3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
1GA1A 1THMA 1TO2E 1VSBA 1BFKA 4B5LA 2X8JB 3P5BA 3WIUA 2DP4E 1GT91 1DUIA 1ST2A 1SBNE 2WV7A 1GTG1 1WMEA 1R0RE 3QMPA 3DE2X 1ZVJA 1PJ8A 1AVTA 2W2MA 1SUCA 2WWTA 2DUJA 4H6WA 3QTLA 2G4VA 3A3PA 1BFUA 1P7WA 2ZWPA 3SICE 1MEEA 1TMGE 4RYDA 1SUDA 4I0WB 3VV2A 1Y3DE 4LVNA 3A3OA 1KDYA 1V6CA 1AU9A 1AH2A 1SUEA 5JXIA 1SH7A 2PWBA 1BE6A 1SUBA 4AKTA 1SBHA 3PRKE 4NMXB 1R64A 4OMDA 2QTWB 2XTJA 3WHIA 1OYVA 1BJRE 3VHQA 5JXGA 4M1ZA 4KG7A 3AJ8A 2ST1A 3EIFA 4CFZA 4FONA 1C9MA 1CSEE 1DBIA 2PYZA 1WMFA 1S02A 5CW1A 4HX2A 3OSZA 4NE7A 4YN3A 1T1EA 2ID8A 3H42B 4OV6B 3EDYA 1WMDA 1GNVA 1SCBA 1SVNA 5I9SA 1Y3FE 4HVLA 1KDVA 3F49S 3BPSA 1KDZA 3WIVA 1KE2A 2V8BA 3SQOA 2ZWOA 2Z30A 1AQNA 1SUAA 3VV3A 3L1KA 2PMWB 5AVJA 2ID4A 1GTJ1 1TM4E 5K7SA 1BE8A 1Y3CE 3I30X 3AFGA 5ARCA 2IY9A 3EE6A 4WOCA 3DE6X 3GCXA 1GNSA 1HT3A 1BH6A 1NDUA 1Y4DE 5AQEA 3DYBA 1A2QA 1SCJA 1TO1E 5FFNA 3TECE 1IC6A 4OMCA 2W2QA 4LVOA 2PQ2A 3DVSX 1P7VA 1SCNE 4GI3A 2Z2YA 1GTL1 1Y9ZA 1PEKE 4CFYA 3VSBA 2Z56A 2W2NA 3CO0S 1TECE 5ARBA 3I34X 1T1GA 5AMXA 1SIBE 4C3VA 2PWAA 5B1EA 5JMOA 3GT4A 1TM5E 3DW1X 1SCAA 2W2OA 1Q5PA 3T41A 1ZVKA 3DDZX 1MPTA 3UNXA 4DJ5X 1EGQA 3VYVA 1ST3A 3LPDA 4C3UA 1EA7A 1YJBA 3DVRX 5FAXA 1TM1E 4H6VA 3DVQX 1SBIA 1P8JA 2SECE 3AJ9A 5SICE 1SIUA 1GA4A 1SCDA 4J94A 1GA6A 3I2YX 3DE4X 3DE0X 1SBTA 1AV7A 3PTLA 5JXHA 3LPAA 1JEAA 1Y4AE 2HPZA 3A3NA 1KE1A 1Y3BE 2P4EA 1TK2A 3DE7X 4ZOQI 4WOBA 2X8JA 3BX1A 1S01A 3DW3X 3TI9A 5AVKA 1TM3E 3TI7A 2Z57A 1C9JA 4AKSA 1YJAA 1LW6E 4ZARA 1Y48E 3DE3X 1Y33E 2E1PA 4KPGA 1C9NA 1R6VA 1SBCA 2WUWE 1S2NA 3QFHA 2Z58A 3WQBA 4NE9A 2Z2ZA 1T1IA 1SN7A 1SUPA 5JXJA 3Q5GA 1IAVA 2HD4A 3VTAA 1PTKA 2Z2XA 1UBNA 3ZXYA 3CNQS 3D43A 2PKCA 2GKOA 3DE5X 1CNMA 1YJCA 2SBTA 4Z2AA 4BWGA 3BGOS 1NDQA 5B1DA 3Q40A 3I37X 1YU6A 1V5IA 1PFGA 2XRMA 1WVMA 1AF4A 2DQKA 1NLUA 1AK9A 1SIOA 4DZTA 4DWWA 1WSDA 2TECE 2ZRQA 2WUVA 3F7MA 1TM7E 3ZXXA 2IXTA 3D9QX 3F7OA 1SELA 2W2PA 3DE1X 4H6XA 1OT5A 3LXUX 4JP8A 1OYOA 3GT3A 1GCIA 4K8RB 2PRKA 5FBZA 1SPBS 1Y34E 4KB5A 4CG0A 1C3LA 2SNIE 5ARDA 3GCWA 1XF1A 1Y1KE 4MZDA 2B6NA 3DWEX 2SICE 3HJRA 3LPCA
chains in the Genus database with same CATH superfamily
2I6TA 2FSSA 2V7QA 4Z0NA 4KR7A 4IDCA 2PKWA 2FMUA 4K0KB 1U0EA 5F33A 3L1VA 1XX6A 1L4EA 2ZSAA 5GTDA 1T15A 1YA6A 2C31A 1FF9A 4AKGA 4LJSA 3FE2A 4DLKA 2F62A 1HSOA 2OB1A 5FPSA 3DL2A 4FX2A 5HFNA 3ZCUA 4F0JA 1JB9A 5KTNA 4QYTA 1K3UB 5BSTA 4J0GA 2EFYA 5AHOA 1M5RA 2HRDA 1TU4A 1E8NA 4KQ6A 2CEAA 2HNKA 3OHPA 4XUGB 3EA4A 3T7RA 1RVDA 3HLKA 2FR8A 3HQ4O 1CY1A 4I9NA 3U4DA 4BC1A 5BR7A 1WEHA 4EHJA 3SXUB 3BWCA 2XI4A 4KWCA 4POOA 3AFIA 2X0RA 3CUEF 5DEOA 3UK0A 2V55B 1NI4B 2C4UA 2Z4SA 3TPZA 4E94A 5FBKA 3B3GA 9MHTA 4EK9A 3DKRA 2SHKA 4XYMA 3FMVA 3KKPA 4LZPA 3UFBA 1TA9A 1ZD2P 2JS7A 4DF3A 5HTOA 3DQQA 4ZVQA 1FFCA 3VPHA 1W2HA 4FEGA 1T2FA 5BMVB 3C87A 1KVTA 3NFYA 2Z8YM 4FIZA 3ZWVA 1EQ2A 2HMUA 5E0KB 1X7WA 5DLYA 1RZ3A 2C9DA 4M6WA 1RP1A 4W5QA 4DQLA 1JPJA 3A6EA 1IB0A 5BOSA 3QELB 3H9QA 2OORA 4RFSB 4UAUA 3SHVA 2GZDA 2YJTD 3Q5DA 4AXBA 1PJ3A 3LOQA 2PUAA 1GWNA 2QI9F 4I8IA 1A8IA 1TQ8A 2V4MA 3NDJA 4ZVMA 1Z34A 4IQGA 4MI3A 4U63A 3HDVA 4O0MA 4RJIA 4ZAWA 5BOVA 4AJEA 3QX7A 4N3NA 5JROA 1JLHA 3MYRA 3H3XA 4TLDA 4EA8A 2O8BB 2QTZA 1BCRA 1KK3A 3C3WA 4KDRA 4R71A 1M67A 2AKYA 2YS6A 3S29A 2QLLA 2H0AA 2VXOA 2OXTA 2PV0A 2R84A 6NULA 1U6KA 1V6CA 2HBZA 2AMFA 4QL3A 3NHZA 1UBTS 4U2BA 5ALDA 4TLBA 2OKCA 2OXIA 5JH7A 3SQWA 1L5GB 2XUOA 5GGXA 3BRWA 4IRXA 3LT5A 1X1BA 3S68A 4Y7CA 1C0EA 1A4IA 2FI1A 4NCAA 2XEXA 2WJIA 4PX5A 1SC6A 1AB6A 2B8NA 3FUTA 1XDZA 1JAYA 1D1PA 1Q2UA 2A78A 1C7JA 3OH8A 5JISA 4N9QA 5K0EA 1P44A 3NIBA 3CNLA 5T3YA 3EXHB 4YALA 3IXMA 3PRKE 5C52B 1KAQA 4L73A 3T8YA 3K70D 2BI8A 1WY5A 2QZZA 3EGDB 5K8CA 1XZAA 2GD1O 2FWIA 1S9HA 5ECWA 2QZPA 1DEXA 5JV5A 4ZI2A 3AVPA 2UXBB 1CNEA 4E1VA 1QPGA 5HEKA 4WINA 1DTSA 4HB0A 4LYFA 4TVBA 2PT9A 2FJPA 3E9RA 3D7SA 3KAJA 1V47A 4LXGA 1YQEA 1RVV1 5JXGA 1MZVA 2WM8A 5EMHA 2VSFA 3FKQA 1NF2A 2MR5A 1SU7A 3HSKA 2RB4A 2ST1A 3L49A 1KJ9A 4D98A 2C3OA 3AVXA 4MR7A 1KEVA 4GECA 4GMFA 4N39A 3MZ0A 4RTJA 1MRNA 1C9MA 1UAAA 5F7JA 3DDOA 3N7AA 1RBYA 3EXEA 3P4XA 1N6RA 5JBQA 1I3CA 3OQIA 5FULA 3B1VA 3WSTA 2OV3A 1SBYA 4X6XA 2BDEA 1O5IA 5EIFA 1MJNA 1W4BA 1FTYA 4G4SO 5FYQA 2H59A 1XD2A 1NX9A 4WOJA 1L7PA 4HWKA 2G6BA 4JBIA 5ALJA 4YN3A 2BGRA 1PEYA 4LHSA 2ZIEA 3SBEA 2JH9A 2GAIA 5ALTA 2Q9UA 4PFSA 1VMEA 3RS5A 4XFKA 4BFCA 4B7ZA 4ZQBA 1YMQA 3T7DA 3SBXA 4G26A 1F8YA 2G9NA 4PW0A 3FVQA 5L3QB 4U2EA 3G2MA 4OLJA 4ILKA 3FCOA 2GEJA 4MCAA 5AFSA 2XDWA 1PK8A 4JB2A 3CUVA 1CLUA 2IRWA 1FY2A 2RG1A 3KT3A 4NL4H 3EDMA 3OWOA 3FYUA 3DHYA 3OPYB 4EQ6B 5LXTA 1J2JA 2H7XA 2ZB8A 3WB1A 5TLSA 4CUKA 1AZLA 1UJ4A 3KQLA 4WESA 4OFZA 5LMZA 4KWTA 5CVUA 5J2TB 2JZCA 4HAWA 1KSGA 3FMIA 1I32A 4JI7B 1DFHA 5KDDA 1IBCA 3BZWA 4HN9A 5JFOA 2WAMA 4R4JA 2HF7A 3O3MB 1I7QB 1WA5A 1XLUA 1OFUX 1UBHS 3OY7A 4MVJF 4UEWA 3SK0A 3ZBQA 2HNAA 1TJ3A 2Z8ZA 2VS1A 3V32A 2XOKA 3ETDA 3R3JA 4PLCA 5B1HA 5FWYA 3IXQA 4PSDA 2PBZA 2WD7B 1JNYA 4CV1A 2OO5C 3QYPA 4E2YA 3JQ7A 3RRXA 3M8KA 2XMPA 