3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
1WMFA 1A2QA 2ID8A 1BE6A 3CO0S 5JMOA 3DE3X 3DVRX 4NE7A 4K8RB 1TM7E 2W2QA 1ST2A 1YJCA 4H6WA 3A3OA 1EGQA 1GT91 1C9JA 2HD4A 1Y3CE 1Y4AE 3DW3X 1T1EA 2ID4A 1UBNA 1KE1A 2X8JA 1SUEA 3I30X 2SECE 3DE1X 1S01A 1SUAA 3A3NA 5ARCA 4BWGA 1SH7A 1Y9ZA 4LVOA 1TM3E 1THMA 4NMXB 1IAVA 3VYVA 1AV7A 2PKCA 3SICE 3L1KA 4I0WB 1SN7A 2G4VA 3EE6A 4LVNA 5AQEA 3P5BA 1SCBA 1R64A 3LPAA 1BE8A 4DZTA 1GCIA 1Y34E 1WMEA 1TECE 2W2PA 1Y4DE 1SPBS 3I37X 1Y3BE 2PMWB 3DE7X 1MEEA 4WOCA 1Q5PA 5JXGA 5FAXA 1SBNE 1GTJ1 2Z58A 1SBHA 3F49S 1SIOA 3DDZX 1C3LA 3BGOS 3LPDA 3WQBA 4OMDA 3GT4A 2QTWB 4WOBA 3D9QX 5JXIA 4CG0A 3BPSA 3AJ8A 2IXTA 1C9MA 1NDQA 1S2NA 4ZOQI 2PYZA 1SVNA 4GI3A 4MZDA 3TI9A 1DUIA 2ZRQA 2Z56A 4ZARA 2PWBA 4OMCA 4C3VA 2W2MA 1KDYA 3Q40A 5SICE 3UNXA 2WUVA 1AVTA 3GT3A 2WUWE 5ARDA 3T41A 3QTLA 1SUDA 1KDVA 1IC6A 1WSDA 1PEKE 1XF1A 1JEAA 1P7VA 1DBIA 2HPZA 1BJRE 1SUBA 4OV6B 5K7SA 1LW6E 3DE2X 1AH2A 1PJ8A 1SCNE 1SUCA 5B1EA 4H6XA 1TK2A 5JXJA 1P7WA 2PRKA 4M1ZA 2IY9A 1ST3A 1GA1A 3QFHA 4KPGA 5B1DA 1Y48E 1T1IA 4AKSA 1S02A 3ZXXA 2PQ2A 1AU9A 3EIFA 3VTAA 1TO2E 3I34X 3LXUX 4H6VA 1BH6A 3DVQX 1ZVJA 1TO1E 2ST1A 1BFUA 2B6NA 2X8JB 1GTL1 5AMXA 4KG7A 4CFYA 1SELA 1BFKA 3DE5X 4AKTA 1AF4A 1YU6A 1ZVKA 1GA6A 1WMDA 2ZWOA 1SUPA 3VV3A 2PWAA 3I2YX 3GCXA 3AJ9A 1VSBA 5AVJA 1SBIA 3H42B 3DE0X 1NLUA 1YJAA 1SCDA 3EDYA 3D43A 4DWWA 3WIVA 2DQKA 2WWTA 1OT5A 1PTKA 1TM4E 2SICE 2SNIE 3TECE 1GNVA 4C3UA 2E1PA 1SCAA 2WV7A 1OYVA 5AVKA 3A3PA 3VSBA 4Z2AA 2P4EA 3TI7A 3CNQS 1KDZA 2DUJA 1HT3A 3Q5GA 1SBCA 3DW1X 1GA4A 3SQOA 1Y1KE 5CW1A 1Y3FE 2GKOA 3DE6X 3VV2A 2ZWPA 3WIUA 3BX1A 4DJ5X 2Z2ZA 2Z57A 1EA7A 1SIUA 1TM1E 3WHIA 4KB5A 1NDUA 3DWEX 3VHQA 1SCJA 3F7MA 1Y33E 1GNSA 1R0RE 1OYOA 2Z30A 5JXHA 1Y3DE 3DVSX 4B5LA 1AK9A 3LPCA 2TECE 1R6VA 5ARBA 4HX2A 2XRMA 1MPTA 4CFZA 1TMGE 4RYDA 1C9NA 1YJBA 2W2NA 5FBZA 1SIBE 2W2OA 4YN3A 5I9SA 3DE4X 3OSZA 1SBTA 5FFNA 1AQNA 2DP4E 1TM5E 2V8BA 1WVMA 1CNMA 4NE9A 2XTJA 3F7OA 4FONA 4J94A 3AFGA 3PRKE 1KE2A 1V5IA 3GCWA 2Z2XA 1PFGA 3HJRA 1GTG1 1T1GA 2SBTA 1CSEE 2Z2YA 1V6CA 3PTLA 1P8JA 3DYBA 4HVLA 3ZXYA 3QMPA 4JP8A
chains in the Genus database with same CATH superfamily
4AKGA 1WMFA 3L43A 1KFEB 3MJSA 4Q1DA 1A2QA 1E9VA 2FQ1A 4ILEA 4L8LA 2PMDA 2X77A 3W1WA 1C2YA 3NGLA 1EDBA 1U7ZA 3RM3A 5DN6D 2H4WA 5FUVA 4FEEA 1OI4A 3DE3X 2JIRA 2BMFA 3SQXA 3F4BA 3GPIA 4XJTA 4XEHA 3KB1A 4MRSA 1WTCA 3M9WA 4LYGA 2OILA 5JE8A 4EGQA 3C3XA 3TRFA 4IJ5A 3CNHA 1L1FA 3PZBA 5BNTA 3GFOA 4MKXA 5EIFA 5KJCA 4W9NA 1NU6A 3HM2A 2H1FA 2MYTA 5AP9A 5C0OE 1IWOA 1M6YA 5K3CA 1ZHFA 4L4YA 4CM3A 2B36A 2O8EA 2G5CA 1MDFA 5AVYA 3OOYA 5EC8A 1RACA 4OAPA 4YJ3B 4PZCA 1UOPA 1Z4NA 2CXXA 2Z3WA 4WFKA 2A5YB 3M3DA 3RC3A 4HZIA 2PSSA 2O05A 5AI6A 3ASVA 4JP3A 2A84A 2NTJA 3EPRA 4TT3D 3JYHA 1I7SB 5TGDA 3LOPA 4P8RA 9GPBA 2NZYA 3G0GA 3U1TA 2KLHA 3VU3A 4K6FA 3WO1A 4WX2B 4DQDA 4ZCMA 1EI9A 1CUWA 1B6TA 4C4YA 1MMFB 1ND5A 1YVDA 4MW9A 1EK1A 5FI3A 3RYIB 3OC6A 1GFWA 2PZBA 3VAAA 3FDIA 1SMKA 3EH1A 1AKNA 1A5TA 3C41J 1KDPA 3PQ7A 5ESXA 4C06A 1K2WA 3LUKA 3MEQA 2Y93A 2JD0A 1XVUA 2JFXA 3M4XA 1RJ9A 2XMRA 1VG8A 4U7FA 5THXA 1X87A 2CNLA 2JFQA 2BVNA 3ENWA 3FPGA 3OURA 4KQ1A 3VGPA 4DLPA 1N0IA 1VCNA 2GEUA 1Z6TA 3B6JA 3KKKA 3ZD8A 2H9IA 2V5AA 3QVTA 1SURA 2ZWAA 3GL9A 2V58A 3PP8A 4NQZA 4YT2A 3O38A 4MVJA 4JB8A 2DLCX 4B3HA 2CBXA 4TKLA 1QQBA 3UQYS 2E4WA 2REXB 5DOZA 3C7TA 4RVDA 4TUYF 5CDSA 1Y9EA 2XZPA 3AINA 3AKYA 1DRKA 3A70A 2FEOA 3UH0A 1C8KA 2OUIA 2FDRA 3MOSA 2IYLD 4QVIA 2UUBB 5CTAA 2GA8A 3EUWA 3OIDA 4MLDA 3ZE2B 5HILA 1XMJA 1KEEB 2GZ3A 1DAOA 2EARA 1EFPB 2ZQYA 3LM8A 5C35A 1HLDA 1PEDA 4UBNA 3FYDA 1P80A 3NCHA 3STUA 3Q7TA 3D7NA 4TWAA 3HA5A 5CA0B 2PUTA 1CUUA 1FDWA 1F8UA 4NMHA 3DE7X 1JA1A 1MGPA 2P40A 3QEKA 3UTDA 4G24A 1M7GA 3JAWA 4O08A 2GM4A 1Z37A 5IG2A 1NRWA 3L8DA 3M3PA 3OZEA 3HJBA 3DMTA 1R2QA 2H2DA 3ZZNA 2CEKA 3FBGA 3VPFA 2IK8A 3BM5A 4MGIR 4ER6A 1ULSA 1BTOA 2BHTA 2YWXA 2C3MA 2AI3A 3T9FA 2AR7A 2O2HA 3H97A 4XB1A 4RS3A 2QR3A 4WLOA 4GRAA 4XD7A 1FRFS 2Z4RA 2ZKLA 2ECOA 3P9NA 5CURA 3X1ZA 2RK6A 5LKRA 2DBVO 2IEIA 1GCOA 3LFTA 5K0GA 1FIUA 4ITRC 3S29A 3ITEA 2CL7X 3WYAA 1O9HA 5BN3A 3EDCA 4EW2A 1WQ1R 3VKVA 4X6YA 2HRDA 4CQMA 1M2VB 4RDXA 4OFXA 3Q8LA 3O8LA 4OYRA 3UOWA 3NPAA 2ODPA 4LW8A 4E5YA 4OFZA 1DCKA 3KOXA 3N58A 1AO0A 3P0HA 2AYXA 1CJCA 2C8KA 1HOTA 2AFIB 3ESQA 4H7FA 2FQXA 1XZMA 2ODTX 2GCOB 2VJBA 2DFPA 4RF4A 3MTBA 4NESA 4DMFA 3AFHA 2RHLA 4HPWA 4DILA 4GWGA 1LUAA 1WMSA 4OXIA 5ICGA 5LP6F 3TL2A 2ATEA 3RT9A 3C98A 4RAOA 1J4AA 3GEIA 1C0LA 1DTEA 1SVNA 3EDRA 4G4SO 2W42A 1IXRC 4J07A 1Y9JA 4TS1A 4R1LA 4IPTA 2ZDQA 3E82A 1Y8RA 3KAJA 2X7XA 3PKJA 2QMUA 1X9IA 3QLUC 4BVKA 4HYTA 1P2GA 2CCGA 4EPXA 1Z0IA 2Y9PB 3OCWA 4LOLA 4OJTA 3MWFA 2QGZA 3MC1A 1K27A 4FYHA 2W6PA 4GSKA 4MQ5A 4XQCA 3BOSA 5AJWA 4JODA 3ZHRA 4ZZ3A 1BQ4A 3DTVD 4Q3NA 5CDTA 1M1NB 5HTKA 1NI4A 3D6MA 3FMFA 1XAJA 3T3GA 1OH5A 4XCQA 3HNRA 2YXPX 4MSUA 4UHHA 4ZZIA 1DT5A 5FPKA 2B92A 5I4IA 3TGWA 3WBJA 4NBTA 1OASA 3AP2A 1IVNA 2DGDA 2J41A 4O2AF 1L8OA 1SUDA 5JZBA 3TLMA 1TO6A 2E6UX 2HHLA 4HDQB 4ZT7A 