 4Z51A 2HMSA 1VP9A 4D8TA 4G1BA 5A7GA 4D6PA 2JH8A 3QVWA 4BMCA 4NYJR 1NG1A 3S1LA 3QEJA 4RACA 1Q7TA 4CFSA 2IH5A 2X8JB 3ZG6A 3RR2A 5MN4A 1WUHS 3DO8A 3ZW9A 4ZTUB 3DF7A 3NT2A 4L08A 1ML4A 1YTLA 1K63A 5EEGA 3RSLA 3AEQA 2C3OA 3E9RA 1GG9A 3D3QA 3TAUA 3ZGVA 1CUIA 1U7HA 1UIMA 3WBBA 5JS6A 2XEDA 5IEBA 1NR7A 2WHEA 5JYEA 3IKTA 1FU4A 4CTMA 4JX8A 3Q0IA 2CVOA 3DHYA 1PD1A 2BM1A 1JA0A 1KBZA 1CY0A 2ZBGA 5L3QB 5EZSA 3E8XA 3KALA 4CWAA 3PRHA 3OQBA 3IDAA 2BTQA 1MTOA 2ZLBA 3BRWD 4Q24A 4XGKA 5BVHA 1CDZA 1TUIA 1Z13A 4FC7A 4Y6RA 2X2FA 5AW0A 4PX2A 2OHJA 4BJ1A 1AKRA 3OPYA 5KYVA 1JIQA 4R2IA 3T94A 2IU3A 3EZFA 5KJCA 1WMFA 3WYNA 4RTSA 1U5AA 1H4SA 1REQB 3CGGA 3T3IA 1ZBQA 2R1VB 2IL1A 2YNMA 4DJ5X 1Y3BE 4M1OA 1NRWA 3U9TA 4XX1A 1IN6A 1Z22A 4F12A 4YRBA 3SJZA 4K6CA 5JFTA 3ORFA 3W6PA 4RC9A 2O0MA 3T9BA 4ZZIA 4BNWA 4Z8YA 3DDUA 4D0NA 2ECQA 3JWJA 1A5ZA 4OAOA 1KETA 3CXRA 4NONA 2VDNB 3DVQX 3ROQA 1F5SA 3SHFA 4CNQA 3T1OA 5DCUA 1PFKA 2NACA 3AUXA 5FBRB 2R8RA 1DV2A 1MFZA 1QCZA 1Z5NA 1ENZA 3M5PA 4M88A 4V3CA 4U8GA 5CIQA 1XF9A 4IDPA 5H59A 2HK6A 2CL0X 1WW3A 3ADPA 3CEMA 3QOYA 3RHFA 3PUWA 3QXSA 3S44A 5GINE 1LDNA 3E3MA 3EH2A 4F45A 4G65A 4RDIA 1OZFA 5KPDA 4YRRA 5K6TA 4EM6A 1W5BA 1WU8A 2GEBA 3I32A 1GN9A 1ZINA 1W9HA 2WUGA 2LDBA 3IILA 3PYMA 2J31A 4IZHA 5IT5A 1YUBA 5B6JA 1Q20A 4BE4A 3B20A 2XEXA 4IJ5A 5C32A 1CRPA 5EUCA 4JNCA 2V8OA 4H7HA 1A4RA 2NUTA 1HK7A 2A0XA 4J4HA 4KFUA 4LPKA 3AM4A 3NV7A 2HYDA 1T35A 3O3NB 4OHMA 1U11A 3EOAI 3LL4A 3A1NA 3H8JA 3ANYB 2W43A 4BQOA 2V3CC 2VPPA 2HGZA 2JK0A 4IJMA 4DLTA 1HZZC 5M3BA 1TCCA 1F4LA 1VSBA 3BFXA 4OFBA 4RDXA 1PDVA 4YRGA 2VP2A 3L1UA 1ECGA 2COUA 1EXVA 3L7AA 5TR9A 5T4FA 1EFKA 5I4CA 2OBBA 1BQ3A 3EGDA 3A6JA 3D54D 4MCAA 4WFJA 5AM2A 5ED4A 2OESA 1C9JA 2XMQA 5CDTA 4ZHQB 1G8GA 4E4YA 4YAJA 3G23A 4IOLA 3AX6A 2KBFA 4Y9TA 1HUQA 1WJGA 1C8BA 1J0EA 4IOMA 4MVJD 2GXUA 4AZ3B 1KJ8A 5F7JA 4A6DA 2UYYA 5K3AA 2AN1A 4DUPA 1CQXA 3F6RA 3TQCA 3IBCA 3HKEA 4EHNA 2HO5A 1V43A 4REMA 5K09A 2DFLA 1T3ZA 1T6BY 3COVA 3PUVA 1TE2A 1RWQA 1JQAA 2CVQA 4JI3B 1WF3A 2FEWB 3CW2A 3WGTA 1KSGA 5AOVA 3UHOA 1WXGA 1YOVA 1E99A 1N5IA 