3GHHA 3UO8B 4B45A 1H23A 2DBVO 2HNBA 4JJIA 1WQ1R 3GK3A 4KFSA 3C15C 3FVWA 4PPFA 2BAGA 1QIMA 4UFNA 1SC4A 1U04A 1XQWA 2FZGA 3HEAA 1H6CA 1M34B 3T9AA 3JQ6A 2GD6A 4FOSA 2AC7A 3NR2A 5BSGA 2J0QA 2XGJA 3OCZA 2GJ4A 1RCTE 4KO8A 5FLYA 2ZUDA 3B2QA 3C4JA 2DT5A 1BWRA 3GNTA 5J63A 3N8GA 4XB2A 2I1QA 4OHPA 1W1UA 4HTFB 3K1JA 4LOIA 3GI1A 1SURA 2CHEA 2VAXA 1DQNA 2PPLA 1NM5A 5LMUB 1SHTX 1TO1E 3TECE 5KYXA 5IARA 1ULHA 5CR9A 3TK1A 1EHIA 2ZE8A 1LFAA 3ZWOA 4FQ5A 1S0UA 5H3CA 3F98A 4QEKA 4PLWA 4EY5A 5JTTA 1UFVA 3HXKA 2RFLA 1K66A 1TIKA 3K4HA 1T26A 4Y9UA 4HPWA 3RK1A 3AONB 1T36A 1VFNA 4RHUA 5IPFA 1XZGA 2Q41A 3DB1A 4WCFB 1XWWA 1U99A 1SG6A 1E7YA 5LJIA 4CQNA 4FKMA 1N6NA 3QBVA 4IL5A 3NT4A 1TM2A 3C5WP 2RBKA 3OFNA 2ARKA 1MVLA 3ETLA 1H2FA 3FSGA 3NP9A 4GXNA 4D4JA 4XVQA 4ZVUA 2RHMA 1A7UA 1RJ9B 2J3EA 4MV6A 4O08A 4X92A 1E3QA 1KOJA 1P7ZA 4JB0A 3F6SA 5E4FA 5BN4B 1OZAA 5KOHB 3WNZA 3Q41A 3JQAB 2YXPX 4BVEA 2J7KA 2YWRA 2BSQA 2A84A 3ONDA 2HWYA 2JARA 5CGZA 1BDIA 1SOVA 4CL0A 4P36A 3RFXA 3TE7A 3SFZA 1USUA 4EVRA 5IJWA 2QD3A 4DUYB 4BMNA 3T9DA 4O25A 2CUZA 2ETXA 3KOYA 3EW9A 4Q3BA 1VLQA 2W6IA 1MJGA 5LP6B 2LR0A 4LQCA 2WU3A 2ZBRA 4N3BA 2NVUB 4HDKB 2R1TA 4QGGA 2YWXA 4N54A 3EGEA 4R68A 3FJ1A 1VPWA 3PQ3A 2VTVA 4ZJUA 3LX5A 3H87A 3TKYA 1OMOA 2QGFA 3EG5A 2D54A 4NMMA 1EFUA 3B38A 1U7WA 3CRRA 3ONFA 4IDEA 3FWNA 5EE9A 2YV4A 1L4YA 3DDNA 2WE7A 3O73A 1YR8A 4K86A 2VDUE 3N2NA 3IT0A 3BDVA 3L40A 3SEAA 2QV7A 4CLHA 4DYVA 2M2IA 2CFRA 5A5EA 4D79A 1ZM9A 3DVRX 1IRXA 3PTZA 3CKLA 3TIGA 4EATA 2IH5A 1QO0A 2H85A 3QIAA 4YMVA 4HPJB 4PINA 1A2OA 4J43A 1AN0A 4HMOA 4Y67A 2DY1A 1MFPA 4CIBA 1T5OA 3H16A 3LC1O 2G08A 4CMGA 4G23A 1HPLA 2Q3MA 4C2TA 1AXEA 1SBIA 3G8CA 1E4YA 4IMPA 1G16A 3F78A 3NBAA 3PI7A 4ODIA 2FRXA 1FMLA 1O95A 5JD3A 2YYAA 4EY4A 2F8SA 3UAVA 2BH2A 1YSCA 1UEJA 3V55A 2CL6X 1P1BA 1YTLA 3K0CA 4DT1B 1NOIA 1Z15A 4PE5B 4XUEA 2Y1LA 4TLCA 4ITRC 3KZVA 3STVA 5DNEA 3VR6D 4KITB 4JC4A 5AUNB 3U1BA 3A3NA 5JSKA 1N0HA 1U0OC 2NPOA 2WTMA 3EPRA 3LF1A 1EBFA 2R6HA 4S0ZA 5B1SA 2QN9A 3TUJC 4D9MA 1PYGA 2P4EA 3E70C 3EARA 3R1IA 1CQIB 1TLFA 4HDSA 3EEYA 4UAGA 5MGNA 5GZ1A 1O6CA 4YB8A 3ER8A 3VZRA 2MSCB 1M75A 1L1EA 2H1FA 3LI2A 3UQZA 2VNKA 2I67A 4NYMQ 5BPHA 2OHJA 3ZY4A 3DV9A 5KJCA 2IITA 3BX1A 1WZCA 1LB1B 3L06A 3W05A 4JUBA 3BTSA 3JASB 1DKMA 3ZJVA 3R3ZA 5LOVB 2WABA 3INTA 4OGGA 4P3NA 5C8YA 2C00A 3VTZA 1GTZA 2J9FB 1UMCA 3QNUA 3C74A 4S35A 2B0CA 3MWEA 5JYBA 2CHGA 2FZ4A 2HRQA 1UP4A 5C4GB 3CCFA 3RU2A 2HADA 4MB6A 4OGKA 5K3AA 1U9IC 5B4TA 2QX4A 4UNPA 5FOVA 3N7UA 1KKMA 1KQPA 3HFRA 4OH7A 5HJEA 4N03A 5CLHA 2OGTA 1X1SA 1Y6FA 2B4QA 1NG9A 1YUMA 3F74A 3FOAA 4R1UA 2O54A 5TMPA 3EBOA 2XTMA 2QROA 2FGKA 1UMDB 2IUFA 3A1FA 1CUCA 5AJVB 3P19A 3W5UA 4AM8A 4C78A 3O8RA 2ONJA 3BXXA 1C7ZA 2P4SA 4CYMA 3C2QA 3ECSA 5DF1A 5JOQA 3EB9A 1G6KA 1TJ5A 3NP7A 1JHVA 2FZCA 4HGQA 3QFHA 3W1WA 3WQBA 1G60A 1VCOA 3JALA 4XRRA 3P94A 4M38A 2EWWA 1XMXA 1XL1A 3AUAA 4X85A 3FKJA 1A71A 5HIKA 5EZYF 1K7XB 2PX8A 1VB5A 2XT6A 1I4OA 3DNPA 3LP6A 4S24A 1F14A 3QEMB 3W5HA 4BO1A 5EIXA 2QR2A 5CU7A 1RT9A 1BC5A 1PNOA 2XCUA 2QEQA 1U8ZA 1V41E 2Y66A 3LK6A 3NAGA 4NBNA 2NZ2A 3VTAA 5DW3A 2WF9A 5BQXA 3P9PA 1XELA 3UJBA 4XPZA 3LL4A 4ER5A 1BDJA 3VPGA 5KTPA 1JMYA 3BTOA 1XTJA 2IYVA 1I1HA 1PLLA 2GKOA 2TS1A 1OHHA 2B8WA 1U2EA 1LA2A 3HR7A 4DGQA 1E6UA 1JH8A 621PA 3NS7A 5JPDA 5TV2A 1FFAA 1V4BA 3C41J 4NCJA 1UP6A 5CB4F 5I9LA 1Y6ZA 2W0SA 4LNUB 2Y2VA 3KSRA 2WEKA 2BKEA 1M2NA 2JIPA 3A9TA 3QOFA 3G7NA 4MQ4A 3FD8A 2WSSD 1YT5A 4I50A 5KKNB 4N4AA 1N8NA 3AY6A 4F5YA 4I5FA 1HBJA 2GAAA 1L5FA 2B0JA 3E23A 4DBLC 1TTTA 4FFWA 3UAXA 2YV1A 3AEYA 3IVCA 4TOIA 1ZR4A 1RYFA 1H2AS 3D4OA 3RDPA 4Z4HA 2OC4A 4RKWA 4NQZA 5DBIA 4C05A 1AK2A 4DLZA 1ZC4A 5CT4A 1VKZA 3QUQA 5HK9A 1O0CA 1GPNA 1YHYA 3GPIA 3G2KA 4LJ9A 3PDHA 3SIRA 4O4LF 3TRJA 3H1EA 3DTVA 1F6WA 2CNBA 4IS2A 2V5VA 1AK9A 1SIOA 4RVNA 1R4ZA 4POAA 3REGA 1ADBA 1FSFA 4PAOA 4KRXA 1NQUA 1E5DA 1P81A 1XYVA 3AXTA 4K3UA 2FVYA 1YBVA 4K9OA 3H8SA 3U7QA 4WBNA 4DQKA 1QNLA 2D1FA 4AC9A 3AVYA 3GB9A 2G9RA 3AJEA 3AFNA 1C1XA 1WS6A 3FTPA 2ZI9A 4J9UE 4IFIA 3W5VA 4BNIA 2AXNA 4YRKA 2C4MA 1N5DA 2R62A 1LQ2A 2OK7A 2X4DA 3WKBA 1JIIA 1K6JA 5BV2P 4CEHB 3C6YA 4UEOA 1YCFA 5G1PA 3STTA 3VHXB 5AK4A 1SU8A 4YP9A 3ZKWA 3K6SB 4V0ME 3E35A 2VP9A 1W87A 1ZOOA 2OD7A 2D4AA 2G88A 2HTFA 1Q92A 4WY2A 6LDHA 2PN1A 1U0FA 2QT0A 3BEDA 3OT4A 4DWOA 2CDAA 3D54D 3UMVA 5I4KA 3QWAA 4R16A 1GCIA 4JWKA 4L1KA 3C7KA 1SVWA 4I6JA 2JF0A 4C0KA 4GP9A 4IG9A 4HF7A 2QRVB 2P4HX 5ALGA 1B0PA 4M8KA 3W2IA 3ZX4A 1E96A 3PDIB 5I45A 5HTKA 2ZYUX 1K0FA 3RVLA 1QZXA 3W2FA 3A4TA 3HBJA 1GKYA 2ACWA 2FFQA 1E98A 1UXHA 3AHFA 1GG2A 1UOPA 3M3PA 4DBZA 4RTLA 2QJFA 3WR5A 3WDMA 1QGZA 1JXOA 5EPUA 4HZUB 1Z5PA 1B6GA 4P38A 5B1EA 1AE1A 2DM6A 1KI1A 4K7JA 5GJVC 4B6JA 4HDMA 4UVHA 2EJWA 4A26A 1FRFS 2GEBA 4G3XA 2YNMA 4R2XA 3FG9A 1R6TA 4B5LA 5BSHA 1FJXA 4N3GA 4CQLB 3EZ9A 3PFIA 3WVNA 2KLBA 3RRZA 1Y9DA 1GR1A 2FE4A 2H08A 4D8WA 1P74A 2ZBVA 3LFUA 1CEQA 5CJPA 4KHPB 4X8MA 3KYCA 2PGJA 1J1UA 3LBNA 4RDCA 5KAPA 3QF4B 3BF7A 1SVSA 2IZ5A 1QHEA 2P6RA 1HUQA 3RIXA 4KR6A 4CMBA 3MFYA 4RESA 2YV5A 