3C74A

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
242
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 82
structure length 242
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c74A00
4TS9A 1CB0A 1M73E 1OU4A 1U1EA 5CCEA 5CYGA 5IFKA 1OVGA 1Z5PA 4BN0A 5F7OA 1B8OA 1ZOSA 5CXQA 1RFGE 4DAOA 1JDZA 2AI2A 1CG6A 1Y1QA 4D8XA 1V2HE 1VMKA 2AI3A 1RCTE 5F78A 1Y1SA 4D8VA 5EUBA 1JE0A 5ETJA 3K8OE 1TCVA 4NY1A 3OF3A 1PR6A 4JP5A 2Q7OE 1RXUA 4L5AA 1JPVA 3ODGA 5B7PA 4L6IA 2QTGA 1YQQA 2GUWA 1A9QA 1Z38A 1TD1A 4YO8A 4NS1A 4R2XA 2I4TA 4PR3A 3INYA 1LV8A 3FWPA 2I8AA 1I80A 2B94A 1K3FA 3T94A 3FNQA 5F73A 4DABA 1Y6QA 5F7JA 4TXLA 1Z5NA 4E1VA 4LZWA 1V4NA 3KVYA 4FFSA 2OECA 1JP7A 3BJEA 1SQ6A 3KVVA 3OOHA 4TYMA 3IEXA 2A8YA 4G41A 4TXHA 1N3IA 4TXNA 4OJTA 3NBQA 4WKNA 5CYFA 2ON6A 3E0QA 4TTJA 1RXYA 1Z36A 1V3QE 3F8WA 3KHSA 1Z39A 1Z33A 1ODKA 4DA7A 2HSWA 3OPVA 1RR6A 1VHWA 1PR2A 4OEHA 1VFNA 3NM6B 1YR3A 4U2KA 3KVRA 4GKAA 1ULBA 4BMYA 1A9RA 3NM5A 4GLJA 3P0EA 4ECEA 3FUCA 3OZDA 3FOWA 4UC0A 3E9ZA 1T8SA 5B7NA 1T0UA 4DA8A 1T8YA 3FB1A 1PK9A 1OUMA 3EUFA 4K6OA 1K27A 3KU4A 1VHJA 1Y1TA 3IOMA 4KN5A 1RSZA 3BL6A 1RT9A 1LVUA 4WKOA 5F76A 4YNBA 4D8YA 3UT6A 1A9SA 1Y6RA 5CXSA 1PR4A 3QPBA 2XRFA 3P0FA 3DJFA 4JWTA 3UAZA 1PR1A 4WKCA 2OC4A 1FXUA 4WKBA 2QTTA 1RXCA 5K1ZA 4G8JA 4MARA 4F2PA 2HRDA 4QFBA 2PGAA 4QASA 4H1TA 4OGLA 3FAZA 1OV6A 4MCIA 1Z34A 4PNPA 3D1VA 1PBNA 1OTXA 4LNHA 1SJ9A 5EFOA 1U1DA 1JDVA 1A9OA 1NC3A 4OGKA 2A0WA 3GGSA 1Z35A 4MCHA 1C3XA 4NSNA 4LKRA 1Z37A 1A69A 3LGSA 1JDSA 4YMLA 4TXJA 2ISCA 4GLFA 2QDKA 1Y1RA 4R2WA 3LA8A 1JDUA 1ODLA 1PR0A 4JOSA 4R31A 1SD1A 4EB8A 1PWYE 3EEIA 1NC1A 1JDTA 1V48A 4P54A 1Z5OA 5KB3A 1ODJA 1JYSA 4BMXA 4F3KA 3SCZA 5EPUA 4L5YA 4GMHA 2A0XA 4F1WA 4TTAA 3DF9A 4L0MA 4X24A 1ULAA 1Q1GA 3O6VA 3MMSA 4M3NA 1B8NA 4QEZA 3DDOA 3TL6A 3E9RA 3UAYA 3PNSA 1WTAA 1XE3A 3OZCA 5IU6A 3PHBE 1YQUA 3ONVA 3OOEA 3O4VA 1TGYA 4D98A 3EMVA 2H8GA 2OXFA 1RXSA 4L5CA 3DPSA 1LX7A 1V45E 2QPLA 1T8RA 3LBAA 1A9TA 4TTIA 4OY3A 3K8QA 4DA6A 1T8WA 2AC7A 2OC9A 3U40A 4OF4A 4IP0A 2A0YA 1A9PA 1PF7E 3PHCA 3EUEA 4RJ2A 1YRYE 3UAVA 2HWUA 1V41E 1QE5A 5CCDA 1OTYA 1G2OA 1YBFA 3OZBA 5C80A 5DK6A 3GB9A 4DAEA 4YJKA 1PW7A 1RYZA 4G89A 4M7WA 1JE1A 1NW4A 5JPCA 1TGVA 3NM4A 4QATA 3BSFA 5F77A 3BGSA 2QSUA 1PKEA 2HN9A 5F7XA 5B7QA 4F3CA 4DA0A 1K9SA 1ZL2A 3UAXA 5I3CA 4QAQA 4TS3A 3DP9A 4BMZA 5FAKA 4WKPA 4DANA 4M1EA 1PK7A 2BSXA 3ENZA 2P4SA 1U1CA 4TXMA 2RJ3A 3UAWA 3MB8A 3PNPA 2AI1A 1SD2A 4QARA 4LNAA 4LDNA 1U1FA 2IQ5A 4I2VA 4EARA 1ODIA 5F7ZA 3OCCA 1ECPA 3C74A 4DARA 4D9HA 5B7GA 1U1GA 3KUKA 3OZEA 4F2WA 1PR5A 1TCUA
chains in the Genus database with same CATH superfamily
3UT5A 2IDMA 3MXTA 3VJRA 1P9WA 4ODIA 3E3OA 5DJ5A 3G49A 4C6RA 2QRUA 4I8XA 3K0CC 2PD6A 3H9QA 4P82A 4QL3A 4RDHA 2DTDA 5AKLA 2ECPA 3OC0A 1TT5B 2EF0A 3ZW8A 2GEVA 3GI1A 4BN0A 4QYSA 2I0FA 2B9EA 2P9GA 4NG5A 2A9FA 1UBOS 3HYSA 4UXIA 3DL4A 2WJGA 4OJMX 3WQHA 5EHQA 3NWOA 3ONNA 5GINE 3TTTA 4WIAA 2Q0SA 5C7YA 1RZRD 2AI2A 5CYOA 2IYSA 2Q50A 4KIFA 4KXUA 4ITRC 1XRNA 4H6PA 4P53A 4OYLA 1OASA 1CZNA 4H60A 4I5FA 4EL5A 4DMUB 3CV3A 1VMKA 2Y4OA 1I14A 3QXJA 1FFBA 4J0KA 2ROQA 2COKA 4I5IA 1BYUA 3KE9A 1TM7E 4N3GA 4X45A 2DWUA 1DRJA 2O8NA 1J00A 3IKTA 2I99A 4MV9A 5EESA 4KE8A 3TBHA 3KLBA 3PQEA 1OFTA 4JEIA 1STOA 2GN8A 3RVMA 