3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
4J94A 1DUIA 1AF4A 3A3OA 4H6XA 1Y3DE 3AFGA 3AJ9A 4DZTA 1AK9A 1NDUA 3DE2X 3BGOS 5CW1A 3DVRX 4RYDA 4K8RB 3DE4X 2DQKA 5SICE 1BJRE 5AVJA 1BFKA 1GA4A 2IY9A 2Z56A 3BX1A 3VV3A 4Z2AA 1PFGA 2SBTA 1KDZA 1SUCA 1SUDA 1SVNA 1GA6A 3SICE 4NMXB 5AMXA 1S01A 2Z58A 2ZRQA 2HPZA 1P8JA 3ZXXA 5I9SA 4DJ5X 2WWTA 1C9NA 2XRMA 1WVMA 1C3LA 1GNSA 4GI3A 1GT91 3L1KA 1SUPA 2TECE 2SNIE 2P4EA 2SECE 1TM1E 1SUAA 1GA1A 2Z57A 5JXIA 2PMWB 5JXHA 3WQBA 3TI7A 1R0RE 2Z30A 2PQ2A 1BE8A 3WHIA 1SBCA 4LVOA 1TO2E 4HVLA 3ZXYA 5ARDA 1TECE 3PTLA 1TM4E 3AJ8A 1S2NA 3A3NA 2W2PA 3GT3A 1Y3FE 3H42B 3Q40A 3DE6X 5JMOA 1PJ8A 3DE5X 3VYVA 1Y34E 4MZDA 5B1DA 2ZWOA 3DE3X 4KB5A 2HD4A 1BH6A 1VSBA 1EA7A 1T1EA 1Y3BE 2ID4A 4H6WA 4WOCA 1GTJ1 4JP8A 1SUEA 1YJBA 3A3PA 2PKCA 2W2MA 3HJRA 2DP4E 1SCDA 2IXTA 1WSDA 2PYZA 1Y4AE 3LPCA 3PRKE 1KDVA 3GCWA 4NE9A 1TMGE 4OMDA 4B5LA 2GKOA 2WUWE 4M1ZA 1YJCA 1EGQA 1WMEA 2X8JA 2ZWPA 1SBTA 1GCIA 1KE1A 4AKTA 1CSEE 3QFHA 4YN3A 1YU6A 3D9QX 5AVKA 1SBNE 4HX2A 4DWWA 2ID8A 1Y3CE 3GT4A 1UBNA 4AKSA 1R64A 5JXGA 3I30X 1C9JA 3EIFA 3WIUA 2X8JB 3CO0S 4KPGA 1T1IA 2V8BA 3TECE 2ST1A 3TI9A 1MPTA 1V5IA 1AH2A 2WV7A 2XTJA 1BFUA 1CNMA 1AQNA 1TM7E 1GTG1 1OT5A 5FFNA 1C9MA 4NE7A 3CNQS 2W2QA 3I34X 1SIBE 1NDQA 3VSBA 2Z2YA 1ZVKA 3DYBA 1LW6E 1HT3A 3F49S 4CFZA 1ST3A 1P7WA 1SPBS 1BE6A 1AV7A 3OSZA 3GCXA 1S02A 3F7OA 3DVSX 1Q5PA 1THMA 3I2YX 5FAXA 1T1GA 1XF1A 3DDZX 1Y48E 4C3UA 3QTLA 3P5BA 4KG7A 2W2NA 1WMFA 3DWEX 5ARBA 1SUBA 3LPDA 1KDYA 4OV6B 1TM5E 2PRKA 4WOBA 3EE6A 1YJAA 4H6VA 1KE2A 1GNVA 3SQOA 1GTL1 1WMDA 1SELA 4CG0A 3Q5GA 5K7SA 1SIUA 4I0WB 3LPAA 1Y9ZA 3BPSA 1ZVJA 1SCAA 1PEKE 1IC6A 2Z2XA 1Y4DE 2Z2ZA 1SBHA 1SH7A 2E1PA 5ARCA 2SICE 5JXJA 1SN7A 4ZOQI 1IAVA 1SCBA 1SCNE 2W2OA 1NLUA 3I37X 1DBIA 3DW3X 3DVQX 3F7MA 1MEEA 1TO1E 1Y1KE 4LVNA 1AVTA 1PTKA 3VHQA 5FBZA 4FONA 1V6CA 3WIVA 3D43A 3DE0X 3UNXA 1JEAA 5B1EA 1SBIA 5AQEA 2G4VA 4ZARA 1P7VA 3DE1X 1R6VA 3VTAA 2PWAA 1SIOA 1TM3E 3DE7X 2B6NA 1ST2A 4BWGA 4CFYA 4OMCA 2WUVA 3T41A 4C3VA 3VV2A 1Y33E 2DUJA 3QMPA 1A2QA 1OYOA 1SCJA 1OYVA 1AU9A 2PWBA 1TK2A 3LXUX 3DW1X 2QTWB 3EDYA
chains in the Genus database with same CATH superfamily
1DIGA 3KBOA 3LNCA 1TFRA 3FJ1A 4BU0A 1B76A 1DCKA 1QH8A 1JFTA 3PUIA 3EDCA 4EI9A 4JJEA 4ZDIA 3OE1A 2GM3A 4PHFA 2J8ZA 2OG2A 4G36A 2DFNA 3W5VA 2XQGA 4C9BA 5H68A 1E5XA 1YVRA 3BZBA 2NQ2C 2JK1A 3GRFA 2VXOA 1A98A 2AFIB 1H9BA 4B0PA 4HVCA 5IXYA 1BKSB 5BMVB 1X7WB 4HGNA 2AXQA 3VTKA 2Q9UA 4G5SA 4HGPA 2DR3A 2Z8YA 2WYWA 4TWZA 4LNAA 3WE7A 3ZJ5A 2V0GA 1ENOA 1JHUA 1RQGA 5GM2A 4B73A 1F12A 4RLSA 1EJ2A 5DWDA 5T57A 3PD1A 1M9NA 4OGLA 3I6BA 1MCZA 4CHTA 3P9KA 3Q72A 3IOYA 3K1YA 5A6VA 3DVAB 1Q12A 3NCHA 1E6KA 3ZU4A 2C2KA 3SQMA 2GD1O 3U7QB 2GHTA 1C8BA 1PTJA 1L8LA 4NOLA 2HREA 4ZZ0A 3KJQA 2NQTA 2ZUDA 2NAFA 2JFZA 4E22A 3HY4A 4O2BF 2IYNA 4FFNA 4GM1A 4Z2AA 5LMNB 2IIBA 3ND8A 1N7HA 3B7GA 3EEQA 1AK2A 2B1JA 3HYNA 5IC4A 9GPBA 2NYVA 1ISMA 2R1TA 4HR7A 2LD4A 3O4VA 3CLVA 5HJEA 2D13A 1DAEA 4G25A 5MGBA 3SICE 2GD2A 4J0CA 4GZMA 4CF6A 4F45A 5KYGA 1ADCA 5LSAA 1OBVA 3TM5A 2FUEA 3GJQA 5FPHA 3SHVA 3V8EA 2ZYIA 4CMJA 4WNCA 2IHTA 4AP6A 4RYLA 1XXLA 1UJMA 4GC9A 1IZ0A 2A2ZA 2G5CA 3O2QB 4QU9A 1E1RA 4DJ5X 1M0WA 3EUEA 4DS3A 1JJAA 3L79A 5BSFA 2XRMA 1B2RA 1FFHA 2H9AA 2WUEA 3A32A 4GX5A 4X00A 1RW4A 4UHHA 4XUEA 5JHHB 4GWKA 3TVDA 2JFNA 5KQGA 1Y8ZA 2HRRA 1DV2A 3T94A 4N8SA 1RU3A 5JAMA 4WZBA 1N3BA 1RXYA 1W49A 2WE8A 3JQDA 3TSWA 4P22A 2HCFA 1J0XO 3N2ZB 2FSFA 2WC1A 4TV8F 3RRZA 5AVQA 2OYRA 2OCDA 1E2FA 1OYWA 1DKOA 1M6VA 2TECE 4X20A 2OD9A 2FG5A 3L4EA 2M98A 2YV2A 2Q3DA 1AN9A 2JKYA 1TM1E 1STOA 3BH0A 3OM9A 3QLJA 4G23A 2DQ4A 2XE7A 3Q3JB 5EMLA 2FB9A 3ZNOA 3KLMX 4ZANA 2ZI6A 1GA1A 3K8OE 4QYSA 3O84A 4YMSA 4CYMA 5EJ9A 1QFZA 2BP7A 3KEFA 4E07A 1W4LA 3PCRB 5FR2A 3WLNA 4BNGA 1W5EA 1G5PA 3MTGA 4I55A 4PYQA 2ZJ0A 3CPJB 4MV9A 1FXWA 4DE5A 1H9AA 5LIRA 3IHKA 1IBLB 3DOCA 2Q49A 3R8CA 1N6OA 1P2BA 5LM3A 5LKAA 1SXJA 1XTJA 4Q01A 3UF0A 1Z15A 5C4IA 5JTUA 4KFUA 5IUNC 2WHPA 1RJWA 4K86A 1H3NA 4X95A 4ND6A 4OLFA 5DEIA 5KYTA 2QBYA 4QTXA 1PLJA 4WVFA 2IDJA 4GR5A 1GTZA 4G2TA 4Y6QA 3ZGZA 3ZD7A 3O21A 1EZ1A 4FT4A 2I2FA 3GN1A 3BS4A 3HNOA 3NBKA 2IDZA 4XGIA 4CKEA 2O8EB 1FQJA 2VO1A 1VL1A 4NCNA 1NMEA 3CT6A 3EVCA 3HC7A 2Y9MB 4YIHA 1LI5A 3S1LA 2C00A 3VHLB 5DK4A 1Q1EA 2HTEA 3WJ2A 2JAHA 1A9PA 1LC0A 2J0UA 2JAPA 5JZBA 1UDAA 2QRQA 4AW9A 3AM3A 2Y68A 1IFXA 4UCFA 3ZK8A 1IY9A 2VF5X 4IDAA 5KYUA 3VKHA 4M0EA 4D41A 2QVLA 3SHQA 4Q4CA 4Q7MB 1SU8A 4WKGA 4ETWA 2QZJA 1PDVA 1ZGBA 4M9ZA 3C6MA 1ARZA 4MX8A 4A4DA 1T5HX 3NWPA 1U0FA 4BNKA 4G8DA 3FE2A 4GIBA 4MZDA 3FYSA 3OWOA 1OFTA 3LWZA 1FYEA 1MABB 3PC2A 3QVGA 5FHRA 3WVNA 2FXVA 3PBKA 3A6LA 3DAPA 1NQAO 1P1KA 1SD2A 1SXJE 1WXEA 1RQNA 2HF9A 2Q28A 3CUSA 3DR3A 4NV1A 1I36A 5DCWA 5EL0A 4DUGA 1HE3A 4LF6B 1LDNA 1WR8A 2VNAA 2Y77A 4LY6A 1DTWA 1B0UA 1PGJA 2PSFA 1V5FA 2QDXA 3D4IA 3D3KA 1IPFA 1VHTA 1FQKA 4I99A 2G9VA 5JCXA 2GD0A 4ZIRA 2EGGA 2Q1WA 4XB2A 3BJEA 4JU9A 4KPEC 1G21B 2IPOA 4DV2B 3CISA 4CM7A 1J0DA 1T4CA 3ZLUA 4B2IA 3W2IA 4GSLA 4DLSA 4ZOLA 1UINA 