2RIRA 1IC6A 2BDTA 4ZVSA 1CUFA 3ZWYA 3DR5A 5A5GA 4TXLA 4D3YA 2W6JD 3NTRA 5K8TA 4KYVA 3C4JA 2YOFA 5JH7F 5JANA 2RGAA 3NEPX 1Q11A 2FWIA 2ZLBA 3GLHE 1ZH6A 2XUZA 1ZBQA 2O8CA 1EDZA 5ICEA 1JEAA 4C7VA 3MF4A 4G56A 3NM4A 2BKAA 2XYGA 1D5WA 1RIFA 4QODA 4XRRA 1PGPA 5E3JA 4BVLA 1W2GA 1XZIA 4L16A 2PXCA 2DU8A 3GF4A 4PS0A 3QF4B 3JRWA 4I1VA 5BNWA 2PXXA 4DDUA 2EGUA 4UNRA 2CSXA 3I9MA 5BVGB 2ZXUA 1L7DA 1MA0A 2G77B 2R4TA 3RFVA 4RPKA 3HVRA 3DDHA 4AZTA 5D8DA 2DBRA 2OCXA 4RELA 1IVYA 4WZ6A 1FLVA 4IXNA 4YDHB 5FPHA 3RTAA 4TTVA 1QPGA 1MAVA 4QEDA 4MKFA 3K8QA 4CQJA 5FWXA 3SZUA 3E3OA 3J81A 1UKVY 2FDXA 4M1MA 5JMWA 1VIVA 3DBVO 2G7ZA 4G36A 2VXOA 5SY6A 4RHFA 2R7MA 4MYHA 5EKSA 3WNQA 1A98A 4F4HA 1FFWA 6Q21A 2GNAA 2A9QA 4D46A 2E87A 5BWMA 2XMSA 4CQNA 1GV1A 4PAWA 3LU1A 4YMVA 4HUQA 4DYDA 4OHWA 4P5DA 4TS9A 1LX6A 3PRHA 4QTUB 5DP1A 5LC1A 3RS7A 2PEYA 2ZXEA 3I8OA 4BNVA 5BYJA 1B0PA 2QRVB 4O4JB 1NP6A 4QLOA 4Q9HA 2BE9A 2I65A 5KYKA 5CP8A 1OKKA 2YRXA 2JFNA 2OSBA 3AFNA 4UFNA 1WM1A 4YP6A 2WIKA 4CIBA 2RJOA 1E2IA 1CDEA 1D1TA 3GLIB 3K9GA 2PMCA 4I6GA 5BXQC 4FXPA 2AX3A 3C3YA 4HDNA 5JO0A 4L6IA 4L4SA 1OH6A 3EIXA 4UEOA 4CRWB 2V7EA 5JPIA 3U3DA 3CCBA 3D8HA 1EP1B 4GLOA 3LT4A 3U3KA 4NHEA 1QH1B 1V4VA 1H0HA 1QQ6A 3LXUX 5CDGA 3KTFA 1E92A 3HKDB 3MWYW 1P0IA 2QTFA 5JZSA 3AU9A 2FWJA 2XB6A 2NGRA 3KUCA 2GM9A 2JAPA 4Y6QA 1UFRA 4H08A 3IBGA 1OX6A 4WCDA 2GM3A 5CAEA 2L19A 3JAKB 1TU3A 2A0UA 1HYQA 4ZCPA 1Y9AA 3RVSA 5CBPB 1YTLA 1IXSB 5HW0A 2O54A 2NUTA 3G82C 2JKVA 1JU9A 2A3RA 2FUNB 5IP5A 3PBKA 4RFSB 1ODIA 2OOSA 3EOAI 3BD6A 1WZUA 2NW6A 4G07A 3LWZA 1FYVA 1UWLA 1YH3A 2FG6C 4M1OA 1SELA 1PKXA 1ENOA 5DHTA 1HRDA 2JIDA 1EFTA 3PZRA 3N2ZB 3W8FA 4AKTA 2ZI5A 4FHDA 5K5EA 2VJLA 2R1UA 3EMKA 4RD3A 4QRIA 5A4DA 1T9GS 5CB4B 3ZVKA 1PR6A 2BFEA 2HJSA 3GP3A 4GR5A 3O1IC 1T6NA 4L22A 2IWRA 3KZNA 4GI2A 4YEDA 4ECAA 3TKYA 1X7GA 2O2IA 2CLOB 1E7MA 2VBGA 3DB2A 3H7AA 4OIFA 1DRVA 2YJNA 4R2IA 4Q3DA 5BW5A 5ALOA 2HXGA 1K3TA 2IU3A 3GCXA 2Q7OE 3ZI7A 2C8LA 4ALKA 1T4CA 1VSBA 5TPZD 1IOWA 4C0SA 1GAJA 5IM5A 3C43A 1EYZA 1I1OA 2JFOA 4R2KA 5J2TF 1VHTA 4BVBA 2XAAA 3BIJA 4EUHA 1N1GA 3LG2A 2ZCVA 2WZQA 5JFTA 3OIFA 3H2YA 2NZ8A 1J2RA 1GZSA 4OX9B 4BX0A 2FUG6 1V11A 3BXGA 3PC6A 1JL3A 3D8RA 3F6PA 4GGPA 4X93A 2Y4NA 3RHTA 4LNAA 4ZMBA 4D9GA 1GL3A 2O2GA 3L0OA 2PGXA 3B8EA 2GD0A 2ODEA 3VO8A 3T5DA 1VXRA 5IYZF 3VNQA 1VPTA 2QM7A 2P3LA 2FCAA 4M1SA 1NRXA 4KIJA 2WVJA 1P91A 3GDHA 5KEIA 4QJ5A 1K8YB 5E95A 1KRHA 1OYVA 4JCCA 2VTBB 4JYZA 3Q3GE 4LISA 2O5VA 3N2LA 4HX5A 3STTA 3TXXA 4X0EA 1U5BA 4XQEA 1G4UR 3CKYA 3REFA 4YAFA 4FHCA 2J3QA 2WFMA 5AD1A 4GI1A 3UMYA 3EVGA 4YCDA 3RIMA 3L8EA 5BSHA 3K5PA 3ROMA 5TT1A 2QGFA 3K2IA 3EWIA 1B3BA 1QS0B 2J9FB 4B75A 4BVJA 1KYZA 3DONA 4WGGA 3L0YA 3QFTA 5K3SA 3H8WA 2ZB2A 3FKJA 1Y3FE 3RROA 4P1ZA 1DBVO 5B7NA 5CNIA 2LD4A 1YE5A 4RZSA 1XCMA 3H83A 3JV7A 3VV2A 3WIUA 4C7MA 4HXYA 1IFXA 2AFRA 4GS5A 4Z3DA 2C54A 2RHOA 4C04A 3L8FA 3WGKA 4YAKA 3ZHVA 2JLWA 2O1XA 5A3SA 1KAOA 4EO9A 2ZB3A 1P2TA 2CZGA 1N75A 3FMGA 2WZCA 3PR1A 2YY6A 3ESBA 4Y9UA 3AQIA 4FYYA 1SCJA 4BLVA 4ND4A 3R40A 1FFDA 3QEJA 4QVGA 3GXBA 1L4BA 5KUTA 4X97A 3ZHYA 3KUDA 1M34E 1M54A 1Z4QA 2QUBA 4GBMA 2QT0A 3ZYCA 5A5FA 4BC0A 2XRZA 4TV9A 2JEYA 1HC7A 5EMKA 1WP9A 2WE7A 1FP4A 2RGXA 3UK0A 4JC5A 3NDRA 2YN0A 2OXFA 3QWAA 4LBZA 2GPNA 1APBA 3B1XA 2I9KA 3K0CC 4MV9A 4YUYA 2ZIXA 3H4TA 1P44A 1O0SA 3DVSX 4YS6A 3AONB 4HK4A 4RK6A 4EX7A 4WY5A 4B6EA 4B6QA 2BUBA 1ZUNA 3FF4A 4M1EA 1RAAA 2I99A 3EXEA 4W82A 3V8NA 1BU8A 2YMLA 3CEAA 3ZOZA 4CMGA 1ZGGA 4DQUA 2XRMA 1MPTA 1VBMA 1XJ5A 2R1VB 3MXOA 2GJ4A 1RC1A 3SHQA 4BGEA 1K7XB 2H92A 2J5RA 1NVDA 1QFSA 1QG4A 3OJLA 2Y66A 3O6VA 3RBAA 2WEKA 2OXTA 4MW1A 3W7VA 4O4HB 4YMGA 4MKRA 3IQDB 2E37A 5EMMA 4ZEXA 1US8B 1L7MA 2AW3A 3RBZA 4OB8A 4JEMA 3CINA 4L8GA 3QE3A 2BGNA 2YV3A 1AKUA 4EHJA 5BN4A 1YZGA 2Z5FA 2CHGA 3IP9A 4O5AA 4Q1BA 3T5TA 2BGMA 3ILXA 1G1MA 4Q5IA 1IOZA 1CNFA 2WMOB 2BFFA 1V5FA 1PWEA 2HHCA 2QRGA 4LXTA 1D0IA 1TK9A 2W71A 4FGJA 1CNEA 2X5OA 4NVRA 4PE5B 4PHCA 1XUOA 1CC1S 3ONNA 2VSXA 4CKEB 2OFFA 4NE9A 2YH2A 1D2EA 3KZOA 1KQFA 2PANA 4BZQA 1EUCB 4LQLA 2Y27A 3H2IA 3VTKA 2QXTA 3H7IA 4UQOA 5AM2A 3F7OA 3TVDA 2H6EA 3UHPA 4KX3A 2UZ0A 4J94A 4NCNA 4JI4B 4OXRA 3UV6A 2SCUB 3WK7A 1QE0A 1H0SA 3MD9A 4I55F 4Z9XA 1W52X 2JHGA 2ZYRA 5KI6A 1JQDA 1DX4A 1V5IA 1ZIOA 2OZKA 4IXTA 1PWXA 2Z2XA 1FTQA 1L4HA 3G8CA 3HUUA 2RHBA 2WHXA 2LGJA 4K6OA 2A0KA 1J24A 2OVFA 5KS2A 1E1NA 3T4EA 2IA5A 4G5SA 4EHLA 3IMGA 4DCSA 1IHUA 1PSWA 2PV7A 1EVQA 2FMFA 3PGA1 4MRVA 4DG8A 1YQEA 5EJ7A 2UUCB 1YVPA 4YJFA 1PG5A 4HRVA 1GNLA 5CLFA 3OM9A 3JW8A 3BILA 3D1JA 3O4GA 1IPFA 1EUDA 1DI0A 1U2DA 2IDKA 2OCDA 5M7EA 4P0QB 2WT4A 1SC1A 3QEAZ 4R8SA 3TR0A 2XVMA 1NIJA 1PGNA 1ZVMA 2CNWA 1PT7A 2NPOA 1TC2A 3LUCA 1SRQA 4M6WB 1Z2NX 3RKSA 2QX6A 2QI9C 3CUSA 5T5QA 2GCIA 3AB8A 2EG9A 5JCJD 4FSHA 3MS4A 1HF3A 5C32A 1AKQA 2KB0A 1ZWKA 2ATXA 2M6LA 1PT8A 3KJQA 3U44A 4H3HB 1VPWA 1G0OA 2E85A 3NLLA 5DM2A 5REQA 3CVVA 1QO0D 3L84A 3ZU3A 1W8DA 1H8ED 2BHLA 4Y2PA 3BT7A 1JBKA 4IIHA 1NF8A 2GXUA 4YFYA 1YGYA 3JQFA 3IKTA 2D1RA 1ST2A 4I4CA 1V7CA 1LEHA 1VE9A 1MAAA 