3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
1SUCA 1TMGE 4H6WA 2PMWB 4KPGA 3TI7A 1Y3CE 1BH6A 1LW6E 1S02A 1YU6A 2ZRQA 2W2NA 1MEEA 2G4VA 1KDYA 5K7SA 1IC6A 1SBCA 2E1PA 4AKSA 3WQBA 1SBIA 3I37X 2PRKA 1KDZA 2SBTA 3ZXXA 4ZARA 2XRMA 3D43A 1SIOA 3I34X 3F7MA 1GA4A 3DE6X 4I0WB 2PQ2A 5AMXA 5ARDA 2IY9A 1NDQA 2Z58A 5FAXA 3D9QX 1SN7A 1WVMA 4DJ5X 2X8JA 3DE2X 1AH2A 1BFKA 1AF4A 2HPZA 2ZWOA 1GTL1 2ID8A 5FFNA 1NLUA 1SBNE 3SQOA 3WIUA 1SUAA 1T1GA 1BFUA 2SNIE 3DE3X 4CG0A 5FBZA 4J94A 4JP8A 3VV2A 1AQNA 3DE7X 4H6XA 2W2MA 2Z2ZA 1EGQA 2B6NA 1Y3DE 4OV6B 3PRKE 1Y9ZA 1SUBA 4NMXB 4BWGA 5JXJA 1DBIA 1C9MA 1P8JA 3QTLA 1C9NA 1SIBE 1Y48E 1BJRE 1Y1KE 1P7WA 1PEKE 1SCAA 3DW1X 5AQEA 2IXTA 3TI9A 1BE6A 1PFGA 1WSDA 2Z57A 2W2QA 1ZVKA 4WOCA 1P7VA 5CW1A 5AVKA 1SUDA 3A3PA 1SCDA 1YJCA 1R64A 3ZXYA 3PTLA 3BX1A 1WMEA 1Y34E 3L1KA 4FONA 4ZOQI 5JXGA 4NE7A 3UNXA 1JEAA 4MZDA 2X8JB 1SBHA 1Y33E 2QTWB 3LPCA 1GTJ1 1V5IA 1KDVA 1AV7A 1Y3BE 2DUJA 2Z2XA 4GI3A 4RYDA 1SCJA 2PYZA 1SUEA 3DVRX 3DVQX 3LPAA 3VYVA 1VSBA 1ST3A 2PKCA 3DVSX 2HD4A 2WWTA 1ST2A 1CSEE 1XF1A 1T1IA 4C3VA 1SCNE 1Q5PA 2Z30A 3GCWA 3DWEX 2W2PA 3OSZA 3WIVA 2PWAA 3DE4X 2SECE 1BE8A 1OYOA 1SIUA 1R6VA 1OT5A 1TO1E 1AK9A 4B5LA 1GTG1 5ARCA 3H42B 5AVJA 3DDZX 3VV3A 3AFGA 3CNQS 3BPSA 3GT3A 1EA7A 4DWWA 3T41A 1OYVA 3I30X 2WUWE 1SUPA 3A3NA 3GCXA 1ZVJA 4LVNA 1C3LA 2WUVA 4KG7A 4WOBA 3VTAA 1TM5E 4CFZA 3DE1X 1TM3E 3AJ9A 3Q5GA 2TECE 1SBTA 3TECE 2GKOA 1Y4AE 1A2QA 3QFHA 1PJ8A 2Z56A 2SICE 1KE2A 1TM7E 5ARBA 3LPDA 1GNSA 1GT91 1SPBS 1HT3A 1TM4E 3DE0X 3F7OA 3Q40A 1AVTA 4OMCA 1NDUA 1UBNA 1CNMA 1TO2E 1SH7A 2PWBA 3AJ8A 1SVNA 2ST1A 4AKTA 3P5BA 5JXHA 1TM1E 1WMDA 4HVLA 4HX2A 3EE6A 1TECE 3GT4A 3DYBA 4Z2AA 3SICE 1V6CA 4KB5A 5B1DA 1TK2A 4K8RB 4YN3A 3QMPA 5I9SA 3VSBA 4C3UA 3CO0S 1S2NA 2DP4E 4OMDA 1C9JA 1PTKA 1SCBA 1YJBA 2DQKA 1WMFA 2ZWPA 4H6VA 4LVOA 4CFYA 1S01A 1R0RE 3LXUX 5SICE 2ID4A 2XTJA 1Y4DE 3EDYA 1GCIA 3EIFA 3A3OA 4M1ZA 1T1EA 4NE9A 3WHIA 5JMOA 5JXIA 5B1EA 1Y3FE 2Z2YA 3DW3X 2W2OA 1MPTA 3BGOS 3I2YX 3HJRA 1KE1A 1AU9A 1DUIA 1GA6A 2V8BA 2WV7A 3DE5X 1SELA 1THMA 1YJAA 1IAVA 2P4EA 3F49S 4DZTA 1GNVA 1GA1A 3VHQA
chains in the Genus database with same CATH superfamily
3KETA 2JI7A 4XARA 3PTZA 4G6ZA 1P6XA 2C0CA 2H1CA 3JZMA 4JJFA 3H5TA 3ZZ1A 4AF8A 4DLYA 3SBEA 2XNHA 5JAMA 1GVNB 1K7SN 2R6R1 3ROQA 3LA8A 1IN4A 3BWDD 3L7NA 1G21B 1EFUA 1KK2A 1KO4A 1OLSA 3N8IA 3O8QB 2I6XA 2PMFA 3QFFA 3S3TA 2GM5A 1KY4A 1ZM7A 3OIVA 4V24A 1OB5A 1P61B 5H70A 1V0JA 1GGFA 1XZEA 2VSYA 1E7QA 3I92A 3WGQA 4M1TA 2NXCA 1OFVA 5C34B 2ATCA 4QSHA 1CYDA 4DUZB 2XIJA 3OA2A 4DUGA 1CERA 1N2JA 3BD8A 5AICA 3JD0A 1U8ZA 3EZ9A 1BVUA 4JBWA 2CVFA 2FPRA 3IVAA 1HMYA 3ZZMA 4GDFA 1XXLA 2V7BA 4MR9B 4DCNA 3G9UA 2QPLA 1SVMA 5B3JC 3KB6A 2FZKA 3AX6A 4JIGA 1QG0A 1J23A 1UJ2A 3EG5A 4R81A 2XUDA 3PITA 1UBLS 4IS3A 3TOVA 5KQLA 3VOBA 1KDPA 1E66A 2Q3JA 2OT3B 4H15A 2F8LA 4QAQA 3FTNA 4LJ9A 3RUFA 3LGSA 4LRUA 3EVAA 4M7RA 5BV8A 1HYBA 4HEHA 3H13A 4EMSA 1R8QA 2IP2A 3CXUA 3B8HA 4HB4A 4LXXA 2HL6A 4NPHA 1OFGA 2YN0A 4OHCA 4QJ5A 1CS0A 4BVHA 2C20A 3HEMA 5ALMA 1AUOA 4RLQA 2K5UA 4ENUA 1ID8A 4RZ2A 1DB3A 1B73A 2JIMA 3ZVNA 1KY3A 3WE7A 1P1FA 3M6FA 1H22A 3IKVA 3KWFA 4L9SA 2IQIA 3T1HB 3FOZA 4MRRA 3KQNA 4OQQA 4FB5A 2JRLA 3D6MA 2FG5A 2B8NA 3CV3A 2AIRA 2ZUUA 4L3WA 4LNAA 5ICFA 4HLDA 4KYIB 1GKUB 2QN6A 2BM0A 4IIBA 1ZK4A 3GIWA 2C7GA 3TLYA 4TVBA 1SXJB 3LOPA 4YJFA 2P2LA 3QM1A 4PPFA 5FV7A 1OOEA 2C58A 4UFPA 3Q9SA 3TW4A 3ZHTA 5JADA 4PCUA 1G98A 1HZZC 2O2DA 2B3DA 5AKXA 3SIXA 4LHYA 4A10A 3JSAA 1PR0A 1ZD1A 2XQKA 3EIXA 1MJGA 4G5OA 1J7KA 2PGXA 4N6OA 2XYQA 4TTQA 3GUCA 4R98A 3R9KA 3EXFB 4C4PA 4YPVA 2B1QA 4ICIA 1O77A 1RAFA 4RGQA 1U1FA 1ZVJA 1VHQA 3OICA 4LVNA 4AYWA 4QGBA 4N0PA 4ZHQB 3PC8C 3AH8A 3SF8B 5KB3A 1G8SA 3JQGB 4LZLA 4P9NA 2RHBA 3ENNA 5BNTA 4HNQA 1PR6A 3Q40A 1NUHA 3N2EA 4XVRA 4DNOA 5JDCA 4K9QA 4RVDA 3GXOA 5EZ6B 3CRVA 1VPDA 3AY3A 2AH5A 4Q3LA 5CR9A 3UB2A 4AX4A 3EQ6A 1GGEA 2Q9BA 4LC9A 3TDMA 1V8ZA 1W8IA 4C6TB 2VATA 2EC5A 1JH9A 1Y9EA 3LX8A 4WCFB 4G24A 1KVQA 4QOEA 8LDHA 4JEHA 2Q3HA 3HM9A 3NHWA 4WT7A 3DDNA 3CJQA 3ELUA 3FI0A 4P4LA 4P83A 4L0CA 1EVLA 4FI3C 2MR6A 3AEXA 1SWVA 3CNOA 4JU9A 3FNQA 2GCOB 3Q4GA 5DWQA 5IAEA 5T8KA 5A1JA 4ZYTA 4JFAA 3N0WA 5FXMA 1G21A 1JXMA 2EFEB 2QNRA 1X0VA 2P90A 1YZ3A 3NYIA 1MX3A 3Q7TA 5GQSA 3QIVA 2WJWA 2H6EA 3L0BA 2JAWA 4MKIA 5ALDA 1V71A 4NOJA 3WL5A 3VU1A 2A94A 2Y05A 3PF9A 1ORIA 3U7HB 3E9DA 1Y4SA 1AMNA 3IEMA 2FN3A 1BCSB 4LJ7A 4XJTA 2PE5A 3QMMA 4KQCA 4MITA 1Z37A 3LLCA 3I8XA 1XC7A 2O2IA 3N6VA 5BR8B 3U4QA 1XE3A 2RGCA 4IKEA 1DHRA 3MLAA 1W0KA 3A6DA 4MKFA 4JZKA 3PEVA 2ZSDA 4MGHA 3ZTTA 2QTVA 1CWUA 4DUPA 2BKUA 2INGX 5LWHA 1A4UA 1CDZA 3DAGA 2A2ZA 4RKFA 3T7CA 4A8JC 1PS9A 5IX8A 3A1UA 3STXA 3A28A 3V4FA 4CG0A 4DR1B 2E7ZA 1W19A 1USGA 2ZTUA 2HRBA 3INGA 3WBBA 4JYZA 4D9EA 3NBFA 2O3RA 4FE7A 2J0VA 2HYIC 2I7XA 2X6TA 3OA0A 1XTSA 4WMLA 3I5XA 4RL4A 4TL7A 4R2HA 1G59A 3OOJA 3I12A 3F5MA 3UB3A 2AJBA 2H5JA 3CRZA 5DM4A 5A6SA 5KSWB 1XPUA 4KR6A 2D54A 3PJDA 1R27A 3PJRA 1KVSA 5I9MA 1SCDA 1UK8A 3AR2A 3EHDA 2JPDA 4G5YA 3ZI7A 2ZREA 