3T7JA

Crystal structure of rtt107p (residues 820-1070)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
250
structure length
237
Chain Sequence
b'TKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHSQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDVIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of Ty1 transposition protein 107
publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 76
structure length 237
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7jA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7jA01
1KZYC 1GZHB 3PXEA 4U4AA 2M2IA 3EF0A 3COJA 1OQAA 4Y2GA 2COUA 2XNHA 3L46A 1Y98A 3PXDA 4OFBA 3SHVA 2K6GA 2LE0A 3AL2A 3U3ZA 3AL3A 3SHTA 4BU0A 4Y18A 3SQDA 2JW5A 3SZMA 3K05A 2WT8A 3QVGA 3K16A 1CDZA 4BMCA 2EBWA 3PC8C 4XQ0A 3KTFA 3PC8A 1T2VA 3T7JA 3JVEA 4IFIA 3T1NA 3PXCX 3PA6A 2DUNA 3PD7A 3EF1A 1Z56C 2AZMA 2NTEA 2VXBA 1L7BA 2L42A 4JLUA 3T7KA 1L0BA 2VXCA 3UENA 3OLCX 1WF6A 1T15A 2EP8A 4XPZA 3T7IA 4BMDA 1T29A 3L41A 4IGKA 3II6X 2EBUA 3I0MA 3QVGB 3K15A 3L40A 1N5OX 2K7FA 4N40A 2COEA 2D8MA 2ADOA 1IMOA 3HUEA 3FA2A 3PC6A 3PXBA 2INGX 2R1ZA 1IN1A 2COKA 2E2WA 4BU1A 3K0KA 5ECGC 3UEOA 2XNKA 1T2UA 1JNXX 3PXAA 3I0NA 3K0HA 4ID3A 3HUFA 2HTFA 3PC7A 2ETXA
chains in the Genus database with same CATH superfamily
1M7GA 1GPLA 2UVPB 1W75A 3E1KA 3MG9A 3ZXXA 4F91B 1B14A 1ZK0A 2WHPA 2WJYA 3FZYA 4HNTA 1SB9A 2A0KA 1BWPA 4WY5A 3MJEA 1OREA 1X1RA 3M5PA 2ZPUA 2QG6A 4FFLA 1KYZA 4HR7A 1GGJA 5AOVA 2X4IA 4CGYA 4ERXA 3SFTA 4RTPA 2FOLA 3EQ2A 4FUTA 3TDMA 1IK4A 2AWNA 1NFRA 2NAFA 4N9QA 3RWMB 3SZRA 2NV6A 1KQFA 4U6SA 1V39A 2QN3A 1BS9A 1Q1NA 3CWZA 1E9VA 4OGFA 1G7SA 4HEHA 2H18A 1HE8B 4EUFA 5I45A 1I1QB 3AHCA 3P0EA 4JL6A 4QU0A 4QPDA 2AMYA 4ZQBA 3BXHA 3LS2A 2JEZA 2E1RA 1PNTA 3WLJA 1QG2A 4QJ4A 4CLEA 5C7LO 2DKFA 3OEHA 4IUCS 3ZJ4A 4BKQA 1MAVA 1RE0A 4TTAA 2R5WA 4FYHA 2QTAA 3QH4A 3RVRA 3VR5D 2QIPA 3WO1A 2EKZA 3ELWA 2A9KA 4D44A 2H7CA 2BMFA 3KM0A 3ZHYA 5LIRA 4RESA 3VV3A 4AZ0B 4NJEB 6ADHA 3SLKA 5KWIA 4KQXA 3ADOA 5EFOA 5CDGA 1A2QA 3L79A 5EJ9A 2FWNA 2ZUUA 4DILA 2F8TA 1OLUA 4NOLA 4PO8A 5IC5A 2QTGA 1RXVA 1E7SA 1PEAA 3K0FA 2ICAA 4FHDA 5KNBA 4G9EA 3IUMA 4C3ZA 3VPDA 1ZP6A 5FNVB 3GT0A 3G5MA 3P7MA 3HJCA 4JOSA 3NYRA 1I2BA 4AUMA 4UD6A 1U2TA 4K6OA 4E4YA 2H1FA 3K96A 2JASA 4OFXA 3W06A 5D87A 1QYXA 3GFOA 1CD5A 3PTZA 3W79A 2C5GA 1E4YA 2GBFA 1W96A 2ZRNA 2O0JA 3C24A 3QKSB 4GLOA 4QM7A 4OA8A 3H42B 3X2SA 1K8YB 1LVUA 1MKYA 3N1UA 3DOFA 1O2DA 2PX0A 3VHLB 1UBMS 3N75A 4KSYA 2Q8NA 4OHBA 3V2IA 3L8YA 1BE1A 3DAOA 3SHQA 1PAUA 2WG2A 1ZXBA 1KGSA 3HBMA 4KLRA 1ABBA 3AERB 1TTPB 2B4RO 4YCJA 1PJ2A 2GDZA 3HQ4O 5CPFA 5BT9A 3G59A 1UEJA 2C0QA 3DMNA 2ZWAA 1NL3A 3KT6A 2NU8B 4CCWA 1VL2A 8ADHA 5LZ9A 1L5ZA 1RWOA 3BE4A 3K20A 3B5IA 1L9XA 2J9GA 4IR7A 4J9VA 5DX0A 5FWDA 1PWHA 5GGXA 5A02A 1Z29A 1UFQA 2H85A 2QGFA 4IXTA 1JEDA 4TYNA 1M9NA 2X58A 2ZQ5A 3G2QA 4NABA 5INTA 4WLUA 2C7BA 2H51A 3N8DA 1D1SA 2XCSB 3SYLA 4CLOB 4DLKA 1Y3HA 3FKQA 3U1VA 4BECA 1CC1S 2J09A 1Q7BA 2ZAGA 4FEGA 1F14A 1EK6A 1J20A 4XYLA 2EHJA 2H1SA 4IDBA 4YCLA 3UJ3X 1E77A 4ER6A 2ZUFA 2XTJA 5EZSA 3IUQA 2BMDA 3SSMA 4NCBA 2FW0A 5B1SA 2VHUA 3WL5A 1G42A 2P4SA 3RUAA 1G5QA 2PVCA 3JTMA 4FGKA 5GV7A 4WUTA 3OZCA 4UXIA 5BQFA 5FTWA 1TT7A 5J2UA 3E03A 4MWEA 1M5RA 5JDCA 4DUGA 4L8VA 1GAEO 1FW8A 4ZI7F 5BSFA 1IZ8A 1OTXA 2UVQA 4PFJA 2M6SA 5DHTA 1T43A 3ELYA 4DQDA 1F7UA 2OAGA 4IRMA 3ZKAA 3RAJA 5KOIA 5FTNA 3EHDA 2YXEA 1D4AA 1KY3A 3CX3A 1APBA 3VC2A 3QG1A 1QONA 2WJZB 3QE2A 3AIIA 4GHWA 3EIWA 3RF7A 1FZQA 4TTQA 2RGXA 4BFYA 4TUYB 4FCVA 3S7TA 4INJA 4YAIA 1Q0ZA 2BFFB 2P2CA 3U4IA 1NJ8A 2QMUA 4D80A 2FEPA 4R5HA 2O2DA 2YNMA 4U7HA 3ST7A 1T9CA 2WT4A 5AK4A 2VNAA 2Y1FA 3KXLA 2QENA 5A7GA 4C4YA 3PKZA 3L0CA 3F7TA 4IIJA 4JFAA 4KZPA 3U37A 2FSUA 3OLXA 5ICGA 2G4LA 2UVDA 4Q9DA 3PSAA 4BASA 1V8OA 2JCVA 2WTXA 1AGYA 2IKQA 3HM2A 2Z1MA 4O1MA 2F00A 1BS1A 1FXUA 1NR7A 2NNLD 2RONA 3A4MA 2OZLB 1H2EA 2X5OA 3SY8A 1XQWA 4EYQA 3HDHA 2W58A 3T9FA 1HLDA 3J81A 3ELUA 4HWTA 3LOQA 4KX3A 3TGPA 4RVUA 2WKWA 2ZROA 2NYUA 5I7WA 4PX5A 2H0RA 3C3CA 5BN5B 4PTLA 3VPHA 4OGWA 2GSDA 4C6SA 2VQ3A 3WGTA 5TQ0B 2P27A 4UFPA 3TGLA 1JG2A 1SG9A 3WDKA 2ZJYA 4HAVA 3C6XA 2TRSB 3DB2A 2ZANA 5DISB 4ZGBA 4KGXA 2NYRA 5E9AA 3TG2A 1K6JA 1R66A 1CUDA 5TEVA 3OJ0A 4YJFB 2JG3A 4LK3A 1UANA 2QQEA 1L4MA 5A1TA 5IJ9A 4X94A 1T5HX 1K08A 5IHPA 3BFXA 4HQLA 4RM3A 2W6JA 2H2IA 3K4HA 1GZ6A 2B1QA 2V5UA 4JDUA 3A2LA 1H85A 1Y37A 1SRRA 5IAJA 5KAMA 3DKKA 4BZPA 2FEXA 4UQPA 2WFMA 3AKCA 1P1CA 3L8ZA 2MSCB 5H8WA 2QI9C 1CY8A 3HDJA 5LYJA 2AYYA 3F9RA 3IXLA 2J6IA 4RJ2A 3S2YA 1P2UA 5AVUA 2D1FA 1U99A 1ZX1A 2GD2A 2F67A 3EUEA 4YDRA 2Z5GA 5HVNA 4Y6LA 3UHJA 9MHTA 4RHEA 1E1DA 1U81A 3PIRA 4ZTUB 3TZCA 3TL2A 1P61B 1AO0A 1XMOB 2GXAA 3C5WP 3PV0A 1UKBA 1RQLA 3KDSE 3D2CA 3OZFA 3RTGA 3WHKA 4WBNB 2IE8A 3OZWA 4L51A 3Q8LA 3KSAC 1JU4A 1R6DA 4LYFA 1P4GA 5EVCA 4G97A 4RTQA 5F76A 2R47A 1SVUA 2QM7A 3O74A 2ZJ5A 4FBMA 3DLCA 4FFPA 4J0CA 2BI7A 1VKNA 4F4FA 1NUSA 5LSAA 3GGDA 5LUAA 5JYCA 1ZOPA 2Z0MA 1LJLA 1X7GA 2HRDA 4DWJA 4G2TA 5CNIA 2R3SA 3EZGA 4IIVA 2CCGA 3K1TA 2VATA 1QIHA 4HXEB 4WLFA 5B4VA 5EL0A 2BFCA 2QL9A 5J43A 