4IDEA 2YXBA 3E7XA 2PJRA 4LJ6A 7MHTA 1CJSA 3DEKA 4WPGA 3LUJA 4TVKA 4YRLA 1U0NA 2JLZA 4QUAA 4YROA 4JI3B 1Z5VA 1KVTA 3ZVRA 4PYKA 5DIFA 4CKWA 5F78A 3UAGA 1VI6A 3PRKE 5CG1A 4QXPA 1KDVA 3EG5A 2WVGA 2MU1A 3DTVD 3H7AA 3HL0A 1W0KA 3HDYA 1FFXA 4B5LA 4RTOA 4QGFA 3BQ9A 2CE2X 2BRUA 3U31A 1FX0A 3BILA 3EVZA 1JPNA 1ZD1A 4DMRA 4QGSA 4MWTA 1EXMA 3GMSA 1PP4A 1H0SA 3G3EA 1JV2B 5LQMA 1YUBA 3CLRC 1IHPA 3Q3CA 5SZIA 2D8AA 3BTSA 4Q05A 4CMEC 1PJTA 2V59A 2VDVE 3KZ1E 4W5WA 4AMBA 4DR2B 1BMQA 3VDXA 4GNRA 3FGZA 4D02A 2JLQA 5L7TA 4OHCA 1W4BA 4CLRA 4A5SA 4JJGA 4CKBB 4HGRA 3ZTTA 5KPDA 1GN9A 4A5OA 5L3VA 1AQLA 2XGOA 3FI0A 3UZUA 5T7BA 3FSEA 4G5FA 4GMHA 5BUQA 2ENUA 4P7BA 4D3XA 4ALLA 3IP1A 5EUMA 1MFPA 3HLYA 5EZQA 1YU6A 1BS1A 1TC1A 1KI6B 3CZQA 4KQGA 4YS6A 3GOQA 3O1HB 3QLEA 4QO8A 3T7JA 1J8FA 1QV6A 2F2TA 2YIVX 4BBPA 2RH5A 4OIMA 2C7OA 4QPNA 5FBQB 3VR4A 2JCXA 3G2LA 3HYSA 1DS6A 1RXUA 1UZNA 2I2AA 3IILA 3T1YB 3KJNA 4P3NA 3ZHSA 5K0ZA 1KC3A 3CWCA 1Q19A 2UVPA 3SEQA 3E8MA 3A1SA 1FRFS 1UT5A 3FY4A 3DAOA 1NVUQ 4TLDA 4EGJA 5JARA 3NBFA 4JJ6A 5AW3A 2JS7A 1XMPA 3ABQB 1RKXA 1PG2A 2GETA 2XY4A 3TZKA 1DQPA 4MWBA 5IF9A 2WSBA 4FYKA 3MTAA 4MIKA 1GKIA 3CR8A 1IRXA 3UPUA 1J22A 4PNEA 3TDKA 1VJGA 5LP6B 1X1QA 1I5OA 2VH2A 1P9LA 3ZK7A 1YR9A 5NLLA 2XADA 1DDGA 3H8SA 2Y4OA 3H5WA 1A04A 1THGA 2A30A 2NNLD 1OAKA 3CTPA 5CJPA 4YRNA 1BVHA 1GVNB 5KTTA 4EF5A 5C5EA 2WSSA 1K2VN 1V5IA 1YCHA 3GLRA 4JI6B 2ZB3A 2YBDA 4PHGA 2FWNA 2YFQA 3WBKA 3BL6A 2FRXA 3EZ7A 3FZYA 2XUAA 2Q5CA 3QMMA 2VNHA 1OT5A 4WKBA 4QU0A 4BNZA 2Q8QA 1NQTA 5ALEA 3JS5A 4MVYA 1CZOA 3LT4A 1TZKA 4KTTE 1YCGA 1YFJA 3IIIA 1MOZA 2QYHA 4MI6A 2Z2JA 2FPGA 4KDEA 3VAYA 2FQ1A 3A31A 3JYOA 3PA6A 3ZWXA 5C7YA 3U09A 5HQ3B 1M6HA 3R6TA 5AK6A 1C7FA 2R1ZA 1UT6A 2ECFA 2M32A 2BEWB 4CL3A 2IKSA 1K5PA 1L7PA 2CXNA 2EKQA 2PZFA 3C7KA 3I8SA 3NORA 4JLJA 1QFYA 3EDRA 1BZYA 1XZDA 1EXWA 3IQWA 4ZVQA 2I5PO 3V7NA 5E8RA 1HT0A 4JLDA 3X1XA 3DC7A 3FNGA 5J2TA 4KPYA 3HJUA 4Y1RA 4R9SA 5FPYA 3ZHRA 2BOVA 1ZR4A 1LW6E 2ROQA 4ZCLA 4RSRA 3JALA 4L5CA 2WW8A 2VCHA 3DCNA 3DM5A 2EKDA 1TYAE 3FRIA 3P97A 3PHLA 4HWSA 4PO1A 4AJKA 3MGCA 4AICA 1EIWA 1ST3A 4IHKA 4HAYA 1SPBS 2WAMA 1T10A 2R4UA 3T7RA 4S04A 1VSUA 3D8UA 4LN1A 3UXEA 4AJEA 5AVWA 1NUTA 2CB0A 2GN4A 3AXTA 4WXYB 5D7BA 1DO0A 1MC4A 4EKGA 3FHOA 3UH1A 3AEZA 1QRTA 2JGDA 4FFLA 4Z0PA 3K9FC 1NRJB 1TZBA 5JZVA 1QIGA 2EXXA 4JLNA 3M70A 1Z4QA 4Q1DA 3SXUA 4F5ZA 2PMCA 3CZRA 4IFBA 5FAXA 3WB0A 2PKRA 3DCYA 1T1GA 4EJMA 4D26A 3IXMA 2D0PB 2H4JA 4C08A 2QB5A 4L5AA 3KQUA 3OOWA 4AJOA 1U1DA 1YR8A 2OBXA 2QQEA 2C61A 3NDJA 3ASVA 1SY7A 3PNLA 3SYNA 1ZK4A 1XL1A 4LEIA 3I23A 3IMEA 2WIJA 4UUBA 2Z6VA 3DYIA 2PZLA 3EGIA 1WQ3A 1TKBA 3ZDDA 2XE8A 2A58A 3VTFA 1MAUA 4F5YA 2NPFA 3C7AA 1P1CA 5K3BA 3F5QA 1DFIA 1QYDA 3RYIB 4RZIA 2ORED 2X4LA 2B8JA 2Q5LA 3CH5A 1B14A 1UOEA 2FGJA 3PNMA 4JU8A 3L6BA 2EJTA 3KQSA 1NY5A 3SBDA 4C4AA 3VR0A 1QTRA 5BV2P 3LXXA 1YZFA 1ATIA 2V9PA 4IIEA 3TZEA 3W8DA 1JRLA 3EGOA 2IX3A 1H1LA 5CURA 1V6SA 2CJXA 5IYZB 5JZSA 2OXTA 3T1HB 1DJQA 4RM2A 4NX2A 1D1QA 4D57A 2QPLA 4BZQA 2GA9A 5B7NA 5HKKD 1V7CA 2FPSA 1D9XA 4P2GA 4EF4A 2O8BB 4FCWA 3Q5GA 5C34B 3AFOA 4V3CA 5AHXA 2J87A 4CTJA 4NMLA 1LRJA 2NTVA 1NYLA 1OGYA 3FSGA 4I0WB 4BJ3A 3FHTA 4KXNA 3B9BA 2QL5A 1JDNA 2VDKB 3T6KA 3NATA 1T4GA 4G24A 4DMFA 1OLSA 3UV3A 5KMGB 3DEZA 3OF5A 4ZDKA 3SQDA 4KITB 4EB3A 2P5SA 1SOMA 3OT1B 4ROSA 2WTAA 2ATXA 4UUOA 3R9IA 4AJ2A 1YDHA 2E1PA 3USES 3MGBA 3PC8A 1UJBA 4FHEA 2I34A 4ZVMA 3KKKA 4EG3A 2OCGA 1EFVB 1U2GA 2J1LA 3IE0A 1DAHA 1B8NA 4PAGA 2QVBA 1DWQA 2OAEA 1U7ZA 3P0JA 2XCSB 2QAJA 1PS8A 5I7RA 4LZOA 3O47A 1UEJA 2BZ1A 3TOSA 3VC3A 5LCXA 4MTCA 4DA8A 3AETB 1HM5A 3KR0A 3PDWA 4DBLC 1ADBA 3F2IA 2I66A 4LYJA 2VT3A 2YIDA 4EZEA 5FBVB 1QU3A 5HUJA 4R2IA 2GNPA 4XUCA 2H1OA 2H2WA 1VYUA 5FBHA 2OORA 4EUEA 3CEAA 5LPNA 3I9KA 4US1R 3MPOA 2J5RA 4R8MA 1Q6ZA 4D9KA 2VP4A 3T5CA 4DANA 2FZKA 4J90A 5DM1A 2X9QA 3PIIA 5IU6A 4HSEA 3L0CA 1FDWA 4U2DA 5ECWA 1BKDR 5F7ZA 1T8UA 3H4TA 2VNSA 4BU1A 4YR7A 1ZJ5A 4ZQCB 1Z74A 2IVZA 1E2UA 2WJAA 2XTZA 4EPRA 2AMJA 5F7XA 2ZTHA 2EKBA 4UDOA 5JEEA 2QMHA 1QCCA 4FEGA 2IX9A 3K5PA 4MRRA 4BX8A 5KOIA 2HCRA 5CT8A 1JQ3A 4K6GA 4GPBA 5G2OA 3TJMA 1J33A 4OXNA 1QTNA 2PWAA 3COSA 2IUSA 2EP7A 1MXHA 2KMLA 3HN6A 3K09A 3Q15C 5DYYA 5E9JA 4C0SA 1HSOA 2OO7A 4MV6A 2B6NA 3ZTYA 1ST2A 5C1PA 2WWVD 3WBBA 3JYNA 1VG1A 2Z5GA 5I4KA 1KZYC 3A27A 1IBCA 4TMTA 4WJZA 4O4HA 1R37A 1XXHB 1XZKA 2QAIA 4XKJA 1G16A 5K51A 2BTQA 2Y2VA 5KJ6A 2GFIA 4TV9B 2O3QA 4P31A 3L4BC 1C4WA 4P54A 4IMJB 4CMAA 1YFKA 4C1BA 4D4GA 1AXRA 3MS4A 3P4YA 5DIZA 1PT8A 4EFMA 1V16B 1T9HA 3TX6A 1LWNA 4A6DA 2NXNA 4BN5A 3RAFC 4HN9A 1N8TA 3BG5A 4JEMA 3D4LA 2Q3EA 3AIOA 1IN1A 1Y1SA 3CG0A 4BVJA 2PLWA 2YCBA 4P5DA 1VE9A 2PAFA 2QUBA 3L8FA 4JOCA 3C3YA 4KYIB 1OYOA 1AU9A 1NN3A 4UNPA 3VYUB 3D31A 5EE9A 4WVLA 3PGVA 2I55A 2XX3A 5AESA 3WLHA 5HNKA 5LR6A 4X3CA 5AW8A 4F0JA 2XZLA 2NQ8A 1GUFA 5K3DA 5TEWA 5BVGA 2ERYA 4M9UA 3SVLA 1SU7A 4GD3Q 4YFYA 2NO4A 2XNJA 5I9LA 1XFDA 4CF7A 3P94A 4PYMA 3RV3A 3WGMA 4L6CA 2V7QA 1K08A 1YXMA 1M2OA 4RK0A 2V7EA 1E89A 1NPTO 3BFKA 2OT3B 1SR8A 