5GGYA 1E20A 3LF1A 2YNMC 3EF3A 3BMOA 4KN5A 4ARZB 1YS2X 4J90A 4AZ3A 2IOYA 1LXCA 2ZJBA 3UAOA 5BSHA 4US1R 5BY2A 2RGWA 4GIBA 4BECA 2QPAA 2QDKA 3DFZA 3LUDA 1EXNA 2EKDA 2C04A 5BV0A 3VVMA 3X0DA 3DBHB 5GTDA 3F6SA 3NWOA 1E3DA 3FSEA 4LDRA 4WGGA 1PD0A 1CJSA 2PKCA 2YOHA 4LQ4A 3B2NA 3FOFC 5DU2A 1FYXA 2P6MA 2PWZA 2HWWA 3R3JA 3VR1A 4XUGB 3DVAA 1OA1A 3LC1O 4YBZA 1E5DA 3AHEA 3T35A 4R7GA 1H6CA 3DDZX 3INNA 1U4OA 3M2TA 1NRIA 2B1IA 3B1JA 2C61A 1KOFA 1P1HA 3H97A 3DH0A 4FYVA 3OCVA 2VNAA 2ZT5A 1N1EA 1TZ2A 3QW4B 3MRVA 1SUIA 3KYIB 4NJOA 2BM1A 2V54A 4FI3F 4YP7A 1RZUA 4V03A 3T3PB 4GZ6A 1WM1A 5HDBB 1TE2A 4HWKA 1OWNA 1U5BA 2BFPA 1KJIA 1SPBS 2VEDA 2WUFA 2ONZA 3HBAA 5E4YA 5E0KB 2CN1A 5K6TA 3KQHA 4LGMA 3IAAA 2JGMA 4QTYA 2XKBA 3MT7A 5BN4A 3MRSA 3H1BA 4YJ2B 2B7CA 2Z4RA 5G4LA 1Q57A 1R4AA 2QSUA 3NC4A 4L28A 1J8QA 4OLHA 4WEQA 5JASA 5JNRA 4U7FA 1ZKMA 5LMUB 5CA0A 3RRMA 2ZSBA 4BXOA 5HF8A 1Y6QA 4TMTA 5HX7A 4Q9LA 3TAXA 2AK3A 5ITVA 2ZRIA 3TZLA 1A8SA 4Z9BA 4WKNA 4BL5A 3FH0A 4M1SA 1OWLA 1XO1A 1JLRA 2P30A 2VF8A 3G2OA 5JCZA 4QT4A 1C9EA 3IRUA 3DHWC 1NVVR 2ZYHA 1PDOA 1YR1A 4JBHA 1ZYUA 1RW4A 4HY3A 4H9GA 1GUYA 4QA9A 5DCLA 3UK2A 1BE0A 2QBYA 4OLBA 1TYZA 3VHRA 1US8A 4RK0A 5GOTA 4AUKA 1BWPA 2OK8A 2ETVA 1YL7A 2XWBF 4KVGA 1D4FA 1W4ZA 3PNPA 2HW8A 2QLBA 4BJHB 2AN9A 4TWZA 1RFGE 3QPAA 3B53X 2AUMA 3MJVA 4UHBA 4BP1A 1P2BA 3ICCA 7GPBA 1J1UA 4ZFNA 4D8TA 5FT9A 3ZVKA 1AO0A 3PFWO 1K88A 4ZRDA 2R7KA 4PGHA 1QLJA 1TNDA 5IC6A 3EPLA 1DBPA 1MDFA 5ARDA 3ZBUA 4AU1A 5EJEA 2O3SA 1H3EA 5HZMA 1XEWX 2VT2A 3GEPA 3O94A 1CULC 4NDNE 4LHEA 4RK4A 1Z6AA 4YRKA 1G8YA 3MMNA 2IHTA 2J30A 4RNCA 4R41A 2CD7A 3M9WA 2J48A 2WJ6A 3O0DA 1VB3A 2FZEA 4O2RA 4QHTA 2AR7A 4CM4A 3OM0A 3IDZA 2AUTA 3FB1A 3UQYS 2BFDB 2J08A 2J0UB 3C5HA 3OP1A 4FM9A 3RS2A 1UKYA 2ZAGA 1LW7A 3DWGA 5D2CA 3PD7A 2XMRA 1O0CA 4WZAB 4DQVA 1J99A 1IHYA 2G36A 1VECA 2W2QA 1OHHD 1MO4A 3AVXA 1U3GA 1ZA2A 2CHEA 3JAKB 1GR1A 3O73A 1CQJB 2WAYA 5TQ0A 2X0JA 2QE7D 3BCHA 3RSCA 2I6FA 4EVQA 3KQKA 3NRJA 2QN1A 1GAWA 2BI8A 4IIJA 3AESB 4Z54A 1KZ1A 1ULAA 1V8DA 4FLMA 2VPYA 4B6RA 2QXYA 5K4AA 2YQ4A 1TTHA 4OKIA 2P9TA 4PO1A 5ES3A 4C7MA 4KV9A 1L4MA 3K0KA 4OTZA 1SEVA 2WF8A 2PUEA 2X9VA 3E5NA 1ST2A 4OB7A 1RLMA 1T9AA 2WA2A 3Q3VA 4MUBA 3F74A 1MPXA 4BNXA 1UPUA 3LPLA 4KWEA 1HFEL 2VP3A 4CIBA 3WLJA 2AI1A 1DGQA 3TNDA 3VR6H 1CY8A 3HDYA 5CTJA 5J4VA 3MMXA 4REQA 1TQ8A 2GBFA 1Z2PX 4UU7A 4YMSA 4GP7A 1B8UA 4MX8A 3V8NA 3TIVA 5HFNA 5AW4A 2Y93A 2DULA 4L2IB 2PBRA 4UAJA 2XXJA 4CMHA 4L0MA 4WOBA 1S2MA 2YRXA 4EIWA 3EC1A 1ZO8A 2GGSA 1VMAA 3UG7A 5H1YA 1JMKC 1GUBA 3GA5A 1N2CA 3QVSA 4MQBA 3L40A 3T3GA 1GT91 1HQCA 1HT3A 2Q1SA 2H52A 2X19A 3IVCA 1L4KA 4MEAA 3RQIA 5KPDA 2G04A 1SVNA 3BJEA 1MA0A 3D2CA 2C2ZA 4P35A 3CT6A 4B4WA 1V7QA 3M8KA 2DQ4A 3A6EA 1BCRA 5FWXA 4Z3KA 1WABA 4L4UA 4EJ2A 4YV7A 2PU7A 1XQXA 4AJLA 4YMTA 1GZ5A 1QVWA 5JYDA 3DR3A 4W1QA 1I0IA 3RI3A 4DAOA 5I7OA 2FN4A 3FBWA 1ATIA 1ZIOA 2OV8A 5JHGB 3E84A 1A8UA 2ODNA 3LNCA 4MV9A 2LD4A 4UBKA 5CNKA 4D9HA 2IBSA 2GPJA 1GTSA 1X70A 3L93A 4QOGA 3H7AA 4QOIA 4P0PB 4HK4A 1LDNA 1QYRA 2Z43A 3HR8A 2NPOA 4PLTA 1IDOA 3UG6A 4LRTB 3ZOZA 4GVPA 5GJWC 4C7VA 3ER8A 1CUXA 1E3WA 5BN5A 3PFKA 2O8EA 3K6KA 4ZT6A 3GMIA 4AL4A 1DXOA 2HGZA 3AV0B 2A0WA 1F2UA 4GNRA 2X3YA 4L5YA 4RD0A 3EXHA 4MQFB 2V6MA 3P9SA 1G17A 1N7GA 4CKEB 1QU3A 5CJ2A 3PE3A 1Q1EA 1X8KA 4UNNA 3GLFE 1Z25A 1BXRA 2H9YA 3EFOA 5DGDA 2Z6QA 3VUFA 2YHIB 4EW6A 3V4ZA 5DRTA 3VYWA 1DRJA 3OZIA 3CVVA 1SC4A 2O7RA 2CLDX 5LP6F 1WBBA 3W4KA 2D2FA 2W0MA 4JP8A 4B3IA 5JXHA 2JGNA 5JQGB 2VWHA 1YAJA 1I1OA 2GZ3A 4X1IA 1S9HA 1F5SA 3KKPA 3QLJA 4YAEA 3W04A 4B43A 4BNNA 4KE9A 1I01A 2ZB2A 3R6LA 3BWBA 1P7WA 2F17A 521PA 3N58A 4ZO6A 1NQAO 2G9QA 5K8TA 3PI7A 1NDHA 2RHJA 3VNVA 1T8SA 1Q14A 1RZRD 2ABWA 4J6EA 2COEA 3EXAA 3C3CA 1H1LB 3GJ6A 4O5AA 1SG9A 2PZAA 2WWRA 3JQRA 5DB4A 4F4IA 5A62A 3TPFA 1JEDA 4ZK2A 3UUWA 4BJ3A 4Z7NB 10MHA 1H6DA 2EKLA 5CH3A 2YRFA 3WWCA 4Q01A 3H84A 3DTVB 4GGPA 1XTKA 3CQ9A 3IEPA 3ONFA 4G23A 2GD2A 1LEHA 1N2SA 2HQBA 3FKJA 1DUVG 4WRRA 4ZI5A 3HEBA 3FG9A 1S2DA 4ESEA 3H4TA 4KXYA 4PYRA 1ZJJA 4YAIA 1TC2A 1XMVA 3ETHA 2O06A 2NUPB 2HV8A 3RUEA 1Z2CA 3WLIA 1ZGAA 1EB9A 4IFEA 2V0GA 4K9SA 5CX1B 1FYEA 3NKVA 1K7XB 1OYVA 4CU2A 1W2WB 4MCHA 4R1UA 4II2A 1TGVA 4X1KB 2E5FA 2FRDC 2WOOA 1M1NB 1LWNA 1EAMA 5EWMA 5D01A 1UJMA 2VPZA 1PFUA 2Q3MA 3T7IA 4BLQA 4KXXA 5BO5A 3PIRA 4JC4A 5CAEA 4QL3A 1V37A 2VP9A 3OKPA 1KGSA 3HLYA 3RWMB 3E3LA 4DLAA 3AJ8A 2WNIA 3BTUA 4YH1A 2AC2A 3HE3A 4B3CA 1OXUA 4EMTA 4HPJB 5G41A 3OOYA 5T6BA 2IWHA 1DELA 2J31A 2QI9C 3WMEA 5C8ZA 1XZ8A 3FWNA 1Q7RA 2GNAA 1E0JA 3UJ7A 1DC3A 2BGUA 4FNMA 4TUYF 3W8NA 3PDWA 1KHTA 3R44A 2IF0A 2J3HA 3QG1A 3AOGA 1KZHA 3UYLA 3DOOA 4R9UC 4ZI7B 3FETA 2PGJA 3PNMA 4ZT5A 4Z4CA 1M8KA 4OGWA 3QPDA 1VMKA 2FZ5A 3A05A 4YQEA 3NLLA 5BMVA 2R7AA 3DEJA 2WINI 1T6XA 3KSAC 1KJ8A 2JIZA 3HYRA 1CUGA 4U0JA 1JSRA 3JQFA 3LY7A 4RETA 4TQAA 1TD9A 1G55A 4WJZA 4EGQA 3GY0A 5CB6A 3LIIA 1LWOA 3L0OA 2TS1A 3BXFA 3TL6A 4I9HA 4DLLA 4TS4A 2NAPA 3OIWA 3QZUA 4H3KB 1TVKB 1Z4IA 2IZ1A 2IIVA 3ACCA 5C31A 1NRWA 2L82A 4N0EA 3DOEA 4BKUA 5IYZA 1IVNA 