2C04A 1KDVA 1T0UA 2QQ0A 3GELA 1I3KA 3I2IA 4QPNA 1LTHR 2VBFA 5PNTA 3FLAA 3AEKB 3T9BA 1L8LA 2FPPB 4DNOA 5C2JB 1MMFB 4TXHA 3ZHVA 4NAVA 1NFFA 2XNCA 3N8IA 5ED0A 5E9QA 3BFKA 2SBTA 4MAMA 2NT4A 2DHDA 5DSXA 1QGAA 4MV4A 1XIVA 3OE4A 3LDGA 3PWSA 1QQTA 3AFNA 4ZHQB 3V7YA 3OD1A 3RPEA 4G09A 4C87A 2C96A 1VKJA 3ZCRA 4J7UA 2QPOA 2ZRMA 5SYMA 1Z07A 3RW9A 4S05A 3THWB 1JHPA 2OXEA 4Y2JA 1D09A 3E9DA 1Q92A 4F2PA 3EFHA 3ADCA 4R69A 5DB4A 2QBYB 4WDRA 4QBFA 3Q88A 3B60A 2A86A 4KN6A 4QPCA 3TM4A 5KZMB 2FE1A 1E3MA 4NCXA 5IF9A 3UB3A 1TZKA 3EISA 4HLNA 5CA0F 1BDIA 1CERA 1DXQA 3EC1A 1BGVA 1D4ZA 1LDYA 2FXVA 3VYWA 3EN0A 3LT4A 1FFBA 3KQHA 1R5NA 2VP0A 2XEDA 2YYSA 3ONDA 4FZ5A 2Z8XA 2DUMA 2ROQA 3QHAA 4IEEA 1TYCA 5D6NA 4CYMA 4YCMA 1RRPA 1ODJA 4L50A 2CNKA 2I3ZA 3MHPA 3UNXA 5LQMA 3D6NB 4RPCA 3I76A 3ZWAA 2XMGA 1I2MA 4F1WA 1P72A 2P67A 2WHXA 3DZCA 4F85A 2G0NA 1CUGA 1S3SA 3GRVA 1ZUNB 1JDNA 3T7JA 4YJ3A 1HQYE 3WRXC 1SCJA 2HRZA 3P32A 3PPWA 2X0IA 1N3YA 2WUFA 3AF4A 3AIOA 3NORA 3VZQA 1N5LA 1JHRA 4F11A 1N36B 2J3HA 4PLCA 5KJEA 4Q34A 3FF1A 4RVDA 3K6KA 1CNEA 4K9MA 4IEIA 4ZRNA 4DLLA 2D1TA 4JJGA 3B89A 3LNTA 4LGMA 1Q50A 1RC0A 6YASA 1MEOA 2JLSA 4N0DA 4X8MA 3JAMA 2PGOA 3DMGA 4DSAA 4C14A 2A0FA 4X54A 3A4LA 3RWBA 3SR4A 3ACBA 4PZDA 1J8MF 4RIGA 1JH9A 2JAQA 1U0OC 1Y3FE 3BL5A 3SYKA 1NX6A 4E31A 1F8YA 2RGNC 1OMOA 4KU4A 5IFKA 3ANYB 3ESZA 3IX7A 4DIUA 1V35A 3MQ2A 1TT5A 3EZ7A 3NHPA 1V9LA 4YUXA 2PL9A 3H2HA 4IIHA 3OA0A 2R8YA 2BV3A 2Z83A 3QEMA 3FPSA 3I5XA 1ECCA 5ESDA 2BWJA 3TWOA 1SGWA 2OQVA 4D0SA 4NCHA 2A1UB 3UMFA 3ZE7A 1ZCFA 2P78A 5EY5B 2IS6A 2HLDA 1BXZA 2YHSA 3DL7A 4HDOB 3CVYA 2BGWA 5LQCA 1N5OX 1V1RB 2EARA 4OK6A 3HWRA 5BV1A 3WQSB 3ETLA 4HQ0A 5EJAA 2AOWA 3KBBA 2D8MA 1HXHA 2QTTA 2VRCD 3RSLA 1W0KD 3SR0A 4BAZA 3AKEA 2ZWVA 1J99A 4PG5A 5KNBH 1YHNA 1RVDA 1Y8QB 1NE7A 1Z4JA 5FRDA 1A4UA 1PGOA 1RYNA 3HKBA 4FYPA 5JZ9A 1SQ6A 4LY0A 3IBFA 1CIVA 1HLFA 2EX4A 2W93A 3LC2O 2IY9A 1T4GA 2R96A 1P6XA 5AK5A 3KQQA 3GU3A 5CFQA 4K2HA 4TTPA 3VH3A 3WGOA 5AHXA 3AJAA 1K7YA 5EUBA 5AVYA 1SD2A 1RCUA 2PAFA 5LQKA 1FVFA 1DX4A 3I53A 3L4SO 1N75A 1QHXA 3N2KB 4WCDA 3RTAA 4C0JA 4ABTA 5JPDA 4WCVA 4RTKA 2Q5HA 1DZ3A 2D7JA 2NQ8A 5IKXA 1OBVA 3OQNA 3RIEA 1MC4A 3OZBA 1GGNA 3IJEB 1KH3A 2J5RA 2J85A 5ES3A 1RACA 1W5EA 4H1TA 3TSZA 2O3SA 1WDLA 3N2YA 4R1QA 2JFXA 2MYNA 4MJLA 3ROTA 1JN0A 1JQKA 3UHPA 2WSSD 2JFGA 2RHDA 3AR4A 3DV0A 4J4TA 4WZ6A 5DW0A 1T13A 2JH3A 5DGHA 1Y9ZA 4KO1S 1L5OA 1FS6A 2OQ2A 2YRWA 3F78A 3EDYA 2P11A 5K7SA 2H17A 3PCRB 3W2TA 1PZFA 1F0KA 3BORA 4FOOA 4RV4A 5B1HA 3Q3HA 4RH0A 3UWKA 2ZRBA 2ZR8A 3N8KA 1BMTA 3AH8A 3VDRA 2Y4OA 5JZOA 5EMLA 3OCJA 5ERGB 3KHSA 1AMOA 3KZOA 5FOXA 5LL6P 4DM4A 1QG0A 4JELA 4D9CA 4LJ4A 1HTTA 1WUYA 4WZBB 4EK9A 4LISA 5GVRA 1V3QE 2RB5A 2WT8A 4IBOA 3G9QA 1D5WA 1D1TA 2PJUA 1S6YA 1E1MA 3VI4B 4JR1A 4F92B 3G8BA 5HUHA 4MP6A 1I24A 3BZUA 4UHEA 2JBAB 2OFPA 5HZHA 4GI7A 3NKFA 4H1WA 3I28A 1KH1A 1CVIA 1M1UA 3MFYA 3WK8A 3HJTA 3K31A 3O73A 4W4TA 3TLGB 1MJNA 3QUQA 1AE1A 1TA4A 1M6VB 1YR2A 1ZO8A 2DFKB 4KMMA 4QBHA 1E8NA 3ZE0B 2H9AA 3PT5A 2A4KA 5DPMA 2QU8A 1AZWA 1LX7A 2J9RA 3C87A 3IJPA 3EZYA 2ZYHA 5SZIA 2FN4A 3NXSA 5FUQA 1C14A 2X7JA 3SICE 1E9BA 4CVNA 3KZCA 2VJCA 3I92A 4DUYB 4MUHA 4ZAVA 1GJRA 1SBYA 2Q3JA 2VHJA 3DL0A 1PJ4A 4R9UC 3U49A 2HSGA 2ECQA 1CY7A 2G1AA 4MS1B 4TYYA 4M60A 2WYUA 3H6KA 4IMPA 3CLTD 4EELA 3EFBA 4EY3A 3THOA 1DWPA 4QFCA 2QUAA 3VPSA 1GQRA 2OBFA 1MAUA 3C3PA 4ZT6A 2DLNA 2XUDA 1HZZA 1ORIA 4ZVQA 4DL9A 1SCKA 3GROA 1HFJA 2HWUA 3UT0A 4POOA 4D9FA 1QV7A 1SIUA 1XALA 6REQB 2X5JO 1J2EA 3DD1A 5FOWA 3QVGB 4FHEA 3E3AA 3L40A 4IV0A 3NBUA 3QTLA 6ABPA 4RADA 3MMSA 1Q19A 1QH0A 1N7GA 2OSBA 3PHGA 4N40A 4E08A 3KUXA 5JZSA 3EIXA 5BORA 4D9BA 3KFVA 3P19A 2GZ2A 4DARA 4MCIA 5CLQA 1B3RA 2XUFA 3L7NA 1MO3A 2XUIA 4D96A 1UKYA 1CUZA 3LT5A 3DWEX 3K1JA 3W1VA 4AWAA 4TQAA 5BNIA 5KNBD 5L3QA 1G8YA 2BHRA 3GAAA 3HPQA 1PJBA 2LRHA 1GGHA 1OAKA 1MX3A 2V7BA 2HBQA 4N7MA 4UCWA 2JGNA 3DAGA 1SXGA 3OZ7A 4V0QA 4D57A 2O0KA 4ZI7A 1RYBA 4TRMA 4ZZ3A 2ETXA 3DCIA 5CD1A 2VJBA 2XKAA 2I2CA 3QEKA 2C8JA 2KE5A 1TCUA 1Z12A 4WZAE 4L7VA 4TXNA 3KEOA 1N6NA 1F4VA 4LC1A 1CQWA 3HKDA 3MPUA 2YWCA 3PXEA 2WQZA 3IURA 4PSUA 1K8ZB 4MW4A 3MCAA 1CJUC 4XCXA 2XCRB 1I0ZA 1ZL2A 1V41E 1L5GB 1A77A 1ZNZA 3HXKA 2C2GA 1TU0A 3TN7A 2C3YA 3ISJA 1VBFA 3ZR4B 4AYXA 2JFQA 1Z5PA 3SX0A 3KKNA 4W5JA 3ZGYA 1RP1A 1Y48E 4MVJP 1RWKA 3MQFA 3X1YA 2R7KA 1GDDA 1GN8A 1YZUA 2KM1A 3EUFA 4OHRA 4RQUA 3KOYA 1IG3A 3UT5A 3VU8A 2BF4A 2ODQA 1A95A 3C14C 1ZH0A 1MU0A 2PZLA 3BG5A 4I6JA 4M8LA 5AQEA 4P83A 2DH6A 4GWGA 2VTDA 4WLVA 4B8ZA 4MVJM 3L4BA 5DNUA 3SZ3A 1B23P 3F0TA 1W88B 3ZWKA 1O57A 1KJZA 2I4NA 3I45A 3KYDB 4WI1A 1NBME 1EJ6A 3O0TA 4I4CA 4QTYA 1J24A 3AFMA 5AW6A 2YASA 1IQPA 3T9EA 4EQ6A 2SKEA 5I5EA 1ZRMA 4JJZA 1H42A 2QTNA 1W4AA 5TE9A 1C3XA 3DBLA 5CVTA 4E5YA 4OHUA 1SCUB 2RH4A 4WRRA 4Z0HO 1K6XA 2YXLA 3TSOA 2P4HX 3CCFA 1JW9B 5HZGA 3VJMA 4UTNA 1M2EA 1EK5A 4JXZA 1M1NA 3OE7D 4QGAA 3GOQA 4HDRA 1C7IA 1ZD2P 3AF3A 3GWGA 5JXIA 2DHQA 2XTZA 1GTJ1 3KNZA 1SHLA 3HRKA 3PNMA 3B6MA 2QY9A 4GP7A 1U5BA 2Q4DA 3F3YA 2EFHB 3GLUA 1AKVA 4FW9A 5K0JA 1VLLA 2VSQA 1ID8A 1EFTA 4HL6A 2R6HA 4QGBA 4RZIA 4GKJB 