2IOFK 3NHKA 4YAGA 1F06A 1RXWA 1BQ4A 1N2SA 3IEUA 4A0GA 1ULSA 2X86A 5AXBA 2EAUA 2FPPB 1ODFA 2HK7A 5IDQA 3IKVA 4HQRA 4PYJA 2EF1A 3BSYA 3RUAA 2Z8ZA 1BC5A 3KETA 4BQSA 2YS7A 2WIKA 1NOIA 3LCUA 1RXSA 3DBHB 2O3UA 3PL1A 1FC0A 1SZJG 3RS8A 5AIBA 3PITA 3QW2A 3LU1A 4WLVA 5FWXA 1E2LA 2FWBA 3ZU5A 3E9CA 4B3FX 1R6AA 4E33A 1EXNA 2AZTA 4IP0A 2IZ1A 2C2YA 4A91A 1W93A 3HTXA 5MHTA 5AP9A 2B37A 1S2OA 2F8SA 4PO3X 3SHFA 3IKTA 2HU8A 1U6JA 1UANA 1ZMRA 1XP5A 4G2NA 5FULA 2CBGA 5BN4B 3VQTA 2HT6A 5B4TA 4P0QB 1R0SA 1S9HA 3VV3A 1QBGA 3AB3A 3CUEF 3PNPA 3RKRA 4K6CA 1PYOA 3D3JA 3FB4A 2FX2A 5C35A 3B1YA 3L7JA 3U13A 2DLDA 4TKUA 2VKTA 2NUPA 3ROTA 4K9MA 2X3YA 3INTA 2FW9A 4ZYYA 1Z33A 4K6HA 3ES9A 4AVYA 1U9YA 2GZSA 2G1JA 3EB9A 4QUEA 1YQQA 3T5AA 1JA0A 1QKIA 3Q7QA 2NOAA 4EW1A 1EP3B 4BBAA 3BREA 3KALA 4UAJA 5DHRA 1QJCA 2A5GA 2ZGVA 4PVCA 4JI8B 2GBFA 3FTFA 3JRXA 3ITNA 1ADJA 2WF6A 1CW2B 4EGFA 3O4HA 1BWQA 4U7PB 3GZJA 2IE8A 3P9IA 1O89A 3C5CA 3NRBA 4IKPA 1W8DA 2YN0A 1C3LA 5LNK6 1DZIA 4JYMA 4OLJA 1H2ZA 1XU7A 4RC9A 4RTPA 4KX3A 1EVQA 4FB4A 5KC9A 5L4NA 3IXQA 1D2HA 1NWCA 2ZQZA 3M2TA 1FNMA 2BLLA 2GAOA 4J0JA 2HPHA 1TQ6A 4HPXB 3IE2A 4AP9A 1L1QA 3TBHA 2REOA 2QNBA 2ZAYA 5FNVA 2ZXEA 1Z6ZA 2PFGA 2WLSA 3GA7A 4GYWA 4QOSA 1PVOA 2RHBA 3VC1A 4MPTA 2J5QA 3UMYA 1A27A 3LFHA 3D54D 2GZ1A 1CRZA 3FMGA 2R7MA 2XUJA 5BV8A 1QO9A 3DMPA 4UVEA 4BQRA 1EK1A 2PGJA 1CS0A 2A5JA 1RRFA 2KE5A 3GF4A 2FTKE 2IZOA 1WEHA 3BMXA 4EYEA 3FVVA 2IYXA 1I7NA 1QYRA 2VPTA 1AQYA 3LVBA 5KTYA 3JD0A 2PUEA 5JAPA 1J5PA 1K5GA 2GESA 4DCMA 4LF8B 1YF3A 1JKJB 3OCUA 4C4YA 3MRVA 2IYUA 2CHGA 1TJ4A 1WVGA 2YWCA 2FSGA 1ACMA 3PNSA 4JP1A 1YDGA 4G5YA 2ZUFA 1EKXA 1PD1A 4XSVA 3DLIA 1IB0A 4GDFA 3GJ4A 2ZIUB 3CPSA 4JY7A 4YACA 1ZJJA 2IUUA 2MINA 5KX5A 2Z4SA 2ZIVB 4QTYA 4H3VA 2H9IA 2QN7A 4HDMB 4UNQA 3DLBA 3T1VA 4CEIB 3GUYA 1ICEA 4PSUA 3RVDA 2BKLA 3VPBA 3IVGA 2RC5A 1DKNA 1GGFA 1A5SB 2CXPA 2ZDHA 1JILA 3IOMA 3PDIA 3K35A 4U7GA 3ONVA 5F9MA 3ZLTA 2YZGA 1E2EA 5KQLA 2HWXA 1UXHA 1JP7A 2WAXA 1XTPA 3NKFA 4P34A 1S2NA 1KZGB 4RELA 4RVNA 3H42B 2C3OA 3AILA 3IT1A 4IOMA 3HDQA 3P9ZA 3Q40A 3UAYA 3ZE8A 1Z2NX 4E6EA 1BMFD 2OXIA 1VG8A 3SS7X 2PUGA 3ET5A 3DKKA 3P2EA 2HPVA 1IPHA 1JQBA 2C2HA 3HXTA 4UAGA 4OHUA 2RKBA 3KTOA 4PR0A 1QXSA 4PWYA 3VDQA 3WLJA 1HV8A 1P1BA 5AW4A 2Y6UA 4R4JA 3SE7A 4W5NA 4I5FA 3VI4B 3F67A 1RBQA 3NHBA 5BSEA 4XWWA 5HTOA 1ILWA 4ZEXA 3DFUA 1FU7A 2D62A 3ASUA 3F8TA 4FB5A 3WGIA 2HHLA 2OC9A 1B3BA 1VLVA 4G0MA 3DHNA 4ISCA 3NEPX 4TRNA 3SK0A 3NNSA 1V48A 3N0TA 4NYJQ 1IDOA 2BSQA 5C18A 4Q19A 1EFPB 1GZ4A 2WPDA 2EC5A 2B8WA 1WTCA 1A5ZA 1FS6A 3PIDA 4I50B 1FVOA 2DB3A 3PKJA 2BEVA 4MUHA 1IY1A 4V2UA 5DHFA 1WXHA 1NXVA 3GWZA 1JAYA 3TN7A 2BFEA 2X1HA 2VRWA 1VKJA 1ZJ6A 1ZL2A 4CIVA 3ROQA 1Q1GA 1ZUWA 3AR8A 3FHJA 3MCZA 4URVR 1OH6A 4HLCA 3P32A 1EDZA 1FDSA 1XZQA 3L8DA 5I8ZA 3TZQA 2Z0MA 3AYXB 4EG1A 5JCJD 1PYGA 3EF0A 1JI0A 5DM4A 2CCJA 3M6IA 3FWKA 4RJKA 1HA3A 1DXHA 2VAPA 1KY2A 2ZUEA 4B3RB 1E3SA 4F91B 5BR1A 3TRDA 4UW9A 4CDGA 4YQFA 3TE6A 1V8OA 2IDMA 2FA9A 4WGGA 4AS3A 4BFTA 4YT2A 1J0AA 5F51A 4EMSA 4B3TB 3SGLA 2V6IA 1T15A 2FVXA 3UMCA 5M7EA 1NURA 1V25A 3NVMB 1X1SA 1BJTA 4M3NA 4BXOB 1G8HA 4UHBA 4RA6B 3TEMA 3RUHA 4FCVA 4D80A 1GQOA 5KVSA 5JH7F 1HYBA 3L06A 3H5IA 1YDMA 1I3NA 4G67A 3C3MA 5ALIA 3SYKA 3ZNQA 5I9MA 4W1QA 1N3IA 2XNSA 4N5DA 4JQYA 4ZAFA 2JJ1D 5FHQA 5FPSA 4CQNA 3R3ZA 4F6CA 4IEIA 1QC5B 2J7PD 2E6KA 3IRUA 4FSXA 2VK2A 2Y99A 2FZEA 1UQUA 1B1CA 2YL2A 4NFHA 3CE6A 3NTRA 2C9MA 1VE3A 1B0ZA 4Y1GA 1TOAA 3PPYA 4Y3UA 2Q1SA 4DN6A 3ABSB 4V1CB 4Z53A 5AVKA 2QVYX 2AR7A 2YQ5A 4FR0A 5T8KC 3TLCA 1DE0A 2XGMA 2XXAA 1Y3CE 3PV0A 4CJXA 2WMDA 1EFRD 3GT4A 4MWCA 1U8XX 4O4JF 3OZCA 2GEVA 3TMYA 2J9XB 1J8VA 1U0TA 4YRTA 4AO8A 1ISHA 3H4VA 3I9JA 4DTIA 3DKIA 3A04A 4DLBA 4GGOA 4C4PA 2BWJA 1T6BY 2E87A 1XBTA 3IAEA 4RNCA 2OCKA 4NLLA 4B9AA 1CUUA 2YMLA 3LO5A 2QM7A 3AVYA 2WABA 3V1MA 1P39A 5JD5A 3ZVLA 3R1IA 4EQZA 4Y8VA 5LXTB 4ZOAA 1R0ZA 2ARKA 5EPOA 5L9AA 5D3MA 3EDQA 4ZT3A 3WIOA 4ZYXA 4MRVA 1C7RA 2A4KA 2CWWA 3P7MA 1Z0DA 1KIAA 3TKYA 4B2LA 1W2GA 4MKFA 5J5AA 3R9XA 4PZ0A 1VKRA 1BAPA 2WV7A 2AQIA 2ZTUA 3H5OA 5L3ZA 1U7TA 1ZD8A 3DKRA 4QAJA 2WU4A 4QC2A 3SIWA 6REQB 3HN7A 5IDVA 5AKJA 1YQGA 1ODSA 1BDMA 1C9MA 3GLGB 2IS1A 3NUGA 2J4CA 1MA0A 2JI9A 5F9HA 2WJ4A 2ONYA 3KYDA 4P80A 3LBFA 4DIFA 3TDMA 3L8HA 1EQUA 1IQUA 2FHSA 4AY3A 2WMYA 2HBRA 1ZMXA 5ED0A 3ONWA 1UBKS 2B9EA 3PNKA 5IBRA 4DLZA 5AW2A 4MJ7A 4KRFA 2HK6A 2QT0A 4MS3A 1N9GB 1MAAA 4ZFNA 1MF7A 3IUSA 1W5BA 3IQEA 2ZPAA 3H11B 3SVTA 4EW6A 1IPEA 4KQ2A 3JWEA 2RONA 3KB2A 4C14A 3EMDA 5KNDA 3U5ZB 3F3KA 5E1MA 2HZBA 4BNXA 2PXAA 4H2DA 2PGLA 1GG8A 4QZVA 1A2KC 3I45A 2XA1A 1BWRA 4JYCA 3D6UA 4BJ1A 3DYVA 4R16A 1RWVA 1EB9A 1BCRB 4DLRA 2B36A 5AK5A 2AMVA 5CP8A 3N8KA 3BCUA 2B2NA 3F6PA 4TRMA 2VRCD 2WKWA 3IOCA 1T2EA 1A77A 1NOKA 2HNAA 4TKLA 2FN7A 1S96A 4M8SA 4XR4A 4XI9A 4DM4A 4DV6B 3OMXA 1M3SA 2BFBA 1UC8A 4H16A 4Z1OA 1AKVA 2YWGA 4RTMA 5FNZA 1V11A 2VAVA 3A4LA 2RB5A 2X9GA 4I1YA 3CF0A 1CB7A 3K73O 1AJEA 2EDAA 3C8MA 3D7SA 3UPTA 1QGYA 1CERA 4WV3A 1YA8A 1FNSA 2HIGA 3DL4A 3TEJA 2JGFA 5IMSA 5KEIA 4RESA 