3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
1SIUA 3AJ9A 3VV2A 3GCWA 1C9NA 1BH6A 1YJBA 5FAXA 1KE2A 1WSDA 1P7VA 4H6WA 3VSBA 2SICE 1TO2E 1Y3DE 1WVMA 3BGOS 1THMA 1YJAA 2ID4A 2XTJA 1NLUA 1SUPA 1T1GA 1EA7A 3QMPA 1XF1A 1GTJ1 4AKTA 3Q40A 1BE6A 1SCJA 5AVJA 1SCBA 3VV3A 3DWEX 2W2MA 3LXUX 1Y3FE 2ID8A 1KDYA 1BE8A 3WIUA 1SN7A 4LVOA 1MEEA 1KDVA 1Y3CE 3I34X 1KE1A 5JXIA 4KG7A 1TK2A 1OT5A 2IXTA 4AKSA 1AH2A 1C9MA 1TM3E 5CW1A 1T1IA 2XRMA 4M1ZA 1Y33E 2W2PA 3I37X 1SIBE 3BX1A 3TECE 1GNSA 1GA1A 1SBHA 3HJRA 1Y4AE 4C3VA 3VTAA 1SBNE 2SNIE 1V5IA 1NDUA 3DE6X 3DVSX 2WUVA 1TM4E 5AQEA 4LVNA 1JEAA 1MPTA 5I9SA 2DP4E 1Q5PA 1C9JA 3EE6A 3F7MA 2WWTA 1IC6A 2G4VA 5AVKA 1NDQA 5B1EA 3GT4A 3PTLA 1BFUA 1DUIA 1SCAA 1ZVKA 3CNQS 3D9QX 4RYDA 5FBZA 3DYBA 3QFHA 1GCIA 1SBCA 3A3PA 3T41A 3L1KA 2SBTA 4FONA 1SCDA 3DE1X 3DE2X 3DVRX 2DUJA 4NE7A 4ZARA 4KB5A 4HVLA 5ARBA 3F49S 2ZRQA 5ARDA 4B5LA 1R6VA 1PJ8A 1TO1E 3AFGA 3DW1X 2PRKA 1Y4DE 2PWBA 3AJ8A 3OSZA 1AVTA 1GTG1 2P4EA 3D43A 4HX2A 4C3UA 4Z2AA 5SICE 3EDYA 2PKCA 4H6VA 2X8JA 3DE7X 1WMDA 1AF4A 2ST1A 2GKOA 1PTKA 3P5BA 1SVNA 3ZXXA 2HD4A 3TI7A 1S2NA 2TECE 3GCXA 1TM1E 3DE0X 1LW6E 3BPSA 5JXHA 1OYOA 4OV6B 3DDZX 1CNMA 1Y9ZA 1DBIA 2Z30A 4WOBA 1CSEE 2E1PA 3WQBA 1SPBS 3UNXA 1HT3A 2QTWB 1SBIA 5B1DA 3SICE 1WMFA 1TM7E 1T1EA 1Y34E 1BFKA 2SECE 2Z2ZA 1VSBA 2W2QA 1Y3BE 2Z57A 1OYVA 1SUEA 2Z2YA 1KDZA 3VHQA 1GNVA 4GI3A 4NE9A 4DWWA 2B6NA 2V8BA 4WOCA 1SIOA 3DE5X 5ARCA 1TM5E 3ZXYA 1AU9A 3DE3X 1WMEA 4H6XA 4ZOQI 1Y1KE 5K7SA 1SUBA 1R0RE 1ST3A 1YU6A 1GTL1 1V6CA 4K8RB 2W2NA 2W2OA 2WUWE 4JP8A 2DQKA 1ZVJA 3CO0S 5FFNA 4CFYA 5JXJA 1SUAA 3VYVA 1GT91 3LPAA 2Z56A 1Y48E 1R64A 3DE4X 4YN3A 3LPDA 1GA6A 3GT3A 2PYZA 4DZTA 1SUDA 4J94A 1P7WA 3A3OA 3EIFA 3WHIA 1AQNA 4OMCA 4BWGA 2X8JB 5JXGA 1BJRE 1IAVA 3SQOA 2WV7A 1TECE 1TMGE 1P8JA 1GA4A 2PQ2A 2Z2XA 4CFZA 1PEKE 2IY9A 1ST2A 2PMWB 3PRKE 3F7OA 1EGQA 1AV7A 2ZWPA 1SELA 1SUCA 2HPZA 3DW3X 3QTLA 4NMXB 4OMDA 3Q5GA 1C3LA 3H42B 1PFGA 1YJCA 1SCNE 1SBTA 3DVQX 3LPCA 1SH7A 3WIVA 1AK9A 3I2YX 3TI9A 4CG0A 3A3NA 4KPGA 1A2QA 4DJ5X 4MZDA 1S01A 2Z58A 5JMOA 4I0WB 1UBNA 2PWAA 2ZWOA 5AMXA 3I30X 1S02A
chains in the Genus database with same CATH superfamily
2WTNA 1KI3A 2PJDA 3FHOA 1CE8B 1UBTS 2B1RA 2P3OA 2O05A 3QSGA 4GLLA 5C4GB 1IY1A 3JASA 3A6KA 5T4HA 4MV5A 4P4SA 1E94E 4TWAA 2P2YA 1Z56C 1UKYA 4TKMA 2O6HA 2WIKA 4XQEA 2BELA 2PSJA 2CEKA 3VZPA 1A9SA 1M8FA 2LBPA 1L4LA 2ZVDA 5CD1A 1XWWA 2VJAA 4IHJF 2P6NA 4NYMR 3SN6A 4ZI7F 4X84A 5HSGA 1XZQA 3ZQJA 5IC6A 3NKVA 4YJ3A 4ARAA 5HPYB 1R8JA 5A6SA 3WIUA 5FWXB 4HZIA 1ZUNB 4MJ3A 3RS8A 5EE3A 4UUPA 5CP8A 3UA3A 4LJYA 2GZDA 3H0CA 3TQRA 3N2NA 1T2NA 1S2LA 1GSIA 2J7PD 3M6VA 5LBTA 3X2EA 2IHNA 5IXJA 4PSCA 3LU1A 1XZIA 5AI6A 4D9MA 7ABPA 1NT4A 5A4FS 3A8TA 4KQ2A 4EI7A 3IEMA 5EP2A 1Z29A 4M49A 3HZOA 1U2TA 1PNQA 3SKXA 2XTAA 1Y6RA 2P27A 4PO8A 1S2DA 3DGEC 3NFYA 2F17A 4H15A 4PWYA 4ZT2A 1NSFA 1UOQA 2A1UA 3MRXA 1CB7A 3R3YA 4ZJUA 2QX8A 3LLSA 4WADA 5LXTA 2IHZA 3ZGOA 3B20A 4OU5A 1WB6A 2W7TA 1PJ8A 1N9KA 4ICIA 4MRMA 5JBQA 3HXQA 3HEAA 4URXR 1XEXB 4MUFA 5AJWA 2EQAA 4MMYB 5D1HA 3TSCA 2XZPA 2O2YA 4L4UA 1RC8A 3KXPA 4R3UC 5E6RB 4EZIA 2J5BA 4P0QB 3RSGA 2K4MA 3MPUA 1SOMA 1PGJA 1L8AA 2GK3A 3WLJA 4C4YA 4WTOA 5K6RA 1MMFB 1G20B 2D54A 1RHKA 3TNLA 4C03A 1LD3A 2JH3A 4L4ZA 5IK2D 4DL9A 1EZ1A 4FKBA 2VJQA 1AKRA 5BYBA 2P2DA 4WXPA 1RRFA 1L7RA 2RGBA 3OOSA 3W5IA 5ELXA 1YC2A 3I9OA 4MARA 3AEKA 1JHVA 3IIMA 1VCHA 4HFNA 3MD0A 3NO4A 4UTXA 2MIIA 4OQDA 4G4JA 3TR6A 3LO8A 4HB0A 1XZFA 5LB4A 1XPRA 1A2KC 1JMYA 2JZCA 1PSWA 3EIQA 1U31A 2LXNA 5FV4A 2ECOA 3A0RB 2PSFA 3OCVA 4HH0A 4YRLA 1XVIA 2WD8A 3M7IA 1TUBB 1V71A 1M6VA 1E4EB 3LW8A 1KJWA 1PZEA 2QRZA 4O2BA 1CS0B 3F97A 3T1QA 3CHYA 3LP6A 1JYFA 3KJHA 4MVJP 4QQNA 4BMDA 5HOQA 3CFYA 1NQ5A 2PGDA 4HRVA 4ZXPA 5JS2A 1PF7E 4AUNA 2BV3A 3QRWA 5B37A 2E6UX 5AOVA 3H5NA 4Y1EA 3EZXA 4GMKA 3ZHBA 4YUZA 1GZUA 2XMCA 1MABB 2A8YA 2ACKA 4ND7A 1JPVA 4KNYA 3QFSA 5CW2A 1GNPA 4NENB 2MR6A 1G55A 1Y8CA 4CIDA 3W5AA 4UJ3A 2PMBA 5KAPA 1Z06A 5A5VA 3O75A 5B2EA 3O91A 4BNGA 1MJ5A 4C9BA 1QHNA 4AS2A 4C4SA 4I8DA 6NULA 5TV2A 4YJ2B 1EHCA 5HQTA 1CUHA 2E9SA 1JF8A 2GKGA 2VT7A 3ZE2B 2EW8A 4OYLA 4HN9A 1YI0A 3WP1B 1TMOA 1UXJA 4OP2A 1V5GA 4BZQA 1XYGA 1TFRA 4IRXA 4F5WA 3C5HA 3MLBA 1E2HA 1U7XA 1XCJA 2AWOA 4KXFB 1GTJ1 3PDWA 2OXTA 4R8RA 5EUQB 1HQYE 4KO2S 1Y1TA 1GQSA 5IARA 4IO1A 3VR5H 3HP4A 2CL5A 2JIZA 5BSUA 3F3KA 3KHSA 1OT5A 3JD2A 3RIEA 3T9BA 5F5XA 5HK8A 4BMXA 1OGJA 3FOAA 3LH5A 1LH0A 2W9XA 1UPTA 1UKCA 1WQ3A 3H9GA 1X7ZB 4DXHA 3FJOA 5TX7A 1ZUIA 4O4LA 3SXUA 4Z4HA 5FWNA 2QNRA 2E5FA 1SC9A 2X2FA 3S2IA 4WLNA 1US8B 3BE4A 3H1FA 1RC0A 3NDBB 4FYMA 4GIBA 3T0FA 3CO5A 4R31A 4FZ5A 3UMFA 4ZN6A 3OQNA 1N5JA 1GHTA 4GP9A 2XOEA 3TVYA 1ZXBA 1PWYE 3W2HA 1D8TA 3A9SA 4Y1GA 4CG3A 3PPXA 1U8YA 4KWTA 2F64A 4I50F 2KI5A 4K86A 1HTTA 5CLFA 1FFXB 6GPBA 3AFGA 1RLJA 2W8BB 1I51A 4ZRDA 4AMVA 3T9DA 3T9FA 3FTPA 1VRCA 3BBLA 2XUPA 2QI9C 3UHJA 1Z2AA 1ZD5A 1L5OA 4PEVA 4RF3A 3K0AA 3EDRA 3FLEA 4WERA 3GZJA 4WY2A 4KQ9A 5E6UA 3DF7A 4ALIA 4HAWA 2DQZA 3ZU6A 1F5SA 3HJCA 3JTEA 1CRQA 