3G1UA 4DG9A 1WUJS 3P9YA 1CE8A 1VG9B 3GLFA 5JJIA 5IMSA 4DV5B 1KQGA 3G89A 1J2UA 5CUQA 1FOEB 2CLSA 3K94A 5EHXA 4G09A 3O8QA 3QTTA 4YJGB 3SF8A 2ZIZA 4C9BA 2EW8A 4DJTA 3GT7A 1YJXA 2OAEA 2C9CA 4Y2QA 5BQPA 5KI6A 3ZHCA 1DBQA 1DQPA 1GAEO 5DYIA 1X38A 2O1SA 1PZHA 2H4HA 3EIWA 1TU0A 3UMGA 4QKQA 1E1NA 3NYQA 5HFAA 3T52A 2WIDA 4E5SA 1J5PA 3IQXA 2WKSA 1F2VA 5AR1A 1NXQA 1QAQA 2W2TA 3VVBA 4UJ5A 1CR4A 2RJNA 3IIJA 1II0A 3RSHA 1X8XA 2IYLD 2XXBA 1E7QA 2YJNA 1HE2A 2A9PA 3R3WA 3QHQA 2XWJI 2FOIA 4X7MA 2A0WA 2ODBA 1MO6A 4W8OA 5CYFA 4FLFA 1HDRA 1QGUA 3MAGA 4LXYA 5LN1A 1XTUA 1NUTA 4BJ5A 2NU9B 5ALKA 3ONEA 5ILGA 3RVOA 4CLEA 4EJSC 4I0WB 5HIAA 1E99A 3TSAA 1YVUA 3SQXA 1P3JA 5TS3A 2YQ4A 3NTQA 1DADA 1N9GA 5AHXA 3QVSA 4F5DA 1NASA 4QTUB 4MXDA 1CP3A 2P7IA 4C0HA 3EFHA 4C4XA 1HMPA 4ER3A 1QYDA 3KK0A 4IIUA 3VNSA 2XYHA 2IU4A 3E22A 3RFVA 4G1UC 1LX7A 3C3CA 3GLKA 5FBHA 4RK5A 1U2PA 3GW8A 4RVFA 3A11A 1CETA 3BS4A 5CLLA 4YCCA 1EVLA 1AJEA 3MK31 5B36A 1OC4A 1DPGA 1JFVA 1L8LA 1SCUB 5FA5A 3AF2A 2PSSA 1Q6YA 3OQOA 1DC5A 5E6UA 4AS3A 2C2ZA 4Z4GA 4CJXA 5F1YA 3H1TA 3H65A 2GSWA 5JSYA 2CMKA 3K6JA 4U02A 2J09A 3SQNA 5CT6A 4EENA 3A2MA 2VTBB 1E3JA 2IU6A 3CZAA 2DBRA 3JSXA 3JYLA 4KH1A 4U3JB 5AVOA 1B0AA 3F6YA 4ES6A 1YO6A 1RKBA 2ODAA 2P3LA 1NMYA 1G6Q1 3JD2A 4FP9A 4I1IA 4XR9A 1KYQA 1B4DA 4F71A 5A4AA 4G0UA 1YNOA 3EIFA 2OQVA 1OAKA 2WVJA 3R5JA 1CRZA 5K6RA 1E3TA 3TTYA 4XQGA 13PKA 1IM5A 2BFCB 2C4VA 3FNEA 4X0EA 4CMIB 3D3QA 3WISA 3ZQ6A 3B36A 1EJ0A 1A9YA 1PTJC 3I01A 4E4TA 1MIOB 1SD2A 4H3HB 1B42A 1PVDA 2YS7A 2BFPA 3I9OA 2WVAA 4KKVA 5DM2A 2PNJA 3W8DA 3ZNNA 3B52X 3ZK7A 3BL8A 1EVZA 2C4WA 4YRSA 4Q18A 3AGQA 2B2XA 4IDGA 2XBMA 1JIKA 1IONA 4I1RA 2WJHA 1C1DB 1IZZA 1S3GA 2WT4A 1INLA 4G4SP 4LWOA 5E1DA 5A62A 1YQGA 3LWNA 1MAVA 4QQKA 4KQ1A 3PNYA 3ZDAA 3W34A 3IIKA 3TX6A 3D6MA 2RARA 5CBPA 3OX2A 2HMYB 2YRXA 4GC9A 3SEQA 1JHXA 3LDFA 3JD4A 4BLQA 1P2BA 1ZVMA 2AE2A 2I6SA 3FTEA 2XCSB 3ELBA 1YZGA 3WV5A 1X1EA 2X2FA 3HV2A 4QXPA 5JZSA 2V8BA 5LA6B 1PX2A 4FYMA 4JHXA 3RTDA 1T9ZA 4R8SA 2YXBA 3NAMA 4FZVA 1MO3A 4NBLA 1A5BB 1ACJA 4HWPA 3VZCA 2XAAA 4FOTA 5TSDA 1AQNA 1YL6A 4BXOA 5BVGB 3MYYA 5GM2A 5BQ5A 5IH3A 10MHA 1QNFA 2XUZA 3FN4A 2R8PA 3BICA 3Q9SA 4RQTA 4UVDA 3CUUA 4G0YA 3PUHA 2WFZA 2WJYA 1BNCA 4QVGA 2FMIA 2H9IA 4YASA 4J2HA 1FZTA 2ID4A 4FZRA 3F7TA 5DHRA 4Q39A 1KBQA 3QG5A 2ZUTA 4GG1A 5HE9A 1ECCA 2XXAB 2QPLA 2ZIXA 4UHBA 4F3CA 4PGHA 1NAHA 3ZLBA 1PT8A 1DNPA 2QLBA 3DC7A 1KYYA 1Y80A 4RE5A 2CLLB 2LRHA 4XSVA 3TAUA 5J23A 1BA3A 4COKA 3FMOB 5M2QA 3QKSB 2GTIA 1YAHA 5JS2A 4CRWB 4DNQA 2EC5A 4LMRA 1BAPA 2ONKA 2X2EA 2L69A 1XAIA 3WY9A 1RABA 4P3PA 3RROA 4FBLA 4LRXA 4CM1A 2FHSA 5AESA 1BX3A 4V03A 3OIUA 1Y4DE 3IESA 1YB5A 3OE4A 3PR2B 4RVOA 3EAGA 5KHAA 5JJBA 1X7ZB 2DPYA 1TX4B 1NBIA 2C77A 3BDIA 1K1EA 3H4VA 1NGSA 1T4MA 2DHEA 2H2FA 2WHRA 2B4KA 3AV3A 3MJRA 3NHRA 5DI9A 4AF7A 1Z5OA 3OZGA 4ARZB 4MW0A 1H4TA 2K2QB 5THXA 4ZIRA 3HP7A 1X74A 3F6PA 5ALYA 4YR9A 5KS2A 3OEHA 1UBSB 1G8SA 2WG1A 4BNDA 4ARIA 3PLAE 1G1MA 1CP2A 3OA0A 4Q3KA 1JJAA 2AEFA 3ESAA 3PFGA 4FR0A 3HU3A 4L28A 5TGTA 1PL8A 5A3SA 4AU1A 2NXJA 3IHTA 4HLNA 5EE1A 2R8ZA 5A0VA 3B1FA 5EJ9A 2KBEA 4A91A 2QGZA 1SXIA 2ZE7A 1EEXB 3L2OB 1IDN1 9LDTA 4FFSA 4RD4A 2HDOA 2I9PA 4Y6GB 4F84A 2X8LA 4D4MA 1Q19A 2YJ6A 4R2MA 3ZWWA 4ZTBA 3QRWA 1CVLA 1WCIA 1S3IA 3QOYA 2IWRA 1H3NA 3W6OA 4D5EA 2QW1A 4IS3A 2EWMA 3HCNA 3TEJA 4IFBA 5KINB 3U7GA 2UVDA 3BK1A 2Q6IA 4ETMA 3TCKA 4B2IA 5DHAA 1SD5A 4GBJA 4QX6A 5CX1B 1WKBA 3PUZA 4B46A 4BNMA 1UCFA 5CEEA 4EUEA 4AKHA 3KIPA 5CDHA 5JMOA 2NSJA 4NH4A 3QI2A 3SOZA 1QYCA 2O3JA 3CE6A 5LBTA 1J7KA 1CLEA 2OPBA 1ZDMA 4EHHA 2OWEA 3DV0A 3RT9A 4GI1A 1HQDA 2YW2A 3JQAD 4QWWA 3OAAD 1WPRA 1S2OA 2V9ZA 1YIAA 1NW3A 1TYCA 4OU4A 1HA3A 3QY0A 4HYTA 3ETGA 1KEWA 1QG4A 4X1KB 4O29A 1F6BA 5C8DA 1AS3A 4HRXA 4ENQA 3NHJA 4JEMA 1EE1A 3NBXX 3NBYC 5EWMB 3DCJA 1KI7A 1ST3A 2BEVB 1EUDB 5EGNA 4X3OA 4XWOA 2JFZA 2QMUA 4ZZ3A 2BGJA 3FMGA 4CR7A 3S5JA 4RD0A 2IBTA 5TY0A 2Y1DA 5ICSA 3HCDA 3TW0A 1EXWA 4MUEA 5EEGA 2B1JA 1O5OA 2IEGA 2WHYA 3M5WA 3L0YA 4HQKA 2AHOA 2D0OB 2GRAA 4JL5A 2ZZNA 3A6GA 1C4OA 1SY7A 3ANNA 4G0VA 1Z6ZA 2FR0A 8GPBA 3I12A 4BX9A 3GLTA 4PHCA 4BO6A 2EJBA 4NBVA 4IOJA 5KOYA 4L08A 3VR5A 1JVBA 4FMDF 5G1OA 4BQRA 1OC2A 1J90A 1YUNA 4DG5A 5BPFA 5IJ0B 3NHYA 2ZCUA 4HS4A 3OF2A 5D3ZA 5J9FA 3RYIB 1EVEA 1LF0A 1OXTA 2B30A 2Y1FA 3HJUA 3VDMA 4BU0A 3C4VA 1KK1A 4C2AA 5IBCA 3PDCA 4HYQA 1L8XA 2W71A 5EQJB 2XYPA 1IIBA 3QU5A 5KQMA 3KVYA 4J3JA 3VKGA 2YFYA 3RF7A 1LPOA 3MERA 1Y4AE 1Z0SA 4H3VA 1V16B 5CG1A 1XDWA 2EWVA 3AF4A 4AI6A 1GNQA 1NI5A 2ROQA 4V2UA 1EVJA 3A10A 1KTIA 4KPUA 3S70A 3I2IA 4LRSB 2JCYA 1AO3A 4RSRA 1CEXA 2VZ8A 2NZ8A 3GRVA 3PNQA 4IEFB 4YCJA 1NHGA 2D62A 1E2JA 2QLTA 3IH5A 4DRXA 3RHFA 4D0GA 5A5VA 5EZ6B 5K01A 2WU0A 3U56A 3KYBA 5JMWA 3N6RA 3AEQA 2BMWA 5IVKA 3TRDA 4N48A 1T4GA 5JD4A 2VJOA 5T3UA 2FWBA 2WHPB 3JYHA 3LVRE 1PDVA 3TI9A 4QJ5A 1TVMA 3BHJA 4MLCA 5CIWA 5FOSA 4RVCA 2WMNB 5B5SA 5K3SA 2QL7A 4YHHB 1VZ3A 3N0RA 3JYQA 4YXFA 1VC2A 3AFOA 3GUUA 1P1RA 3QFSA 3BHMA 3ESYA 4MS4A 4TKLA 5ALMA 4F5ZA 1QYXA 2EF0A 5HZKA 1UFKA 