2Q1SA 2QN1A 2GD0A 5ECYA 3O8OA 1WPXA 2CGEA 2WYOA 3MSCA 3SZRA 3KJXA 1L1EA 2ZI5A 1PL6A 1XAGA 3G8YA 4LJLA 4BLUA 1P31A 3BMNA 5DX0A 4UDXX 2XMRA 3E5NA 4LNUA 1WXHA 2V0NA 3I3OA 3NHPA 3OQ1A 3IT0A 3PCXA 4AIRA 3KSBC 3W90A 3BCSA 1MAAA 4HWOA 5LKAA 1CR4A 3OUUA 2P8SA 1EFDN 4ZT2A 3A2NA 5HQJA 4D79A 3CB4A 3RNOA 2CDNA 4NBTA 4YCNA 4L78A 3PFBA 3K9NA 4DR2B 3OE7D 1TYAE 5EP1A 1EK1A 3ZCPA 3JQ8B 1W34A 3D7NA 3RFVA 3GLHA 5E1MA 2F2TA 4L85A 3PLNA 4YMTA 2I71A 4YRLA 5SZHB 2OG1A 1YDEA 1A95A 2CUZA 2JRLA 2JLYA 1MW8X 3E58A 3G89A 3HTXA 2QTRA 4YUXA 4F3KA 1JHRA 1U3WA 1I7QB 2JLRA 1UKYA 1AZSC 3I39X 2VFAA 4Q4DA 2OBXA 2NNWB 3HXMA 1Y1TA 4RLSA 1CEXA 4Z4IA 1RE1A 2BTOA 2CFTA 3WWCA 2WE7A 3QY9A 4HQNA 1K8YB 2GOYA 2CNDA 3DOHA 5JD3A 4Z7NB 1Y3DE 2Z5FA 4F2HA 5CB4F 3T3OA 3VZBA 1ZMTA 4WVLA 1UKBA 4EY6A 4KWHA 3KBOA 3L1JA 2QAGB 5JPDA 2JRCA 5FTMA 1THGA 1QANA 5F7OA 3QBEA 2ZRDA 4OKSA 3RVKA 2Y8EA 1M1UA 3R09A 2J67A 4J03A 4RETA 3D8TA 3VPFA 4QTYA 4EYSA 5GIOE 5TIIA 1SXQA 1S5PA 4GVPA 3V42A 1TQHA 1Y4ZA 3GG9A 5DM1A 3SZUA 4AJ9A 3LE8A 3N7AA 4D96A 3WLHA 1TT5B 2E85A 3LI2A 1ZOIA 4DLYA 5HZKA 4KJZA 2EWMA 2EW1A 2QDKA 4C7BA 1DQSA 3BFPA 3CJRA 3DZBA 1BROA 1TJ5A 2I8CA 1CUGA 1SRQA 4Z7JA 2NO0A 3ONVA 5JH7F 4UXHA 3L1VA 5K7SA 3MMNA 3OLZA 3FPHA 4JASB 5BNZA 4XSHA 1TF2A 5DBIA 4MINA 2QRNA 4RLQA 4E2WA 5DX8A 2BRUC 3WRYA 4XDZA 4R3UC 1IBRA 2EDCA 3IHKA 3CEPB 3IXMA 4X7BA 3SS7X 4R8LA 2Z4SA 2AUTA 2WA2A 5EFOA 1G8FA 3I28A 4GGPA 1WETA 1CUXA 4LZLA 3V4ZA 2BOVA 1XN4A 4LJ8A 1E8NA 3K9FC 1ISFA 4Q4AA 4XLLA 4BMSA 3LUFA 4ECEA 3D2BA 3HDJA 5JZSA 4UFOA 4M9CA 2ECPA 1ZITA 4C0BA 2ORVA 2OCXA 3VV3A 2PMEA 4B3MB 3V00A 4BS9A 3FNQA 4L76A 4PTYA 2GBLC 5IFKA 1PJ8A 2W6OA 4JLKA 4F4JA 1MH9A 3AIIA 4ZYXA 4L5JA 1RBYA 2N75A 1N8NA 2Q6KA 4ER5A 4MKZA 5CH3A 4PM4A 4PV7A 3P2OA 3VVCA 2VUUA 3L6EA 4DUZB 1XDWA 2PGLA 1T9CA 3LQ4A 5AI5A 1GU1A 1K7SN 2BR3A 3EDCA 1FRVA 1YE5A 5F2EA 4C88A 2IV3A 1TZJA 1IULA 2O4UX 1I14A 3FI0A 5G0WA 4EG3A 4XIJA 1Q3KA 1R0ZA 1MBZA 1Z0JA 3GEGA 3RUPA 4X8OA 4EB6B 5KYGA 3NBAA 1U4NA 3HVJA 4KQGA 4FLEA 4X61A 3C6XA 3KDSE 4MUJA 4ML3A 1T3TA 3PXAA 3BUSA 4GFDA 3W4IA 3OHSX 4YQYA 