1R9NA 1EQ2A 1TZ2A 5CB0A 1YBVA 1C8LA 3DV2A 3SEAA 4DQ0A 2P4QA 3UPDA 3CXRA 4OBXA 4ZAWA 3ZVLA 4PG7A 2IZ7A 4JP5A 3C1OA 1J56A 3TQIA 2ZR9A 1LWOA 1Y9EA 1IMJA 3RLFA 1SKUA 2O1SA 1YA8A 2I8LA 4HAWA 4QBTA 3BGDA 1SMKA 3IXQA 1W2WB 2R9VA 2B8TA 3KQTA 2QUJA 5EGSA 3TR0A 4CUJA 4LF9B 4XM0A 3OT5A 2P2GA 1PJSA 4N5NA 5KNDH 1SUIA 4YHHB 2FSGA 4H7JA 4UOQA 5EUQB 2G4CA 2OBBA 1CB0A 1USWA 3BMOA 1QGED 1XXHB 3P2YA 3Q5EA 4CL3A 4OQNA 3T3NA 4PN7A 3DE1X 4DJFC 1Y7PA 4CRWB 3G2LA 5K5EA 4BCCA 3QLVA 3X1WA 2OHHA 3CC8A 4WCFC 2VAMA 3IR5A 2IUEA 2W0MA 1KDYA 4EUHA 4BQEA 3E1SA 3L7LA 3AINA 4RYDA 4KV7A 4BB5A 2UUOA 1CHNA 4HQKA 4BO1A 3CF0A 3TSCA 3E3MA 3H16A 4AIRA 3GJYA 3I4FA 1U8CB 3IAEA 4ENSA 1XVIA 1HOTA 2EBHX 2ZJAA 3JD0A 1QK3A 3EXAA 4DNPA 3RUDA 1N25A 3ECCA 4ALLA 3PFGA 2XE8A 1TOAA 3VUEA 2Z6AA 1GL3A 1KZ4A 3OHPA 4M49A 1JHQA 3DZDA 1SUAA 1EBBA 1II9A 2ZE7A 3A1SA 4L4XA 2ZU6A 1B1AA 2CMHA 4LYJA 3B6ZA 4W7IA 4YUAA 1FRZA 4FWIB 4L8WB 5B58C 4LZJA 4P1ZA 1P3Y1 1VJTA 4K6KA 4NMHA 4Y6QA 4DT1A 3OH8A 3TTYA 3LH5A 5LWHA 4LHEA 4L1KA 1AXRA 2D0OB 4E2YA 2W6JD 2K7ZA 2PX8A 1RYYA 1RADA 4I1YA 3ZU6A 2O05A 2ETVA 3DW1X 3TVDA 5ENVA 3C8UA 3LX4A 3A1DA 4BNKA 1PIWA 1DRUA 221PA 1NHGA 1NI4A 4BBJA 1PNQA 2BLLA 1U65A 1JDPA 2X1MA 4HC4A 2J3IA 3B6EA 2NX2A 3CMCO 1QNFA 3EA5A 1BFUA 2W2KA 5CA0A 3P9PA 1DO0A 1O8CA 1WF3A 4PLHA 4J0GA 3WA7A 2PL3A 4QXAA 4RCZA 3UQZA 4AJOA 5LMCA 4TL6A 3J80A 1HE2A 1K1EA 1XD9A 2DFLA 2IIVA 4R6WA 5B30A 4M0PA 2B2NA 2UZIR 3EWAA 1BVUA 1PG5A 1U31A 1UDRA 2XRZA 4UM5A 3IKMB 2RSLA 2VDWB 4GNKA 2GEBA 3H2ZA 2BEWB 3KQYA 2GAOA 3NU1A 1CDDA 1E1LA 1YVRA 1AG9A 2D1QA 3HJNA 3IP9A 3KE8A 4MVJD 3ZS8A 3L4JA 3C6MA 2OECA 4V0LA 2X4LA 1UUFA 2O6HA 5CBPA 4FFBB 4XPIA 3U4AA 1RYFA 3ZS9A 2I54A 1S8OA 1G7TA 4PRKA 2Y6VA 1LWNA 3KB6A 5JH7F 3LE8A 4X44A 3RVDA 1SXJA 2QF7A 4EPXA 2VDMB 4K2AA 5CVDA 1K5PA 5KNCA 2CXRA 4KPEC 2DPXA 2H29A 5JAPA 2Z4SA 1NM5C 1ODFA 4O4JA 1M1YE 2ZBFA 3HJUA 2WKPA 1UDWA 3IB3A 4LDAA 4WXYB 2W22A 3FUTA 4XIIA 4YMSA 3ZDCA 3ZGNA 4Z2YA 1CCWA 4ICIA 3RRFA 4ZOQI 3ZDAA 2R8PA 5FYQA 4IDCA 1FRQA 4M0MA 3ZXSA 5CB6A 1KYXA 1Q7RA 2ZJ4A 2Y8EA 3PQEA 1OA0A 4D9IA 3COVA 3A9VA 3BGWA 1FNBA 1H0RA 5LFAA 5AK6A 3KEMA 4JJ4A 5JLJA 3KCQA 4WKNA 1ZUWA 4G8BA 5FPYA 1PFYA 4BBZA 2ZTUA 4Q1CA 3G1TA 3LP5A 4UVGA 2J46A 4HFJA 1NI3A 3V34A 1E3WB 2Y71A 1OFGA 4BNHA 4TLLB 3UIEA 4A2CA 2VZ9A 3SVZA 4UREA 5EQTA 4QOSA 1QHIA 2H16A 4BPBA 3G7SA 4L2IB 1ZAYA 1NR5A 2QRQA 3EODA 4TL9A 4EBFA 3F2IA 2JLBA 3ND6A 3GJ5A 2OD7A 3CSDA 3MZ0A 1FQWA 5DHAA 1CZOA 3OJOA 1ZI9A 2OYSA 2PM8A 3VPFA 3QITA 3HCPA 4C78A 3NAMA 4TMKA 3R3SA 1KQOA 1KI6A 3KQNA 1N5DA 1C9YA 3NT2A 4JN6B 3H65A 5DYNA 3N7TA 1LLUA 2P9HA 4XKJA 4L78A 3W3AH 2X2OA 4U00A 3AF0A 3ELDA 3GP3A 3FXAA 3QU4A 3QOWA 3AP3A 4ZYXA 2VFAA 1KJQA 1UM9B 5EHNA 1Y5MA 1EFHA 2Q8QA 3Q9NA 3OP4A 3QFFA 4OHWA 5CFRA 4BY9E 3ZH2A 3HBLA 2ZAIA 4RE6A 3KRTA 3RYIA 4MW9A 1W4ZA 2C9MA 4IV8A 3IODA 3N0XA 4CV3A 4AQ7A 2W43A 4M87A 4RDCA 2J33A 3OC6A 2X6TA 1U8AA 1AURA 1I3CA 3BC1A 4UAUA 4EF4A 2HRQA 2JEOA 1N2IA 2AOTB 4P4LA 4JYAB 4O1HA 1L4LA 1LBTA 4LDRA 3VO1A 5FBZA 1E9SA 2HA3A 1J9EA 3A9SA 4US0R 5HUQA 5KOJB 3QFHA 4OJNA 5CB4F 4BYGA 4E2WA 3JV7A 1W85B 3O38A 4LC9A 3O03A 4MKFA 3M2TA 3PNOA 2C4UA 1NSFA 3SC2B 4BP1A 4BFTA 5K45A 2WIJA 4WKBA 1MB2A 2EFJA 5IZCA 1JLMA 3QP9A 2ZJOA 3EVNA 4MW7A 4WEQA 5D7NA 4EGQA 4EH1A 7REQA 5HQJA 1UC9A 4B87A 4B74A 3DWFA 2YZMA 2Q41A 3KS9A 2DFNA 3GJSA 2RHMA 2F43A 1E3JA 2MMCA 2Q99A 2YJNA 1P31A 2XEXA 2CVZA 1S2LA 1U8EA 3ZY5A 5K01A 5JJIA 4P3OA 2FZEA 4M7OA 4BBAA 4HAXA 5EOVA 5L4SA 1NLZA 4CQMB 2ZRFA 2FLKA 3B1YA 2G1PA 1TQ6A 13PKA 3I01A 1QPGA 4AMGA 5LZ2A 3P0RA 4RA9B 1L5MA 1U7TA 4QYXA 5E95A 5GP1A 5TVKA 3A6PC 2H2DA 2HSEA 3PXCX 2XWSA 1Z18A 1G1AA 1GRNA 2FYTA 4GLLA 1VB3A 1VL8A 2RK3A 2XHEA 3AVTA 3X2EA 3H2BA 2ZWOA 4IGAA 4LCEA 3E2MA 1VJ5A 4UAVA 3DLHA 2NV0A 2QAGA 2PZFA 3HC7A 4HPJB 2HCJB 4D4GA 1YDHA 3G0GA 3KWLA 5E6UB 4KQ9A 3WX0A 5JD6A 1Y1PA 1OAOC 3R24A 2FP3A 3N8HA 3NHYA 3GGCA 1OXMA 1GCUA 3UWSA 2HFJA 1US8B 3TZHA 3MCUA 1RMQA 1SZJG 1YQEA 2VPTA 3IALA 5FWYB 2O8CA 1P7PA 3AP1A 3MGAA 3MUOA 4RCVA 4O4LF 1Q0HA 3ENNA 3JVDA 1IATA 2D5IA 2JIZD 5E6SB 4F7WA 2ZSDA 1AXEA 2AXPA 5AI5A 4MQUA 1LUAA 4ATNA 1LEHA 3BCUA 3LIIA 3M81A 1K7SN 1MOSA 2RDMA 4FC7A 2PK3A 2ZRCA 1Z5ZA 4ETNA 2XCOA 4JBLA 5CIWA 1IWOA 2KJQA 2XBUA 3HLKA 2H4XA 3L6DA 2B7CA 3GJ3A 1L5FA 3GLQA 4L4ZA 4PHFA 5EIFA 3C45A 4ZCIA 5EMNA 3OVMA 4WBXC 1MO5A 2WKQA 4F45A 4RV5A 4JLBA 3S5UA 3JD1A 1A8PA 1Y5RA 5KUTA 1HEIA 4QELA 4ND8B 2E7ZA 3BULA 4YMIA 2ATIA 4FEEA 1H3EA 1XKTA 2JHFA 2QUHA 3OUZA 4ZOCA 3LHKA 3QFSA 3EEYA 1W5BA 1C9NA 1YULA 2Z2YA 1Y4DE 3BF8A 2GM4A 1QYVA 1G8PA 4ADSG 1W9MA 3UBTA 3GDWA 3JCZA 2IXAA 2QWXA 3ZWNA 4DLTA 3AHHA 5EKDA 1Z88A 4JB0A 4QVGA 3HGMA 4KXUA 2CDCA 2N0SA 4RSMA 3ZTYA 2O59A 2P6MA 5IMSA 3AUXA 3O8NA 2Q4TA 2Z30A 3LK7A 3GV0A 3W3AD 1T2EA 2K2QB 4MI3A 1R8QA 1RPJA 3EZ2A 1SVSA 1RXUA 1XTUA 3DB1A 4B3BA 3ZZTA 2Y1KA 1SNYA 5K8VA 3ER9A 4HYEA 4RGVA 4FKMA 2B5VA 3FWHA 3KSRA 5DLQC 2PGNA 2ZREA 1YIOA 2EZ9A 4BNNA 4EA8A 2ZRGA 3RVPA 3L46A 1PHPA 5AXDA 4R1UA 4HH4A 4LBWA 2H06A 1Y1RA 5KTOA 1Z6YA 2AEFA 4OMUA 3JX9A 3RE1A 1NAIA 3U7FB 2PMEA 2VJKA 4RPGA 1R6TA 4AS3A 5AWFC 4UBKA 3ZX5A 3TG8A 4JI2B 2V59A 