1BAPA 1X7ZA 1Y1PA 4F38A 2B82A 2IUUA 2WHQA 3E84A 4LSGA 3LT4A 2ZSIA 1YZTA 1GGFA 2I6QA 5FOTA 4B09A 3VOBA 4BAUA 3WL8A 3ZQJA 5JO0A 2GILA 1B8UA 4Z3DA 3THWB 3IPYA 3GEGA 4P6VF 5EWMA 4E6PA 3K1ZA 2OLKA 4EMTA 1HH4A 3U16A 1J07A 5EZYB 2Q4RA 4DGSA 1ZWLA 3AM1A 3MWJA 1R4MA 2V7PA 2AKAB 3LOUA 3LSTA 2PWAA 4HGPA 3W5SA 5MN4A 1JIIA 2NXWA 1YQQA 4H08A 2W2KA 4K88A 4Q4JA 1OGJA 1OD6A 5K01A 4HRXA 2XUIA 2IZOA 2BEWB 5FPTA 3D2LA 4JCCA 5K8JB 4PR0A 1YNOA 4YAFA 1TF5A 3OM9A 4MYCA 3VTFA 2XTJA 3BCUA 5HWSA 1G98A 5ECYA 1W4BA 3EQ6A 4P4SB 4EECA 4J3JA 2C2ZA 2NVUB 1LC0A 2O1SA 2YIDA 4Z9YA 4CUJA 3UPUA 1G8YA 1VE1A 2IIPA 1Y34E 3DE3X 2A88A 4CHGA 3Q3VA 1M1XB 2ZS9A 3FUTA 4FFNA 3VC7A 5CB4F 2VP4A 1N2HA 2PCJA 2FFRA 3X44A 1MN6A 4X8OA 4MVWA 1ZIOA 4JJKA 4NV3A 2V6MA 3ZKWB 1Z73A 4MQ6A 2DPHA 2W2QA 1U5CA 1N5KA 1IFXA 3QNWA 4TTSA 4KR9A 2VK4A 1TW2A 1U2GA 3PUWA 3WHIA 4NKRA 3AHHA 4AZTA 3WIEA 3IA7A 4BFSA 1LDEA 3AUAA 3GVIA 1G0NA 2SCUA 1TUEA 1NXXA 2FMFA 2FWIA 4K9QA 2BFEA 2GAIA 4BKUA 3G59A 4GI7A 1ZMOA 3TZLA 1MO5A 3THYA 1P4SA 4ZAFA 3RK0A 1Z6QA 2VJDA 3JQQA 4KP7A 1J0XO 4RANA 3N2GA 3DOHA 2FZKA 2PJRA 5A4FS 3IBGA 4O1MA 3IR5A 2QVBA 1SUAA 3NUZA 2R60A 1QVZA 3W2GA 4P4LA 1WXIA 3PC2A 3F49S 3T5MA 3ABIA 2D2XA 1GQSA 3G2MA 3PFBA 1CQWA 1KU0A 2FG6C 1A2QA 3V7WA 2XE8A 1CUAA 3E0QA 3GLRA 2JGLA 4XUGB 5IK2A 4XB6B 4B33A 1KH1A 2VT6A 1Z36A 1OI3A 3BF7A 3CSUA 4L74A 4MKRA 1RRKA 5LMCA 4UQLA 4GU5A 3WJ7A 1Z33A 3IQDB 1H2HA 4P34A 3IJEB 2YQ4A 4I1UA 4BZXA 1E8MA 2FDCA 1SZJG 2F4VB 1OZAA 3CLSD 1KZ4A 4XJSA 1RYFA 1YR3A 2QUIA 5ALXA 3KVRA 2XCIA 4DJJA 3HKEB 2E3JA 4D4MA 1C4WA 4REQB 4KXNA 2I62A 3T5AA 1RRCA 1P8JA 3DLAA 2PKYX 3I2FA 3AW9A 4MVJI 2XUZA 2P5TB 5D3KA 4EA8A 3ESRA 3FTEA 3AWDA 9LDBA 2H06A 1AHPA 4P4NA 2IU6A 3TS1A 1JTVA 3JAWA 5D1NA 1SBIA 4O2AB 5ALTA 2F90A 2XA9A 1TT7A 3KKMA 3OZSA 1AUPA 2AMVA 2EGUA 4KUEA 3ROFA 3H3JA 2VP5A 2HQOA 3P27A 4ZYWA 3DD1A 3FTQA 3T7KA 1KBZA 1M33A 3NBUA 2W5UA 3ZNQA 5DNDA 4V0KA 1O97C 5A71A 3PITA 1R15A 2VJBA 3BD6A 4B6RA 4LECA 5I45A 1ARZA 1XRPA 3O1LA 3E35A 3PVCA 4CF5A 2Q7DA 1G5QA 2XKKA 1T0PA 5LMNB 1RJWA 4D9JA 1R0XA 2BY4A 3PWSA 5AKZA 4XE5A 3IOMA 1RSZA 2NYAA 3CN9A 4X8HA 2HQ1A 1HDCA 1DO8A 5DGXA 1DT5A 2WJYA 3PR3A 1E94E 4DG9A 4F1KA 2CT8A 2RBEA 3UT6A 4X00A 1V9SA 4D80A 4LK3A 2QLMA 1V16B 3X1XA 4YRKA 2EP7A 2HBRA 3CEAA 1F4VA 2Q3LA 1PV2A 3CE6A 3OPYB 5L3ZA 1ZGJA 1W85B 4YDSA 4BLUA 3RNOA 2XRFA 1QIGA 3IE1A 1JEQB 2OP0A 3DWFA 4FFOA 2GM9A 3I23A 4HRAA 4JWTA 4XVHA 3QVJA 5CLHA 3TECE 3GLSA 5FH9A 2JLVA 1KJYA 2JRCA 1YC2A 3MJVA 2OC4A 3RFTA 4DYVA 1C3OA 4Y1GA 3VO1A 4KNYA 2GPSA 4PCLA 4BJ5A 3DE6X 2PUAA 4ZKDA 3GPCA 2K2WA 4LSMA 5LWHA 1D1TA 4BLPA 1J0BA 4LZNA 4A0HA 5K1ZA 1IRIA 5K7SA 2XIJA 2G72A 4TSRA 4PZPA 1JIXA 1WXQA 4LRUA 1ORTA 2Z5VA 1NUUA 4UNRA 1Z6YA 3PUHA 4HYYA 1PGJA 2ZP1A 4XRGA 2BM9A 1KYXA 3TZQA 2AJCA 3DO5A 4G8DA 1E2JA 2JLBA 3LXUX 5AM4A 3FTFA 1Z0JA 2AWNA 1S3GA 2WM2A 4BVEA 4MPDA 1KKLA 2UZIR 4JGGA 3REQA 3M1IA 4W5OA 4FNGA 3DG9A 5H9VA 3GLFA 3NEAA 4H2DA 2I7TA 3QIAA 1ECLA 1QV9A 4U9UA 1AOXA 2CV1A 1O3YA 3GMIA 3VOTA 4Z49A 1SJ9A 4XARA 1H0KA 4WESB 2VNSA 1NPTO 1RAHA 2Q0QA 3NR2A 2AJ8A 4QYWA 4BJ6A 4CF6A 3DL0A 3H9JA 1YTLA 2XB4A 3ZDFA 1XXHB 1K8YB 1PT7A 3OKFA 4OXKA 5HYVA 2HIHA 1VMDA 4IDDA 1DAEA 3T7TA 3ZQ6A 2L2QA 1ILWA 1G0OA 3SYKA 5DULA 3OE7D 2Z8ZA 4WNCA 1GVHA 1Z37A 2BR5A 4XIGS 5D6OA 5F51A 4FMDB 