2JLQA 1M8JA 5FUYA 3C3MA 2NZVG 4RL6A 2F8SA 2QPLA 3KRTA 2R6GA 4U8HA 2PLAA 2ZT6A 4OJMX 5D01A 5HF6A 2NPIA 4D45A 5EJFA 3NC1C 1Z0ZA 1LI5A 4QJ5A 1Y8CA 4P4NA 2RH8A 2JEYA 3ZDZB 3HBLA 5C5CA 1UJ4A 5A0FA 2YS7A 3FIUA 3L6DA 3EXHB 2Y99A 4YROA 3ZYCA 3FOFC 3HB0A 4MV4A 3DLHA 1QGDA 5JMTA 1I6WA 3D0KA 3GD7A 4P5EA 4PEVA 4R8MA 2G82A 1GN8A 3IEUA 4MV0A 5C9ZA 3FSGD 3DEHA 1LDBA 1W5FA 5E95A 5DNUA 2CD7A 3UH1A 3RJZA 2ZXFA 2B7LA 2RKBA 4D9JA 5FNZA 1OLSB 2PQ0A 4F9EA 2OO3A 2L69A 3ZV4A 1N0IA 3WLTA 1G21E 3CJTA 3GHHA 2HADA 1XPJA 1CY7A 1AS0A 1G3MA 4YP1A 5JCOA 1DQYA 1QO0D 4XXHA 2N42A 3RFCA 4D0GA 4F91B 1IN7A 1SXPA 2V1UA 1WUIS 1TLTA 4XDYA 2W8BA 5F98A 1IZ8A 4MP3A 2F6RA 2JIZA 3P8ZA 3E2PA 4X91A 5E2BA 3T41A 3WLEA 1ECPA 2GHQA 2A78A 3HLYA 3IPXA 1BYIA 4HWSA 5CYPA 4HGNA 2OBFA 3FUCA 4URWR 3BGIA 3PNSA 4K26A 4R40A 4DCMA 5IZ4A 1NLZA 2VTBA 1D2AA 2E55A 2YWRA 2H4JA 1E0KA 2IYSA 1PR2A 1GNTA 5KSWB 3MOIA 1GPUA 3OZDA 4I9HA 4OQ4A 3BX1A 2ZR0A 4HY3A 5FULA 3G9ZA 3PXBA 4FEAA 3ZU4A 2PZMA 1PKEA 2W58A 3Q9LA 5REQA 5CFNA 1NM5A 1N5JA 3ND6A 1RYEA 3BEOA 5ENVA 5HK8A 3DMFA 8ADHA 4H27A 5A3JA 1QPZA 1M2EA 2YVUA 3L7NA 3M6MD 4LZAA 4MVJH 1OWLA 2R5NA 3O0TA 3ZCTA 5AIBA 5IDQA 3DYBA 4X60A 3IQZA 3IUMA 1NXQA 4GUDA 2H1VA 4NJEA 4UREA 5FPTA 3A1SA 4FR2A 4LA4A 1XEWY 2R7NA 3IHTA 2WOOA 3GFRA 3P7MA 1QORA 4XEUA 2WYIA 2FG5A 3RYFA 2J3EA 1BQEA 2VNJA 1HDRA 3L3BA 3L1KA 3QKRA 1K75A 2QTGA 4GPD1 4NE9A 3BTOA 1SD1A 2AMVA 2FGKA 2UZ0A 1Z6TA 1GAWA 4HDRB 3DBLB 4JS0A 5EC8A 4E5YA 4E5DA 2R1TA 2UYOA 3H5NA 4QTZA 3X43A 5HS4A 3JQFA 1KH2A 1F2UA 4MW4A 4HOYA 2Q27A 3PDHA 4KUGA 5AH0A 4TTTS 4Q7KA 5BUCA 1NQ5A 1G98A 2P9FA 3GT3A 3MLBA 1DFHA 1NTOA 3O3CA 5DV9A 2CYAA 2FE1A 1XTQA 3FZNA 3I9JA 4FFPA 4TZKA 3MZ0A 1S1CA 2YZ7A 1L4BA 3WKEA 3QLVA 2CUKA 1ZDMA 2UVPA 5D6OA 3LTNC 4EI9A 4KN6A 2H07A 4LDAA 3TRHA 1GGNA 4QXOA 1T5IA 5IDYA 4OQFA 3FCUB 4H1HA 1Y7HA 3JQ7A 1E9RA 2C5HA 3EVFA 4RGBA 5MF6A 2ZIVB 4YA6A 1F48A 1DUSA 4A2PA 5JWOA 3EC7A 5LQCA 4UM5A 3AEUB 3JD1A 1A2QA 3EDOA 5H81A 2YRXA 2K6GA 2NSHA 3RVJA 4B8YA 1GFIA 3LX8A 1DP4A 3PKIA 1IUKA 4UNQA 2BUAA 1YKFA 1WVGA 3DMTA 1CQIB 1WCWA 8LDHA 1Z83A 