1YOBA 1RM3A 3K6RA 1AUOA 3RC2A 2VT6A 4DKXA 4MWOA 2AF3C 3G2JA 3NWOA 3OESA 5ALIA 3AM1A 4C4AA 1SCIA 5JJCA 3NKFA 7AT1A 1P75A 4GPEA 4EEKA 1J0XO 1NW5A 2XTMA 4JX8A 4WVFA 4WKPA 1ZRSA 4LE2A 3FVTA 3RUPA 4L15A 3LHIA 5KWIA 1H2XA 4D9JA 3B2NA 1JHRA 2ZYUX 3LX5A 4CEIB 1EZ1A 2E89A 4QHYA 4ER7A 1NVAA 3PDIA 1XP8A 4BB9A 4XIJA 4B5KA 3ZE7A 2R5NA 2QTVA 1QQAA 3BXFA 3OTGA 4OJMX 4KV9A 3CF4G 5EVJA 2G9RA 2XECA 3LW7A 4HP8A 1PVVA 1UBNA 2ZVQX 5BN5B 2C7PA 3L8YA 5ECDA 4YMHA 1CETA 4N0DA 2VP0A 4EYGA 1BDBA 4LK3A 3A6LA 3T9AA 1Z26A 3U6KA 3KS9A 2JJ1A 2YMMA 3AZOA 1S01A 3DE1X 3HE3A 1KERA 4FKMA 3WG9A 1HQYE 1I3NA 1LU9A 3FX2A 4BCBA 1CLEA 5TGZA 4FDUA 4NCKA 5U1PA 1ICEA 1NAHA 4FYKA 3SYRA 4BTVA 1HEUA 4NRDA 4OXQA 1DC4A 1LBSA 3U9TA 4B40A 4F21A 3WR5A 4KXYA 3J7TA 4H2DA 1AS0A 1U7XA 2IYAA 4I81A 4RF3A 4ZOAA 6YASA 4GECA 4QBIA 2W7TA 4ON9A 1X92A 1X39A 5BMVA 2VT3A 4D99A 1JEQA 5B58C 3FR7A 5C81A 3W5SA 1IJKA 1E9BA 2EHDA 4FHEA 4KX5A 5BNFA 4DCOA 1AHPA 3M7IA 2Y1XA 1A3CA 2YWEA 2CFCA 3VTFA 1T9HA 2Y6UA 5HKLA 3RYHB 1JSXA 1XN4A 3LLCA 3N74A 2QZ9A 4R2MA 1NVVR 2AOTB 4LJRA 3QPVA 2ROQA 4EVSA 3QPBA 3LNCA 1U11A 2EX4A 2Q9AA 4EAQA 2BKEA 3MBOA 4II3A 4B3IA 1E1RA 1EFUA 1HDRA 2AXEA 4OFWA 4R8VA 1HE5A 4CMEC 4Y2XA 4DZTA 1ONOA 1Y34E 3ZEIA 2DUUA 4MV7A 1JW9B 2APJA 1YBFA 2XX3A 1U9YA 3FE2A 3QOWA 5HXAA 4ABTA 5K3AA 1YJ8A 1FMFA 3OOWA 4Q4DA 5DI9A 2XT0A 2X0JA 4GX0A 4MRMA 1TMOA 4MRNA 4QTTB 1SPBS 1N32B 3SC2B 3CLTD 5K3DA 4F4JA 4H4EA 3PNLA 4NX2A 3ZDQA 4BYMA 2CVOA 4CI0B 2VDJA 4IFTA 1MEEA 4WOCA 5JU6A 4M89A 2ZE8A 2K5UA 2F64A 4ASUA 2EAUA 5KVQA 4IIJF 1NN3A 3JATA 4KXQA 5JOQA 1C3LA 2UZIR 4QFBA 5DU2A 5JC8A 4MIOA 5JJKA 1OWPA 3L6CA 3WLPA 1R8SA 1PLJA 2GTHA 2YRWA 3GEEA 1VTKA 3ZHOA 5C5CA 2P3SA 2FX2A 4IZIA 3PQ6A 4KH0A 2PRYA 3GT4A 4MO2A 3GJTA 4A5OA 5K8IA 2H1WA 1KIMA 4LECA 4JLJA 3SU8A 2D54A 1NVVQ 3PHHA 3NNDA 1LZKA 2A9PA 4IWNA 5I8ZA 3UMRA 4UM5A 2C98A 4G2NA 4CG0A 4D6YA 3AHFA 4LOIA 2JAXA 2WDPA 3NNNA 2JGLA 4NZMA 4PIMA 1GWNA 3TGPA 3U4QA 1IVSA 3U4MA 1QX4A 5JLJA 3RD5A 2BZGA 3SJCA 3HN2A 3H9GA 4Q9DA 1YB6A 4XQ9A 4BP3A 4MQ6A 1Z08A 4P3KA 2W6OA 1UQTA 5TB5A 4LF5B 2IEDA 3MELA 4WACA 2JDID 2PYZA 1NBMA 3TJMA 1M75A 2J0UB 2OO5A 4PLTA 4RTNA 3WFZA 4D3XA 2R6FA 3DFIA 2Q4EA 1TUGA 1U1IA 2O0HA 2ZRKA 3EZ2A 1L0BA 4ZO8A 5G3YA 3HBLA 3A1CA 3AHHA 5E6SB 3QE0A 1Y4UA 5AI5A 6AT1A 1VXOA 5I7UA 1EFAA 1X3SA 5ITZB 5FOWA 4M1QA 4P92A 2Z2JA 3EIOA 4E5UA 1UK7A 2V54A 4QUAA 5K8JB 3SM3A 1XK6A 4Z7OB 1W93A 3EFEA 1R5OA 3SE7A 5CDYA 5LU9A 1YRLA 3SQMA 4M0DA 3UA4A 4JLOA 3VPAA 1UKCA 1KQPA 1WUJS 1N7JA 5IJXA 4D9IA 2UXBB 5FWYA 1UIRA 1Z2PX 5DN9A 3M6LA 2M6RA 2GK7A 2UZ1B 3VR5A 1G19A 5JY1A 2MYNA 1H2WA 4XM0A 5TJ9A 5JRZA 4P93A 5IDVA 1ZXXA 3S70A 5DGCA 2CJXA 1D09A 2V6FA 4M60A 1RTKA 2R87A 3KCNA 4MWBA 4EECA 4N4AA 3IOEA 1L9KA 2VUHB 3ZWVA 1B6GA 2DSNA 1Q7TA 2G17A 5M2QA 3QKRB 3T1TA 2CMKA 3ZI4A 2V8OA 1AHNA 2RGNC 1O5TA 2P67A 4PLHA 5IXYA 3LQ4A 3FPAA 4AN0A 2I7TA 1RWVA 3LJKA 5EJAA 3ET5A 2PWZA 3TYXA 3DXZA 4G2TA 4IDCA 4ME6A 5BPFA 1H4QA 2UZ3A 4M7RA 5DHFA 3H0EA 1EWYA 3QY0A 1Y5RA 3UW3A 1EK0A 2EEPA 4NAVA 4MW0A 1TVEA 4K9NA 3G8AA 4OHMA 3RSFA 2ZUWA 2G82A 5AKGA 3H6GA 1YB4A 4CL2A 4G0PA 2Q9CA 3LHSA 1H22A 4FMBB 3GFQA 3ROGA 1NURA 4PR3A 4Y2VA 2B1RA 3GJXC 4MINA 3LYLA 4PRKA 2ZBEA 2C4WA 1A69A 4N7JA 4FFLA 3NVKI 1MO5A 2VDWB 3PNPA 3WLIA 3D3EA 3VHXA 4GG1A 5IW8A 3D2AA 4DDTA 3DBHB 1ACMA 1HXHA 2MJLA 3B6EA 3QVXA 3BRCA 3CM0A 3ICPA 2OQVA 3RLIA 4U5XA 5TVGA 3GUYA 5MN5A 2ONZA 1ICIA 2ZJZA 3CX8A 4TUYA 3JALA 3K2EA 2GZHA 3FGZA 3HA3A 3LL4A 5B1DA 4BV2A 5HDQA 4DYHA 1LDGA 1F1JA 4HAZA 5FBWB 4D8VA 1V5WA 2CEAA 2X2OA 1EX1A 1ZUIA 2GYYA 3V7WA 4ZQEA 4UUAA 1LGYA 5EQJB 5JARA 3OQMA 1KVRA 1KR5A 2WJ6A 4HTAA 1RXVA 1NBOA 4CIDA 1BEEA 1E3TA 1P3JA 2X19A 1JG1A 5LPNA 1RLOA 3KQKA 5CITA 2PLNA 4R4JA 1QC5A 4MW4A 3HV0A 1MF7A 1RS0A 2VDKB 4M8IA 4MTLA 1JJVA 2G70A 4DBLE 2HCRA 4MDFA 2Q3CA 3NB0A 2POCA 4J6EA 4UBLA 1XZGA 3HUDA 1W36D 4JYAB 2Q6TA 3KR1A 2WMNB 3F5SA 3L4BA 4DM3A 4IMRA 1DKOA 5ICMA 5KTPA 1E77A 3LVFO 1QH0A 4XLZA 4D8UA 2QN3A 2B6NA 2MSWA 3O4FA 3O8RA 3KLOA 4NBWA 4JT9A 4D5GA 3HDYA 1KYWA 1PKEA 2EKZA 3KQLA 5JCOA 2JBAA 1C0KA 3C5HA 4KN6A 4LOKA 5A4FS 4KV7A 4UATA 4URYR 3HTXA 5FP0A 1NMYA 5K8CA 1GLGA 4HB0A 1D1QA 2R68A 2FXVA 4M49A 4QDTA 3DFUA 4P35A 1ZA1A 4RQUA 5GV7A 3SX0A 4F5WA 1QIHA 3I0NA 2HZ7A 4FBLA 3OQJA 2D8AA 1PT9A 5D2CA 1OXMA 3HO8A 3OJWA 5LP6A 1ZX1A 2MSEB 3K5IA 3I2YX 3EJWA 4WD3A 3V42A 3INRA 5IJ0A 4XE5A 5J4YA 3OT1A 2JK1A 1T8YA 4Z4QA 3AJ9A 3E9NA 4Q16A 1E7QA 2IXDA 3B2QA 4E94A 5JDCC 1L9XA 1G2QA 1GPNA 2BRUA 1G7SA 1TVMA 5CGQB 1MO2A 4YRIA 2AFHB 1ENZA 3UN1A 3VUFA 2H57A 3HVHA 3OKCA 3HJUA 5DNEA 1FJ2A 2JANA 3UPDA 3WBFA 2B5OA 2BEJA 1UK6A 3ZWBA 3WISA 1CLUA 1P2UA 4D0SA 2ORYA 2TYSB 3AOEC 5LQJA 3TNYA 4DWWA 3BK7A 1PS9A 2IHZA 3FLBA 4L72A 1H8HD 1KI7A 2GEVA 3AF0A 4NARA 3M1YA 3G79A 4IJMA 3TIIA 4DJDC 5A4MS 2ZIVB 1OFHA 4C0KA 4M98A 1OT5A 4XZ3A 2AH5A 5F78A 4WLUA 3FMIA 3SLGA 4YV1A 3ZH2A 1OLXB 1Z5GA 2CD9A 3SLRA 4E32A 4O2AA 5JPCA 1I01A 2C9ZA 1L7OA 5I5EA 5JPDA 1EFVA 4NOLA 2O7SA 4D57A 1KVTA 2MHCA 3K94A 5DX8A 4A2WA 1MV8A 3GZ4A 4EPWA 5HQJA 3OFNA 5JH7A 3Q3JB 3K30A 