3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
3GCWA 4B5LA 5FBZA 3L1KA 3LPDA 3TI9A 2DUJA 1C9JA 4KPGA 1NDUA 1AVTA 2W2NA 4JP8A 1V6CA 1TO2E 2V8BA 1SUEA 4CG0A 1PJ8A 2QTWB 1SN7A 3H42B 3DVSX 1SUBA 4WOBA 1BJRE 1SUCA 1ST2A 2X8JB 5AMXA 5SICE 1GNVA 3CO0S 3I34X 3T41A 1R0RE 3DE6X 4KG7A 1P7VA 1UBNA 1SVNA 4OMCA 3I30X 4LVNA 2DP4E 4DZTA 4K8RB 3GT3A 1YJBA 4NMXB 1BFKA 2ID4A 1KE2A 2ZWOA 1SCJA 1AU9A 1GCIA 2SBTA 2PKCA 3VYVA 1T1GA 2ZRQA 5B1DA 1SIUA 1CSEE 1PTKA 1DBIA 1SUPA 2PRKA 3Q40A 3DDZX 1GA1A 1Y4DE 1OYVA 1ZVKA 1SUDA 2XTJA 4H6WA 3AJ8A 1TM1E 5AVKA 4OMDA 1S02A 1VSBA 1T1IA 1LW6E 1TM7E 4AKTA 2PWAA 1JEAA 1AV7A 1C9NA 1GTJ1 1BE8A 3VSBA 1BE6A 1GTG1 3DE1X 3PRKE 4AKSA 1KDYA 1SUAA 2W2PA 2PWBA 1EA7A 1OT5A 5JXHA 3DE2X 1SIBE 3LPCA 1SBCA 1NDQA 1GA4A 2HPZA 4DJ5X 3EE6A 3F7OA 1SCBA 1R64A 1TM3E 4YN3A 1SCDA 3LXUX 3DYBA 3VV3A 2HD4A 3VTAA 2P4EA 4MZDA 1TMGE 2GKOA 4H6VA 2ID8A 1Y9ZA 1KDVA 1AF4A 4ZOQI 1ZVJA 1IC6A 1NLUA 3DE7X 1C9MA 4NE7A 3QTLA 2IXTA 1Y34E 2SNIE 2W2MA 3I2YX 3WIVA 1SELA 2Z57A 1SCNE 3A3NA 5I9SA 2IY9A 3D43A 4Z2AA 3EDYA 3HJRA 3OSZA 3GT4A 2W2OA 2Z58A 3UNXA 1P7WA 4H6XA 3SICE 5JMOA 1SH7A 4KB5A 1YJAA 1SBTA 4C3VA 4DWWA 4HX2A 2Z2XA 3DWEX 2Z2ZA 3VV2A 3DVQX 3BX1A 1SBNE 1GA6A 1EGQA 1HT3A 1A2QA 2Z56A 3VHQA 1C3LA 5AQEA 5ARDA 5AVJA 1IAVA 1Y4AE 2DQKA 1Y48E 1KDZA 1Y33E 1AH2A 1BH6A 4C3UA 3GCXA 1BFUA 1TM5E 1WVMA 1S2NA 3QMPA 3ZXYA 4HVLA 1TK2A 3TI7A 4NE9A 1TO1E 3ZXXA 2XRMA 1Y3BE 3DE0X 1P8JA 1GT91 5JXJA 1SBIA 1R6VA 4I0WB 1ST3A 3A3OA 3DE5X 2Z2YA 3AJ9A 2SICE 1TM4E 1THMA 1MEEA 4CFZA 4GI3A 3TECE 5K7SA 1WMEA 2ST1A 3BPSA 5FAXA 1TECE 5FFNA 1Y3DE 1AK9A 1MPTA 2SECE 3DE4X 2WWTA 1Y3FE 1XF1A 2PMWB 5CW1A 1SPBS 2W2QA 4J94A 3PTLA 1Y1KE 1DUIA 3LPAA 3F7MA 3DE3X 5B1EA 1Y3CE 4BWGA 2WUVA 1WMDA 5ARBA 2B6NA 1AQNA 3DVRX 3F49S 3I37X 2G4VA 1WMFA 2TECE 2PQ2A 1T1EA 3DW1X 4RYDA 1YU6A 2WV7A 4CFYA 1YJCA 3P5BA 1OYOA 1PFGA 3WHIA 1V5IA 5ARCA 3WQBA 3CNQS 1Q5PA 4WOCA 2X8JA 3AFGA 2PYZA 4OV6B 1CNMA 3SQOA 3DW3X 3BGOS 1SIOA 2ZWPA 1KE1A 1SBHA 3D9QX 2E1PA 2Z30A 3Q5GA 4M1ZA 3WIUA 1WSDA 5JXGA 3EIFA 1PEKE 3A3PA 1GNSA 4LVOA 1GTL1 1SCAA 4FONA 1S01A 2WUWE 5JXIA 3QFHA 4ZARA
chains in the Genus database with same CATH superfamily
4KO1S 3PNYA 4B5LA 3U09A 4JUCA 4LHVA 5FBZA 4GFDA 5JH7B 1CQWA 1MBZA 2ZUVA 3RLIA 2FLVA 1U1DA 2AJ8A 2IUFA 3FUWA 2GN9A 2YZGA 4HAUA 4P5DA 3FY4A 3QLVA 3VKWA 3KJIA 1AGRA 2QGFA 1GTMA 3F4BA 3ZCPA 2ZR7A 1MT0A 4I5EA 3C3CA 3MSXA 5GONB 3UMVA 3GRAA 5KIAA 3T7KA 1UPFA 4HGPA 4YEDA 3ACBA 2P75A 5TMDA 1KP2A 4CKEA 4BX2A 5BUZA 4KYTA 5CIQA 1UINA 1D2NA 2JI6A 5FF9A 3ZWMA 4I5FA 2PL9A 3HFRA 2ECPA 1TNDA 4IG4A 1RTKA 3NEPX 5CCEA 3HB9A 1FJHA 2ZSBA 2VQEB 1TUEA 3QU7A 2CMFA 1FBTA 1RVV1 2X5XA 1HOXA 4D9GA 5CH8A 3IDOA 2NXEA 4BNXA 4JI0B 3IJRA 4L8GA 4Q9AA 4W5QA 2CSXA 3FB4A 4AROA 1WABA 3FPCA 3LA6A 1UZNA 3EIWA 2FZEA 4JGGA 1Z18A 4KOEC 2QN6A 4KG7A 5GM1A 3P2IA 1WX1A 3QKSA 4FN5A 3NDRA 3OC6A 5GJCA 4CR6A 3QXXA 4Q3AA 1OCEA 2OYRA 4G8CA 4MHOA 2AQIA 4LAFA 1DS6A 3DB2A 4MP3A 3ST7A 4U9HS 2HN9A 5AKLA 1SEPA 3EC7A 4WDQA 2C2KA 2R7KA 3HCAA 4D8WA 1M5RA 2ODBA 2WT9A 4DZTA 2CD7A 3WGLA 4K8RB 4UTXA 3VR5A 1BMFA 5D86A 2Y05A 1N33B 4L3VA 1YJBA 2O3TA 3IXMA 3HWSA 2QZPA 3AU8A 3L1UA 2W6MA 4NRDA 5DN9A 1OU0A 3LO5A 5FULA 4HH3C 1F5SA 4FGKA 3VNRA 4DAOA 1AXRA 1OLXA 1P8AA 1DMRA 1YDGA 2DQZA 1H9AA 4TTJA 1QKIA 1KO1A 1RWNA 3SX4A 4JU8A 3W6PA 1TC1A 2YYAA 5LCXA 3T1NA 3PWKA 2BEVB 1CNFA 2KB0A 4EJFA 1W76A 4HK4A 1ECLA 5JLAA 1LC0A 2AI1A 4UAGA 4X1YB 4CR8A 3R7WA 3HCWA 4WZBE 1JHMA 1I30A 1OI4A 1Z36A 4G2TA 1B14A 4NYJQ 4B7XA 1JEQA 4TPKA 1ZFNA 5JZMA 4DKXA 3ABQB 2DQ4A 2GEKA 2WOJA 2XE4A 2NNWB 3NHYA 3OPYA 4GBGA 4DR7B 1AE1A 2CE2X 1YDEA 2IYLD 3E48A 3GZNA 4IQFA 2XCQA 3NHRA 4DR3B 1PQUA 1VMDA 1ZH0A 2GAJA 3PSHA 4NNJA 1HFWA 4LJ9A 4I6JA 3TLEA 4DJEC 3LUBA 3NIGB 1AK2A 4E11A 4YFYA 2RGRA 2VUUA 3JAMA 4JJKA 3WYFA 2BGKA 5A1JA 2WICA 2I34A 3HN6A 3I1YA 3M2TA 2EFCB 4XVRA 1Z45A 1ZVKA 3TEMA 4RL6A 5K1ZA 2GM4A 2ZKLA 3GPIA 4IR7A 1XDUA 1JR2A 1UP7A 4MI9A 2Y1LA 3R6GA 1XZLA 3GLVA 3Q6IA 4M98A 3HCRA 3VJMA 4GF5A 2QL7A 1W7AA 4C0QC 4AD8A 1UBKS 3AOEA 2JK1A 1VJRA 1X9HA 3SSAA 3QU9A 4G6ZA 5L6LB 1G8JA 2GK4A 2IIQA 1MVLA 3AHEA 3ZVNA 3ZV6A 5ITZA 3EPHA 4IIXA 2J6IA 4PYOA 3STWA 1D3AA 4JT8A 3BBPA 2PWAA 3CLHA 3M1LA 1XK6A 2B20A 1V47A 4RMGA 5ER9A 5KBYA 2XEXA 1C8VB 5K2MA 1IPFA 2YXBA 1XD8A 4B6OA 4EGFA 4JQYA 1HQKA 2IXBA 3S8YA 5AT1A 4DM3A 5IWAB 2XDQA 3U3KA 1EDDA 2ABWA 2F8LA 4RGBA 4RWEA 3VX4A 3TIGA 1M74A 3QLEA 3DM9B 5LQNA 2EFEB 2AMLA 4Q4DA 5HS4A 1H8HA 3RC2A 3R9XB 4FW8A 1WW2A 2XUZA 4MV6A 2CEKA 5BN5B 1KDYA 5EG5A 5BSWA 1T2NA 2BBSA 1OZHA 3N0RA 1GZDA 1Z8HA 4UREA 5LOVB 3IUQA 4IFBA 5M5BA 4UCQA 1Y6GA 1S8FA 4ZJPA 3C16C 4MVJA 1M66A 3KR0A 3K5IA 5E9QA 1D9ZA 5B58T 1J9EA 2Q5QA 4XLLA 4AZTA 2AB0A 3RQIA 1H0SA 3PLRA 2XXAB 1U2DC 4DRXA 4JBIA 5KAPA 4CDRA 4KE7A 5LDDC 1KIAA 2R1TA 5I51A 3LPCA 4JQOA 4Q1DA 2V65A 3GLIB 1Q7BA 2GT1A 2OYCA 2GVZC 1L4BA 3GLGA 4R2HA 3WWDA 3RANA 4K46A 5HKKD 2P2DA 3OOJA 4C78A 5JZSA 1GO2A 2FZGA 2X1LA 4JJFA 1MOSA 3A9RA 5SZHB 1KA9H 1UMKA 2P9CA 4QYIB 3D81A 1VI5A 4MQFB 5FJJA 1XZ8A 4JBYA 4X24A 2C00A 