2IHKA 1EK2A 4GYJA 2H5EA 2A1UA 1O6CA 1N2GA 2JVKA 4KXXA 4OSEA 4AXBA 5JAHA 5JSFA 3VNAA 3SLKA 2A33A 2K2QB 3VMFA 1FY2A 1Z7EA 3PR1A 1EB9A 4XWWA 5SZJA 2CL7X 2D54A 2FOLA 1QYWA 4H1VA 4PZDA 3EBOA 1RMTA 1KO5A 3OKCA 1IVYA 2B6NA 1DLJA 2E6KA 4Y2RA 1U94A 3VSDA 4R1SA 1H6BA 1WULS 1ZSNA 3LK7A 1Q5PA 5H7XA 1YAHA 2BDUA 1Y1PA 3IJPA 2BH2A 3EXFA 9GPBA 4GOND 2PRYA 1QE0A 2Q3LA 5K0LA 4TLLB 5LQSA 5P8WA 4B4KA 3QEBZ 1VPDA 3DBHB 1C7RA 3NEPX 3TE6A 2QDXA 3PVSA 4AP6A 4ZRDA 3F5SA 4K8OA 5H16A 4AJNA 1SPBS 3OWXA 4KKXB 3PNKA 1RPAA 3VO2A 1KF0A 4R0VA 4TT3D 5IZCA 4KL8S 1QGED 2QU7A 5JXHA 2YNMD 3HCWA 1Q7EA 4M86A 4F5ZA 4PNEA 2GN4A 1L4UA 3SXUB 1YFLA 3PD0A 2ZRFA 1FL9A 2HI0A 3FGZA 4NY1A 3RT1A 3PICA 1SUPA 3GZNB 2EFEB 4LUCA 4E5UA 7REQB 2JGIA 5HGXA 3CE9A 2JBAA 5ECGC 3DB1A 5EI5A 5CLQA 3IQIX 2HPHA 1JKIA 3Q7EA 3AHJA 1Z6XA 1HQDA 1SBNE 1UMBA 3C43A 3I9MA 2XGOA 3F7TA 3PQ7A 5BRNA 4CMAA 2E4WA 1NJ6A 1EP3B 3H0EA 1D4FA 5C51B 1U0LA 2VJQA 1G5QA 2XD9A 1A98A 2PV7A 2Y93A 4HGZA 2VNHA 3OQIA 4O1HA 3ZTWA 3MS2A 3R7WB 2ZQZA 3WKCA 4EABA 2YOHA 8ATCA 4HEA6 1K97A 1K8RA 1U0FA 5ALTA 2DPMA 3R5FA 2ALJA 2BELA 2FX2A 1QOQB 2IHVA 2IXAA 5I9MA 3BZWA 3DE5X 4FBGA 1G6OA 3CVOA 4LK3A 4CGZA 1QBGA 4Y6SA 1MVNA 4Y6GB 2NSLA 4KO2S 1T1RA 3KAPA 2IWHA 3S7TA 1FUUA 3ZHOA 1JPVA 4Q4CA 1U7DA 4PLFA 3DE2X 3P5SA 5CW2A 5HR5A 3B3QA 2YDYA 4PBTA 1RAIA 1DL5A 3NP9A 3W79A 3HXOA 2EFYA 2CMGA 3IPYA 4Q6BA 3V1MA 1VDMA 1TZ2A 3BE8A 5K1ZA 1AQNA 3MA0A 1E6KA 1C9YA 3LC7O 2K87A 3SIPA 1U2QA 7ADHA 3C4QA 2CDRA 3O83A 1Q0SA 1ZGZA 4PQRA 3WDKA 5KX5A 2BHNA 1TECE 5FOXA 4Q4JB 5DYNA 3RFUA 2IYEA 1WM1A 2P1ZA 4J1QA 4N8EA 4FOOA 4RA6B 5DYIA 3SJUA 2YN4A 2KE5A 4GBMA 4KFRA 1W581 4ZO8A 4D8YA 3C7KA 5CXSA 4LI0A 1KEPA 3UW3A 2PEYA 4M0PA 4PAOA 3AY6A 3WQQA 5IJZA 1PFQA 1E79A 1QONA 1TQ8A 2CLDX 4WK0B 5IUNC 3NOQA 2J3MA 4K9PA 5FNVA 1BMQA 4C4PA 1UXHA 3RJMA 5C31A 1VLJA 3IUQA 3TMYA 3X1MA 3KB1A 1XTBA 1R0WA 3D6FA 4PHTA 3K92A 2II6A 3AEZA 3EZLA 3QU9A 3K05A 3SX2A 4ZGGA 1IN5A 1EUYA 5TQ2A 4LJ6A 4GLBA 2P5SA 2C5AA 4QECA 3PXCX 1TDJA 3OPVA 1DJLA 2DU8A 2ZDHA 4W82A 1WCYA 5TC4A 3RUDA 1ZUNB 4DDWA 1U6JA 4X3OA 2HL6A 4CL0A 