3ABZA 1WJGA 2GJSA 1B6TA 5ADUS 3FCYA 4HT3B 3GPIA 3KQQA 2AQKA 1Z15A 4W9NA 2J0QA 4RTKA 1VL2A 1PLJA 1PFWA 1SBZA 4JLOA 3EY9A 4XQ0A 3QLUA 1PR1A 5JHHB 1RVDA 1F17A 5CPFA 1IOZA 1ODLA 4D8YA 2DPMA 5JJLA 4MIYA 1XVIA 4MVJF 1N6RA 2NUBA 4QATA 3ORQA 1EZ4A 2BM8A 3ANMA 4RJIA 4B4DA 4B3MB 2CHQA 2HWXA 2JDID 2ILTA 4YCMA 1S2LA 1N77A 5M3BA 3VMFA 5FCDA 2OKCA 1MAWA 3D7SA 3DAOA 3ND9A 2IX9A 4CLDA 4D9GA 5LVAA 1LV7A 4ME6A 2Y66A 1IXRC 1B1AA 1OV4A 4MVJG 2P0YA 2QE7A 3KWLA 4R1OA 1JDUA 2WYUA 3G5AA 4GKJB 1P4HA 4UVIA 4E51A 4CL0A 3IV9A 1O6FA 4UATA 4MUHA 1IOLA 4UM8B 1QPZA 4RZ3A 1E1CA 1B74A 4YYZA 3PHBE 4YP5A 1AKQA 4BNHA 4LOKA 2AXPA 2VRBA 5TQ2A 1WEKA 3GVIA 4DLTA 1R15A 5F4ZA 1EWVA 1X1DA 5L7YA 2PYDA 3OQHA 3NJRA 5HFAA 2WDPA 4F2PA 1KARA 3G2PA 1V45E 3F3SA 4GX5A 4HLUC 2PMCA 5EMKA 5A4DA 4MA5A 1U0HC 3OD5A 3NASA 4BZPA 5HRUA 4UZEA 4G1BA 1T2CA 1RPTA 3JATA 3T3NA 3WYBA 4TMWA 1MOZA 4TPKA 3PS9A 3A3KA 2VRWA 4Q24A 2XB2A 4LZWA 4MVJA 2YHBA 1D7AA 2N47A 4PLHA 3X44A 4XYLA 2HR1A 1YHNA 2HLDA 3FE2A 2P1RA 5KOJB 2CNWA 3FUTA 1NR1A 4U3JA 3B36A 3VR3A 2Y3IA 3DE1X 3FYCA 3G0BA 4WL0A 1XRNA 3GLIA 3AUKA 2HDWA 3MPOA 3PK0A 4JDUA 2AQIA 2X0KA 4MLDA 1CNMA 1T6BY 5I9TA 3SN6A 3B6EA 4FHZA 4QUJA 2NZVG 4FBMA 4JLUA 3T4PA 5K2OA 4XR4A 2OOSA 3P4XA 4TX1A 4YWJA 3U7QA 5JCPA 5DHQA 1Y5LA 3IKTA 2OCBA 2OUKA 1WG8A 2GLXA 2VNKA 2FK8A 2ZE7A 3I04A 3Q10A 3M6WA 5BSGA 3ERCA 1EX7A 1J22A 4UUNA 3Q3GE 4ZHQA 3MQFA 3AEYA 1R66A 3HGQA 3G5TA 2ZJZA 1B00A 2FRVA 3PD1A 5T7BA 1TKCA 2B9EA 1XVAA 3AI7A 2AG1A 3TRJA 5KC9A 4CEHA 3SM9A 3KFVA 2N3ZA 2WT4A 2JZNA 4IILA 3HXOA 2J07A 4ZOLF 1T2FA 3S4YA 1Y9DA 4M3NA 1F12A 5KINB 4B6PA 3LK6A 4IIUA 4MB0A 1R5JA 1KO7A 4PGAA 3VDNB 3O3CA 4ZV9A 2J7PD 5MF6A 3KSUA 3MSXA 3AJAA 2VA9A 4BRSA 2X2PA 5HK9A 1N6KA 4M1YA 3KXLA 4Z4FA 1SFRA 3S5JA 1YACA 4BWVA 4BMVA 2ISQA 3FNGA 5GJBA 4BE4A 1P0MA 3W9UA 1E3IA 1KS9A 1QHSA 3FYUB 4NYIR 1X19A 2BKLA 4OXNA 3WL4A 4BMCA 4PS1A 2JGLA 1QGDA 2HJHA 2ZWVA 5REQB 3PE6A 4M9QA 5A5VA 5KYUA 3DLHA 4JHLA 2AFIE 1KYZA 1TA0A 4M4SA 4HDRA 1I1HA 4QYWA 4R3WA 3DCJA 3HA3A 3IKLA 1JALA 3X2EA 4OMFG 3VPSA 3AM1A 5HJ7A 3PUYA 1Y9ZA 2RH8A 2DU8A 2G6TA 4H3VA 1DBIA 4YP1A 5JNSA 2Q5CA 4E5DA 2JJQA 3IILA 4P7JA 2YH2A 4R05A 3UJDA 4JVNA 3KJGA 4OA8A 2QN2A 4JLAA 4UASA 5TQ2B 1UQRA 1Z8FA 4P0QB 1A77A 1LS1A 5H81A 5HOEA 5AW5A 3OLQA 5FTJA 2CMKA 2PZEA 3ETDA 3R23A 4HGOA 1FS6A 1JYFA 1SHZA 1SRRA 2W8BB 4RSMA 3HXMA 2PSJA 3EIQA 4V0LA 1GTJ1 3CS3A 1DG9A 3OEED 3GNSA 1ZU4A 4M1WA 3C3KA 1P5ZB 2QTRA 1AX9A 3TLGA 3IYLW 3LT4A 3W2EA 1TJNA 5F33A 2JK1A 5KYTA 2HYDA 2CUTA 3ZCTA 1MNQA 2WFLB 2BMVA 4C7BA 4EHBA 4NBLA 3H19A 3GJ4A 4R1SA 4EB6B 1O08A 3ILVA 4JLBA 4JGIA 4ZU6X 1Q7TA 2UVQA 3GV0A 3H6GA 3ZCSA 4ZC1A 4GMKA 1EZZA 2ACWA 1HPLA 2XGSA 3DQPA 1TEVA 5BQ3A 1OJ7A 2G7MC 3OZTA 1COZA 1UJCA 1NATA 1OXTA 1Q0HA 4F7DA 3JWHA 4X61A 3LCRA 3FOAA 3GO4A 1A9PA 4GAEA 3IT3A 3L7MA 4JT8A 2ZPAA 5K0LA 1G6Q1 3AJ9A 1M3SA 4L4SA 3F6EX 1OBOA 2QVYX 4IIEA 4KQWA 1ZOIA 3ZEIA 2GZHA 3E2PA 3OP4A 1X13A 2B35A 3ADPA 4JLVA 4LI0A 5LMZA 1GG8A 1V1RA 4YCBA 1NF8A 3OY7A 3LQFA 3PEUA 1OE0A 3LWBA 4PANA 1XL0A 4POAA 4PYKA 4WOPA 1KFBB 3P0FA 1Q84A 2F67A 1VL0A 3Q6MA 3H4IA 1N0HA 5FUQA 4KB5A 3UM9A 4IOMA 3L6EA 1ICEA 3QMPA 5LM3A 3K4HA 2IV2X 1IJKA 1JEEA 2WNSA 3GEEA 5DSZA 1UOPA 2XTMA 3FI9A 3PXUA 4J0EA 3W2IA 4NF2A 4FTWA 1XT6A 1DC8A 2D8AA 1Q1QA 3K9FC 3WLEA 3LYAA 4ARIA 2EX1A 3DDWA 5LLTA 4X93A 3AHIA 2IX3A 1XTTA 1JLLB 1MGOA 5SY9A 1IAVA 3UMSA 5B12A 3QEAZ 3NT4A 2I65A 5JNVA 2VUIB 2QUBA 2V6GA 1ONOA 1R6TA 1WDKA 2HU8A 3S7TA 3TRHA 4D45A 4BEBA 3LJKA 4DNXA 1PS8A 3PFFA 4OMUA 4MRMA 1NU8A 3DEFA 2VTBA 4CM6A 1EE1A 1K6IA 1L6RA 3ZY6A 2F3UA 2IWRA 4JP2A 1UM9B 3JVVA 4YAWA 4FUQA 2P1DA 3CCFA 1RXSA 2WIJA 1CUEA 3BJIC 3WX0A 3RYFA 4C3OB 4HDRB 4LRWA 1XDDA 3LE8A 2P79A 1XSEA 4R2LA 5TR9A 5C52B 4PLZA 5L3SA 3B52X 3AU8A 1V16B 2QDXA 1OPRA 1J2JA 1ZGCA 4Q4AA 3PEFA 3LY8A 4J76A 4RADA 4XDZA 1W59A 1JRLA 3PC8A 1VRCA 3DB1A 3IMCA 1AQNA 3RAGA 3FHLA 4IFBA 1VGVA 1TYBE 2FZGA 2W4IA 1DQRA 3A1VA 2HDHA 3C3AA 1CZNA 1B76A 3M81A 5JXJA 5FX2A 2Q3LA 3KFXA 5E1OA 1OZGA 2A0XA 5L53A 2ZR8A 2OZLA 4WOCA 4C7JA 2OE2A 3GLFA 2H3HA 2A9OA 4DIEA 3ILHA 1AN9A 3IMKA 2CFSA 1GGMA 3AWDA 2P8JA 1E0AA 5EHZA 1Y6RA 5F73A 5FI0B 3AJEA 3TM4A 5ES4B 1E98A 2CNBA 4PXSA 1R37A 2YFHA 3NCHA 2C4TA 1I6WA 3E3OA 4IM7A 1QG4A 2OP0A 2RHHA 4EGCB 3QEJA 2FZCA 2FN7A 4HJRA 1NG9A 3IUBA 2M32A 4C0LA 3G0CA 7YASA 5I7AA 5TMBA 3JRNA 5YASA 3S2SA 1RQRA 2DUWA 2NZ2A 5H68A 1Q5PA 4IH1A 1L5KA 2PR7A 4G8JA 3CURA 3V46A 5CEFA 2VTVA 3G8CA 1GAXA 2Y77A 3II6X 3FFTA 5U4XA 5BV1A 5L45A 1CQIB 4J7XA 3N2IA 3GWGA 3AV3A 4DXAA 4Z51A 3OF5A 1XNRB 2AMJA 1X8XA 2GF2A 4QDJA 4OXRA 5DHTA 1UT8A 4GO1A 4RLFA 1ZGJA 2C95A 2CHGA 3AKYA 1JBQA 3K9WA 3MJRA 4D3DA 4U2BA 2REQB 3UB4A 1IZYA 1D4OA 1XP8A 1FQWA 1P73A 2JGEA 3BMNB 3OPYI 3PFHA 4P3KA 3T95A 3IGFA 3F46A 2O4CA 2ZULA 4HAIA 4RV5A 2X76A 5J23A 2P65A 2QR5A 3VKWA 3NAMA 5AHOA 3HHPA 4EYKA 1SU7A 4YNBA 4JBNA 3ZLTA 1G42A 4OCZA 3DBVO 3RWBA 2WWXA 4TYYA 1YJ5A 3UMVA 2WFMA 3LECA 5I9LA 4O4JB 3L8ZA 1M8GA 3HVKA 1EUZA 4IJ6A 3T12A 3W5UA 2XUQA 4UNPA 1OWMA 4F3CA 1H9CA 3WLOA 2VUHB 4RHEA 5IXSA 1JZQA 