3LX5A 4JROA 5FYDA 5IAEA 4EI2A 1SCDA 5GADl 3WRVA 1CP3A 3F8WA 3ABZA 3ACCA 1C41A 4ITVA 4PV7A 4QVIA 2ZIFA 3O26A 1KKUA 2OCLA 3VTAA 4KXLA 4RA6A 4KUEA 2E2WA 13PKA 2X0RA 2CHUA 3CZAA 3KKLA 4G63A 1NLFA 5C8VA 3QEAZ 1V11A 4XIIA 2CEAA 2F59A 4MZDA 5TPWB 3FWNA 4RHUA 2NSLA 5HGXA 2X23A 4MMYB 4AUMA 2QN8A 2AN5A 4C5AA 2IITA 3AZPA 3E61A 4HRVA 1MB3A 3IHKA 4XWGA 1JFSA 2WSLA 2ID8A 1QH1B 4JI5B 1GXSA 1ZJ4A 2ZIVB 5FPQA 3IAFA 3R7NA 2W98A 3D1VA 4Q00A 3QYPA 5EOVA 3THYB 3SSMA 1XPUA 3BGSA 1O96B 3L0CA 4HWSA 2J08A 5KKCA 3L77A 1J39A 4Q6BA 5B12A 2ZRLA 2EWVA 1IC6A 2X4GA 2GBGA 1Q6ZA 1Z0KA 3KYCA 5FWAA 4ER6A 1GGJA 1P9WA 1GNLA 3EOAI 5DHTA 3NTLA 1T4BA 4Z1MD 1UADA 1D0VA 4V39A 1W5BA 3PFNA 5E6RB 5IVDA 2E5WA 1DAPA 4V24A 3DVAA 1U3GA 3EFOA 4B8WA 1M8PA 3AEKB 1KBQA 3DDSA 4HWKA 2WB2A 4YXWA 2IBTA 4C7OA 1UAGA 1E79A 2HHCA 5C4IA 1MDBA 5IJZA 1XQ9A 3EVGA 3NC0C 5HMLA 3QE2A 3H04A 4XJTA 1O8CA 3H3XA 4PEVA 3T9FA 5K20A 5LLDA 1XWWA 3MGGA 3B6ZA 3FJYA 4C4SA 3KKPA 3AV3A 3KNZA 4UBLA 3DEAA 2FFRA 5EQDA 1F8UA 4F3NA 1U7WA 4W5RA 1YASA 2DM6A 1KK1A 1QOZA 3QTBA 4H1TA 4ZWNA 5DW0A 2HCTA 2B37A 4QXMA 2C2GA 1K8XB 2ZG6A 5CX4A 5FI1B 4EW2A 5CEJA 4H6XA 4U7JA 5HG0A 4JI3B 4IPTA 4PG8A 1JIXA 1E62A 4Z1OA 3PDIB 1DO8A 1JIJA 1P0MA 5DLQC 4LYJA 4RHYA 4KR0A 1E6EA 1IH8A 4WKNA 2PGIA 1HBJA 2AVNA 3AFNA 4N8SA 5AW9A 3VVMA 4DWWA 2W9XA 1BWQA 1G98A 2XNDD 4MYTA 4OXNA 4PHTA 5CDFA 4X8OA 3GEPA 5CYGA 1RWBA 2HDNB 4XM2A 1PT7A 2DGDA 3GLQA 3GDGA 2ZVPX 3LLCA 4C08A 2AEMA 3GK3A 5EPOA 1NU8A 2EBHX 3WWZA 2I1LA 5DCLA 3U56A 2RG1A 2WP8J 3AIIA 1QG4A 2A5GA 1ECJA 4Q6WA 3RFFA 3VR0A 1SZPA 1TAHA 4B9AA 5CG1A 2GARA 2SKCA 1KEWA 3IAS1 1A2QA 2E4ZA 4RY2A 1CEXA 2CL6X 4M9UA 3WLRA 2YQ5A 1TXGA 4JUFA 3SMQA 1L9KA 2XNSA 1JQ3A 1TFRA 3IFSA 3VAZA 2QTGA 3X43A 3ZLUA 1TPYA 2JGEA 4ECAA 2WF5A 3UWOA 3ODPA 4DR5B 1G59A 2AEFA 2VH5R 5HF5A 4JBXA 2WV9A 4HB0A 4KSCA 1JR6A 2FDRA 5HF9A 4PG5A 4MQ6A 3P5SA 3JQ8A 2ZYWX 5LA6A 1DTWA 1FNDA 3MMNA 2C2BA 2BGLA 3LUGA 3PHIA 5DTRA 3UB2A 2C7RA 2M6LA 2UZ4A 1WQ3A 3ONDA 3R09A 2GPBA 3AVXA 2A0WA 1VE5A 4N7RA 1YR6A 3OIVA 3PQ2A 2ZBFA 4G81A 2Q3CA 1MFPA 3DL7A 3ET5A 3K9FC 5KAMA 3VJKA 2WT4A 1MIOA 3ENQA 4JYBA 2OZVA 4MHSA 3W5SA 1OJ7A 4KIFA 1H0RA 4JMLA 2CHVA 1ESDA 3DZFA 4YDHB 2WAAA 4QOIA 2WABA 3OP1A 3FFBA 4ZU3A 3SCZA 3TVDA 3ZWDA 4BC0A 1XQVA 3TTWA 2GTPA 3B3QA 1N8SA 4JCCA 4LV5B 2OHOA 4CLOB 2JGNA 2W83A 1QZ3A 4JLUA 4F5ZA 1YRAA 1E1QA 4HUJA 4YMVA 4G0ZA 4NE2A 2XRMA 4IIJA 2IBMA 1C81A 1KO8A 2ZRNA 2QYOA 2ZYRA 4F21A 3I1JA 3FNIA 1QZUA 3C3BA 3LBHA 5DEIA 3ZU2A 3JRXA 3HCDA 1MX5A 3B1KA 4NK4A 4Y9SA 4HV4A 1H65A 1Z22A 3L8ZA 3OKFA 1YULA 2RHGB 4GRAA 4PNPA 3W78A 4CM4B 1MQSA 2GEUA 1G63A 2G40A 3KEQA 4E0BA 1E2PA 1QU2A 3Q0IA 1OGIA 3C24A 4GZ3A 2HJGA 5JO9A 4BZXA 1WNFA 1OFTA 4FFWA 2YIVX 2Z4SA 2W2KB 2NO7A 2GK7A 4OLBA 4PFJA 1IUPA 1JBQA 1KQOA 5A3VA 1HGXA 2Y9MB 4Y9RA 2MSEB 1BC5A 1JBEA 2BLLA 2CDAA 2OB2A 3HPQA 1S7CA 3CONA 3KE9A 5JC8A 4XUEA 4AJKA 4NH0A 1G3IA 2C5AA 3W4KA 3EEIA 3GL9A 1W4AA 4IZHA 2CFTA 1E3QA 4KWHA 4L7QA 4BNGA 1MUUA 3CF4G 3QVSA 3ROTA 4B7AA 3TIFA 1TECE 1E69A 1WDMA 3D3NA 3N6VA 3KVYA 4FGZA 4Y0NA 5FFNA 3V97A 4DEVA 1UAAA 2Z6UA 4REOA 5IEBA 1PZEA 3OKPA 9ABPA 4Z51A 2BISA 2C82A 3G0DA 3K70B 5CGQB 1TT5B 3NM6B 3WBJA 2E4WA 1RHQA 2P6RA 2HCJB 4PQRA 2NU7B 1N7JA 4E5YA 3DV9A 4PE5B 1KC3A 1N3IA 4Y1EA 2O2ZA 2Q7DA 3R5TA 2NQTA 2XMBA 3LZ6A 1FLAA 2QN1A 4OAOA 4ZO6A 4N8DA 4NR0A 5B3AA 3TFQA 3SF0A 3TL6A 3PWSA 1VA4A 4D5EA 4JOCA 4LC1A 2WU8A 1XEWX 4QU0A 3DE3X 4ZO4A 4DLSA 2ZXUA 1D1PA 1JMVA 5HIIA 2PUBA 1P17A 1CV2A 5BXYA 2HHJA 2GJSA 3EVZA 3UJ8A 4M1EA 3E81A 3F4KA 5LZ2A 2H1OA 3LUHA 3K9WA 2ID7A 3N59A 2VT3A 2GXUA 4G1BA 4XQEA 4B6PA 3I9OA 2ESRA 1RKBA 5J9FA 4OQEA 3PF8A 4B3MB 3DHVA 4EHBA 1XD9A 4KQ1A 2FAXA 3R7SA 4I1UA 1N2GA 4RV9A 2XOKD 3K9HA 4Y9DA 4ZV7A 3I76A 3S4YA 3ZU4A 1QRUA 3ZVLA 4ZYUA 3ZW8A 3JWJA 3GUVA 4DLVA 3I3SR 1L8XA 3N2LA 3OEWA 3GGDA 1EJ2A 1J33A 3L7AA 2A78A 4LXUA 3CX8A 2QPOA 4P83A 4P80A 4WEOA 2VTKA 4C0JA 5H59A 4GQAA 3QKIA 2GMWA 4KQFA 3U7QA 1GV1A 3WK6A 1WL8A 3G8DA 4IYRA 4MRMB 3DV0B 4RENA 2YMMA 3WMXA 1OI2A 2XUJA 1TB4A 1K4MA 2OXFA 4NCJA 1RT9A 1V5IA 4FEYA 2OFXA 2Q1SA 4O4IF 4G5FA 3OE5A 3F78A 2VDOB 3P8ZA 3LT2A 3LLUA 4YJGA 5EL0A 4AAYA 1D1TA 3VBEA 2D1RA 1R9GA 3C14C 3BZWA 3GUCA 4LGMA 3TYXA 4DLPA 5KDLA 1YJQA 2FPUA 1EQUA 2K5UA 3GFGA 3UF0A 3WK9A 4F4JA 1Y6FA 2BHNA 2I4MA 4QE3A 1E9CA 2BP7A 3FROA 4L57A 3WBKA 1CIPA 3V4LA 3KOXA 1R3UA 4YCSA 1LX7A 4M37A 4NBKA 5B7PA 1YOBA 1NV8A 2QRVA 1I7DA 1WEKA 2P2ZA 3I62A 3WB0A 1V8DA 2HXYA 1H9CA 2PGDA 4CV2A 4WPGA 1WP4A 1ZX1A 4F2DA 1G8FA 4C4TA 3PRHA 3SQOA 4DY6A 1BXGA 3B2NA 3AF1A 3Q9NA 2W70A 5FL7D 2VH2A 2XTZA 5LB2A 3F2VA 3OLWA 3THXA 3NEAA 2G17A 1RS0A 3FMOB 1KZ9A 3WL3A 1H6CA 3E5HA 4J07A 4R68A 3SJUA 3MVEA 1M1YE 1UJ4A 2OZLB 2AUTA 2WEKA 3OCWA 3OLYA 4N5IX 4OG2A 4E1AA 1CRQA 2HA2A 2JI9A 2QJWA 2YASA 3LF1A 4NFSA 3IUNA 5FIUA 1WHSB 1Z73A 3FPGA 3HLTA 2HT6A 5HIMA 1ZK1A 4O2RA 5ADWA 5EE9A 5BYKA 1N3BA 4IX1A 2C3PA 2ODPA 3U4QA 4PFKA 3OF5A 4BVAA 1T5HX 4TMKA 1GQOA 5DYGA 1UDXA 4UDOA 4GHWA 2H07A 1SUWA 3D4PA 2IPOA 3VOSA 4R8MA 3PC4A 4FIDA 5E3JA 3TOVA 4QLOA 3WNDA 1NPYA 4O02B 3LRPA 