1IL0A 4YRAA 5D84A 3IDZA 2X0RA 3RC8A 1BD4A 1KJ9A 4C87A 3CC8A 3IQHX 4RA6A 2VWGA 2L69A 4FINA 3CM0A 3K6SB 3SNHA 1NJSA 3A9VA 4P3XA 2KM1A 2NO9A 2CHFA 1FDRA 3CF0A 4M1OA 3FOCA 1R0RE 4FFOA 5LYJB 3RFCA 2VHZA 1IYZA 5HQ3B 2V54A 2QW8A 4M1EA 3A9UA 4GLOA 2C0QA 1KRWA 1E3IA 4Z0TA 1CUGA 2C1ZA 4X41A 5BR7A 1W5EA 2XQKA 1DHTA 1L7BA 1SC4A 1EVLA 3SOPA 2QVXX 2JGNA 1Z0DA 3TGLA 4OX9Y 5H59A 4KE8A 3LHDA 1ECGA 2XUQA 3K92A 3P0RA 4TSKA 3SEQA 3TVTA 3NHFA 3Q7SA 4NNPA 3VVMA 3WLFA 5BWNA 2N47A 1Q7RA 2Y1WA 2QWXA 3D4PA 1PJTA 1IONA 1J2UA 3KPJA 1G6KA 3MN1A 1M6YA 2IYYA 2ZT5A 4LI0A 1Z63A 4WCDA 1NPYA 2VNHA 3I72A 3QSYA 2I7XA 3QVTA 4I81A 5IM4F 1GPBA 2YV4A 5IWAB 3P32A 5E0KB 1CUIA 2CXNA 2QKYA 3W2GA 1PR3A 5AK0A 5JPIA 4BN4A 2GZ3A 4B8YA 4YAWA 5F51A 2J3JA 3T1TA 2J0SA 3AETA 5CA1F 1G16A 1ITZA 1LSJA 2WK1A 4PTZA 5JARA 1FXWA 4XUDA 4FC6A 2X22A 5LD2B 1NQOA 2P65A 3NKFA 3ZWQA 1F3LA 1KDTA 3BF8A 3KD3A 4L9RA 4M7OA 3R7BA 5C35A 3OIVA 1CS4C 3MHPA 3W77A 1WCWA 3F5MA 1JSZA 1A5ZA 4DDVA 4OX9B 3TIIA 2SCUB 3ROGA 4IG4A 3AB7A 2V4UA 1N9ZA 3E5MA 1YQEA 1JWBB 2QGFA 3D2BA 5EWMB 4XPIB 2D7DA 1M1XB 2W93A 2XVAA 3FMFA 4M88A 1EE2A 2C03A 3K16A 3TRJA 1RPZA 3I9FA 2BFAA 3PNOA 5TR9A 4QG3A 2PIDA 2HCBA 2HKIA 1N7JA 1I3CA 1RAGA 1N9GB 1S0UA 3ELWA 1BXKA 4Q3AA 3KBOA 2H17A 1P4SA 3DAYA 1AHPA 5JV5A 2V6GA 2VJMB 4QDZA 1LTKA 4OQEA 3TZHA 2DFKB 1T9ZA 1FW8A 2WSLA 2ZSHA 2QHXA 3K5HA 4PZLA 4CUZA 5LP6F 1AGPA 4I3FA 1Q11A 2PNFA 1PAUA 3OCCA 3RWOA 1ZX1A 4E30A 4EGCB 1GG5A 2ORWA 1UXKA 5ENZA 4L5AA 1PGNA 2UVPB 2G72A 1EI9A 3FKSA 4Q47A 4RY2A 421PA 3EUAA 2FG6C 1K7SN 3CNEA 4HEQA 3SJAA 2CL7X 3G0IA 1IN5A 1F20A 2AHOA 3PL5A 4P32A 3ZGXA 5A9SB 5DYYA 1EAMA 4TMZA 3NVAA 1YNSA 4PYIA 3P9PA 3UJNA 4D3XA 4CLRA 1TF5A 1I80A 4QKQA 5LP1A 4HRYA 2NU7A 3HADA 4YONB 1OAOC 2ZB3A 2OV3A 1Z6TA 1UAGA 1FP7A 2PKRA 3GP3A 1U0TA 1IZ9A 4TYWA 3WY9A 3I01A 4LFCB 3TQOA 3GYGA 3KJQA 3MJ4A 4MJXA 3E15A 4RHXA 1KFJB 4EW6A 1F0PA 2HIGA 4ZAZA 2Z6AA 4LNUB 4H77A 3K5PA 4K7JA 5KVCA 1XCOA 5IYZB 2CXQA 2WOOA 1O96B 4OK5A 4MYCA 2JIMA 3C1TA 4N3NA 3CPHA 3ZWBA 3TQHA 3AOEA 4KOEC 2FQXA 4E13A 1EB8A 2JHFA 1Z88A 3NHBA 3PZRA 3ENWA 4OBEA 5C8XA 1JR4A 2QRLA 5JH7A 1UJBA 3RH0A 3LX6A 1LLDA 1MENA 5HIMA 2AKEA 3WRVA 4PTYA 5ALGA 1E7QA 3A3KA 3IESA 4CE6A 2QY9A 2XNHA 3GRVA 5AR1A 2HHJA 1IN6A 1L4HA 3M8KA 3F0TA 1N0VC 1FNBA 4NONA 1Q14A 3UY4A 3F47A 3C7AA 3B9QA 3N5CA 3O95A 1GNLA 4PGHA 1NBOA 1N2SA 2Q8NA 1QPZA 2ZJ1A 5DJ5A 2AMVA 3DW3X 4JOQA 1E62A 1Q1EA 1QG2A 5AKZA 1JBQA 1U5CA 3SC2A 3GJ6A 4CLDA 1INLA 3B2EA 2XDWA 3N58A 3PNYA 5CU7A 3DDSA 1EXWA 1F38A 1RZRA 4I50B 4UHHA 5FXMA 2ZCVA 3B36A 4I4TB 2HQOA 4WASA 5HUQA 5JIBA 1FY2A 3UJCA 3ODGA 2C98A 1BAPA 1FDWA 5DV9A 4LYHA 2L19A 1VJ1A 2Q0QA 3TQCA 4Y2RA 4ZHQB 1XSEA 3RS5A 1W36D 4NV3A 4FXPA 4CMIB 1AN9A 2WMDA 5FNZA 4I6JA 3UMBA 2A0FA 1PNVA 4GEGA 4MS4A 1U8XX 3RSLA 3SIWA 2J6BA 5AVSA 1QO9A 1O94A 2JI7A 5B7NA 5KUTA 1IVNA 3MUNA 3QLEA 4IV8A 2AA3A 1QH0A 4MLZA 4B3BA 4X6UA 3MGBA 1Z37A 1Y3FE 3CT4A 3WGKA 1NBAA 3FHLA 3FTQA 4ER6A 4YRKA 2C4WA 5C1DA 1DE0A 3PLNA 2I2AA 4RABA 4DPLA 5G3ZA 2VNIA 2M1XA 3DZDA 2EJTA 2GF0A 1G7CA 4LYGA 5CX1A 4ZIRB 2FWAA 2HA2A 2LCFA 1B73A 4TS4A 3AUSA 5EWLB 7AT1A 3T5MA 1BG6A 2Z2KA 4B33A 1KZHA 3N2YA 1P5ZB 3UH1A 1A8HA 3TLCA 3SQWA 4L0CA 4BZPA 3OWHA 1E9BA 4UU7A 2RBKA 5FYQA 3SP1A 3CLVA 3UYKA 2EKZA 3KR1A 4HPXB 4GDFA 1AOXA 1D2EA 4JT2A 2HSJA 4IO0A 5EUBA 2XT9A 4W99A 1YB7A 5AXCA 1OU4A 4N4AA 1Y63A 2FN4A 1A27A 2XDQB 4L9AA 2A0KA 3R9IA 4D9KA 4RIEA 1WHSA 3TRIA 2H85A 1R6BX 2PUGA 3VDXA 2P8SA 4EB8A 4OTZA 3WLLA 2YWHA 2CLOB 3EEYA 3L6UA 3KJIA 2IQ5A 4ZYWA 3DM9B 1N75A 3EUWA 3ZS8A 4WW0A 3GJ7A 4QUEA 1WXIA 4JI7B 3HEMA 4YNBA 1GU1A 3A6FA 1PNRA 3JRWA 3WMEA 3WWEA 3EEQA 5BVHA 1GZVA 5CM8B 3LWBA 4DIEA 1K8XB 5ENVA 4IDNA 2FFQA 3JYQA 3N2IA 3Q4GA 4X60A 3R8XA 3IP3A 1XN4A 2VF5X 2ZI5A 3FROA 4PQEA 4WOBA 2ABWA 4AUEA 2WAXA 2EYUA 2H59A 3A1CA 5EJ9A 5LNK1 5I7HA 2P4UA 1JR6A 3EOZA 3B2NA 4BVGA 5AOBA 2QU7A 4HRAA 4B7XA 9ABPA 1F2VA 3X1XA 1KVUA 3ASZA 2Q46A 4QUJA 4RSGA 1BMFA 4PC6A 2R97A 2QZ4A 1EB9A 2AX4A 2VF2A 1MXHA 2WMYA 3PITA 1E2LA 4X1KB 4M89A 4L4XA 2G9UA 2JFYA 4W5NA 1UKVY 1IH8A 1V6SA 3EC1A 3TNJA 3SM9A 1T0IA 3GH3A 1QUFA 2CVFA 2Q5OA 3BB3A 2EBWA 3BEDA 1OQAA 2HIAA 2IHTA 4OAPA 2FFAA 2JRLA 3HR4A 4TQAA 5JSHA 2H4JA 3TDKA 1ZIOA 5K0CA 1OTYA 1V47A 3UK7A 3KFVA 1VFNA 4YK7A 3VOAA 3ZCRA 4DVJA 5D85A 4AECA 1IBRA 2ZUFA 3LUFA 4B6SA 2JA2A 2G82A 4CIBA 1G6HA 4GZ6A 2LCIA 5IAJA 4IMJB 5D87A 3CRRA 4XVCA 3ZCUA 2UVQA 3QVOA 3DEJA 4KMSA 5ALUA 4P35A 4CVNA 4BQFA 1N0WA 2VYND 1J56A 3AUXA 1MRSA 1GPYA 4JL8A 3WX0A 2I9KA 3T1YB 4RJ2A 1FFAA 2BW0A 1V8DA 5DNVA 1DJOA 4GI2A 2JAWA 4YBRA 4ISCA 3GJYA 2DG2A 1CUZA 3S28A 1XZJA 3GQBA 4CV0A 2J0QA 4AWAA 1EXNA 3M4XA 3WGMA 1IIRA 1U7OA 4KW7A 1QQ6A 4LK3A 4HS4A 3SYKA 3UK1A 4EPXA 4GOND 1JR3E 3OIFA 4HDSB 4UHEA 5LB2A 4UUAA 2ZQZA 5FLKA 1YJAA 3EEFA 3E3NA 4NNOA 4I9UA 1ZIYA 5COAA 3IMEA 2PJZA 3S55A 4AQ7A 3RIYA 4OP3A 1YE3A 4B6JA 2Q50A 3RV3A 1PEDA 3CJQA 3SQDA 1QJCA 2YVUA 5JXIA 1JALA 3A6GA 4LECA 1SUWA 1O0SA 3CONA 3G9XA 5L8VA 4M1ZA 3SD7A 5BT8A 2G9QA 1QHYA 2W22A 3B52X 3C8MA 2F9MA 4X7PA 1D2AA 2CLEB 3DCIA 1GNSA 1G8GA 