3PEEA 3T7TA 1AY0A 3DTTA 3GJRA 3KUKA 3L5OA 3HCOA 4OSPA 5HE9A 4M21A 4EI7A 3OZVA 2X23A 4ZVOA 4BLWA 4G8DA 4JQSA 2GJ8A 3BWYA 1O97C 2HCFA 2WE7A 5KIAA 3DW3X 1Z0FA 3RJMA 4S12A 1E5TA 3U2QA 1E2NA 3A6EA 4QUAA 4YPFA 1DV1A 2FW9A 3H18A 4YP5A 1JHOA 2FSIA 4NE2A 3KSMA 4QXOA 1X7YB 1FFGA 1RRMA 1FW6A 3LY8A 2X1LA 1RJEA 2PMBA 4TV8F 3UICA 1ONNA 4Q18A 2XZOA 2ZT8A 1G66A 3COSA 2PH7A 5CVCA 2FQWA 4DCMA 3ENKA 2X42A 3DDZX 2POCA 2BGGA 2FWBA 1QR2A 2I6TA 2RAFA 2X4DA 4I99A 3DYBA 5A9SB 3S2FA 3K53A 4UZSA 4MR7B 1JP7A 2P9CA 3KP1A 1QIFA 1FB5A 3R4CA 2QR2A 5IH7A 4NVRA 4AK9A 4B6QA 2G5PA 3WO0A 3VNBA 4PYKA 4Q05A 1IEXA 1O6GA 4KLAA 1VRVA 4XDGA 3JQFC 1E20A 4Q93A 3WNDA 3NWJA 3URKA 3C8DA 1UJBA 3MOGA 1ZLXA 3RQSA 2GJAA 3K6RA 3PSHA 5EC8A 1J9GA 1FP7A 4RO0A 1YZGA 2JGJA 1YBHA 1TJNA 3H3XA 5DYWA 2AFHB 4EHFA 4OLAA 2AXQA 3PWKA 5F5LA 2XDQA 3SJUA 1N6LA 1PT5A 5EHZA 4IOKA 1N57A 3H87A 1SELA 1ISGA 2NZYA 2C0CA 3NWOA 1KEEB 4FI3C 3RKSA 1Z28A 4MA0A 2EKDA 3H9BA 2IYWA 3LXXA 3R0VA 4PYIA 1HEYA 4Q4AA 4CKYA 3ZJVA 4UEWA 4GKBA 3AVXA 5A9RA 3U1BA 1DXOA 3O2SB 4P5PA 5FOVA 2VDPB 3PJFA 5A3JA 4KR0A 3EFOB 4YPVA 3B7WA 4O59O 4P3XA 5BUSA 4F6LA 1JG7A 3E9RA 3L8DA 1HNXB 5H7XA 1K63A 1UBKS 1SOMA 2D7CA 2FMKA 2OHGA 3BBPA 3QLEA 621PA 3PQCA 3CVJA 2NWQA 4LTMA 1IUNA 2VLIA 1GZ3A 1ZAKA 2CLFB 1GA4A 2XUOA 5K03A 2YN4A 3Q8XB 1GAQA 3HCRA 5EIHA 3AU8A 3K35A 1W5TA 4JJKA 1GG2A 3TGWA 1I4EB 1Z6TA 3QK7A 4RPJA 3HBNA 5CW2A 2BR5A 4EO7A 2R8ZA 4BNWA 4ENTA 1KBOA 1MB3A 1U0EA 5E4TA 1MG0A 5BSKA 4NFLA 4CT0A 1E3LA 1YZ3A 3L9WA 2QSZA 2VYQA 2D2VA 4EJMA 4ETWA 3UWMA 4NONA 3S8EA 1C1XB 4WK0B 4UMFA 1YB6A 2F1JA 1RQPA 2G06A 3K9HA 5TS3A 3D1VA 3DCYA 5FT9A 1U8ZA 3OZAA 1X3LA 3PB3A 1C2YA 4H31A 3JAWA 1TYDE 3I2GA 1C3OB 3OU6A 3E22A 3BOSA 2DULA 4YLGA 1EUCA 2X9VA 4I5IA 4IIUA 2CNOA 5J1SB 3I9NA 3JSAA 3A70A 2IFTA 4N49A 4C07A 1VHDA 2HK8A 1MO2A 2BN4A 2VTBA 4KHPB 3W8NA 1F6DA 1L7RA 1ZM4A 2H2AA 3GEEA 4Z6KA 5LD2B 3KLBA 4IS2A 4P5DA 4JJFA 3WGJA 2Z5VA 2HGSA 3SF8B 5JQGB 4JJ7A 5FORA 1WU8A 3MWLA 4YBZA 3X2FA 1OD6A 4BQOA 1H23A 3K9LA 1N2HA 4X7BA 3E3NA 1HQCA 4LCBA 3X43A 1S0UA 3K1YA 3ZHRA 4F6RB 1MQAA 1E96A 1YDGA 2HJGA 2OHXA 4UE2A 5K4GA 1VGQA 1YO6A 3PICA 4FU0A 3KG2A 4PLVA 3L1IA 1RJ9A 2E5LB 1KQ3A 1JBEA 1RM5A 2PJDA 1K88A 1VRWA 3DDCA 3O3OB 3L43A 2ZCVA 3VR4H 4A6PA 1CT9A 2O2EA 4DREA 1IXKA 4WK4B 2GNOA 2EFEB 2JH8A 1KMHA 4A6XA 5JH7A 4HG2A 3LWBA 4J0FA 2P9QA 2WQ6A 1KZHA 2CHVA 3E9YA 1PYGA 3A9UA 2LDXA 2WFLA 2V54A 3WLOA 3EF1A 3ZWWA 4RFSA 5C4IA 3O9VA 1TIKA 1XJQA 2OUIA 5AIBA 1YVEI 2D1SA 1U7WA 1C9JA 1X7HA 3KT0A 4RQTA 4A82A 3DJYA 1GYRA 4PGAA 1W36C 1ZGBA 4A10A 3GXBA 3HA2A 5IFLA 3CTMA 1HL7A 5K8UA 1LBSA 1VM6A 4RH3A 5K9ZA 4Z54A 3NHWA 2HBRA 2G08A 5T7BA 1W6UA 3GHHA 4EG4A 5BN1A 4M9XA 4WA7A 4ZVSA 5EHGA 4CMKA 1FNCA 3ZNQA 5DRTA 1JXAA 1L3CA 2HRBA 1U8XX 4Q9LA 5KI6A 1N32B 4D26A 2HA2A 5I7SA 4PAQA 3OT1A 3GEHA 4OKSA 1OXTA 3KWFA 2ZSBA 1G8HA 4KV9A 3NASA 5J4YA 1MB0A 2PLAA 1A9XB 1EZ4A 1SU7A 1VYVA 1X94A 4MR9B 4BWFB 5GONB 1WUHS 1DTSA 1VSQA 3ND7A 2VQ6A 3JZIA 4U7GA 4X0EA 4FMBB 5JVDB 3PUHA 4Z53A 1C80A 4X61A 1ZJ5A 2EAUA 1B6RA 1A9RA 1PSZA 2QG4A 2MWMA 1HUQA 5CLLA 1HT1E 2VWGA 1HE3A 2DTDA 1USKA 4IHJF 1A04A 4H18A 4WLOA 4JUDX 3LPDA 4HTFA 4Q7EA 3T0IA 2B4YA 2VUSA 3JWHA 1IZ9A 1CQIA 5EESA 4B9AA 2OCIA 4F97A 2YXPX 4HCJA 2ZSEA 2GEJA 3I6BA 3QKTA 3DKVA 1U4SA 3ZXYA 4H3HB 2C00A 1XZIA 4C7KA 3P9SA 4KN5A 4Q3AA 4XM2A 2BBOA 2OGSA 4JU9A 2J0UB 1R0YA 1V7CA 3OOSA 2BLNA 3K30A 4RANA 4YV0A 4Y0VA 5F3RA 1G8MA 2JBWA 1PG0A 2KBFA 4EG3A 3LXRA 3M9XA 1JDBB 4MO2A 4V0SA 3VU9A 4EJSA 1E3DA 4M54A 2QEQA 1HTBA 2I6FA 2CZCA 2GPAA 3RUHA 3IUBA 1RKVA 1KYIA 4U7WA 5CB4A 4RYLA 2HGZA 4RL6A 4FYYA 4BVGA 3QPDA 5NLLA 1P7YA 4ISBA 2IPMA 3BWBA 1Q17A 4Z9XA 5JCPA 1U1EA 2BTOA 1OLXB 1RU3A 4G4JA 4J2HA 4LYGA 2RI1A 2OQIA 4P4NA 1LC3A 1ZVKA 2ZB7A 3I5MA 4FGUA 4HX5A 2OCBA 3A2NA 2RHOA 4IL5A 2ZVJA 4X60A 1O9GA 3JATA 5HOEA 3S5JA 5LMNB 1YHYA 1CS0A 4ZOBA 2AQKA 4HQNA 2JGFA 1WKCA 4C0SA 3BE5A 2GPWA 4K7JA 4Z0PA 2HHHB 1QCCA 2HA4A 1BCRA 1W44A 2YV1A 3UAGA 5BWCA 3Q2KA 3OM0A 1AZTA 4IDAA 4NBTA 3IDOA 6Q21A 3UTDA 1JPNA 3BF7A 4IIJB 3MIZA 4HNRA 4RTNA 4LF4B 1UPFA 4MH0R 3FDFA 4KVGA 4QQRA 1Q21A 1EDOA 1U2ZA 5JNLA 4P7JA 3MTQA 5DCWA 4JP3A 1XT6A 1I4OA 3N70A 2DSNA 4XQEA 4AJPA 3CFYA 4TWIA 4DKJA 3NM6B 1JLLB 3VR4D 1U0FA 3A25A 3N53A 5EP1A 4OP1A 3QKRB 3NH6A 3TQQA 4UMVA 3CCBA 4L22A 2FXIA 2QZ4A 1EUQA 1Z25A 2JKYA 3V8EA 1RPTA 4M8NE 1HM5A 3G5UA 4PHTA 1GPJA 3L8CA 3ANSA 3CIOA 4WOJA 3IJRA 4LJ9A 3LMKA 2A58A 6AT1A 4B5KA 2OESA 3H7IA 4LQLA 4O4LA 3BD8A 3MT9A 4EFKA 5B2FA 1C4OA 3I04A 1E2BA 2OFOA 3R7WA 3T99A 1VHTA 2F3SA 3RJ5A 4KIUA 4REQA 2FMTA 4DJJA 3EXEA 5CGZA 3II6X 1POWA 5JATA 2C4TA 4KZKA 2O5CA 1SQGA 3ICQB 3LCJA 1IDOA 2QE6A 1DC6A 3VHXB 1KA9H 6NULA 3JQBC 2NPFA 3OQVA 3MSCA 4HJRA 3OCXA 5ABPA 1NQWA 1MAHA 4JQZA 3FFXA 2YKGA 2O23A 4LHSA 1Q14A 1EH5A 1U28A 3LQKA 1OZAA 2HF7A 2YHUA 4XCVA 3M70A 3SQNA 4EYGA 1U63A 3VDNB 3GGJA 1GCIA 1BU5A 3UV6A 4TTJA 5BRNA 4MDHA 3R5SA 4H77A 3R9IA 1Y8RB 4EDHA 4Q15A 2RJNA 4Z4HA 2VP5A 3H3FA 1T3HA 4S24A 4PNEA 5KYNA 1FSPA 1GEGA 4OI1A 1YL7A 3M6WA 1X8LA 1REQB 2C4VA 4UEKA 4K0RA 4DQUA 3WKAA 3OPQA 4GDMA 2C20A 3JAKB 1CY6A 5ES4B 1GPMA 16PKA 1G2QA 