3LVBA 2PWZA 3KYBA 3TI9A 4PLPA 3WZ2A 4R71A 1V3TA 4GPBA 3NALA 1UQTA 4ZGBA 5HQTA 4YT5A 2IT1A 1PZFA 3V2HA 2OZEA 3PJRA 1CUIA 2H4HA 1U7PA 3GGCA 1KSHA 5ALNA 1VG0B 4KQKA 4B76A 2GAIA 3NG1A 3FSRA 2CFSA 2MTBA 4U2GA 5JNVA 2OO5A 2G4LA 4PPGA 1N0WA 3VR4A 2QS9A 4PRKA 1BCSA 2W22A 2BR4A 5IK2A 3ENNA 4MYCA 1LQTA 4IXTA 2Q4DA 4P31A 3TF5A 3K53A 2V9PA 2YDXA 2XF2A 1FYVA 2JFGA 2P9TA 3WXMA 1JAHA 4UUQA 3ZGYA 1V5FA 4BCDA 4GUDA 1SCUB 2WJVA 2X8JB 4DDWA 2P9YA 1MVNA 1EIZA 1PR4A 3FDZB 4OD0A 5CFMA 4HB2A 3FCOA 3WOVA 3CX4A 1GUZA 2Q1WA 5DX8A 4MKHA 4QOGA 3UCFA 5BWBA 4FK8A 1MZPA 4JXJA 4BNYA 2XSZD 4KDFA 3JASA 3LIIA 2RHCA 1NFQA 5HKOA 1T9KA 3NIBA 3WKDA 3FWZA 3P52A 4DYHA 1B7GO 1R00A 4UNIA 3TS1A 2PEZA 3VU1A 2BGGA 4B8ZA 4DRYA 4WJLA 3I30X 5I9LA 2IP2A 1DG9A 3ESDA 4LWQA 3C7DB 2VATA 3I04M 1NTOA 3VMMA 1XB2A 1CQZA 2JVKA 4L4ZA 1IQUA 4P35A 4L74A 5B4TA 3WGQA 1LTKA 3L0ZA 2QGNA 1DIBA 3SSOA 4O4HA 4WY2A 4I5GA 1ENOA 1RZVA 1PYGA 2NSJA 3DWFA 4Y6PA 4A8HA 5MF6A 2BM9A 1VG1A 1WPQA 1KOJA 1TEZA 3SZGA 1RAEA 2P0YA 3EGEA 1UZLA 2HY7A 1E3IA 3NNNA 4X7RA 2H48A 5JBQA 1U0SY 2CFCA 1GILA 1NE7A 2DE0X 5D2CA 3SSNA 1A7UA 3FDFA 2BMJA 5CT4A 4MA4A 2O8EB 1DQPA 2AXEA 3C5VA 3HB4X 4J4TA 3MB8A 3W04A 4LGYA 4UARA 5CYOA 1UWVA 2I3ZA 3N86A 4G07A 4PZPA 4TYNA 2BZ0A 1FFAA 4QX6A 3RFTA 1T8PA 2VYQA 2UUAB 3LDUA 3P2JA 1KZ7B 3N7UA 3N53A 3W7VA 2YWGA 3KR9A 1LGYA 2C84A 2BHRA 2WUDA 3H17A 1P2SA 2XZOA 4CKEB 8MHTA 1FLDA 1Z5OA 2XD4A 2H29A 1XJ5A 4XOIA 5AW2A 3SX2A 4U8HA 2HDOA 3W2GA 4ZI7F 3YASA 2YY7A 1A8PA 2I7DA 4B43A 1Q44A 1RWKA 1PQWA 2BF7A 3NRBA 3MTAA 5HK8A 5A4FS 4WSOA 1MNAA 3FNRA 3C2QA 2YY5A 1UJBA 3VSCA 1MHPA 4YRCA 5H02A 4YT2A 2AZTA 1SG6A 2DR3A 1UBHS 2W4QA 2PD3A 4HPJB 2DBVO 4RBNA 3I2HA 1R6BX 1AQUA 1UK6A 2NTVA 3DC2A 4FHCA 4MCJA 4MI6A 4TV9F 3F9IA 1QTNA 2OBLA 4XGKA 2C2MA 3TIIA 4YRSA 2H59A 2RC5A 4GM4A 1T2CA 5HIJA 1S3SA 1D03A 1RE0A 2E49A 2VYNA 2WJPA 3PC6A 2OV1A 3FR8A 5I7FA 5IJ0A 3QKSB 1YA4A 1E7MA 1G4HA 1UK7A 1Z08A 2Y1KA 3QKRA 1EHIA 2GHRA 4R0VA 3F46A 5LFAA 1NXWA 4L07A 4D42A 1EFVB 4ZEMA 5IS2A 1QRTA 1ZBDA 1KZ4A 3AV0B 4U2EA 3WLIA 4BLSA 5AO9A 2ZJYA 3COZA 3D64A 1DDIA 2VWQA 4FU0A 4L95C 3OO0A 5GJBA 1LVGA 1HDGO 1TKAA 3U3RA 1ID8A 1JDTA 2B7CA 1QBGA 2ZPTX 4G0NA 5TRTA 1NUQA 3AP3A 2CUZA 2NZXA 1VG8A 4FYJA 4P86A 5AKYA 2G80A 3AG5A 2CKDA 1TVKA 3KD3A 2B8EA 3HWWA 3NC4A 4O2BA 4UVIA 2WM3A 5J5VA 2EP7A 5K0EA 1OLXB 3DG9A 5AXCA 2BFOA 3URKA 3TGPA 5DHSA 4DREA 1SBYA 2D2IA 3D2BA 4L0MA 4XQ0A 4F2HA 2AI3A 3DSRA 4OHYA 1JDZA 2H1HA 3I1IA 4J3FA 3EHEA 3B8HA 1O7JA 3MCUA 4GC9A 4C6TA 4YPFA 4GZMA 3R7WB 4I1RA 3JQGA 2QU7A 2VRCD 3PXXA 1DC5A 5C3UA 5B2FA 2B8WA 3NASA 4CL8A 1YVRA 1KTVA 1JEQB 4JLSA 1HRDA 3ESZA 4KLZA 5K0NA 1FTSA 2R8XA 4PTYA 5DU2A 1JLRA 2GF2A 3BH7A 3OPYB 1HTTA 2OPHA 3GZNB 4FQ5A 3OQHA 4HEHA 2P67A 1H5UA 2PXXA 2QD3A 3K70D 3VO8A 3S2UA 1KOGA 2P2NA 1XMOB 2BHTA 4XD7D 4DJ5X 3TX6A 1QH9A 1RRKA 5D5QA 1OR8A 4GI1A 1OBHA 4TVBA 3A2NA 3F7OA 2O2GA 4S3MA 4EJ2A 3PXEA 3NYRA 4RHFA 5LQUA 4O5OA 4YJ3A 5G4KA 5HUHA 3N6XA 4LQ4A 3MBOA 4M8NE 2VF2A 3GD7A 1Z15A 2B4RO 2PT9A 3IIJA 4JEUA 4DJAA 1NVBA 1ZIDA 4ZHSA 2WDPA 4F12A 1JFTA 2C96A 1QSGA 3DF9A 3N75A 1YFLA 2CDBA 4M1WA 4OJYA 4BWFB 5FP0A 4WRRA 2ZP1A 1BVYF 2NVUA 1XL1A 3MJVA 2GKOA 3W5VA 3OFSA 2K4MA 3WZMA 4IO1A 1NY6A 2RJ3A 4K9NA 2NUTA 2H6EA 3CIOA 4AZ3A 3ZDZB 1SG0A 2YJ4A 2AX3A 2HMVA 4OOEA 3WLQA 1C50A 4YLEA 4B31A 4KW7A 3VI3B 1AV6A 2I87A 2VDRB 4PSUA 4X62B 1AHHA 4L28A 4RH3A 5JAPA 2G1PA 1CY1A 1A96A 2DJ5A 1C4KA 2XDQB 1IK4A 1C0PA 3IVRA 5SY9A 3FUUA 2I2WA 1W29A 3T3PB 1DINA 2EU8A 4JC0A 4EVSA 1ETHA 2PT6A 1GM5A 4J7UA 3A7EA 2ZDHA 1MDFA 1RJGA 3PC7A 5G0VA 4CQMD 5IP5A 1ZNWA 4QHYA 3JQRA 2OV8A 3BRCA 2Q5JA 1UBOS 1RPAA 4QD3A 3T1YB 3RVBA 3P19A 1D7OA 3LYUA 1HF3A 1II0A 2Y76A 1ZJZA 3F3YA 2V0GA 1DJNA 1UMCB 5D6NA 2JAOA 1I1OA 4ETIA 4BNWA 3DHEA 2W6JA 4QBIA 1DUSA 1I0ZA 2R1TB 4ZT3A 2G4CA 2YKGA 5HUQA 4HDKA 4LI0A 4CCAA 3IE1A 2Z6VA 1OXMA 4R05A 1K0UA 1LNZA 5HVNA 3RADC 2CD9A 3GLGB 1OX6A 4I8XA 2DY0A 1XTKA 4A1OA 4LJLA 4ZOBA 4KLRA 4DTCA 4CNQA 3BQ9A 1KEEA 4DRXB 5HZHA 3E4CA 4J1TC 1DKPA 2ZATA 4G5QA 1UXHA 3KHTA 3I2GA 4XWYA 4I9HA 2RGBA 4FZJA 1CJMA 2B98A 2IYOA 2FUKA 3UH0A 3Q85A 4JR2A 1X13A 1CIJA 2H4YA 4RA6B 2HSZA 3PJFA 2FMIA 1NSFA 1X7YB 2G0NA 1Z82A 3TR5A 1V11B 2QV0A 2GCIA 3KU4A 2ODNA 3T95A 3WLHA 1PZMA 4P7GA 4LUCA 4DTIA 1Q91A 1T8WA 1RQLA 5CAEA 2XWPA 1R6AA 4UNSA 1V1MA 3VDXA 4OKSA 4CM5A 5CB0A 3EZNA 4BRSA 1IHUA 3ZK9A 1R16A 1GXSB 1YBAA 3CU5A 5E8RA 3O1LA 3S2FA 4CG1A 4D41A 3GRFA 3QPDA 2BUAA 2IZ1A 4O25A 2HO5A 2GLUA 1H1TA 4FWBA 1Q57A 2QTVA 2FN9A 1BQ4A 3SZMA 3I8OA 1LC3A 3WGKA 1P74A 3V42A 1D6JA 1FZTA 1V8OA 3D0QA 3KYCB 3OC0A 4OY3A 3HLYA 1WPRA 5IKEA 4KGXA 2IYXA 1GSAA 4L9RA 4M3NA 3SS9X 5AK5A 5IAAA 5DN6D 2R6AA 5KQGA 1ORIA 1R88A 4ZA2A 3FBTA 5JMPA 1JE0A 4RH1A 4AJEA 4F3YA 2BDUA 1GFWA 3DVAB 4N4AA 5C1OA 4OJQA 3EFOB 4BO3A 3ZKAA 3T1TA 1DSSG 4Z49A 1NF2A 4ZO9A 4C7OB 3QLJA 4MI3A 1CJBA 1K6MA 4JLOA 1XQYA 5T3YA 5C8YF 5EIFA 4Q21A 1OYYA 4AS1A 2VXYA 2CCKA 4ADSG 1KNQA 4NWIA 1BJTA 4Y2GA 5AI4A 4FIZA 2R6HA 3MTDA 3A9UA 1ZAYA 2WHYA 3AHHA 2BC9A 1WDLA 3HGMA 3UENA 4D6XA 2W42A 4PCAA 2Q21A 