3I72A 5FUBA 2XVXA 2HRBA 4MVCA 5HCIA 4C9BA 1K68A 1YRWA 3QG5A 3GRPA 4RJTA 3FBWA 4R84A 5A02A 1CZUA 3CF0A 4BO0A 1KKUA 4X41A 4RYLA 3LY7A 1NP7A 1B0UA 1N3LA 1XJWA 3O2JA 3OQ1A 2FJPA 2ISSD 4EKIA 2YYSA 3OZTA 1ZH8A 3TQFA 2DCUA 4NZNA 4AXXA 1COWD 2CNDA 2IQIA 2WLSA 5C8YB 1IHOA 5HOEA 2FW1A 2OCKA 4MA4A 4KBGA 3N28A 1C81A 2YOGA 4IDBA 3DDUA 4MVJP 4XLLA 3K5WA 2GBLC 1B4DA 1UK9A 2JA1A 5K0FA 1ADJA 5C2JB 1UANA 1DVRA 4L8FA 4LBVA 5P21A 8ADHA 5JASA 2XNCA 1Z0DA 1W46A 1NMXA 5JADA 4R71A 3UKOA 1WO8A 3D3NA 2YCBA 1IEXA 2JFGA 4Z53A 1ZEMA 2ET6A 3FA2A 2JCYA 3AY0A 3VKHA 3E6AA 3G8DA 3G59A 3FCXA 3V2IA 5JSHA 3ED1A 2EX0A 2ZRBA 1AXEA 2C8VA 2PX0A 4TLAA 3NXKA 4V2UA 2OHHA 3U4IA 4DLUA 1ZK3A 3VHQA 2G25A 3ND9A 3FPCA 1KGSA 3NMUF 3BMXA 2XIQA 3OHPA 3SFZA 5B3LA 3H9QA 3GPDG 1ZVQA 4JMLA 1GXSA 5HK9A 3MMSA 4NQRA 2VPZA 3PHJA 4J1QA 3V6MA 2V4MA 4G8DA 1GNSA 3HA7A 5HQ3A 2J3DA 1C7JA 2HBYA 2QDKA 3CX6A 2X3YA 4XYBA 1JLHA 1K9VF 1IWBB 2O2CA 3F98A 5HE9A 4DHWA 3SP1A 2X86A 1GVHA 3C1TA 3O03A 2ONKA 5HKBA 1L5MA 4WCVA 2O59A 1X7XB 2FPXA 2WJ3A 1NOKA 4ZOLB 4A2QA 5A4KA 4R1UA 3LP5A 3FFTA 2F48A 1X74A 2WF7A 3H6HA 4TQ9A 4DANA 3TL6A 5LJIA 4Q9NA 4R7TA 1LS1A 2PE5A 1WBJB 3LVRE 2O7RA 1HA3A 4L07A 1WOYA 2VWPA 2Q49A 5COBA 2PU7A 1O95A 2HRZA 3MWGA 1M7HA 4RD2A 1C0EA 2JGAA 2OD7A 3E2IA 4GP7A 4U2FA 4DR6B 5CJJA 1A2OA 1EB9A 1WKBA 2G6BA 2I76A 5GZ1A 1KF0A 1YQ9A 3UAGA 1JAIA 1XD2B 4U6QA 3RC9A 1RQ2A 4W1QA 3U1VA 2D0DA 1A77A 3A6FA 5U4XA 5CG2A 4PGGA 5I7RA 1AZTA 3NHRA 3OEYA 4BGIA 4ERXA 1XL1A 4JLSA 3VHRA 2YL2A 4YT5A 4LUCA 3IAS6 4EFMA 3I9V6 5KNCH 3LDFA 1MIOA 5HKKA 4IIDA 1BG6A 1N8TA 2GRUA 1XA3A 2Z98A 3SJAA 4DUGD 2QQFA 4QRDA 3WX0A 1OBVA 1R3UA 3KKEA 3N0RA 1CUEA 3AVPA 5IMSA 3IDZA 1QRDA 3IO5A 3GPLA 2DWQA 1CJUC 3I92A 1NN5A 1KMHB 1RJDA 4GXTA 4V24A 4XWGA 2O2EA 2RGWA 4GBGA 4RABA 3EPHA 1IHXA 1V4NA 3RH0A 4CEHA 4P3XA 1XRNA 5CYFA 3MWDB 1K7SN 3GUZA 1BVYF 4AJEA 5F77A 4RULA 2Q2NA 4RXUA 1E96A 2JBHA 4LIPD 2DHRA 3CUEF 3OUUA 4DA7A 2VKTA 5TMDA 2XZDA 1VRVA 3IL2A 4QPPA 4ARVA 3OMWA 1EM6A 4N3NA 1S9DA 2Q50A 3KKPA 5J2TA 3W5CA 2IYVA 1FQJA 2VTEA 3RRJA 2OXIA 1YACA 1SU4A 4L3VA 2ZJAA 4DBVO 1YJXA 3TX6A 1O94D 2IH2A 4JU9A 4NZOA 2YIDA 3VZRA 3IT1A 1GPH1 5JAZA 2ETXA 2AB0A 4IXMA 3B53X 2VQDA 1P0QA 1QRRA 1XDZA 3PGVA 4BO3A 2DY0A 2GPWA 3BAFA 3FDZA 4GX5A 1CSEE 4POOA 5JYDA 4PXYA 3ZHBA 3HWWA 3FRJA 5BSUA 1F8YA 1KJ9A 3B52X 4ZYYA 5DI3A 4FS3A 1XQWA 2F55A 1CYDA 1HSOA 2I55A 2YYZA 4NENA 1GRQA 4HPXB 3RV4A 5IYZA 3KELA 5LIPA 1GITA 2VYCA 2GO7A 2XT6A 5DGHA 4YRZA 1YS1X 4YO7A 4MR7A 4J0IA 4RL6A 3V2HA 3JQGB 2XDAA 1NBIA 3ICWA 3U7QA 3O91A 1DEOA 3M1AA 4PXSA 3SG0A 4M53A 1KJZA 2FOIA 1VB5A 3UH1A 4YUWA 1DJOA 3AKCA 2IYNA 2D2FA 3HGTA 4DQXA 2YWDA 4EGFA 1A9QA 3H65A 4KRXA 2PJDA 4FDAA 2JIBA 1XTSA 3HB7A 2P9QA 4ZOEA 3VAZA 2GUWA 3MS7A 1DB3A 2PA0A 3H11B 1DQPA 1N9KA 1NI3A 2NPIA 2QN1A 1JEYB 3R6WA 4LZOA 2P75A 3L6BA 2GD6A 5DK6A 4XKJA 2GWHA 2C29D 4W6QA 2D00A 2P65A 3I73A 3Q2KA 1OOEA 3MMXA 4DLYA 4UVIA 5EHZA 2FPRA 5E6UB 3T61A 4GZ6A 3JQCA 1BNCA 3PXUA 5AK6A 1TQHA 4Z1MA 1L4MA 5AW8A 1SZPA 1E1QD 3QLTA 3MGCA 1C9KA 4Z8XA 5AYVA 2FYTA 2YWFA 5GJBA 4PFQA 3TZKA 3W2HA 3LQQA 1AKRA 3FFAA 4YO8A 3THSA 4FX2A 4CU5A 4X1IB 2VZ8A 4M1WA 3RSOA 1SK9A 1NJ8A 1XTKA 2H54A 3UWOA 2HCTA 4CKXA 1RNLA 2X2EA 4P3YA 1KE1A 4I3HA 2YZ2A 3K0AA 1YQWA 2W6ZA 4C22A 4TMFA 1EUQA 3SEZA 3RAJA 4ZQBA 4X63A 1UM9A 3EY4A 2X23A 3PITA 5CFLA 2PN1A 1F2UA 2JGKA 5DEIA 4TVBA 3VJRA 1BWRA 4F5EA 1O4VA 3LK7A 1FTWA 4UEJA 1RZRA 3DKPA 4EY6A 3K0SA 3PUWA 2QLFA 2BI4A 1OB5A 5CGZA 1W88A 3U81A 1TKAA 4DR7B 1TT5A 1SC4A 1CRZA 1AV7A 5DM0A 1PD0A 2PAAA 4AD8A 1M1YE 2QI9F 2JIPA 5EWMA 5CB6A 1DLIA 2QN7A 2X0FA 4F6RB 2VJNA 3DO6A 2WJIA 2CXQA 3N07A 1JAHA 4RKFA 3MG9A 1TADA 3BTUA 1AMNA 3T95A 2LBPA 1W4CA 2JLBA 4M9CA 1SKQA 1NWHA 4ZYVA 3NTUA 1WSWA 2BEVA 2OBLA 3ENNA 2EHJA 5AQEA 1UJ6A 5IJZA 4HTFB 4IGFA 1QGOA 2FDCA 3EIEA 1PZXA 3KOYA 4DNPA 1ZD1A 1THZA 4KGZA 4HB3A 2W2LD 1UZNA 3BSFA 1VDMA 3RRNA 4AG5A 1MTZA 4NU0A 3TAUA 2QZZA 5A9RA 4WA7A 3B3AA 3RK1A 1GCIA 1YE8A 2YV2A 1BJTA 2DKFA 3MT9A 4ESEA 1IZ0A 1Z8HA 2AZMA 2CLLB 2KLBA 4P86A 1WA5A 1XP5A 5KO2A 3ZTTA 2O8EB 3I37X 4A6EA 2OPHA 4WE3A 1E9EA 1LBTA 3IOCA 2HBQA 1O96A 4DUPA 2LDBA 1C30A 3C6ZA 1IYZA 4M21A 4KCGA 2ZBGA 3A0UA 4OQ4A 1SBHA 1SVOA 1GU1A 1QH9A 1KSGA 4DQVA 4G26A 2IHNA 1BVRA 1XCBA 2P2CA 4HAYA 4ISCA 4D9CA 1ISJA 1TZBA 2PM8A 4QOFA 3ICVA 1HQDA 4M36A 4YLYA 4I55A 2XGOA 1ZFNA 3RVDA 2HRRA 5JTUA 1MQ9A 3W1EA 2OMEA 2W11A 3RT7A 1NXSA 3P9XA 3WIEA 4Q9LA 4NSNA 2KS6A 1JHXA 1F8GA 3EFOA 4RIEA 3GZJA 4UUPA 4DV4B 2GVZC 5JXIA 5EXXA 4X24A 4OBEA 2QIOA 4B8ZA 2Y1WA 2BMVA 1ZD2P 4DJJA 1PYDA 3I6MA 1RMYA 2CYAA 1EESA 1YI1A 3QVJA 4BCCA 4E4TA 3HRIA 4WKBA 3BIWA 3VOAA 2NZWA 1YVRA 2GEKA 3A1DA 1VKRA 2WAYA 1NKTA 2YC2C 2R11A 1M1ZA 1IL0A 3D2LA 4TLMB 1S2NA 1UMKA 4TMVA 1Q3HA 2WTXA 1EVYA 4FE3A 2FGKA 4U3JA 3I2IA 3ZWNA 3IOMA 3LZDA 1M2OB 1VL5A 5IVKA 3LRXA 1J07A 2WWWA 2CLDX 3P0FA 4AZ0B 3AX6A 3K09C 4N6GA 1BROA 4N5NA 3BD7A 2JJ8A 3M81A 4MWGA 3IUNA 1T2DA 3L5KA 2XWPA 3EEOA 2W2MA 2X0NA 1LWNA 2ZTHA 2FV8A 1ADGA 4EPYA 2B4KA 5IKMA 3BHNA 5DWDA 4BNDA 5KWVA 5K0SA 1U4NA 4YCJA 1NJ5A 