1GL7A 1VMEA 5LXTB 1EB8A 2GAJA 3L93A 1KSHA 3OA0A 4HWPA 2DEUA 2IYRA 4G1EB 1E5QA 4FZ5A 4F3YA 4ITUA 1D6JA 4ENWA 2HPAA 4YRJA 4CUKA 5IX8A 1D8TA 5CT6A 1JKJB 4Q12A 1C9YA 1XKLA 2G04A 4RVFA 4BX0A 4ZICA 1Z0SA 2GBIA 2NZYA 1EYZA 1V9LA 2V65A 2R8OA 4IRXA 5BNFA 3W1EA 2JIRA 1QO9A 1WCV1 3AFMA 3GIWA 4JSRA 1SCKA 4J1TA 1FX1A 3IOCA 4UZSA 1AF7A 1OFUA 2YYAA 3CTMA 3MWYW 1BSVA 4I3GA 3ZWNA 4RQBA 4DJ5X 2PUCA 4CM4B 2EYQA 3CUEF 1RJ9A 3VNBA 2AXNA 4ZYYA 2BGKA 2EFHB 1NM5A 3R09A 3RIXA 5COAA 1RAAA 1NC1A 4G1BA 3L6UA 1JDTA 1V5IA 5FYDA 3OLQA 1Z5OA 2GBLC 3F47A 2R0QC 5JAHA 1QG4A 3BFVA 3QE2A 3AM3A 1JHRA 3IDZA 3MJFA 1AO0A 1OZHA 4EG6A 1U99A 3FLMA 3WGKA 1JJVA 1NSFA 2D13A 1XCGB 2P67A 1NXPA 1QWOA 2ZYVX 4F1WA 2VHJA 1ZISA 1BVYF 3QZUA 1AGRA 5KC8A 3GAAA 1WL8A 4TLCA 4C6TB 4CU5A 2YWRA 2XKAA 4JLKA 4UQOA 4NBUA 1T4CA 4DR7B 1IY8A 2IS4A 3HACA 3G6KA 3C5CA 3MEQA 1N2CA 4CZ2A 3A0RB 9ATCA 4S1PA 1EXMA 2E4XA 4GOND 3EYWA 4UMDA 3USZA 4PLTA 5HP4A 3NBYC 3IQFA 4NABA 1TPZA 1JQEA 3KOYA 4MW2A 4KNVA 2V6GA 2KSQA 4HMPA 2BTQB 2WTAA 1JB1A 1GZHB 1NUQA 4R3NA 3W6PA 1BYIA 3RS8A 2W0MA 3QBEA 5JVDB 4GGOA 3PNLA 5TVGA 3HBJA 1K7YA 3NKVA 4GI2A 2YL2A 4OATA 3D3WB 1VPVA 4QGSA 4HXEB 5A3VA 4ALNA 1ZD1A 1M8JA 3HY4A 1TCBA 4CG2A 2QEQA 3F8TA 1PZNA 3V8VA 3C85A 4F6RA 2GK3A 4R40A 4RPKA 1C7EA 2FHPA 3MPOA 1U2PA 1USGA 1CNFA 2Y0DA 3ENWA 2O8BB 4AWXA 1YS4A 1LDNA 3I4FA 3NFYA 4MGKR 1N5JA 1TB4A 1UBUS 1PL7A 2BI7A 2Y27A 2OXFA 3EMVA 1WU7A 1KDVA 3ANXA 4BXOA 1LX7A 4HUQB 4JIGA 4POOA 2CYCA 1QFZA 5FWAA 2ZRHA 3ZZ0A 3AF2A 5ER9A 3R1IA 4LQCA 3FXAA 1PQUA 1U8EA 2C9DA 3E61A 4M0EA 5H3HA 3LH5A 5F1OA 4CG0A 5AW7A 2LUOA 3EX7C 2ZPTX 2R5NA 1QVWA 2UZ1B 1WCIB 5LQDA 1JEYA 1P2BA 2AG1A 3KOXA 3EXIA 5EE1A 2G5TA 4A0RA 4J07A 3MJTA 2JATA 5IN5A 4DM3A 4E21A 3IUPA 3O7MA 3HWSA 4FOTA 4I9FA 4BNTA 1NVWQ 1U2QA 4JC5A 1CEQA 3VSCA 4IEIA 3KYDB 4DCGA 1XMPA 2UYOA 4OUDB 4KIWA 2OC9A 1AKQA 1EZ4A 1Q7TA 2QDXA 4YA6A 3EC1A 4F8JA 2GWHA 3ZHSA 1A9PA 3STHA 3MJEA 1TAQA 1IK4A 4ZOAA 3RTAA 1FIUA 1GKUB 1USIA 3GY0A 2NVBA 4TS1A 1Z47A 3DHEA 2W6IA 5FRDA 4NC9A 5ITWA 4PCVA 1DXHA 1J6UA 2Y05A 3GJ7A 4KWCA 1ZMBA 3GF4A 1YI0A 5JNSA 1XTSA 1G2OA 4LZZA 4AQDA 2QTVB 3OZBA 5BNWA 3RVSA 4KV9A 3P7MA 5AOVA 4CCYA 3PA8A 5LIPA 3GB9A 3JD2A 3L7YA 4W8OA 1QYCA 1HY3A 2BBOA 3IB3A 2D5AA 2GCGA 5A1TA 4CEJB 2BDUA 2FWJA 5LBTA 4EKIA 1P29A 3GR6A 4Q7EA 1OV4A 1M7GA 1NN3A 5C37A 5AK6A 4DDKA 4DMMA 3KQNA 3AESA 1NI4B 2MYTA 2VPYA 4B31A 5TQ2A 5FWXA 4DDTA 3BH6A 5WRFA 4C5AA 1M5UA 1W9HA 3QU2A 3SR3A 4DCUA 3ZDBA 3B3FA 5F77A 2GPWA 1PZEA 4KXVA 4PGAA 4RKQA 1U8UA 5T6BA 2NU9B 1MOQA 4U0JA 2P2CA 4MUIA 3VFDA 3EIEA 3OX1A 3A1TA 4P84A 1T10A 2NM0A 1PR3A 2QRHA 1ZIYA 3KPWA 5C31A 3VAYA 4EPWA 4G23A 4C7MA 2R751 3WLMA 4D81A 3E6AA 4L4RA 1U0BB 1U3CA 4EJSB 4MXDA 3GVPA 5F4BA 5FI5A 3ZDYB 1T9ZA 3L9WA 1E3IA 5FLXA 3E58A 4DANA 4DCOA 5BWOA 5LZ4A 3K71B 4NCIA 4DLWA 3ED5A 2PMFA 3B85A 2NV6A 3LUKA 4M8NE 2HJVA 4LDJA 5EMKA 3FSGD 4ZV4A 4ZANA 2VJYA 4XIYA 2V54A 3ZYZA 2AUTA 3T3NA 3V46A 2JEYA 1XZHA 2B35A 1SVKA 3ZE0B 5I5GA 5CT8A 1PDWA 4WX2B 3T41A 4IIVA 4JASB 3GFBA 3WGMA 4LJ9A 5KAMA 2AMJA 2V0CA 2CHVA 1Y98A 2XOXA 3G89A 4DLZA 5TARA 2JGDA 4CIYA 3FOEC 4W5NA 3OFND 4YQYA 5DF1A 1Q0ZA 5K4HA 2R6HA 2AI1A 3C43A 3QEOA 4N01A 4R2LA 4FMBB 4O0MA 2DHQA 4ZOLB 4XWWA 1FFWA 2X0KA 2GNAA 1XL0A 2I9PA 3QU9A 4WFIA 5I7EA 1UBRS 5IWCA 4IILA 4MZDA 