4GDMA 1BMFD 3OOSA 5AI9A 1KNXA 2GN0A 4GT1A 5DHRA 2W00A 2HUPA 1Z4MA 3BMQA 1QU2A 4J1TA 5LIPA 3BFXA 1IDN1 4L2IA 3ZQ4A 4RIIA 1P75A 5AI6A 4QE3A 3B3AA 4RIHA 1K4YA 3R6WA 4AS1A 2B8JA 2W71A 3QKIA 2ZITA 3SXJA 5A4IS 3Q7IA 4R8RA 1UC8A 2C2MA 1N0UA 2ZRCA 4HNTA 2XRFA 1USKA 1YFZA 1EDDA 2ZRQA 3DVAB 4MWOA 4U2KA 1H2AS 4UHCA 3UAXA 2Y0CA 1TZBA 3B8EA 2ZBFA 3NWEA 1UMBB 1EHYA 4GM1A 3U13A 2ZZMA 3FBTA 4IL5A 1JZTA 2WD7A 4ECAA 5IFLA 4KUHA 3BDIA 4R5MA 1EK1A 4NECA 2A5DA 1HTBA 3QFTA 4GZ5A 4QECA 1RPZA 1MHTA 2PBFA 3D7KA 5HKOA 2EERA 1G6HA 2Q2NA 1QFYA 1WU8A 3HB9A 1ONSA 1KYTA 3RBVA 2CLHB 4HN4B 1RTTA 2MSWA 4UW9A 4URXR 3L43A 4W5RA 2HB6A 2VYQA 3MIIA 3FWPA 1SK9A 3SQOA 3KB1A 3O0TA 3VO8A 1GCOA 2W6JA 2Y1XA 3H11A 4TMVA 3TRKA 1WMAA 4HQOA 5CCEA 2XUJA 5IYZB 1BXKA 1D07A 2HMYB 4AJKA 1ECJA 3W90A 5LKAA 2FZVA 2I3BA 3A4TA 4X63A 1PX0A 3ITEA 4YRZA 3TJZA 4G89A 2D00A 4CUJA 2YFQA 5AHKA 5TE9A 1QANA 4HDKA 4MS1B 3E70C 4S3MA 3QJGA 3TNLA 4DMHA 1V11A 4EO4A 1FDTA 3NVMB 4KW7A 3BN3A 3GFQA 2PKYX 2Q1TA 1P19A 2QMEA 5SZHB 3IR6A 3KAJA 1I9GA 3VSEA 1FMJA 4X3CA 4NNJA 3ICQB 3UWSA 4NDAA 5B1HA 4IIXA 1OHHA 4CG2A 4QYMA 5LFAA 1OBHA 2AZTA 2V9PA 2YZNA 4JT9A 1LA2A 1X7YB 2O2HA 1NN5A 3CKLA 3JTMA 3LPAA 5J9FA 1NG1A 1QYDA 1VBNA 1XYGA 1VSBA 2O48X 5FOQA 2PUGA 3DC2A 6AT1A 4TWJA 4W5JA 2ZIGA 5ICMA 2IJGX 2QQGA 3WIVA 3UXHA 2BHSA 2R11A 1RHQA 4UPVA 2IYTA 4CN9A 3ODGA 1R0CA 2PLRA 1C0PA 1DIHA 4BNTA 1Z0FA 1TO1E 1G21E 4EGJA 3RE1A 1BYUA 4PVDA 1EFVA 3OE5A 1AC5A 5TVKA 3HYTA 4KACA 5EE9A 4AJNA 3WV5A 5B3KA 4G63A 4UBLA 3HSSA 4DMLA 1NR5A 1QJCA 1JA1A 3CH4B 1ULTA 1NMEA 1VL5A 3P0IA 2WUVA 3FPSA 3BIJA 3TAUA 4F4JA 2IZ7A 4I5FA 5I47A 5JSFA 4YCAA 1GG9A 1ZRHA 1ZM4A 2JHFA 1Q7CA 1TDJA 1YZHA 4QDUA 1TMKA 3CLRC 3IOMA 3CVYA 1HNWB 1QV7A 2JAUA 3EXG2 1G20E 4JP1A 4AN4A 2V6FA 4ACAA 1ODFA 4POOA 1MXFA 1TO2E 3NV9A 4HNSA 2LW7A 3N7UA 5M2QA 2CFTA 3JQAB 2DBVO 4LVUA 5T4BA 2CLFB 5EWLA 3ZV6A 4FE3A 2ZJ1A 4I8DA 4ND8A 4Z2AA 2E82A 1JNYA 1NKVA 4J16A 1I4EB 3X1DA 1NPDA 3B1KA 3WJ7A 4C88A 4D4IA 1SCBA 1VFNA 3WWPA 1W5AA 1E7WA 3MT8A 2JARA 2ODPA 1EK0A 1TKBA 4GXNA 1MC4A 3R5JA 5LZ2A 1G1MA 5AW0A 1O97C 4GICA 1WSAA 5CFLA 3EUFA 1Y4ZA 3SQWA 2BMWA 1PSWA 3FHJA 4LBYA 2WTEA 3DL4A 3GW8A 3IP9A 3JQ7A 1RXYA 4L50A 2PUFA 3DSRA 9ABPA 4IY1A 1YJAA 3TW8A 2W0SA 4JMPA 4XPIA 3H99A 4N3GA 1CR2A 4S1VA 2XOEA 4LFCB 2O7QA 3REOA 2HOQA 2MIIA 2PL3A 5BURA 5JH7F 1NN3A 4QVIA 4S1WA 5CT5A 4IAOA 4B4UA 1H2HA 3G7NA 1PJQA 3I2IA 5ITSA 2PUBA 1RRCA 1QAOA 1UANA 2X8LA 3SS9X 3WDMA 1C1HA 3TRIA 4ZICA 4GM4A 2AT1A 3Q1LA 4C0WA 2G8LA 3V33A 3KP1A 3HKCA 1KEEA 1C8LA 1I8TA 4MH0R 1QO7A 3BIWA 4H08A 4X71A 2PZJA 3KBOA 4I1UA 5E7QA 2JLAA 4H0CA 5C0OE 4MR9A 1NDQA 3ED1A 2C2BA 2JATA 3LX6A 2K2WA 3ZW7A 1S7GA 5ITWA 1HYEA 1XD2A 4HTFA 2HMUA 1ESEA 2E4YA 1A9YA 3IELA 2W98A 6GPBA 3EF1A 1IEVA 3GXBA 5FPTA 4E46A 2XZDA 3GLFB 4HLUA 5THKA 5GV7A 1EVYA 3GHYA 1W4BA 4DR5B 3HR7A 4TV9B 3SYMA 1NI3A 2X3UA 3DMFA 4KAAA 2BP7B 1DJQA 1O96B 4KPYA 3ER9A 1XALA 2VNSA 1G8FA 3RC2A 2H29A 1Y1KE 1Q17A 4O4HF 3O8OB 1IG0A 4M49A 4CMEC 2C7PA 1O7JA 5A4JA 3NZEA 5LJLA 1CUWA 1T3ZA 1H4SA 2Z9DA 4AG6A 3RNOA 2ILVA 3IS3A 4FYKA 4C7OA 4YRLA 2VZ9A 2EW1A 5GONA 4BOYA 5DXFA 1NSTA 4QFCA 5BQPA 4IJVA 4KH0A 3NBXX 1BHSA 4L5IA 4NFYA 3ZTYA 3EGEA 4D43A 1YHYA 4KFRA 4LV8B 4DBZA 4EA8A 2W6CX 4B40A 1Z39A 4EJSC 4O25A 1K7YA 1B0ZA 2YY7A 3DVSX 3A4LA 3HUDA 4RMNA 2IUTA 1CSEE 2RG1A 4AUMA 4G9BA 1V8OA 2F00A 1ORDA 4MVJI 2YV5A 1COWD 3CB2A 2WUEA 3OM1A 1E3WB 3STTA 1P1KA 2XHEA 4BC0A 1AK9A 3PXEA 1UJ4A 2PX2A 1GPJA 2D7CA 3N7TA 2LKCA 4IGAA 4L8YA 1QH0A 2CBZA 4DYVA 1U1CA 4BMPB 2D4HA 2RGGA 3GRRA 3SVLA 1T3GA 3MC1A 4LYJA 1M33A 3TQHA 1I3MA 5A4FS 1ENOA 3O1IC 3RUPA 2FSVA 3HVUA 5BNFA 1KMCA 4DKXA 5KU1A 4X90A 4BASA 1JVNA 3HCNA 2FP4A 5ALRA 4EJ6A 4INPA 1VE6A 3CEJA 1JDSA 1Z2AA 3T7EA 2AFVA 3DE0X 4XIJA 4AMVA 1U0NA 3MUOA 1SURA 5HMLA 4BP3A 3R9IA 3Q2IA 2NTVA 3PC4A 1Q15A 3K5WA 5EZSA 3ROKA 3SR0A 4LXIA 1Y1SA 2HF9A 5KJCA 3HRHA 4K7JA 1V6CA 3CZCA 2NWQA 3LL7A 2C8LA 4TLMB 4WOKA 4U8HA 4IDHA 1ODCA 2MSKA 4JI7B 1HORA 1S2IA 3PQ5A 4J3JA 4FEGA 1LTHR 3OIGA 5HBGA 1DG1G 5IPFA 2HU5A 4LOJA 4JI8B 1VJ1A 1BVHA 3EYAA 4LGVA 5CJJA 5GZ3A 2CFCA 4CCSA 1CETA 1K1EA 3NPAA 1QCDA 1TMYA 2JGDA 3OZSA 4HNAB 4MR8A 3T4UA 4BCDA 1M2NA 1OAKA 2ZUWA 4FS8A 2IU4A 1D6JA 1BJTA 3SG0A 1RKBA 4YC7A 4F4HA 1YFLA 2X2OA 3C98A 4MV3A 3WLHA 5HWSA 4QOHA 3TI7A 4ARCA 4TN5A 2V5UA 2JI8A 1DEKA 1NJFA 3JALB 4KKVA 3LVFO 1NBMD 1J42A 3JW8A 4E3WA 3EOAI 1QYWA 4P92A 1G5IA 2A0FA 2ZBPA 3TSAA 3CB4A 3EGCA 3L04A 5I7FA 2NNLD 1P0QA 4DAEA 4MB2A 4QQFA 3AL3A 4ZI7F 3J81k 2H7VA 4GH5A 2PKRA 4XJSA 1KJNA 4Y98A 3U44B 3CPHA 2X8JA 4U63A 4X62B 3FWYA 3A10A 4KWHA 3ZKWA 1U63A 3ZI0A 2BBTA 2O1SA 2ID7A 2ZTVA 3GLUA 4JH0A 5FOSA 3T7AA 1N2BA 1MRSA 1G16A 3LCVB 4NU8X 3SMVA 3W1EA 1QP0A 1Q22A 2CVHA 1ZY2A 2D0DA 3WK5A 5CD9A 1SOMA 4PF1A 1JECA 4XX0B 4JJ6A 3KQPA 3L9WA 5I7UA 1ULSA 3QLVA 5CB8A 2GH1A 1H2BA 1T0HB 1XZJA 3H2ZA 3IUNA 3TS1A 3WFIA 2I8CA 2QN8A 2H0QA 4DEXA 1EM6A 3QXJA 1PFGA 4W5NA 3SFVA 2EW2A 4M1MA 5IJ0B 5A02A 5K3FA 3N2NA 4U2CA 4K26A 4AJHA 4TOIA 3MBIA 2C5SA 2RB4A 3MWGA 4DIBA 1UKCA 1X1BA 3F71A 3L1KA 2CXTA 