3FFBA 4LN1A 1LCIA 4PS0A 1KI7A 3TZEA 2GARA 4EGSA 3EJ6A 2QV0A 2EOAA 4X8LA 1FUKA 1WX1A 5JAQA 2OXIA 2WUVA 3ZZUA 5JPDA 2QR3A 4A8JB 1Q3TA 3TXYA 3VC3A 4JLDA 4LHZA 2G0NA 4YT5A 2WYIA 1JFLA 1OJ7A 2EJCA 2RCNA 1MB0A 1UXOA 4YRFA 5AK5A 4HJRA 5HILA 1NVFA 2ZBVA 1XHEA 1OZ0A 1QJ4A 2HIMA 1K3TA 3L7YA 1AJEA 2VZ8A 4H60A 4AXXA 5FTNA 3OTGA 4AX8A 2ZWMA 1JA1A 4JJ8A 4RY8A 1XA3A 1IXSB 1QQBA 3AGPA 4QWWA 5M5BA 4EG0A 3M81A 4UVEA 2F1HA 4LOLA 3DEZA 4LC0A 4ZYXA 5G1NA 4BJHB 1O57A 2XA1A 4DV6B 1R10A 5SZKB 5IM4A 3WG9A 5DCYA 1NN3A 1NW5A 4H1VA 2JCVA 2EW2A 4WOKA 1IEVA 1Z0UA 3OZAA 1U4SA 1M1YE 3IAAA 1Q84A 1PUXA 2ZTMA 3DBRA 2IP1A 3ACCA 2D2VA 3SC3A 4CCAA 4EUKA 3QEMB 3WYGA 2Q29A 1KYQA 3T35A 4DLPA 2BDTA 5AP9A 1IUPA 4GG1A 4HUQA 4E5DA 5HK9A 3WLTA 1K8ZB 2IHKA 4UBMA 3SX4A 1KOLA 1E6EA 3VFDA 1X2EA 3LCVB 4DTCA 4KH0A 4ENSA 5HTOA 5AVXA 2YJ3A 1HZZA 4O4JA 4YDSA 3H2KA 1KMIY 1DAPA 5BUZA 1K7YA 3GB9A 1WCIB 5KDOA 2XEXA 4WNAB 3A6HA 1FK8A 3RTBA 4AAYA 4RTPA 1H22A 4JXJA 2PYIA 3GLSA 3JQBC 4FE3A 4YWHA 1M75A 3G88A 4J0GA 1EG2A 4B7ZA 2E5WA 1VE7A 2PHZA 1QZTA 3PHIA 3HVIA 1QP4A 1L7NA 3TFQA 4YN3A 4MXDA 3VYRB 2B5OA 2GZ1A 1KY4A 1XQVA 2ESRA 3B6JA 3NBYC 3NHZA 4F4DA 4DV2B 3C6ZA 2IBMA 2YIJA 4FHCA 2ZIWB 6AT1A 1Q3HA 1VHTA 2WT9A 1NNSA 2YJ6A 2D5BA 1VM6A 2QX7A 2QNIA 1A9OA 4YMSA 1YZLA 1R0ZA 2H4YA 4DMUB 1OFVA 1MOSA 1ZD9A 3CURA 3CX6A 4IPTA 3VGPA 3U4MA 2CMKA 3N8NA 3S2SA 1J24A 4X91A 3OJXA 3A6PC 1T5TA 2J31A 2NIPA 3ER9A 1C1DA 2PKQP 5F78A 2ZBEA 3LPCA 2IGBA 3MJCA 1NNEA 3LT4A 3QLTA 4NBNA 3BS4A 2CBGA 4HBGA 1FRNA 1Y82A 3ESAA 2CUTA 2GQ0A 5H16A 4ZGBA 2N3ZA 3D64A 3AL3A 4U39A 5SZJA 2GFIA 4MHTA 1TO2E 4H0CA 4M6WA 3ITKA 4PYKA 5FPQA 3SIRA 3RWMB 4WEQA 2MHCA 4KWIA 3MWDB 4LX8A 2P2SA 2ONCA 3C87A 4LISA 4Y1RB 5E1BA 1L1FA 4WY8A 3D1LA 3T94A 1Y3CE 3AZPA 1ZD3A 3EUEA 4P6VF 1XDBA 3KTOA 4BV9A 1FJ2A 1T25A 4BO1A 3JAWA 2FDXA 2W11A 3PKJA 3C3WA 3R8CA 1U94A 4K3UA 4Y2VA 1IWBB 1E99A 1Y4AE 3WDSA 5P21A 3WHPA 1GPNA 2FW6A 3OFND 1EBUA 4QPNA 4YH1A 4XIIA 1O94D 2FN8A 1YHNA 3EH2A 2OXRA 4G4SO 4HH3C 1TA0A 1J7KA 1WUTA 2RAUA 3PDJA 2C78A 3WR5A 1PV4A 2CHQA 5E7IA 2Z95A 4TXLA 1Q19A 2TYSB 4BAGA 5IKMA 4HDQB 1A50B 2BGMA 4NNJA 3ZI0A 1RRPA 2QZ9A 5FD8A 1J1ZA 3PQ8A 5IDVA 2Y0EA 2F3SA 1CJTC 2UUAB 1J8FA 1UODA 4G1UC 1ZMRA 2PZ8A 4C3UA 3GFRA 1BDMA 3RAFC 4MJLA 3SZUA 4CF6A 1WNFA 4ME6A 1EUYA 4V1CB 2Q3MA 4IJ5A 2GAFA 2R5NA 3NG1A 6CHYA 3EAFA 3DTTA 3KLPX 5C46F 4BVHA 4NDAA 1YBAA 3FE2A 5H3CA 4JJKA 2PLFA 3RJZA 5B36A 1K27A 4TYQA 1QG0A 2HC9A 4D4MA 4PHGA 2HJ9A 1H8HD 4DY6A 3PP8A 1H2RS 1MOPA 2BAGA 4DUPA 5T7BA 1JEYA 4RY9A 5CB8A 4EA7A 2F8MA 2M6LA 4HH4A 1DAMA 2YHUA 4Z3DA 2NUBA 4RSHA 3RBXA 1XQ9A 4M0EA 4CL2A 4F92B 4N5IX 1KJNA 4O33A 3FUUA 4QVGA 4R41A 1EVKA 3A04A 4K40A 3TPCA 5AJYA 2ON6A 3HZZA 1J22A 2H1WA 4URHA 3TGPA 4DLLA 4WLOA 2LUOA 3INTA 3T3HA 1RBYA 2B98A 3R20A 2GAAA 1ULHA 3E7PA 4JLSA 1XRRA 2QL9A 5EWJA 2Q5QA 1K9VF 3SU8A 4DUZB 2WWRA 1KEWA 4GU5A 3WFJA 5A2GA 3UAZA 2FDCA 1LZLA 3O92A 1T4BA 2PMFA 3FWHA 3VM6A 3O2JA 4ZOLA 4CLXA 3H86A 1C3JA 1KC3A 1RRVA 2Y4NA 3D8TA 1W85A 4H4CA 4YRJA 3UT6A 3WJ7A 3HJNA 1W93A 2QB5A 3UIEA 3PGXA 1KMHA 4FILA 4OIFA 3L7AA 1YR3A 4TLDA 4ALMA 4C14A 1CDEA 4A1FA 3ZBPA 1CZNA 1G1AA 2WKSA 1K8RA 2I5PO 3R24A 5JEEA 1AK9A 4TMFA 3W1VA 4JBXA 5JNUA 5ALDA 3LJKA 5TQ2B 4ENWA 3S3TA 4CG1A 4IZHA 3VDMA 5I9BA 3IQDB 1A7AA 4OJMX 3TLBA 4DWOA 2JGAA 4OQFA 2H5JA 4WKBA 5CNMA 2O20A 3DZFA 3CBGA 1BA3A 3L18A 4IZ6A 4PLPA 5F3RA 1Z5ZA 2GF9A 2AFHA 1FYEA 3G2PA 2A3RA 1DWPA 2QVZX 4FHZA 5DISB 1N1GA 4X20A 5F1YA 4DE5A 4CF7A 1DKRA 3L0IB 5A3QA 1V7QA 2AW3A 2FMKA 1ZR4A 5FO1A 5DRTA 1GXSB 4RZIA 4RGYA 3C1OA 1REQA 3QI7A 1ZMTA 5F5LA 4A2PA 5BWCA 4K9OA 5F7OA 2DKFA 1VLHA 4LE2A 3JRXA 1OA1A 3K05A 3N8KA 4TWRA 3LYLA 3BA1A 2NUPB 3TSOA 1VIAA 4M0CA 4XWGA 1KRXA 1T9AA 4JS0A 5FI1B 1E2IA 2ZYAA 1DINA 4MYUA 1C8VB 1U8AA 2BFMA 1Z47A 1JVBA 4MGHA 3SSAA 2ZBQA 1D3AA 2QQ5A 3LW7A 3VZRA 1TZMA 4E6EA 4DANA 4XWKA 3T8YA 4HI0E 3P2YA 3BZWA 1TUGA 3T7AA 2BMVA 1HI9A 4E6PA 1XKQA 5IH7A 1VPDA 1W9HA 3PTLA 3ZBQA 3BH6A 2HRQA 4LCEA 2H2GA 4YUYA 3PX2A 4AKEA 3WAGA 2J07A 4EY5A 2AMFA 2DUJA 2DTDA 1O9HA 5C34B 4KR2A 5TF4A 4BNZA 1II0A 3PUYA 1EFDN 4QJ3A 2HNAA 2C8LA 3BE5A 5TQVA 1NLMA 4U7DA 1CVIA 1G8KA 2FYTA 4BNDA 2CV0A 3FFXA 2ZULA 3KS9A 4JL5A 3QWAA 2ECKA 2GNAA 3E4CA 3U3DA 4TSFD 3U0BA 4ILKA 1WSWA 2C4NA 3MJTA 4PANA 5TPZD 4OV6B 4CU2A 4LW8A 4OM8A 1KIFA 2Q8PA 5JSUA 1KIAA 5DLQC 2LNDA 4Z49A 2JA1A 3CSDA 3CLTD 1GZDA 4ZT4A 1ZUWA 3E53A 3NEPX 2BKXA 1KSFX 2P5TB 5G0UA 1QF7A 1NYLA 1C14A 1SOVA 5DN6A 2NZWA 2QOEA 4M9ZA 1SHTX 3VHQA 5BR8B 2WM9B 4X97A 3T3PB 1FL9A 3W5JA 2BWJA 4PSVA 4RV5A 3ZWCA 4LV8B 5IXYA 5JNTA 3E3AA 5DYGA 1D5CA 1HH4A 4AJOA 1YC5A 1BMTA 2IXDA 4DW8A 1JSLA 2VDLB 2VQSA 1RACA 4DIKA 1CHNA 2J3DA 2VP6A 4ZQCB 1WO8A 3IBSA 3C1UA 4PBTA 5CT9A 4C04A 5IHXA 1P9OA 3QXXA 1PYGA 1XMXA 4PZ0A 1M2WA 2HMSA 2JJMA 5JCOA 2WHPB 1EUCA 3HA2A 4YQEA 4BASA 4ZOAA 4MHOA 2H18A 2WV7A 1G8PA 3DOHA 1UPAA 3DYIA 4K2HA 3L07A 3ZPXA 2BFDB 3ZD9A 4F5DA 3SHVA 1NLYA 3FWZA 2VBIA 2JGMA 1VLMA 4BLVA 3OQJA 4C22A 5LKAA 3PFKA 3RI3A 3W6ZA 5JHHB 4UW9A 3BULA 1W581 2BGNA 1BH2A 5CIQA 5TSDA 3OTOB 