5LM3A 1Y6GA 4W6ZA 1FRZA 3DPIA 4MCAA 2PNFA 2W0SA 3ZV6A 4NZOA 4OV6B 4Q4HB 3KUUA 3KX2A 4FN4A 2OSBA 4R8RA 2HHHB 3N0XA 3E7DA 4TTQA 1C3JA 1ZKDA 1M67A 2KYRA 2NG1A 2ZDQA 4NBVA 5DCWA 3HABA 5HW0A 3IP5A 4M99A 3E53A 2UZAA 4TKUA 4ZVUA 5LZ8A 1PR5A 4DUGA 1TCUA 3N0TA 4RY8A 3LBNA 3RFXA 5KDDA 3D6JA 1XT6A 4TS9A 1YWGO 1JHZA 4RK7A 3T34A 5G53C 4ZAXA 1L1QA 3QE4A 5I8ZA 4O4HA 4QBKA 3ESQA 2KLHA 2R48A 2QN8A 2QRQA 3H6HA 2RKBA 3P5BA 3V6LA 3KOWA 4X1YB 1QCCA 3RK1A 1L5OA 2IU4A 3CGWA 3DKKA 4C30A 3NUQA 3UK6A 4WACA 1IPHA 2K2QB 3EISA 3VA7A 2W42A 2NNWB 4NBRA 4EI9A 2IS6A 1XXHE 4GZ5A 1HM5A 1RFGE 1UMCB 1NQUA 3RH0A 4Z2AA 2KLBA 4GM4A 3G6WA 3ORFA 4F6CA 5KYXA 1Y5RA 5BW6B 2J0SA 3AEKB 3TTSA 5AXDA 5KO2A 2OR3A 2GESA 4S1NA 2AQHA 4ZQBA 1TM4E 4U2BA 2MINB 4ZT5A 3IE0A 1HWYA 3PUXA 4EL0A 5FPSA 3WLRA 1T2EA 4RMIA 4C3VA 1W34A 2WKSA 3TJZA 1JR3A 3BTUA 1EFVA 2R8YA 2RCYA 4NV0A 5EA2A 3H9UA 5FOSA 2HPVA 5EUBA 4YQFA 5JJCA 1H85A 2VWGA 4PX2A 4JYBA 1K5HA 3GT3A 3VU9A 1MJGA 4PPQA 621PA 3AIIA 4Q1CA 1H8ED 4BVHA 1MJNA 1YVPA 1ZVKA 2Q6VA 3GUYA 5EIWA 4WBNA 1VZ2A 1EVEA 3SFZA 3ZHTA 1TK9A 1K8ZB 4QYTA 2ZB2A 3P2MA 3U44A 1BHSA 2M6LA 3FVTA 2FZGA 2P0YA 5EN4A 2QD1A 4CKEA 4BECA 1E1DA 4TYWA 2XYHA 1AJEA 2X5JO 4WZBB 3HVJA 1YSCA 2QGFA 4RH3A 4MLPA 1KMHB 4DSTA 3OQVA 5CNKA 3C8UA 5AK0A 1U1IA 1V7ZA 1IIBA 3Q8MA 2J3DA 3DDHA 3HP4A 3L8FA 2ZBGA 2RHBA 2YY6A 1Y3BE 5KSOA 3BZUA 2O2DA 2BL4A 2HMUA 2RGAA 3F3YA 3SSMA 3PPIA 3ZJTA 3A4LA 4BUZA 1I4OA 3H2SA 2A94A 1N0UA 2WT4A 1YB6A 3H87A 3MLBA 4I36A 3ZCTA 2JCYA 3IAHA 4PR3A 2YDYA 4L0QA 1LSSA 3TNFA 2JBHA 1K4KA 3QVTA 2PH1A 4Z99A 1S9HA 5AJTA 1HLFA 4P5PA 1HSZA 1PI3A 4R2JA 2BELA 1O5IA 2JFZA 4PZAA 1QYVA 4X85A 4Q9JA 4HB2A 4AROA 4Z9XA 3CRRA 4DABA 2QWXA 1Z7BA 4IIGA 2WJVA 3WYAA 4LF6B 2ZM5A 2WIKA 4O2BF 1LW6E 5FUQA 2WVJA 5IC4A 3D0OA 3FD8A 3MTGA 4BO0A 5KBYA 3A25A 3VHXA 4EK9A 4LF9B 5JLJA 3H9GA 2VL7A 2DLCX 2ZBFA 4G0XA 3NYQA 5EJIA 3L7MA 3RSLA 5BV2P 1TKAA 4PZDA 3GJXC 1A5TA 2JK1A 2QYHA 1U80A 4LRTB 1PG2A 4B80A 3HWWA 3A14A 5C8YF 2YS6A 4HNGA 3CLSC 3WIDA 3WKEA 3EGDA 4HDOB 1SM4A 4BLVA 4PLWA 2CLSA 2X6RA 4GM0A 1HNXB 2C94A 4I1SA 5LVAA 3QYJA 4KQKA 3KYBA 3WKCA 4BB5A 4D9FA 3HUDA 3ILYA 3FI9A 4UU1A 3QVLA 1M7BA 3GOHA 5JZMA 1VLJA 3EE6A 5A4KA 4LDRA 3WV4A 3ICCA 3NBMA 4LX8A 1ZU5A 1L7NA 2QP3A 2N75A 4OXNA 1PE0A 1DLIA 1HOXA 4YAOA 2BMWA 4M76B 1LPPA 4RKEA 4UM8B 5ALUA 3UC9A 3CRZA 4O2BA 2CGEA 1YS2X 2Q4TA 1QM5A 3E23A 4LJ8A 3L8HA 3QQPA 2Y8EA 2FPXA 1DJQA 3FDZB 4HGRA 4WKNA 4Z6KA 2ON6A 4L07A 1F8YA 2I4IA 4OAPA 4EGJA 1BZYA 5C8YA 2JZCA 1GD1O 3C3XA 4CNQA 1Y8ZA 3MN1A 2IRWA 1R9JA 2B1JA 5CIQA 5IF9A 4WY5A 5CK5A 5LMZA 8LDHA 3LLCA 1FDTA 4DM4A 3AJEA 1R74A 4HUJA 3WNBA 2PEZA 1YR2A 2F1KA 3KTAB 2OGTA 4Z7NB 3FZGA 1NDQA 1SKAA 5I6DA 5KYYA 1QAOA 3KWJA 1XMQB 4ZJYA 2PFSA 1I7NA 5AW2A 2PG3A 4GUDA 3P0EA 3O83A 2OKGA 2FZ4A 1YDGA 4WCDA 4LDPA 4UHDA 1QDLB 2NPIA 3E9ZA 3D5EA 2GLTA 2XNDD 3QIVA 4P92A 4ZQFA 1YFJA 4RGBA 5FOVA 3L7DA 3ILXA 1K7XB 1VL8A 4KU4A 4OO3A 1RJDA 2B21A 4L4UA 1ZA1A 2B8EA 4OXIA 3S2ZA 4C0BA 5CXXA 1VA5A 3KEFA 2ZWVA 3HA2A 1UZUA 3FB1A 4DLUA 2CL6X 1G21A 2R1TB 2YZ2A 4IHJF 3M5PA 1ZIXA 5AUQA 1F7VA 1CYEA 4MI9A 4XCVA 1OYYA 3D6NB 3BKXA 3ZU5A 5ITZA 2B1QA 1B15A 2BSQA 2VBIA 3HKBA 1SMKA 3N2KA 4PO8A 4OYYA 1Y4DE 1R8YA 3CFYA 3BL6A 1GDHA 2JAUA 1LVUA 1PSZA 1CDOA 1P60A 1X80A 3Q3CA 5AMXA 3UK2A 3ZKWA 