4EPVA 2XQFA 3G2MA 2XVXA 1XCPA 2VNKA 1XMXA 5DNEA 3CLHA 4OHYA 1T9AA 2ZRLA 3P27A 3U4HA 1WDKA 3BM5A 1KERA 6ADHA 5EHXA 1NSYA 4TM7A 1VOTA 4WXYB 1UZNA 4FU0A 1KZ7B 1LPMA 1U3UA 2FDXA 4MUNA 4YQFA 2LCFA 1FSSA 2V03A 4L7QA 4O0LA 4ZVNA 2DQZA 1A96A 4II2A 1T8RA 1VA4A 1MUUA 3L7MA 4KDRA 3U44B 1GZUA 3AP3A 4EEZA 5JADA 4I5EA 1J49A 1GKIA 2GLXA 4G0YA 2FZLA 1RJGA 2G4CA 3NT5A 4IXMA 3GDHA 2AFRA 3QHPA 3P94A 5EXXA 4B31A 4BP9A 5ALUA 1YI1A 1VMDA 1CG6A 2HBRA 1JDJA 2QQFA 2VZEA 3K35A 4ZVPA 4YXWD 2ZTLA 1ADBA 1XJ5A 4FQ8A 1XYGA 2QKYA 4LNHA 3F78A 1X8KA 1H05A 4Q9JA 1B8VA 3VJLA 4HLNA 3WXMA 4GPZA 4E5SA 4BY9E 1Y4DE 3PIIA 1U9IA 2OEPA 4IGEA 3PA8A 2P2CA 3JTMA 3GYBA 1QX3A 1UC8A 4I9FA 1NKVA 3H9GA 1MG0A 2XA2A 4GP9A 4B35A 5CBPA 3MNFA 4PLPA 2QTHA 3GCZA 4KR9A 2H5IA 3WB0A 4KZKA 4LGMA 3D4BA 5G0SA 4H7DA 2IZ0A 5TEVA 3SLGA 2D74A 2IY9A 5JC8A 1HNXB 2OLEA 3VMMA 2ODEA 2VIIA 5J1SB 2YY5A 3FYUA 1BO6A 3ZLUA 1OF1A 1BTOA 5CCBA 1Y3CE 1WP9A 2X0IA 5DP2A 3U3ZA 3BF8A 3QUAA 3ENZA 3L77A 4FCWA 2PXAA 3GHYA 3AVTA 2HIMA 2CNLA 5ADUS 1FMFA 2ZITA 1MGOA 1F2TA 4EB0A 2F55A 1ZCAA 2Q5OA 2Z2YA 3PUXA 2WF9A 3OOHA 1Q50A 5IKEA 3WIUA 1J07A 4O8CA 4E09A 1BWSA 2P3LA 4N3GA 2VHZA 5ALNA 3IELA 4AO8A 4F4HA 3CPHA 1QFYA 2OVBA 2WMNB 4HADA 4QREA 2Q4TA 4YMLA 4UD2A 2A3RA 1K68A 4MMZB 3UXMA 5EIEA 4HAYA 5C8VA 1ZZGA 1AHNA 3OJWA 4N7MA 2BBTA 4NFSA 4BYGA 2Q6OA 2ZIFA 3CXUA 3AI1A 3QWFA 4LYJA 1V96A 5F9MA 4EFMA 3NAQA 2D0PB 4PYLA 4QJIA 3Q8MA 2ONCA 3AM5A 5DXJA 3FPEA 4P4SB 1NBHA 3RS9A 2FN8A 5IVKA 3ANSA 3IBSA 1P0MA 3TBHA 3L4JA 3EOZA 4E22A 1D2CA 1JTVA 3N9IA 3QVSA 3TSCA 4F5DA 2QS9A 3U5TA 2WABA 3NHUA 4IF4A 4RYDA 5DE3A 1SIBE 1KGSA 4TMFA 5DYYA 2VSYA 4R0MA 3FDJA 3LX4A 1JRLA 1K5HA 1OT3A 1YRBA 4KK4A 4R1UA 5IJ0A 5IYZA 3DHVA 2OP0A 3SFTA 3COPA 3LQ2A 3ZWWA 5JASA 4P3KA 3HEAA 2JHPA 4H3KB 3N8DA 4NBVA 3MSXA 2QR5A 1SHZA 3BIJA 2PWPA 3FOEC 1OFUA 2ZWVA 3EQ6A 3K5WA 2OGUA 1Z4OA 4GD3Q 4FWTA 2NQTA 3QENA 5JAZA 3IUNA 1B8PA 1J99A 4P84A 4BEJA 2IU6A 1I4DD 1ESCA 3NDBB 3MJ4A 4OBEA 3PWZA 3GCDA 1Y5IA 4AJ1A 4LJ5A 1MOZA 3AFMA 2C9ZA 1TK9A 2H3HA 1CP2A 4J1TA 1L7RA 2OAP1 2NP6A 1F06A 4KV7A 4BTLA 4ITRC 