4CEHA 3BTOA 2ZB4A 4UEJA 1L4EA 4J4HA 4CMEC 2JPDA 4ITRC 4AQ7A 3TZ6A 2I8LA 4NE9A 1Q7EA 1EAMA 1G20A 3QPWA 3UK1A 5SY4A 1N6KA 2ZSDA 1KHHA 4FHFA 4Q3LA 5IBRA 1XN1A 1BDJA 1Z2OX 1N4DA 2JDIA 1DG3A 1LTQA 3QFRA 2JW5A 2PT7A 1ISJA 3L7KA 1QIDA 3CN9A 1KY4A 4JOQA 5F3DA 3E22A 4H7JA 4RDHA 5L3QA 2EOAA 1MMFB 2EX0A 3LHKA 3EWSA 4ZVTA 3L07A 3DBIA 1ZYUA 3LDGA 1QHHA 1P0FA 3ESQA 3TNDA 4I50A 5CM9C 4DWVA 1G9SA 3I64A 5HFNA 1J07A 1CNEA 1AURA 1TJ4A 1O5TA 3LA8A 1E2LA 3CEAA 3WFJA 2JAWA 3SVLA 3PQ3A 5IH7A 1LQUA 4B7UA 4COKA 4FUTA 2F1JA 4ND6A 5DLPA 3RJTA 2D7JA 1ZOPA 1WZCA 2SICE 1T0PA 4X6YA 1QIEA 2Z04A 3DR3A 3S2ZA 3NATA 1YJXA 2I6FA 1U5AA 4O1IA 3JXEA 4MUJA 5CB4F 4R40A 2JZCA 1E2UA 1XRMA 2P9FA 3JD3A 2YUIA 1L5KA 4UOQA 3TR6A 4YQYA 1PJCA 4UEQA 5J2UF 2IZOA 4CMIA 3RV3A 4NCBA 4ZPXA 5BOVA 3N0VA 2OXRA 4ABTA 4JGBA 5BWOA 3MQ2A 2QUAA 3JQ8B 5J4VA 3FCEA 2WNHA 2WWRA 3A1VA 2NGRA 5LA6B 1DTWB 1L0BA 1WKCA 3PCRB 2ZJAA 1GPDG 2OAQ1 5B6PA 5CPFA 1TRHA 1XDDA 3I0NA 5AXDA 1VIMA 3R3VA 5HKLA 1QAOA 2X7JA 4JA2A 1YRWA 4AURA 3OCVA 4OOFA 2ZIEA 3MOIA 5CW1A 2C3YA 5IJWA 2OV6A 3L1VA 1ZBQA 3NH6A 3ETEA 1E58A 2RK3A 4L16A 4N18A 1MIOB 4ZVOA 1IY9A 2AN4A 3FAZA 2CZGA 2FMXA 3G0OA 4FB4A 1IVSA 1T0BA 2YVKA 3EZ9A 1OH5A 3GELA 3WKBA 4Y1RA 4HQRA 2YJZA 5FQOA 3PXBA 1KNXA 1HV8A 1Z3CA 4TMFA 1EFPA 4WLOA 1AM4D 1H22A 5KDDA 4IJWA 3H1PA 3OIWA 3H0EA 3IMKA 5FNVA 5B4UA 2WUVA 5EE1A 1I8TA 3H86A 2VAVA 1AQNA 4UFPA 1Q1NA 2EL9A 4J0HA 1B43A 1JHYA 1CJUC 1SC4A 3R9KA 2O0MA 4CM8A 4IIJB 3JPYA 3FNHA 3MA0A 5BMVF 2HPAA 4AY5A 3V7UA 3BHJA 1L5FA 3CCBA 4JCOA 1QIJA 2UZ1A 3V8RA 5EJAA 4PGHA 2ZBEA 3QWBA 4K9OA 4Y2VA 2ONJA 3VR5D 1QG6A 1BMFD 5CMLA 2EFYA 5DK6A 3PYMA 3HZZA 1OLUA 3F6YA 3PHBE 4HRAA 1QTIA 2NSDA 1NXTA 1B8OA 2J4CA 3OCXA 4S1TA 3VR6H 4BNNA 1T91A 1BVUA 1KK3A 2EFGA 2EXXA 3TXXA 4QOJA 1JYFA 1WXGA 3QV2A 4ILKA 4M0FA 1P0QA 3KVNA 1JQJC 1X7DA 1WXEA 5I8ZA 4YDQA 3KQMA 4KREA 2CSUA 2Y3IA 1IBRA 2OO5C 3E8MA 1BYIA 2I2BA 1N2CA 3L4KA 2J9ZB 1W4LA 1Z68A 2Z9CA 3WJ2A 4FCCA 1M34E 2C4KA 1VPTA 2IOQA 3BDAA 3WL4A 4LDAA 2DWCA 4OM7A 3VSAA 2MSDB 4I14A 8ADHA 3SVTA 1PBTA 3GWZA 4DUGA 2LR0A 3QZUA 3RAGA 3D4NA 4MP6A 1J1UA 1DT3A 1FE8A 3IJPA 3S3TA 1HFEL 2AR9A 4JQSA 2GBIA 5EIAA 1TQ6A 4M22A 3RE1A 2WF9A 3NB0A 5BSFA 1LS6A 3CINA 2PSJA 3S7TA 4H4CA 3S5UA 3RIMA 4LSGA 1Y0BA 3FPEA 4DBLC 1KJYA 2NADA 4RSRA 1PSZA 3TB4A 4ALNA 1UDCA 4BKMA 5IUJC 4KO3S 1UBLS 1BX0A 2G9VA 3B20A 4OIMA 4QAJA 1TQ2A 3LY7A 4J9VA 2JRLA 2BEWA 1GL6A 3NHWA 1T3TA 5E6SA 2G1KA 4DMUB 3ZJTA 4KQEA 4M7OA 3FHOA 4OP3A 3IIKA 5FOSA 2FSVC 4K1LA 1BYUA 1FMCA 2RIPA 5BSHA 2WZBA 4E13A 1IMOA 1CE8A 2O2JA 1DKMA 2ETXA 4A82A 3TW4A 2C9YA 1PHPA 4G0UA 1PNTA 3GT7A 4P4UA 3EJ6A 3QVLA 4HWOA 2BI8A 2MWMA 2XWJI 4IJ5A 1N2BA 3EXAA 2BAGA 4PZUA 4CKCA 2XHZA 2QQ0A 4PLYA 1HOTA 2GPTA 4EVIA 3GJRA 4GD3Q 4UVHA 1WMBA 2Q2WA 3OCCA 5CVEA 4YAUA 4MPTA 1IXZA 3TZCA 5KKNB 1T9GR 1XU7A 4ALIA 2X5NA 3QUCA 1ZWKA 1W30A 2PBZA 2WWIA 2XDWA 4CMCA 5A2GA 1G5HA 4JX8A 3WQHA 4LYFA 4XR4A 5CTJA 1H8HD 3FVQA 3U7QB 3W7BA 4C2BA 4OKNA 1GGVA 3LQ1A 1TW3A 3UY4A 2XUPA 3ZCUA 1JQEA 4WKPA 3VR5H 5IAGA 1HYHA 4K6CA 2O5EA 5MFZA 3AJRA 4NZMA 1L4YA 3NUZA 4JH0A 3NHFA 2AIRA 4YCAA 1NLYA 4MVJD 2LP4Y 4YDSA 3B9RA 1SN7A 1FSFA 2E6UX 4YJGB 2GAAA 2C3OA 2GNAA 3MT8A 2UXDB 4ZMSA 2X7HA 4J1SA 5T8KA 2J5RA 4X7PA 3HI4A 5CLLA 5TV2A 1XQ1A 5AJXA 2BP7B 4DW8A 2FYTA 2P9HA 2RGXA 3CRRA 3Q9LA 1GNVA 5DSZA 2QRVB 4A2WA 6CHYA 4NCHA 3GLHE 1R0RE 1W96A 1QE5A 1ZK3A 2CWDA 2H9YA 2XX3A 4PF1A 5DGXA 4FYKA 4KXWA 4LIPD 4CF4A 4RF2A 1BXGB 3X1YA 4WIAA 1UBNA 6REQB 4ZCPA 4BN5A 4JNCA 2IU3A 3BIXA 3THXB 1NW5A 3I6BA 2QN7A 3ZY4A 4NXMB 1D5WA 1X70A 5COQA 2GFHA 2OP0A 3R76A 2Z08A 3TQFA 5EIXA 1IXYA 2WK1A 5IDYA 3S2GA 4BNDA 3QNMA 1ZK0A 1QDUA 2H11A 1EBBA 3HB7A 2ZXEA 1EKXA 2V74B 2FETA 2VZ8A 3GI1A 4IF6A 3T3MB 4ZCTA 3L3BA 1R6TA 1GLNA 4O1MA 2I76A 2BKUA 1WZEA 2WMNB 5D5PA 3TJZA 1MEJA 2LDXA 3X1DA 3P9QA 1CTQA 1YCFA 2GLXA 4DC0A 4J0IA 3F6EX 1PD1A 1SURA 1UBJS 3NHUA 1VYVA 2VSNA 2IXFA 3WBFA 4E12A 4B5KA 3U4MA 1K4YA 4Z4CA 3O82A 1IPEA 3SC4A 5KTPA 1UOEA 4A8JC 3IBTA 2H0QA 1RWQA 2NVBA 2YZMA 4HLDA 2C9DA 4MW4A 1P81A 1N2EA 3IDQA 3HU3A 2BW0A 1X92A 3BL8A 4FOSA 4NV0A 4O8ZA 2ZT7A 3KSDO 3ICPA 1P6XA 3AVYA 3K15A 1FSSA 1H1DA 2CLEB 4KU4A 2PUEA 1T8YA 9ATCA 3CF6R 3P9PA 1K6IA 2AKYA 3ANLA 3OLQA 3QYAA 4EKNB 3CR8A 1VSTA 1ZN9A 3PHLA 4JQZA 2G6BA 4ZJZA 2RHOA 3TTSA 1BCSB 2PGXA 4YXWD 4PINA 1E79D 4V1CI 5CHYA 4JC8A 2YCBA 4L5YA 5AOBA 5F76A 4HNHA 4JVLA 2DETA 4ND8A 4LGCA 3DBRA 3ILXA 4C7BA 2PL1A 1OAAA 4OVKA 1V43A 2PJZA 3JVEA 1JWBB 1YV9A 2N9UA 2C0CA 2XQJA 3AUJB 4JVSB 1AK1A 2BKAA 4W7IA 4B17A 1KFJB 4I5IA 1CULC 4IIBA 3E8SA 4U2CA 2BI7A 1WO8A 4TVOA 1PK8A 3UATA 4YAKA 1T1IA 3WRXA 5JCXA 1QFJA 2CNWA 1T13A 2OCPA 1TM7E 1EB9A 2IYZA 4AM8A 3JASB 4EUEA 3CEHA 2EX4A 3IP5A 4EHAA 1XEXA 3D7LA 3OQMA 3K0FA 1B2LA 1F6DA 2RKOA 5KNCA 1XPJA 3OZSA 4ZEXA 3OO1A 4EBFA 1MJNA 1AV7A 2ORED 3VU3A 4F9GA 1VLLA 4YRBA 2BELA 1QG2A 4FDUA 1X38A 1HMYA 3LT5A 3GJZA 3H3JA 4JLAA 4OJKA 4QYTA 3T7SA 4QVKA 4TXJA 5IDVA 4BQFA 2VR1A 4JUBA 2UZ0A 1VJTA 4MLDA 1JI0A 2FOXA 2QXUA 1P19A 3H7AA 1MX1A 1Z28A 2B4AA 4O4HB 4DNOA 4HGRA 3IP7A 