1UJ4A 5FAXA 4C7VA 3VKVA 4DG5A 1AZLA 3D43A 3E7XA 4ZDKA 4WOPA 4EGSA 4QU8A 2HCRA 4HAZA 1Y6RA 3AFIA 5EJ2A 1XLTA 1RDFA 4E4TA 5HGXA 2H4HA 3MSCA 3TPFA 1T5TA 2JHCA 2Q1UA 2BI4A 2O52A 4RGYA 4EGQA 1JHQA 2ATXA 2AVNA 1UBKS 3HDYA 3WLHA 4R1MA 3NBAA 4RA6B 1ADYA 3BAZA 1EFDN 1XVAA 5K0CA 5IWAB 2ZIAA 2ZSEA 3H5LA 4M83A 2XMBA 5DWDA 5LD2B 5JNRA 1QS0A 1ZNQO 4Y0VA 3B3GA 2H7YA 2X3UA 3FNIA 3KWFA 3ZEIA 5AW0A 1HDYA 5REQA 2VUIB 2P4EA 1WM1A 3JQ6A 2VPQA 4R2MA 5E2IA 2XE6A 2JKYA 2W71A 1N6HA 4H7JA 3WBJA 4B6FA 1KRXA 2QTWB 5KQPA 2IYPA 1QTIA 5LWQA 1J23A 2YW9A 5CCXA 1GGMA 4WOKA 4N0MA 1KOGA 1OV6A 3SEZA 3UF0A 4YCNA 4F7DA 4DYHA 1QGUA 1AA9A 3W5JA 1IVSA 1C7RA 4C7JA 2HUNA 5KNBH 1EUDA 2B34A 1UKBA 2RHDA 3SVLA 1V71A 3F5QA 4NQZA 1E7QA 4II3A 1UEIA 1NWHA 2H1IA 2PA3A 2YVQA 2MTBA 1U1DA 1I01A 5B53A 4XQCA 4B2LA 2UYHA 4DIEA 2DE0X 4LYEA 3THRA 2X1VA 3OQMA 4OCZA 2JLXA 1W46A 1W35A 2J48A 4IQ4A 3K0SA 3HNPA 3JRWA 4LV6A 3X1JA 2X76A 3ESBA 1KY4A 2C83A 1EFAA 4QNNA 5AYVA 3EEFA 3OCVA 1FMTA 1RYDA 4QUGA 4ZJPA 4LBYA 1DJLA 4LKRA 1E61A 4Q3OA 3RGGA 2XCSB 1K63A 1ZZGA 2ZIEA 4S3MA 3KDAA 4MVYA 4U2EA 4BVKA 1QDUA 1JDSA 1H3FA 2EWMA 4M87A 3ZV5A 1IWPB 1Z6AA 1OAOA 2AK3A 4TLEA 4HNAA 4YCBA 4ER6A 5AUPB 5CNIA 3RQSA 4OI0A 5KVSA 1GNPA 2IYVA 1YDEA 1RI2A 3UCEA 1C1YA 2OP1A 1MRZA 4NH4A 3KSUA 5DM4A 2ST1A 5TGTA 5BVHA 2ZRDA 5IZ4A 1FDOA 1PR0A 2DFTA 2AFRA 1Z6PA 5A7GA 3CUUA 1ICIA 3MTDA 3TRJA 1A7KA 4JQZA 3SS8A 2O05A 1YVUA 3DQZA 3I09A 4OP3A 5AI5A 1QGZA 2C77A 4YASA 4RPJA 4AKTA 5LN1A 3GPLA 5ELXA 4BGDA 1P1IA 1T8TA 3KVOA 3ITDA 1N2GA 5H7XA 1YMVA 4AJLA 4CEIA 4JLOA 4WXMA 2WU3A 1DEHA 2BMJA 2FOIA 3WMFA 5CNMA 3OICA 4U0KA 3ZJVA 3BN3A 1EAMA 2NN3C 4TV8B 4XX0B 4CLRA 4DFDA 4RSHA 4RTRA 5EPUA 4L6CA 2K5UA 3GEEA 3ONWA 4XGNA 4AZ3B 3TLJA 3ZZTA 4EMUA 1JEDA 1OIXA 2CDAA 2ZANA 2FEOA 2FAXA 3M0EA 2NNLD 4MICA 5HJ5A 4Q7MB 3AVTA 3VGJA 4URWR 2BFCA 2XLBA 4WZBE 2E1RA 5DN6A 3OI7A 4MP6A 4EKGA 2XQFA 4AB1A 3PD0A 1XXLA 4C04A 1Y5IA 2JJYA 1EE9A 5AQ1A 3D81A 4EITA 4OLAA 1JS1X 4F96A 3O2QB 2C8KA 3NDPA 4DF3A 3IUYA 2R00A 1H8HA 4Q1BA 4R2IA 4XSHA 3G1TA 3TSAA 2RHGB 5ED0A 3GBSA 1K92A 4YV2A 3ERCA 3R6GA 1ZH0A 1T26A 1FRNA 4TTVA 1GITA 5DISB 1E5TA 4F45A 2DBQA 4U8HA 2V7BA 1JLMA 5A4DA 5B1HA 1P4AA 2I1QA 2OK8A 4L85A 2DETA 2WI8A 3PGKA 1JSZA 2NT3A 4QREA 1YUBA 5AM0A 1QIIA 3T5DA 3UYKA 4W9RA 1GNRA 2DU8A 4KDRA 3NYIA 1Q1BA 1G38A 3KJNA 3GAMA 5BN1A 3R0QA 2ZWOA 4L5CA 3DPSA 1N3LA 3DXXA 5BSUA 2HA5A 1SRQA 2B8NA 4BTLA 1CXZA 1ZPDA 1VSUA 4GMXA 2XEDA 5B12A 3SFVA 1JVBA 2O4UX 2MYNA 1EFPB 2W6QA 1MGPA 1GG8A 1Q0LA 1JIQA 2OMEA 4MVXA 2VHXA 2CCKA 2OBFA 1OA1A 2G88A 2JGMA 2DRIA 5DNYB 2Q3HA 1DBRA 3N2LA 2HDOA 4IDAA 3TGPA 2FP4A 2PWBA 4ZEVA 2B1RA 3ZU2A 3A4NA 4B81A 3L0DA 4DPKA 1MEOA 2H1HA 5CPBA 3IH5A 1MQAA 1OZ0A 4MS1A 1VOTA 1U2ZA 2P2GA 4ZV9A 4ASUA 2H6EA 1Y8CA 1Y8AA 3A3KA 3H7AA 5E0OA 5GGXA 1CRPA 1G6Q1 3NWJA 4PLZA 2CMHA 4U2DA 5IBRA 5CCDA 2Q1YA 3BJMA 2GM4A 3TMKA 2ID9A 2VF8A 1HF3A 4GKKB 1GPBA 3ELUA 1XKXA 2JLYA 2WSYB 5DK6A 4ZQEA 4LJ5A 5EWJA 4WK4B 3TLKA 3HUEA 2PMWB 1X13A 3DHYA 4BJHB 4BO7A 2BKXA 1PW7A 1RYZA 2SNIE 3A1WA 2FSIA 2ZSBA 1QRTA 2IZ1A 1HKUA 4B5LA 1XTBA 3DE2X 4Z3KA 5EHZA 1KI8A 1VLQA 1FYVA 1AUQA 1ID8A 4KE7A 2HK8A 4JBGA 3ZU3A 4QATA 4DREA 5GV7A 1OX4A 3D5TA 4D4GA 1HNZB 3KR2A 4DQXA 1G291 3VC1A 4FD2A 3CNLA 4LW8A 4BX3A 4BX2A 3GGOA 3BULA 4PNHA 3RC2A 2IUTA 