3ZJ4A 2EVWX 3ZZNA 2DFLA 2CJXA 1JEAA 2QX6A 1IBRA 4HDMB 4XCVA 1YRLA 2Z8YA 1E2BA 2J3QA 2C9DA 5FA6A 5JBQA 4KOAA 1NI4A 3U4HA 2PBLA 1AE1A 4UXIA 4AZ0B 4KXLA 2IPLA 1XCMA 2DFPA 2AMLA 3G6WA 1LF5A 5K03A 1OLSB 1NASA 1VBMA 1P45A 1WX1A 3RIXA 4CM8B 3L6CA 4Z6KA 4EA6A 5IN4A 2Y1EA 1NVFA 2BFNA 2TMYA 1K5HA 4E5NA 9LDTA 4CQLB 2Q29A 1B8NA 4MGEA 4NCIA 4UM7A 4Z9YA 4BNKA 3IX7A 3SJAA 1O89A 3ZK7A 1HDYA 1L7NA 2R1ZA 3HU3A 4RY8A 3KSRA 2R48A 5C3UA 1FJHA 2PL5A 1EESA 4RSRA 1GL7A 4MP3A 1R6AA 4L5CA 2I4TA 2PVCA 4OQPA 2IP4A 4B8YA 5TT1A 4DIDA 5JSHA 5ETJA 3M6UA 1TM5E 2QIPA 2VP4A 4DIKA 1XIVA 2YHUA 3OC6A 1FDRA 1JW9B 4KSBA 4Q39A 3D8NA 2YZ2A 3QFHA 1KE2A 1Q95A 4NRDA 3QOWA 3WMXA 3NR2A 1JB1A 1GSOA 1PL0A 1CW2B 4I4LA 5H9VA 1XLTA 2HRZA 3KL2A 3W06A 1HWYA 3B3JA 3JD4A 4UUBA 1P39A 3V3TA 3TD9A 3VJRA 2RHMA 4C29A 1KH3A 4I55B 4G1CA 4BP8A 3H2SA 3T54A 1JHYA 3GQVA 2WSYB 5EXDA 3ZU3A 4XLZA 5EJGA 3W79A 4MR8B 5GIPE 2GM9A 1ZBDA 3MVEA 1Z5PA 1C9JA 4GI7A 4IIFA 2QBYB 3D7RA 2P3SA 1L7QA 5IKXA 1MB3A 1P6QA 3L1IA 4D0NA 3AVTA 1QWSA 5TS3A 2VHEA 1GNTA 1RYZA 2PX6A 3JRWA 2XGJA 3M82A 4JI6B 2FW1A 1JWAB 3A4VA 3IDOA 1JMVA 4ONEA 1FFXB 3QA3E 1H5QA 4UHDA 5AJZA 5H80A 3UGQA 3DE5X 3C8UA 1VL6A 3KPUA 4CDGA 4IQ0A 3A2KA 4Y2PA 3A32A 3RLFA 3GUHA 3PXXA 3NHKA 2HRRA 4NL4H 1LPPA 3VHQA 4EQ6B 1CF4A 3L79A 3LD9A 3KT6A 1SEPA 4OHKA 1VG8A 4HDAA 3FLAA 4PPYA 2DWQA 5ER6A 3BJMA 2R1TB 3WDSA 4R2IA 3SC2B 1L1QA 2NSLA 1F5NA 3D5QA 4PLVA 5FOUA 3ZHOA 1RRPA 4L7QA 1FW8A 3L5OA 1FBNA 2OG2A 4PQFA 3RIEA 2PFKA 3N0VA 3ROFA 4CKBA 2PXXA 3D8UA 4Z3OA 3E9CA 2WTUA 1DTWA 1K5PA 2ZIZA 3NDIA 3RRYA 1IM8A 1BMDA 1YKFA 2H1VA 3ANTA 5J2UF 1ZM3A 3RABA 2B5WA 3NAQA 4TSFA 3EMKA 1N2ZA 1V41E 2GASA 5IBQA 5ELMA 2GDZA 3PGKA 1L8XA 2HSZA 2B94A 3KLOA 2DUUA 4BIMA 2IS1A 1PSZA 2VC2B 2WD7B 4JLMA 4CM1A 5IWCA 1WPGA 1NP3A 2R86A 3ZDRA 3QIAA 5K8VA 3WICA 5DW3A 1XN1A 1G66A 2F3QA 4U2DA 1BVYF 3UHOA 3I1YA 3TSZA 4YY3B 3JQAD 2EFDB 4N7JA 4I4IA 5EZQA 2VDWB 4YCCA 2FWBA 2HA3A 1ZBQA 2J9YB 2YJ3A 1GPDG 5ALSA 1SBHA 1ZJ5A 2WJAA 4XM2A 4XXHA 3BFJA 5C3MA 3NEPX 1LFAA 3CRW1 3G1UA 3Q5DA 4TWIA 4U5QA 1UAGA 1W0JA 3FUXA 3KSDO 5FEMA 3N3BC 4ND6A 2P0AA 5LBUA 3VR0A 2XHZA 3NVKI 3FSJX 1BHJA 1VGQA 4LXHA 4MW0A 3U3MA 2B8TA 3NBMA 2HIHA 3WXBA 3W4JA 2XYRA 3LQ2A 4L4ZA 5DF1A 2DVMA 2NXJA 2X9LA 1HDIA 4RTQA 1YI8A 5D6NA 1QCZA 5MFZA 4RULA 3DG9A 3IJRA 2YZGA 3JYOA 3LC0A 2EIHA 3B38A 3DLTA 3ZXUB 3BK2A 3R6DA 5FJJA 3I62A 3A58B 2HREA 4CTJA 2WR8A 3CZ4A 4B1FA 5IUNC 5L4SA 2ZAMA 4C5CA 4Y67A 1K4MA 2ZB7A 2H5IA 4ZCQA 3RS8A 4AJ4A 1XAHA 5F3RA 1YZYA 1D4AA 2VJBA 2YBDA 1C0EA 3PG5A 2DAPA 4LOHA 1MEJA 3PFNA 2IHYA 1IN7A 2BLNA 2ES4A 1QGAA 4F4DA 1CEYA 1TQDA 4UAGA 4DV5B 3D0KA 3LHDA 1T3HA 3A6PC 2FE1A 2O2CA 1GGKA 2OMKA 2WLTA 4K9DA 4CKCA 4LNUB 2CJFA 1AVTA 5HJEA 4FGKA 3HKEB 4P53A 3IUYA 3P9RA 5KTSA 2IYSA 4JXKA 4H1UA 1R9JA 3BIXA 2HJRA 4JY7A 3LVBA 3JQDA 2BGMA 3OG9A 4QFMA 2IL1A 1ML3A 3B3FA 3OZ7A 4YLEA 4Q3OA 1JR2A 2OXRA 2OTCA 4C3UA 1DG3A 1J9GA 2KS6A 3OOEA 4YFVA 1CR4A 3R3XA 1EVKA 2C3OA 4EFDA 2Z2IA 2V1XA 4RCYA 2H2GA 4V2UA 2V96A 3TPCA 1TPYA 1NW8A 1WVIA 3K0BA 4FFBB 3I2YX 2FSGA 2JF0A 1HH4A 3LSTA 3SC2A 5D87A 3D3JA 3BXXA 5L40A 4ND8B 3D6VA 3AF2A 3I05A 2OOKA 3NTLA 3DEYX 3R1IA 3IA2A 4FOSA 4HDQB 5IAGA 1AKNA 4KI7A 4BLVA 5HYVA 2F4VB 1MIHA 2C5EA 5BQXA 2XDWA 3R8CA 4XWKA 2G1KA 3G7SA 2HSWA 4QXAA 1ORRA 2VXBA 1NQUA 5CFPA 3L8FA 3BMCB 3F1KA 1JG1A 2HF7A 1T9KA 4N5NA 5GJCA 4WNAA 1W2HA 2P9CA 2WZDA 5IP5A 3RTEA 4M0PA 3SLKA 3FUCA 4DWVA 1P9RA 1L5HB 1G38A 2I8LA 5E6SA 1R74A 4TZKA 2AA3A 2B20A 4OUDB 3ESXA 4C3ZA 2ZWOA 2P9ZA 4N5MA 1J5XA 3NIGB 5SY6A 3H9UA 3RYIA 1N57A 3MTQA 4L4XA 3MCAA 5D5HA 1U2DA 1OVGA 1UZLA 3PP8A 4PTYA 5IJ0A 3I2KA 3WAGA 4J7AA 4CODB 5ADVA 1ZH6A 2LWIA 3ROTA 3KJIA 4BEWA 1F38A 3J80A 1G291 4B79A 4A8JB 3EVCA 3MD9A 5E9WA 4Z7OB 1EDOA 1YULA 3S2IA 4FPXA 1R4MB 1W87A 1LGYA 2YVLA 1PGQA 5B7PA 5J2TF 3QITA 3RARA 4AZ0A 2WPDD 1YI0A 3U4IA 2GHQA 1H5UA 1PGPA 1MJ5A 3A6FA 4OB8A 5H82A 2OFOA 1IATA 3EXHC 4FHDA 1ZJWA 4IZ6A 1EXVA 5B6PA 3HZZA 2JLCA 4QBGB 1QH8A 4YI3A 4URVR 3OU2A 1UDCA 1XDZA 1YQEA 2QTHA 3DLAA 4IMRA 4TKVB 5F7XA 1YFJA 3OTHA 4UPEA 1DAFA 4EFNA 1HE1C 1WMSA 2NACA 3I9KA 1R6XA 2P8SA 5SYAA 1TAUA 2XT6A 4J2OA 1FRQA 4DRYA 4HB3A 2IVZA 2OHGA 2JLSA 1XF1A 3S5UA 1YDWA 2C2HA 1ITZA 3N8KA 1TZKA 3BRWA 3LUAA 3BH7A 3D4LA 3PA6A 2UYQA 4GOND 1OFIA 4IIVA 3HI6A 3SQDA 3PGA1 1KDOA 1CE8B 5GZ1A 1PDWA 5J3JA 3E3MA 2P9YA 3EH1A 3OMLA 3RS0A 3QV1A 1CCWA 1YZKA 5EKXA 3EUEA 1OXXK 2DWUA 3IEUA 3RU3A 1ULZA 2E4WA 3AKCA 3NOXA 3WGMA 2JJ1D 1SVWA 2OBBA 1PFYA 2OLEA 3M6MD 1UMDA 1A96A 4JROA 4RANA 4II3A 1AKYA 2W2KB 3QKUA 4OLAA 5TMDA 5DT9A 2FHSA 5IKEA 5CBPB 5IDVA 5AKHA 2NYRA 3IO3A 4U9IS 1NFRA 4WZBA 2CE2X 2QLTA 4JU8A 2P4SA 4NABA 4WD3A 3WZMA 3L6RA 4DBLC 4FGLA 4AW9A 1DO8A 1CS4C 1E1KA 2N1MA 4R2WA 3RC1A 4CMCA 5KSYA 4WHMA 2B21A 4HBZA 3I5AA 4UU8A 5H83A 2NT4A 3FGOA 2C57A 1E6CA 3ZDCA 1RZVA 3UK0A 4A16A 3U44A 2G8NA 2ASVA 4JOBA 1HUQA 2OAGA 3I2FA 4LC0A 4M6WB 3PC7A 4N0QA 5TQVA 3TR5A 3DBLA 2CDBA 4C2AA 4E2XA 2W5UA 4E5YA 1GFWA 4D74A 1RAAA 5L3RA 3GD7A 1XL1A 3GT7A 3AEZA 4JB8A 3U39A 4PYJA 4TLAA 3N2KA 3QUTA 3IAS1 