2ZTHA 1RQNA 4BNFA 1J7KA 2JGIA 1DXHA 4RHXA 4B3CA 1G6KA 1VI5A 2I2BA 3GG9A 2I4LA 2VBGA 4WZBE 1FQKA 2MOKA 2R7NA 1O8BA 3EWIA 1D2NA 2H5LA 4D9JA 2WNIA 3HFJA 3CH7A 2JIPA 4IXDA 5KYYB 4YRIA 1A9ZA 2NMVA 3LCRA 1OFUX 2XMCA 2BGLA 2D3TA 1CRQA 3O7MA 1MG5A 3PTLA 2H4YA 5HKKD 3FWPA 4GC9A 1Y3IA 4P80A 1U1GA 1R64A 4TWRA 4BVBA 4Q7MB 4L02A 1O54A 4WOKA 4Z0NA 1WEHA 1MZVA 2IXEA 1YS9A 2G28A 3IV7A 1IWPB 2AJ8A 4EX6A 4LYAA 4HDKB 1LCIA 5KKAA 3SJZA 5KDOA 4KQ2A 1FJXA 3T5TA 4IUBS 4JZYA 1R74A 1PR3A 1UBHS 4EEZA 3PQ6A 4TV8A 2C9BA 4I5FA 3ZDXB 1FPMA 3A3KA 3MILA 4HDQB 4QXMA 4D46A 2ST1A 4HAOA 3P9KA 1GG9A 2DQYA 2HU7A 5DHSA 3AOEA 3P5BA 3N5KA 1IBCA 2C4KA 4RENA 1EE1A 4CEJA 2HSDA 3C39A 3H8SA 4U0JA 4HB3A 4BX3A 1CBUA 1TKRA 1X15A 5ILOA 1NDUA 3KR0A 5TF0A 4JLMA 1TGVA 4Y1RA 1N8KA 1GCOA 2BEUA 3VV2A 3QPWA 1W73A 4M9ZA 1IVNA 1T8UA 3JARA 4MAAA 1K0UA 3CV3A 4WXPA 2Z09A 3HM9A 4FDVA 3UAYA 4FFDA 1EGMB 4CDRA 4D1YA 1ZZEA 1E0JA 2VSYA 3EXG1 2X8LA 3UENA 1QVAA 4AJNA 3OPNA 3I4LA 4C22A 1NONA 2VPYA 3BMQB 2Q1TA 1T15A 4L7QA 5GJVC 5EHIA 1E59A 1JIJA 3LQRA 4H3SA 1BDJA 1AMNA 1KAHA 2IE0A 2I03A 3A1NA 3KVRA 4FONA 3R7FA 3SYTA 2RMKA 2NQ2C 3GLHA 4XJXA 1QRRA 1YV9A 2LUOA 1EVZA 3EAFA 1Q1AA 4YJ2B 3ZD8A 4R3NA 1CUVA 4DNXA 2QPTA 1I7LA 2PKEA 3WL3A 3OTOB 1NWCA 1TDJA 4P7KA 5ALFA 3FH0A 5IJZA 1A5BB 4HQOA 4QDKA 3W8DA 5MGNA 1ZN8A 2RGGA 2P3QA 2FMFA 1VP9A 2OUKA 1S2OA 1J25A 3HRHA 4UNRA 5C5IA 4JC0A 3V6LA 4WOPA 3W05A 1MA0A 2P2LA 2WD8A 3JASA 2JJ2A 5ECGC 5LZ5A 3A10A 4OV6B 5E2BA 1AUPA 1RLOA 3PHBE 5I7VA 5IWCA 3AYXB 3FDZB 5I9SA 2RI6A 3RNLA 2PT6A 2Q9CA 2VHXA 4NG5A 2WTNA 1BMFA 3UUEA 2RE8A 1DL5A 4JQCA 3B1KA 3RFCA 2I91A 4PQYA 1SVWA 4AULA 4D8VA 3UJAA 1YUBA 3FHOA 1OLSB 2X1VA 2I7XA 3I9KA 1IJEA 1PZNA 3DE0X 2CMGA 5FEMA 1LK0A 3UY4A 5TGDA 4E13A 3GT3A 4S0ZA 1K0FA 1KKMA 3K0CA 3HU2A 3KJIA 4ONEA 3PF9A 3EUAA 1QRDA 1X14A 1OQAA 1P6UA 5D3MB 1JAXA 1R0BA 3HU5A 4ZRMA 2XNHA 1TA0A 3M1IA 3OQOA 4JOBA 1GPUA 4KWIA 5I4BA 3EEOA 1O0CA 3TX6A 1XZCA 1AS3A 3JZMA 1FRFS 2YIDA 1UK6A 1FVHA 3GAFA 4W9NC 4JYMA 1ORWA 1VBNA 2LE0A 5ALIA 2R4UA 4G67A 1VHJA 1BEEA 1AUXA 1CUYA 3B1ZA 1TM1E 3A4YA 3ZNOA 5A6SB 3CZAA 2GJ4A 2BKEA 1DAHA 2BFPA 4FHCA 2WF8A 3B51X 3C3XA 1G4HA 4R2JA 1G60A 2P9TA 1DQRA 3W04A 2RBGA 3AX6A 2B78A 5EWLA 3PKJA 2BOVA 2IEYA 4BUCA 1WNFA 5KVSA 3CX8A 1MRSA 3A7DA 3IAS6 4INZA 1H1LA 1DJOA 2Y67A 1FBNA 5GOZA 3CN7A 1G2IA 3LQ1A 4QD3A 4DMHA 1WBBA 1I51A 3TJRA 1FSSA 1HQDA 5FLKA 3PGLA 1QH8B 3O8OA 3RIHA 3AHEA 4NE7A 1OTHA 4J2OA 3UAXA 4ECEA 1T1RA 2ERXA 1NXXA 3V3KA 5CDYA 3LZCA 4TKVB 4LHVA 1OHHA 2H0QA 2A78A 3VO2A 1XOIA 2I4TA 1J22A 1GEEA 2VSFA 3AETB 1VSUA 2QRGA 4ND7A 2W6QA 4LOLA 1QKIA 1MZPA 4C4ZA 1XRNA 4TSFD 3PD7A 1O08A 3OSUA 1C7QA 1DFHA 4GNRA 2GCIA 3E4DA 3FZQA 3LW8A 1OI3A 2YC4C 2Q3CA 2R6JA 3KKMA 4FE4A 4N8SA 4OU4A 4YN3A 3LQYA 5IDXA 3OQBA 3LI2A 2P2NA 4DLWA 1UT8A 2AJBA 4N47A 3N8NA 3L8FA 4KUEA 3KVYA 5F7OA 5I7RA 2XLBA 1RAIA 3T1QA 2BJVA 1SN7A 2ASVA 1UJMA 4B73A 4R2MA 5LQSA 5K3FB 2EGHA 2WB4A 3FBWA 2YVQA 3EOAI 3EXIA 5D1HA 3UG7A 1KI3A 4AJ9A 1U5AA 2F8MA 2X2PA 1K5GA 4XDHA 5U1PA 4KTVE 1IRXA 3QBJA 1ULZA 4DV1B 2EZTA 5E38A 4KC0A 2AKYA 3SF0A 4BJ3A 1KI1A 3QXGA 4B3DA 4EG8A 2IXDA 2P2YA 4UNQA 3E5RA 5ELMA 1KDZA 5IF3A 3L6EA 1JVBA 4R7TA 5C4MA 1JQ3A 1NVEA 4ZFNA 4R3WA 4KEAA 3WYGA 2ILTA 4H3VA 3QELB 4FYWA 1PJLA 2YQ5A 3WLKX 1JYSA 4KXMA 3D6FA 4IHJA 3VGJA 4IGEA 2J6CA 1Y3DE 4RPIA 4ZXPA 4EKIA 5DYIA 5HF5A 2D5AA 4FZVA 5FR1A 5IVDA 2IH5A 3TIGA 2XNKA 3HV0A 3PU6A 2WVAA 2PDAA 2B2XA 4RELA 1XPUA 1WHTA 1Z5WA 3V33A 2WTUA 3DMFA 1ZISA 1OX4A 2BHSA 5F77A 4YMTA 4PC7A 1F2UA 3EXHA 3I6MA 4OQMA 1LRJA 4M46A 5AW8A 5ECYA 4ZGWA 2IU3A 3BSYA 1U3DA 1YMUA 4ZV7A 3FMOB 1UF9A 3H5TA 3WRWA 3CR7A 3MVEA 1EXMA 4NTZA 3BEOA 1ISIA 5K8LA 4EB0A 5BR1A 1WZ2A 2Q46A 2ZUSA 3FNFA 5TRTA 2ANCA 3OICA 4ZI3A 2OVFA 5EXDA 1F1JA 2O9JA 3ESBA 4YRZA 2I2XB 2X1HA 4ZARA 2B36A 4ESVA 2PXAA 1K7EB 1MHPA 2OL4A 4WNIA 3VDXA 1DQSA 1V7QA 2PZJA 3FMVA 3KHTA 3H9CA 3C43A 5D3KA 4ZVLA 5IM5A 3SBEA 1R0LA 1SM4A 3HYTA 2BZ1A 3BDIA 3STUA 2C82A 4W9MC 4EO4A 4UDXX 2YXBA 5C37A 1JTFA 3TL3A 4LSMA 2C5LA 1GPWB 3FROA 3OAAD 4NU5A 3DOIA 4UDNA 4V2IA 3ZQKA 2JI6A 2IBTA 3GLFE 1U0BB 1FNMA 2B8WA 1NLYA 4OUDB 4U3JB 1J8FA 5BOVA 2HMUA 4B4KA 1YGYA 2OQRA 4LOKA 4AN0A 4OXKA 1GWNA 4GD3Q 2H7YA 3GRKA 2ZYGA 3FRHA 2NP7A 1ZINA 1D0IA 5EJ6A 4DKXA 2V03A 4NQZA 3AJDA 4N8DA 1U2QA 1SU4A 2ZB3A 3WXBA 2VH1A 3WWYA 3ABRB 2YX1A 1N8SA 3E7WA 3W5CA 3I2YX 2GK6A 2N47A 3W5DA 2XOXA 4U63A 2IS1A 1O96B 2R68A 3LUHA 2EV9A 3W5IA 4ITVA 3E7PA 1SUEA 5ALEA 3UUFA 3QWIA 1OPXA 5E0OA 5JECA 2ZWMA 1YJ5A 3LOUA 3FKSA 2P6PA 1MABA 3IP6A 3KSZO 5EJFA 1UIMA 1JQ5A 4CKXA 3DVSX 1WXXA 4LVUA 3BBLA 5JSYA 5L8VA 1Z16A 2B5OA 2LP4Y 4CF6A 5E4FA 1MAAA 3I1JA 2ZAMA 4BPRA 1DLJA 3ASYA 1T3LA 1I4TD 4RV9A 2ZYWX 4LY9A 3BE8A 3DMTC 2XI4A 3LHIA 4CQJA 3BSFA 3NKVA 5BQ3A 4HADA 1N3IA 1AF4A 2X5NA 1IVYA 3B48A 2CWDA 3L6CA 3NIWA 4M1MA 4HO1X 3AUFA 2ZRLA 4AZ3A 4UMDA 1NA5A 4J3FA 4PHHA 4H0NA 5D84A 4N5IX 1Y5IA 3CG0A 4MQLA 4C43A 2J4CA 4QG7A 1K98A 3E53A 1WW3A 4MSUA 2WMOB 4XR4A 3X0DA 5TMBA 1A98A 3ZV3A 3CQ9A 4XDZA 2IC5A 3LXUX 3P2MA 2AC2A 2JFUA 2WHEA 1QUFA 2OPBA 5EERA 2DLCX 5BV0A 3DDUA 4QECA 4WUVA 5DLPA 3IAS1 2JI7A 5BO5A 