1VJDA 3WK9A 2R7KA 1UDXA 4IFIA 5KKNB 1QGUB 3EZ9A 4QQKA 4X91A 3WDLA 2JBWA 3OCCA 2WJPA 4QYSA 3W4JA 3ETCA 4BAGA 3DMNA 3TQQA 1QP0A 8LDHA 2Z8YA 1NSYA 2OV1A 4CMIA 4BFCA 4XYLA 2CJWA 5FAKA 4C0XA 2E9SA 1VSUA 2QUZA 3ONFA 4LE1A 1H0RA 3A1UA 3DCYA 4E51A 4JBGA 2JVKA 4UUQA 4S04A 4U2CA 4RPGA 2BFBB 1VL2A 1XF1A 2YXLA 1QUEA 4DTCA 3VBCA 2XE8A 3RUAA 1W6RA 3D3WA 1V3VA 1OAOA 1Y1TA 1T2CA 3EDOA 1P1BA 1B93A 3CJQA 2HCJB 5CW2A 1ORRA 4ZT2A 1E2KA 2QRQA 2HV8A 3WLKX 1F6BA 3GEMA 4E6EA 3ZGYA 2DPXA 4V39A 1KFJB 3QLJA 2FH5B 2B4TO 3OPYI 3RSLA 2EBHX 3AF2A 5EJMA 3FW1A 4C6TA 4D56A 1Z63A 5BURA 5E38A 4OF4A 4AN1A 1NUAA 1YRQA 2IUYA 4UHBA 3IIKA 3FTFA 4LEIA 4ZPXA 2C00A 3TG2A 4LYYA 5FOXA 5BV2P 5J40A 4AI6A 2GEBA 3TQOA 4HNUA 4UTNA 1CS4C 2O23A 5CJPA 1JE0A 4DLRA 5L3VA 3MWEB 2REBA 3PNMA 5J4LA 3QA3E 4O2BB 3WL6A 1OGIA 1A8IA 4NBUA 2NQ8A 2G76A 1WZ2A 1Y8RB 4K40A 5CIYA 4TVSA 4PGHA 4IGKA 4M1ZA 5KQRA 1C29B 3IELA 4LWOA 2WSSA 3I1FA 4YP7A 4QL3A 4UEWA 4CLOB 3NR2A 1N4DA 1EEHA 1NM5C 4PNPA 5F98A 4X7RA 2O2XA 1U2RA 4FFWA 1HTBA 4NS1A 1VJ5A 1T9AA 3MWLA 5F7JA 1TKCA 2CL5A 4IG4A 5CHYA 4MXDA 3KAQA 5JSYA 2PO5A 3GELA 1OXVA 1AGXA 1JLRA 1SOWA 2VPPA 3I04M 4I4IA 1QIFA 1RRVA 3W2FA 1GLNA 1I0IA 2DBZA 1JJAA 2W0MA 3AHGA 5I51A 4OSEA 2G0TA 4XYGA 5H3HA 3ZXXA 4Y67A 4C07A 2PQ2A 5JSUA 4JROA 4JXKA 4XAQA 1FS6A 4Q47A 1UPXA 3I12A 1MNQA 3RTGA 1URPA 2A9JA 1FOEB 5EGSA 4DB4A 4NICA 3EDMA 2HO4A 3O1HB 3KG2A 1P6QA 1PX2A 3JYOA 4LN1A 2XWSA 2HZBA 3PJGA 1H2ZA 3LUFA 4ER5A 3RUIA 3HKBA 2C3OA 3I83A 3NHYA 1DOHA 3R24A 4IIJA 5LLSA 5I6DA 2ZJ3A 3MTDA 4REOA 3S55A 1Z17A 2DWCA 4FB4A 4Z54A 4F3NA 3L0CA 3K5HA 5E7MA 1Z4OA 2JAUA 5EIOA 3F8WA 3J80A 3LP6A 1D4OA 2O1WA 3ZVNA 3G2MA 3L7LA 3OBBA 2HHAA 4P3NA 5DX0A 3HI4A 4GKVA 2XMZA 4U7TB 1P9WA 2Z5VA 3OA0A 4JSYA 1QAOA 4AS3A 4KG7A 3LBIA 3N8GA 4BQFA 5M34A 5A9SA 2YZ7A 4Q3KA 4J49A 3DBRB 5BT9A 2MCFA 3U62A 4ABYA 1WU7A 1GZ7A 5I7WA 1V2HE 1ZLXA 2JFUA 2GHQA 5F2EA 3TOCA 5JDIA 2ODWA 3K32A 4C1NA 4B6OA 2C7RA 3KOMA 1QVAA 1NC3A 3M6UA 3AEQA 4BRZA 3VV3A 5LDHA 2VJOA 2XA2A 1V8BA 3ZLJA 2IYOA 4MQUA 4QX6A 3PUIA 3TTUA 3JQDA 2PH3A 3BGWA 1H6CA 1TFRA 4MUHA 2AN4A 3KPJA 4GOKA 4HYYA 3VSCA 2REQA 3WV5A 2JLQA 2GVDC 2IHJA 2WJHA 3D8UA 1HEYA 2ZJ8A 3AERB 2Q5IA 5A2QA 4BLQA 4N3CA 3G17A 4PC2A 4KYTA 4OFBA 3OX4A 3W2EA 1R5JA 3GOHA 1V1JA 1NLUA 3TKAA 5A6VA 3TOSA 3W8DA 3ASYA 3BH6A 1YR3A 4X85A 1PF7E 3NBAA 4TKVA 1UEIA 1RWOA 2D1SA 1SVMA 1UBCA 3D43A 4V03A 1GZ5A 4HDNB 5EPOA 4TLEA 1EJ6A 3E4DA 1EX6A 1TXGA 1Z6XA 3QJYA 3TOXA 4YRBA 2FZEA 1E6LA 2I6XA 1NMZA 1Y4ZA 2VK4A 3IBSA 3PHGA 5G1OA 2VDPB 3H04A 1QK4A 1V1MB 1YI0A 4RZIA 5LMCA 3FHCB 1B76A 3LUJA 4FFPA 5B7QA 4BE9A 2C77A 3A27A 3CLUC 3CEJA 3G5LA 1PDOA 1DXQA 1LF5A 1ZJ6A 3TZBA 2G5TA 3E58A 3MUOA 1EX7A 2IEBA 1BFDA 4HDSB 1KI6A 3FSEA 3QXXA 3FDXA 5B1HA 1HH4A 3HYCA 1ZM3A 4UTRA 2VA8A 3HY3A 3LF2A 3OE1A 4KFTA 3O31A 1B00A 2B94A 1FFEA 3ZX4A 5KC9A 2GN1A 4HQ6A 3W9BA 4MVJG 1XQ1A 3H99A 5ER6A 3J81k 1H4SA 2Q1XA 4DT1A 2X9LA 2V1XA 3GCDA 1WDTA 4GZLA 4JZKA 1UT6A 2VLIA 3OU2A 5K6AA 2CFIA 3A4YA 4UCWA 3RJTA 1PJRA 1N33B 3EXHB 5GONB 3WNBA 4YCBA 4X62B 4GOOD 3QI7A 4A8TA 1XIVA 4TRMA 3U4GA 1N2JA 2PR7A 2C5EA 2ODNA 3E84A 4PYKA 2F7SA 1XYVA 4KR6A 2VO1A 1PHRA 2ZBRA 4RZQA 4UHDA 3EJ6A 5KREA 4GMKA 3DZGA 1YMQA 3D81A 2DAPA 4LZPA 2E0IA 4N0QA 5KNBD 4IIGA 1C4KA 3BX1A 1K8QA 5JD5A 4TRRA 4YRTA 3FOBA 2Z2ZA 3WHKA 1Q91A 1JDVA 4LZAA 4M0FA 5E0KB 1AG9A 3VSEA 3DDWA 1V5GA 1PJQA 3R75A 3PLNA 5BR8B 1NDUA 4K9DA 4MPPA 2AE1A 2QPOA 4BNXA 1CY6A 2MINB 4MUJA 1S1CA 3I6QA 3RTBA 1IUPA 1OREA 5EE9A 2BD0A 1BDMA 1OBOA 1N3YA 3GB9A 3I45A 1XNRB 1MAWA 3QKIA 1YU9A 1JHOA 4A8JA 3F9CA 2RMKA 4XOIA 4X1KB 4X66B 3ZGOA 4GM1A 1ZNQO 4F1JA 1EU1A 3VPDA 4ZMSA 1JT2A 1Q3KA 1UC8A 2EZUA 1YNSA 2OBYA 3N7TA 4FNOA 4I8DA 2VHJA 3DOIA 1EWQA 3ZKWA 1FFXA 5JXHA 4DA8A 1JR6A 1VFPA 1U6JA 3AI3A 3RS2A 4EHAA 4WXPA 1SBQA 3GI1A 3AR2A 4I9UA 4UZFA 4JN6B 5IFLA 3RC1A 5KTSA 2PUDA 5L3QA 3EXFA 1NJ6A 4J03A 4K46A 4NNPA 5J4HA 1N6RA 3T1VA 5K0BA 1QVZA 1YCFA 2CWDA 3VTZA 5AWFC 3RADC 1IEQA 4F04A 3PEYA 4QLBA 2RGGA 1U5BB 2NO5A 5IJAA 3AVWA 3V5NA 4IICA 1QTRA 2O8FA 3PQ4A 3N2GB 4N6NA 4D9HA 4WLFA 4BV8A 5AVXA 2LW7A 2OCBA 4IOMA 1GEGA 2XBLA 1Y1RA 3H3JA 2M6SA 3KEGA 3OX1A 2MDTA 4LRTB 2VPIA 3JAMA 3N2KB 4BB0A 3FKSD 2HSEA 3GRFA 3O95A 2F3PA 3JQ7A 3PC8C 4KVGA 4CT4B 2I3BA 2UDPA 3OY7A 5IKXA 5EA2A 4DNQA 1NF3A 3CZ4A 5EN4A 1ITZA 4CIXA 1TM5E 2GN2A 2VP5A 5JJ5A 5AVQA 4O4IB 4MYDA 3WA7A 3DZBA 1MO3A 1C4WA 2PGDA 3FSGD 3B5EA 2CZCA 5K8UA 4Q93A 3ZY4A 4Z4GA 4OI0A 1M8GA 4ZK6A 3IVCA 4G1UC 4RZUA 3HA2A 2HFKA 4GLLA 2CMHA 4GR4A 2AUTA 2XHEA 2GAAA 3WWOA 1XNGA 5EXTA 2BTEA 4KQJA 4W8GA 4ZVNA 4L75A 1QDUA 2FMHA 4MWSA 3QBJA 1PSZA 4S1PA 4J91A 3U49A 4UU1A 4L0MA 4PHFA 4TTIA 5D3KA 1R6XA 2E6KA 1WX1A 1AF7A 1HLFA 3HXTA 4GBJA 4PFSA 1JMKC 2ASVA 1WETA 2ZG6A 3ZWDA 1SXIA 1CY1A 2BDEA 2IUSA 1C3XA 3K6SA 3AH8A 1P9LA 4M0UA 5AJUA 1VLLA 4KTVE 1IK6A 1H2EA 1GFIA 1NBAA 1ZUNB 3EXEB 4DTIA 5CVEA 2XODA 1Q16A 1E64A 2O2DA 4BXOA 1E0AA 1E5LA 1A82A 1TLLA 2W93A 1EXVA 5T3YA 421PA 1BIFA 3ZE0B 2WFAA 4K9KA 4YRQA 3OLCX 1T10A 4DR2B 4TXHA 5FTJA 3FLAA 1WTAA 1T3TA 3AG6A 3ZOKA 