4G0YA 4IL5A 3FA2A 1DQZA 1BE6A 3IQWA 4V1CA 1G5IA 2JRCA 3QV1A 3JARA 3TLKA 4F1WA 3EQ9A 2FMUA 3PJGA 1HORA 1JSRA 3S2SA 5JUWA 1L7XA 2R96A 3F97A 5CX1A 1T8TA 3Q7QA 3B51X 3ED1A 3CH7A 2EAUA 2OGSA 3BIOA 4LKRA 4BV8A 3ESBA 1JDSA 4ECEA 3HXLA 5CNIA 2Q1TA 3FFTA 4AJJA 4D0LB 3RNLA 2CZCA 2YW9A 5JJ5A 2DHQA 2VJQA 4Q12A 4RXMA 2PLFA 2BE9A 2UDPA 3VC1A 3CN7A 1QX3A 2FW1A 1LFAA 1KC1A 3PC3A 3DOCA 3U37A 1G3RA 3SLRA 3B82A 3AG6A 2A3NA 2VA8A 2VCEA 3KKOA 5JSKA 5ALZA 3TMYA 4DIEA 1OWLA 4YGYA 3HVKA 1VL6A 2HPZA 3EB9A 2J3DA 2GCEA 4I4LA 4ND5A 3U7IA 4XGQA 5DMHA 5I9MA 4ZCIA 1UKBA 2VZLA 1BXKA 3OT4A 1YR1A 5CJJA 3PX7A 4JUIA 5J4YA 4M6WA 1T24A 1CUGA 5C7OO 1HEYA 1Z12A 3OCZA 4B2PA 1WXHA 2GM3A 1RFLA 1YE5A 4I4TF 1L4UA 4IOJA 4LOHA 1TTPB 5G2OA 4L6IA 3K5PA 5FI5A 1LBEA 4JJGA 1YJ8A 3KTFA 4XIYA 2ZBUA 4RK7A 4Z86A 3NKLA 4RTLA 5C9ZA 3OEEA 2HD4A 4YIKA 3ZCQA 4FSXA 4DWOA 3PIDA 4M55A 1YA8A 2CMHA 1PQPA 1E1QD 2M2IA 1C5KA 4ZQFA 5IJ0B 1AHIA 1CJVC 4HNQA 5K3FA 5LP6B 4CEJA 3VAYA 3QKRB 2HCBA 4UU1A 2GXSA 4L7VA 4KCGA 1LPNA 5HBGA 1QFYA 3K1JA 3CLRD 2ZCJA 4EUFA 4KFCA 2WIBA 4E32A 3UV7A 3TE6A 5AVQA 4DC1A 3H9QA 5DX1A 3TEFA 4GW3A 3Q7TA 2EQ5A 1T9CA 3EGIA 1H4VB 4EM6A 4UOZA 1L5VA 3Q10A 5F7ZA 4AMUA 2O8CA 4CQJA 3LK7A 1JHPA 2G72A 1QMGA 3QW4B 2FLKA 5JNLA 1NLUA 3BFKA 1PE0A 1QM5A 1LPAB 1TVKB 4O2BB 5AKIA 4JSTA 1YTUA 4L2IA 1R6UA 1PGPA 2HB6A 2X3UA 1KJ8A 3K35A 4OQLA 2YN2A 5JS7A 1RQGA 1MU0A 4XXHA 2C29D 4C6TB 2QTNA 4Q4CA 1GZ3A 4IIGA 4DDTA 4TOIA 4O8CA 2C2ZA 1WSAA 1U90A 3A7DA 3JQGB 3A6PC 3PSAA 2H5IA 3BFXA 1Q3HA 2RI6A 4E7PA 2G5CA 3BILA 3FRHA 3K0AA 4AN4A 1WAMA 3ER9A 2DXIA 1ZIXA 1L6RA 4DMGA 2XTAA 5IABA 5CCXA 4MKGA 3K6KA 1ACMA 2H4XA 2QUBA 1DI0A 3IAM6 4GYWA 3OSZA 3PNMA 1TD9A 3QMVA 2IHUA 1TCVA 4I81A 2HCRA 4AMZA 3D8SA 1SOUA 3C3KA 4E5DA 3E70C 5DB4A 1P7WA 1RADA 4H1VA 2V7UA 4B87A 4KB5A 4YJ3B 2QLNA 2JHFA 2MHCA 5G4KB 2BZ1A 4KQJA 1YRQA 3DXYA 4HDSA 4R1NA 1KZHA 1NL3A 4GL2A 2EZ9A 2ZAIA 5ALEA 1TJ5A 4L76A 4Z4QA 4R9VA 3HK2A 3KUUA 2XITA 4RE5A 1G21E 2OBXA 4A92A 4ENWA 3H16A 1UC5B 4DV4B 1YBHA 2RC6A 5K99A 2BRUA 4YJFA 1UM9A 1LPBB 1LY1A 1ZSNA 4RMNA 2D00A 2R47A 2IH2A 1GA6A 1TZKA 3KWLA 2NUTB 5HJ5A 5FKJA 1K6JA 4AZ3B 5EQTA 1E4EA 4LG1A 2W6OA 2JHPA 3U0BA 4E2ZA 4ARAA 6NULA 4NBSA 3SOZA 3V3KA 4B4DA 4IG9A 1P1IA 4ZI3A 2PCLA 1YVDA 3L49A 1Y7IA 4R9NA 6Q21A 1Z4JA 1X1RA 1E3TA 1L4NA 1I24A 2GN8A 4PO1A 2VDNB 2Q45A 3PUJA 1FLNA 5JI2E 1RI3A 2F48A 3D7RA 1XMPA 3HS3A 3GYBA 4U7PB 2GD6A 1ESEA 4I1SA 5KWVA 2RHDA 2QAJA 3DYIA 4NOKA 1THGA 2UAGA 1N2ZA 2Q1XA 3OFJA 5FUBA 1EGHA 1ONNA 1Z4MA 1AH2A 2QKYA 3CG0A 3UUGA 4POOA 1P9OA 3ZWAA 3ZY6A 1H2WA 2Q3EA 3OJXA 4QFBA 4RTMA 2Y0CA 1PR1A 2G6TA 4G5XA 2YXPX 4U9IS 4N41A 2GZSA 5JFTA 5TSDA 1JUDA 5KC8A 2PUCA 1VLVA 3R6TA 2VPQA 1KSGA 3D6AA 4AG6A 3O1IC 4TT3A 2WSMA 4HCJA 5SZJA 4KQHA 3NUQA 1B0UA 3BREA 2Q27A 1ZI8A 2NIPA 4HX5A 4M8IA 5BQ5A 1Z5UA 4HDKB 3V1LA 3WTBA 3A4YA 2ACVA 4KQGA 2HA0A 1QQ6A 1XTSA 3NH9A 4FD3A 4MUGA 5HBRA 2DZDA 3RUIA 1HLFA 3V32A 4MO9A 3W5HA 2Z3WA 3CIFA 4TX1A 5B36A 5FAKA 3WBBA 2PR7A 4P3OA 2XMDA 1HYEA 5THKA 1KEEB 4JL6A 3E4DA 3CC8A 3DOOA 3MIIA 1NMQA 1M2JA 1XHEA 2R86A 5H5JA 3WAGA 4X64B 2P1DA 2AFIA 2HT1A 4I4IA 1SQ0A 3DL0A 3PI7A 2JCBA 3MILA 1R66A 2FPMA 3Q4GA 4IW3B 1S4MA 1EDZA 3MBKA 4QUDA 2RH4A 1JGTA 1YS9A 2WU1A 5JATA 4D8XA 2AGVA 1DHRA 4R54A 2I2CA 1ZXBA 1W9HA 2WM2A 3N87A 2BSXA 4HLUC 5CAEB 4EUHA 1Y5RA 5C80A 1N0HA 1V1MB 4F91B 3J7AC 3VOBA 3G1UA 4BJHB 3O4IA 1A7KA 2IXGA 1NXSA 3NTVA 2QG4A 3PLNA 1WMEA 2QTVB 5LMUB 4X3OA 1C4XA 2JI7A 2RHLA 5BV8A 3NT4A 5JNSA 3CRZA 5F12A 4HFMA 3P32A 5AW5A 4URFA 1N77A 2ZRMA 2Y6VA 4QXPA 1DQYA 3DCYA 2XA9A 1WE2A 3DMGA 5JPDA 4XR9A 1PL6A 4IDDA 3RRMA 2OGUA 5JRDS 3JVUA 3VR4D 1HZJA 4K9DA 1JXQA 5IK2D 4Q9LA 4RU1A 2CNBA 2PXHA 1WTCA 4MDFA 3JQFC 3M6UA 1RKVA 1PJZA 3G9UA 1I3OA 1GPBA 2OSVA 3A1UA 3B6KA 2X5JO 4CG2A 3PEWA 1Y1KE 2VPWA 4P2BA 5CLGA 5GOZA 1BX3A 4X66B 1D09A 1KEUA 1W8IA 1ML4A 1GG8A 1FDOA 3BRSA 1OA1A 4J0EA 4TN1A 3ROPA 3SQDA 4CEHB 1YQEA 1O89A 1HNWB 1QONA 1ZJJA 1P33A 3JYPA 2DR0A 4AZ0A 4EA9A 2IX9A 3H99A 1BFDA 5ARBA 2IHYA 3A05A 1CC1S 1G20B 2YNMA 3DM5A 2BGUA 2VWGA 5D3KA 1RLJA 3KVVA 4I5DA 3PDCA 4OH7A 1ZI9A 1UPXA 1Z0UA 4DEYA 3HB5X 3LGSA 1KI7A 4BZQA 5TMEA 5EKUA 3E22B 5L3QB 3AVTA 3H19A 5B3JA 5DCUA 5AUOB 1G4AE 2ACEA 4OUKX 2C31A 4YAWA 4RULA 1QHHB 1EP2B 2JLZA 3HRIA 3LZCA 4I50B 5JD3A 4HSEA 5F52A 5DIFA 4MS4A 3MYYA 4PC3A 2QUIA 3IVAA 2P6PA 2WV7A 4LHWA 5ALWA 4DXAA 3GPBA 2ZJOA 1J0XO 4WLNA 3EIQA 3GQVA 1W5EA 1LCIA 4MR7A 3SDBA 1YUMA 1Z4OA 2WC1A 3LKBA 3F71A 1ZA1A 3L1JA 3QU2A 1BA3A 3FVRA 2FGKA 5BO5A 4TZKA 4CUKA 2NW6A 4O59O 1Z4PX 3GGPA 5LYYA 4DT1A 4E5NA 2VPIA 3QU5A 1FP2A 1ESMA 1EUDA 1PD0A 3G8YA 5T8KC 3I9KA 1IB6A 4CMIB 3WYCA 1D8AA 3CNQS 3WLSA 3AM1A 1X9GA 3W7AA 3S1AB 1CT9A 2O14A 5U9CA 5KCZA 3PICA 2GPJA 2J8ZA 1HE3A 4M54A 2PIDA 2Z5FA 2R7LA 4MZXA 2FV8A 4P93A 3ZNQA 1FQOA 4CLRA 1JHXA 3IUEA 4B3GA 3O8QA 4RK0A 3CTPA 2X1MA 3W1WA 4XM0A 3CW9A 2IC5A 1DCTA 1NNLA 4Q19A 3IUYA 1SOMA 3ZHVA 3L7CA 1L5LA 3RHZA 2V5UA 4Q3NA 2ZWPA 4Y1GA 3TD9A 3AYZB 1K7EB 2ADFA 1LBQA 4L5AA 1WF6A 2HX1A 1KOLA 5KVSA 1SVLA 1VPLA 1Y82A 1ZQ9A 4Y1RB 