3OEHA 1C0PA 1I9GA 2I4IA 4W8HA 5TF4A 1TVMA 5K05A 4GL2A 5DI3B 5FL7D 4JAVC 5ICMA 4Q1CA 5KYXA 4Q7QA 1K8RA 2ZXFA 4LDJA 2WHXA 1YS6A 1VSVA 2BY4A 3GLVA 2H4ZA 1E7QA 1UXOA 1XVVA 3H1TA 3UOAB 2XMRA 4EL0A 4MGEA 2G7MC 4Q9AA 3T5BA 1SZCA 2VF2A 2DWPA 4HDAA 1KAQA 1PT5A 4PYLA 1KDYA 5IT9A 2B21A 5FYDA 4FFWA 2HQOA 4ZVVA 4E1BA 4LJ4A 1JSXA 2J3IA 3CSUA 3HB5X 4AX8A 1YNOA 3ZS9A 4J0IA 3G02A 2DZDA 4K9DA 4BOYA 3Q5DA 4JL6A 2O4UX 1FYFA 3C7CB 3Q3EA 1E6UA 1AO3A 1NY6A 3OP4A 3SKXA 1M33A 3JATA 3ZDRA 2DHDA 4JXZA 1G9SA 1YB4A 2F4NA 2E4VA 1I33A 3E0QA 3I53A 1W88B 3N6VA 3T7AA 2AD5A 2BMJA 2FAXA 4C4ZA 2G88A 3HBLA 5MDHA 1TW2A 1CJUC 4HDNA 4P4LA 5E3IA 2ORVA 3PJGA 5KTPA 2XKBA 3L0PA 4IIXA 4TVSA 3FNQA 1QRUA 4HH1A 3DDHA 1OPRA 3TQHA 1OCEA 1LD3A 1T36B 3C3PA 4DYHA 3WYEA 4JEIA 1CJTC 2QMYA 1OKKA 3GLSA 3PJEA 5AW5A 5ARCA 3HKDB 4IMPA 4AI6A 3FBWA 5MN5A 4HH0A 4B80A 3KB1A 1KAHA 1WCIA 3U16A 2AR0A 2GPJA 2W71A 3L4KA 4O59O 1UJ4A 4A2QA 4KQJA 5AW1A 2H00A 1G0NA 4H3HB 2GEFA 2JGKA 4YONB 1IAVA 1E64A 1HL3A 1G17A 3QWIA 3ZWQA 4F3TA 1E3WA 1LFDB 3L01A 1TU0A 3OQOA 4DB4A 5K0GA 2HA0A 1BYUA 4IDFA 5K0NA 1HNZB 1AKMA 1BA3A 1H2EA 3E81A 3HKEB 4G4IA 3OOYA 3G9XA 1ZEMA 5FADA 5G02A 5BXQC 1KK2A 1MT0A 1L7VC 3EGDB 1WXFA 1GAJA 3FZNA 1SXPA 5EIBC 1JIIA 3RHSA 1DAMA 4YT8A 1TX4B 4GMDA 2W8BA 3Q0TA 5KWVA 2JDIA 4K6FA 3NX4A 1PTKA 5LQCA 2ZSDA 3AHJA 4RL6A 3R74A 1TK9A 3KQYA 3URKA 4EAAA 2NP6A 4Z51A 5JMTA 1QOZA 2JC3A 3NHAA 3WLLA 1CRWG 3RG8A 2XWSA 1FOEB 5HWSA 2UKDA 4MHOA 4A15A 1IHYA 3S5JA 2CSUA 4DB2A 1Q22A 3LYLA 1EEXB 3MN1A 1GLGA 3WISA 2YYZA 4R51A 4WUVA 1R6VA 3NUZA 1QQ6A 2VDWA 3RUDA 4AQYB 2P9BA 4D43A 3AM4A 1Q1ZA 2VK1A 2H1IA 3CH7A 1Q1NA 4G0XA 3R44A 5L95A 2R8BA 1KU6A 2JZOA 3OOHA 1R5NA 4X8LA 4NULA 4ZHQA 3W5CA 1PNRA 4MUYA 5C8DA 3KSZO 4JDPA 1AB5A 2GJ4A 4DT1B 1T1RA 3NWEA 1CDOA 3VSDA 4C7XA 5I7UA 1FFEA 3UJHA 1N2BA 1QZZA 4EB8A 1KYVA 2HHHB 3RUFA 1LA2A 1Z8FA 3PG5A 4PPYA 1XD9A 3D8HA 4J7XA 5A4JA 3HKCA 2ZCJA 4YRAA 1K7YA 3A0RB 1DPFA 3ZWNA 4G4SP 1AD2A 4RTLA 5C0OE 3MSXA 2RHJA 4OK6A 4QX6A 4GDMA 4IX1A 3MS2A 5CM2Z 1JHRA 3W4IA 1MX1A 5FA8A 3FCEA 2ZR7A 3PFFA 1VXOA 5CLIA 3TDNA 3V1LA 4B6PA 2QMQA 4JDUA 4LJAA 1NUAA 3KOOA 4EFNA 1F4PA 1FUKA 8ABPA 3CMMA 3V34A 4RY8A 4ERNA 2YMMA 3TLMA 2ZUUA 3ESYA 3CPHA 2ZIAA 4UOEA 5IH7A 3LL4A 4QJBA 3IAXA 2VBGA 5FLXA 2BLNA 4HWOA 1BX3A 4KGDA 5IPFA 3IAHA 3A9SA 4QDTA 1XD8A 2G77B 1YB7A 4YV2A 4HGQA 3X1DA 4JASB 1P1HA 2YJNA 2ZBDA 3SR0A 1HNNA 4TT3A 2F8MA 3TRJA 3IEPA 3F5FA 2GA8A 5KU1A 4Z0HO 4F4IA 3UA3A 4DZTA 2HSWA 2FZLA 1DSSG 2O2ZA 4E09A 2VDLB 1EMDA 4RV4A 3UPDA 4D96A 2IZZA 2P6OA 3BAZA 1PZFA 1M6NA 5H1YA 5LYJB 3RB8A 2X58A 1SXHA 3HXQA 3ELWA 1CBUA 1PKEA 1VDMA 5I9NA 1WOYA 1E1YA 1KI2A 2JHCA 3RU7A 1ZGCA 4HZGA 3JQGB 4GVPA 2F1JA 3EAFA 1HDIA 3MAAC 5EHQA 4ZCMA 3I01A 1J20A 2VUHB 2EW2A 2R2AA 4OQPA 3U1TA 4BLOA 2ZTMA 4FGJA 3C5VA 1JU9A 5K3EA 3UT0A 1SKQA 1ZUHA 3PT9A 4OY3A 5JCPA 4CKCB 2CT8A 3HVKA 1FIUA 4OBXA 5ALGA 3AIIA 3I2JA 1P4SA 3LECA 3ZW9A 5JMWA 1J0BA 3NHMA 2AOTB 4QUBA 5KKCA 3B70A 5BSKA 2H4HA 3FR7A 2JRLA 3HVIA 4PIMA 1J7JA 1JU4A 5AI9A 1W46A 2IY8A 3L4JA 2Q5HA 4RF2A 2WT9A 4OB8A 1VCHA 1A2OA 5C32A 4MXDA 4QM6A 2H4XA 3LDUA 3ZXUB 4M1MA 2IEGA 3AP2A 2R44A 3TH5A 3LRTA 1NQXA 2VQEB 2FUNB 3JARB 1KEEA 2O7NA 3VOBA 5IT0A 4UHKA 2V6BA 4N9WA 2XD4A 3OICA 1WO8A 5ERXA 1DB3A 2Q1TA 3VBCA 4CVNA 3AL0C 4DNXA 5NULA 4PFKA 3ZDCA 3VNUA 1U1IA 3L8GA 5HFNA 4LXTA 4EY6A 1PR1A 5A04A 1UBEA 2O8VA 5HKAA 4CEJB 5L4LA 3L7KA 3ASZA 3F46A 1ZPDA 2H16A 1M74A 2CFRA 1DEOA 1ONNA 2E18A 3HU3A 3UENA 3K6SB 4P81A 5EY5B 4IDNA 3ISTA 4AY4A 3H8WA 3NEYA 3F98A 5MN6A 1CUJA 2XMBA 2GNAA 4U9HS 1N9ZA 1Y81A 3BWDD 1KQGA 4TLEA 1CR0A 5D7NA 4PGGA 3QVJA 3FPHA 2VATA 2XVXA 2OBMA 3LZDA 4QD3A 4RO0A 5HBRA 1NRWA 2KJQA 5IAEA 4ANFA 4WOJA 4K05A 1XRQA 2Z04A 4R2HA 2GPAA 3HDVA 3JV7A 3FDXA 3WMWA 4MB2A 1Z63A 1HDEA 1SKMA 5KYKA 4HHEA 5DXAA 2P4HX 1RQRA 1XTBA 3E7WA 4JC8A 4YUWA 1VHWA 2B92A 2PE5A 1H4QA 1Q74A 5FOVA 4YAUA 5GV7A 3V7WA 3PDUA 1ISRA 2AOVA 1G4UR 4TT8A 3WO0A 2EJBA 4BQFA 3EY9A 4LBWA 4JC0A 5CCEA 1NQVA 2F3PA 2QTVA 5H9WA 1CIPA 2BKEA 1UBTS 1PQ4A 1E32A 3ON5A 1TO2E 4TYQA 1D1PA 5K03A 3ONNA 2C9OA 3D6FA 2IZ7A 4YNBA 3PXBA 1X9IA 4WLNA 1DVRA 4OM7A 1XG5A 2DMRA 2GM5A 1ZBDA 2ZTVA 4ITUA 4JQCA 4AN4A 2EZ9A 1YD7A 4TS4A 4YLYA 1GU1A 3RT1A 3PX2A 4EKEA 3I0NA 3EPHA 3VVBA 1PSZA 3PTLA 4J9UE 2OXFA 1RJ9B 4KVZA 2YVQA 3UIEA 2UZ0A 4YRGA 2J9GA 4Y0NA 5IX8A 2W6IA 2JCSA 4O02B 3UO8B 3FXAA 2RGUA 2PL1A 2QP9X 3EWIA 3FIUA 5IBPA 1H0HA 5B7QA 4JI4B 1RQPA 3PL5A 4BYMA 4NHOA 1T2DA 3UB2A 4I2VA 4JLBA 3P9YA 4HY3A 1PW7A 3B1FA 4R0VA 5DGCA 5CVCA 3NHFA 3JAKA 5KNBA 3AR9A 1E5LA 3BFJA 3CPEA 3N8NA 4AUMA 2Z9CA 1WF6A 5C80A 3GG9A 5HXAA 4U6NA 2JRCA 4UPDA 5IKEA 5JISA 3I05A 1KHTA 1T4MA 1VKHA 1DARA 4R2JA 1VKZA 2EJUA 2W83A 3C74A 2HDNB 2F8TA 3DS8A 1GZ5A 4ZAZA 3UT6A 5EUQB 3H65A 3KOMA 2QTAA 4YC7A 1DT3A 4J1SA 4CUJA 5EJ6A 1O6GA 2I4TA 3TB6A 3NTUA 4ER3A 4Q9DA 4QWMA 4LI3X 2VT6A 1P19A 3GLIE 2NTYC 1I2MA 4LOJA 3WNCA 4KVGA 2FDCA 1NM5A 4BFLA 3IA7A 3L7CA 1MG0A 2F1OA 2A88A 4QQ8A 5GJCA 1HY3A 1HYHA 1CD5A 3OFVA 4G5OA 1G6KA 1SC4A 5LQDA 4CLOB 2WYOA 3EISA 2IOQA 5FTMA 