3OEYA 4BNGA 2GEBA 1DBVO 1A27A 1LRLA 4JQOA 1I3KA 3DD5A 2OHOA 4MV4A 2P9FA 4LVNA 3OTWA 3AGPA 2ISSD 4ETWA 3E18A 3HU1A 4AMZA 2IV3A 3F3SA 5JAUA 3SJUA 3TOXA 3ITNA 4C4TA 3KOOA 3PLNA 1I5OA 1HT1E 2G4CA 2Z4TA 2W6CX 3HCPA 4ZP1A 4NBLA 2QMQA 4GLLA 4PFQA 3W2HA 4BTEA 3EQ7A 4B3RB 3CUYA 3I52A 1Y1KE 5DLPA 4HAIA 3ZX4A 4KAXA 1SVNA 4MAFA 2X2OA 4XOIA 1OFVA 3ITEA 3E5MA 3OJ0A 4C4SA 5JCPA 3K5WA 2YTZA 2NQTA 2AN5A 4FI3C 5F4ZA 5AK3A 4HDKB 5L3SA 2HM7A 2WD7B 1P4RA 2QRNA 3PNPA 2H8KA 2ZFUA 1SAYA 3CX8A 5DTRA 5DCUA 3S2GA 4JXKA 3TG8A 2FJPA 3IQIX 3THSA 2EJBA 3UTDA 4PICA 2WU4A 3SS9X 5E1OA 4FZVA 2P3SA 3JALB 3NT4A 4RVNA 2WNHA 1NVVQ 2VHZA 1S2DA 5A2QA 1FLAA 4IXDA 4E88A 2JA1A 1RCFA 1IQRA 1FY2A 5E9QA 2OXCA 1YOVA 5TT0A 1DARA 2Y1WA 4D9HA 3K1AA 1Q3KA 2NTYC 3WE7A 3A4MA 3PWTA 1EUCA 1CFJA 1LDBA 3A2MA 2RI1A 3GJ0A 3ZUGA 1VCNA 2RSLA 3L43A 3N53A 3OZEA 4NMWA 5BYKA 4AJHA 1R5NA 3QQ5A 1DX9A 4OOFA 2Z8YA 2NZUG 4WFQA 1WVGA 1UWLA 3DOJA 1EKXA 1OHHA 3KEQA 3P9QA 5EUMA 1OI2A 3PNQA 2OYRA 3ZCQA 1MZVA 1BXRA 2DERA 2BONA 1C41A 2P3QA 3SHWA 3LVBA 3W8DA 1XDGA 3QKWA 2SKCA 5JCOA 4LHSA 2FZWA 4KQ9A 2FR8A 1P17A 3DZKA 5ALVA 3FIUA 2BMDA 3DTVB 4CGYA 4KX5A 5IYZF 4JZKA 1VIMA 1VBNA 1TYBE 2NU6A 4MR8B 3SX0A 3TJMA 1WULS 5C1DA 1FK8A 3LVQE 2ZE5A 1W36B 2ETXA 4I3FA 3FGOA 4ZYLA 1JDZA 1P33A 1CYDA 2EWWA 4WN9B 3S44A 1TK2A 4FCWA 4HDRA 2VDWA 1KJIA 3PE3A 3AEQB 3GLHB 4MQ4A 1RFLA 4XGRA 1F2TB 2XHEA 3ADOA 1IQUA 1VKHA 2ZR8A 4LOAA 5IH7A 4ABTA 3I04A 2WTMA 5AJXA 3K6SB 3N70A 1Z83A 1RCTE 1XCOA 4YO7A 4YMHA 3I6YA 1TKRA 3KZ1E 3L6CA 2LD4A 2AD5A 5EJEA 1U63A 4EMSA 4XYGA 1BTOA 1P62B 1ACMA 1FMCA 3RSHA 2FZ5A 4IZOA 4R9VA 3EQ9A 4NIMA 4FMCB 4CMCA 3EFHA 2VSXA 4P5DA 3LF1A 1TCVA 4QYIA 5FOWA 2OVFA 3RYHB 3B6MA 1LRJA 3QUCA 2HU5A 1F60A 3AZQA 3B1FA 3JWIA 5IYZA 1FYXA 4A26A 1O8CA 2CNDA 5L7YA 4DLLA 4CM9A 3DXYA 4NFLA 1HG1A 5IM5A 3ADKA 2WJHA 4YPFA 1JLLB 3NIWA 3DMFA 3E2MA 3VR2D 1AF4A 3W8FA 1AQIA 4BEJA 2TMDA 4U39A 1VPLA 1T2UA 2H1WA 1REQB 2ZJ5A 2GVDC 1U2EA 3JX9A 3KC2A 4L5AA 3WK9A 1PW5A 4YAKA 3Q8LA 2VYND 2GD2A 3HDVA 1O89A 3ODGA 4JLMA 3RDPA 3UHAA 2H5IA 2ZOSA 4L6IA 3UJPA 4J7UA 5HVNA 4F46A 4ZA2A 4CM1A 5LP1A 4N65A 4HDSA 1AQUA 4LPSA 3F67A 4YIKA 4TYYA 2BUCA 3ID6C 1U4OA 4Q7LA 1XKTA 4IV5A 1MRNA 3FROA 1BWSA 2QTHA 3I9LA 4YO8A 6AT1A 1SUSA 1EU1A 3U39A 1EUZA 4HDMB 4NCKA 2QI9C 2ZB3A 2ODPA 2ZBRA 4LJ4A 3OE5A 5KJ6A 5K0GA 1JEAA 2QTNA 1MQ8B 1OU0A 1T6NA 4Z4QA 4KN9S 2O50A 1KOFA 2NSDA 4MR9A 4E7PA 5AI0A 2O8CB 3FTNA 3HLKA 3HFSA 2W2OA 3ROXA 1E1CB 2QRJA 3AVPA 3SBEA 2OCGA 2F6RA 4C76A 2OHFA 4FYHA 3WZLA 2ZBQA 4WADA 3S3TA 3JQEA 4CN9A 1EVYA 2JL1A 1OXXK 1VG9B 3PSAA 3WQBA 5BVGB 1ZJWA 3DOIA 3GWGA 2YXDA 1RZVA 3OBBA 4E1VA 4AJ1A 3JARA 3BL8A 4FDUA 4P08A 1BW9A 5CDFE 5LFAA 4LSZA 4BMOB 4MHTA 4N48A 3LY8A 2DJIA 2GVZC 1KEPA 3EC7A 1RWMA 4RZXA 1R8SA 3CLKA 1TVCA 3OJCA 4KOEC 3MFQA 1P4JA 2Q9BA 3H2GA 3O75A 1N78A 3SK0A 1SQ6A 5AVKA 3JQAB 2Q5JA 5LOVA 2BUAA 1Q0RA 4OA5A 4UD2A 2QTCA 1NIJA 3JPWA 3B1XA 2FQWA 4BTVA 2E18A 1P72A 4LF4B 1SUDA 4Z2YA 1GADO 3RODA 4QXAA 1PT8A 5E7QA 3I6IA 1I6LA 5JS7A 2HT1A 1V11B 3HXTA 3M9WA 3Q8XB 4LJLA 4BFWA 4PXSA 4J0EA 2IV7A 4CM7A 4HFNA 4W5HA 2OWEA 4ZODA 3TL3A 4M7RA 3LG2A 1K0FA 5GONF 3E7FA 3BM5A 5JNLA 2X0FA 3QUQA 4ER3A 2KHZA 2G17A 3C16C 3KXKA 3NBQA 4EJMA 2VTBB 4AS1A 3LDUA 3LCMA 1ETUA 2IHJA 4CCWA 5T6MA 3W9YA 1P0PA 1NKVA 