3VC7A 3ELWA 2V58A 2MINA 2O2IA 2J5XA 4W8GA 3L7NA 4AJHA 3KZKA 1EFPB 2Z30A 5HE9A 4R51A 1OC4A 4HDNB 3WYDA 5FNVB 4TQ9A 4YLYA 1NIPA 5IMSA 2VYND 2XR1A 4A9AA 1W59A 2XWQA 4GP6A 1ZW6A 2XUKA 1B1AA 4CM8B 4ZAVA 4ARZA 7AT1A 5J4LA 1ONSA 3F8SA 4FWTA 3QFTA 1IEXA 2BSAA 1SKYE 2IYTA 1XZNA 2H0AA 2UZ1B 3NBKA 4WINA 4KYVA 5BWLA 3VGJA 2FMKA 3LPDA 1JILA 5I48A 1JDUA 4BQOA 1ZU5A 4XSGA 1K5DA 3ZWQA 1C9JA 4KPGA 1OLUB 1NDUA 4DUYB 2GI4A 2XQGA 4MYSA 3TIXB 4A2PA 4M38A 5LMNB 4ETMA 2P69A 1PW5A 5EJ4A 2C2WA 3M70A 1TU4A 1HFJA 2WU3A 1A5BB 1IQ0A 2ZTSA 4RWZA 2HHHB 1Y89A 1CB7A 2RGAA 1N2CB 4G26A 1Q0RA 3R3UA 4B74A 4WT7A 3GT0A 4PFSA 4CHGA 2OYSA 3I4CA 1U3VA 3O75A 3EULA 1NXOA 2ZJ7A 4EI9A 4FMDF 2F55A 2OMEA 5ADHA 2QZ4A 1CDDA 3ID6C 3NC1C 4K6HA 3V4FA 5BN3A 4EG1A 1XDBA 3T41A 2XYQA 3KQTA 1Z4QA 4QLAA 4MV9A 1CEQA 2CB0A 2QRQA 4Y6QA 3SFTA 2AOWA 1N8TA 2EW2A 1V8ZA 4EMTA 3GH3A 4MUHA 5GZ1A 2BGRA 1X2BA 3PC8A 5FBQB 2IIBA 5TGDA 2VF5X 2NZ2A 3F8TA 1U81A 4F9EA 1JX6A 1TVCA 3EEBA 2IE0A 4BUZA 1NYTA 2N1MA 2BEWB 5J1TB 2QJFA 5E6SB 5CM2Z 3WGOA 4GLFA 4XX1A 1CZNA 2A67A 4RKFA 1JHVA 1KVQA 1TIPA 4TRJA 3V8EA 1ZM4A 2VPXA 4BX8A 4FHDA 3SFVA 2NMVA 3C70A 1QYRA 4RANA 4O4IA 4S04A 1ATIA 3PEEA 1FTGA 2BFFA 3NYWA 1SB9A 3TX2A 3LE8A 1K3TA 1PFYA 4XCQA 4ZRDA 1KE2A 2XLBA 4RLFA 4CKCB 3OAAA 4C43A 3KWMA 1HQDA 4HTAA 5JYDA 4YJ2F 2A1TR 2IYNA 2JFXA 2XH8A 4DCNA 5HW0A 2CJFA 2SBTA 3N5CA 5KU1A 2QZZA 5ABPA 3CV3A 3PUIA 2CL0X 4V0QA 1N1EA 2HWXA 5BSGA 2O48X 4JENA 3MCVA 3SS7X 3A6ZA 5K3EA 2HXSA 1AMOA 3H2GA 4YUVA 4KWCA 3VZPA 2LKCA 3UMCA 1SUPA 1Z6QA 5B3KA 2D0DA 1EE9A 1TYEB 2Q5LA 3IAM1 4QDZA 4D6YA 1O8BA 2C7OA 1P2BA 3C97A 4KACA 4CETA 3CNBA 1T1JA 3UVEA 1CETA 1KGDA 1TQ8A 1ZZGA 4DLNA 4OLAA 4KAFA 4MR9A 1NJFA 4QBKA 3UAXA 5JARA 1T6NA 2GCOA 1QHYA 1NMXA 5EHXA 4JP1A 2W6JD 4PGMA 2CNKA 2L19A 1U9IA 1J90A 1W85A 2HLPA 4F6RA 4OMDA 4L4YA 3RC3A 1S02A 1T6BY 3LYAA 5E3HA 2B34A 3PE4A 5FR2A 3I73A 3OQVA 1JHUA 1E89A 1TD1A 1ODFA 1J23A 3AEUA 2D4AA 4KFSA 1FXWF 5ICCA 1JHRA 3ZHQA 3I9V6 2XCLA 1LBTA 4RK6A 3K16A 3CE6A 5M29A 2QAGA 4PC2A 3COWA 3V8MA 2CHGA 1I2DA 3IBYA 4ZDJA 3FSGA 2IHZA 4REQA 4EPXA 1O6BA 3OZIA 4IEEA 1IBSA 4KH1A 4BNKA 1K7CA 1QCCA 4J8PA 4AZWA 4NU8X 2A4MA 3EK2A 1VCOA 2XYGA 2G25A 4IQ0A 1B76A 1C4OA 3CR7A 4TZTA 3RG8A 2V54A 1N25A 1FK8A 4MW5A 3VO9A 2H92A 3OZVA 3W2TA 4BNDB 2UU9B 4A36A 5LPNA 1L5HA 3V4PB 2ZJZA 2ZTUA 1W6RA 1WKBA 1FNMA 2EC5A 2RHJA 5JMWA 3WP1B 2EKPA 4HUQA 3CUYA 1JPNA 1UXGA 4LA4A 1K4KA 2VF7A 4HN2A 1KBOA 2OGWA 3ZIDA 2YJ3A 2FMFA 4P34A 4OMFG 1IHPA 4UEKA 3AETA 5GONF 3D6TB 2O8VA 1QJCA 4EJSC 2IH4A 1QP7A 3I9JA 2QL6A 4R6XA 4FYWA 1DLJA 5C7YA 5JZVA 1IHYA 2P2SA 5K51A 2X4IA 4WXRA 1UMBA 4L4XA 5JQWA 5KTNA 2P27A 2W0MA 1Q20A 3C6MA 4DEXA 1MB9A 3LBYA 2P8JA 3NRJA 4EYOA 2PGJA 2ZJ4A 2HF8A 3BFJA 4JUDX 4NIMA 4ZVQA 4U6QA 3F5QA 3MYRA 1FX0A 4LNHA 5FOTA 2FI1A 1QH0A 4E7OA 3L1HA 1QUFA 1CYDA 5HF6A 3II6X 1WDWB 1NDQA 4FGUA 1TKRA 4PGFA 2QOEA 2QMYA 2GCPA 3GUUA 5AM3A 4E1VA 4QVGA 3VTKA 3X2FA 4EUNA 4P4GA 4L0CA 1J2JA 2QW8A 5D6OA 1SCBA 2YV3A 2QSJA 2QUJA 2R5FA 4ND8B 4W6ZA 1YZKA 2P6NA 3DBRB 3EC1A 3KSMA 1T3ZA 2Q2OA 3GD5A 3GJ4A 3M4NA 4FYXA 4N7MA 3RIXA 1TEHA 3T6KA 4BQRA 3MM4A 4NARA 3H5WA 2ZRPA 4KFRA 4P5PA 1QHEA 2DG2A 2V7XA 3JWPA 2P11A 3ZHUA 2R8YA 2ZYAA 3Q9SA 4AKIA 3UK0A 2E89A 2F00A 2WWGA 1XZAA 3CLSC 3ZE0B 4L1KA 1NF9A 2BRUC 3L4BA 4HQFA 3IT2A 1O6CA 1XEXB 3H4TA 4C89A 3K0FB 2JDID 1NT2A 3LNTA 3AR8A 2V7QD 3QUAA 4K9PA 1O95A 4DR6B 4WNCA 1ZM9A 3KT8A 2NP6A 3IBFA 4ZCMA 2N75A 3RROA 2ZDQA 3HKBA 4DLRA 3ZKWA 2FB9A 4C0AC 1KORA 2A6PA 1SZJG 4X8LA 1H6BA 4DHWA 3BWCA 1DXQA 1BD3A 3PX2A 3ZUPA 1PJQA 3EXIB 3S2IA 1HSOA 2WVHA 2AFVA 4V1CB 1KFBB 5AVVA 3JARB 3AHIA 4ZI7A 5KQRA 1MW8X 3WYBA 4D8YA 4NI5A 1L5MA 3KQQA 1OH7A 5J59A 3ZLTA 1VIVA 4XPIA 5CX1B 1T34A 5FTWA 2IRWA 2LE0A 3QEOA 5KS2A 4C03A 1U9YA 5KYYA 1GJRA 3FW1A 1V45E 5D3ZA 1EVLA 3VPDA 4COOA 4J75A 2XIJA 2XUFA 1XZQA 4BMVA 5AVRA 3B7GA 3RQSA 1TAUA 3O3OB 4S24A 2J0QA 1XMVA 4P08A 2YIMA 3QNWA 4WFQA 1RP7A 4Z2AA 3HYSA 4WKGA 2EW8A 2C8VA 2YFYA 4MV3A 2J41A 1AC5A 2XMRA 4DR1B 2GO1A 2YBDA 1PJLA 1PFKA 4YV2A 4LZOA 3DMYA 4PVCA 2XODA 1A50B 3JR3A 1KYTA 3PUXA 4RJIA 4DDVA 1RC8A 4N12A 2M1XA 2H57A 4M6WB 1JPVA 1ZM2A 5A9SA 1XTZA 2Q28A 2Z5VA 3R3SA 3GJ7A 3W3AH 4JEHA 1AKQA 2XNHA 2FG6C 1QWOA 3PVSA 4C3VA 2KM1A 3QU4A 3ADPA 4J0CA 4WKOA 3A9CA 1KJZA 2PA3A 4PTZA 5L3SA 1KRXA 3ZVKA 5AJYA 4M9CA 4ND7A 4HLQB 3L05A 3TH5A 2W43A 2FMTA 3RTDA 5K3FB 4CEJB 1YKFA 2UUOA 1I6KA 3DTVD 3DVQX 4KQMA 4YJHA 3KXIA 4LZZA 3KPWA 5DYTA 1Z3IX 4HC4A 3L7IA 3AWIA 4UZFA 4E07A 4N9QA 4BL5A 4M49A 5FBHA 1E6WA 3UYKA 4EY8A 2RGEA 5AVJA 5FO0A 1NFRA 1V96A 3T3EA 2ACWA 4GPZA 4Q9IA 2G28A 1Y1SA 5BW6B 3V48A 2O8CB 2P78A 5ERGB 1XZCA 1I6WA 2CNDA 1LW7A 3L1IA 1PT9A 4F5DA 4K86A 2FR8C 1P6UA 3UBMA 1FU7A 3OLVA 1OIXA 4L2IB 4MEBA 5EJ2A 4DL9A 4ARCA 1R4ZA 3FIJA 4TTVA 4G5OA 4YRRA 4AI6A 3HU2A 1W9MA 1H2YA 3IVXA 3GFFA 4RPGA 1P5ZB 3KFLA 4U7GA 2RHBA 2HMSA 3P0IA 4FR2A 5CM8B 3BWEA 3CG4A 1MF7A 4F06A 5LMZA 2J6HA 5KYVA 1RWMA 4IJUA 4NNOA 1H5QA 1M7BA 1EGVB 1VGVA 1UBRS 2ZYHA 3K0AB 2ZQYA 4I8IA 4RO0A 2P35A 4YIHA 1MT3A 2JFWA 3IDFA 1BXZA 1CK4A 