5CNIA 3REQA 3T9BA 3KUCA 3D6JA 1TMKA 4AYXA 4O2AF 2DRIA 2YY6A 3TF5A 2FJPA 3TLGA 1I4TD 3EHEA 3FZQA 5TJ9A 4EZBA 1WQ1R 2AN4A 4RTRA 1IZ8A 2GPWA 2WFZA 1B6TA 2XNDA 4GVXA 4M9SA 4N40A 1GAQA 1DNPA 1Z5GA 4CTNA 2M9MA 4F2HA 1ZI9A 1FBNA 2BGRA 2EFGA 4FK8A 3M1LA 2R68A 1AC5A 4DY4A 3EOZA 2AFHB 4H31A 3QOYA 1OAAA 1H2HA 4BMSA 4WJKB 1K98A 2M6LA 1AS0A 1N6RA 4B47A 1YZYA 3LDAA 3PGXA 2GCIA 2QY9A 4DLVA 5JVDA 3EXFB 3K92A 4NBSA 1SQSA 4Y6RA 1G8SA 3U3MA 3ZBTA 3B6JA 3HSYA 2YY5A 1Z3IX 1L1FA 3IQFA 2DFDA 1XQWA 2GYVA 3HA7A 2X1VA 4DG5A 1P18A 3HDGA 3V8RA 2MWMA 2BCJQ 2LUOA 2PY6A 2GYYA 3VKGA 5DHSA 4NABA 3JWPA 2WUGA 3WNQA 5DHTA 5EP4A 2CV2A 4E0BA 2XDYA 2NMVA 2Q9BA 3P2JA 2VHEA 5HIMA 3CZ5A 2P2CA 1KKUA 3Q11A 5MFZA 4V0MA 1MIOA 2C5FA 3DT6A 4U2GA 1OY1A 1RWBA 4EQ6B 2CJPA 1OZ0A 4EH1A 3DNFA 2FE4A 4K9SA 4QOGA 4RKFA 2IYPA 3VDMA 2FMTA 3NR2A 5EKDA 5ITZA 1TYDE 1CVIA 2BUCA 3OOJA 5MFPA 5EINA 4P53A 3NVDA 4EGQA 2OXEA 1PO7A 3WFIA 1UBNA 5TMEA 1EBFA 3W0LB 1WBDA 3TNLA 1LLDA 2G9ZA 1BRTA 1T9KA 4ND2A 5B12A 3I72A 4GP7A 5LWHA 1CCWA 2WDPA 3GL9A 3BSFA 3EA4A 5F3DA 3FRHA 3L1VA 3JW8A 1SWWA 2FDRA 3N2IA 3L1UA 1P9RA 2Z09A 4JELA 1UKAA 4N5NA 3IXLA 5KOHA 2WVHA 3VU1A 4CM4A 2PUDA 1CQWA 3F74A 1X8JA 4JYPA 3FCXA 4ZCQA 1SOWA 1XA0A 4DARA 2H06A 5ITVA 2A1UA 1YMQA 3BMNA 1XU9A 2BGWA 1RYDA 4PBRA 1NF8A 2B2XA 3ODPA 1C0LA 3ZY4A 4KHPB 2LCIA 3BEOA 1II8A 2C7PA 4U7FA 1B8OA 1SHJA 2IXDA 3GRCA 2CXUA 2R66A 2XDQA 5AOCA 1A4UA 2VJBA 1YULA 1FVXA 4V0ME 4OHXA 4B3JA 2JFBA 4L8GA 1OE0A 1RM4A 4HAUA 2WVJA 4LDZA 4TYWA 2IHVA 2YFHA 4CV1A 4LMPA 1PLLA 1YNSA 3O38A 1GP2A 4PC2A 3ZW7A 4D0LB 1Z4NA 3N7UA 1QYVA 2AEEA 2ZIXA 3E7PA 2CYBA 2FW8A 2LDXA 2H2AA 3SM3A 2PZAA 5CH3A 1JR3D 1NXTA 2BT4A 4M0CA 2OV1A 4DWOA 4ZRNA 1NDQA 2QTRA 3NOQA 3ZI7A 4PC7A 1Q7BA 3VVLA 5FLYA 1PSDA 4GBGA 2XUHA 2ENWA 1R0XA 2REQB 3IQGX 4DXDA 2LIVA 5DRTA 1W1WA 2VP6A 1G6HA 1C1YA 3EW9A 3BIFA 3GC6A 4WLEA 5HQTA 2B4KA 1NVFA 1FBTA 1E4VA 2Q50A 2QVGA 2XB9A 3PB3A 5ERYA 3R24A 2FFBA 3WMGA 1IVYA 3EXEB 3WLKX 2CDRA 4ARSA 4R40A 3N74A 2NLOA 4CFZA 1WUJS 1P7WA 3EC7A 1KOLA 1ZIPA 2QN6A 2R11A 3A1DA 4F2PA 2ZJAA 3QWBA 3B7PA 1ZRHA 2E4XA 3P9CA 3RV4A 4RY2A 3IO3A 2XHEA 4PIVA 3KJHA 1MO3A 4RVDA 4J2HA 5BSMA 5EXXA 5TR9A 3D0RA 3DVSX 1KOJA 2OGUA 4FQ5A 2P9JA 5EC8A 1RI4A 4CCYA 5JS6A 4KDFA 2CFSA 3W7AA 1P33A 2OCBA 4P93A 5THXA 3S7ZA 2ZS8A 4GMXA 4KOEC 5FWNA 2WTUA 1OFUA 2ZAIA 2I6QA 2PG3A 5FIUA 3H75A 1FMJA 2OQ2A 4C4OA 2YQ4A 1CDZA 3N86A 3OJ0A 2P1DA 1KSJA 3KFVA 1CJKC 2YHBA 1FTGA 4QXQA 2H1RA 3RVQA 4ARAA 2GI4A 5E7JA 2AC2A 2QI9F 2B99A 3O8QA 3OE4A 4ND7A 9ABPA 2EVWX 2I62A 2RAUA 2VBIA 4H9GA 5IWCA 2B4QA 3QU2A 4OV6B 4ZCPA 1RAHA 2R1VB 4WOBA 2CDCA 2CLFB 1GXSB 2QG4A 3DAHA 2TYSB 3UAZA 2WJZB 3VMMA 1AKWA 2R97A 3ICOA 4E70A 4LZWA 4XYMA 4B0OA 1GDTA 4Q93A 1YWGO 2B25A 1OBHA 2DGDA 3G2KA 4AZSA 4C5CA 4LNUB 4HFMA 2BVNA 3HRIA 4AURA 1BROA 4HLUC 3CKMA 3OPXA 1SWVA 3U60B 1GUZA 4Z0NA 1QLHA 1HQYE 4H0CA 2WOOA 2H0QA 4A2CA 3BHMA 1WXDA 1N2CB 2BFFA 4BMNA 3JQ8A 2GO1A 5GIOE 1TPYA 5COAA 4ZV9A 2QQGA 2RJ3A 3H84A 5DBOA 2FVYA 1C3EA 2AG6A 1G7SA 2O50A 1QHNA 2X0IA 4NZ9A 5JLJA 4FSDA 2DEUA 4R1OA 1QVAA 2DWOA 2GMWA 6Q21A 1XZAA 5T5QA 1QIMA 4I1VA 4V24A 3HEMA 1JEOA 3QTTA 3Q9NA 4C6SA 4BKPA 4EL5A 5HZHA 4HD8A 1OVGA 4UJ5A 4IWYA 3GLQA 1XDSA 2P77A 4RMIA 5F2KA 4Y7DA 3QE3A 3BORA 3GMTA 3JU3A 1FEZA 1S3IA 1SCBA 3A1UA 2ZJ2A 3MJCA 3O92A 5ALYA 4WZAA 1BW9B 2J59A 4OYYA 5IKXA 4KMSA 2VCYA 1JXMA 5TQ0B 3DW3X 5SY6A 4F96A 1LZLA 4I66A 1YACA 3CUYA 3I6IA 3DFKA 1GL9B 3ND5A 4QOJA 1XNHA 5LA6F 3H6GA 4IQ0A 3NDIA 4EW2A 5CUQA 2W90A 4JSYA 4O4JB 1MZPA 3OHSX 1FRVA 3OTGA 4AM8A 4FMCB 4DHEA 1K68A 2X8BA 5FP0A 3FJOA 3AQ4A 3D1JA 1CP3A 5EQDA 2JHPA 1H0RA 2PX4A 3DDOA 1UPTA 4OXQA 3D43A 3OPVA 5J5CA 3I4LA 5J5VA 3TXYA 3OO1A 1W5AA 5JG7A 3PE4A 4LYDA 1EGAA 3MJDA 1ODIA 4HB0A 4J1QA 5DW0A 5CB4A 3QK7A 5K8CA 3N76A 1PJBA 2HGSA 3E35A 1AV6A 2IPMA 3AHCA 1N2OA 2Y0EA 3JSAA 4LOHA 3F1LA 5CLGA 3U3ZA 3WJ1A 5JQGB 3D7LA 4IFIA 3OX3A 1OV4A 3N58A 3PJDA 3H13A 1NVGA 1NE2A 2P9HA 3FMVA 1LV8A 4L5YA 3HB0A 3M49A 3HJAA 3CURA 2OTCA 5A1TA 4KI0A 2WU3A 4CFYA 4WZAE 3HRKA 2AN3A 2G80A 4C0LA 2YH2A 3A1WA 4XJVA 2V6FA 5A0FA 4D8XA 4JYZA 3THYB 4YALA 1USKA 2WWWA 4KP7A 4WACA 4DIUA 3UJNA 2LRHA 5A9RA 2GOYA 4IH1A 1O95A 2CMHA 2H1HA 1XRPA 2IP4A 4MQEB 1GYQA 1F6WA 2PPLA 3IEXA 3O2JA 4XLLA 5BOVA 1YS1X 3U9SA 4WE3A 1A72A 2J41A 3D02A 4IUCS 4PBSA 5FORA 5CA0B 1YVDA 3DVAA 3OBIA 4TLLB 4PG7A 3KJXA 2C03A 3KL2A 4HTFB 4B09A 2WIFA 1AUOA 3CCBA 1NKSA 4JXKA 3U7QA 4X1OA 2IBTA 2IXEA 3EDMA 1X7ZA 1ZO8A 3OJFA 5A5FA 1I14A 2I8LA 1V4NA 5TE9A 2NV6A 4D4HA 3CNHA 3C48A 4PG8A 1W34A 5BSVA 3LGSA 1L7DA 3A6KA 4MLCA 4QXAA 2O1WA 5FV7A 3A9VA 1NE7A 1FSPA 2Q6IA 2AFIE 1TA4A 1E77A 5EMJA 3DFZA 1AK9A 1E99A 1EJBA 3NG1A 3HYRA 3KKMA 1EE9A 3OFNA 5EE1A 3B89A 2WY2D 3LDGA 4ZEMA 5DO9A 2H4FA 1XZCA 4MUKA 4CBVA 4Y18A 3VISA 4EHBA 3SZ3A 2B83A 3QMWA 2WSLA 1RKUA 3I01M 2YV1A 2Z3ZA 2O5EA 4ATNA 3EBOA 2B1GA 1CF4A 3IVMA 3QUAA 2W70A 1RM3A 2K87A 2FX5A 1Q6YA 1XJQA 4LKOA 5EIHA 5EUBA 4UMVA 5I7HA 5KTOA 3VR6D 4HQ0A 5JSUA 1PE0A 5TRTA 1U94A 2BM9A 3PDCA 5BV0A 1GU7A 2FQWA 6YASA 4TMYA 4Z1MD 4EI2A 4KR2A 