2N9UA 2C9ZA 4X91A 2NOAA 5IANA 4BVBA 1UT6A 4CMKA 2ZROA 4BQIA 1EFCA 1JIUA 1XVIA 4PRZA 4X3CA 1TM2A 4JI6B 2G28A 4HEJA 4DR2B 3DHWC 1RMTA 3NBKA 4X9XA 5SYNA 4AJKA 3EDMA 2BYTA 5KVVA 2Q9CA 2RHRA 3RSQA 1Z45A 3W5AA 4DVGA 2V4ZA 5E7IA 2JB9A 3NM5A 2XRYA 1YF3A 1JKXA 1T4GA 3TVYA 5CVJA 2CXUA 3KPVA 4TTRA 4EAAA 4D96A 3L3BA 4ZCMA 2GYWA 1SXJC 2W98A 5KNBD 3TUJC 3C1OA 2C5HA 2FRDA 1B74A 3UAOA 3KAPA 3P1JA 4KXXA 1RQRA 2WHXA 2XDAA 3ETLA 3QMMA 3R3UA 4H3HB 2Z04A 3CHYA 2DQSA 3EXFA 1Z4MA 2FK7A 2ZUSA 1T8YA 4Q21A 1MHTA 1SUEA 3HDTA 3E9QA 3KHUA 4XQ9A 3IMEA 5KSYA 3BMOB 4HH1A 4UHHA 5CLJA 4AI6A 2QM8A 3WLQA 2I78A 4PX3A 5I5EA 4KQFA 1G7CA 2Z56A 4A4DA 4EY4A 5E0KB 4HF7A 3RAFC 5C3MA 3K8ZA 4MA0A 2UVPA 4OQDA 5EQFA 2WKQA 4Q3CA 1NFQA 3N0VA 2XITA 4UM7A 3HBFA 2D1FA 2LIPA 3QA9A 4RH0A 2EW2A 4QGGA 2HJRA 5D7NA 2I3AA 4KGVA 3LM8A 4ZU6X 3TB6A 3HO6A 1V95A 3RYFA 3C1UA 2Q62A 3U9LA 3T9EA 3W79A 4RABA 5J47A 1SHZA 2QZPA 3HB4X 1W25A 2ASVA 2GBCA 3VI4B 2NU8A 1XCMA 2LDBA 3GZTB 1U04A 4X3OA 1CJMA 1RLMA 3TTYA 2IOQA 4F5YA 5JXWA 4XPZA 2XMZA 2ZBVA 3K5HA 2NZXA 4YJDA 2HLPA 2OGZA 2R6DA 4KSBA 4OL0A 3ROKA 3NIGB 2FEWB 5CW1A 4L8VA 2PYDA 5ILOA 4ZOBA 4UVDA 3H2ZA 1PD0A 4Y2HA 1VYHA 1CJUC 1MIOA 3SICE 4CPDA 4UCXA 3DHVA 4UPEA 1WCWA 2ZUUA 3GFGA 3L7NA 4GXNA 4IOMA 4ZZ2A 2NYVA 2CV2A 1RE0A 1P2SA 4BNYA 2CUNA 3P0JA 2ZT6A 3UYLA 1MP0A 1RXVA 1WXDA 1KFCB 1RWBA 4XB1A 4R6XA 4EX6A 2ZJZA 3ZY4A 2PUJA 4N7JA 5K8IA 4JYCA 3RO7A 4OFWA 1X94A 4X1OA 3TE6A 3OX3A 5EJGA 4XRRA 3UENA 1H6DA 2AN9A 4HWGA 1E3TA 1PS0A 4YMWA 5BYJA 5UKDA 3W77A 5BR1A 1J0DA 1HQDA 2GTPA 5THKA 1KK0A 3M6WA 4YLGA 2PXCA 3UH0A 4IUYA 4FHDA 5AWFC 1HNWB 1BN7A 3IIIA 4QPDA 1V2GA 4LKOA 5TDHA 2F48A 2PS1A 1KOLA 1KWGA 2PL3A 2JG3A 3N5KA 1BD3A 4CCSA 3BBPA 3DOUA 2OXTA 3VZRA 4Y1FA 2ZDGA 1P1CA 3S2YA 1JMYA 1QPBA 2JIZA 1XHEA 1ZOLA 4O4IB 4DMRA 2FMIA 1UZAA 2TS1A 2J4DA 5E6UB 3FF1A 1IYZA 1DEKA 5J3JA 2B4AA 2FMTA 2I76A 2ZKLA 1W5TA 4LE0A 5ESDA 1SC9A 4PZYA 3CJTA 4MQLA 3CGGA 1I8TA 5C1BA 1POWA 4KO4S 2UYCA 4FXPA 3WGLA 3HA5A 2X9QA 1SVMA 3WP0A 5JNTA 3T9BA 4M22A 4LDQA 3RRJA 3HRIA 2OV2A 1VPDA 3DVAA 1F5SA 1W75A 2EFJA 3GLHE 3JYQA 3L7AA 5BSWA 2CZGA 2QE7D 5FJIA 4BFCA 3VVLA 1J9ZA 2V7TA 2C2WA 5JQGF 5JBQA 1MUUA 5GIOE 3ESYA 1H2ZA 4F11A 3KEMA 3HV0A 3Q3IA 3B7PA 4N5HX 1OB5A 3C3PA 3UXYA 1L5QA 2OHXA 3LX8A 4DLKA 3F5MA 4JEHA 5F3RA 1N7JA 1ZVQA 3EEIA 2RE8A 2W2LD 2Q2OA 1ZBDA 1SB8A 4KWEA 3H19A 3LNTA 1TEVA 2BVNA 3E03A 4Q39A 4INPA 1EFKA 2ESRA 2IXFA 3W8RA 4B4OA 1N2XA 5IHXA 1YDWA 1K9VF 1EJBA 2OXRA 2RBGA 3FNRA 4BMXA 2PVPA 2XNHA 4B34A 3AR6A 1Z0AA 3RIYA 3DDNA 2DB3A 3T5CA 1NZJA 3ACDA 4U7FA 3V55A 1JEOA 1E4VA 3C5VA 3UW3A 1FSSA 3CNOA 1KJ9A 2EAUA 2HA6A 1KHHA 2QAGA 3RRNA 5BOVA 8OHMA 1ND5A 1LZKA 4RL6A 1LPOA 1QIHA 1Z29A 2VYVA 3ME5A 3HADA 1SVSA 4PAQA 4UULA 3S5UA 4WW0A 1TZ2A 4NCJA 1X1AA 4ATNA 1Q1GA 4IIYA 4MB6A 2CLIB 3RGWS 3MRSA 1GO2A 1RYEA 2XWSA 3NC1C 1FSZA 3L6BA 4LBVA 1PTKA 3GG9A 1ZAKA 3E9RA 5A9RA 3UMFA 3O03A 3HY3A 4GSKA 5EZSA 2OUIA 2ZJAA 1EDZA 1RRGA 1FNBA 1U6KA 2Z6AA 1MW9X 3GN2A 2OV1A 3E48A 4Q02A 2XYPA 3QTLA 3AHJA 4PBRA 4WUVA 4ZCLA 5L7WA 2Y0PA 2H5JA 4HDCA 2VDOB 3ONVA 4HQRA 1Z0FA 4PCUA 5L3RA 1AC5A 1U94A 2BFDB 2HV9A 3A1DA 1PNVA 3UMSA 1WBDA 5KNDH 4RJTA 2JLZA 3F4LA 4MJXA 5COQA 4K8RB 1PFKA 1RXSA 2QUBA 3UT5B 3ZR4B 3BXGA 1TU3A 3GGCA 2P30A 4IJ5A 3OIYA 3Q0IA 5CT4A 3WFIA 2QPLA 