2EBWA 3RRYA 4HT3B 2IYRA 3IAEA 4E2WA 1JN0A 2VDPB 3DV2A 3KJGA 4LFAB 3UAZA 2AOUA 5HE8A 1Y8QA 4JLNA 2ZBPA 4Z7QB 2YNMC 5COAA 4W1RA 5LQMA 4NATA 4Q1AA 5K3DA 4C3OB 3UMMA 1RXUA 4Z3OA 5ELXA 4QA9A 1A5ZA 3NHAA 3DE0X 1OXBB 1R6DA 4JLBA 1DJOA 2NO5A 4LCEA 3ZUGA 4F38A 5K8LA 3S8EA 1ZC4A 2W2LA 1RZ3A 4NCXA 4F04A 1SKAA 2DB3A 4HDSB 3K9CA 4QQFA 2CY0A 5BN4A 1G8PA 1XQ6A 2PZKA 2AD5A 3JWIA 2QLTA 2LBPA 5AI9A 4WN3A 3ZWKA 2GPWA 4ZZ1A 3G2OA 4US0R 4TRMA 4DUZB 2WKSA 3MMZA 4YJFB 3OQJA 4Q9KA 1UM9B 5ALPA 3A1TA 3O2SB 4BLPA 5IANA 4JFRA 1IDN1 2NZ8A 2P5TB 3JZDA 1LX6A 3SEZA 1RPNA 1MR3F 3OJEA 4UUBA 1Y5LA 1TJPB 2O7QA 2RDMA 2WZQA 1IYZA 1THMA 2PWYA 4RDCA 1E4EB 1S8NA 1XDWA 1MQ9A 3A28A 3IMCA 3PUYA 4ZQIA 3TKLA 1KVTA 3AR5A 5LSAA 2HRQA 4JITA 5CDTA 5HPYB 2HWWA 3OD5A 4ZZIA 5T57A 3BXGA 1CVIA 3FUTA 4K9SA 4B3BA 1QZTA 5DNUA 2CXPA 2AF3C 2EYQA 2L42A 1K08A 1WHTA 2PYDA 3I5YA 3FFAA 4HN4B 4UEWA 2C92A 1NVVQ 4R2KA 3P0FA 3QEKA 3H7IA 5F51A 1NUUA 2ANBA 2PS0A 3HABA 1EVJA 2G5PA 5KWEA 2KX7A 3G2LA 4FMPA 3MEQA 1AGYA 1VLZA 4GYJA 5L3RA 3TAUA 3WWEA 4BFWA 1JDPA 1KO7A 3Q15C 4QDUA 1TC2A 1XF1A 1DEXA 4FMCF 4IJ6A 3ZU5A 1SPBS 4ND3A 3EZXA 1SHKA 2X9QA 3AVPA 3E03A 2Y4NA 5JAZA 3PTLA 4R2WA 3I58A 3LPAA 1MAUA 5EJGA 4UNPA 5HRAA 4TXMA 4HS9A 2AG8A 4RTOA 4MB2A 5B37A 1P4SA 4IIUA 1W0KA 3MRVA 1BNCA 5T64A 2QIOA 1IIBA 4GZ6A 1HEIA 1E1DA 1UJ6A 4MLZA 3DFIA 2C99A 3LP5A 1ZN7A 4E5PA 2NXJA 4IUBS 3TD2A 2ZYTX 1ZD9A 4AL4A 2IHJA 3BSFA 3NVMB 4CPDA 2HNAA 2RGCA 2PH1A 3WIDA 1L1RA 3L7YA 2ZUBA 3F49S 2H1IA 4X65B 4NVRA 1EAYA 5A6SB 1Y37A 2AFIB 2TECE 4KPUA 4B9EA 3AZQA 4WJKB 3E9MA 5ALMA 5BV2P 3IHWA 1T1EA 3LD9A 4J0KA 3LBFA 2ZXFA 4RYDA 3MT9A 1Z2CA 1R12A 3WFZA 3FTQA 3O2JA 1XNGA 4FFLA 5EPEA 3BUSA 2O1WA 4EQ6A 3TUZC 3EUWA 4JFAA 1L7PA 1ZEMA 2GK6A 2QMUA 5AK3A 1GZUA 3ANTA 5CB6A 3SGLA 1AB6A 1C9EA 3JYOA 4BQNA 4ZXPA 3HMKA 3T8YA 3V5NA 1NYQA 1PL0A 3N2GA 3IHLA 2MSNA 5ARCA 2XQVA 1J97A 3NKFA 3SJCA 2JANA 3VRHA 4MYRA 4I55A 4AIRA 3O93A 4G23A 3GLIE 3KHUA 5I7RA 2WILA 4JAVC 1UXIA 2QYHA 1S3IA 3KHSA 2J3EA 2A1UA 5E8JA 4EA7A 3WMWA 4L51A 2HRZA 2PYZA 3DLHA 3TOXA 3DAOA 1UPAA 4RTSA 1UXOA 1NX6A 3QVKA 1KJJA 3GXBA 3PFCA 1CJCA 4NONA 3K3PA 3VH1A 3I9V1 3QWHA 1B2RA 3PC8C 3NHKA 2A9PA 3BGOS 3KZMA 3IXQA 4IKEA 5DNEA 5DTJA 4YAIA 3VZCA 1SIOA 1UIRA 1IN1A 4XX0A 3A14A 5HJ7A 1KE1A 1QGDA 5AK6A 1P7CA 1RAAA 1USVA 3HP1A 2IS1A 1ZCBA 1X1AA 4OHPA 1RYBA 1XKLA 4YP9A 3T3IA 4EEXA 2FQ1A 3HUFA 3U6KA 2R0QC 2DH6A 3WIUA 3CKMA 2VT2A 4AZ0B 1PR9A 5AJHA 4EKIA 3TFOA 1H0HA 1QQ7A 3TSOA 4DDHA 3NM4A 4CKWA 4UHFA 2DPMA 4LTNA 3M3PA 3RFVA 1FUUA 5CB4A 1P7ZA 4KLCA 4RK4A 5KNCD 1CZRA 3U4GA 2AQ8A 1S01A 5J2UA 4J4BA 1V4BA 1Y7LA 2FPXA 1U2GC 4D1YA 4B3TB 4PICA 2PKQP 3RS2A 1YNOA 4IMIB 4OHOA 4BNHA 4DVJA 1AQLA 2P3SA 2NVWA 4EEZA 1UKYA 4FLFA 3SKXA 5LKAA 4TLCA 1KYYA 4PYJA 1UDBA 4Y67A 2QVBA 3OM9A 3VZQA 1A8SA 1T9AA 2HWKA 3MPOA 3PX3A 1V6CA 1M8FA 1Z0ZA 4D9BA 2ALJA 3F3SA 2FWIA 1LJLA 4GP7A 2IF2A 4X95A 2PS3A 3NNSA 1TZJA 1C30A 2BZGA 4RW0A 3U39A 2JCVA 3EYWA 1V1RB 2F4NA 1PYOA 4MR7B 4RYLA 3V2UA 1U0HC 1XCPA 4D9IA 3D1LA 3F74A 5L9AA 3KQHA 2X9VA 3LLMA 4DT1B 3IO5A 1N4AA 2PY6A 4C88A 2EV9A 3LBNA 4RXTA 1JHZA 1U63A 1EUDB 1UQRA 1G4UR 3CWQA 1UM8A 2VJOA 3BD7A 4HGNA 5D7BA 2NSHA 2VBCA 4U6NA 1ULBA 2VXOA 1UC9A 4MGYR 3B1XA 3OM0A 1GU1A 4HD8A 4MB0A 1GG5A 1IL0A 2QPLA 4AECA 3OM8A 3L5KA 5BMVA 2VTVA 4CLRB 2JI8A 2IFTA 2O2HA 3UANA 1X87A 4I9NA 5DLYA 3O8QB 2I33A 1QB8A 3TDKA 3WTCA 5E7IA 3V8VA 1US8A 3FPSA 4Q24A 5I9IA 1JTVA 2OENG 2X19A 3BAFA 1SXHA 1VFPA 1YBFA 3JV7A 3T9EA 1E61A 2UYOA 3NP9A 4TKVB 1X6VA 2FSFA 2OBFA 4LXHA 4UEOA 4F4FA 3WLLA 1NJ1A 5KDOA 3OEED 5DSTA 1KXZA 2X8AA 2ZW9A 2ZRBA 2J0UA 2AMVA 3AZOA 2J5BA 2JHAA 3E15A 5H80A 2ZLBA 2VJMA 2EP8A 2RBKA 5E9AA 2HAEA 2QT1A 3OMXA 4ARZB 3NBQA 4H7HA 1E9AA 2WNSA 1GPAA 2YV4A 3PDWA 4P6VF 1Z47A 4DGSA 3ZBPA 4GM0A 4ZYXA 1SQ5A 1O5OA 5I4CA 5F9MA 4FR5A 1LLDA 3X0DA 3ANYB 1XA0A 2FX5A 4DIBA 4PM4A 1G5QA 2FCRA 1PZHA 4W5HA 2I1VB 1IJEA 3SIRA 2TMDA 4CMHA 4FSHA 1GCAA 2O5CA 4BMCA 4Z0PA 5G0WA 1AF7A 1WSWA 1WW3A 1SIUA 1U9ZA 2X0IA 3D3WA 3LWNA 3RS8A 4DLUA 1O94C 1TDJA 4XLZA 4ZAGA 2XECA 1KMQA 3QUBA 1F6WA 1L5OA 2H08A 3MXOA 4J16A 5G0SA 4LX0A 5JAMA 3M4JA 3T5BA 3CH6A 2PMDA 3DAGA 5AM4A 1MQAA 1Q0LA 2WM9B 3IBSA 4MVCA 4MIEA 5CFLA 1PJSA 3K9LA 2HI0A 4GMKA 2XE7A 3A6LA 4Z7NB 1WRBA 2YVLA 2YJ6A 5LYJF 4NHOA 1TK3A 3RD5A 2DQYA 2WIAA 3CZMA 2WJHA 3H5RA 4J9UE 4MRPA 4UUAA 5DE3A 4D81A 4YRAA 2CUTA 1JU3A 4K0KB 5BN3B 5IXJA 1MJGA 3H8WA 1U7DA 4L22A 2R11A 2ATIA 2ZVQX 3GVPA 4O4LA 4WBSA 2QX9A 2AZ4A 3U62A 2QXYA 3EQ8A 1HO3A 3AR4A 4YV7A 3IEXA 4L75A 5KOHA 3LVFO 1XLUA 2I66A 2E6KA 3JQ9A 4MQ5A 3C6YA 4EAQA 1D4FA 1N34B 1FRNA 1OB2A 4FLMA 1JEAA 3RSZA 1IUNA 1TF2A 1O95C 1T4CA 2GLTA 3DMTC 1CBUA 4RM2A 2XGSA 1GNPA 3IBGA 4PLTA 2EZUA 2CV2A 1PGQA 4IDAA 5DV9A 2DEUA 1KI6A 3GEBA 1X3SA 2DC1A 1GU7A 4GI7A 1XCJA 2HGSA 4E1BA 3JQ7A 3DDWA 4EKYA 3QBTA 3ESAA 3CLSD 3BGDA 2VO1A 3TZQA 3DE1X 2JFQA 4O4IB 5CYPA 2O6LA 4L73A 2PR2A 3WG9A 2BFFB 4NHEA 3W5CA 4L3WA 4PTLA 1ZOSA 4ZCQA 5BV7A 5JADA 1GZ6A 1UWKA 2GZ2A 2W00A 3JX9A 1U4OA 4DA0A 4PSDA 1Z13A 4B1FA 4B8YA 4HVTA 2X5OA 1JL3A 