2B2CA 2HFKA 2WG0A 2Q3HA 4RKEA 4DPKA 1E3EA 2WUDA 4EF6A 5JZOA 4CHGA 4XWYA 2JFPA 3VNBA 3VOSA 3DMRA 4FDVA 1QIKA 3RHTA 4YRSA 1RWNA 3BXXA 3V2GA 1JN0A 5CHEA 2WINI 5C53B 4MS1B 3VZSA 4AAYA 2P6NA 4F46A 1Z18A 1UFVA 2E82A 2XUQA 4IGIA 2NPIA 1GUDA 1QIJA 3UTCA 1SVNA 3IP9A 2GCOB 4J07A 1QPGA 1U8ZA 3LWDA 2VJOA 1XJ5A 4C76A 2VDNB 3DEFA 5AMXA 4E5KA 4LDAA 4N12A 1NBAA 2AN9A 2X0FA 1Q14A 2P4SA 2OVBA 2A9PA 2MR5A 1KU0A 1D6SA 1ZVVA 1W85B 4G5GA 1RE1A 2ZE6A 4AJNA 4JB2A 3SQLA 4DC0A 4X7MA 3V3KA 3GRYA 2D0IA 4WERA 5K6TA 4GLLA 2VF7A 5BP7A 3ONEA 2C4TA 1XVAA 3FIJA 3LUPA 1P17A 4JLSA 4ZQFA 2Z95A 4QUIA 3KAPA 4NVRA 5JS2A 2PH1A 1XWIA 3GHYA 3VUFA 3CKKA 5FO1A 4YR9A 2QDKA 1EK6A 3VKUA 3DAFA 3LCCA 2YHIB 1BEZA 3MOGA 2N47A 1NTOA 4NAUA 5EG5A 4E30A 2O8EA 3ZCSA 4DEVA 2Q8PA 3EEIA 9LDBA 4IXDA 4DNPA 5M5BA 2CLHB 2OO3A 2QRKA 1L5GB 1JG4A 3G8BA 4TXHA 4NZZA 4FJ2A 3S3TA 1OU0A 2IIQA 5F4ZA 5K0CA 4J3JA 1ZH2A 2C95A 2DJIA 4HRAA 3RHFA 1FLAA 1OI2A 2QF7A 1JHAA 4WZZA 4CNBA 1XLVA 1DCFA 1SVKA 2XKAA 3D0KA 1YR1A 4KNVA 1JTFA 4BS9A 5A3JA 3OTOB 4GLFA 1JEEA 3R7WB 1MABA 6LDHA 4HDSB 2W43A 4M7PA 4ND3A 4Q1BA 5BWNA 4HJRA 2WWXA 2HBZA 1GPH1 3G9TA 5ETJA 1TT7A 1WAMA 4KPUB 2P79A 2XUKA 4JLUA 3EVFA 3EODA 2W58A 3HGTA 5FI0B 1EGVB 3MXTA 1LNSA 3F71A 3OPYB 4AMGA 3L7OA 5ELLA 2VHCA 2IUEA 4M4SA 2JD1A 1RXCA 1XRRA 2H18A 5BNFA 2B69A 1W48A 4N0PA 1G21A 1U3VA 5JS8A 1L4NA 1ESZA 2B7CA 2GZAA 1PEAA 2HJGA 3PNYA 4EK9A 1N36B 2HTFA 4MGHA 1JHZA 4FFSA 1T9ZA 4BUZA 1TCVA 1U28A 3EUFA 1KJJA 4G1UC 2VDQB 2XMDA 3ANSA 2V54A 2XUIA 1C29B 3QG1A 1VA5A 1M5UA 3L6DA 4G0NA 4MAFA 4A36A 1CS4C 3MCVA 2NVUA 2PX8A 4HOYA 5DTJA 3KFXA 1NJ6A 3OQMA 5KREA 1HFWA 2P6UA 5JALA 2K5UA 2H0RA 4J1TC 3MBKA 3UCXA 3MRTA 4CMIB 4PZPA 4UU1A 3TIGA 4NI5A 3DTVA 4OI0A 5EXTA 1RXEA 1HLFA 4AYWA 3H2KA 4KB5A 4RK7A 3DO8A 5E7IA 5A3VA 1CUBA 3UMGA 5KTKA 1ZD9A 5AI8A 1FFCA 4IS3A 5KC8A 3ZHTA 4RLFA 1JFVA 2MHCA 1RQLA 2C7QA 2K7ZA 3W5AA 3KCNA 3ZVKA 4LYYA 3TTXA 1MD9A 4I6EA 2AX3A 5H16A 3WLRA 1YJ8A 1QG0A 2IOHA 1G21E 1O97D 4F3RA 3V2UA 3A3PA 3T9AA 5J4VA 1M83A 4EYOA 2IPAB 3ROPA 2NM0A 3P1JA 1TXGA 4E03A 3G0DA 3NHLA 3OZEA 3LY5A 1L4GA 4FKMA 1J97A 3WDSA 2RC6A 3FYUB 1WUTA 1E2KA 4GNKA 3LOPA 4FN4A 4MKZA 4BJ6A 4BNVA 4C7OB 2RHLA 1T2CA 3AZOA 1KPIA 2C82A 1KYTA 4QVKA 2Z43A 5I7FA 1KI6A 3N05A 5K09A 1I9CA 2VYFA 4DLAA 1QYXA 4LUCA 1IHUA 4RGBA 3HGQA 1Y4AE 1Q1AA 2F3QA 1CUDA 4TYNA 4R98A 3OO0A 2BGIA 4NYJR 1EYZA 2WJ3A 3DZFA 3FLEA 1TD1A 4YJFB 4MP3A 3SR4A 2ZG6A 3GCWA 3IBCA 1UM9B 2QAGC 4YAEA 1BE1A 1E9AA 1SVIA 1YSCA 4IW3B 1JKFA 4BLVA 3CC8A 3W9YA 3WP1B 2I9PA 1GO2A 3FKSA 3ETEA 4TS3A 3D81A 2RIPA 3DQPA 1R8SA 1V1RB 4PZZA 3G23A 3T54A 5M04A 4XUDA 3LTEA 2SKEA 4GFDA 3SE0A 3WFJA 4C4TA 1ZCFA 4XM1A 5LFAA 5LP6A 2QN9A 4DQLA 3EXHC 1J24A 2VPYA 2BGKA 4KN5A 1L7AA 2FRVA 4P3YA 3KSUA 3U81A 5CYGA 4YI5A 4FX5A 1SG9A 3AZQA 3EQZA 1GSHA 1REQA 4E5MA 4D0GA 5EHGA 4MQLA 1Y9DA 4WZ6A 1KZHA 1CJMA 1MGOA 1DAOA 2BMFA 5IM4F 2QX4A 3OEYA 4RTQA 3F4KA 3BXHA 4F60A 3T9CA 1BN7A 4XD7D 5HSGA 1N8NA 2MOKA 3MJHA 5E3HA 1TGYA 1HZZC 4M9QA 1T5IA 3IUYA 4YP6A 1T6ZA 1ENPA 3SFTA 2WKSA 3IAS6 3ANXA 3WRVA 5K3OA 5E1BA 3ZHOA 2W4MA 2I2BA 5DT2A 4B7CA 2HO4A 3VSEA 1NVXQ 4QFMA 2AF3C 4WN3A 4XQCA 1UBLS 1K8YB 3RYHB 4FWTA 1GQ2A 5LZ9A 1P4AA 4OHVA 2ZJ8A 2DF8A 4OQ4A 1XCOA 4R0NA 2AS0A 1OXVA 3NDPA 2KB0A 2C58A 2JJ2D 1UJ6A 1XZFA 4KPGA 1TGVA 2RK6A 1XNRB 3UMBA 3OCXA 2I6FA 1OHHA 1VJ1A 1XTSA 2V8BA 3VPFA 1UWVA 4BRWA 3F9CA 4IIFA 2QX7A 4YDHB 4X1YB 4ZJZA 5KU7A 5INTA 2I2CA 5ER6A 2Q41A 1E9VA 1G5TA 1ZD3A 1GUAA 5IVDA 3G0CA 4AMUA 1IBMB 5B1IA 2MCFA 3TIIA 4MJLA 3I2GA 3T5MA 1NVWQ 3Q7RA 4P8RA 3HI4A 2YJ3A 5U1PA 1FVHA 2FJ0A 2VZLA 5F5LA 1AQNA 1DQZA 3KYCB 2A5DA 3OC6A 3WGJA 3ZE2B 2ACEA 3LX5A 1CDEA 2R751 5DYIA 1X1AA 3CB4A 3DJYA 2FFHA 2VUIB 1BN6A 2WE7A 4MQFB 4NE7A 4QOIA 1FTNA 4OQXA 4RADA 1EUDA 4HDOB 5DLYA 4GWGA 2JFYA 3M7IA 4KODA 2X9NA 3WZLA 1CZKA 4FBMA 4F5EA 1DRVA 3HB9A 3ELDA 4NEHB 4E12A 4QFBA 4ILEA 3GK3A 3EGWA 3P2MA 4ZZ3A 2PH5A 4CL2A 5DNYB 1EVIA 4DY6A 2ZBEA 1EU1A 4EI7A 3RYTC 5I9TA 2IBSA 1QR2A 1IXZA 4KKVA 4KJZA 2E55A 1LRKA 2BW0A 1IN4A 3H99A 1KJ8A 1XTKA 3LI2A 3RYIA 1RHMA 3WMXA 1E2JA 1HG1A 3UFBA 3V4VB 2B94A 5L6MB 3ORYA 1A8QA 2LNDA 3OQVA 3AB8A 5HZMA 2WHYA 1J8YF 3FVWA 3T3PB 1MC1A 3PXAA 1G2OA 2R4TA 4RPCA 1ZY2A 3QITA 2CVHA 5IZCC 3KK0A 5IYZA 1XK7A 2Z1DA 5E0OA 4IDGA 4LJ5A 5TT1A 1XJCA 1DZ3A 4FBGA 4LRUA 1NXPA 2O8BA 1JR4A 1G7CA 1KYWA 1U2DA 1XRMA 2X5JO 2Z5VA 2HF7A 3A4MA 4KE8A 5ALFA 4JVOA 1IXKA 3T06B 1JIVA 5MF6A 2GQ0A 4XWOA 3M3PA 3I2YX 4FM9A 1CG6A 1KRHA 3LUBA 2Q0SA 3DV0A 1VIVA 1MA3A 3GJ8A 4D2IA 1UBJS 2BKXA 2FP3A 2EJVA 5CVTA 2PX5A 1AZSC 2Y1LA 3OT5A 3BDAA 3PP8A 4F4JA 621PA 3NAQA 3RC3A 4YAIA 2Q2VA 4HH3C 4DJTA 2IYQA 1W5TA 2YNMA 4QJ3A 4Q4DA 4L5BA 4HQKA 4JENA 4IXWA 5PGMA 1M76A 2DBRA 2EFDB 1UEIA 4L85A 1F1BA 3RFVA 4TSRA 3ZK9A 4ASUD 4EA6A 1K6IA 3AKDA 3AFNA 5KQMA 1YO6A 3AW9A 3BWBA 2QPOA 3CGWA 4TMWA 4I4TB 5JJ5A 2HLDD 4HQOA 1TM5E 5HBGA 2DFTA 1XQ1A 4O2AB 1YZLA 3HG7A 1TZCA 2IYWA 3EE6A 4KWEA 3G0OA 4TMZA 5CYFA 5J40A 3WWDA 4EX7A 2VYVA 4LQCA 2FN4A 2IQIA 1EGMB 3SQOA 2B30A 1RQ2A 1JU3A 1HO3A 1GU0A 1H2RS 1U3FA 