4BUZA 3U61B 2DQSA 4JJAA 1E3DA 3EZYA 4E94A 1R5BA 3MT8A 5DKFA 1SOMA 2D1TA 1GAJA 2MYPA 1V1JA 2P40A 4FYYA 5ERGB 5KDOA 3FVVA 1VJ0A 2XJ9A 4FJ2A 5FWYB 5AK5A 2ZWIA 1E3MA 1VFNA 4DWVA 3FW1A 1GSOA 2YKGA 1FQJA 1TVKA 3U3MA 4ARZB 2FPWA 1EKXA 2OFWA 1VP3A 1NP3A 2P1RA 1GADO 4G23A 4IIYA 1X9HA 2CJPA 2OSVA 3HPQA 4OXRA 4US1R 2BGUA 1XF1A 4XWYA 4XJXA 1GU0A 1Q21A 2J3KA 3P0IA 1HT1E 3QBDA 1EGMB 2HDOA 4K81B 5HGJA 4AYTA 4ZMRA 2Z5LA 3VOAA 5LQRA 2I62A 2QJRA 1U7PA 4RH1A 2Q28A 5FLKA 3ETEA 5L3VA 4U2BA 4RU1A 3H3JA 1NHGA 2J3QA 3K15A 1GCAA 1RZ3A 2W6MA 4N49A 1M3SA 1HLFA 1UP4A 1ZN8A 1EZ4A 2GESA 3K8QA 4MR9A 4WOBA 3GLFE 2OHIA 4IUCS 3LY8A 3N0XA 5JZBA 1TT7A 4WFIA 3K8ZA 3U3KA 2RK3A 5KX5F 2G9QA 3AY7A 3RAEC 4X00A 1P19A 3CUYA 2XUAA 4QOSA 2BZ1A 3M6LA 3IA7A 1E9CA 4B09A 1UXGA 3CZ9A 3D6MA 2FCAA 4TL6A 2VKQA 5B4VA 1L6RA 2OORC 4JT8A 4P98A 4IMPA 3C6MA 4JD5A 3FCSB 1J22A 3LOPA 4DSOA 5FNVF 2C5GA 3S2YA 3ZBQA 4QXRA 4KO3S 1YA4A 3L40A 5JALA 2K5UA 4GLFA 3Q5EA 3FHOA 1I6MA 1SVSA 2DOKA 1JQ5A 3A4YA 1VB5A 3NO4A 4QBKA 4L6CA 3VU1A 4FJ1A 4UPVA 4DV6B 2NMVA 2J9YB 3OT1A 4Z3KA 3W7BA 2RAUA 5ICCA 2ODBA 2VH1A 2W7TA 4HH1A 3C6QA 1OYWA 3FDZB 4K2HA 1RHQA 2FZ5A 2OCPA 3FWZA 4QUJA 1WD7A 1S2DA 5HG0A 5KKAA 3AMVA 2AL7A 5SY9A 4FOSA 2HCFA 4MV7A 5H02A 1P0FA 5AJWA 4DLZA 3R0IA 4PO3X 1J42A 4N41A 1VB3A 2Z3ZA 3DW3X 4IIJA 3W6ZA 1R4AA 1WF6A 3WSVA 5IC4A 4KR3A 2BFFB 3CN7A 4K9MA 1QAOA 4CLXA 1NQTA 3Q7QA 3TBKA 1X7ZB 2IYLD 4YCAA 5FR2A 2V6GA 2VBGA 1R74A 4D5GA 3HNOA 1EQ2A 1V4NA 2WSBA 3ZE8A 4TGLA 3SP1A 3IOMA 4JU8A 3CLTD 2PWAA 3NBZC 4ZKDA 1P1IA 1ODKA 3WIEA 1XKQA 4FYXA 2H1RA 1P1CA 2W83A 3JD2A 5DI3B 4KX3A 5DLQC 2EDAA 2VYFA 3OZGA 5FBWB 3U3DA 2X7HA 4GWLA 3H3XA 4B7CA 2VRBA 1DRUA 4XRRA 2QUJA 2KLBA 1V8FA 1HKUA 4G3XA 3NEAA 3BBPA 3FTCA 4BMXA 1V6SA 4B76A 3B6JA 3QQ5A 2C7BA 5AVOA 3A3YA 4QELA 1DOAA 2ZUCA 4PVCA 3F9RA 4N4AA 1VYVA 4KQHA 1EHIA 2BY4A 2NXCA 2Y1OA 3G49A 3GJ3A 2Q3BA 3IAXA 4BLOA 1GDHA 4M1WA 4H6VA 3L41A 4M1SA 3TAXA 2O20A 2NU9B 3RADC 3W5CA 3RWBA 3DLTA 4RKFA 4F46A 2KI5A 3OFND 4MHOA 1XFDA 5EXPA 1P2TA 2HY7A 2NZJA 4IFTA 3UYLA 2WQ6A 1MB4A 1U8EA 2C4KA 4N54A 4BLPA 2CJFA 