1ZNQO 4J0HA 3ROZA 1XNRB 1BDBA 3EDRA 3ZKWA 3I0NA 2Y93A 1ZN2A 4IQ8A 3G2OA 4LJ5A 5DNCA 2GAIA 4IHKA 5JARA 1QPZA 2VDJA 1QIDA 4R0MA 4ZKDA 1KAEA 4IZIA 1I1NA 2RHCA 1PT7A 5KCMA 3L18A 3RG2A 3VBEA 2AG5A 4DDTA 1ZW1A 4FBLA 1XQ1A 3GN1A 4LPKA 2ADMA 2PMWB 5AVRA 2OORC 3WYCA 4NXNB 1J7JA 2V4UA 4HNSA 1KQPA 5CEJA 4FXOA 1TUBB 4RHUA 1JUDA 3SEQA 3BM5A 1UBRS 4C08A 1I1OA 3M6LA 2AMVA 5F51A 3QVOA 1EWVA 3RS0A 4TV9F 4F4JA 1RLJA 3AM3A 1CYDA 2NZJA 3KX2A 4Q3KA 2NZUG 4M3NA 5H5JA 5HIAA 2YCLA 2AGVA 1L5HB 5DOVA 4TTSA 1PUXA 3S6JA 1YE8A 1GZ4A 5HMLA 4TTTS 3WMGA 2Q5FA 3C3EA 1IN5A 2ZE8A 5EVJA 1MORA 1AK9A 1YJXA 3PGXA 5ADHA 5JXJA 2WWTA 2UYOA 5DTEA 4IQ0A 3T1HB 1HYHA 1P39A 3AUTA 3BYZA 3K6JA 2MINB 1NZDA 5BXYA 1KZGB 4J75A 4P36A 3KLOA 1SHJA 3HKCB 2X9GA 3KEQA 1YACA 2HPHA 4WOCA 4CHGA 2BFBA 5FDFA 3QYAA 3HNPA 2OGUA 3MUFA 3ZTTA 3LTEA 4K05A 4UM9D 1G21E 4PICA 4CKWA 5LYJF 4CTKA 3CBGA 2AL7A 4ITUA 4PYJA 2G40A 3RSHA 4UM8B 2CFRA 4BMYA 3PTAA 4KPFC 3LSTA 4MW6A 3OJLA 2I80A 1V8DA 3MS7A 4X00A 2W2OA 1VP3A 3H04A 1OZ0A 1OH5A 2XUKA 1SQ0A 4GYWA 4QO7A 4DADA 1OB2A 4UPVA 2YYYA 3IKJA 5F9HA 2DZDA 3JU3A 4RM2A 5B4UA 1MC5A 1DEXA 2ACWA 4Z8YA 3GJ8A 3QW2A 1E9RA 4K9DA 4JBIA 4FR2A 1NTRA 2EEZA 3R8CA 4GLFA 3TJZA 1DIAA 5CCEA 5CBPB 4XM1A 4C7XA 3L7MA 3G2MA 2L69A 3DXFA 4MOWA 4MMXB 2WYOA 4QNRA 3B1VA 4EVIA 2VK2A 3M6FA 4MITA 5H80A 3TQSA 2AC7A 2FKAA 1RZ3A 3DDNA 4I9NA 5BT8A 3ERCA 3WB2A 1Z13A 1XROA 1EFRD 1PDOA 1V7PC 3IEIA 4HI0E 1DDOA 4Y67A 2WC1A 3DZGA 1R0SA 4DIDA 1B3BA 1TECE 1TVKB 4WESA 3VZDA 3HVHA 3UJPA 2B4KA 1WX1A 3EXFA 4KWHA 1JFTA 1B7GO 2CB0A 4J07A 1QQ7A 4ARVA 2B25A 3ANMA 1QFZA 2PZBA 4JIMA 5AT1A 3SHOA 2V7EA 3ELBA 2C5SA 1DLIA 1QOQB 1T1IA 3BN3A 3R6LA 1TEHA 1W59A 3R0ZA 2O3QA 3EPKA 1CETA 4EMBA 1SHUX 2ZSJA 3CNLA 2XGOA 2JA2A 4OLBA 4GXNA 1EXNA 3HA7A 4ZODA 2PJZA 3C74A 3LGXA 1DAFA 1P3JA 1CUJA 3LFUA 3PEFA 3KYIB 5ALSA 1FF9A 1CQJB 3NDBB 2BEJA 3HR7A 3W9SA 1RPNA 2IODA 2VJAA 2GBGA 2Y92A 1X7ZA 3F74A 4BHTA 4N6OA 4FNGA 2HTFA 2BFNA 1VL0A 4E5KA 5C32A 1RHUA 3DR5A 1NBOA 3AT1A 3MJHA 3OE1A 4Y2PA 5FULA 4F3YA 1RM3A 1CP3A 3E9CA 5HSGA 3KWJA 1ENZA 3WHPA 1BTOA 4C1NA 4FILA 1T4CA 3EF0A 1FP4B 4OGLA 1STOA 4O4IF 2Q29A 3AWDA 1FYFA 5KKCA 1P74A 3RVJA 2DJ5A 3QU9A 2QN9A 1SG0A 2IW3A 5D3QA 3TNFA 5KOHB 2H9IA 1Y98A 3RFVA 4E5UA 4PIMA 1JT9A 1SEPA 2CUTA 2XMBA 2CXXA 3OZGA 4MV5A 4GZLA 2UYHA 4N5LA 5KYWB 4X6XA 1VLZA 5GWXA 1KRWA 3BIXA 3SXUB 1KMMA 3HVIA 1GNLA 5DP1A 4D4LA 5KU7A 1XNQB 3D4PA 1HYQA 4B2PA 4O5OA 3NC1C 2BTQA 3AWIA 2OCKA 2EKQA 5FUMA 1HYEA 3KKPA 3OCCA 2GXUA 4MYTA 1A7KA 4TN5A 3IOMA 2OP0A 4YR7A 5BW6B 3JQDA 2G77B 1P80A 3NHLA 3EGXA 4CWAA 2B3DA 5BWNA 4AG6A 4MS3A 1WRBA 1ZGAA 5UKDA 3FTEA 2FSPA 4BRSA 3EIQA 3SYMA 1WU7A 3L0BA 4WD3A 4E5NA 2G63A 1KQNA 4LQDA 4NAHA 2QPLA 1KJ9A 4R0VA 4BLOA 2XE6A 2QGNA 4I4TF 4DR3B 5JRDS 1ZOIA 4NYJR 2CT8A 2HWWA 1DC8A 4GR4A 2WD7B 1Q6YA 1NWHA 4M4SA 1UDAA 2X40A 2WF5A 4WFKA 1A5ZA 1GSAA 5ICEA 5JJCA 2J87A 2Z3WA 2G9NA 4U5QA 2QNBA 1P2BA 3TL6A 3VO9A 4RTJA 3Q8MA 4Y9SA 3ZHUA 2BM8A 1QF6A 1BFKA 2RK4A 1FJGB 4UNPA 3ADDA 3DTVA 5FH9A 5JFOA 2EP7A 3DE3X 4DFDA 2HO5A 2D4HA 3SMVA 1KAMA 1QF9A 1Y5NA 4Q16A 5TT0A 5HIJA 4QYMA 3M33A 3OFJA 2BCEA 3KU1A 3R7BA 4M0LA 3UQYS 2A4MA 2IWRA 1FSZA 3GBSA 4FHFA 5DASA 4JI0B 1N2JA 2H1VA 3PIIA 3WLTA 2RGBA 5IPFA 3A1EA 3PGJA 3UA4A 4NZ9A 4PG6A 2X0DA 3KE9A 3LDUA 4PC6A 4QE3A 4BBPA 2Q3LA 2BFMA 4JLOA 1ZRNA 1FIUA 2FPLA 4IOLA 2OV6A 1WXDA 1M75A 4O08A 3M49A 1NR1A 2F62A 3CY6A 3L6BA 2O7VA 1QHNA 4NBLA 3ORHA 1E1QA 3UFXA 2GBLC 5EIWA 4C2TA 1E9AA 2WZBA 2CBGA 2CV1A 1T1SA 4DDHA 3SBOA 2FW6A 3R76A 3WAGA 1YZQA 2ZB2A 4KQGA 3FLEA 3T5DA 1XQ9A 5ITSA 1Q2XA 1EK0A 2O06A 3CMMA 1KTIA 3KZVA 4QA9A 2IBSA 5A3RA 3CNEA 3JQ9A 4NY1A 3OFVA 4D97A 4EHIA 1NVWQ 4LX0A 3K2IA 3W5SA 4C3UA 1OWOA 3U6BA 4MEJA 4CMIA 3I1IA 4WX2B 4QARA 1P4RA 3I9V6 1J2UA 2ODTX 2Y68A 2ZBPA 2G4VA 1UPCA 3QI7A 1BCSA 1M1ZA 3BMNB 5BSEA 2CN1A 4D9EA 1AVTA 2B1JA 3VUFA 1SU8A 5D86A 1DFGA 4DVGA 5CITA 2FPGA 5CDSA 4FR5A 4ZVVA 3PUXA 1UXHA 3V8QA 4XJTA 3AJRA 3L04A 3OUUA 3GH3A 1P0MA 4C89A 1MDBA 3ULKA 2ZAOA 4HS9A 4N3GA 1JBKA 1FLVA 2W71A 4YDQA 1SUWA 4V0KA 4C4RA 3VR3D 1RWBA 1JG4A 5EN4A 2ZQZA 4QU5A 3DOEA 4N3AA 4PZAA 1NNUA 5LKRA 1NQVA 1H8EA 3L9XA 3Q2IA 1MTOA 3PPXA 4DANA 1L3IA 5CDHA 4HLUC 3PC3A 1QTRA 3FPEA 1I2CA 1S4QA 2XA2A 1TPZA 5HDBB 5JPIA 4C2AA 4DF3A 2JIMA 4LJRA 1OXXK 1SUFA 4LA4A 4LV5B 4UBNA 3R75A 2J32A 2BJHA 3W4IA 1UT5A 4C05A 1IONA 1K8XB 4QM6A 2XUZA 3LDHA 2YZGA 4YV1A 3N3AC 3RGWS 1FL9A 3A26A 2OZEA 1VHQA 1D8AA 4Q4JA 3M83A 3RHZA 5G1PA 4B0PA 3ZHBA 4F1JA 1NJFA 1JT2A 4LZNA 1JWAB 1VE6A 3FCAA 4LZAA 2NSJA 3N8GA 3VDMA 4BDTA 2MU1A 1LQTA 1D7OA 1DQYA 3VNQA 4WOBA 2PO7A 3OTQA 5FAXA 4DV5B 4B5LA 5ALGA 2FN7A 3R8XA 4RJTA 4R98A 4ZQFA 2OK8A 5LB2A 5TQJA 3VKFA 2JVJA 4UTPA 1IXRC 1J21A 1GPDG 3P9RA 2HIMA 4IICA 3D0RA 1KOLA 4DLUA 2PUGA 2Q3MA 1M8JA 2ZRHA 4PZLA 4UNIA 3V4VB 3BKXA 4DS3A 2UUAB 2R97A 4WH0A 2V96A 2AHOA 1NOJA 2RC5A 1X7XB 4Y30A 4XVCA 5JHGB 5DI9A 2ZJ8A 4ZPXA 1N6OA 3HG7A 3TFQA 1XK7A 2QMQA 1TQ4A 1S01A 1YRHA 1S5PA 3EDOA 1ANKA 2PZEA 4AY4A 3PNPA 1QS0A 4X24A 1HDYA 2Y99A 3I23A 4O2LA 1UAYA 3SM9A 1C8KA 1K6MA 2Z9CA 3AVOA 5U9CA 4OQXA 2FR8A 2FG6C 2YHBA 4HMOA 5KPDA 5AW1A 