4TV9A 2AOTB 3TLXA 1CIVA 1NMQA 2WJHA 3KUUA 4JOSA 4AU1A 3FDIA 3W1WA 4MWZA 2EJBA 2XRMA 4KJZA 3FYCA 2XUZA 2Q3CA 3NT5A 4CQMD 4RTKA 2BEVA 2ZIZA 3B6MA 5F7XA 4TZ6A 5JNLA 1QV9A 4GC9A 5E2IA 4AUKA 5CK4A 4RHYA 1U3DA 1S9DA 2PK3A 1FP6A 2NTEA 4GOJA 4ZU1X 2XWBF 3WYEA 1ZCBA 1VMKA 4NCXA 4EI2A 1PJQA 1KVQA 4EHNA 1T8PA 4HZUB 5IW8A 5I01A 3ADCA 4G5YA 2O1EA 4M7PA 4MTCA 1EK0A 4ZQIA 1TA4A 3CPJB 1HKUA 4N12A 1LDMA 5E8RA 5C1PA 3NWEA 4GLBA 1Z33A 1Y1RA 3FVWA 1EUDB 5CVCA 1H93A 4I1UA 2I3DA 1UT6A 2D5LA 4P34A 1RZUA 3M9LA 1A5TA 4FFWA 4AMUA 2DB3A 3K0EA 1U5AA 2WB2A 5KX5F 2JIZD 2R8XA 5DFAA 2QN8A 1UJ2A 1XZDA 1W35A 1A88A 2YDYA 5KYKA 4YRDA 1IVSA 1OFTA 5I9SA 3ST7A 3UWPA 1JB1A 1EE1A 3WRYA 1O9GA 1HQCA 3LHFA 5SV2A 1OXBB 4NOLA 1QZ3A 4CN8A 1O94C 3HXMA 5GONB 2OOKA 4LTMA 4JLJA 3OZUA 2QXYA 2B34A 1EK6A 1HYQA 3ZVMA 3S5UA 4OHPA 5KYUA 4AK9A 5JISA 2H9IA 4HDMA 4B5LA 4M87A 4CYMA 2EBFX 3PKZA 5AKKA 5KNCH 1N1EA 1UAYA 5KNBD 1PGQA 1KY5A 4C6SA 3M1YA 2GA8A 3QKUA 3WB9A 2UAGA 1VKNA 4CUKA 3L9WA 3TPZA 2RGEA 3OPNA 4FI3C 4I9NA 4F2WA 1I01A 1XCPA 1ZISA 4N5DA 3R6LA 4C89A 1M0EA 1JHZA 3NORA 5SYNA 2JIPA 3B3GA 3ESCA 4L6CA 1JEDA 3L7BA 1UM9B 5TGDA 3PFCA 3GJXC 1O7JA 2MINB 4UJ5A 5D2CA 3VDNB 4D92A 4F9TA 1WBDA 3RBZA 2ZRDA 2XCSB 2FLVA 2PN1A 3KSRA 2HRCA 1MEJA 3MJFA 4UCWA 2YXPX 5LLTA 1F8FA 2XQVA 3ORFA 5F4BA 3U3OA 1ZRMA 2VAXA 3MWLA 1A4UA 4ID3A 2VHUA 1N6KA 3DLAA 1B15A 4EJSA 5EIFA 1O08A 5EUMA 4O2AA 3QVWA 2BFFA 5DNAA 1JNXX 2ZRBA 4PLTA 3EK2A 3AFMA 2FSSA 4JITA 4YQZA 3W9UA 3BYZA 1BEUB 4AZ0A 5L7YA 4GVPA 1NGSA 4IIFA 3CUSA 3N2GA 1E63A 3ESXA 1VXOA 2Q3JA 4IUDS 3W06A 3DVAA 2OK8A 4QE3A 1GPJA 1OGIA 3IHTA 3OJEA 4A8HA 4UD2A 4OHMA 3TN7A 3RG2A 1SXGA 4DLYA 4ETMA 3O2QB 2ZJOA 3OPYA 3G5TA 2EXXA 2QRVB 4MQ4A 1JQLB 4J0QA 5DBEX 5ALPA 1GU7A 1PT7A 2QSYA 1P73A 1SA0A 2ZQ5A 3R0ZA 1J2RA 1KBQA 2CDNA 2ECFA 2JJYA 1USKA 1P0CA 1W0CA 3C3CA 2H1HA 1MAHA 3JARB 4HNUA 3REFA 1OIVA 2VPIA 3IALA 4G67A 1MZVA 4P58A 4AY5A 3CUEF 4MR9B 1ZRSA 1QRAA 3O4FA 4YV1A 2LD4A 1BYIA 3MZ0A 2H1VA 5DLDA 3V3KA 1D9XA 1LZKA 1EUQA 2RGDA 2P6UA 1E0SA 3PNSA 1N2GA 1N5IA 1VFPA 4BLPA 4D80A 3BSSA 4D81A 3T38A 1FRVA 1KDYA 1KKMA 3PR2B 2MSEB 3UHOA 2VCYA 1XJWA 4RF4A 2J7PA 1IWPB 1JB9A 1S1CA 2Y0PA 3HUTA 3PUJA 4ER7A 5K4HA 2PPLA 3NBUA 2A94A 2C9DA 4LZPA 4BMOB 4MWCA 1HT2E 4BCDA 2ZU0C 1QPBA 1MPXA 3CZ9A 2PSEA 1G4UR 2E85A 4XRRA 4E46A 3T7EA 2LVBA 3AR5A 3EMBA 2PWPA 5HFNA 2OA0A 4F11A 2C94A 1W29A 4Z4GA 1PLLA 3G8YA 1BVYF 5CFQA 1MQAA 1RXSA 4AJPA 4KXWA 5DCLA 2V8OA 1CUSA 3AB3A 1FYXA 2P2GA 3NBKA 2PIAA 4HQOA 1U11A 3EVZA 2DRIA 2FHSA 4LG1A 5DSZA 3W3AA 1EZZA 1M72A 1EVJA 3RUEA 4I1OA 2O06A 4KVZA 1F4LA 2A1TS 4G1VA 2A57A 1IZZA 3DVRX 3PJEA 1KRHA 1MW8X 2BCEA 3D31A 1WOYA 4X24A 3GPIA 3JQAA 4NXNB 3UXEA 2HBRA 2AYYA 4U2DA 3UCEA 2GPYA 4LA4A 4F6LA 5AJHA 5C53B 3LXXA 3GELA 3ZZ0A 2DLNA 3AF6A 3OEEA 1DDGA 3ZXIA 2A92A 3AJAA 5K8LA 4XH9B 3IUPA 3WL4A 2X6RA 3P94A 1GYRA 5HJ7A 2ZJFA 3VR4H 3HFRA 1HMYA 1Q91A 4GX0A 1NMEA 4C4TA 3PNMA 2B61A 5JD4A 1UMDA 2YQ4A 1UXIA 2JFNA 3C16C 3QUQA 1K98A 1RTKA 4NYJQ 4LGMA 1KDPA 1ZKDA 4OP1A 3DF9A 3IURA 4Y67A 3R7NA 3CZCA 4NIMA 3UUEA 3IIEA 1KPGA 1YZKA 2A4KA 2ID7A 2PA0A 2P79A 3CLTC 3GK3A 3HYCA 4KUHA 4ALLA 1USUA 5FBHA 2WIAA 4P3NA 1Q7CA 1GV1A 2FW7A 2FDRA 2DWUA 4CEJA 1WWKA 2BCJQ 4TGLA 2QT0A 3HKBA 4W8GA 5TQJA 3VZCA 4EB6B 3T1NA 3ZDZB 1PJZA 2J9RA 1YDFA 1HSOA 4OQYA 4QGAA 3R44A 1PO7A 1OKKD 3QBEA 1FPMA 3P45A 2ZG6A 4UMEA 1C1DB 1GL9B 2VDNB 4KUEA 3RROA 5AW2A 1HT0A 4N5NA 2XCQA 4ND5A 3TIVA 3U4HA 4M1SA 4KXNA 4NJEB 4TUYB 3PCRB 2X8JB 3WC4A 2P5UA 3KYIB 4MUBA 2I6QA 4XJXA 3VSEA 1UEIA 4B4WA 5ED4A 4TLLB 3K5WA 2QIPA 4FNGA 1T29A 4LSMA 3EAGA 4AC9A 1KO5A 1YMQA 2BHTA 2A33A 2YJGA 2DGDA 5JQGA 3BILA 3FYUC 4X94A 3F1KA 3ULKA 1SCNE 4O2BF 3QY9A 4RZSA 3WS7A 5KVQA 1SEVA 1KQFA 3GGOA 3IOMA 3LP8A 3ZS9A 1X39A 3DBHA 2WRZA 2HOQA 1N8NA 3ETHA 2OAQ1 3LQYA 4OYRA 4WK6A 4YC7A 3KU4A 2O8BA 3GFGA 2ZRMA 1H1DA 1EIWA 3D6NB 3MMXA 1LRJA 4KO3S 5H02A 3GAFA 2I6GA 1V41E 1UKBA 2P6PA 3VNSA 4TN1A 1O6CA 4LHSA 4MCAA 3RT9A 2GJ4A 3NANA 1JG3A 3KSUA 3WV4A 1DTEA 4NU0A 3BMOB 3PXGA 5B7GA 2RAPA 1BHO1 2WWXA 4BP1A 3U44B 3U56A 1X1SA 5A4MS 3O5AA 3LA6A 3QFTA 3L0CA 4OO3A 2NACA 3KBBA 4LK2A 4A3SA 1UC8A 1RQNA 3LXUX 1I7SB 1IB0A 3DDOA 5JDCC 2WG2A 3SSOA 1FDSA 3HG7A 4X54A 3UVEA 1PS0A 2IXTA 1PCXA 4NK4A 1W30A 1K0FA 3I6IA 1SU8A 1HT1E 5LWHA 2I0FA 4PSUA 5KIAA 4TYNA 1JR2A 2IVFA 2R9VA 1WZCA 2D0PB 4BX3A 1FFEA 3NJ4A 2PGAA 4YGYA 2P30A 3OOEA 2OZKA 1T3LA 2FX2A 1YS2X 2QW1A 3B8HA 3F4BA 4U7WA 4DYHA 5ILOA 4ISBA 2Z6QA 1ZN2A 2HF9A 4HUJA 1WVIA 1G3UA 1D0IA 1HE5A 4HLDA 1NBMD 3SLGA 3O2NA 3ME5A 3AI1A 1LBTA 3NHPA 1HMPA 2IZ5A 2X19A 3R2JA 4GHWA 1N4AA 2QVGA 4Y2SA 2H5EA 3BXXA 5GOZA 5EXSA 5EMJA 1YE5A 4F4UA 1YA4A 2RDMA 1PKEA 4CMBA 3UXHA 1R8YA 2GCEA 1N34B 1T3SA 3IIJA 2VJCA 3QYJA 3WICA 5JJLA 4XD2A 3ETGA 3AEUA 3IPAA 3H11A 1MV8A 3OTWA 3PFIA 2I71A 3OCXA 5C8YB 4ESOA 2FZVA 4UNRA 3JQ6A 1OXMA 1II8B 3ZXXA 5JZOA 2HD4A 2O0MA 4B73A 4JWKA 2VXYA 1P91A 1EBFA 3TKLA 3QEBZ 4M9RA 2YXBA 3I28A 5DMHA 2OHXA 4UBOA 1HRKA 2OHHA 4A6XA 4EG4A 2KQUA 1B0PA 3HN2A 1A5SB 4NX2A 5K0LA 1BMDA 4CM5A 2Z2ZA 3WL7A 1VSBA 