4ZEWA 2VHJA 1JW9B 1KARA 4N6OA 4X5OA 5HMMA 1JU4A 1QS0A 1UKCA 2OHOA 5TJ9A 3EC2A 3AHEA 3DV0B 1S9DA 1CLUA 3OLYA 4KUHA 1GUDA 2AD5A 1F3OA 5LC1A 1FVHA 4RK5A 1WEKA 4YP7A 3F5DA 3IQDB 3OZTA 1VXOA 5BMVB 1Q2UA 5HUJA 3L9XA 5CD9A 1Z0IA 3V8MA 4ZJZA 1HL3A 2QD1A 3Q2OA 4OIMA 4OOFA 2J0SA 4P54A 1L7BA 1PJRA 2Q3HA 1FDUA 3GL9A 4F3RA 1DXYA 1JHMA 1KIMA 3A4TA 3MMXA 3PFNA 1Z29A 4YALA 5LUBA 1VE6A 1KI6A 1XZCA 4YEDA 1IWBB 1NLFA 3T5PA 4BMPB 1IM5A 3BL8A 3W5IA 5LZ9A 4HSEA 2AQKA 3PYLA 3VDXA 2XA9A 3STUA 1HE3A 4PC1A 4NNJA 3HA7A 5F23A 2ZKLA 3LK6A 2JGMA 5AWFC 1HO3A 4C6TB 1MB2A 2E49A 3RSSA 1TB4A 1XVTA 2ZYDA 5ITZB 2DEUA 2O7QA 4HNTA 5BMOA 2H5LA 2BMAA 2YASA 2DHEA 1U99A 3OKPA 3KZKA 2WMDA 4R1TA 1K1EA 4B8ZA 3WKDA 1D6MA 1R4NB 2IV2X 3H9JA 1ILEA 3K53A 1NPTO 3JQRA 4BFSA 2CT8A 1B15A 3KZXA 1H3NA 2IGBA 1Q0TA 2TRSB 5IYZF 3KKQA 4LTNA 3TQRA 3DAPA 5L3SA 2SICE 3VFDA 1B0ZA 5AVJA 3UOAB 4B9EA 1M1NB 4D9KA 3JAWA 1KQNA 3Q9UA 3STVA 2V7GA 3WYBA 1M6WA 3I9NA 4O4HA 1W5TA 2KPOA 2GN2A 2IVZA 3LPAA 3SYNA 5F52A 5ITVA 1G5FA 2W6QA 1XK6A 1KZGB 3IAEA 9LDBA 3STYA 1DBVO 3GLIB 4D0LB 3DLBA 1TUBB 2G1UA 4TYWA 1HSZA 4GIBA 1G7TA 3TK1A 4B80A 3N28A 5THQA 1E79D 4DEVA 4KR0A 4RDCA 1WE2A 1OA0A 2J9GA 3IESA 3PUYA 2OE2A 4PYRA 4YP6A 1XWWA 3M0EA 3PFCA 5K0JA 3LWBA 3WWOA 3TSOA 3ZVRA 3HVIA 4RS4A 2EGHA 3D6UA 5BQOA 1C5KA 1EGVB 3IPAA 4B2PA 1Y37A 2B3DA 2A92A 2C4NA 3ZNOA 1LXCA 4YWJA 5FD8A 1UZAA 1WUYA 3KHUA 3O4GA 1BC5A 3CF2A 1SVKA 3KT0A 3VO8A 4B79A 4I4TB 1XVAA 1CJUC 2DWUA 3QVUA 5HUQA 1XL1A 4FEYA 4COKA 4WZAB 5IXYA 5C8YF 3UGQA 1QGYA 3TR0A 1RM4A 1E3JA 1EX7A 1LPNA 1PWYE 4RV4A 4C2TA 1YFKA 2AHOA 5CJ2A 5M5BA 3EDYA 2VF8A 4F38A 2JA2A 1V11A 2VP0A 1KVRA 2BFPA 2Y67A 4ZMBA 1U1EA 1HT3A 4HPWA 5GMOA 5CLJA 2XUIA 1YIAA 3H4IA 2OM2A 1SCNE 3JQEA 4JJGA 4K2AA 3B8HA 3VU8A 2Q6LA 3QBJA 3EDQA 4MW5A 3CU5A 4GI1A 4YJDA 1RFGE 4WA7A 1BRMA 3ETCA 1EI9A 4O29A 3S2FA 2A9KA 2H2WA 5K2OA 1THZA 2QUAA 2POQX 5FYQA 4IDFA 1UK8A 2XX3A 4OO3A 4C2BA 5JRDS 4N0DA 1Z8FA 3ZCUA 3H2SA 1TVEA 5HS6A 4L3VA 2UUAB 1RWMA 1E6EA 4ZJPA 2VAMA 1X7XA 4DC1A 4QFCA 1NZFA 2H4ZA 3D0QA 3DKIA 4M89A 2WV9A 4TTJA 4RY2A 2GASA 