3AJRA 4KQMA 4TWZA 4LF4B 5JS7A 1M5TA 1CRPA 1U02A 2CB0A 1NKVA 2P0YA 3ZD9A 5KNDA 3O2NA 1T5LA 1NRIA 2RBEA 4Q24A 4BRSA 2QRMA 5WRFA 4G4JA 4A92A 1O7JA 2F17A 1TPZA 1IPHA 2R25B 3G17A 4D3ZA 1T5IA 1VB3A 1U1IA 2OGZA 1YVRA 4Q00A 1NY5A 1KHHA 5JVDF 2C7QA 3BRCA 4XA8A 2DFTA 4F2DA 3O1HB 1DDIA 1YDWA 3LU1A 3ZTWA 2R66A 4ND2A 1DKQA 1JIJA 1BQ4A 2V7WA 3ZXUB 3JQ8B 4FYXA 1S8OA 3IDSA 4YO7A 5GV7A 5K09A 1C0LA 3TQHA 5DP1A 3FB1A 2ZPTX 2Q49A 5BVHA 1ORWA 2PSEA 2P9GA 1NLZA 1MNAA 3KJNA 4RVUA 4WXHA 5REQA 3O84A 3RSSA 5BSVA 2WI8A 2R7NA 3PD1A 1O0BA 2QP9X 3IP3A 5GMOA 4BTLA 3BG5A 1CFJA 5DXFA 3PITA 1KFKB 5BN3B 2W11A 4P1ZA 2GJAA 3QX8A 4Q12A 3T5AA 3L18A 4KXMA 5G0VA 1WUHS 1GGJA 5HRCA 4Y1FA 3EPKA 1D2AA 1Y9EA 3OFKA 2Z1NA 3THWA 3CNQS 3IUSA 3R7AA 1VBNA 4MS3B 2DHDA 3S2FA 2VRCD 2C7OA 2PKCA 3R3HA 2VYNA 4JEIA 4OBBA 1UBRS 1MRSA 4LRQA 2IXFA 3QHAA 1DO0A 3IALA 4I9HA 3N53A 3QFRA 2PKRA 3GRRA 1W9MA 4INJA 2VTKA 5I5EA 1IQPA 4EAQA 1NC3A 5EMNA 3AZPA 5C1DA 4ZJYA 8ATCA 3HDGA 1IQ0A 4AP5A 1BO6A 1YBFA 3BKWA 2NM0A 5TF4A 4FXOA 4GD3Q 1EXVA 3J7TA 1POWA 3EIHA 1KDTA 4OXIA 3HBMA 3WNBA 1HM5A 3MRSA 4F6LA 8AT1A 2C2OA 4CCWA 1EK6A 4LECA 2GK7A 1ZLYA 2RHJA 4LBZA 3HXLA 2I91A 1H2XA 2GZHA 1KQ3A 3LL7A 5TGDA 3AVVA 1PW7A 4YX9A 1R5BA 4GKVA 3N59A 2WIGA 5FA8A 4PLZA 4AROA 2MU1A 5D5HA 2RB5A 3T7CA 4YUXA 3W9YA 2BMEA 2PLFA 3UIEA 3BCSA 3UB2A 1ZX1A 4L74A 2OV4A 1XZMA 3EEBA 3I4CA 3JQGB 4KQXA 1FFGA 1J56A 2Q1WA 4IBOA 5EWLA 2OA0A 1MVNA 4DCJA 3MVEA 2I6FA 2PIDA 3D9QX 4KH0A 1QS0B 4US2R 4AS2A 4BCBA 3GC6A 2KPOA 5DTJA 1DE0A 4XGQA 1G20E 2YHSA 4PM4A 4I8DA 4AMBA 1FLVA 4ZYTA 1LPAB 2RIPA 3AIKA 2COEA 3AUJB 3KO8A 2ODPA 4HMQA 3MLAA 1U1CA 1ISMA 2YH2A 1TB4A 3CC8A 3CZ5A 3RT1A 4H3KB 5ADVA 5FUWA 2GZSA 5EY5B 3WK9A 1NF3A 4RTOA 3WLEA 1ZSVA 1O9GA 4R9UC 5EXDA 3ZJUA 1A76A 2X0KA 5FWAA 3RABA 4HXYA 4OK3A 4N7MA 1NQAO 4WE3A 2B4YA 3E2PA 1WCXA 4NONA 5I9MA 2ZSHA 1P62B 4IIJB 5L3SA 4G84A 2B7CA 1XD8A 4L8FA 5AICA 3BIOA 1E59A 2IPNA 3IYLW 1GPKA 3BQ9A 1IFXA 1FXWF 3F6BX 3GROA 4Z53A 4L75A 4IVRA 3G9QA 1A8QA 4XFJA 1GRQA 4P0PB 3DEZA 5HMLA 4KN9S 2BCJQ 1DV1A 3OJFA 4DDUA 1M74A 1KQNA 3X1MA 2IS2A 2IBMA 4KVAA 4A1FA 3UW3A 2YCLA 2I22A 2OGUA 5A4IS 1P0PA 1ULTA 3IAM6 4K46A 4RGBA 1V96A 3JWEA 1XVTA 4LY9A 1T5BA 4EO7A 4CEIA 4RQAA 3BFJA 4LKRA 3I04A 4B87A 5JC8A 1ZN8A 4P8RA 2QT9A 4R3WA 2NO5A 4BPBA 1LI4A 1W76A 3WP0A 3KCQA 4HJRA 4DPLA 1M1YB 1TAHA 5JO9A 4IIBA 3E7FA 4X94A 1UBMS 4GPAA 2ZJ7A 5F2EA 4RA9A 4E2XA 3I2JA 4EHFA 2B8EA 3GF4A 1NU8A 5ECDA 3KSUA 2Y0CA 3X1KA 4QUKA 4EKGA 3QPBA 3N2KA 1S2IA 3MRTA 1JUDA 3PXXA 4NV3A 5DT9A 3Q6MA 5TQ0A 1MJHA 3FY4A 3O93A 3A6LA 3HUFA 4IWXA 4NK5A 1OI2A 3AEKA 5DTIA 1ISPA 1NV8A 3AI2A 5E9WA 2QTVB 3RC1A 2CJWA 3EF1A 3G8BA 1G38A 1L7QA 1ZVJA 3ON5A 3SC2A 3WXBA 1Z56C 1JR6A 2Y1GA 5B2EA 4RPGA 5GJWC 1OF1A 1T9BA 1AMOA 4BO8A 3A1EA 4AJ9A 2C7GA 3RJ9A 1I7SB 2UXDB 2Q21A 4L0CA 3O92A 3C1UA 1ESCA 1TK9A 3NWOA 3VPXA 3F1KA 2HOQA 3A31A 4NAUA 4BCCA 5BQFA 3H2BA 5BSKA 2ZSUA 4H18A 3P5SA 2I29A 2PGNA 2G0TA 4B6FA 3KSAC 4B8YA 1WXQA 4URXR 3MJVA 2HPVA 2I3ZA 4IDPA 5ALVA 3SNHA 5JAIA 2FW0A 6PFKA 4M0FA 1BU5A 3MQ2A 4O6VA 3W1EA 4F6RA 4YRAA 4V1CB 1VCHA 4DEVA 1XDBA 3NEAA 5FPPA 4Q4LA 2IYQA 2P41A 4UNQA 4CPDA 5IFLA 3AF1A 3H7AA 4L72A 4OL9A 4A2PA 3IQEA 5A9SA 1HR0B 4HNSA 1P1IA 1TEHA 1E2EA 3MS7A 2DFKB 5T57A 2FN3A 2ZXUA 5EYPA 3T5BA 1K3TA 2CE7A 1CT9A 1QWSA 2NTVA 3O4HA 2PMDA 3OCCA 3PQ6A 3H75A 3TH5A 1T2VA 2V7XA 4NDNE 4D0RA 4F9TA 5JXIA 1T35A 1W59A 4X90A 3N05A 1R9NA 3OUTA 4Z6KA 3V8MA 1OGYA 4B4UA 2DPHA 3AIOA 2Q5HA 3E8MA 2IZ1A 4OIMA 1NQWA 5C7YA 1SBHA 2PKEA 5I48A 5AOVA 4Q9IA 4U9HS 4RO0A 4BUCA 1U8XX 5H5JA 3GH3A 3U26A 2JIRA 1C1HA 1NMQA 3G2HA 1KGDA 1DXOA 1UWCA 1UZUA 2PZ8A 3P9KA 2OBYA 3DHVA 5LXTF 4CKCB 5A2GA 5IT5A 3UH0A 1F5SA 5IKPA 5JBIA 1TKAA 4EH1A 1MG0A 1ISFA 2WTBA 4MUBA 4ZGGA 1UBKS 1P39A 3WHIA 1GPUA 1BMFD 5TR9A 2OCBA 4WNYA 2C96A 1UAGA 5JFGA 3GZNB 4WERA 1EG7A 3AERA 4TYNA 1OH6A 4M9ZA 1E9VA 2XWPA 2I4NA 2Q1SA 2VZLA 1XEWX 4KE9A 3O1JC 3ZDBA 3ZE1B 2GS9A 2Q5IA 1WY7A 2O5CA 1C3JA 3LUDA 4P3YA 4FCTA 4FONA 4LRUA 4CKBA 5EXPA 1NBME 2O7NA 4GM1A 4RA6B 3U4CA 3SKXA 1TT5B 4GE3A 1HF3A 4AZTA 4EG3A 1BHO1 5AVVA 3MXOA 4HFMA 1TADA 1IY0A 2LZ0A 2G5TA 3FLMA 2HC9A 4ZT3A 4IZHA 2F3SA 4X6UA 4Z86A 3L7JA 5CPBA 2V7BA 4ZRNA 2JBAB 3EQZA 3T94A 3L43A 3V6LA 4XWKA 1PJSA 1U2DA 2C92A 2JVKA 4OV6B 4XDHA 1RADA 3WJ7A 1ODKA 2Q5FA 1HG1A 5E7JA 4Z9XA 2CVZA 3L7LA 4RF3A 3AU9A 1KZ4A 1VJCA 4JEUA 1SVNA 1Y82A 2QJTA 1VLHA 3F4BA 2CLCX 1PYOA 1ZIPA 1P18A 2R6AA 3ED1A 5KTMA 2NTYC 2DSNA 1OLUB 5IF3A 1GM5A 4PLPA 1XZKA 1T9GS 4MRSA 1C80A 5BMOA 3ETCA 4TMVA 4EW1A 3UHOA 4LBVA 4UUPA 2YZNA 3ZJ5A 4DS3A 1QRSA 2WSIA 2FXVA 1O6ZA 3CX7A 4PANA 5ALZA 1V3VA 2VC2B 1NLFA 3OJWA 1Y8QB 4BMDA 3G2IA 3LJKA 2KI5A 1FYFA 1EFRD 4WMLA 4I1OA 2C8VA 3F8TA 3KQNA 2G09A 1Z7GA 2JLXA 3L1HA 2QGNA 4E7OA 2ZRDA 3CH6A 2AEEA 3HN7A 4HGRA 5KYNA 3VV3A 3P9QA 3Q7PA 4PTZA 2M6LA 3VGPA 3HB9A 4FE4A 4RMHA 3VNAA 3DL0A 1FQJA 1H2BA 1WAMA 1ZRMA 1GUZA 3IDQA 4MJLA 4JI1B 3W5IA 1GTJ1 2X3UA 3ID6C 4MPRA 4PZ0A 4GX1A 2ZWMA 3MQFA 4RQBA 5EIBD 1FYWA 2ZRFA 2ZITA 4XKJA 1GGNA 3HUTA 3CZPA 2HHLA 1U0SY 2GB4A 3I30X 