4YXWA 2V8BA 2OXEA 5B37A 1X7XB 4MHTA 1OROA 2Y0EA 3MD0A 2BM9A 2EW8A 5B7QA 4CMEA 5AKYA 2GEFA 2P4HX 2Z98A 4QKQA 3F4BA 2UZ3A 2ZEJA 3MTBA 4F11A 1RRMA 3T0GA 4ALIA 1B93A 1A7AA 2SCUA 2B5OA 3I1FA 4QQRA 2JFPA 2VT3A 2ZPUA 2I2DA 3CH5A 4MHSA 5L51A 3EZYA 1T2EA 2WG2A 4DMFA 4UUQA 2GYVA 2HA4A 2VJNA 3HMQA 2OD7A 2XUHA 4GI1A 1O3YA 3SZRA 3U3DA 4RY2A 2V03A 2XVYA 3PWTA 4OD0A 2O2JA 1Z8NA 3LT0A 3INRA 1SK8A 3MLEA 2HHAA 2M1XA 4H4CA 4ZAWA 2YIVX 3R7DA 1U98A 4PR0A 4WNIA 3VVCA 4TTTS 3A9RA 2OUIA 3ENVA 3WISA 1NLUA 3ZWAA 1JEYB 5CEEA 2I2AA 1HQYE 1XJ0A 2FR0A 4MS4B 4RVOA 4BHTA 2JHCA 1GDTA 3OZVA 2R85A 1FXWA 4GWGA 3W6OA 5G4KA 3HJFA 4QBIA 4AG5A 5JISA 5EQFA 3O1LA 4FSDA 2VT7A 2AZ4A 3GUZA 1V4NA 1FBTA 3CPSA 3GEMA 1X7HA 4UE3S 3UATA 2X1VA 4ZCIA 3GOHA 2FU5C 3TF5A 2C3MA 1DOAA 1G5QA 1I7NA 2QJFA 1XD2B 1FC0A 4HTFB 1JSXA 1MRZA 4KN8A 1HDOA 3CZPA 1VRWA 2XCIA 2Q2VA 4OP1A 2XCTB 3LY5A 2PYZA 1T9GR 4AXBA 4P54A 1OR8A 4FZJA 2Q4BA 3EEBA 2H7CA 5KDLA 1JHXA 5E7JA 1RI2A 4ACBA 2DHDA 4RY0A 4J4TA 3DE4X 5CA0B 3HJNA 4C7XA 1EIZA 1FNDA 1RWOA 2AOXA 4GPIB 4OAQA 4ZEXA 3CR8A 1X9GA 3IAM6 3OCUA 4EENA 2HCTA 5IUKC 2ZYVX 4E33A 1KY5A 4I9GA 3O8NA 4OG2A 4LDJA 1XB2A 4PZUA 2XUIA 2JIBA 4RHYA 1WP9A 3MJEA 1G2IA 3L9XA 5JARA 1GT6A 1ENPA 1KQPA 3DUFA 4D82A 4TV8F 4XM0A 4YMLA 4PLYA 3NXSA 4S0ZA 5EMNA 3EZ6A 4L51A 5AHWA 1TW3A 3V55A 4ALNA 4HDCA 5DMXA 2SKDA 5B4VA 3OECA 1UDRA 2GSWA 2CLKB 1J0XO 1OXVA 2OR3A 5DULA 4A8JA 4BO3A 5K4GA 4O5OA 4FJ2A 1LY1A 2IYNA 2GD6A 5BSRA 2DM6A 2HNBA 4Q3DA 4NHOA 1GAJA 1YBMA 4JJGA 3PX2A 1CUZA 3SHTA 1TECE 3GOQA 4OKSA 1V3UA 3OOWA 4CLRA 1X1RA 1ZQ9A 4I50F 3ZDXB 3VSBA 2FPKA 2CLMB 3DKPA 1GRCA 4UDXX 1IZ8A 3TZCA 4FFWA 5L7TA 3ZY4A 3JWIA 1KWGA 3MMPA 3KALA 3R3HA 4M86A 4PTZA 3GCGA 4OJYA 3CE6A 4FHCA 2AC4A 2XTNA 5BP7A 4AY5A 1EUDA 3G2QA 3ZNQA 3BKWA 3HCCA 2Y68A 3EGXA 4HZUA 3ZHRA 3AUAA 4UKDA 1ZVMA 4OAOA 3X3HA 3LBNA 1JDTA 1G19A 5A2GA 4RWEA 5C8XA 1L9XA 3E2IA 5FWXB 5DZSA 5JMTA 3FWHA 3TFWA 4B45A 4C78A 1WPRA 1XCOA 5C5DA 1M83A 1XZIA 3UICA 2C97A 3EDQA 1SQ6A 1I51A 3FYSA 3MBKA 1B26A 1D7OA 4DDVA 4AIRA 4XYBA 5LQCA 1YCDA 4XDYA 3F7MA 3E58A 4ARUA 1P3JA 1LJLA 3O4HA 3KQVA 3LLMA 3L0DA 1ORWA 4YMWA 2BGJA 1JEQA 3LQ1A 4MQ5A 4M0LA 5EJ8A 2BKXA 3ET4A 4P7GA 5FUMA 5F1PA 1R00A 3RSLA 1JQBA 1NHWA 2QT0A 3E5RA 4HAZA 5JIBA 5M5BA 1R8SA 4KMRA 2PKQP 1OLOA 3H3XA 3F1LA 4IV0A 3ODPA 1SVUA 2Z2ZA 4JNKA 1QDLB 2EFJA 1VSUA 2WHXA 4LA4A 1EB8A 2WU0A 4ZCPA 3JALA 1U8TA 3NQ41 3SDBA 2ZWIA 4FMDB 4DV6B 2Q8QA 2EATA 1ZNZA 5AW9A 2BGTA 1NMQA 2DHEA 3TLGB 1KTIA 1CIPA 1D0VA 1E62A 2GD0A 3S44A 2RC5A 4UOEA 1PAUA 2IDMA 3IDSA 1E2EA 4UREA 4N48A 1IRIA 1EE2A 2ZIUB 3CLVA 3KZXA 3ZJUA 1KAEA 1U2RA 4RACA 5JEEA 1FFWA 3B51X 1N2IA 3I01M 4JD5A 4BQPA 1O03A 3P2OA 1EI9A 1X80A 4WKOA 5K3OA 1S7CA 4MPPA 4QULA 4Z2YA 3I8OA 4HOYA 4NIMA 1VE9A 1PNTA 1NVUQ 1UDXA 3OCYA 2ACVA 4YP9A 4MWBA 3D6JA 5I3ZA 1X0XA 3KSBC 4TVSA 1DEOA 2DTEA 1Q6YA 3MJDA 2PL9A 4EVIA 2EKPA 4BUZA 4JN6B 1GUZA 2EDAA 2RGEA 4E0BA 3AVVA 4DM4A 2Q4TA 3HACA 5JYEA 1TCVA 2PUJA 3VV3A 3AP2A 1K0FA 4F9GA 2LV8A 1UF9A 3ZDDA 5A0TA 2Q5HA 2H08A 2NZ8A 2WWWA 2CFOA 3HS3A 3T1QA 4LTDA 3JYNA 5C8YA 2D7JA 2TRSB 3HVHA 3CNHA 5TX7A 4ND1A 5CITA 2GZDA 1DQZA 2Q62A 3OJWA 2VP5A 5E4JA 4XI9A 2DQSA 4NKRA 1HF3A 1EZ1A 1TT7A 4YMHA 4PIVA 2IIBA 3K6JA 3GVHA 4LYFA 4NPAA 4XGRA 1IHOA 2P5UA 1QKKA 3EIOA 4YDSA 3JQEA 3LMKA 3NRCA 1O87A 2RHDA 1ISHA 1YNOA 3GJ5A 5EIOA 3UUEA 1KI6A 5ITZB 2AJ8A 2YYZA 3BXPA 2I80A 5DMHA 4KQ6A 4R16A 1N5IA 3W9SA 5AVVA 2XF2A 3TIXB 3VHLB 4MYCA 5JAZA 5BVHA 1HV8A 3BL5A 3RU9A 1TA9A 2DF8A 3FCUB 4YMUA 4NCAA 3E3NA 4QXMA 1JN0A 1DRVA 5IT0A 3CKMA 3C5WP 3V6MA 5DHAA 3B1VA 3I32A 3IBSA 3TINA 3HYNA 4HNGA 3VC3A 1ZIYA 1AZTA 4FZVA 1PE0A 3S29A 4CMIB 1XHEA 3K1TA 4PSAA 4C7OB 3C1AA 621PA 3FTPA 4LWQA 4OQXA 2BONA 4F4FA 5GGXA 5C18A 3JQ8B 3QBTA 4CWAA 3K7EA 3P0JA 4WXPA 1Q0UA 1YZVA 1L8LA 2PGIA 2R6HA 3KQOA 2ZM5A 4LOIA 4WQMA 1XZMA 1WO8A 1IJEA 3UV7A 2COUA 1GL9B 1BTOA 3GPDG 4ZA2A 4BX0A 4EPRA 5HVNA 2ZTMA 1AJEA 3L4BC 4IMIB 3U61B 5EXEA 3SNHA 2LZ0A 2YWEA 3E7XA 2H48A 2RHLA 3EGIA 4E14A 3NTQA 821PA 2GBIA 2VP0A 3NM5A 4MULA 5JVDB 5JAIA 4IOKA 1GP2A 1QUEA 2GK3A 2FKAA 2YTZA 2GBLA 1WHTA 3F3YA 1WNFA 2F1OA 3T9BA 3WP0A 2FUG1 4ZT4A 4ZEMA 3COVA 3PPXA 2WYIA 3VC7A 3SMQA 1M2EA 4J94A 1UXKA 2Q7XA 1MR3F 3L8HA 4QUAA 1G3MA 4BLUA 4Q5IA 4WTOA 2ECOA 3H3JA 5JS6A 5JS8A 3ZOKA 3TUZC 1TL7C 4LVOA 4N8DA 1UEIA 3MXOA 1T9GS 1AQUA 2OFXA 4DLKA 3DLBA 1SXGA 4TTIA 4KC0A 5EPEA 3DFFA 4GZLA 3MTEA 4MI9A 1U7HA 4DCPA 1YR3A 2V45A 4KO1S 1DRWA 4U7TB 3A0RB 1WMBA 5GVSA 4OI0A 1T15A 1E9AA 2VQDA 2FQQA 5HJ2A 5CXXA 3TZEA 2Z5FA 5CIYA 3R74A 2XRZA 3P96A 2BFEB 4WV3A 2QW1A 5DNCA 2RGDA 3ZD8A 2HQ1A 3PV0A 1WR8A 5CFOA 3COYA 1YVPA 4XEHA 2Q0XA 3NU1A 5DEIA 5JV5A 4EBBA 2GTIA 3W5SA 3UCFA 2Z1NA 2YFYA 1WETA 3DFIA 3OLZA 2VLIA 5H16A 1ECGA 4J3FA 2WU8A 4JLSA 4BGDA 2ZJFA 3FBGA 1ECFA 3D54D 3ITKA 3IB3A 1OUMA 4HAOA 1VE5A 3EIEA 4K9OA 5K0BA 5KTMA 3E9RA 1PJBA 1X14A 2I2WA 1CEXA 2AFIB 2FUNB 2RCNA 4CL8A 4DSUA 4EY6A 4YDQA 4LF7B 1S8AA 2V4ZA 5DYWA 3B89A 4C1NA 3LXRA 2SKEA 4QYIA 3HA2A 4EI9A 3ZI4A 4JUIA 1ZWLA 2GWHA 1NBME 1OX4A 1UMKA 4YCDA 2XMGA 