1RHJA 1V0JA 4KUEA 4RHYA 3LC7O 2XZOA 4IPTA 1D1SA 1F2TA 1L4FA 1U2ZA 5IAGA 1SELA 2ZSKA 2J9RA 2FFQA 3IV6A 4QQNA 3PHCA 3W79A 3KTFA 2O2IA 4TKMA 3ZI0A 2X0KA 5C3MA 3KOUA 5ICGA 1TU3A 2JNWA 3JWGA 2B8TA 2YUTA 4FOLA 3AUXA 1OPXA 4ZODA 4KZPA 3AHGA 4KH1A 4G97A 5EJ2A 3REGA 4Z3DA 1EXDA 4MPPA 3EC1A 3GN2A 3WWYA 3ETDA 4KBYA 4UM9D 2JFVA 2VS1A 4W5RA 2J9YB 1TUBA 1PZNA 1Y4DE 4GKAA 4US2R 2I87A 2OCAA 3INRA 5J1TB 1E0JA 1G3IA 3FKQA 1Z4MA 1AMOA 5JXJA 4XLTA 1IL0A 1TJNA 3NTLA 3NHUA 1JZSA 1OC2A 3DNPA 4R6XA 2AH5A 2N1MA 5F7JA 1JFFB 2PLAA 4RVUA 5IKPA 2H0AA 2AEMA 3EA5A 1W36D 2FWPA 4IJUA 2AV6A 2IEDA 3V8BA 2CMGA 5AHOA 1ZU4A 2WQZA 3M6FA 1BHO1 4LX0A 4CF5A 2CCGA 4JJFA 1KBOA 1XXHA 3LC2O 1MX9A 1Y5LA 1ZSYA 1R9MA 3B1WA 2ZSEA 4JYBA 4TV9A 3ZC3A 3ETGA 1XAJA 1IOLA 4RHTA 1V16A 3EIEA 1WLYA 3B3GA 4X3PA 3CB2A 1EVKA 2W98A 4BEBA 1AVTA 4G85A 2HT1A 4GYJA 5FBKA 2KYRA 2CXRA 3K53A 2IXGA 1NXXA 1O87A 1R66A 2F64A 3H5VA 1GYRA 5FOXA 1RBMA 1R5BA 3H6KA 1SKYB 2LVBA 1I3MA 1MQ9A 3AW8A 3B3JA 4MUMA 1ENZA 1EM6A 2YZKA 4AD8A 1HPLA 1V8BA 2FR8A 4W6QA 5FUBA 3FD8A 5TS2A 3KV3O 4NCXA 4QUDA 5K9ZA 3ESRA 2HPAA 1IN5A 1WSWA 2G4VA 3F6RA 2O6LA 2AYZA 2FHPA 4QA9A 2CLSA 5TVKA 1DELA 3SJ7A 2DCUA 2L2QA 5B2FA 3VPAA 1R0CA 3W06A 4MV1A 4DDKA 2GNOA 1EUYA 1KAMA 2RGAA 3A0UA 1XI2A 4FMDF 4FYYA 2ZREA 5BR7A 2VTBB 4LJ7A 5BSHA 1U0HC 1NZDA 3G49A 3TQCA 1DI0A 1WRBA 1XXHE 2BF7A 1PG0A 5EEGA 2FPPA 1YUMA 2JIMA 1X1EA 4S1NA 4QEZA 3V8NA 2WHQA 2JBWA 1XEWY 5LN1A 1MXFA 2UYQA 2WNIA 2XR1A 3WZMA 3PUXA 1A69A 2QI9C 4MKRA 4WD3A 2W6JA 3WHKA 3ADPA 5E8JA 1GLNA 4DCNA 5GADl 2CFTA 1I4DD 3AR3A 3NGXA 4JJIA 5AI4A 4H7DA 3DBHA 2OFPA 2UYOA 1PR9A 2DUJA 2ECKA 2JK0A 1L6IA 4MWSA 3HH8A 4Q1VA 5JECA 5T41A 5AXCA 1I5EA 2QPAA 4NMWA 2ZIFA 4IYRA 3TL6A 4I9GA 5BYKA 2BBOA 4B3DA 2O2YA 2A0YA 1INLA 1GG2A 2W6ZA 4LJSA 3R7SA 1WNTA 1OJLA 4G4SO 5C81A 1UIMA 1JMVA 5TPZA 5JDIC 3PVCA 4BO2A 1Z7BA 4Y0VA 1BMDA 1I32A 2ZVJA 1ZINA 2Y0CA 3C1AA 5CW2A 4AYTA 4BNIA 4BQIA 1GNRA 2C57A 1RZRA 4YGXB 1Y3DE 5CYPA 3TR0A 3CINA 3EQ6A 1EFLA 1UK8A 1WD7A 2RBGA 5CFLA 4RK6A 4HS4A 1T0JB 3AFGA 3O7WA 2WM2A 3E23A 4CU2A 4ON9A 2JIBA 2Q1XA 1U99A 4KO1S 4QUHA 5DEOA 3TQOA 1PHPA 1SXJD 3R7AA 4F2DA 2ZRGA 1C9YA 4LBVA 4J4TA 2WI8A 4P7GA 4N39A 2BL4A 1D2MA 3GFQA 5DNVA 3A6PC 3TS1A 4WJLA 5A05A 3KKQA 3OSUA 4MQ5A 4ZVSA 4DV4B 1VP9A 3L9WA 4JB8A 5B55A 1PV4A 1MX3A 2PCLA 4LE1A 1KAOA 1CRLA 3KO8A 5T3UA 4DL9A 2G1UA 4WBNB 3HZRA 3FG9A 3R0JA 4Q4JB 3WJ7A 1EAYA 1YDEA 4D9GA 3VH4A 2HLPA 3D2BA 4M2LA 1B0PA 5A5EA 4Q34A 4YUXA 4G01B 1I7PA 3EPRA 3ESCA 4Q3DA 5TLSA 1U11A 1ZH0A 2PSSA 5HZGA 3PEYA 4GRIA 1GPYA 2C94A 3D5TA 5AM4A 4RX1A 2D7CA 2Q6VA 1X39A 3O95A 3KT6A 1PR3A 2E21A 2JH8A 4W9RA 4DSZA 3LZ6A 2UYHA 1A9YA 4D82A 4LG1A 3BCSA 1E1MA 1LDGA 3NKLA 5EOVA 5GZ1A 2VUTA 3A2NA 1M8PA 4IV0A 3TYXA 4PW0A 5ALRA 5TC4A 4U3JB 1IZ7A 2V65A 3CN9A 4G1FA 3QPVA 1G7RA 1Z37A 4N8DA 4QBGB 3U37A 2QLTA 1S01A 5H81A 4QG7A 1M2NA 4F6LA 4CR8A 2BEUA 3TW8A 4NBWA 3H2SA 2HPZA 3H9GA 1YVPA 4BO6A 4M53A 1C8LA 2W42A 5C31A 2VKQA 2QQFA 1M1XB 2HNKA 2V7WA 1E7MA 1ULUA 4FR2A 1NU8A 3D3WB 4X93A 5CDFA 3A1CA 4ZAXA 2GN1A 4O63O 4ZU1X 4DLNA 4D8YA 2XNHA 3TPFA 2HUNA 1F1JA 1U0SY 3AUFA 3LKDA 3LT0A 3SBOA 3TSYA 2VH5R 3VPGA 4QT4A 1U6KA 5JFTA 5A4MS 2NXWA 5J9FA 3V4SA 3WK5A 5A71A 2WJGA 1WXWA 3KT0A 2RCYA 5IUJC 2VSNA 4DAOA 3O4JA 1JHOA 1QCDA 4R9UC 2D1SA 1K89A 2F1KA 3PZBA 3R3UA 4M6WA 3RVBA 3R77A 1RCFA 3FM9A 5IFLA 5C4GB 1W0KD 1K3FA 3NONA 2DKNA 3C5WP 3SR3A 3N70A 2AQHA 1P2FA 1C2TA 1R6BX 3LQ1A 2EBUA 1EK0A 2Z57A 3ROMA 4D3FA 1DX6A 1W44A 1RSZA 2RH4A 4ZRMA 4EVSA 4RY0A 1ZK1A 1H2XA 2Y4NA 5DWVA 1SCKA 5ICFA 4B6FA 4BMDA 1JIJA 3DMHA 3K9QO 4FXOA 5AM3A 3EVGA 1I1NA 4YJ3F 2PA0A 2BZSA 3CH4B 2CVPA 3SSMA 4GM0A 4ALIA 1D7OA 4F84A 2RDMA 4R9RA 4OB7A 3WA6A 3DGEC 4FXPA 3ZCTA 4BX2A 4CT5A 3BA6A 4S24A 3QBEA 1HFJA 2PXHA 4H77A 5BT8A 4RHFA 5CDFE 2AG0A 4WESA 3E03A 1O9GA 5DP2A 1KK1A 3BWXA 3P9SA 5FH9A 3PA8A 1FA9A 4NOMA 5LZ4A 4JT8A 1YOVB 2DPXA 2O2DA 4PLPA 3EUAA 1F14A 1RVDA 2WICA 1PUXA 1QG4A 1VZ2A 2IYAA 1G19A 1L3BA 1ECJA 2GCGA 2YW9A 5C46F 1T4BA 5DGXA 1W1IA 5CFMA 1TM4E 5L3SB 3LBYA 3MLAA 5F9FA 4I50A 4RVOA 4I3GA 3E22B 4LW8A 2H3HA 3DUFB 3V1YA 3VR4D 1FFYA 3B6MA 4H7HA 5HEKA 1ZK3A 1E60A 4ADSG 4N54A 3S70A 3A3NA 1OIWA 1RJGA 4O4IF 4PRYA 3SSAA 4ALNA 4UXIA 2JKVA 4EHFA 1I0IA 2GXUA 6AT1A 1S8AA 1EXVA 2QXTA 1ZMOA 3HU2A 3QKRB 3KU1A 3ZZTA 3AR6A 5K6AC 2P9FA 2YDXA 2CEAA 1O6FA 3GR6A 3KQWA 2H2DA 1CHDA 1PX2A 2QLNA 2BGGA 2B0CA 3GRVA 3E2IA 1GZ7A 4QQRA 4RFLA 2JCBA 4KLNA 1GIAA 1PS9A 5B1DA 3RK4A 3VX3A 3FOWA 5F33A 1K0UA 4ZDJA 2X0JA 2BONA 4TTAA 1XPOA 4BBZA 5HM6A 5CTAA 2WSSD 3GIWA 3DBLA 3OZGA 5TQJA 2P0EA 3CM0A 5G0VA 1NJGA 1Y3BE 3KWFA 3AKCA 2NZUG 1O7JA 4FZJA 3T38A 1W0CA 3SQWA 5K20A 4CIDA 4Y1FA 4RA6A 3ZYCA 5FOSA 3QPUA 5JBQA 5I45A 1KEVA 1MAHA 1EVLA 1WZNA 2GAAA 5CGQB 1NJ1A 1K5HA 2H17A 3RADC 4CE6A 1M8JA 3N2EA 1TT5B 3B48A 1WCV1 2CDBA 1CB0A 2JJ1A 3ETCA 5KNBH 4RTJA 3ZXIA 4A1OA 1QC5A 1Q44A 4WW0A 4LYGA 2DVMA 4B7ZA 1XWFA 1LCIA 1PJCA 2C7BA 3EZ2A 3C8HA 3L4SO 4LPKA 2R8PA 3ZDQA 1CUEA 4DDMA 4CIAA 3UGJA 5AR1A 7AT1A 4ZT2A 2XYPA 2FEMA 4I6JA 2A35A 4EJFA 5KCZA 3PXCX 