4U7FA 3AW8A 3FFWA 3OZRA 2YRWA 1K7XB 5A9RA 3CJRA 3GU3A 3UG7A 2PZJA 4IMRA 3RM3A 3STTA 4TYYA 3M9WA 1WCYA 1XAHA 2B30A 3E3NA 2X0EA 4BO7A 2X0DA 4UQPA 3P9KA 2PZMA 5EYPA 2OFFA 5HUJA 5KJ1A 4G85A 4JA0A 1L5QA 4DV6B 1DAIA 4XYMA 1F9AA 4WFKA 2HU2A 4BU0A 3SBEA 1M1XB 3Q87B 4CZ2A 4ZKDA 1ZEJA 1AA6A 2CLLB 2XMZA 4EGSA 2WWYA 4PS1A 3RK1A 1PVOA 3JSXA 2QSZA 1E2BA 4EZIA 4ZJUA 4MR9B 4ROTA 2OESA 4UVDA 2GCOB 1NNI1 4G8BA 3D0KA 3WSWA 4TT3D 2Y0PA 1W85B 2Q2VA 4RNDB 4F6RB 4YWHA 2VEOA 3FTCA 4L4SA 2B78A 4DIOA 1OROA 2HJSA 2J09A 2W6PA 3VV3A 1JI3A 2IGBA 5L4NA 1M54A 2I9PA 4KVGA 4URXR 5A3SA 4F7WA 3NLLA 4A7PA 4ZEWA 2I8CA 3C5CA 2BHLA 1B6GA 4Y8VA 5LP1A 1CUJA 1IN7A 1ZJ6A 2QAGB 2QX6A 1H69A 4L8VA 1Q12A 2VSYA 2H54A 2OXEA 4REQB 2YIJA 5B1IA 1XEWY 5EKSA 3VH2A 2P9JA 5CVCA 4DQDA 4NCIA 4V0KA 4BNIA 5FO1A 3DLAA 1F17A 5E9WA 3U40A 5CXQA 2NTYC 4A3SA 2O8FA 1BWPA 1QVAA 2L18A 4QC2A 3UV3A 1HE4A 4L3OA 1L5HB 1EBFA 2RKWA 1OPXA 2VK8A 3ZHXA 1PYDA 1ZVJA 2NACA 5AM2A 3G3EA 4BZWA 4BV9A 3IUJA 4HUQB 1CRWG 3H9CA 1SC9A 2IHKA 3ORHA 3RVMA 4XWKA 3N05A 3ZE6A 3RUFA 3LRTA 3B2EA 1I5EA 3QTLA 4BJ6A 1S4QA 2I6XA 4E03A 3AETB 3FWKA 2LUOA 1CS4C 3C6XA 3I2YX 3R5KA 3SOPA 5THXA 2NZYA 2C2OA 2NOAA 1HDXA 1UMBB 1WP9A 3ZY2A 1H6DA 2GESA 3FWYA 1QJ4A 1SPXA 3H9JA 3KIPA 3FI9A 4WXYB 4QQ8A 2H1VA 2DFLA 2DBQA 5E2AA 3AT1A 3CSDA 1NMYA 1TCCA 3KT3A 1KARA 3C45A 5JE8A 4Q7QA 4QJBA 1DWQA 1RTTA 4MCHA 4IWYA 1WVGA 1U2QA 4ZCSA 4B34A 1F7UA 3BXOA 1FIUA 3LF2A 3D8UA 3COVA 1AGNA 2BKEA 3N2NA 3QVJA 4JI7B 1DC7A 2F9FA 4QEZA 3GLKA 2RGDA 3O2NA 2PVSA 4YRPA 2VHYA 1A95A 3D8RA 2HF7A 3KTDA 2QI9C 1I7PA 2W90A 2XGJA 1J42A 1Y9DA 4UHCA 1H23A 1P3Y1 2GVDC 4D96A 1EH5A 2CLHB 4U6SA 1JYEA 1DAOA 1QZZA 4JLKA 3AHGA 1VM6A 4EYKA 2YNMD 2BFBA 1KDPA 2DRIA 2PU5A 3KALA 2V96A 4HAOA 2JHGA 3GNLA 2A59A 1DRKA 3COSA 1AXEA 5BVGB 5LIPA 4KXNA 3WVNA 4YMLA 3ZBQA 5B55A 1HT3A 1M76A 4CUZA 3EOZA 3W79A 2VSFA 3RUEA 3TKYA 5DBOA 3PRJA 4GGMX 3D2LA 2Z1NA 4MRVA 1FMLA 2TMKA 3ZV5A 2W0SA 1R8SA 3JQCA 1NTRA 1XZHA 2HA7A 4CLEA 2LW7A 1IAVA 5LXTF 3U7FB 3HKBB 2H7YA 1W8DA 3NT2A 3ZKWB 1Y4ZA 4DCSA 4F3CA 4G0QA 5LZ8A 4JWKA 2XYPA 2I7TA 3QLUA 2QM8A 3BF8A 4W5JA 3CVXA 4BMXA 5EZYF 1XNJA 1RAHA 1JR4A 3R9WA 5E7MA 4K6GA 4ZI7B 3T35A 1MFZA 2RHHA 1M2VA 3CZ5A 4OFBA 5KMGB 4LY0A 1FXSA 2R65A 1WZNA 4CQLA 3IODA 2EBFX 4LE2A 4XPIB 3DEZA 3GBPA 2GYWA 1T15A 1R5JA 5KYYB 1R8JA 2WINI 2P3OA 1P1JA 2BFNA 2O6HA 4ZODA 1IBLB 2A57A 4D44A 2PZEA 1D6SA 1J09A 5TEVA 4Y0VA 3TR0A 1BFUA 2ANCA 1KYXA 3E0QA 1B15A 3W6OA 2R1UA 2VKQA 3EWNA 5JTUA 4MDHA 2PFGA 1C0KA 3FTNA 2BCGY 1JFFA 1BE1A 3OFNA 1ZO8A 4ZZ0A 2JF0A 2GEJA 1IRIA 1XXHB 4K6KA 3TO5A 2IW1A 4NPCA 4ENRA 4CXMA 2F8TA 5DI3A 3IULA 2QD1A 4MEJA 3LQRA 3W5JA 1BSVA 2FU5C 2ARKA 4M7WA 3DGFC 2C58A 3VHLB 1CG6A 1LBHA 4ARSA 5A9SB 2V1UA 3GZTB 2AF4C 4UMDA 1G5TA 5AXBA 1LRLA 2VHZA 4K2HA 4HNSA 1OD6A 3NANA 4R16A 4MGIR 3U3XA 4FGWA 3ZD8A 1R8YA 5FPTA 3ZPXA 2OD2A 4J0JA 5U4XA 3BRQA 1Y9EA 5L3SB 4TXNA 2E55A 1LDMA 3ANMA 4Z99A 5K0CA 1RKXA 2X76A 1XKTA 1OBOA 2PMBA 1DC6A 1QOPB 2I78A 5H3HA 3AJ9A 4JVMA 4BC1A 1FJ2A 4UBOA 4JWTA 4YJHB 4LGVA 1NY5A 3F3KA 3KL2A 1SU4A 2RAVA 4Q4HA 5IT5A 1IHDA 1KFKB 1V5EA 2XQFA 3AQIA 4GI3A 4C06A 5K7SA 3KKZA 3RASA 1HG0A 1LEHA 4IGEA 4IIDA 4FW9A 4NCNA 3SI7A 3ICVA 3FX2A 1Y7HA 1Z2PX 5TQJA 1BMTA 2GNOA 1OQAA 1J0BA 2QR3A 4GH5A 2IYWA 4R1LA 4Y6SA 3S68A 3A1DA 3H2BA 2OE2A 3VDRA 3I32A 4N39A 5K3OA 1WV1A 2A94A 1SOWA 2DKNA 1I9CA 1U31A 2QRHA 3ZU3A 1LNQA 3BJZA 1U8CB 1CRPA 2I6GA 4Q39A 1NUTA 2XOXA 1Y3FE 3WXBA 2R6FA 3DZIA 3MS7A 2FH5B 2VSXA 3KEOA 3VU8A 1QGOA 3OIUA 5TARA 4J43A 4JMPA 4OXQA 4WCVA 4E21A 2IS4A 1HNXB 4MCIA 4CF6A 4LXYA 2DBZA 3E7WA 1CZHA 5TVGA 3LH5A 2O2CA 5J63A 1V4VA 4MV0A 4P7FA 5CD9A 3EMVA 2BBTA 1VI2A 2B8JA 3GDWA 3NO4A 3QXSA 1I7SB 4WFJA 1QLWA 2AOUB 1XZGA 2B92A 1Y8QB 2M1ZA 4J0GA 3U3MA 3FVTA 1RABA 2WHXA 2BDTA 4J6EA 2ZJBA 3HJHA 4QUBA 2QPTA 3DEJA 1Q92A 3NOQA 4AYXA 3DVRX 1JAXA 4FNMA 4K5QA 1I13A 1NWCA 3GJ0A 1L3CA 1NFFA 3MAGA 4Q1FA 4XASA 4CUJA 3LQFA 2TS1A 5BN4B 1ZRSA 4GOLD 2DCUA 4M0CA 1NVWQ 3QWIA 4KV9A 1F1BA 3OQ1A 4Q9HA 1CY6A 6GPBA 1PLLA 2NUAA 2G83A 4IQ4A 2PX6A 1YZVA 1EDBA 1OI3A 1YU6A 2HJRA 4FBMA 4FHGA 4BKRA 1NJ8A 3URMA 5K0GA 1U65A 1WNTA 2EGHA 4B3FX 2MSWA 3E58A 1YB7A 5FA6A 3LG2A 3OAAD 2B1IA 4KWIA 2E4XA 2LCQA 1XWFA 1RWWA 3BB1A 1TKBA 4ZZ3A 5LQKA 2VDJA 4TLMB 3UJPA 3TOSA 1PT8A 3IA2A 3BSYA 4HAIA 4MI1A 1VP9A 1MHTA 3I53A 1SHLA 3GDOA 3C1UA 4ENVA 1W88A 1QKKA 1WHTB 1Y5MA 2H00A 5WRFA 3AFGA 1AS2A 4OSOA 1W49A 2FK7A 4ZO8A 1YCDA 2WY2D 1WDKA 3F1KA 5BUSA 3P2YA 2C5FA 4HTFA 1EEHA 5I7HA 2VZ9A 5CXXA 4LTDA 5KJ6A 2N47A 4JI8B 1XX6A 2VNKA 1IOVA 1F3LA 1W19A 5DMXA 5DNAA 3J80A 5L51A 3QOFA 4ER7A 1AHPA 2MYPA 3ONWA 4ISCA 1DKOA 5C46F 1HT0A 2E4AA 1JDVA 2X0JA 2AN3A 1MQ8B 1P2TA 4JLDA 2GA9A 5BNFA 1U2EA 3TCNA 1GPYA 2ZB3A 1FDWA 3M6VA 3K1AA 4I8DA 4O1HA 5GOTA 3TRIA 2I4OA 5BVHA 4N0DA 2D0OB 5B2ZA 3FDIA 3LY5A 4U5QA 2YZ7A 4R1MA 3VGPA 4KE8A 2L2QA 4PAGA 3NT5A 3ZE2B 5KPJA 3CFYA 1I1HA 1J5XA 1XLWA 2WG0A 3R5HA 4HPXB 3G6WA 2C8KA 1VRCA 4BASA 1A82A 2CCGA 1WMSA 2J46A 3FSGD 3H5TA 4J49A 2ZBGA 4X94A 1K92A 1VRVA 2DFPA 2GTIA 2HLHA 3G9ZA 1NHWA