3MCTA 4UVDA 4BEVA 5COBA 4EUEA 2W70A 3RREA 4DILA 7ADHA 4FD2A 4IWYA 4RTJA 4B3RB 1QKJA 2WA1A 3JQ9A 1R4NA 1IY1A 5EIEA 1SXPA 1HFKA 4GLOA 2P9JA 4FFOA 3SSMA 1EJ2A 2V55B 5C46F 1QIJA 1W0KD 1CEEA 1HLGA 1ZSVA 1KZGB 3NFRA 1FNCA 3QE3A 3RVMA 4E4TA 2REBA 3NBQA 3M2PA 2A33A 3GDGA 3WYCA 2IH4A 1IN1A 1GGJA 3AVUA 2WJJA 3IQEA 3QKSA 3CW9A 5IK2A 1FP4A 4LFAB 4G81A 4PQGA 3T7RA 3SQNA 1M9NA 3LKBA 3L7IA 2UVPA 1QORA 4CMKA 3FYUC 4EHNA 3RCBA 2DLNA 2HY7A 2JASA 2YZ7A 4WCFA 1GA6A 4ZN6A 4MRMB 3U7EB 1I3NA 4Z4HA 4GZ3A 1NVWQ 4X91A 1JQEA 2V58A 3B48A 4ENSA 4M0DA 1H8EA 1Y3CE 4BXOB 1L5NA 4AJOA 1RYBA 5HZGA 4AP9A 2OK7A 1GUFA 1RKXA 1UR5A 4LGCA 5LYJA 4HQNA 4XDGA 1P2UA 1C7JA 2WT9A 3LUHA 4FFRA 4A2PA 2YKGA 4B2PA 3U62A 4RF3A 3ENKA 3IJPA 4LYYA 2ZSEA 5KNBH 2ISSD 2VYCA 4IJ5A 1PL6A 2IY9A 4M6WA 3I2GA 1JJIA 1PFVA 1V3VA 5LBIA 4R1QA 1DE0A 1DQYA 4QLAA 2R87A 1CUBA 1KU6A 1ILEA 4UFOA 1QVRA 1DHTA 1JPJA 1OWOA 4NCKA 4X6LA 2HWKA 2WOJA 2N42A 4QU0A 4RVSA 1JLSA 3H2KA 5CPBA 2FWPA 3GRFA 5I8PA 3C7KA 3HQ4O 1P18A 2C0QA 4RF2A 2I4LA 2G1JA 2G0NA 1QCCA 1DEHA 4BKMA 3ILXA 3LBHA 3LKVA 1MO6A 2PG3A 2FEWB 2IELA 5AKGA 2IIQA 4LXQA 3SQMA 1LK0A 3KXKA 4QDZA 4TXJA 2RH4A 1J2YA 3B1YA 1DOHA 3IE0A 4DTCA 5K7SA 2JDIA 4JA2A 1ABEA 2XJ4A 2NUAB 4XB6B 1JS1X 4GE0A 2EKQA 1DKLA 2DMRA 3ETGA 1GTRA 3PTLA 4ML3A 3RVPA 2YDYA 5KX5A 4X6UA 3LBYA 2HAEA 2AEMA 1AV6A 1O5IA 2IY7A 3PCRB 1E58A 4I19A 1T5HX 4N3AA 4LZAA 4QC2A 1L5HA 3PXAA 2CK3D 3RFXA 4ZVSA 2C1ZA 3ER6A 1W48A 5I9NA 2BMAA 1YASA 3NI2A 3WADA 3ZE2B 2BSQA 5CNIA 1R6BX 3DBRB 1GPBA 4Q1BA 4BO4A 1T1IA 4CLOA 5EP4A 3HO1A 1FZTA 4QVKA 3DPSA 1IBLB 1CTQA 3IIMA 2R2AA 5EG5A 1K8XB 1XRQA 2HU7A 2NYAA 2PMBA 4NBUA 4Q9IA 3VZDA 4B5LA 1NW6A 2PGAA 3SC6A 3LI2A 3WK4A 4M54A 4BWFB 4IVRA 4H4EA 2QTBA 3OLYA 3D0RA 2EQBA 2OMEA 4RPCA 3BGSA 4LRYA 5AI8A 3OE1A 5IRCD 3LDFA 3AQ4A 1CS0B 4WEOA 2GB4A 3PXDA 2QYTA 4LJ8A 1GZ6A 3CX8A 1NMZA 5TGTA 1ZGHA 3A04A 1IEQA 1QOQB 1QGOA 5HUJA 5FTMA 1OXKB 1UKZA 2PVPA 2VYND 3FFWA 3F9IA 3JWGA 4A0SA 4BO2A 4DR2B 4K40A 1ZK1A 4ZMBA 3T5BA 3TDNA 4OJNA 4L72A 4L07A 1WMDA 4LOAA 5IM5A 1MV5A 3GT4A 3DYBA 4G5RA 4INAA 1NMYA 2IU3A 4Z49A 1ZMRA 2FW9A 3HCBA 4GYKA 3B1ZA 3OPYB 4ZYUA 3K9CA 5K99A 1HRDA 3Q2KA 3FYUA 4J75A 1D2EA 3B85A 3LYLA 3FGNA 1R8YA 1XKQA 3QQPA 4ZQIA 5E3JA 3K2EA 3RU7A 1LPAB 3FTDA 3T5PA 2C7BA 5J2UA 3ZDYB 1PZXA 1KZ6A 1DKMA 2V0NA 4R8SA 5JATA 2EQ5A 2NZWA 5LYJB 3ZD6A 4HGNA 4DXHA 2W2LA 4WJLA 1X6VA 2RD2A 3QBDA 4CJXA 5K0ZA 2AFRA 3KKZA 1WUIS 2A5GA 2X58A 5HQTA 2OESA 4JI3B 2ZM6B 4ZVUA 1VA5A 3C97A 2AE2A 5BRNA 1LQTA 4ZYXA 5HIJA 3RYCB 3EEQA 3AOEC 1OU4A 3BFKA 3V34A 5JQWA 4RA6B 1T26A 5CLQA 4LX0A 2GF0A 4XSHA 1ECPA 4TV8A 4B2LA 4HN2A 4J4BA 4D57A 1ZI9A 2VAWA 4GD3Q 4RTRA 1PHPA 2DCMA 4EEZA 3DTTA 3LHSA 4G07A 2IYQA 2NIPA 5JCJA 5B7NA 4MUNA 3FIUA 1X80B 3S7ZA 5ALEA 3ANNA 1CK4A 1PP4A 1X2EA 2FE4A 3QKRA 3DMHA 4U2EA 4D4JA 1ZEJA 1RC0A 3MAJA 3M6VA 3QSYA 2JCXA 4X7RA 4UTPA 4PGGA 1X7ZA 5GONF 5K20A 4FYPA 2WQ7A 2GFIA 4UTOA 1BMQA 4MV1A 4EH1A 5DNWA 3C7DB 1DKOA 2IHKA 5KMGB 1W29A 3IBCA 2PT7A 1E4OA 2JI9A 1CY4A 3AVOA 4ZCSA 1EMDA 5DX1A 5K0GA 5JEDA 4RKWA 4Q05A 1OFTA 3HDQA 5LUAA 2VJOA 3H2JA 3HFGA 1WU7A 4BAUA 4AIIA 5DK6A 1U99A 5C53B 2A1UA 4ENTA 3KYDA 4OI1A 1IONA 1PR3A 5D3QA 5BUCA 2A35A 2O8FA 2Y1KA 3OUTA 4O1HA 2B4AA 1JG2A 2NO6A 2J9FB 1Z3IX 3T4XA 4AN0A 4ETMA 2DXIA 1SU6A 2CCJA 2HX1A 5KC8A 5ICGA 3F6PA 4I2NA 3TD2A 3ZCUA 1IN5A 2P2DA 3K0EA 2CFIA 3D2BA 3QF7A 3EWIA 3GZTB 4FOTA 4J0GA 1JHRA 3LFHA 3GELA 3L1HA 4KIJA 5AUQA 1A9RA 1F8UA 4HP8A 3ZX4A 1J0CA 1P5RA 1Z5OA 4EY3A 3M49A 1ZK3A 2EF1A 3O83A 4WFJA 3TMAA 1PTJC 5E6UA 3DDCA 5F9MA 5JS2A 4E2ZA 1NULA 4ATNA 1PX2A 4XIFA 4BWYA 4PO3X 1R5NA 4XYMA 3R3ZA 2KX7A 3L0CA 5FRDA 2H4FA 4DLSA 2CDCA 3K09A 3BE4A 1D1TA 2GHRA 5BR7A 1L7VC 1U3CA 2QRVB 1WW2A 1QP7A 1RQLA 2QY6A 2P9FA 3GMSA 1E60A 3CZAA 3HABA 4PX9A 4D99A 2AG6A 4P36A 3VR2D 1W34A 5C7LO 1WQ4A 1J56A 1YAHA 3KJFA 4LZOA 3HWRA 3VNSA 4BDTA 1A5AB 3OEYA 4YYEA 5EERA 4DDHA 3CEHA 3WBKA 2JLWA 4ZK6A 4EG6A 1NKTA 3B1FA 4XYGA 1K66A 3P45A 3R41A 2RGNA 5AM5A 3PNVA 1XZCA 4J1NA 1VL8A 2CHFA 5DT2A 1K06A 1WXWA 1II8B 3PIIA 4Y2JA 4C4SA 4JWTA 4WBXC 4N6NA 5JPDA 3UPTA 1O9GA 5JOQA 1LKZA 5ECDA 2OV4A 1XAIA 5DTQA 3RIMA 1FTGA 1QH8B 2NQ2C 2FSVC 2C31A 3P4UA 3TQCA 3U48A 3BIFA 2Q3BA 3AR7A 1E3MA 3VKGA 4YRQA 3KUUA 3BWCA 2ZI3A 3TL2A 2ZRMA 2VBFA 1B2LA 1D5CA 1V1MB 2J67A 2V7WA 1MABB 3NNDA 1K5GA 4I4TA 5DW0A 5CB0A 5FB3A 4EJMA 5JD6A 2PBZA 4UXHA 5JCOA 4F1WA 2R97A 4M55A 4XX1A 5JJBA 3QHAA 3W3AH 3TGPA 1Z0AA 3D4OA 1IJBA 1P4SA 4BO0A 1KPGA 1SOUA 4JQCA 1Z7GA 4R2XA 1G3UA 5BXQC 5DNAA 2AVDA 4OPMA 1UCFA 1NVAA 3A27A 2P9GA 4NG5A 3WA7A 1T1SA 1R18A 3USZA 1M75A 4I1IA 1XPOA 2IZ0A 4TLDA 4FS3A 4W8OA 3BXOA 2VDKB 4UEOA 5FOXA 4LZZA 4OU4A 3N2GB 3KE9A 1K92A 1UAYA 4KDRA 1OZFA 3DAHA 3EH2A 5FUWA 1OI2A 4MUFA 5AD1A 4ZZIA 1QIGA 3FMVA 4XE5A 2HFKA 5KBYA 1G20B 4K87A 1D2MA 4YV2A 5C4IA 3SQXA 4HDSA 1FVXA 3VDMA 3WGUA 2OC4A 4TS9A 3C24A 3KQSA 3PQ8A 5TSDA 3QVOA 4OUKX 3PQCA 4C4YA 4JR0A 5AJHA 4CKCB 2DOKA 4ID3A 1DAPA 4M1OA 4N8SA 5DWDA 1SD2A 2H1FA 3AF0A 1WUKS 3IULA 1W30A 4Y1GA 4ITVA 4X3OA 4WINA 3K2BA 3QPVA 4HEA6 