3KFXA 4WEOA 5AIBA 2W2KB 2H1SA 4NYJR 4GI3A 1R8QA 2Q2QA 2RK3A 1R4NB 1SXJD 2ZBDA 3FTDA 2VJKA 1PJLA 1DEKA 2HU5A 2FPKA 3FSGA 2FXVA 4GP6A 3L4BC 4V0NA 4B9AA 3H04A 5F5NA 4CPDA 2W37A 3K31A 1ISPA 1KOFA 3CO0S 3PF8A 1LB1B 1V2GA 5A7FA 1RVDA 1NVWQ 2D8AA 4E7OA 3HXKA 4Q3DA 3GLIE 2IOYA 4RKEA 1G21B 4Y6OA 3NWJA 2XD4A 2XYPA 4R8VA 1HURA 4CR8A 1U6KA 5JS8A 2XEDA 1UKEA 3KEQA 4R1QA 1KYWA 5B4VA 2H2DA 4OXRA 3K6SA 3IR6A 2QL5A 2HT1A 2AS0A 1G42A 3EC2A 2PWYA 2XZTA 4U0JA 2X3FA 3AEQB 3FCXA 1Q1QA 1GNRA 1VBFA 3H4MA 4MP8A 5TRTA 1NC3A 1G63A 1T2UA 3MJVA 3A11A 4MVJG 1TIKA 5IC5A 3E9ZA 4EM6A 3K20A 2IPXA 4QODA 3A3NA 4HADA 1U65A 2X7HA 2XKKA 4G9BA 1FFHA 3AR8A 1G8HA 2W4IA 4D56A 5CDHA 3ZX4A 3NAGA 4Y0NA 2ZSKA 3K6JA 4PGFA 4EUFA 2YN4A 4CNBA 1RABA 3LZCA 4LCJA 1JQJC 3VH1A 4DYVA 3ITEA 2DWPA 5A5FA 1DXYA 2GJSA 3HVJA 3WK6A 1CBUA 2R8ZA 2WWFA 2J9XB 3VAAA 4YX9A 1P3DA 2W0MA 3UCXA 4E32A 4OH7A 3BCRA 1Z3CA 1SCJA 3NOOA 4RK0A 1T3ZA 3ERCA 2WYUA 4FYWA 1W4RA 4G09A 3RFTA 2GDZA 4TLAA 2QG6A 4P84A 2WSYB 5BN5A 3G2NA 2XWQA 4GBED 5DE3A 5EJMA 5BRJA 2EJWA 3CNNA 5L3SA 4KQEA 5LQCA 2I2BA 1L4FA 5AI5A 4D8XA 5IJ9A 3VGJA 3TXXA 1ORDA 4F3NA 4N7RA 5D3ZA 4KBYA 4JLNA 2ODBA 3MIZA 3VPDA 3C3DA 4PHFA 3SF8A 1NQTA 2L17A 3ESZA 4XR9A 2VJDA 1B1AA 1UBEA 2XZDA 5I4CA 5F98A 3UG6A 3O8BA 1Q20A 2ODPA 3OZIA 3V33A 3AU9A 2R6CA 1Y8QB 3OPXA 1U0FA 1TKAA 3QVXA 2GPTA 3LBYA 2B8NA 3SAJA 5DOVA 2R47A 3IVMA 3D1VA 2RKOA 1AGNA 1G0NA 3QWHA 1EHIA 2I7VA 3AONB 5K9ZA 1JIUA 4JJAA 3MLAA 3ZQ6A 2PEZA 1I3MA 3FRJA 3WNVA 4RTNA 4QXOA 1DJQA 1N25A 1XYVA 4PIPA 4PPFA 4S0ZA 5CT5A 2G83A 3TAUA 1NU6A 2UYCA 3KX2A 1BWRA 1N2JA 3VU1A 3MWJA 4D4GA 4PVCA 1GL3A 3BMCB 3BT7A 3ESDA 1ULBA 2CFCA 4KUGA 5C8YA 3AILA 4XJTA 2Q4OA 5KQMA 1RQGA 4NQRA 3HBFA 4QPCA 1ZC3A 5D6NA 1SCQA 2JD0A 4LDQA 1MB9A 2JGFA 3UAWA 1D6JA 2GH1A 4OL9A 3A6ZA 3UHAA 1D2MA 1K86A 2XBLA 4FE7A 5M34A 2UYGA 1ONSA 1EJ0A 1OXXK 2C42A 2IL1A 3IOEA 5D5QA 1QFMA 2FV8A 3BD9A 3EDMA 2O57A 2VXCA 1I8TA 5KREA 4UM9D 3HCPA 5D3MB 4O4JB 4FFSA 3IKTA 2BEWA 1EUCB 3IJPA 1IPHA 3K1ZA 3L77A 4JVOA 3GZ4A 1R8SA 3MK31 3CEPB 4JUDX 4OQNA 3SZMA 3WKCA 1AKWA 4COOA 4W5RA 2RBEA 2O5EA 3L7DA 3HKCA 4IICA 1JJVA 1FPQA 4ABTA 1N5LA 1FE8A 2C83A 1DBQA 4IOKA 3BDVA 4U5XA 1Y48E 5EZYA 5K03A 1QE0A 4M1KA 4WLUA 2AI1A 2QN2A 3MB8A 4ZYLA 4TXNA 3WIOA 5JQGB 2XADA 2ODNA 4KYVA 1NJ1A 2DY1A 2QN3A 2AJBA 4J43A 4L27A 5GONF 3DMRA 4Q6BA 1NR7A 3GAAA 1XMVA 4HB3A 5BSMA 2QE7D 4YREA 4L8GA 4EI9A 4DWWA 4RX1A 5K3DA 5B2FA 3QXHA 3I09A 5JCPA 2VUTA 1V5FA 2FR8C 1VKOA 1PSDA 5EEHA 1IVYA 1NJ5A 1X6VA 3SXJA 6Q21A 2OLEA 3M3DA 1TZCA 4NDZA 4TYPA 5AJVB 5JECA 1MOZA 4J49A 3S8EA 1YZGA 1XKLA 4E1BA 2GVZC 1WXEA 3EA0A 1F6WA 1XTUA 2QX4A 2QYTA 3GDGA 4ND8B 1JHMA 4R40A 1O87A 2OFFA 4LF9B 2LRHA 1P45A 3LZDA 2ZXEA 1AF7A 2ZTHA 2G0TA 4II3A 4OVKA 4OJYA 3U7QA 3VNVA 3HCDA 2WWYA 3NRJA 1SG6A 4WIAA 2BY4A 4AN1A 2XYVA 1MO2A 4YHHB 2DBQA 3Q6MA 3Q98A 1QHIA 3FZGA 3GW8A 3QNWA 3EW9A 3HCFA 4FGZA 4JODA 2AOXA 2G76A 5JBIA 5IVHA 2CWDA 2O7NA 1GTVA 1X70A 2MSWA 4UBIA 3NHAA 5ADUS 3O4RA 2HJGA 2QPAA 4AROA 3HJFA 2XSZA 2FJ0A 5LYYA 4MVJM 4IIBA 2ZBRA 3E23A 3GA0A 1OSNA 4F4FA 1DDOA 4NZ9A 4AUMA 2WJVA 4ZK2A 3WGOA 1OUMA 4RPJA 1YJ5A 1YZFA 5FQNA 4UQOA 4MUGA 3ETNA 4JP3A 4UU8A 5TMDA 5KI6A 2JCBA 2BT4A 4XZ3A 3UAXA 2BCGY 3R09A 5ALTA 4CETA 1S3GA 3MTDA 4WXEA 8LDHA 3R4VA 3GOQA 1M1UA 3DLTA 4OD0A 4IGFA 4R0MA 1DC6A 4N0QA 1NVTA 1UMBA 5D7NA 3WRYC 4BFCA 2CBZA 4PHCA 5C8ZA 2BHNA 5KYWA 5JCJA 3A9TA 1J21A 3ZUGA 1V9LA 2GCPA 2PUTA 4CF3A 2RC6A 5KOHB 1DELA 1RTTA 3NDRA 5KQPA 5ITZA 1D5WA 4DLAA 4G8CA 4PPYA 3ZU2A 5TE9A 3I04M 1N8SA 3A36A 5C5EA 1G18A 3DP7A 4AI6A 2RGAA 3T6KA 4A26A 1T4DA 4TTQA 2I33A 4JLOA 5F3DA 4F1WA 4XTRA 3T3MB 3DEFA 3J81A 3AVTA 4FFVA 1EP2B 2NX2A 3N0WA 4HPWA 4HZGA 4BBZA 4ZZ0A 4GDMA 2POQX 4RENA 3SX0A 3LY8A 3ILXA 2BUAA 3PUZA 2GCGA 1YDGA 4MVXA 4XDZA 3P27A 721PA 1GZ5A 4RIFA 1M2KA 3RGWS 3GEDA 1E7MA 2BFEA 3T99A 3ZD6A 3K4HA 2OSBA 1MAAA 4AJHA 2WWWA 2VNKA 3CB4A 1A8IA 4C07A 1A76A 4NBTA 1VL0A 1YOVA 4YBZA 2CXXA 3K3PA 2NG1A 4R2MA 5KYTA 4JI8B 2GZMA 5H9VA 5EPEA 3IKMB 4YDRA 5BSHA 4UDOA 1SA0B 3F73A 2V4ZA 2NZUG 4OUDA 1VDMA 4RULA 3PJRA 3GLUA 2EIHA 2YR0A 1XLTC 5H7XA 1JG6A 1GTZA 1W76A 2GBLC 1FVHA 1PFYA 2GJ8A 3F5DA 3GMTA 1M34A 4MVJF 4R1LA 5IMBA 2J48A 3TH5A 4FEEA 3MWEB 4J3FA 3W3AD 4EG1A 1DBPA 4GZMA 2J5XA 1I7PA 2JLRA 1FNDA 4WCFC 1JAHA 3TAHA 2CCJA 3R7SA 2XOKD 1Z0SA 4P2GA 4TM8A 3SJ7A 2ERXA 1W1IA 4F8YA 1R0XA 3JQ7A 5DASA 4AZ0B 2OMEA 3GGJA 4JSTA 3K73O 3VVBA 4TZ0A 1W6RA 3MEQA 4ZCLA 1L5LA 3ZJ5A 1QRTA 2PVPA 3GD5A 1WKCA 3MQ4A 2IE0A 1QP0A 4L9WA 1SVSA 3EQ9A 4DS3A 5FHQA 2VG8A 2G9RA 4N6OA 1U8ZA 3I2YX 1VL6A 5AUPB 4V0LA 2ODAA 3MCVA 1CEXA 2OZEA 5DLPA 3BF7A 2P9YA 2FB9A 3FFTA 3N75A 2ZSFA 3VUEA 5HZGA 1NONA 2WJ3A 1Y6JA 4ZJPA 2QZSA 4WN3A 3EGXB 2IFTA 3VISA 1YU9A 5JQGF 3LYHA 3MOGA 3ADPA 4AWXA 5GIOE 1BCRA 3MTGA 4LE1A 1AKVA 3U17A 5FF9A 2BE7A 2F48A 3I4LA 3NIGB 3U7IA 4YRSA 5KNBA 1XHLA 2X76A 4IQFA 1GGNA 3GLFA 3JXEA 3RC1A 1B8OA 5DWVA 5EXTA 4I1SA 3VKVA 2EG9A 1NXOA 3OZSA 1MA3A 1Q1ZA 2XT0A 3PKIA 3R7FA 4GMXA 1YK0A 2F3RA 4FOPA 1K0UA 3DWGA 1JLLB 2RGCA 4D9HA 1WQ1R 2IYNA 