4OGWA 4GR5A 3WTBA 3TL3A 3FDIA 1IAQA 3EXG2 3UA4A 4XD7D 2IEDA 1GRCA 1SRQA 3B48A 3MGKA 1WMBA 2Q6KA 4Q82A 1DAPA 3WHPA 1CBUA 4AMYA 5KX5A 3IX7A 2PEYA 1G3RA 2ZZKA 3GNLA 2YX1A 3O31A 1G4AE 2DFLA 4LWPA 3BD9A 4F2HA 1OE0A 1OU0A 4P4GA 2QM3A 1XU9A 5TQVA 4NWIA 1TQ6A 2CDBA 3OT1B 4RK4A 3PJRA 5JRJA 2WR8A 1KIMA 2A5GA 3BWBA 3FUXA 4G0MA 4F1JA 3QE3A 4HXFB 4NEQA 3RASA 3SQMA 3FNIA 3Q87B 3T95A 1K8QA 3MIIA 3MT9A 2H3EA 4CCAA 2RE8A 4KQ9A 1KAOA 5AVWA 3HV0A 3QVXA 4MQBA 4KAAA 4MV3A 4OMCA 3VISA 1UBGA 3ZC3A 2W2QA 1GVNB 2BFEA 2JI4A 3TW8A 3X1WA 4TT3D 4ZN6A 3WYDA 1YOVB 3B7GA 1WTAA 1OXSC 2EG5A 4R01A 3P9XA 5EHGA 2Z95A 1GTL1 2QG4A 4AFNA 2PWYA 3G0OA 1ZD9A 2FJ0A 2JCVA 3CR7A 3NRJA 4Y1RB 4XYEA 2JFXA 5HKBA 2G3YA 3N2EA 4NRDA 4X8HA 1D07A 1TT7A 4RKYA 3UHFA 4E5VA 1U8FO 2XEDA 2XUGA 1GKIA 4C6RA 3K0EA 4PSVA 2F48A 4O02B 2C0PA 1K6MA 1QTIA 2YVAA 5CNKA 4L3WA 3WK7A 5TPZA 2ZZMA 3R4VA 3Q7IA 4NIMA 4A0HA 4I08A 1V11A 2J5QA 1IN8A 3OIWA 4R2HA 1RRCA 4QGFA 4ZTUB 1Q0LA 1S5PA 1SXJE 3EQ6A 3EVNA 1QUFA 4RCYA 1HT0A 4TV8F 3VDRA 2GCOA 2ZVQX 3ONWA 5IKOA 1BHQ1 1N5KA 2AFIB 3FHTA 4XARA 3U7RA 1YCDA 2EDCA 3QEJA 1FYXA 1UDXA 3TTXA 3ZGOA 1FSGA 4IJWA 3WO1A 4H6PA 2P78A 4M49A 4OJKA 1IWOA 1TUGA 3G5LA 1X9IA 4O59O 3G6KA 2PWZA 4O4HA 2FRDA 3ZVMA 1NQVA 3O1IC 4A5SA 5HUJA 1CQXA 3K6RA 4MYUA 4XIIA 4PG8A 4U9IS 2RAUA 3W4KA 2JCBA 3MMZA 1HC7A 1WE2A 3FCEA 2JLYA 1ACMA 1WDTA 3HVRA 2AT1A 2BOVA 2QAGC 3PFWO 4M8NE 3EZXA 3T41A 5BQOA 2Q4BA 4C6TB 1QVVA 2CZGA 4LK3A 3ZU4A 4CQMA 3TNDA 1G42A 4Y3UA 5JAZA 3O9VA 1COWD 2I2CA 3PNKA 5JHHB 4I4IA 2FUCA 4MARA 2NT3A 2PNFA 2RCNA 2AW3A 3KQTA 2ZTSA 1IHYA 1EA7A 5DGHA 3EX7C 1H6DA 1LC0A 5HF5A 3BJIC 3KKKA 4IDHA 3R7SA 2DF8A 2XF8A 3PKIA 4GM0A 3MCZA 1UJ5A 2EG9A 1H4VB 3KPYA 3BGWA 3M0EA 4ID9A 1GGMA 3AR4A 4L9RA 3GEPA 4NNJA 4G97A 4AK9A 4FYIA 3FA2A 1S7GA 2FEKA 3QVGB 1YRAA 4M7RA 1QHHB 2DTXA 3QV2A 5AW9A 3HB5X 3WYCA 1TAUA 3CS3A 4O2BA 3AJ9A 3QWFA 3ZTTA 4C1BA 3IP1A 2WYOA 4IUDS 1TVKA 5C9ZA 4D8UA 3D6UA 2GEFA 3LT0A 1LWNA 4MR9A 3W8FA 2WPDA 2GXQA 4L4UA 4ZRDA 3VTKA 4BRWA 3ZWAA 3TF5A 1TQDA 4ZAFA 4EKYA 3G3EA 1UH5A 4I2NA 1O8BA 4NV1A 1W5SA 4QELA 5K8IA 1O94D 4Q4HB 2HA4A 2G06A 4H1TA 3PTLA 4X8OA 4ZMRA 1QKIA 3ZKAA 3U3RA 2O4UX 2GTPA 5UKDA 2O2IA 2OORC 4OTZA 4PLYA 3DHWC 3M5PA 1M66A 3MJHA 5CFPA 1Q83A 4N5LA 1L4UA 3HGTA 3QXJA 4JOSA 2ODTX 5G0SA 5CYPA 4BB6A 4C7OA 4F4CA 3KBBA 1LRKA 2AG0A 4ZOQI 5H83A 1RBMA 3HJAA 2XE6A 1GDHA 1Z8HA 3B8EA 3DT8A 3EQ9A 3GJ0A 1GSIA 3OOYA 1I14A 3UF0A 4DV1B 1KSJA 3PNLA 4KVGA 3RU7A 2AKAB 1EFPB 4ZOEA 4KK3A 3BMQB 5EHNA 2KWIA 3CT6A 2VQDA 3K16A 3R5XA 4WLEA 1N2EA 2IYYA 1EJ2A 2JAUA 3HWX1 3L4BA 5KVQA 4B4OA 4QUBA 9ABPA 1GYQA 1CR2A 2RCYA 2D2FA 1U5CA 1G4UR 4P3XA 3G2JA 2O57A 2I4TA 5FYDA 2WIKA 4EGSA 1N0UA 1TYEB 1D2NA 1DS6A 4D8VA 1YJAA 2WTEA 1JKIA 2FP4A 1YCGA 4NBTA 3VZPA 1FW6A 4ZARA 1WP4A 2JVJA 3G23A 3IDFA 4QHTA 1UKEA 3DE3X 4C4RA 1YIOA 4M7WA 2VNIA 1DO8A 5TMEA 4D82A 1QV6A 1KDRA 1KRHA 2Q2VA 2VCHA 1VSVA 2BHSA 2WINI 3C3EA 4KPGA 4E08A 3T4XA 1O87A 2LV8A 3T7JA 4EPRA 3NC4A 5JD6A 1Q1BA 1NOJA 2AUMA 4C6SA 2G07A 3GAFA 1HL3A 1NVUQ 2VK8A 1UXIA 3BQMB 5FF9A 5DGDA 3GLGE 1OBCA 3IAAA 2PU5A 3TGLA 4WBNF 3KHUA 1QIGA 4XI9A 4DMGA 5JCOA 3ACBA 3BRSA 4BNVA 5CAEB 2PJRA 1Z18A 4RW0A 3CEAA 1ZN9A 1GRNA 1P9OA 2FE1A 3WRXC 4Q7MB 4CCYB 4DTIA 4LV6A 2W6OA 2UU9B 3BXPA 3HCWA 5K3EA 3LX4A 4WECA 4MQ5A 1P5FA 3K8YA 2HMTA 3EDOA 4XX0A 2QYOA 2GBGA 3MNFA 3CNOA 2VH5R 3I64A 2QRHA 2G9ZA 3NM4A 5LVAA 2EFJA 1GL7A 5B12A 4C4ZA 5K0ZA 2NW6A 1U0TA 1U0BB 3S27A 1IZ9A 2BFDA 4LDAA 3LXXA 4ARVA 2WTNA 1GQQA 3KR0A 3VR4H 2UUOA 3F7NA 2BRUC 3DDCA 1R6AA 3HZZA 4XB1A 4X91A 1FFXB 4IKOA 3MSCA 4MVJM 4PC3A 1R2QA 1CDOA 5C7IO 1P0IA 1IEXA 1YZQA 3NCTA 3GEDA 4HUQB 4B4VA 5CK4A 4LZOA 5SYMA 3E3OA 1DX9A 4BWGA 2QQFA 2GBIA 3BGOS 1SZDA 3V2HA 2BKAA 3B9BA 2WZBA 3DGFC 3ZS8A 4GO1A 3ZV3A 4C76A 4GYWA 3G85A 1HYGA 4IY1A 5DBHX 1JLLB 1C8VB 2HA7A 2B4RO 4HS9A 4BAUA 5JZVA 4NZZA 4JHLA 2WB4A 2H5IA 1BMTA 1E2IA 4Z9YA 2VJBA 1Y1SA 4CGYA 421PA 1TD1A 1I30A 1UDAA 3MXTA 4ENRA 4FFVA 5B3KA 3O03A 5I3ZA 4Y9TA 4I4TB 2HA0A 2Y1WA 2C2HA 3KLMX 1SHKA 5NLLA 5ANRB 1A5TA 1TC2A 5FR1A 1VJRA 2EU8A 1U3TA 5AKKA 1U3UA 4KI7A 4AY4A 1TDJA 3IRUA 2QUIA 3L8ZA 3OUUA 1OWLA 3ZV6A 4A0QA 4B2YA 1EFCA 2OBMA 2NU6B 5COBA 2WUVA 2HRZA 4PIPA 4CN9A 4P35A 3R3SA 1ZITA 1T0PA 5I9TA 1HNZB 4Q4AB 1ZD1A 3TWOA 1T2EA 2CE2X 2IOFK 1G21E 1N2XA 2PH5A 3TLGB 2Q2WA 2J0UA 4GAEA 4BFUA 2R6JA 5DCYA 1QAMA 2AK3A 1FLDA 4Z8YA 1C9KA 3D4NA 1WXFA 1M72A 2VUHB 5G02A 1AKYA 2MSDB 1Y8RA 1WU8A 3RIHA 1BOFA 5AVRA 3MEQA 4L9SA 1MC8A 1AGNA 1OYOA 4AURA 1QQ7A 4RDXA 4OQPA 1HYQA 3GT3A 3U1TA 3WOVA 2N9UA 3QZUA 4ND5A 4OQFA 2CWDA 2V3VA 3GLRA 1FTSA 1MJFA 3K9NA 1ZCAA 3HXMA 1J09A 2F9LA 3IIMA 2Q07A 4YREA 1NM5C 1PKXA 4GQAA 4RXUA 1RYBA 2FZVA 3V34A 2W6MA 4FHCA 1Y8ZA 1UWLA 2FF7A 2C0QA 1V1RB 2QVBA 3O8OB 2IYRA 4PPNA 1BEEA 5E0OA 2ZJ3A 4I1YA 5A3QA 1KMHB 3FPEA 2W6ZA 2O3SA 2JAXA 1UEXC 1GA1A 2CLMB 2UUPA 1JXAA 5IDQA 1G8AA 3ZCPA 2ONYA 2PZFA 2NZJA 3BXHA 1BWQA 2QMZA 1GY8A 3KWLA 3MBOA 1U9YA 6AT1A 3G2QA 3QBJA 2E0IA 3D1VA 2CGEA 4IJMA 4CKWA 1AKEA 4ZODA 2ZRJA 3VI3B 1E3EA 1HX7A 1DBVO 2ZI5A 