3WMRA 1WKVA 1JFVA 1F2TB 1NLUA 4XX1A 1ELOA 2J7PD 4ZT7A 5H0IA 5CFPA 5U4QA 3VMMA 5F5NA 4MV9A 2H57A 4IYJA 5TARA 1I36A 4LYEA 1AN0A 4B79A 4YEDA 2WG1A 2AMJA 3EVTA 1H69A 3CRQA 2DQZA 5ULLA 1DCFA 5CTAA 3WL4A 2IDZA 4HDSB 3L7YA 3NAGA 2IU4A 3DFKA 5HE8A 2MHCA 1C8BA 3TO5A 5CDFA 1DGQA 3PUZA 4BUJA 1E1CA 5J58A 4F38A 1T1JA 2JCXA 2YCBA 4FVTA 4WZAA 2DPGA 1X1TA 2B20A 2ZUWA 4FPXA 3SG0A 1L1QA 2VCEA 1BMDA 3GZNA 2W2PA 2O2ZA 4OJYA 1PVOA 5H02A 1U6IA 1L5QA 3TUIC 1QC5A 3CZ9A 2O0HA 1TKBA 2GI4A 1RZUA 1NW8A 2AB0A 2DMRA 2OBLA 1PQYA 5CLGA 2ZW9A 4QOJA 1TK2A 4Q4HB 2XNSA 1GADO 3MGCA 5E1MA 2FF5A 4B4VA 1QE5A 2K2WA 2GK7A 4U7PB 5CEEA 1VE9A 3IIKA 5FNVF 1FXWF 4UOEA 5HKAA 2GARA 2BMAA 5TR9A 1N4DA 3T1TA 1V1MB 4TV9A 2PUDA 4FMDF 4EY8A 3CZQA 2P9GA 4BE7B 3S55A 4MUAA 1ECFA 4XOUA 3VNVA 2JGKA 4YRPA 2PEZA 2XT0A 4TLAA 4CKEB 1EHCA 1F6BA 4MW2A 5JXHA 2R1TB 5BSGA 3L7CA 4FWTA 1KAGA 1OUMA 4MO9A 5FWXA 2QL7A 2BP7B 4MZXA 4G1VA 5IXSA 4PFKA 1OZFA 4A15A 1GKKA 4TKZA 4W1PA 3CPSA 2HJVA 1LI4A 3H1EA 3O31A 3PQ7A 1E0SA 4B4DA 5FLYA 1ZR4A 4ZMRA 4GPBA 3B9BA 2I99A 2VBCA 5FBLB 3A9CA 4UHCA 4YYEA 3ZK7A 2HCBA 2JW5A 3QVUA 4Q3BA 4DMMA 1F3OA 1TF7A 3KR1A 5E1BA 3BA1A 5ALMA 4MV7A 1FRVA 3OOYA 2PE5A 4DR4B 2WAAA 4TGLA 4HGYA 3K16A 2AN1A 4Z9YA 1CULC 2VAPA 3QX8A 1AQNA 1AA9A 4K9RA 2FWIA 2G71A 3ETGA 1J9ZA 1I3OA 2FA9A 4IH9A 1TNDA 4M9SA 3EYAA 1KMQA 3IHKA 4J0DA 4I81A 2HHJA 3ND9A 1RBQA 1Z2CA 3P0JA 1OXSC 1OBOA 3O4GA 2O1WA 4FZRA 3ZWBA 5FADA 1ISRA 5IARA 1YCHA 3BZBA 2FW1A 1TMOA 5ERYA 1ZCJA 3I9V1 5EZQA 4DR5B 1IZ7A 4ZC1A 4RZUA 5FYDA 8AT1A 1A2BA 3DV9A 4ODIA 1KMHB 1RCFA 2A9QA 1KEZA 1R6XA 3ON5A 1WY7A 1PV1A 1SIWA 3LQ2A 2FFAA 1WB9A 1MJGM 4H60A 4P0QB 3W34A 4NR0A 3NEYA 1SY7A 3OX2A 4TOIA 2QSJA 1KYTA 3QJGA 1GNTA 1VIAA 2PGLA 1OXBB 3LFTA 3OQPA 4MPRA 1EX1A 4W7HA 3F67A 1L1EA 3M4JA 5HRCA 5HQ3A 3KOZA 3ORYA 5EQJB 2DVMA 3R6TA 2F64A 1CDOA 3HPRA 4EF6A 1A1SA 1WSDA 2XH8A 5ADWA 1CUFA 1XQ6A 4TUYF 5C8VA 5TIIA 4QX6A 1UAGA 4QYWA 4EBBA 3JS5A 5K0LA 1T5OA 3CLUC 4HYTA 1XJ0A 4LDJA 3M82A 1H8HD 1M54A 4BFWA 3EEBA 2CL5A 3A3PA 2PZKA 3U7RA 5JEDA 4NU0A 4G26A 3WWZA 4QRHA 5CDUA 4DA7A 1G59A 4Q3LA 2NUPA 1PJ3A 1VPEA 2O1XA 4OB6A 1X0XA 1U3VA 3CPJB 3ANXA 2NOAA 3GEGA 4XX0A 1M2HA 1J0XO 2BFDA 3EC7A 1QFSA 5DK6A 4E07A 4XD2A 2JGDB 2Q5JA 2FFRA 3CYFA 3DP7A 1PV4A 2QN6A 4W99A 1KSFX 3RU2A 1U7DA 3MB8A 4B44A 3JQQA 2Z2ZA 1VECA 2V4MA 3ZOKA 1C3JA 3O47A 3QMMA 4LRTB 4XUDA 5DT9A 1CX9B 5TNXA 5KDDA 1THMA 1UMBB 1Z5UA 1N2XA 2VYCA 2HXYA 3KOXA 3OIGA 2B92A 4HNQA 5JSKA 2M6LA 3RTCA 1IQRA 4ZAZA 4ZMBA 5L51A 4O4IA 4P7GA 1HFKA 5KAPA 1GL9B 1MUUA 3PX2A 1NVFA 1KNXA 1TTHA 2OXIA 4Z7QB 4JHLA 2B94A 5AXAA 1RI2A 2CLIB 3GLTA 3DF9A 3NBFA 2CLEB 4MUKA 3AHJA 4B4UA 3FPAA 1RAGA 4KKXB 3DWIA 5J4LA 2COUA 3CLRC 3H9GA 3TOXA 5JWOA 2ODWA 1XN1A 2HC9A 4RD1A 5DTIA 1KFCB 3FNIA 3L7BA 4Z1MA 2ZOSA 1DI0A 1F0NA 4DJDC 2PMKA 3M3DA 3B36A 2HHLA 3F6BX 4M22A 5JMPA 3DZKA 4BEJA 1WMEA 4DC1A 2SKDA 2H4FA 4NI5A 1FJ2A 1VI6A 2I6QA 4LECA 1K3FA 3NO4A 1QDEA 2E82A 3S7ZA 4ZEOA 2FLWA 5AW9A 3RG8A 1W2GA 1VJGA 4MINA 2FVYA 3OCWA 1T9DA 2ZM5A 4F56A 4UHDA 2BE9A 1OU4A 1TAQA 3TJMA 3TR5A 3UJ9A 2HK9A 3VAAA 2V9CA 4I55B 2SKCA 3K72B 1OKKD 1TM3E 1H5QA 4EHDA 4I4TA 1TM5E 4GI3A 4LY6A 4BX2A 2VUIB 5EXTA 4WBNF 2FPKA 1AGPA 1USIA 4NENA 3B6IA 2IRWA 3PC8A 3UW3A 1AV6A 2VHEA 1JIIA 3MJTA 4IVRA 2QU7A 1TJPB 1UC5B 3TH5A 2V7WA 3OECA 2AE1A 4BNDA 4R84A 4HHEA 2QV7A 4MRMB 4YDHB 1S3IA 2RKOA 4B6OA 4NMWA 4WXHA 3QXJA 4D4KA 4FGJA 3FLMA 1V1JA 4ZVPA 4I14A 1BHO1 4JJAA 2C3PA 3N7AA 2HLHA 2XF8A 4Z99A 1COWD 3OLVA 4H7FA 4S3MA 3ESQA 5IKOA 1QHHB 2A5DA 5KHLB 3X1MA 2CBXA 4E09A 3B8HA 8MHTA 2AI2A 2D3WA 2QZ9A 4DRZA 2ENWA 2XVYA 3Q40A 4DV6B 4XB1A 3MWFA 3NW9A 2DTXA 3FVQA 3T7IA 2PYZA 1H9AA 2F1KA 3D7SA 2MSLA 3FCEA 3PT9A 3ILHA 1QP7A 2DEUA 3SNKA 2ACEA 3UOAB 3G0BA 2EBUA 1UC8A 2ORYA 3NHZA 1EEHA 1GNRA 3A06A 3G88A 5TEWA 4ZDJA 3LUFA 5IAOA 5IG2A 3K6SB 5C1IA 1L4FA 2ZBEA 2XYRA 1GPAA 4ZHQF 1Y9JA 1O1YA 5I4CA 3Q98A 2VF5X 3F3KA 4Y7DA 3G0OA 4NRDA 3LLSA 3NV9A 2WM2A 4E21A 4OQLA 2COKA 1Y6FA 3DPIA 3KQOA 5JCXA 4ARIA 4TZKA 1M5TA 1DKNA 3WGVA 3NFYA 3NDIA 4MS4A 4BMZA 1JXQA 2GGSA 3CPHA 4W1SA 4K81B 1N2CA 4YO7A 5B1IA 1Z82A 5EPEA 5J5AA 3ZOZA 3AR2A 2Y0EA 2W8BB 3EYWA 2PKCA 4V03A 1CZLA 2G83A 4EMTA 1SIBE 1RVV1 2OBNA 3M1LA 1XZJA 1RHJA 4QZVA 2FZLA 3NOQA 4UM9B 1XTKA 4G5QA 1MP0A 1OC2A 2NXCA 2RHRA 4JFRA 5DN6A 1PW5A 2ZUVA 3VVMA 5BR4A 1XFDA 1W46A 1XTBA 4MTLA 4P7BA 2VHCA 4ASUA 5IDWA 1JFRA 3T3PB 2FPXA 4WACA 1WV1A 2I3AA 2ZZMA 1IBSA 3LYHA 3ML1A 1I3MA 2HYDA 5AVWA 4MWOA 2IH4A 2XV1A 3IQEA 4RD6A 3CSSA 2OV4A 5DSZA 2QX7A 2FPRA 4CM4B 4TMTA 1N5IA 1VTKA 1XWWA 3K3PA 2X8WA 3V6MA 3UAZA 4P3NA 1CJTC 1JR3D 4H1VA 3Q0TA 5HRAA 5JAHA 1L6RA 3Q72A 3PDWA 2EWMA 2Y27A 3JQPA 4E1VA 4KPYA 5CM9C 1NW7A 1WVMA 2PLWA 1CZUA 1J6UA 4Q1BA 4CUKA 4EUKA 5JIBA 3RADC 2YN2A 4R7GA 1HG0A 3BHJA 4BU0A 2CNBA 4RWZA 3RNOA 1QO0A 2OMEA 1ZU5A 1RZRA 4LWZA 1DZIA 4HDNB 4ID9A 1E1QD 1M2OA 1RKXA 5DFAA 5H1YA 3UXMA 1C7FA 2O0MA 3EWNA 4OCZA 1CUEA 4YP7A 1Z73A 1S8NA 1FTSA 3GAMA 4H7PA 5A7HA 2WWVD 4AP6A 2QTVA 2N1BA 3U4MA 4UHHA 4OHPA 1QR6A 4N5MA 3PCXA 3D54D 4J8PA 3LL7A 2RGYA 3MLEA 3HBFA 9ATCA 5FWNA 3R7AA 1E69A 4L27A 1JECA 4F3NA 4RY2A 