2HBRA 3V1MA 3KXLA 4YH1A 3U80A 5AVRA 1C0IA 4D8YA 2PX5A 1XDBA 2FSIA 4NTZA 1NNI1 5FUXA 2OGWA 3LX6A 4F3RA 4RA6B 2Y0EA 3M6MD 3VH2A 1KJ8A 2ZJ2A 1P74A 4ZVVA 2EKBA 4K9OA 2I2WA 1CS0A 1ZOLA 4OQMA 4KXVA 4OQYA 2YVLA 3PYLA 5H81A 2BFFB 4TYQA 3I6ZA 1NJGA 3B9RA 3FWYA 1UZAA 1T6XA 4D0GA 1L7AA 1CY4A 4YP9A 3JSXA 1OR8A 4IS3A 3PE4A 3IR5A 4GOMD 7REQA 4N9WA 1L2TA 3N6XA 4P3PA 2IHTA 1GT91 2HHJA 4NPCA 4NYIR 2G09A 1M8FA 3GEDA 4L1KA 1D6MA 5KDDA 1L4NA 5CXQA 1G21B 1H2HA 1NOJA 1RKVA 2BM9A 2EJBA 3DCNA 3G49A 4JVSB 4U9UA 2BZSA 4BNUA 3WL7A 3IIJA 5ALHA 4KDRA 4L9WA 3K2QA 1TVKA 1TYZA 3ND7A 1CP3A 3H75A 2CFSA 2Q9UA 3OTIA 1XRPA 1PJ2A 1OQAA 4MUFA 1ZICA 4PQYA 4AZWA 3T7RA 1GRVA 1PR9A 4YJFB 1PQUA 1F5SA 3IQXA 1QP7A 4GNKA 4GDFA 4L9RA 4LDRA 2P9ZA 1K2VN 3GUUA 4EHBA 4H18A 1SUFA 1NBHA 1P2VA 1U9CA 1YC2A 3GUVA 4TWRA 2IY7A 5FPPA 4F1WA 1XRMA 2PLRA 5IF3A 1Y5LA 1JEOA 3D4OA 3NC0C 3Q2IA 4UC0A 1KO5A 3CFYA 1F3LA 4G8JA 4MVWA 3H05A 3UENA 2Q5JA 4EY7A 3AR5A 1TF5A 4YYEA 3ZK7A 4V0NA 1VJTA 2Q3DA 1H2FA 1JGTA 1GGMA 1LPBB 3AP3A 4JJ8A 1CIJA 3S1AB 4EJ6A 1RCUA 1X6VA 4G0MA 4XUEA 3ZWQA 3NM6B 5DNCA 4J9UE 1UAAA 2ERXA 1P3Y1 1GT6A 3AKDA 4ZAZA 2IS1A 4UNIA 5BV1A 4TLDA 1TEVA 1IBKB 3KYDA 4IUCS 4LVNA 1U7HA 1PUIA 3B9BA 3ROKA 3O0TA 1YA8A 1KS2A 3PFHA 1SBYA 2WF9A 5M04A 2P4UA 1TFUA 4R5MA 1ADFA 1ODLA 2HNKA 4XXHA 5KCZA 4KXXA 1Y3HA 4OQZA 2OESA 2PXHA 4F97A 5JWRA 1V4BA 4BB5A 5FLKA 3DHWC 3QTTA 3PTAA 2HF7A 1XTBA 5AXDA 2KMLA 1TECE 2FEWB 2RD2A 4A4DA 2V4ZA 1OI3A 1UDRA 3IOYA 1BHO1 3DXYA 3P9IA 1UPTA 4IV5A 3SPXA 2WNHA 3HQ4O 1ULUA 3SR0A 3VR6A 3VNBA 4WOKA 4FCVA 4BRUA 3ETHA 1FP1D 3LPLA 1EXMA 1VYTA 2HB6A 4U2BA 4KUGA 3WS7A 2BC9A 4DDKA 1TTQB 1ZM9A 2HA5A 1ZW6A 2VHZA 3DZCA 3QUQA 4X44A 4WLNA 1SCQA 2C20A 3O8QA 2ORED 5HZHA 2AJLI 3CLSC 2VJMB 4C0AC 1MN6A 1Y3IA 2I66A 3W9YA 4B79A 2XCRB 3ONWA 1C80A 1DBWA 2CLIB 2BE7A 3PUYA 4R6XA 2G36A 4BLSA 4QJ4A 2IP2A 3S2EA 4NFYA 4TSKA 3ICOA 4WNYA 1M73E 5CVDA 1VHLA 3Q88A 1R0BA 3PGMA 3PFWO 4WCFC 1AKMA 1XEFA 3L79A 2PZEA 1R6TA 5IJWA 1R4AA 3PYXA 3ORRA 5JC1A 3V4FA 3NAGA 1QYCA 3JQBC 5JTTA 1O6GA 1JHZA 1JEQB 3MGKA 3P52A 4YJ3F 3IUJA 2PZKA 5SYAA 4DV7B 1P2SA 3ZCXA 2WILA 3UHFA 1R0SA 2EQAA 2FPSA 4EB0A 2BTQB 2VJCA 1JLLA 1GCGA 1KEVA 4L8YA 1AUXA 1ZUHA 2DUMA 3NORA 4F60A 1WHSB 2DVMA 3D4NA 4EX6A 5MHTA 1J2UA 3SYMA 2ZAOA 3R0VA 5EKDA 2VDMB 1W73A 3AILA 1G8GA 2O7VA 3L9WA 1B26A 4FZVA 4G9GA 2OWDA 3EC7A 1P8AA 2PGLA 2LCQA 3WLMA 2P8JA 1AO3A 4EATA 4KNYA 5GINE 1QJ4A 3ZIAD 2GHTA 3EUEA 5SICE 3F78A 3RQIA 1NVKA 1U9ZA 3UNXA 4EELA 5CFNA 2O8DA 3WJ1A 3R3JA 1FRVA 1L5HA 1CUHA 2GHRA 2N1MA 5F51A 3RB8A 2PBRA 3O2QB 1JHAA 4RY9A 3BGSA 3RS9A 3UCFA 2IOHA 2C4MA 4ZKEA 2IUUA 4URWR 2F3UA 3UWPA 4L9SA 3BG5A 1I4OA 1XA4A 2YWRA 3C48A 3OF3A 4CDRA 4KMSA 4WASA 4YJGB 1GUAA 3M1IA 1MPXA 5C3UA 5G0WA 2XD9A 1P1HA 3R3XA 5B64A 1BMFA 1TGYA 1WAMA 1MW9X 2YVUA 2ODBA 4XWYA 1N7IA 3JASB 2DXIA 3UG7A 2PL3A 2RGEA 1Y8AA 4DJEC 1P7VA 3H18A 3VYTB 1BN6A 3MBKA 1NIPA 4G63A 4KBFA 4QUEA 3FMOB 3GLGB 2RSLA 2E3JA 2GLUA 1EE2A 1I5EA 5KBYA 5DHQA 1A88A 5J4KA 3P5SA 3TFOA 4UCXA 1U65A 1YJ5A 1N5JA 1W0CA 1YHYA 1UINA 3OD1A 1VRCA 1FMJA 3KQSA 4LGYA 2BBOA 3QELA 2EFJA 4V3CA 4GQBA 4MRRA 1Q7GA 2Q29A 3LDUA 4DR1B 2BGJA 3DE2X 4KWHA 4Q3CA 1EWRA 1LPSA 3DL0A 3LY5A 3NV7A 4B0PA 4MUAA 1PJ8A 3ZDDA 5IDQA 1B16A 4PTZA 3HJFA 1N2CB 2R8XA 3H87A 5AXBA 4M54A 2HLPA 4Z9BA 4OP3A 4KQIA 2FW7A 1POWA 3CJTA 3CT4A 1KNQA 1X9GA 2CW5A 2FWNA 4XRGA 2CY0A 5A0FA 2WBLC 4MHTA 5JFOA 1QF6A 3DF9A 4YRMA 5A9TA 5DYWA 1VMAA 2AK2A 2FFRA 4RWZA 1G9TA 4BNKA 5LVAA 3ER8A 4WXHA 3RYTC 3ZJ4A 2J6BA 2CWWA 3B1WA 2XNDA 4MHOA 1NXOA 4ZU1X 3UC5A 3MLAA 3NW9A 1RXSA 3H5NA 4Q1CA 3RIYA 1RFLA 1UT5A 2VCEA 4G4JA 3C5VA 4F4CA 5JV5A 3GGPA 5J3JA 1U8XX 3FPFA 3QFHA 4PPYA 1M6NA 5DULA 5DYIA 1DGQA 1LRKA 1Y48E 1JDZA 2IEAA 1K7EB 1PL0A 2FRDA 1BRTA 2JD1A 4K8OA 1A9TA 1PR3A 1DARA 4I4NA 4PGFA 4UBIA 1DTSA 2JARA 4H27A 1B23P 3LY9A 3COYA 1A9XA 4PICA 3ASUA 5E1BA 2PL5A 5DSTA 4O0MA 4Q48A 3RC8A 4LDNA 4JFRA 4TN1A 2MYUA 3VTAA 3E23A 1T9CA 3VU1A 1D0VA 1NN1A 4KKXB 1SHLA 3AWIA 5CT6A 1TO1E 5D87A 4DB2A 1TZKA 1YCGA 4J3JA 4KSCA 3H1AA 3CVUA 3R7LA 1SEVA 3ENKA 1SXJA 3IHLA 3KZXA 4EJSA 2XGSA 2WHPA 1W85A 1A5SB 1TA4A 3E61A 4G0QA 4JB0A 4BC1A 2IXEA 2DOKA 3DH0A 3GJZA 2WG1A 4WJZA 5F5NA 4BRSA 3IC5A 2GCPA 5DBGA 4I1OA 3W5HA 1FMCA 5CXUA 1E6KA 1RWKA 2Q4BA 5LLTA 2Y0CA 4J3NA 3OSUA 4LY3A 2B9EA 1X19A 3LDAA 3IV6A 1CVLA 3WLTA 3CWCA 3OPXA 5BSTA 4RKRA 2CXNA 3OAAA 4ZPJA 4X20A 2FCRA 3LZCA 4R9RA 1YBVA 2R6GA 3GH1A 4CTNA 4RHUA 2QUJA 3V4ZA 1J8QA 3MCTA 3CJRA 1KTIA 4P4LA 3F97A 5E4FA 3ZWMA 4C7KA 1DFIA 2QP3A 2RGUA 2W2TA 4PG7A 4AURA 3M5WA 2OP0A 1WL8A 1YZ3A 4IP0A 5CEJA 4ER3A 5H9WA 3Q7RA 4N65A 4AJNA 1XZ8A 1COZA 2QVGA 3LQYA 3DBLA 4TUYB 3JALB 3BSYA 1UC9A 5DV9A 4EUSA 3J7AC 5DNDA 4XTCS 3HVIA 2CMDA 2IF0A 1QG0A 2GNPA 3L6OO 3PFNA 4JHXA 5F9MA 5ICFA 4NJMB 3UK2A 1G38A 3L8GA 3HKCA 4M0MA 5DTRA 4LV5B 4REMA 4RTQA 3O0DA 4GLBA 4F2HA 2ZTVA 5L51A 4ZZ0A 4WZAE 3W5BA 1OWOA 5KZMB 4L8VA 2JLRA 1GAWA 3E3MA 5A0VA 1KAHA 1WE2A 3SFTA 4BJHB 3GLFA 2WM8A 4I8IA 4B3DA 2FEMA 2HWYA 5HJ2A 3NTQA 3WQSB 4X9XA 4UCQA 4FVTA 2GD1O 1B2RA 3L1IA 