1G5PA 2H52A 4LSMA 4RIGA 1FPMA 2VHYA 4IHJB 1WXDA 3C3AA 4FFBA 5K8TA 1IOZA 1GT91 3OZVA 5IJ9B 5JY6A 1SRRA 3AHJA 1FQWA 1M8FA 4M60A 5CA0A 3RBZA 4P08A 3L9WA 3S2YA 4C04A 2BM0A 3QEAZ 1SBNE 2ZULA 2PJUA 3U7FB 3T7TA 3ETHA 5EJ8A 3EGWA 1R3DA 2H07A 2WAAA 3A27A 5K0TA 5EE3A 2BTEA 5D3MB 1V71A 5C8VA 3KV3O 2WWRA 4M1QA 4NAHA 3R44A 1GG8A 5EJIA 1XJQA 4QOHA 3UW1A 3AIMA 1M0SA 2WWIA 4IX1A 2UUAB 5IYZA 5F7ZA 5GAJA 3KZXA 1PD1A 2CJXA 1QF9A 5E6RA 1R15A 1ECBA 4X61A 5K1ZA 2ENUA 2XNDD 1E3SA 2HCBA 3QLTA 4X1YA 2R0QC 3GDHA 4OMFG 3T3DA 2PH7A 3PGMA 1T4CB 2JASA 5AW2A 3VDQA 1NVTA 2FW8A 5HRAA 5DN6D 1XF9A 1OKKD 2G4VA 3IOEA 4EB0A 4G81A 3IDAA 5T8KA 4FB5A 2VJAA 2EFGA 2P1ZA 3E9ZA 4F9EA 5BXQC 2DSTA 1XR3A 2ICAA 1JSLA 3PNSA 1SVIA 1VFPA 2Y0EA 3DLPX 2YY5A 4XYBA 1GKLA 1TA0A 4MUFA 1K97A 5LKRA 4O2AF 2I8LA 5D1HA 2VZ0A 5TNXA 4FC6A 4FDVA 3NDIA 3W1VA 4BZPA 1FS5A 1U65A 3IUEA 2X9GA 1T4BA 4XH9B 2OZEA 3S1AA 4W5NA 4EGQA 4N49A 4YDSA 4G0ZA 1BXRA 2GVDC 3KFXA 1G1AA 1WX1A 2GRUA 2O3TA 4GICA 1KDYA 5JECA 1C30B 3RWMB 1EVKA 1JILA 1ZS9A 3HCRA 3E48A 1ACLA 2KS6A 2XNKA 4IO1A 1D5CA 1VE3A 2VSOA 3DVLA 5EAIA 3A70A 5FIUA 3ZDEA 4E03A 1P5HA 1F7UA 1HI9A 4IJ6A 2FFAA 4QYXA 2J45A 4AKTA 1EESA 1NVEA 3RC7A 3CVXA 2I7DA 1EXDA 1O96B 2X77A 3CBGA 2F9FA 5C4IA 1L6RA 2IXGA 3MIZA 2FPGB 4I5GA 4XWYA 2HSJA 2VDMB 4Q3OA 1L7MA 1UT8A 2QLNA 3FWZA 3RYHA 3R24A 5KWEA 1E2PA 1EDOA 2AYZA 4HQNA 1GDTA 4HGNA 2VA8A 5EOVA 1PT7A 1DQYA 3ZWBA 3OWHA 3VR5D 3CF6R 3EXIA 3ENNA 4GZLA 1QE3A 1A9OA 1PFVA 2W5UA 1VTKA 2YBEA 3LQRA 1W2WB 5DLDA 4NI5A 1WW3A 4UM5A 3NW9A 1N1MA 1GYRA 2VDWB 5ELXA 4UOQA 1K9VF 1QIJA 2AE1A 3SM9A 1O2DA 1X1CA 2P9JA 3EGXA 4O63O 2O3UA 2PMFA 2OXFA 4H60A 3DEYX 4HL6A 4LQDA 1NVMB 4BVJA 1I7DA 4Z8XA 4BFLA 1P77A 1Y7LA 2AN1A 2H1VA 4FHFA 1R8XA 4HAIA 4XJSA 5A3VA 4DCNA 4BEWA 3UT6A 2EBWA 3B82A 1S1CA 3K73O 1WMFA 1X7XA 4LDNA 3DZJA 4UFOA 2HEGA 1X7YA 3G2PA 2A7QA 3CONA 2HIMA 3K30A 2ET6A 4GPD1 4J1NA 4NCXA 4A15A 1AHIA 3W6NA 3MWLA 1Z6PA 2H54A 2ZQZA 3BIWA 4IZIA 4AULA 5ITSA 1MQ8B 1QV9A 1EA5A 3IMCA 3JWGA 4YRPA 4MYSA 5HFJA 5CD9A 1E2MA 4NBSA 5FI3A 5FV7A 2ERCA 1UQRA 4OU5A 2M6SA 2OZLA 5HDQA 4TS3A 3ZPXA 4TTIA 3ZWQA 1TIBA 1BHSA 1JA9A 4Q4CA 1W34A 4TQGA 4EY3A 2VPXA 1JIUA 5JADA 1Z4KA 4FINA 3OSUA 5JQGA 1XK7A 1J21A 2PL1A 4NLLA 3KNZA 3H8VA 2A86A 1OX4A 2P27A 3UXEA 2JGLA 2QSJA 3RRBA 3AW8A 4LOKA 4W5RA 3D8TA 4B6QA 1OVGA 4GGMX 1Z4QA 4EEXA 5FOTA 4DR7B 3I2KA 4L22A 1CVRA 2AGVA 4CLOA 3CIFA 1N7HA 3U44B 3GRAA 4JBGA 4NF2A 3EODA 4UM9B 3UFXA 1QOQB 2GPNA 3GMSA 1HZJA 1JSCA 4YI5A 3UWKA 4BLRA 3BCUA 4TPKA 2GZ1A 3AT1A 4IIGA 1LQUA 3PYXA 3A9SA 4PLVA 1N6KA 3EZLA 1AUXA 3MPOA 5ITWA 1QH9A 2QAGB 4A03A 3BL5A 1QBKC 2J9YB 3AK4A 4KR2A 3W9BA 4OI0A 2J6BA 4IJQA 3T06B 4BRZA 3A9WA 1M83A 1J23A 2QY9A 4ID3A 2ORIA 1G8FA 1VHJA 4BFTA 4RIIA 5E2BA 4MUNA 1IEQA 1K3FA 1MXHA 1G8KA 2E6UX 3HN2A 3MRVA 4QPDA 5TEWA 4C08A 5E4YA 2PKYX 1FQOA 3PDUA 3DZGA 3DLAA 3DONA 4QUIA 4NFLA 3SZRA 5CCDA 1WULS 3LGXA 2HJWA 1E8MA 2M6RA 2B20A 4OJYA 4ALLA 2I78A 2YCBA 4I55A 1CUIA 3DBLA 3JRWA 1VYUA 1UADA 4WKGA 1Z26A 4EI8A 1TZCA 2YQZA 1RQPA 4BQEA 4H7HA 3JATB 2B1RA 2R6GA 1UC9A 4LV5B 2D7DA 1F60A 5DHQA 3SGLA 1VECA 3CKKA 5ARCA 1NI4A 1SVKA 4HH0A 2XMCA 3KU1A 4A0RA 3PT5A 2JJYA 1RI5A 3HNOA 3WBBA 4CF4A 5LPNA 4ZOBA 3PPXA 2HJRA 4N6NA 5EHIA 2OOKA 3QKRA 1NNEA 2EHJA 4Q3CA 1LDYA 4LSZA 4LJRA 2JFPA 1X7WB 1CF9A 3R0ZA 3EG9A 2Z98A 1T10A 5KNLA 2RI6A 3AEUA 3N7TA 3CZ4A 1OAAA 5BOSB 2WJPA 4IUBS 3A1TA 1X19A 2Z2YA 4TQUS 4N82A 1T0IA 1T3SA 4P0TA 2R68A 1NYQA 4JLMA 4W5TA 1YL5A 1GQOA 2JK0A 1XNHA 2NZWA 3U39A 1FFDA 1QHSA 4H4DA 2AZ4A 3CNHA 1Q21A 4L5AA 2ZJFA 4ZOLF 4CZ2A 1EZZA 3CNNA 3V1LA 3UA3A 2YRFA 1OFUA 1CJUC 1XJCA 2FPIB 2D5LA 1TRHA 1E1MA 4JU8A 1A98A 3URMA 2OHVA 3H5LA 4HH3C 3E4DA 4CNQA 5A3RA 1S8NA 3LLMA 5H82A 1IJBA 3UMJA 3THRA 1I7NA 2POQX 1Y6GA 1Q1AA 4LY0A 4MGEA 1YQ9A 5JXWA 3FSEA 4Q9JA 3NTUA 2AI2A 1QP4A 3CZRA 1XHLA 4FJ2A 1Z16A 4NZMA 3ZD6A 4PLGA 3X1DA 1GRRA 4AWXA 1N3LA 4XGRA 4E30A 2BWJA 2I1WA 3LIPA 1CY4A 3PFHA 3RHZA 1GTMA 4C3VA 1J4AA 2BELA 4HP8A 3ZD8A 1KRWA 1RNLA 3T1NA 3EXHA 2W2LA 1YB7A 1MR3F 4WK0B 4D4GA 5I7HA 5HPYB 1V48A 4ZZ1A 2X15A 2ZSFA 2HU7A 3H5AA 4AECA 4OX9B 1E5QA 1FE8A 3HTXA 3H13A 1X94A 1DKNA 1SKUA 3D1JA 4MWZA 5GOZA 4CT0A 3L7OA 1U63A 4KPYA 1QFSA 1MVOA 3N3BC 3T5DA 2I2AA 1MH1A 1YOBA 4KX5A 3UC5A 4HSGA 2ZIFA 1LDEA 1VE1A 5J2UA 3I1IA 1K92A 1XZJA 3JAWA 1J39A 1PW5A 5EIEA 1URPA 3VYVA 3U6BA 1SVMA 3E9MA 3LPDA 4F3NA 4MR7B 4ZAYA 1K4KA 2X0IA 2DH5A 4HYYA 1JGTA 2ZYVX 3EXAA 3DH0A 4R2KA 4FYPA 4Y2RA 4D6YA 5LZ2A 4DREA 1NNSA 4BZXA 2AEJA 4LEIA 3ZX5A 3CLHA 4LQ4A 3EH1A 3ORRA 3K0KA 2I2WA 2IP4A 2C98A 3DS8A 3GJQA 5DHPA 3OOWA 2VP0A 3MMPA 2IY7A 1XD2B 2ZJ6A 4MW7A 1F0KA 3EYWA 1GA4A 3PPIA 2VYVA 2PQ0A 4RTQA 4MQMA 3GGCA 1U3VA 3V4PB 2JFOA 4L85A 3CH4B 3R9IA 4MW6A 1PVOA 4B6GA 1EB9A 3UENA 1C8KA 2ASVA 3A25A 1W93A 4X1IA 4ZCLA 1YDMA 2XCQA 3X1JA 5CBKA 3GNSA 5L3QA 1Y3BE 1D6MA 1JJ7A 2CBGA 5ESWA 3C6MA 1QE5A 3QQ5A 4DC9A 1HO3A 1OXMA 4OQQA 3KZ1E 1WU7A 2PLWA 4GQIA 1PJLA 1WD7A 1FMJA 5DLPA 2IS6A 4P3OA 4AJ2A 3AVTA 2CV2A 5FPQA 4WESB 4KBGA 2BFMA 3SDSA 4ZZIA 1A4RA 1NHWA 2QL9A 4PG4A 