2C7PA 3WB2A 4FSDA 1KYIA 2WZBA 2Q21A 3B1WA 4MQEA 4DREA 1LS6A 1QTIA 1J9GA 3V8VA 2G40A 3AK4A 4XX0B 4BBJA 2PX3A 3RWBA 1IUNA 5ERYA 2X1HA 1FYVA 4MVJD 1IULA 1GJRA 1TW2A 1OYWA 3IUMA 1L6IA 1XKXA 1UC5B 1FF9A 2I8CA 2Q07A 3LWDA 3R3HA 4XM1A 5D1NA 2WE8A 3PGLA 1KI4A 4P0PB 4BAZA 4EENA 1XL1A 3KSDO 1ZJWA 4K0KB 4MRSA 3LBFA 4QULA 3V4LA 1MVLA 2G9ZA 1Q22A 4YAFA 5E3HA 5C4MA 2AXNA 3DOEA 4L8VA 5DHTA 1IBKB 4IIEA 1Y81A 2A1IA 2D4HA 5DYTA 4F3CA 9GPBA 1R5NA 4U00A 4O02B 4PCVA 1X3LA 2UYQA 5JD5A 3GDHA 4Z4IA 2VXBA 2V97A 3BVPA 4IX1A 2PKCA 4XIYA 1GY8A 1EKXA 2I4OA 4JQZA 2VWPA 1M9NA 3WHKA 2Q2VA 1L8QA 3V6LA 3N7UA 4OLFA 3KRTA 3OLZA 4J4HA 3IYLW 2DFLA 2PT6A 3GARA 4N39A 1XTRA 4ZK6A 3BN3A 4FFPA 1OI3A 2FWMX 1ZYUA 4RLSA 3GX1A 1QZXA 4WKPA 2E89A 2WUDA 2AG5A 4KGVA 2FOXA 3Q87B 1XLTA 4IJUA 4JHXA 3U26A 4ESHA 5EXEA 1RYMA 1VI5A 2YVQA 2VPTA 4JBIA 4IJWA 4WXHA 4KWCA 2IS6A 4WQMA 2VYQA 4BPBA 2WHRA 5WRFA 1KVSA 3OA2A 2CZQA 1TM2A 1SUBA 4PGAA 1A95A 1NIPA 1UC4B 2H0AA 3AEUB 3E22A 3LL4A 5CNJA 3VJRA 2FF5A 2H2HA 5DTRA 5JATA 4MR8B 4YT8A 2QAJA 4WNCA 3JWJA 1A9XB 4MP3A 3SLRA 1IATA 4X93A 1PQ4A 4Q4LA 4UZFA 4YRTA 1ZWKA 5J59A 4FNMA 1ISFA 4P81A 1ST2A 1UC9A 2ZWPA 5CIYA 2V55B 4TTPA 4V38A 1YB2A 4FTWA 4Z3KA 4EJFA 3ORRA 1LPMA 1BOFA 3NOXA 1Z39A 3ANTA 5JASA 3QKSA 3FXAA 1Z08A 3EW7A 5MN6A 4EH1A 5J2UF 3O0DA 1CQXA 1IEXA 1NWCA 2JBWA 4RS3A 1ZUNA 4JASB 2AJDA 3H65A 4ZKDA 3SI7A 1O9BA 3HYRA 4DQUA 2B8TA 5A3SA 4B34A 1I7DA 3IHKA 1WCV1 3N8DA 1H3FA 3KOMA 4D96A 1UQUA 1KQOA 4LF7B 2KLHA 3CINA 1P7VA 2MOKA 4G56A 4WY5A 3QE9Y 4GLJA 2CFRA 1OWNA 1RDFA 3COWA 2FMTA 1H6AA 1KAHA 1D1QA 4UXIA 3NI2A 2F9LA 5C3UA 1I7NA 1WR8A 4AX4A 4HAUA 1KAQA 1XP5A 2CUNA 2JFHA 2VOJA 2BTEA 2ZYWX 4CV1A 1ZK3A 1LFAA 1H2AS 4DSZA 1WEKA 2WICA 1HETA 3GRUA 4E51A 5KJCA 2O3RA 2J0UA 2NSLA 2QN1A 1JE1A 3E9DA 2Q5LA 3IOCA 1F7UA 1SOUA 2ZETA 4FCCA 4KO4S 4CTJA 2CFSA 1C9MA 2DPLA 2VIIA 2XNKA 4EW3A 5CB6A 3B1ZA 3GNSA 4N82A 1V5WA 5EQTA 3OFSA 4AMGA 4NESA 3S4YA 4EGFA 3M82A 1KMHB 3HUDA 3QEMA 3I4CA 4LDZA 1GNTA 2OO5C 4OHUA 4LDNA 5K0ZA 3JQ7B 3S27A 2CJXA 2VP3A 4B76A 5LMCA 1ZIDA 4EKGA 3VKHA 1PDWA 1DCTA 2PO5A 4QRIA 3T5AA 1E7WA 1KDRA 1SVIA 3TB6A 2SKDA 4C06A 4H9GA 3T7CA 3IUNA 3T5TA 4C2AA 1LK0A 4AYXA 5IT5A 4JENA 3BIFA 3ZHCA 1L4EA 3EXIA 4FZRA 3TO5A 3O8LA 3KCQA 13PKA 5F1KA 4DC1A 4FOOA 4JT9A 4DSAA 3CKMA 1V35A 4FKZA 4M0PA 3H87A 1LK7A 3AL0C 1XEFA 2I65A 3GZNB 4BRWA 4TYYA 3KKOA 1AT1A 4Q9LA 4EA8A 1F8UA 1QYDA 1EIZA 2ZYHA 4O3FA 1G20E 5F3WB 1Y9JA 2HREA 3IUJA 1LW6E 2IOFK 4D02A 4C7OA 1FFCA 2GD2A 4M0LA 3TR0A 3AR9A 1Q95A 1OZAA 1TQ2A 1UDCA 5JWOA 4CV2A 1YONA 2XV1A 5A0VA 1YZHA 1ORTA 4KPUB 2OHVA 3FCAA 4O4LF 3RBVA 2EEZA 2IYRA 2ZIXA 3NPAA 4OXXA 1J5PA 2MSDB 3G0OA 2ZCJA 5JC1A 2ZI4A 1OI4A 5AHWA 5BN5B 1R0YA 1J70A 4E4RA 3E61A 5ARCA 2NVWA 4AFNA 4AWBA 4RU1A 4UHJA 2JAQA 2M6RA 4TZTA 2PXAA 4FGJA 2IUFA 1NP6A 2BEKA 3EG9A 1NP3A 5TEWA 2IELA 4PZCA 3AB8A 4ZTUB 3OBIA 4RTJA 4BQIA 1NFFA 3L1JA 5KJ6A 2ZI9A 3VKWA 3LXMA 2FHPA 3W9SA 2J67A 4II7A 5U1PA 1TJ4A 4HC4A 1BRTA 4R1MA 3H4VA 3JPWA 5DRYA 4KGXA 2FUG1 1KKLA 3AQ4A 2O8DA 1ZJ6A 2X6QA 4NBKA 1LX6A 4XEHA 4LJAA 3D1JA 3ZTTA 4L7VA 3BJZA 1QSGA 2C2XA 1SB9A 4MRNA 1QCDA 4QT4A 3S40A 4EBFA 4JLVA 5LJIA 1C3LA 1B6GA 1P6UA 4RZQA 3VU3A 4EKIA 1A3CA 2AV6A 4Z6KA 4XPZA 1W5TA 3JQDA 3R4CA 1EGMB 4W5JA 2XRFA 1KU6A 1M7GA 1R8XA 3EXFA 2PWAA 1G5PA 2WSSA 4U2CA 2DXIA 3DEKA 1P31A 3PVZA 3AJ9A 3R40A 3LF1A 5BSGA 2YW2A 2HMUA 3WXBA 2MWMA 5TNXA 1SUIA 5F33A 3ZWWA 2HFKA 4M0KA 2GN2A 3KQWA 3RHTA 4BO9A 4Q1AA 4PRYA 1NOIA 2XZLA 2PAFA 3AO0B 1DTWA 4IP0A 4GUDA 4Y2TA 5B58T 5JNSA 3QMPA 1CVLA 1MVNA 3E9MA 1AKQA 3LYUA 3V48A 4BS9A 1HQKA 3U09A 3DMPA 4PX3A 1T3HA 5JRZA 4CM1A 2F3QA 2GCIA 3NT4A 3EN0A 5CNKA 4LWOA 1TJPB 3BHIA 4WA8A 1ZU5A 2HLDD 1KHHA 2JVIA 3DZ8A 4OH1A 3RNLA 4DIBA 1KPIA 5U4XA 2WT4A 4CKEB 2W2PA 3NGLA 3WV5A 3GAMA 2ATVA 3UQYS 4DEXA 2D2EA 3VI3B 3OZTA 4EVQA 2R44A 3U3KA 1V48A 4XWOA 5JO0A 1JQKA 5DGCA 1BDHA 3ONFA 2JFGA 2PPVA 4QICA 4P86A 2O59A 2HN9A 4ENPA 4LJ7A 3NBQA 2X9QA 2X9GA 2VQ6A 3KZXA 4L2IA 5CVEA 5TGTA 2ZJAA 3H11B 1WXXA 1SCAA 2FVYA 1F14A 2EGHA 2CNDA 1CR1A 2BZGA 2K7ZA 2UUCB 4D4LA 1B8NA 1WD7A 2C4TA 3GGDA 3LKZA 4IDFA 4K2AA 4TLBA 4BTVA 4MW1A 5LMUB 4OCZA 1LLFA 3I73A 4GUAA 1FXWF 1N5OX 3OTHA 1LC3A 3WDKA 3G2MA 1JSRA 3H16A 4KR0A 4EBBA 1AVTA 4Y2JA 2GN4A 2P4EA 4LY3A 1H9BA 4O4HA 16PKA 2HGZA 3VOTA 4ASUA 4Q3EA 4DHWA 4EG7A 3HXPA 1A8UA 2WM3A 4QELA 3LQKA 2SKEA 3KJGA 1DC5A 4AL4A 4PPQA 1YIAA 2GN1A 1TQ4A 3UTDA 1M1YA 4QX6A 5C7OO 2G5GX 3INRA 4DV7B 3C8DA 2O4CA 2JK1A 4I6GA 1NYQA 4EVIA 2EWVA 2X7JA 3VSDA 2P78A 1E0DA 1NM5A 2A9OA 2Q3FA 4JZKA 3MCWA 3VX3A 1IQ0A 1T0PA 4PHTA 4CKBA 1X7WB 4MMZB 1G8SA 1HFWA 1V43A 1L7DA 1CR6A 1JW9B 1SIOA 2W42A 1N7HA 2XA9A 1XFDA 3T9CA 2UVDA 1JUDA 3CN9A 1L5HA 2QUZA 1YU6A 2X0EA 1AE1A 3ODPA 1L4GA 4NSNA 2W8BA 1ZVJA 2YN2A 2B25A 3K6KA 3I62A 2VRCA 1DJLA 1RE0A 1U8TA 1XZCA 2WP0A 1JWAB 4FX2A 2OGWA 4Z8XA 5F7ZA 2G63A 3BL5A 2OLKA 1N2CE 4GMGA 3CEJA 3VSCA 3W2IA 1PD1A 2IP4A 4K1XA 3R75A 3I39X 3AVQA 4XASA 3WWCA 2V9ZA 3HN6A 5AVOA 5FPSA 3B5IA 3LDUA 4FR5A 4KLCA 1YCFA 2NV0A 4UC0A 5JH7F 3BM5A 4C29A 2FMIA 4FM9A 