5JZOA 2E7ZA 1XQYA 4O4JF 3VNRA 3SWWA 1QMGA 3T38A 3UV7A 4RMHA 2P4EA 4CM9A 5IK2A 2AIRA 3AWDA 4JBLA 4TXJA 1DIAA 1KQNA 1RWNA 4FFRA 1NN0A 2Y8EA 1OZFA 3G5MA 4PS1A 2BSQA 3DS8A 1KDZA 3ROFA 2C2ZA 5ALLA 1GTRA 4TLCA 2JFPA 4D25A 5KVSA 2HYIC 2NADA 2VBIA 4NK5A 5EI5A 5AXCA 5CJ2A 4B2YA 3CZMA 4IDAA 3V7YA 2P5TB 1BZYA 3T94A 4F72A 1QZZA 1E89A 1OVMA 2QBYA 1DU4A 1KZ6A 4IDPA 1EGAA 4EK9A 3BDVA 3OM8A 3AQ4A 3HYNA 2B7LA 4H3SA 4H7HA 4BNJA 1D6NA 1Q0UA 3I5XA 1KAEA 1I4EB 2ONYA 1IN5A 2V0CA 4NZZA 4PYNA 4QIHA 5TPWA 1YZHA 4Y1RB 1AX9A 1QOPB 3KXDA 1JDTA 5IJ0B 5K20A 4R01A 2HQ1A 4G23A 1A9SA 1R4MA 5K0ZA 1ENYA 2PO7A 2GPAA 4HQKA 1FFBA 1QHIA 3ANLA 3EGVA 3O26A 3BFXA 3CCFA 3TB4A 3UMCA 3LC0A 4II7A 1ZMXA 5KVAA 3VOBA 2XJ9A 1ATIA 5CT8A 3OE5A 4YASA 4G0XA 4G0OA 3R6GA 3RIGA 3TLGA 3FR8A 2O20A 3TW6A 4CI9A 5HS6A 2EKLA 1AY0A 2WHRA 3EQZA 2EF1A 2V6BA 3EF0A 3FVQA 1SIWA 3JQPA 1V39A 3CNEA 4EYQA 3D6NB 1Y7IA 4XVQA 3IPCA 5TC4A 4TLLB 2EU8A 3NBMA 2I7CA 2FHSA 3EYAA 4KAFA 5EWLA 4YQZA 3A3YA 3CVWA 1OROA 2OGUA 3BHJA 3GDOA 4I9HA 2ZS9A 3N7UA 4G5FA 1VYHA 2NZVG 3ZGLA 1Y5IA 1XKLA 3EISA 2AOUA 3GAZA 4RWEA 1JKJB 4HNRA 2JVIA 2H48A 3RAPR 4ALLA 5IT4A 2TECE 5JEEA 2I33A 5DPMA 2CCJA 4DRYA 3W5DA 1PJBA 5JH7B 4RA9A 2J3IA 3RUCA 2XXAA 4R2LA 2ZWIA 3V6LA 2XWQA 1BMQA 1WQ4A 2QE6A 1MXFA 5HCUA 5CFOA 1I7LA 2XSZA 3AP1A 3MCAA 1A9YA 1E61A 2Y67A 3EEBA 3VNVA 1YZVA 1VP9A 2XCSB 3RS0A 1XXHE 4URHA 5DKFA 3GAAA 3EPKA 4P54A 5IC6A 1NBEA 2RGNA 4LGVA 3TQRA 4EZBA 5E4JA 1XEWY 3TKLA 2VHQA 3BQ9A 1SIBE 2XKAA 4BMYA 4BHTA 1ZHOA 1MKYA 1K3FA 4Y6OA 4ONEA 3HCBA 1IXYA 1IHPA 5CYOA 1Y6GA 1SBTA 2L17A 1CXZA 4ZHQB 9ABPA 1RKUA 1WW8A 2VJQA 4E08A 2I54A 5C7LO 3C1UA 1TA9A 5KHLB 1WVMA 3CKKA 4DR4B 1OYWA 3BFKA 2NYRA 2OBFA 3BKXA 3DMPA 3ZCSA 2BFPA 2H31A 2PR2A 3CS3A 4DV3B 1J5PA 2BMAA 4IDEA 2H7CA 4CL8A 2B21A 2X5XA 1N2EA 1B8UA 3KYIB 1DEKA 1XX6A 1ZGBA 1YR1A 1JFRA 2EIXA 5HJEA 2YRFA 3PVZA 1OU0A 4BEJA 4ZAWA 3C8HA 1ZGJA 1Y7LA 4F71A 4DCPA 1PK9A 1O97C 4C29A 3H5AA 4FFBB 2HJWA 4MV5A 3MGGA 4TZKA 2VNSA 4MLCA 4NAUA 4Q19A 1GTG1 3RFTA 3EDQA 4XR4A 1P31A 1XEXB 2PL1A 2VQSA 3KYJB 4ZO6A 4QA9A 4AJ2A 4CCAA 2VZ0A 1OFVA 4HQ0A 4QDOA 1PJAA 2VJAA 1V1RB 1UEXC 2YHIA 4JKYA 4S0ZA 4RTOA 3HXOA 3JYPA 2VJYA 2VF4X 3DLPX 1NQVA 2LUOA 4LDJA 4E70A 4DSZA 5GWXA 1ZUWA 4ZDKA 4MB2A 3ETEA 2P8SA 3QPDA 1LDEA 2QPLA 4C08A 4MQBA 3WFIA 3VNUA 4JIMA 4ND2A 3H5WA 3GMIA 3TCNA 4QJBA 3ELBA 1KH3A 4NATA 3GRVA 5CH5A 3RVPA 1NONA 3VC3A 3SR4A 2JASA 4ZRMA 2LDXA 3HY4A 1X7ZA 3QSGA 4RVCA 3QEMA 2FE4A 1KRWA 4UASA 1PUXA 2F9FA 4B09A 1ZWLA 5AKKA 4G9BA 3UA3A 4IIYA 3WWYA 2VR1A 2SKEA 3HMQA 1P2DA 4IUDS 2WW8A 1F4LA 1MIOB 3A58B 4KLZA 5I9TA 1O54A 2IBSA 2EJCA 3Q8WA 5MGBA 1XZNA 4IO0A 3BH0A 3I62A 2AR9A 2B20A 1IJBA 4OAQA 1XDGA 4EY4A 1JUDA 2FOXA 2MT9A 2FGJA 3IRVA 4O29A 3KFXA 5FCDA 3VYRB 4BVHA 1JQEA 4AYTA 4BKPA 4EA9A 4CEHB 4J1NA 1FTGA 2CUZA 2FZLA 2HD4A 4W1PA 2HK7A 4F8EA 1XDSA 3OFSA 4B32A 3AI1A 1UFVA 3GZTB 4O4HF 4HGPA 3VI4B 2XDWA 2WD7A 2HA2A 1OH7A 4IOJA 5TARA 1FQWA 1CPYA 1K6MA 3LMKA 2QSZA 4RENA 3F3SA 1BS2A 1J0EA 3L7BA 4Q02A 4TS4A 1JZQA 4CIVA 4PN7A 2FPLA 5EZ6B 4OOEA 2YFYA 3V4VB 2V7QD 3LDHA 4GVLA 1GYRA 1G6OA 4Q7EA 2NUAB 3TEMA 1F4PA 1ECGA 3NTXA 1U9JA 2IS6A 1CUAA 3IAFA 4L4UA 3GJYA 4MUGA 3EVZA 3O8DA 5IARA 4AK9A 3U5ZB 5JNWA 3AOEA 2O6LA 4FN4A 2J3EA 2XDQB 5JYBA 4G8BA 4MB6A 3MBIA 4OH7A 2O3TA 1U5CA 3CT6A 3SZ3A 3JSAA 3B82A 4NENB 4P5EA 3R7SA 2AZ4A 3W2TA 1E9CA 3L4SO 1DMRA 1MLDA 3A26A 2RONA 5GGXA 5DDIP 2ERYA 2NU9A 1PU2A 1JF8A 3ILSA 1CD5A 3TB6A 1YSCA 3ZDFA 2DUWA 3O8NA 5HRUA 2PKWA 3GD5A 5K1ZA 2ZVJA 4BNLA 5C1DA 3A0RB 1SU7A 3T7EA 3VVMA 4MQ4A 4C4TA 1M7BA 1T4BA 4G1FA 4YDQA 1IJEA 4HN2A 1YZQA 3BB1A 4G25A 4LQDA 1OFGA 2RAVA 3Q1LA 2IPXA 4I36A 5KHAA 1U90A 4FSXA 3DP7A 1W7AA 1U2EA 1Y1QA 4G37A 2IVFA 3V3KA 3WJ7A 2R2AA 4P80A 5IDXA 2OYSA 4TVKA 1K9SA 4JYMA 4HLUA 1JWBB 3IBCA 1RJWA 3WBKA 3WQQA 2O50A 3OI7A 4QULA 5AKEA 5LQKA 2V6MA 4D4KA 5GM2A 5TR9A 5DNUA 4XVRA 3K0FA 4AECA 2PRJA 3RIHA 4BKRA 1DPGA 1NW8A 3GGGA 4YAUA 2DZDA 2HSDA 3E9ZA 4N82A 4O63O 3Q0EA 2GCNA 3HU3A 3U31A 1PT6A 2KM1A 3FMVA 2WWHA 2GDZA 5H4GA 4A2CA 4V0ME 2QRZA 3QHQA 2PZGA 3GVXA 1N6IA 4R3NA 4W5WA 3S40A 1ZESA 3K0AB 2D5LA 4NDNE 3B1YA 3LE8A 3ESZA 3ZDXB 3X44A 1Z4IA 4Y6GB 4G1MB 4CNBA 1RU3A 4W9NC 3L4KA 3FIUA 2OG2A 3UJBA 3DEAA 2QUKA 3NFYA 1KK3A 4D0NA 2FX5A 3ZJTA 2HA4A 2OZLB 3G9QA 4PFKA 4GUDA 2XTNA 3FCCA 1X70A 1TT5B 3B7WA 3HWX1 4PPFA 1J25A 3NHAA 2R6AA 2FQYA 4Y2TA 1U2PA 1TCUA 1O7JA 4KFRA 3EMVA 4CM7A 4YP1A 1IE3A 4UAVA 4CXMA 1BOFA 2NSJA 1UC5B 3NYIA 3UGTA 3N5CA 2WTMA 3FWPA 5EERA 1RJGA 3QW4B 1RHQA 3C1AA 4HB4A 3T06B 1KDOA 1PR4A 3G0OA 4FDLA 5DLPA 5EJ5A 1CZOA 2R48A 5M5BA 1R0YA 1G5TA 5DIFA 1PS0A 4OMCA 3DMFA 3HH8A 2B69A 3G9ZA 4N7BA 4JQSA 3T35A 1YR6A 1P4RA 5IWCA 4UNQA 4BEVA 1KDYA 3ILYA 5B37A 2J6HA 2QE7A 3ENQA 2BLLA 2A30A 2OAP1 2H59A 5JAUA 2AN9A 2A1IA 2PFGA 2YMQA 2WUVA 3GMTA 4LJ7A 3S0JA 3WWDA 4YECA 1T4DA 1E2PA 1TCAA 2IYTA 3G2OA 1GUYA 1S2GA 3ILHA 3ZGXA 2ZP1A 4RPCA 7ADHA 5K99A 1RSZA 1PG0A 1MQSA 1MJGM 2ZE6A 3L7YA 4NABA 4YR9A 2FFHA 5AVZA 3RHSA 4S35A 2WJ4A 1ZGCA 5KYWB 1EAMA 1UKYA 3SZMA 4DFDA 1NXQA 