4X84A 4EHLA 5F7OA 2H29A 3AWIA 1UBOS 4R2IA 4PS1A 5EKXA 3UWDA 3MGGA 5J2TA 2PSFA 4LYDA 4OQEA 1SKAA 3ZJYA 3PTAA 1H2HA 3JQ9C 4CV2A 4D6PA 3ROMA 3P9NA 4ALKA 3K9FC 1CRQA 1DJNA 1NT4A 3I42A 5KQGA 3MAJA 3WFZA 1H69A 2BGIA 5F77A 5C2JB 3HJCA 4OKSA 5EJ4A 4OX9Y 2WD7A 1UFQA 3JQ7B 1GNPA 1UC8A 1Z25A 4ASUD 1YCHA 2K2WA 2X4LA 2VR1A 3UG7A 3UT5B 4EG7A 3A06A 2H5JA 2ZBQA 5KEIA 2PJDA 3DZDA 3OQ6A 2YY6A 1ZSNA 2HI0A 1QCYA 3K1AA 1QU2A 3FUCA 3PVZA 3QYAA 4RHXA 4ZGWA 1MD9A 1Z39A 1L4MA 2Q5LA 3OETA 4OSEA 2GFHA 2VF4X 2FPKA 4J0IA 3N07A 3WLQA 4EUFA 3R5TA 4JYAB 5J40A 4KI0A 4DY4A 1UZMA 1BVRA 4BV9A 4UBOA 5FI5A 1DKUA 1RWBA 3FPKA 3AEXA 4ZT4A 4ARSA 2WAYA 4IV8A 1B73A 5KYXB 3GOQA 3F90A 4IM7A 1BGVA 4HB3A 3ZGNA 4MULA 1SUPA 4XR4A 1M6VB 5LQUA 1QH8A 1Y5NA 3FBGA 4FWIB 1VPDA 3ILXA 4URFA 3UH1A 3WFIA 4B85A 4DN6A 5FWNA 1SKMA 2IP2A 3CZCA 1BFDA 1T36B 3LBHA 2WWWA 5JYEA 2F7SA 1E1YA 4WY8A 2P9FA 2BV3A 4WCFA 3PFCA 2ADOA 2IX3A 3X2FA 2GX6A 1GSHA 3H1AA 3WA6A 4OD0A 1M5UA 1SXHA 2X23A 4H15A 2WYIA 3OJOA 2FB9A 4MQLA 3WK4A 1T13A 3H84A 4DSNA 3Q8MA 2I4LA 3KE8A 4BKQA 4JCOA 3QYJA 2AFHA 2WA1A 1OCEA 1QVAA 5D1NA 3OQNA 1M0WA 1YR3A 4IOKA 5HM8A 5CFNA 3FOWA 3I39X 2HX1A 4MO2A 5A1JA 3RIYA 1UT5A 2J48A 4L5BA 4AUNA 4AO8A 4FGWA 3SS9X 3EZ2A 1E77A 3EFBA 3FPBA 5ADHA 1QBGA 3MGBA 1PS8A 3W3AH 3GQBA 1J2TA 1W30A 5I4CA 2R1TB 5AH0A 2QTFA 1R5OA 2WAXA 3PC4A 2FA9A 3E05A 4UZSA 3ZHQA 2CB9A 4MYHA 4DQ0A 3C3BA 2NPFA 5I51A 2X13A 3U3JA 2FX3A 4I1VA 2BTQB 2QMQA 1Z2EA 4PYLA 5H8WA 4L9WA 1KS2A 1RQLA 4FFLA 4K87A 4EPWA 1XMQB 1W49A 1GFWA 4P58A 4GVLA 5JZOA 1FL9A 1JU3A 1SUIA 2ZBUA 3JZFA 3OF3A 3QFCA 4BGUA 5LLDA 2V7GA 1RZVA 4B3IA 5AK3A 3RC9A 1YRHA 3ZV5A 1NJ2A 3MILA 4ESEA 5FUVA 4TN1A 4MB0A 2Z04A 3KSZO 4XDYA 1LBHA 3WYBA 5MGBA 3UXYA 3VRHA 1AKMA 5KNCA 2VJPA 4L7VA 4F06A 4ZV7A 4Z51A 2ZJ2A 1ZIXA 4HK4A 1KJNA 4ISCA 1UBJS 4ZO8A 5AK6A 4E15A 5JNVA 2M1XA 1JL3A 2PWPA 3KKQA 2FEPA 1CQWA 1G7SA 2B78A 1M8PA 2O9JA 4G5OA 1J24A 3BFPA 3I32A 4ZVTA 1DZ3A 4E33A 1EIZA 1KI6B 3KR9A 4EELA 3CRW1 2HWWA 1NW4A 3GPDG 5TT1A 4N65A 4O4IA 2O1XA 4WK2B 3LECA 4EG0A 5GQSA 3KOUA 1Z38A 4LKOA 4CFSA 1Y1PA 5B58C 2OR3A 4J0JA 3WLOA 1RCFA 3D59A 4UOEA 5EWJB 1C9DB 3PG5A 4BASA 1IY2A 3PKZA 2WY2D 1V9SA 1F4VA 2B2NA 2OVFA 3DEAA 4IQ8A 3EDQA 1FLNA 1T8RA 4PCAA 3FHCB 3RJMA 4WI1A 4WY5A 2X4GA 3KTFA 4R8LA 1STOA 5AW5A 2QS9A 4BZQA 3QU9A 5B57C 1KYZA 3AI1A 4UU7A 2VYFA 2JHGA 1LS1A 4WZAE 5BN1A 1NSFA 3MWDA 4NG4A 2ZDHA 5DHSA 3JW8A 4H1HA 2ZJ5A 3MTEA 2D5CA 3DZFA 3UAZA 3OLZA 4HEQA 4F4UA 2WTUA 2OVBA 4DR2B 1VPEA 5K3BA 3CXUA 3OZ7A 5EG5A 4YMWA 4PY2A 3R75A 1U94A 2ZYHA 1JPNA 2DTEA 3COYA 3NNNA 5LB2A 4ZCRA 3R9XA 1CZUA 1FFBA 3GUZA 4LJ7A 4WFIA 4JQZA 1G3UA 5C8YB 2ZRIA 1UMCB 2FSFA 4TMFA 4QYWA 3U4GA 4KXYA 4RAOA 3MWEB 3PUKA 5FH9A 5ESXA 1XMIA 4K9LA 1GTG1 4E13A 3HYLA 5JO0A 3BH0A 1N2CB 2WA2A 1W1WA 1WO8A 1WDWB 3AILA 1HRKA 3KT6A 3GFGA 2ILVA 2IXDA 1YR9A 4JGIA 4N0EA 4US0R 3HC7A 2C94A 2GVNA 4RK1A 1J1IA 2BCGY 2E48A 2CNKA 2J0VA 2PL9A 2Q99A 3VQTA 1XMSA 3W8RA 5AVTA 1EAMA 3KT8A 4Q03A 4GMHA 3OOEA 2Q3JA 4INOA 4X20B 5IKMA 3QQPA 5T4BA 3IE2A 4R81A 3PFFA 2NXCA 4M89A 1UK6A 2R00A 3JALB 2AQ8A 1Q50A 4OAPA 1BSVA 1FPQA 1KEZA 2P77A 3OLQA 3JZDA 3MCVA 1PHRA 1Z68A 3I92A 4I6EA 4JLOA 1L5SA 2PRYA 2LGJA 1E2QA 5KMGA 2PT7A 2V1XA 2X0DA 1P45A 9GPBA 3ZNQA 2GDZA 1GL9B 3F96A 2ZJAA 4NECA 3NV7A 1NC1A 2JFBA 5DWQA 4XGIA 1Q22A 4GVXA 2I66A 4F04A 1UMBA 2ZAGA 1WCV1 3BJZA 5ALSA 3A3OA 2ZR0A 1YVEI 4F4IA 2HJHA 2HJ9A 3TE6A 5KNBD 4YRQA 4E7PA 3CVVA 1HRDA 3RYFA 3WBKA 4EJMA 1V4VA 2PWBA 2V45A 3KYIB 4E1BA 4LNUA 1CW2B 5F9FA 3TIXB 4IWNA 3DLHA 4WUTA 4I50B 3A3YA 1KK0A 2XDYA 1ZH4A 4G24A 4CWAA 4RHTA 3KC2A 4M1EA 3KJHA 4QU8A 3SAJA 4BNXA 1X9GA 4KWHA 1CUAA 1KFBB 1EDEA 1K4YA 2BDUA 2OAGA 2QZ9A 3ECAA 4BMXA 3W5CA 1Z08A 3WLHA 5I9BA 5CDFA 3RRJA 3SR3A 4CCSA 2Y2UA 4GUAA 1DRJA 1JBEA 3R5KA 1QMPA 3KP1A 3RSCA 1KZ7B 2ASEA 4DQDA 4Z3DA 1RS0A 1BE0A 3B1WA 4A0SA 4C0AC 3T1VA 4TUYA 4XZ3A 3DTVB 3O38A 4LNAA 3A32A 2GA9A 2VUUA 2NO6A 4IQ4A 3DWGA 3RFUA 1Z74A 1QLHA 2P5UA 1P5RA 2HUNA 4JJGA 2WWHA 5KYUA 4HDRA 3H04A 3UMSA 4CFZA 3O5AA 1GSOA 1F6DA 1HLFA 4TMKA 1C1XB 5EJ5A 3JQBC 4UXHA 2PYZA 3B1YA 2VH1A 2D1TA 3W04A 2WQ6A 2ZFUA 3KVNA 3QE4A 4BO5A 2H4YA 1XL0A 3ZKWB 1VDMA 4YRNA 4FZ5A 3K6SA 4KNVA 5AW3A 2NMVA 3CWCA 3L7IA 1L7BA 3L8EA 3TBKA 1T1EA 3NZEA 3U0VA 2PMBA 3FXAA 3NHWA 1ZM4A 4NU0A 2XF2A 3L8MA 3WGLA 4HNTA 1MEOA 3K2EA 3EPPA 3A4MA 4FN4A 3UAYA 4YUWA 2AJTA 2EOAA 4TWJA 3T5GA 3VNQA 4EPTA 4UD2A 1L4GA 5FPTA 4AVYA 1Z37A 4ERXA 2AEMA 1XDSA 1XN1A 1K8YB 2NGRA 4EEZA 3PDIA 4G67A 3U62A 2RSLA 4TXHA 3GUYA 3GR6A 3IPAA 1XA0A 3Q7TA 4JR1A 1JDSA 5F2OA 2VJNA 1KZYC 1JHPA 1KYIA 1T6ZA 3BPSA 4QU5A 4UNSA 1QJCA 2B36A 2QQ5A 5K8LA 2YWFA 1WM1A 3D8SA 2Q3HA 4H77A 3U9LA 4LCJA 5I7EA 3KR2A 3UG6A 1YTUA 2I4RA 1WBDA 3HKBB 1EFLA 4TTTS 2HYIC 4BVGA 4G0QA 3KOOA 4JBWA 4YAOA 6REQA 2QTNA 5AW7A 3SU8A 5IAAA 3VR2D 4JGGA 3G5MA 1Y8AA 2GUWA 4MJ7A 4N0PA 5FL7D 1LNQA 5MF6A 2WKWA 4L2IA 1UPFA 5D8DA 3CW8X 2O2HA 1N0IA 4GWLA 1VE7A 2MINA 3QXSA 1E18A 1ZXBA 2GPSA 1XMJA 1ZK3A 3CKMA 1N5IA 3KEMA 3R3VA 1M7HA 3QF4A 1DAGA 2V7QD 4EGFA 1F3LA 2PVCA 1NW8A 