2TRSB 2QF7A 1A4XA 2RHDA 1BSVA 5TXGA 4AVYA 4YMVA 4PRKA 5BP7A 1IU9A 1CZRA 1O6ZA 4KMOA 4WZ6A 1QYCA 3MQFA 5F2KA 3GFVA 5FPTA 4XKJA 4CM4B 1X3SA 3AH8A 4ZQHA 1QMGA 2Y68A 3HXTA 5AUQA 1T8TA 3D4LA 4P3PA 1QIGA 1TC2A 4DXDA 3BMQB 2PGLA 4U7FA 3PXXA 2K2QB 4HGYA 1I5EA 1L7VC 4KFSA 4U7HA 1AV6A 4G63A 4OB6A 4O4HB 4ZV9A 5B3AA 4EECA 2B36A 1I7QB 4ND6A 4LS3A 3ZE8A 3DV0A 4XSVA 2Q0HA 1KPHA 4GEKA 4CM3A 2YXLA 1M2EA 1RI2A 3GCDA 4MKHA 1GAWA 3WDMA 3U7EB 1EFPB 1OAKA 4EY3A 4V1CI 5K05A 4RTSA 3K94A 1YO6A 2JKYA 1T9GR 2V7UA 4G1BA 3C8ZA 5C8DA 3I45A 2Y1KA 1U6IA 4L8FA 4UFNA 3R5TA 1A96A 5FBKA 3P2JA 5HJEA 4AKSA 4UM5A 2OR3A 4NBWA 4ZODA 5GVRA 2QBYA 3TUIC 1T1IA 4IY1A 4TMTA 1XN1A 5CVUA 2ZYVX 3I61A 5EIWA 3AEQA 1KC1A 1HEYA 1Z6QA 5TS3A 2AF3C 4G1CA 5DHAA 1V4NA 4UZEA 4FEGA 4BWYA 1OB5A 2ZYRA 4XQ0A 4QUBA 4RJJA 1UWVA 1ZM2A 4P36A 4J7XA 4BQRA 5JWRA 4X65B 1FX0B 1YTLA 3EGOA 3LKBA 3IS3A 4N3AA 4TS3A 3ZHQA 4H3HB 3KO8A 1LPOA 5CDFE 4YUVA 1MQ8B 2GLUA 1E9VA 1M7BA 1ZS9A 5KZMB 1C50A 3HE3A 1WZUA 1G2OA 2VO1A 1X1RA 1NOKA 1TEHA 4WNYA 3QXJA 3GY0A 4G0NA 1SKYB 1QRDA 4ZVQA 3R7DA 3PBKA 4EGAA 5I7FA 4ZVTA 2IKQA 1EVQA 1RI5A 3WTCA 4ZAYA 4DDTA 3OIYA 3HLYA 2Y1GA 3EQZA 4JYMA 4L50A 1G3QA 1N1MA 4AJNA 2P1RA 1NDHA 4DA6A 1CRZA 2QAGA 3FYTA 1C4OA 3VPGA 1FDUA 1NFRA 1W5SA 4E11A 1A4RA 3L93A 4B83A 1BKSB 5AJUA 1K2VN 1Y8RB 2H3EA 3F6BX 1P72A 1GM5A 2CHGA 3L01A 3DE0X 2IYAA 3N59A 1FFDA 4AG6A 2FUCA 3KSMA 2IYQA 1NOJA 1USIA 2K2WA 3N6RA 4YPVA 1Z7YA 5FPKA 3C3XA 4G5HA 2C5EA 4PSAA 1J9ZA 4LHEA 1NQVA 3RVSA 4DDMA 4E4TA 2C2BA 4OQ4A 3FMPB 4LWQA 1QP8A 3L7IA 4ZEWA 3MGGA 4L76A 2OZLB 5ALLA 3FPCA 3PD0A 2RKBA 2QSUA 4FHGA 4Y8VA 1K5PA 1QHXA 4EO9A 3LL7A 1GRRA 3KV3O 4L28A 4WOPA 4H3KB 1PT5A 1RBQA 4JVMA 1TCBA 3GLHA 3H1GA 3KXKA 1XU7A 1QKKA 1XEXA 2WJJA 1Z36A 1RMYA 4O2LA 1OCEA 3H5WA 4X5OA 5FORA 3RSQA 2BDEA 4RWEA 4CXMA 3EYAA 1K06A 4DEYA 5DEIA 5HS4A 4K6FA 3TMAA 2XE8A 1EGAA 2HLDA 5GZ6A 2OV6A 3WK4A 1XVTA 1DQYA 3H6KA 2I4TA 2OV1A 3L7JA 3R0IA 2GT1A 4QBIA 1L3BA 1GDHA 1NFQA 1PR6A 2XB4A 3DLPX 4MVWA 1TNDA 4CV3A 4J1QA 3H9UA 1BQ3A 4LZNA 4L95C 4L6IA 4RM3A 3FZNA 3LK6A 4DIOA 1UWCA 4ZGGA 3HCBA 4BNMA 1G9XA 4CFZA 1GA4A 4EABA 3HLTA 1HRDA 1MB2A 4Z9AA 3IIIA 4MS1A 4BVKA 1R3DA 1VHLA 4KLRA 1Z5WA 1I3NA 3CUYA 3QKIA 1M76A 1SBTA 5KTPA 4UXJA 1WETA 3OEHA 1BQEA 1OXTA 1AUOA 3OQIA 4AJ9A 1RQXA 4XYMA 2I03A 4P7BA 3H2SA 2XECA 3NBMA 1MAWA 5EERA 3MC1A 4BLRA 5ECGC 4G36A 1IBMB 1SG0A 3CRQA 3ZDYB 2AE1A 2PS0A 5KVAA 2AJCA 3EEOA 1OT3A 4Q48A 4N9QA 1G38A 1BE1A 5GMOA 1WSDA 1Z7GA 1ZJJA 4X62B 4FQ8A 2GGSA 3CH5A 4I4LA 2BN4A 4JUFA 5HRCA 4UNPA 5KYUB 3E9YA 1LU9A 1REQB 3PI7A 3Q0IA 1Y7HA 4EY4A 1ODSA 4LRTB 2O50A 3GEBA 4A1OA 1FTSA 3RSSA 2GVNA 3DDNA 1JI3A 3MCTA 2JLCA 4MOWA 1RKVA 3ZZMA 3HJAA 2IF0A 1UANA 2JD1A 4CM8B 2NOAA 2XMSA 2ZJ5A 2C96A 2HXYA 1X9IA 3BWEA 4GICA 1CP3A 2I78A 1ZD1A 3SC2B 2BKUA 2B0CA 2HK7A 2WC1A 1WLYA 1X9HA 4ZD6A 1LBEA 3Q0EA 4L16A 3IAUA 5HG0A 4JEIA 3RVPA 3WOHA 4BLSA 1N6NA 1RWVA 4WRRA 4M9SA 4KIJA 4CL8A 4DDWA 3Q8LA 3T4XA 1MIOB 4QNMA 2AZXA 1KYVA 7MHTA 2E55A 4BVAA 1O1YA 4W1SA 2EJVA 5FWAA 5I7RA 3X1YA 4NH0A 2F4VB 5ICGA 3HO6A 1QHFA 1F2DA 3B70A 4RBNA 3BWXA 2JAHA 5JSKA 1E2KA 2QU8A 1YDMA 1DZIA 4IVPA 5CIWA 4HNRA 2R1VA 2C58A 4BY9E 1URPA 1ORRA 3FW1A 1VJ0A 4M4SA 1X1DA 5EWJB 1SHJA 2BDUA 2TMDA 3AI7A 4PLWA 3ZHVA 2NP7A 1TGVA 1AZWA 3NDIA 3MSCA 4GBJA 4E5SA 3LOPA 3JW8A 2EKPA 2PL3A 3FJYA 3SVTA 1YTUA 4KXLA 2AEFA 3VC7A 2O19A 4XB2A 4LMRA 1JWLA 4CHTA 3WYNA 2VQFB 4M1MA 4UNNA 3TW6A 4GX2A 3AEYA 4S04A 1W6UA 2H4ZA 4RD4A 1ZINA 4BKUA 5DBHX 4JSYA 4Q34A 5K0EA 1R74A 1Z6PA 2ZIGA 1HLDA 4WA7A 3LV8A 2CC2A 4HF7A 2Z4RA 1EZ4A 4GOXA 4RSRA 4M53A 4XLTA 2Q45A 2Q7OE 2EFHB 4LX0A 1KEPA 2VK8A 4X8MA 3KQLA 2IH2A 2OB2A 2WTEA 4K26A 3IHWA 4WOCA 2O3SA 3LBNA 5FTKA 4DWJA 2W8ZA 3D2CA 4MUJA 2CV2A 1VJRA 3K70D 3P2KA 2NVOA 1ST3A 3BB1A 5ADHA 3YASA 3W8NA 4JFAA 1UMKA 1P5JA 1RMQA 4FLEA 4MINA 3M5CA 3NH9A 4B17A 2XCTB 4DB4A 2FR1A 2OKGA 1TCAA 1WPQA 3RVMA 3R3XA 4G4SP 2NXJA 4LF5B 2YZ7A 3HFJA 1WDTA 2C9BA 5D5HA 4NECA 1W0KD 4CEIB 4YDHB 4C88A 2C3MA 2A14A 1T9HA 2RFLA 2JHCA 1E2FA 2BMAA 3H3JA 3HSKA 1G9SA 1XAHA 1G3RA 4FPXA 5TLSA 1KI6A 2DWCA 5DW3A 2EX4A 3BE8A 4KX5A 3U0VA 4KPYA 3NP9A 1RSZA 1L4NA 1D1SA 2AN4A 4MUXA 5C5CA 4KR3A 1ONPA 2ZS7A 3AHGA 5K3SA 3KM0A 1GR1A 5IDQA 1L1EA 1AB5A 1RPNA 1SHLA 4KPGA 4WFJA 3AVVA 1PEAA 3ZWKA 3VR5A 3C3BA 3UV3A 1C1XB 4JC0A 4X92A 3KQQA 1T36B 1PFKA 1NX6A 4GPIB 4GSKA 5AXAA 2YVAA 3HKEA 3NB0A 4BNDB 5BYAA 2VDRB 2WF6A 3N8IA 1O96A 3E2MA 3RLFA 1Y5NA 3CR7A 4EI8A 2JI9A 3IUEA 1OC2A 1Z75A 3DV9A 4KU4A 5IT4A 3HDQA 2RB5A 5EE0A 1SD2A 1X7HA 5AVJA 2KS6A 3PFWO 1QHHA 4I9FA 4MRVA 1X0XA 4LZZA 2ISCA 4ENUA 4YMGA 1YGYA 4MWBA 4E5UA 5IJ0A 2JIQA 5DW0A 3ET5A 1JNYA 4YRMA 5F77A 4U7PB 1COWD 4V0MA 3DDHA 3RE1A 1EEXB 1H2FA 2KLBA 3PJFA 4KDRA 4D4KA 1PW7A 1D0SA 1FYDA 2Q41A 1EFRD 3OEHD 3QK7A 4G5OA 4XQ9A 4QUIA 2P7HA 2W6CX 1FVFA 1ZOSA 2JC3A 2YHIA 2I29A 1QGUA 4KEAA 4LMPA 4PG7A 1R2QA 3NRBA 3K09A 4JC4A 2D3TA 3SE7A 5K0GA 3IAXA 1IZ7A 3KL4A 4XQGA 2W6IA 3EG5A 2XE6A 4UEOA 3MT7A 1SCIA 3G7UA 1H1LA 3UJHA 4D3DA 2FMUA 4KLAA 3O9MA 3W4IA 5AVZA 1H65A 5C5IA 