4B81A 5HM6A 1J5EB 1HNXB 4RIEA 4PN3A 2QLMA 1AB6A 4OXXA 4QDKA 4PSUA 1GG2A 2RKOA 3CJRA 1UFRA 4PV7A 5J2TA 2Y1FA 5CDSA 3Q3EA 3IERA 4K2AA 1KDVA 1EJBA 1RWMA 2CC2A 4C0KA 2XCLA 3DVRX 1EWTA 1Q11A 4O2LA 4PGMA 3ASVA 3O95A 4DHEA 4F3NA 2GN1A 3ZD7A 1XEFA 3ACDA 5T57A 1APBA 2F7SA 5AXCA 1B43A 4FCCA 5KAMA 3BSYA 2BDUA 3F5DA 1ISSA 4RGBA 2F1JA 16PKA 1CY7A 4M21A 2YMMA 1ZH8A 5GAJA 3DM9B 4WY2A 5CLHA 1OXSC 1J21A 3A6HA 2X42A 5CNMA 3NHPA 1XWFA 4AWAA 2OHXA 2R5WA 4C2BA 1WXGA 3EHEA 1QYXA 2E2WA 1SOWA 4FJ0A 1J0BA 1DAMA 1M2HA 2C9ZA 1TM3E 4NH0A 4Z9XA 2H0AA 1F1BA 3DNFA 3GP3A 5F5NA 4FLFA 4AJ2A 3ICOA 3NJ4A 1W85A 4G41A 2WZCA 2FMXA 3EXIA 5C37A 4TKZA 4I5GA 5EIWA 1RBYA 5FUYA 4HADA 2O6LA 1N5MA 5K4HA 2PWBA 1V7PC 5G4KB 2D13A 3P9YA 4I4TF 4FMCB 3JZIA 4QOSA 1M6VB 4ARAA 3QEOA 4MS4A 2A30A 4N7RA 3M1LA 3RNLA 3CZ5A 4R8MA 3S8MA 3S2YA 2ZS7A 5I7HA 1JBEA 5JYCA 4FLEA 4YACA 1MH9A 2FPIB 2NLOA 2P5SA 5KNDD 1TUIA 5KVCA 3CLSC 5E38A 1FYVA 1Y4DE 2DE0X 4QUHA 5EMLA 4EKNB 2FPMA 4F9FA 2VIIA 4KP7A 1DO2A 5LMCA 2WRZA 4BBZA 2PXCA 4AMBA 3G9TA 4OBXA 3AI1A 1OASA 4CHTA 1BOOA 1XLWA 3F8TA 2VQ3A 3IP7A 1A5BB 1I0LA 1OJLA 1S5PA 2DBQA 4FIZA 2JFZA 2YWDA 4KYVA 1RYDA 3IT2A 2C29D 2WFLA 5EE1A 1BH2A 4UM5A 1NN0A 2JGRA 1JXOA 1G64A 1GUAA 3NX4A 3PDHA 2UYGA 1ZVQA 4E07A 1PJ3A 2HHCA 4M9CA 2QA5A 5TC4A 5JECA 1TUBA 5JI2E 4Y9TA 5REQA 1WV1A 1Z18A 1FUIA 2OZVA 5DSTA 5F52A 2I9KA 1XKTA 1CUAA 2Y4NA 2WKSA 5KDDA 2GPWA 2ZCVA 3D3QA 2GMWA 4OJTA 2WYHA 1OTYA 1D09A 4NWIA 4QGHA 4ZKDA 4LDAA 3GLGA 3KAQA 1GFSA 3ZN2A 3BTSA 5DM70 3O6VA 4DA8A 4ZEWA 2B2NA 2PD3A 4E30A 3BICA 2YN2A 3JXEA 4K03A 3PVZA 3AB3A 5LZ8A 3PR1A 2RHOA 3L8GA 3VO9A 1H2RS 1TGYA 1SRQA 1UDWA 2DFNA 2F9FA 3ISJA 3MEQA 4R8LA 4PIPA 5CT6A 5DKFA 5DCWA 3RHFA 2Y1DA 3DT9A 4PM4A 4D3FA 4DG9A 3AOEA 1HLPA 2QRLA 2HADA 1MQ8B 3RFFA 3AM5A 2ECQA 1MLDA 2HJ9A 3ESZA 4TLLB 2PSEA 3AZPA 4PYOA 2OCXA 1KYWA 4R3NA 1KI2A 1U1IA 2WY2D 4Z4EA 2CSUA 4IINA 4HI0E 3K5HA 2QTTA 4DM3A 4FOLA 5FQOA 3FRHA 2OM2A 4GOLD 1J97A 5I9IA 4HFJA 4MLZA 4O2BB 4UVGA 3WI7A 3GFTA 1KETA 3HZHA 3FZNA 3MK31 3ND8A 3BB3A 4PG6A 5EESA 1GV0A 1U8XX 1TQ6A 4AUEA 4NXMB 1WTCA 4ZP1A 3RVSA 3NUZA 4Q6WA 3DAPA 3OM9A 5ARCA 3TEMA 4EFMA 3WTBA 4DF3A 3GLRA 1BXZA 4A6EA 4MW9A 2A0UA 4BN5A 1JYEA 4MKHA 4B7XA 1CQZA 3MWJA 5ED4A 3CKKA 2IKSA 2QRZA 3D8BA 4AS2A 2XA1A 1B4DA 2VBGA 1DFIA 4CXMA 3AIKA 5ILOA 5ECYA 5AUOB 4BFYA 4BX8A 1T10A 1L5WA 2XA9A 4CFZA 4KX5A 4F2DA 3DQQA 5J1SB 3OJ0A 1R9MA 3AB7A 3VISA 1A2QA 5K8LA 2YRWA 2X0FA 3NDRA 1AHNA 2F3PA 2ONKA 3IEKA 4D8UA 1JFSA 4YJ2F 1KOJA 3G0IA 4HAYA 1G6KA 1EX9A 3HHEA 3ZCVA 1XMIA 4FWIB 2AWNA 1MVLA 4WN9A 2EZ9A 5CCXA 3LCJA 1NYQA 1B8PA 3TBHA 1P74A 5CHEA 2E37A 3BREA 3K73O 3AR5A 4GBJA 3V97A 4UOZA 5HNKA 4L9RA 3DLCA 4JVLA 2OCYC 2V0CA 3NIDB 1FU4A 3ZGZA 3A25A 5ANRB 1XU7A 3FJOA 3HB7A 2MYUA 4INJA 1NT2A 1RTKA 4MROA 1PL8A 4NE9A 4QTUB 4TMXA 3SBXA 4F4UA 4U7GA 3W8DA 3HM2A 4JJEA 5A3VA 2W37A 2C5LA 1GZ7A 5AW2A 2J46A 4M9UA 1E59A 1X1SA 1B6RA 1NNSA 1QC5B 2Q1WA 3HBJA 4XA8A 3UN1A 5D6OA 4DGSA 4GPAA 4H0NA 1E32A 3NNNA 1N33B 4H27A 4Q4HB 3ZGNA 3B82A 5JZOA 3E8XA 5HS6A 3P26A 4RTSA 3PX7A 1RIFA 3KEOA 1PO7A 1ACMA 1ZOOA 3QYJA 1WXEA 2NM0A 1NQWA 2POQX 4QPJC 4JGGA 4GLLA 5EZYF 3RFTA 4AKSA 4DGQA 5B58T 3KCNA 4K6KA 3SM3A 3OI7A 2VUUA 4BRWA 3I34X 1UXJA 2JBWA 3MYYA 2HSEA 3DKRA 4U6SA 4GW3A 4ZKEA 1D0IA 2C3UA 3ZV3A 4DXDA 4C0SA 1NWCA 1V16A 1OGIA 3EBOA 4G5HA 1QVAA 1T91A 4HFMA 3KYCA 3ZDAA 4OFBA 2ODEA 5CDYA 4LDNA 1XQ6A 4DR7B 3OVMA 5JI3E 1IQ0A 3BRSA 3OU6A 2VYVA 3M3PA 1LS6A 1RP7A 4LPKA 3H9JA 4LN1A 1EG2A 4A7PA 2C5HA 2IV3A 1T1JA 2XBUA 1V9CA 3CUKA 5B36A 1L4HA 1QDEA 3FZGA 5E3IA 4AD8A 2ZRNA 4XSGA 4YJ3A 1L5ZA 2P40A 3RYCA 3EVTA 4E70A 4HH1A 4X1YA 2GN8A 2OYRA 3T06B 4UJ5A 1I2CA 3V8VA 1L2TA 3B5EA 4B3GA 4E08A 3MTGA 5P21A 5K3BA 4HMQA 1N2GA 3A06A 1BYIA 3GGPA 1NBIA 3LPCA 4V0NA 4M9ZA 2ZWAA 1VA4A 2EJWA 3JAMA 4RYDA 2CZCA 2GBPA 1GRQA 1NLFA 2QTGA 1L5LA 1VKZA 3SJZA 3PR2B 2XB8A 3KU4A 3GDFA 1VDMA 2D3TA 1P31A 5DLDA 3R7FA 4YT8A 5A9RA 3PCXA 3OE7A 3RVOA 1ZITA 3BRCA 2E89A 1P4GA 2B1JA 3DWEX 4L5BA 4DE5A 1JFRA 2O8DB 2BZSA 4FU0A 3WRVA 1QSGA 4G4JA 2RG7A 3T7JA 4NU6A 1AMOA 4MKGA 5HSGA 5DNDA 3FWZA 2FSIA 2PO7A 2BZ1A 3OZUA 5B3LA 2BSAA 2E1RA 2R6FA 3UY4A 4EEKA 5AFSA 2A1UB 1NSFA 2OV1A 1C4WA 1WXDA 4X00A 2UUOA 2GD1O 1UIMA 2DCUA 5EJIA 2O2EA 3VHXA 1YS6A 1K8YB 2BW0A 1U9YA 3K32A 1CR0A 1VCNA 1YCGA 4EATA 5KOHA 5D7BA 1MT3A 2AOTB 4IKOA 4PAOA 1ZZGA 4GWKA 1ISRA 5AM2A 3EISA 4UD6A 4Y0AA 5GADl 1OFUX 4I3FA 4BN4A 3KTOA 3G13A 4RVGA 5KTKA 2JCGA 4JOSA 5LSAA 1RXEA 4HUQB 2PKEA 3ZHUA 3EPJA 3OO0A 2L18A 3QXHA 4JHXA 3OTOB 1TK2A 1VCIA 4K8RB 3H65A 1KVRA 2QOEA 2VBIA 4NBRA 4EDHA 1Q3KA 2DB3A 2OHVA 3HL0A 3EEIA 3UAVA 1M7BA 3P71T 1ZD8A 4FQ7A 3GDWA 1Z17A 3R5TA 4M1ZA 4EYGA 3ZVMA 1M66A 5I45A 3AY6A 4HEQA 1RJGA 2A5FA 4LKOA 4XPZA 3FHTA 1L7XA 1MAVA 2C2OA 2W8BA 3KT3A 1QZUA 3Q7QA 4O0LA 1RHKA 2J3EA 1MB9A 3I1JA 4UTZA 3GT0A 1RHRA 5D3MB 1U7XA 4OVKA 2I6GA 3WC4A 1E4VA 3J7TA 4F8JA 4FMCF 3PYMA 1Z6GA 4H6WA 2O52A 4WY8A 3C8HA 3REQA 4FQ5A 4M7OA 3THSA 3S55A 1OI3A 3RHTA 2C2GA 1JX6A 4ZOEA 3WQBA 4XWWA 1DWQA 1DCMA 3ZH9B 5F1OA 1IIRA 1WUJS 2IHBA