4RACA 2NYRA 3GLIA 1J8VA 2R4UA 3BFXA 1J25A 2D2IA 3AFGA 3GLFB 4PF1A 1NSTA 3V8QA 5ED4A 1YXMA 2P67A 3CURA 3O8QB 1I80A 4L7QA 3ELWA 1DB3A 3EE6A 4LYYA 3TO5A 5BSFA 4Z3KA 5BYKA 1KJ8A 2XCLA 4ABTA 1U8AA 4O5AA 5GWXA 1RR6A 2BKUA 2WFMA 1R6DA 1GNSA 4W7IA 1BH6A 1WG8A 2EKBA 4CMCA 2I33A 3VKWA 1I5OA 4BY9E 2CKDA 2QYSA 1UPXA 3DMNA 3EHEA 1NMZA 1SQFA 1ETUA 2PLRA 5AQEA 1RRPA 1XTBA 4GOND 4Y9SA 1BDBA 1FS4A 4U39A 3UBMA 4E32A 1SCJA 3TG8A 2X9LA 2A14A 1M2KA 2GFIA 3MCWA 5EHQA 2JW5A 3LCRA 1GAQA 3TPFA 3EIQA 5I7AA 3KALA 4U8HA 4AG3A 4EI9A 1P7VA 3ND5A 3M70A 1SCNE 4GI3A 1B8VA 4PSCA 2WC1A 3EQ8A 4D74A 1Z63A 1AUVA 1YKFA 5B6JA 2E5WA 1XKLA 3HJTA 4FNAA 5IYZF 3EUAA 3IAFA 2EGHA 2GJ9A 4TWRA 5H70A 3ZN2A 2O59A 2OYRA 4TROA 1IVNA 2XXJA 3DA8A 3D64A 1P0FA 1E9SA 4JWTA 3VUEA 2FMTA 4O2BF 3FBTA 3EN0A 5AOCA 1A9QA 1K98A 5K3OA 3D3NA 2IVZA 4I36A 1D4ZA 4KQCA 2BFWA 1XTIA 4QNRA 3LYAA 1CB7A 3NKVA 4K6KA 4J2TA 1JTFA 4YV7A 2FUG6 2KBFA 2X7JA 2RHHA 2VSXA 2FUKA 4QSMA 1E7MA 3GNQA 2GHIA 4Z2YA 4D02A 1P7YA 2RIRA 2REQA 3B60A 2FEOA 1SOMA 2ZTLA 3LUBA 4GZ3A 4R83A 3IR5A 3ITKA 4C4SA 4CETA 1TF2A 3OU2A 3VYTB 1SGWA 3MUEA 1YMVA 1FMFA 1QOPB 2OO5A 3NV9A 1B6SA 2HLDA 1KJJA 3GVXA 1Y5RA 4YBRA 3KQMA 1H8HA 1PUJA 4U7PB 1SCUA 3KHTA 4MDEA 1JG3A 5E6UB 1ND6A 4PICA 4ZYZA 4MGZR 4RVDA 3GX1A 1WCWA 2I3AA 2XRZA 2I4IA 3AR9A 2BMDA 3AKEA 1AIPA 5BQ3A 4AG6A 2VTBA 1X80A 4U3JA 1P60A 2IGTA 2EX4A 4EYOA 2BUAA 5JZBA 1TJYA 2YYZA 5FV4A 1ZU4A 4YAGA 4TQAA 4RZUA 3UGKA 5D86A 4AMUA 2O8FA 2FSHA 1TFRA 2DHCA 2YWGA 3B6IA 2HK9A 3D8NA 1YJBA 2DLDA 2G4CA 4PZEA 5HKLA 1VL6A 1PJZA 4TTQA 2ZRMA 4HGPA 4H4CA 4R98A 3PICA 4CMIA 2ZIGA 3JQEA 1J0CA 1G2PA 4RF4A 1HE3A 1JNXX 2D6FA 1HT1E 2A4MA 2IZ7A 3O21A 5CRIA 5DI3A 5J5CA 1ZHOA 3W7AA 5CW2A 4EY6A 3D5EA 2GBFA 5JDCA 2GN9A 4OGLA 1N57A 1ZH0A 3MCTA 3B6KA 2QP4A 3E53A 1SIUA 4EI2A 2VDRB 3ZOZA 3L6CA 1Z83A 1D9XA 4J94A 3WLPA 3ZHBA 1O1YA 3LT1A 4GPBA 4LI0A 4DEYA 1TZJA 4Z7OB 1YAJA 4Q7LA 1QU3A 3Q8XB 1C1DA 4O4JF 3H99A 1X86B 1ZRSA 4Q9LA 1ESEA 1HQKA 2NNLD 1CUVA 2NNWB 2OFXA 4KRGA 5CTJA 2GN8A 1R6BX 2DPGA 1Z0ZA 5CBPB 1KY4A 1A96A 1QIHA 5EJFA 2GAJA 3LO8A 2WJVA 4A36A 1U1FA 3PFNA 3DE7X 2XUPA 1ZAYA 2E4VA 4QBKA 2WF7A 2QNBA 2IUEA 2VF2A 1XRRA 3T4PA 4Y2JA 4MI6A 4C3OB 3V2GA 2WT8A 5FWXB 4QYMA 3FHJA 2KE5A 1JZQA 4J07A 3CPSA 4OFWA 5M34A 3L41A 4WVLA 2GD2A 3LLCA 2A5JA 4WDQA 3V7WA 1JT9A 5F51A 1SXQA 3O8LA 2RHBA 3Q9UA 4C4YA 4IDAA 4BXOB 4DVJA 3H2SA 3SC6A 2PM8A 2WYHA 4GPEA 1KA9H 2ZQ5A 5DX0A 2WIJA 5AW1A 2OFPA 3LFTA 1ES9A 1Z22A 3DMYA 4D96A 5DDIP 4N0DA 4RTNA 1ZL2A 3TTVA 2Q8PA 3WKCA 4JBYA 4YRMA 1FVOA 2FKAA 2ZAIA 1MO2A 3K8OE 2LIVA 4G1VA 4ZVSA 4AKSA 4G5RA 1EGVB 1EHYA 2R7LA 3MS2A 3OKAA 5BV1A 3A04A 2RGGA 4PG7A 1SWVA 3STXA 4CMHA 5KTYA 1Y33E 4JZKA 3S2ZA 1EZ1A 3E27A 3L9XA 2I6UA 1LVHA 2E1PA 3PUXA 4JOQA 4M3NA 4YP6A 3OZIA 3TL2A 3C7DB 5AVSA 3R0XA 1CV2A 1W5AA 3C0KA 3QKSA 4R7ZA 2F59A 3I0ZA 3UMYA 5K2OA 4EDFA 1VI5A 2IPLA 2WUWE 2XOKD 1DQRA 2O0LA 3DNFA 3HKEA 3DVAA 5EUMA 1ML4A 3FTCA 4YMUA 4AUEA 1NY6A 1MAAA 3PGKA 2ZGVA 5ALLA 3E18A 3KZOA 4ZVKA 5LYJB 2OZVA 4CODB 3GLHA 3KX2A 1TTHA 4M1WA 4RGQA 3U7IA 3IUQA 1PO7A 2XB4A 2QN1A 4BN5A 4BV8A 4LBWA 5A6SB 4ZIRB 2YW9A 4JI0B 3PVSA 5HWSA 5BSEA 4BNDB 3S99A 3OJEA 1SHZA 1V8DA 1XZFA 1DFGA 2HMVA 2CJPA 2MOKA 4KBFA 4KVFA 4M0DA 1Q1NA 3B1XA 1YQUA 4YJ3A 3USZA 1DEKA 1W9HA 1VM6A 3L4SO 4MDYA 3ZQJA 1UBNA 1OZHA 3E9NA 4BQIA 5DNYB 1S3SA 2VDKB 3I9V1 5CH8A 3PE6A 3V1MA 2VXCA 3NQ41 1KZHA 2G9QA 2C5FA 2ZS9A 1XTZA 4A10A 4ITUA 3V46A 5LQKA 4PC1A 3JAKA 5E9AA 4TYYA 3N8NA 1EMDA 3NG1A 2DVMA 1L4KA 4UHFA 5FTJA 1CY6A 2G9UA 1XQ6A 2ZXEA 4B83A 2G5GX 5GIPE 2W6JA 2P65A 2ZE5A 4NU6A 3LG2A 2CV0A 4HWSA 2HF9A 4G86A 4BDTA 5CVCA 4OJMX 1JWLA 4ZA2A 3AF6A 1RXVA 4O1MA 1ZFNA 3TSZA 2ID9A 2CVQA 3OTIA 4BAZA 3IBGA 2JGDB 4F7WA 1NYLA 5AKLA 2J8ZA 3KJXA 4R51A 1DLJA 4ZDWA 2UZ1A 3BB4A 3OFND 5A06A 1FYEA 1U9IA 3FSGD 2G7ZA 1HDZA 1B8PA 5M04A 4KSCA 4KE8A 3TQFA 1P5ZB 4YXWA 4CLRA 2CLEB 2YJGA 3GZ4A 2R1VB 4RAQA 1DTWA 3C43A 4O1IA 3DV0B 3ABRB 4BBAA 4UHJA 4YRBA 1YS7A 2OFOA 1NLUA 1Q0PA 5AJXA 1EX1A 1Y42X 5EZYB 4DZTA 6YASA 2VTDA 1WSDA 4OYHA 3RAPR 2K5UA 1T9GR 2WU4A 4N8EA 2YVLA 3F7MA 5CNJA 2NTJA 4BP1A 1OSNA 1I6MA 2YOGA 5KQLA 1Q7GA 3NYWA 3ML1A 2FV8A 5K3DA 2D5AA 2IXTA 3PENA 1KAEA 1MN6A 2QVZX 4MV0A 4MUHA 1BDMA 4UM7A 3ZDQA 1PR4A 1U4SA 4MVJH 2BEVA 5JI2E 3MW8A 4DR5B 3HJFA 3ICQB 1N2BA 4EW6A 3LLSA 4XVHA 2DUWA 2H00A 4LDQA 2CYBA 3QW2A 1GKUB 2N75A 2Q6VA 5TB5A 3UJNA 2ZSBA 1ARZA 3VAAA 3RREA 1JFFA 4YMLA 2EYUA 1KS9A 2GM3A 5HKAA 1M7BA 1NAIA 2LUOA 4YCDA 4DZRA 2V7PA 3FJOA 1CVIA 1RDFA 3GG9A 3CLVA 3TQQA 4EIWA 3ZWYA 5CA1F 5IJ0A 3M4NA 1T8YA 1GNRA 4CW7A 3RYIA 2DPMA 3BHIA 1DAFA 3OURA 3RWOA 4EHKA 1AZWA 1KJIA 4M1KA 4DZZA 1BVYF 1D7AA 1MMFB 4O4LB 4YS6A 2F90A 3SS7X 4Y98A 2PT6A 3NIWA 3ANSA 4EG5A 5T67A 1DVRA 1LTQA 1V16A 5AKZA 1CUYA 5DRTA 4ZHQF 5E2AA 1E9RA 1TIPA 2IDJA 3D4PA 1UZLA 3HNRA 4QOFA 1C1YA 2O3QA 3BA6A 1O95D 4URWR 1O6BA 3HS3A 3HRHA 4GDFA 3DV2A 2G77B 4BDSA 2XNSA 3AEQB 5BSRA 3C1TA 3M5DA 1SK9A 3NUZA 4FCVA 3ZZ0A 1SUWA 2O5RA 3RT7A 1H1LA 4M9XA 2PE5A 4KAFA 3T15A 3ZHTA 2WHPA 1GITA 5SZIA 2AA3A 5ULLA 1JDPA