3CIFA 2PUAA 2X3UA 5LQUA 3CB2A 3ZVNA 1NXVA 4Q9HA 2I67A 3HCNA 2VSNA 3V1YA 2WIFA 3MGAA 2G09A 3DBIA 4FT4A 1BCRB 5A1JA 1EUZA 1C0IA 4QASA 4UBLA 4ZDJA 5KKCA 3PUXA 1TT7A 1Z4JA 2X2OA 1UJ6A 2PY6A 4KLNA 1TE2A 2AZTA 3L3BA 5E1DA 3WBKA 3MXTA 2WOJA 5I9NA 3LQRA 2ZB8A 4EMUA 1J2TA 4P2BA 3DCNA 3TIXB 2F8SA 4H7EA 2C4HA 4BGEA 3FR8A 4OFWA 1XRPA 2SCUA 4CLHA 1H2BA 2HDHA 3X1KA 1GP2A 2B6HA 5A62A 1JEYB 3ESBA 3HFSA 2JK0A 3TTTA 4D4IA 2ZIUB 1VHDA 2SECE 1SXHA 2QRNA 3CNOA 2BM1A 3K9FC 1VTKA 1NI4A 4AY4A 2DLDA 4EO7A 3L79A 2NADA 2V58A 3ETDA 4ZOQI 4HDMB 3AY3A 4EF4A 2O2CA 2OUIA 4DGQA 3F6SA 1RMTA 2PFSA 3OZGA 1LNZA 1EWQA 1ZJZA 2HXSA 2J32A 4G26A 3ZYCA 1YJXA 2X5KO 2WVHA 1SR8A 3URMA 1NUTA 5ICEA 1ZR2A 2CDAA 4ROSA 4JN6B 3D4OA 3F9IA 1Z0ZA 3H5TA 5AUOB 5HA5A 1SC3A 3KD2A 1US8A 2BFEB 1N7GA 4WBNA 3ZE9A 4W5OA 2F6RA 2QIOA 5KTRA 3DEIA 1J4AA 4D97A 3U80A 4OQLA 9ATCA 3N05A 1ABFA 4ZYTA 4A0RA 1XK7A 3OX2A 5KO2A 4Y6QA 2G7ZA 3FNBA 3SPXA 1Z25A 4Q4CA 1S8NA 1BU5A 1RQLA 3F6RA 5CYGA 1U3UA 2RI0A 3EVNA 5I4IA 4IM7A 1PV1A 3HBMA 3BJIC 4YB8A 2IT1A 3WGGA 1FS6A 2CMDA 3IEPA 3L0OA 3H05A 4LOHA 3RYIA 3ZUPA 1WU7A 5E95A 3GH1A 3AXSA 1M2VB 2BP7B 5JG7A 3Q6NA 5BSRA 3SLKA 4BYGA 4KQ1A 2E4ZA 4W82A 3BK2A 4EUHA 4EQ6B 2Z09A 3LUKA 2O2IA 2FWBA 2Z1NA 5CB4A 3TTVA 1Q12A 1JKFA 2HCTA 3I52A 4IFTA 3WADA 5KYXB 3PQ2A 3ADKA 4RJTA 4HWOA 4DLVA 5IJZA 1RKUA 1HR0B 4MO2A 3UA4A 1AMUA 3V4RA 2FN9A 4RCVA 3GDWA 5F52A 4BMPB 1YRLA 1W9MA 1FDTA 2XUOA 3NKLA 1L7XA 4Z2YA 1VL2A 3OPMA 4DM7A 4X6YA 1TCVA 4DMRA 4CWAA 2O2HA 2I3AA 1KFKB 1YB5A 1AKYA 5LQNA 4JLUA 3INGA 3C6XA 3DVSX 2VWQA 3D3WA 1G9TA 2ZJYA 2I55A 3MWKA 5FTMA 1CY6A 2OYSA 2ZJ0A 2R48A 1HEUA 2JAOA 2FPGA 5EIOA 2DPXA 4JD5A 4DADA 4WXYB 5HS6A 4RYDA 1B6SA 2XCIA 5REQB 2Q49A 3JZAA 2C82A 1SCDA 4NE7A 2L0XA 5CR9A 5EEGA 4ZEMA 1LDYA 2NYVA 5BVGA 2Z2IA 2YL2A 2A9RA 4UAVA 3ISTA 5EXPA 1Z26A 3TLGB 4YV2A 5IAAA 4C7OB 1PLJA 3H17A 3KAKA 2ZBPA 1BN7A 1C0PA 3N87A 4FN4A 4YRPA 3WMGA 4DR3B 3K30A 2UXBB 2V74B 3DLCA 2RH9B 2VEOA 3GJ3A 4B09A 5EE5B 1IJEA 3P9KA 5JVDB 3VJKA 3EDCA 5JAZA 1E3EA 1DV2A 1OLSB 5BMVF 2GYVA 2I2CA 2PD3A 4IOJA 1MRZA 1G5HA 5K8UA 2I4LA 3DT9A 3RB8A 4I5GA 3BGWA 3UATA 1QU2A 1GUYA 1WPXA 3FPGA 2DQSA 3HJBA 1MORA 3R6GA 4GFDA 4HQ6A 4OXYA 1D4OA 3BXHA 4QFMA 1JTVA 3TOXA 1G3MA 3NVMB 1LI5A 2ZAOA 4UQLA 4QFDA 5CGQB 5BVGB 3UV6A 2YV5A 3PFBA 1KY3A 2DERA 4OGLA 2ASEA 3QYAA 1YA8A 3BRQA 1NMZA 2FEXA 2ENWA 1P1IA 1Y7LA 2A78A 2IYEA 2R6R1 1GA6A 3C39A 3P2EA 3WLAA 4PAOA 4NY1A 5CH8A 1L7MA 3GMIA 4Z1MA 1DRJA 1U7PA 2O1SA 4HDNA 1HX7A 4AICA 5JBNA 4DLZA 2G3YA 2JDID 4ND8A 3TR5A 2P9QA 3WBBA 2ISSD 3ANYB 4G9GA 1NVUQ 3RTCA 2VOEA 3UFXA 5IEJA 1G2QA 1YZVA 1D4AA 1JFFB 4BMYA 1VLQA 3K32A 3HXLA 2EZ9A 1J8VA 3K9WA 1TFUA 2X5OA 2Q6KA 3UWSA 1L0BA 2QYHA 2ZSBA 4FOTA 1KORA 1U98A 2IDZA 5EWLA 4HLUA 1VSTA 5L40A 4H1HA 3GLIB 4Q4DA 4YCSA 1T2VA 4G8DA 5G4KA 2QW0X 1J0BA 1T0BA 1RAIA 2R8YA 4HLCA 4M0DA 1E2NA 3RF7A 2NPOA 3JAKB 1FJGB 1JLMA 5ALQA 3VSBA 1ZBQA 2ZIAA 3DDUA 3SMQA 3VKUA 3NTLA 1CEQA 4ETWA 3K8QA 1ZGZA 5J47A 1Y4ZA 2NQ8A 2YDXA 4OB7A 2R1VB 4HB2A 1WXWA 5A3JA 3UZUA 3RAEC 3PGVA 1CY7A 2VF4X 2AOVA 5EIHA 3VHXA 3W2EA 1YB6A 2JBAA 3F7TA 1FNSA 1QDLB 2M6KA 2O7SA 3KP1A 3V4PB 5CFLA 2V0GA 1KK3A 1TW3A 4Q1DA 1JQ3A 4PLGA 3RRZA 4KX3A 4AN4A 1T4CB 3D7MA 3GLKA 3DTNA 3GOHA 3BOSA 4M37A 2FR8A 2X41A 2Z4TA 3A0UA 4UAJA 4ITVA 4LXYA 2ZR8A 4KQJA 3EXHC 3CZMA 1E69A 3K1YA 1NDUA 2YBEA 4L8YA 4URFA 4HSGA 5FOTA 1JFSA 2FSUA 3EXEA 3KDAA 4IOMA 4NR0A 3FDFA 1ZM4A 1POWA 3BGSA 3ZWYA 1ELOA 4C0KA 2HBYA 4Q37A 1XCMA 1K5GA 3ROFA 3REOA 1JVNA 4AZ3B 3SM3A 4DJFC 5HOEA 4GQBA 3KOYA 3G23A 1AA9A 1I13A 2G77B 2R6AA 4ZVNA 2YOGA 3H19A 4I46A 2I34A 4PW0A 4ZVUA 5C18A 4HDOB 4M8NE 2GO1A 3VVLA 3JZMA 3F3SA 3ON5A 3TD2A 1P1JA 3DW1X 1JZSA 4PNZA 1XMJA 1QKJA 4FR0A 4IFIA 1W96A 2C77A 3EF3A 3UAVA 1PYOA 4U9UA 4O5AA 4JK3A 1JS1X 3CS3A 2F9FA 4E4YA 1S2NA 3PRHA 1MO4A 4OA5A 4F0JA 2J6IA 1LPAB 3PA6A 4JX8A 1KMMA 1KS2A 3L4SO 3TLGA 4JGGA 3U9LA 1P33A 3WRXA 2H5IA 4FDMA 4R0NA 5DNWA 5ENDA 4POOA 1EQAA 2PGIA 5LYJA 5LXTB 3TZQA 1LQTA 2VPYA 1AA6A 4RMIA 5SYMA 4HVCA 1OB2A 1Z2CA 4LMBA 1Y3BE 4O4IB 4U9IS 2LCQA 1QXSA 2WD7B 2P62A 1ZIPA 2C4VA 2VJPA 3DCYA 4WCFB 1C4KA 2QP9X 1TQDA 2NV2B 2Q8QA 4PF1A 4R1UA 3V3TA 5FTJA 5I8WA 3DD5A 4BX0A 4HTFB 2HSEA 2C20A 2OFWA 5JLAA 3UG7A 4BE7B 5EUCA 2HLNA 3ROZA 4ZQBA 1N2CB 1XV5A 1S8OA 3ZKWA 3B6ZA 3ICQB 5CDFA 5L45A 2VDWB 4GM4A 3QLVC 5CYOA 2AYXA 1XTJA 1X8LA 2E87A 2VHYA 4IUYA 3W05A 5FT9A 2VP0A 3R41A 4MW7A 2C99A 4XIFA 2CUZA 2YWCA 5HKAA 3S1LA 1JA9A 2PQ2A 4CT4B 1XLWA 2CFIA 2XY4A 3D8RA 3EVBA 1JH9A 2PMWB 3QHQA 3O1IC 1J6UA 4IGAA 5AI4A 5FOQA 1WUIS 5IANA 5G4LA 4UATA 5HIAA 3LX4A 5CG1A 2DHQA 4MUIA 1JPUA 3LX5A 2FZKA 2LZ0A 2WFLB 4Q3NA 5EJ4A 2ZYDA 3ETJA 4XUCA 5IFLA 4KYUA 2YXDA 4WLEA 4WKCA 2XR1A 4HQLA 5J1SB 1T5DX 2IYPA 4B85A 3LUPA 2XMGA 1RI1A 1JQEA 2H4WA 4IJKA 5EWMA 4DCJA 5ICFA 1QVAA 1QGED 1ZD2P 4UTVA 5CDTA 2UXDB 3TXAA 2RGGA 2RHOA 2DCMA 2JANA 4JLMA 4ZV7A 3SDZA 3SHOA 4BV2A 1FZQA 2ZAIA 2XUAA 3QPAA 2NVUA 2Q28A 1HG0A 1DAOA 4W4TA 3THRA 4CMJA 3MF4A 5LUAA 2BC9A 2OCKA 2Z2JA 4C78A 2CHVA 3I04A 4I2NA 3I34X 2GKSA 2JZOA 4QLAA