2HIMA 1WOMA 4MV0A 2FLVA 2JCVA 2NACA 4OX9Y 1RJEA 2GOYA 2H17A 3E7FA 4MUBA 1M74A 3L18A 3E22A 4G86A 4DCVA 5KYXB 3IQIX 2HX1A 3AOGA 4J0KA 1SULA 1Z45A 2F1KA 2WP0A 3IILA 3UAYA 1ILEA 4MJ3A 3EFOB 2ZI9A 2G72A 2GLXA 3ESYA 5I3CA 3KHKA 2F62A 2PT5A 1NNSA 3HKEB 4BNHA 1ZCAA 2FEAA 2G4LA 3CNNA 3CLUD 1MJNA 4R1PA 1ZI8A 3Q9UA 3BQNB 2H11A 4FQ7A 2QK4A 2JIZA 1KOFA 2W70A 2J7PA 2FSFA 3WWCA 1U0TA 3V7NA 1IPEA 5K7SA 5ED4A 2ZYWX 5FJIA 1YDFA 2BDUA 4G85A 1LPPA 4NMWA 2M6KA 2Q7DA 3L92A 3WMGA 3HU5A 4IMPA 1YIOA 3DPIA 3SE0A 4A3SA 4OK3A 4UOQA 1SC6A 2GK4A 2G4CA 3FETA 4W7HA 4EI7A 4ALNA 5L8VA 5DYTA 5BNZA 5DLYA 5IF9A 2EKQA 5LNK1 1F9AA 3ORYA 2HPHA 1QZUA 2ARKA 1FNNA 1X80B 4AIRA 3LT2A 4GEKA 4M3NA 3I6BA 3CGGA 1YB5A 3KVNA 5CA1F 1KQGA 1UBMS 2P2YA 2EGGA 1JQAA 3P2MA 1FZQA 2EC5A 4BNIA 4QOIA 2UZ4A 1UBJS 2ONCA 4HQNA 1DFGA 2WKPA 5KJFA 4UARA 4NFHA 2O8VA 3KOZA 4DCUA 2UYHA 1UMCA 1WXWA 3A1NA 2G40A 2PFSA 3K53A 2WYIA 5C7OO 2CFRA 4INJA 1GCAA 3BHIA 4AWBA 5LBUA 1L5SA 1L4KA 3BMCA 4PSUA 4AMGA 1Z6PA 1T1IA 4JJEA 3QSYA 3WB0A 2IX3A 1FSFA 1W4RA 2FMXA 1CQJB 1NJSA 2A5JA 4K81B 1QLHA 3TSOA 3GIWA 3D5QA 4EG3A 2I4RA 3GP5A 3UQZA 2PYDA 2FN3A 3F5FA 2ZUFA 5ERXA 4HFRA 1NQUA 1DADA 4QATA 4JXJA 2GEJA 2XCLA 3GT0A 4IW3B 5EZ5A 3PC7A 1BH6A 1C4OA 2CMGA 2HV9A 3I2KA 4F5DA 4W99A 1WEHA 3K9CA 2PMFA 2LPMA 3NHZA 1Z82A 2WWVD 3BFJA 1KO1A 2XQVA 3FY4A 3QJGA 4JBYA 4YAEA 5DZSA 3U40A 3CVYA 3L0SA 4LFCB 3T7KA 1P18A 2V5UA 2C2GA 1E62A 4CLDA 1Y1LA 3E70C 5TIIA 3ABOB 3QXGA 1N2IA 2PH5A 5H7XA 1QOQB 4YWJA 2NUBA 4CV2A 1AD2A 1JYSA 3EEFA 4FCWA 4G01B 2C4NA 2V6IA 3PNSA 2OBBA 4JLDA 1U3WA 2W6ID 1Z4PX 2HFJA 3H3FA 3OOHA 2O3QA 3OZVA 3THYA 1J2JA 1IMJA 1QHHB 4WSOA 3MFYA 2O57A 1MHTA 1OVGA 3NBYC 4RVSA 5DLQC 5LD2C 2B61A 1ORDA 5FFFA 1Z73A 1NE7A 1NYLA 4F5ZA 2X2PA 4YJ3A 4KN8A 1LBEA 3O2SB 2XOEA 4P7FA 4ZVMA 2FFQA 4DMMA 3KWMA 3BTSA 2Q5CA 3HBJA 4J9VA 1QFZA 2VI5A 3QEOA 4WN3A 5JALA 4MQMA 4A10A 4CLRA 3SC4A 3Q5EA 1U0JA 2WYWA 4YUAA 3MXTA 2OV3A 2C03A 3LPNA 3U13A 5KJ1A 2OHFA 4OL0A 4TMYA 4BMVA 3UHJA 4PYIA 3AF3A 2XUHA 3K2BA 4YALA 1A5ZA 1FRNA 2FVXA 4YAJA 3RYIA 4B81A 4Y9SA 1ESCA 1YFLA 1SCDA 3CUWA 4C43A 1AKYA 3C45A 3TZ6A 5LMZA 4HV4A 4ZKDA 3GROA 4BMZA 5CBPA 3QENA 1TI7A 4Y18A 3ZS9A 2BKUA 1I94B 3FZQA 1ISIA 6NULA 5LQUA 3DZ8A 1W5FA 4XJXA 4AJHA 2AFIE 3BA1A 3TECE 5AKIA 1D2AA 2Q41A 1W87A 4YC7A 3SX2A 1J56A 4MR9A 1CF2O 4Z0NA 1RW4A 5HWSA 4KREA 3KWLA 3WIBA 3DMHA 3NHBA 4U39A 2UUOA 4RMJA 2GJKA 4LX0A 5KTOA 2BGUA 2JLZA 1SCAA 1W0JD 2FZVA 2A5GA 4IIJB 2QLBA 3GW8A 1UR5A 3PGKA 2QLJA 3MLBA 1JAZA 1T5DX 5AKYA 4WADA 3D7MA 4Z6KA 1G7CA 2RHCA 2QU7A 1RQLA 1RVDA 1NVGA 1U0RA 3EBPA 4P31A 1GAQA 4JQZA 1TTHA 2ZPAA 1OI7A 5BSVA 2GYWA 3ANTA 5KSZA 4CR6A 4GPZA 4NEHB 5LQAA 2J5QA 1EB8A 4J8PA 4KLCA 3BRSA 1OXBB 3VJLA 5A9SB 2FB9A 4Q3EA 1RVV1 5K8VA 1E1DA 1DQNA 2A9KA 3OKPA 3TD9A 1KEEA 2HA3A 3LO8A 1CU1A 2Q8QA 1EFPA 1XPRA 3P9QA 1Z39A 5HVNA 1A9RA 5LXTB 4I5FA 1EZ4A 5FR2A 5EZYB 3OJCA 2XZLA 5ILOA 3L1HA 1F51E 3RI3A 1L5WA 1OLSB 1YZTA 2GB4A 2GKGA 3Q9SA 4HXGA 1KO4A 5FL7D 3AFMA 4KWCA 1IJFA 2IYPA 3WLQA 4JEIA 3DHEA 3DZIA 4HHEA 3TS1A 4JYPA 2QGNA 4HSGA 3TBHA 1SHTX 3EASA 4FQ5A 2WNSA 4R54A 3REQB 4QBHA 5D86A 1YB2A 4D9MA 5ESRA 2C97A 1D9XA 4RQBA 2DFKB 2DY1A 4X92A 1UJ2A 1ZJYA 2LRHA 4KDFA 4Q9JA 4PN3A 4NCBA 3MPUA 2QTLA 2VHYA 4LTNA 4M1YA 2VLBA 4I19A 4BE4A 1TJPB 1ZK0A 3KSRA 5CCEA 5I9BA 4AQDA 1YDWA 1DKPA 3EXHC 4UFPA 1QFYA 1UQUA 1QGDA 3HVKA 4KE6A 1M2VA 4B85A 2RHMA 1U4SA 2ABWA 3EGIA 1FSGA 3I52A 3K9BA 3TDKA 1Q7RA 1IN1A 4UUOA 3UUGA 3SKVA 2VNAA 2AFIA 4IJ6A 1KS9A 3IHKA 2GCOA 3OHSX 1AK9A 4QXMA 2RKBA 1ELOA 1N36B 2PT9A 1WBBA 4WZBB 1YXMA 3T1YB 1N9GA 4FYJA 2ZE7A 2JCSA 4QPCA 3S27A 4JQYA 4PLCA 1RCTE 3C8MA 1UADA 4QU5A 1HTWA 1NPTO 2DRIA 4UMDA 3SZLA 3WMWA 2HEIA 3QE2A 4DG5A 2EFDB 2E2WA 4MWEA 1FW6A 5JSKA 3HXPA 1ENPA 5TF4A 3N59A 4TS3A 3HMKA 2QYSA 4B1FA 5JYEA 1GUDA 1M1NA 1YE3A 2QV7A 4LJ8A 4DYVA 3EZXA 1J8FA 3V8RA 3ZVMA 2ETVA 4TM7A 3GLIE 4HOYA 3DE4X 1YRHA 3ZHTA 5TMBA 5AW0A 3WE7A 4OUKX 1AQNA 1J39A 3O74A 4TN5A 4ZDWA 2F9LA 4KLAA 1LI4A 5B5SA 2YTZA 5FH9A 1VA5A 3FCUB 4FYMA 4OMFG 3RPEA 4ZVKA 1ZZEA 3OJFA 1SC9A 5ALUA 1ANKA 4ZVPA 2FN9A 3R6TA 2PSFA 3O4JA 3IDOA 4WQMA 3C39A 1RAEA 4F9GA 4LDAA 2AG8A 2QMQA 1UQRA 1L4LA 1UPAA 4FFNA 3QKTA 3A8TA 1KE2A 3QXSA 1P6UA 1LH0A 1P1KA 3HEAA 4GOXA 3WFJA 3TRIA 4CCWA 5DHSA 2YNMA 2WU4A 3M2PA 3CWQA 3PCXA 3W7AA 1W0KD 2E4XA 3QF4A 4FHZA 3G5AA 2QSJA 4L27A 3ZZ0A 1FZTA 2B83A 4TM8A 4LF6B 2F2TA 3WGUA 5BVGA 2PUAA 4NE2A 5C8YF 5LUBA 3MQFA 1E1LA 5KNDH 1ZSNA 3AUJB 3P94A 1S6YA 3TOZA 3DVAA 1J2YA 3N2IA 3FRIA 3HB4X 5TEVA 3I9OA 1KO8A 4P32A 3NRCA 2I87A 3PEUA 4D44A 5HUJA 2H4FA 3HEBA 3O8OB 3A4IA 3GHYA 4FYXA 4IZHA 4RUKA 4WHMA 5EE0A 4TWIA 5G02A 3K70C 1JXOA 4TYPA 3CLSD 1IBRA 3W3AD 2Q3EA 3WYBA 5KMGA 3KJFA 3SYTA 3WLNA 2IPMA 4FE7A 1AXRA 3KTDA 1VFNA 4K03A 4BRWA 4D74A 1OH8A 4KL8S 1OZAA 5KDOA 4FKBA 4F92B 3NP9A 3ELDA 2Z2IA 1HE4A 2VSYA 3DPSA 4QREA 3A31A 5FWDA 4O4JA 2QRVA 1TF7A 1KEZA 3HP7A 2ZI4A 3A1VA 4UTXA 1KI8A 3CX7A 4EG8A 3L1UA 3BL6A 2I91A 4BO5A 4F3TA 1RKBA 2C5SA 4PG6A 5TSDA 1BGXT 3JQ7B 3IR7A 4IOKA 4EHIA 2EQBA 4HNTA 4K8RB 4MYT