3B6MA 3R40A 2ZXEA 1MQSA 3LPMA 1KRXA 5C5EA 1EE2A 2W22A 1E9FA 3IOEA 4MQLA 2ZETA 5EQFA 2LBPA 3PF8A 3QUQA 2C2KA 3O4JA 2XDQB 4QPJC 1SHJA 4XYBA 3BKWA 4EO9A 3ELBA 3UJ3X 1ISRA 3DBVO 3STXA 2F90A 2Q5CA 3K0SA 5EZ6B 221PA 3RG8A 4CLHA 1LI7A 3CWCA 2A9JA 2AN9A 3E9EA 4K40A 4QPDA 4RFSB 4F2PA 5EJ7A 1FTYA 4Y9RA 3BXFA 3TLXA 3VHXB 2FW9A 5FFFA 4DQLA 5KWEA 3RCBA 4F06A 3WLAA 3M4XA 4QBGB 4UNNA 2A35A 4IIJF 2PY6A 1LF5A 2PIDA 2HJ9A 5EJ9A 4PGGA 1BE6A 3B70A 3JATA 4K9LA 5DEIA 4AF8A 3ZHVA 3EYAA 4N9QA 1N4DA 4NMLA 3EVNA 1AG9A 1I2MA 4BB6A 3C7DB 4N5DA 4KQCA 4R6WA 5ELXA 1RYNA 1I3NA 3OUZA 4HXEB 1M0SA 2WHYA 4HQRA 4AQ7A 4DCCA 2B21A 3C8HA 5BN4A 5HMLA 5JI2E 2GAOA 4RZXA 4BVLA 1EX9A 1YMVA 1RTTA 3GPCA 3ML1A 3WGGA 3SSMA 1ZSVA 1E1NA 5GQSA 4IS2A 3OFSA 4OHFA 2XLBA 3UXHA 1N25A 1LS1A 1WKCA 1CVLA 3HXPA 4RFLA 1W4ZA 1XZQA 3D5EA 4XDHA 1X2BA 4KU4A 3A2MA 4BQPA 5EPOA 3KAJA 2OD9A 3F49S 2Q0XA 4QUIA 4AZSA 2FXIA 4KPYA 3N0RA 3T38A 3K4QA 1MRNA 2ZTHA 3RRFA 3CQ9A 3PPXA 1YRHA 4MR8A 3IAHA 3EZ9A 2WFLA 4Q00A 4BGIA 3IAFA 3A6GA 3E5HA 4ACBA 2FSSA 4M0DA 4RMIA 2CXXA 3S68A 3SMVA 5CK4A 3BGDA 3BILA 3JV7A 2VN8A 3OMXA 4RK6A 4TOIA 1BH2A 5J5AA 1NVVR 3IKMB 1N3IA 3D3WA 3RS2A 4C0LA 4LIPD 4CF4A 5EJIA 4DYVA 3E03A 3BGVA 3MELA 5DNWA 3O9MA 2CL6X 1EFHA 2TMYA 1NKSA 2CN1A 4HUQA 4CE6A 2E3JA 3R3JA 4LGCA 4OTZA 1JHDA 3JYOA 1KQOA 3UOGA 4F5EA 3IDQA 3G88A 3NOOA 4QJ4A 5AKZA 2V7EA 1A82A 1G8MA 3IMEA 3DKKA 3OU2A 5EE5B 3QQPA 3SCZA 3ZOZA 1A7AA 2NZXA 5J2TB 2WJPA 4J3FA 3TTUA 2QF7A 3EY4A 4OREX 3WA7A 4OX9B 4UHFA 3JQPA 3PEUA 4FSHA 5MDHA 3AG5A 5MFPA 2FAXA 4QJ3A 2FMKA 4UHHA 3F74A 4ZT4A 4YUVA 2QRMA 3HCDA 5SY4A 1CS0B 1LRLA 1WR8A 2ZIZA 4AKSA 4I1YA 3DE7X 1XVUA 1RI2A 3CNEA 1AHIA 3QKSA 4U7DA 2F9LA 3L8DA 5KVSA 4UBMA 5AIAA 3LO8A 3U40A 1NI5A 4DQXA 5C8XA 1IJEA 1NM5C 2CMKA 4XGQA 5EE3A 3U39A 1Z8HA 5J2UA 3PQFA 5L51A 2HCJB 2J6CA 2XSZA 3FA2A 4HQFA 1RADA 2JFNA 4Y8VA 5GGXA 3UO8B 4V1CA 2I1LA 1T5BA 1PYDA 1TYBE 4LOIA 2IUUA 4EBFA 2UXDB 3HUDA 1E5TA 5AKXA 4CU5A 1HQCA 1A5TA 5AK4A 3SHWA 1ZRNA 2HPVA 4PFKA 4BVEA 4HRYA 4UQOA 2OILA 1Y9EA 2A3NA 3MWEB 1XPUA 4M55A 2Q8NA 1KO8A 3P9ZA 1C2YA