3COPA 2OO5C 3PWTA 4J49A 1QZUA 3WWCA 4I8XA 1DCMA 3GRKA 3HEAA 1KNQA 1TKAA 2QTBA 3CXRA 3DJFA 3JRWA 3H1EA 4V0KA 4RH0A 2FLKA 4H7JA 2NSJA 3RJ5A 1RP7A 5FD8A 5ADVA 2JIZD 4R3WA 2ZJ4A 1KSFX 2MSEB 3UK1A 1P2UA 3A9RA 1YJCA 2OSVA 3ABZA 3Q2IA 3K16A 4FNOA 4K6KA 4ME6A 1EGQA 1RLMA 4N7BA 2O3TA 2E37A 2ORIA 2Q8NA 4C6TB 2V03A 4GX2A 4XDZA 5BNZA 1J99A 5CIQA 4LWOA 5LXTA 2QD5A 3NVAA 5HCUA 3ZV5A 5AXAA 1XMJA 2X7JA 4LHWA 3FFBA 3QX3A 4AF7A 2PFKA 2X9LA 4U5QA 4FHCA 3M34A 3MPUA 1LF0A 1LXCA 1WP9A 4I08A 4PWZA 1S3GA 1E98A 4UULA 3Q8XB 3KQMA 3WL7A 1BGWA 1IY0A 2Z83A 5A4IS 2QSYA 3AOEC 3EY4A 6REQA 2FETA 1N0HA 3K0EA 1VI2A 1CQJB 5F76A 3GLGA 2XZDA 1PUJA 1KFBB 4P9NA 2H8GA 4ZP1A 5LC1A 3RRNA 5J1SB 2OLKA 1MRNA 1B16A 4TKVB 1TAUA 3MWLA 1MZVA 3CONA 3LFUA 1I7LA 1WSAA 4B84A 3L3BA 2UXCB 5DRYA 1VL8A 4ZPXA 4UU0A 5H83A 1X8LA 1UJNA 3RABA 3OZBA 3GHHA 1DT5A 1PR4A 3QPBA 2WWHA 3QXGA 5EXSA 1N1MA 3RWBA 3W05A 3WIBA 1Z5UA 4DIDA 1E3JA 1PT9A 1L4EA 4NR0A 4B6GA 3CU5A 1N9GA 2YWRA 2YR0A 5EJ8A 1A8UA 1QFMA 1C9JA 1NBWB 1U5AA 2QA5A 3A6FA 4K1XA 1XCLA 4R7TA 3H11A 3OX1A 5LBUA 3VC7A 3H5LA 3UWSA 3VZCA 4C87A 2W2LD 3UJBA 5J23A 1KOFA 3B36A 1VP3A 4NC9A 3U26A 5K0FA 3TGLA 4LZPA 5B36A 1JJFA 2J4DA 3II6X 3PSAA 4W5JA 1NVDA 2CLMB 3K96A 5BV1A 3FSGD 5DM70 1CE8B 1N25A 1BCRA 4UEOA 3WIDA 3EPLA 3QENA 4NICA 4WFKA 5FB3A 5JDCC 1Z2AA 3T7IA 2F17A 5F52A 1QDEA 2QEQA 4IIVA 3JYLA 1X74A 2HCTA 2WHRA 2X7HA 1Z82A 3R0ZA 4FOPA 3T1QA 2CE7A 2P0AA 1E5TA 3FGOA 3BRSA 3L0DA 3QBVA 4GZLA 2ECOA 4Y6PA 1V37A 4R9NA 3SNHA 3TMAA 3WK4A 3S28A 1KJWA 4CV2A 5CB0A 4YP0A 4BLUA 1TC2A 2Z3VA 4E3ZA 3K70C 3IJRA 1HQCA 4LC1A 3UGQA 2IITA 1LVGA 2A6PA 5DI3A 4R69A 4J2OA 1BEUB 4JODA 5EHNA 2Y66A 5BPFA 4TQAA 1C81A 2H08A 2OHHA 3MHPA 3WB1A 4TQ9A 4AU1A 4N4AA 4X6UA 1I6LA 3RBVA 4YUAA 4IVRA 5B7GA 3T4EA 1YB5A 2KM1A 4L9RA 4JK3A 3PDJA 1ZVKA 4MVJF 4C6HA 1AM4D 2X40A 2RKWA 5SZHB 2YZMA 4BNJA 1PNVA 4R1LA 4TLBA 2H07A 3P52A 3VH2A 2A57A 1EK5A 2FPXA 3HUFA 5JSFA 4QPJC 4L8FA 2ZRPA 2PRSA 4BGDA 3QP9A 1HDYA 1QMGA 2HHCA 1CF2O 5FUXA 3SDZA 1DOZA 3WX0A 1JNXX 4BLTA 4P33A 5J4HA 5GJBA 4UEQA 4LXIA 3E7DA 5K8VA 1NL3A 4UDXX 2NN3C 1W6RA 2EWVA 4GG1A 3FYDA 3M4XA 4ENTA 4NYIQ 1ORDA 1R10A 1W88A 3DSRA 4K26A 2GUGA 3ORRA 3KD3A 4P5PA 2HCBA 4XDHA 3T7TA 2XQKA 4MV5A 2UVDA 1DL5A 3B7WA 3FN4A 3FWNA 3PE3A 4MR9A 5TGZA 2OPHA 3ZE0B 5K3CA 1X9GA 2BAGA 3Q9UA 4BUJA 1T9DA 1T36A 3QBJA 5K2MA 1A2BA 4R8KA 3RVKA 1YL5A 3AXSA 1KAGA 4QVIA 1AQ6A 4JBXA 2F67A 4DOMA 4J0DA 3QOFA 4JROA 2QUKA 1GV0A 2WFAA 3FPLA 3K70B 5JI3E 2ODPA 4Y2QA 3DWEX 4ITVA 1QRAA 2IH4A 2X19A 2A84A 2ET6A 5GOTA 1PL6A 4HWRA 4NBNA 1T9GS 2FMXA 2GDJA 2HU5A 2XQFA 4KL8S 1DAFA 3R0XA 4PZCA 1FYDA 1PGPA 2PXXA 4HRVA 1KE2A 4GPD1 4CR6A 3HKEA 4L07A 4DM3A 5H8WA 2ZI9A 1LZKA 2F7SA 2X14A 2A1TR 1WPQA 3IJ5A 1KFKB 3ELUA 1QG2A 4R1SA 2PJZA 1KO7A 4HB2A 4YJ2B 3QYJA 3AU8A 3FTNA 1OWOA 4E5YA 3C3DA 4AIRA 4EUSA 4YP1A 3A05A 3A6GA 4BX9A 4EY8A 1CZUA 1DAPA 3AJEA 1IULA 3SX4A 1RS0A 3NRCA 1KETA 4OQMA 1V3UA 3AFHA 3OJXA 1ECGA 5HJ2A 1Z47A 4Y30A 2CGEA 4BPBA 5JQGF 3MTBA 2WWYA 2YVUA 2JAWA 3SIRA 1KJNA 2Z6AA 3LL7A 2XNCA 1IG0A 2Z2ZA 2IS2A 3C3EA 1L5OA 1CQIB 1RPJA 5ALLA 4LF7B 3IT3A 4GEGA 2EZUA 4XARA 4F72A 1B73A 1CP2A 1SN7A 2V5VA 3DOJA 4OYLA 3RDPA 4DGSA 3HACA 3QKWA 2HJHA 3QOXA 5DNEA 3I6YA 5T4FA 3D4OA 1I3LA 4I2NA 4IOKA 4A8JC 2XPCA 1L4YA 2VYNA 3I52A 2BM1A 2O7RA 5KOJB 2A92A 2FH5B 2PQ0A 4DT1A 1G41A 1G60A 3MERA 4KWCA 1WXIA 1XEWX 2A3NA 3KSDO 4I9FA 4KQWA 1USUA 1H2FA 4A0SA 3A2MA 2NVBA 1MEEA 3JTMA 1NWHA 2IYRA 4ZVUA 2CHEA 3ND6A 4IQ8A 8LDHA 4HQLA 4YCSA 1RAEA 2XCIA 1GZ3A 3PUHA 1FX1A 5HGXA 1SQFA 5HMMA 5TMPA 3I8OA 2YJZA 4LWPA 3E2MA 3O90A 2Z6QA 1EWYA 1P0IA 1U7PA 1XZ8A 4NCIA 1YQEA 1R0YA 2F3RA 4PZ9A 1QZ3A 3GMDA 2QD4A 4YCAA 5EJIA 4DRXA 4ER0A 1M1YB 4UHDA 1SBIA 4Q3NA 2ISQA 3TZHA 1I2AA 5JAHA 3P71T 4R1UA 3QKTA 2DBYA 4MA0A 3V8QA 1ESMA 2PZKA 1LX6A 1HC7A 1SIOA 3A9WA 4KWIA 2F8LA 3V1UA 2VZ8A 2DC1A 1WZ2A 4BWYA 2P8JA 1PFYA 1GQRA 2ZE7A 2PVSA 1V7QA 3K6KA 3P2YA 1EHIA 4KRYA 2DUUA 3CXUA 3X1WA 2E9SA 4BC1A 1I7SB 2ZM5A 4LV5B 1VE1A 4L9SA 5A9SB 3KDSE 1MQ8B 2BM8A 2G17A 5B4UA 5LYJA 2R5WA 3GEPA 2QMUA 4MYDA 3KSBC 4QNRA 5FLKA 2W6OA 4JMPA 3JQGA 3ONDA 3R3VA 2VQSA 2R6AA 2R6JA 3ZY3A 4A8JB 2HYIC 4QYMA 3WKCA 3MQFA 2GK3A 3IPAA 2QJOA 3KDPA 4G9EA 1ORWA 2YBEA 3DBIA 1GR0A 1EFKA 2A86A 5G4KB 4A2PA 1A2QA 2BHSA 5FTLA 5HR5A 4H7IA 4CKCA 3AJAA 1KMMA 4BAZA 4N5HX 4PHCA 4BFWA 2WB4A 2FZ5A 4K2AA 4R01A 2VP2A 1NQUA 3DW1X 4MUIA 3QVTA 2ZU6A 4AX4A 1YL7A 1TF7A 2VJNA 3O73A 2HL6A 1KY5A 1Q11A 4KE7A 1KEKA 5AHRA 3STTA 3KD2A 3RSZA 1WKVA 4CCSA 4EDFA 1JLLB 3CBQA 2ZRDA 3EZYA 4J0FA 2WSIA 2C4HA 4M0KA 4QREA 2ATVA 4EFKA 4XCXA 4BGUA 2XLCA 3H0EA 1VECA 3DZ8A 3T8YA 3GVXA 3U3DA 4DA6A 4TTVA 3LK6A 1LBSA 3JARA 1YZTA 3LBAA 2IU3A 4JWTA 5HG0A 1E8MA 4AUNA 4M1TA 3GV0A 1X7HA 2CJFA 2ZR9A 2I3BA 3KJIA 3LLVA 1EUCB 2C2XA 4ZJYA 2JANA 4G1MB 4XTRA 1R5JA 1QOQB 3QVUA 3NYIA 3Q8WA 3S8YA 1HURA 5JWOA 3K9WA 4ARZA 3H1PA 5KNCA 1FTWA 1GRQA 2PS3A 2IU4A 2C1ZA 4RCYA 1RMQA 3K6SA 2P41A 3B6KA 3RC7A 2B98A 3U17A 3L8MA 2AG1A 5IJAA 5IEJA 3SEAA 4UFPA 2JEZA 3TL2A 1U2SA 4ARUA 4XCQA 3TZCA 3VHXB 2