3SJAA 3ZI4A 5DHUA 3PRYA 3KTAA 1KWKA 2C29D 3NIFB 3RTBA 3VZCA 1AMUA 2H3EA 2VO1A 1NNI1 4JZKA 4MR8A 4RKFA 2JLWA 3O8DA 5K6RA 5L7TA 1SXIA 1VLHA 1Y7IA 2VTVA 2H4HA 4G0ZA 4NK4A 3X1KA 1CQPA 3TVYA 4UM7A 3EW7A 2C57A 5HK9A 4IDHA 5FR2A 1ZGGA 3GQVA 4KVAA 4B3FX 4EPRA 5L3SB 1DG9A 3T3OA 1GRRA 1NN3A 3VZBA 2C2KA 1U1FA 2F7SA 1AUOA 3SZGA 3HE3A 3S0JA 3ZUGA 4K28A 4WNAB 2UVPA 4TVOA 2C7OA 2G82A 4P3YA 4YXWA 2H07A 2QAJA 3OZSA 3U7QB 4W1RA 1ZY2A 4TMXA 1E8DA 5KJCA 1SC6A 3LDFA 5AVSA 2IYVA 1GUFA 1Y6JA 2WA2A 2ZIZA 5JASA 5IH3A 5AJXA 4RGBA 3GGSA 3R23A 4UUQA 3FI9A 4JX8A 4E32A 1NXQA 2Y1XA 3HBJA 3PC4A 4YT2A 5TQ2B 4PY2A 3ZV4A 5JXGA 3K7EA 5FA5A 5HS6A 1QGYA 3RFUA 1EDEA 4IQGA 4NMLA 4OI2A 3VFDA 2HCTA 3MT0A 4CL0A 2Y2VA 1A8UA 4MMZB 4QHTA 1D4OA 4OY3A 3I58A 4GPZA 3AP2A 3JQFA 2I87A 4KLZA 1ML4A 2B98A 4AZ0A 4NJEA 3TQHA 3LHDA 5BW8A 1W5FA 1D03A 4KQHA 1EFDN 4MI6A 4KCGA 2RAVA 4KIGA 3P71T 1ZOOA 5EXSA 4BKOA 1E2DA 1NASA 1WM1A 3K09A 4P92A 4JKOA 2E3JA 1XL0A 2IXBA 2WILA 3D6TB 5AHOA 3DOCA 4EEXA 3EQ6A 3WTCA 3AM1A 4L72A 2JJQA 3LDAA 4WGFA 2YV5A 3OP1A 4MWCA 4WNYA 1L8AA 3ITKA 1EE9A 1XVAA 2RD2A 4DLAA 2IYAA 1LBQA 5FNVA 1FXWA 1K86A 5LKAA 1ZH8A 1T10A 3IH5A 1LK5A 4FW8A 2V6GA 3MCTA 1H0KA 4IM7A 2P7IA 2XUAA 4OP2A 2X3FA 4YMWA 3RC1A 2GPBA 4EKNB 2OOKA 3A6LA 1W76A 3HA5A 5T67A 1K4YA 3HFRA 4GVPA 1G3UA 4UJ3A 3WRYA 3FAKA 2OCLA 1E98A 2K4MA 2YIVX 5E7IA 2BMJA 2FZVA 2EF1A 3G2NA 3QKSA 1D6JA 2W90A 3R8FA 3HO1A 2HR1A 3A6FA 2O8EB 1R9GA 1M33A 1N0HA 4WSOA 5F4BA 3W1WA 3CR8A 4EOGA 4DB4A 2GUGA 3FR8A 1UDBA 1HDXA 3PGMA 2I78A 3R4VA 5EIAA 3VNRA 3NX4A 1HNNA 1DMSA 3JR3A 4N48A 2W2MA 3FHJA 3R3JA 4LMBA 3AERA 1VCIA 1EXVA 2FX3A 3FI0A 1ZIYA 5JU6A 3TI7A 4B7AA 1NRIA 4GOND 4JVOA 2NU8A 3OLYA 1HDOA 3IQWA 3G02A 4JB8A 5IC6A 3WIEA 4Q47A 4BEWA 3SWWA 1T8WA 4A7PA 4DBZA 3O2QB 5E8RA 1DBSA 5JCJA 3U56A 1G8AA 4IEFB 2FRDC 4L4RA 4EB3A 1UK9A 3SLRA 1NVKA 2QYOA 4TRNA 3GFTA 1OWMA 1YR6A 1IL0A 2ID4A 3KQVA 2HXGA 4KXXA 1ZSNA 5F3DA 4L8LA 3RR2A 3RS5A 4NE9A 5KVQA 3SDBA 1AZLA 4RZHA 3O8LA 1X8KA 4BTVA 4CLOA 2NYVA 3AZPA 1JV2B 2WM8A 5DTQA 1Z33A 2VNIA 3RS8A 4EY7A 3HVUA 3D3EA 2ZXFA 3NWPA 4PV7A 4EHBA 4RVCA 4JSRA 1JB1A 4X90A 5JSHA 1EJ2A 4FOTA 2NTJA 3QX7A 1JF8A 1MIOB 4GYYA 1J8QA 3SDZA 2OCXA 2OHOA 4QU9A 5DLEA 1QIKA 5EJ4A 1DARA 3BS4A 2I33A 3EH1A 4HWKA 2A5LA 1YDWA 3CRRA 3E0XA 2H1WA 3V5NA 1UZNA 1VJCA 2G9RA 5CLJA 1AO3A 1N0IA 2YJTD 3F7NA 1BDHA 4HMQA 4Y9TA 1Z9BA 3KD2A 4LPSA 10MHA 2PHZA 4ZJUA 2W48A 3PE3A 2R6GA 2QTHA 3MWJA 3UMVA 5LLTA 3PLAE 5AYVA 3MMZA 1U9IC 4XWYA 2EP8A 2R2GA 3B1JA 3T5BA 2H5IA 4OLFA 1EVEA 3CURA 1KEPA 1PR2A 1YE5A 4C04A 4CFZA 421PA 2VT7A 2G72A 1F5NA 4TUYA 2AK2A 2CNLA 4D4IA 1DRKA 1EQAA 2BFFA 2GZ3A 4AMYA 4BVEA 2VP2A 5CXQA 7ADHA 4G1UC 3I9JA 4UULA 3QSYA 3EHEA 2QJOA 3GJXC 2BM1A 1SC9A 2QUKA 3HUEA 2ZCUA 2YICA 2Z8YM 4LMPA 3RB8A 3V3TA 2NG1A 1CUXA 2HLNA 2ZI4A 3R5JA 4MROA 4UUAA 3HXQA 1NRXA 2QG9A 3MS4A 4U8HA 4JCCA 5ALOA 3DGFC 2QM0A 3MELA 5FQNA 4ZDIA 3UEOA 2ONYA 3GEPA 4EITA 2OZLA 4KXWA 2CFIA 1P17A 3GUCA 5CNJA 2VRBA 4Q02A 1YNOA 4OHMA 4DN6A 2PSJA 2VA9A 3IDZA 3PNYA 2FFJA 5BN5A 4BZZA 4DEYA 3CRW1 3SVLA 1DOZA 2R60A 4DA4A 4NHOA 5TQ0A 3THSA 3KZMA 2HIGA 3RREA 1GTMA 2Q5QA 4Q03A 1NRWA 2C4NA 2B61A 2O2CA 3NCTA 1C0KA 1P5JA 2XNJA 3LC7O 1ND6A 3Q10A 2FTKE 2OTCA 4QT4A 5LU8A 5C52B 2HIAA 3VPXA 3CNNA 1YKSA 4FB5A 1A9TA 2Z2JA 4YJFA 1HMYA 1L9KA 1YZHA 2Z58A 1HTWA 1GFIA 2I3BA 4PZEA 1IULA 4RA6B 1E7MA 1MO6A 5B58T 5CVJA 5GY7A 1OIWA 3FGOA 1F3LA 3GMDA 4N5HX 4ON9A 3ZN2A 4EGSA 4B76A 2CJPA 2X7HA 2GLTA 2IYNA 3QKWA 4KR3A 1RHKA 1T6XA 4ZMSA 3FNGA 5LIPA 1O95C 2ZJ2A 3CR3C 1KTVA 3OLZA 2C4WA 2D0IA 1NP7A 3HY3A 5I7HA 2JFHA 5FQOA 2P2ZA 1KO5A 1YVPA 4M76B 4FFVA 3ABSB 4CN8A 4CDGA 1YR8A 4MUEA 2PRZA 4K03A 4WBNA 1K4MA 1JEJA 1Q0RA 4N7JA 4KVZA 3V7FA 1ZWKA 3MWGA 4QUJA 3FPLA 2V3WA 3MOSA 3VZPA 3X1DA 1JG1A 2VCYA 4BQRA 2HJHA 4TPKA 3BRCA 3BGIA 1KE1A 4CI9A 1W4BA 1Z38A 1IAVA 3TMYA 1ZMOA 1KK3A 3AHGA 1P44A 2GESA 4MRVA 2O7RA 4BP9A 4CPDA 4DEXA 4EKYA 4JEMA 3LT1A 4RAOA 2Z4TA 4A0GA 1P9LA 3WYBA 3H8WA 4OI0A 1JILA 3SSNA 4EGJA 3VOSA 3ZZNA 1U02A 2H9YA 2Z2XA 4EYSA 2GZAA 5M5BA 1GCGA 2DC1A 2J4FA 3AEKA 2R8XA 3MWEB 4ZC8A 1LB1B 3PNLA 4LHWA 1RXIA 2FPPA 3BZWA 1WY5A 4K9NA 4R31A 1OVGA 3B82A 3M6MD 3PD0A 3IPRA 2J5QA 3QBEA 4JMLA 4O6VA 5A4IS 5KTRA 1IBMB 4PFSA 1SXPA 1JTVA 5THKA 4MVJI 1M8GA 2IU6A 2EDCA 1RLUA 3GZ4A 4CBVA 1MX1A 1IUKA 2FN9A 2WM3A 1N6PA 3GLIB 1KDRA 4CCYB 5KQPA 2I9KA 4JP8A 4ARBA 3K70D 2HPVA 1PNVA 4MNTA 2I8AA 4CIVA 3CW8X 3R0IA 4EY6A 4ZHQA 1JSZA 3JQAB 3OE5A 4HAZA 2XDWA 1EM8B 3Q3IA 3TPCA 4WN9B 4KXNA 2H54A 5H70A 2Q2QA 3THWA 1RWQA 4ENVA 1OSNA 1IHDA 1VG1A 2C9ZA 2J9XB 4UVHA 1JEQB 3VKVA 2QBYA 4HZUB 3Q41A 1TJ4A 5G1OA 3EF3A 1WWKA 4DIMA 3O8QB 1I33A 2LR0A 4EKEA 1D04A 2W6IA 2ZKIA 3FUCA 5FP0A 3WZLA 1VXOA 2P69A 3O8BA 3QBTA 2VZ0A 4MCJA 4JI4B 2ZDQA 3V55A 4KREA 5BWMA 1YCFA 2DUUA 3CVWA 1SCIA 3EBOA 3QKUA 4BQQA 4YRGA 4AWBA 1LRLA 1DKQA 1DTWB 4U9HS 2Q0SA 4CN9A 4FQ7A 5K6AC 1RT9A 1ZDMA 1ZUNA 1KZYC 2IJGX 4G4SO 3U7EB 3Q6MA 3D6MA 3P2KA 1Y8ZA 4HFNA 1S9HA 4XFDA 5KNCH 2BFOA 1JQBA 3I30X 3JQBA 1GGVA 1ST3A 1X74A 4W82A 1YI1A 3IAM6 4OB7A 3OIYA 2XTNA 2A6PA 4X6UA 3WLMA 1OH7A 3DZIA 2DT5A 2O3TA 1FS5A