5LYJF 2MWMA 4TRJA 1KWKA 2GAFA 1OW3B 2EP5A 4QPZA 2JS7A 3JATA 3LY5A 4M53A 4Y7DA 4ZQGA 3SZLA 1TUBA 2H52A 3A4TA 3H18A 1WP4A 1YB1A 5CFLA 2H9IA 4IG9A 4BMPB 3V97A 4FCVA 2CYAA 1RWKA 1U28C 4TT3A 5FULA 2QVZX 1J33A 1KORA 3AR5A 3IPAA 1CY4A 3VO9A 1MKYA 4U63A 1R10A 1HC7A 1R0CA 2JKZA 3EZYA 2V7EA 1DTWA 3KTOA 1NI3A 3T1YB 1LRKA 4HV4A 2O1EA 1BS2A 3VR6D 1R9GA 1NF9A 1AUOA 1IN6A 3L8EA 3H5AA 3ETJA 3TQTA 1Z7GA 4GGPA 1O6CA 2VP3A 5H16A 4EJSC 1LDGA 2OFXA 4KWHA 5ALLA 2DY1A 2LDXA 3OQJA 1WDTA 3I9JA 4FYWA 5DDIP 5E3JA 5LYJA 3W1WA 4B17A 4TV9F 3IAEA 4HX5A 3SXUA 2IT1A 1D09A 2YV3A 2BHNA 5KCMA 3UVEA 3Q1LA 3QLVC 2E1PA 5LCXA 2IEAA 3U3DA 1UP6A 4LHXA 1I32A 3ZVNA 1E18A 1P5JA 2ERYA 4TVBA 3S40A 1AB5A 3A9CA 4R1NA 2JGKA 2VHEA 3NFRA 4GYWA 1YRBA 2QQFA 4ENSA 3EVAA 4OQNA 1T43A 5JPCA 2P7IA 3BPSA 1FQOA 2XQJA 1TW3A 2OV8A 1CPYA 2CLEB 3H17A 4QBHA 1SOAA 2KW5A 1NRXA 3P2JA 4GC9A 5HKKD 1PD1A 4JBWA 1DCTA 1MT0A 3TRDA 3KQUA 3OX4A 3PD1A 3HYLA 1ZP6A 2J6BA 3DMNA 3OAAA 4HO1X 2P91A 4KPGA 4LBWA 3T7DA 1V37A 4M55A 3TBKA 3N58A 1OF1A 3EOAI 4RKFA 4RO0A 1IEQA 2PIAA 3GPIA 2WLTA 3OBIA 4LXHA 1G6KA 1R4MB 1GP2A 1G4HA 3N8KA 1RI4A 3P20A 1ACLA 1NONA 1GEGA 1HMYA 2W2KB 3P9ZA 2XTMA 4Q4JB 1V8ZA 1BN6A 1HL3A 3I2HA 4TV9A 3HJRA 5PGMA 1DPFA 3LUAA 2BF4A 3VISA 1IXSB 3I39X 4YVFA 3C1TA 4MI3A 4BNMA 1EEHA 2V7UA 1U98A 1P2TA 1UBTS 2ZVDA 4TS3A 2C00A 1A1SA 4GLOA 3FWHA 1IHOA 4MP8A 1ZJ5A 4JS0A 4KRYA 4WKPA 2MHCA 4L8LA 3KQHA 2GXQA 3ZDRA 1B93A 3O31A 3PC8A 4CBVA 5L9AA 2BMVA 1M5RA 4JT8A 3DZJA 1P0CA 1ZVMA 4BYMA 5CLFA 4DSNA 1OSNA 1RJFA 1WHSA 1ZUNA 2P8JA 1T5DX 1P45A 3FF4A 2PMBA 4D6XA 4IX1A 4UE2A 2XB9A 3K92A 3EIXA 3FJYA 4TM7A 4DR1B 1GAJA 3MGBA 2CLFB 1W8IA 1UFOA 1VLHA 3EH2A 4MRRA 2EJVA 3A9TA 4BWGA 3M9LA 3U7FB 4NDZA 4AU1A 5JLAA 4FKMA 4ZMBA 2ZZKA 3U49A 5HJEA 4AG6A 1EGAA 1AS0A 5IJWA 1WDKA 3DMDA 4RD3A 1Y1LA 4AM8A 1AKEA 1IDN1 2SCUB 2QMZA 5LZ9A 2B30A 2FEPA 2ZWMA 3QLTA 2AW3A 4L95C 5HBRA 2PV7A 4KTTE 2E21A 3TW6A 4MYTA 4BLQA 4CQMB 1PJ8A 2FUG1 3BCHA 3DAOA 2N3ZA 3M6UA 2NSYA 4ROTA 3THYB 4JENA 5CB4B 3IDSA 4LYFA 5HF9A 3FSJX 2FR1A 1YA4A 3LE8A 3N2GB 3SWWA 2IIQA 4NENB 2OL4A 1OT5A 1ORHA 2OD2A 3A9WA 1P4GA 5IDQA 4GQBA 4F2WA 2F1RA 3HA3A 1XUOA 2ETVA 3KE8A 2E87A 2Q49A 4J03A 5EPOA 1U9IC 3TKAA 2WUVA 4KE9A 4E08A 3ZDZB 4NPCA 5EIAA 4EFLA 1L7MA 1NA5A 3CY6A 5FWDA 4XCQA 1CUIA 3B9QA 3GLTA 1MAAA 2ZIXA 1I4DD 5JS2A 5BOSA 2GJ8A 4YJGB 4NK4A 4LVUA 2R65A 2XUKA 3ZDQA 2PUVA 4YAGA 1RZRA 5BN5A 2HEGA 2ZUVA 1OVGA 1KKMA 1YRHA 4TOIA 1XZMA 2WHRA 4LE2A 4PC6A 4D5GA 4DAOA 1V8OA 3FYDA 1OXBB 2RGNC 2EQBA 1KR5A 2H4YA 2IWHA 4WCFC 1IB6A 1L7RA 1FJ2A 1X70A 5JAIA 4BYGA 3Q1KA 2WABA 4UDOA 1E3DA 5LDHA 4CKWA 3RT1A 1QGED 1KVQA 3HCNA 4BIIA 5AD1A 2AYYA 3JAWB 1NULA 5AXAA 3ZLVA 2NSLA 1L4LA 4WNYA 3O8LA 5TGZA 1G5HA 2R6R1 3AM5A 3C3WA 3REGA 2R86A 3RTBA 3U4QA 2DCUA 4MYUA 5TV2A 4B46A 3MG9A 5BNTA 4X62B 5TSDA 4URZR 5ETJA 4E5SA 1WAMA 1MX5A 4PX5A 1R00A 2OFPA 2PL1A 3R4CA 4MQMA 2R68A 4KFRA 4B3BA 4D3DA 2FN4A 1XTJA 2GO7A 2FN3A 3G1WA 1FDVA 1Q7CA 5B3JC 5LIRA 5H3CA 1GUYA 1P61B 2PXAA 3QELA 2E4VA 4MQFA 4RK6A 5EXPA 3QUAA 4KITB 2JFUA 4DV2B 4Z0TA 4OJQA 4Q1AA 4EEXA 3PTLA 1HDRA 4D0RA 3B6JA 2Q5HA 3IA2A 4Z4CA 1KGSA 1JHPA 1ESEA 1ZW6A 4HAUA 4A2CA 3BGIA 1E0SA 2GUWA 3GQBA 4Z4IA 3FCEA 1GLGA 3V7FA 4DJDC 2I3DA 1W96A 1TIPA 1YR8A 1FL9A 2I4RA 3CKYA 4PC7A 2OFOA 4L1KA 1UPFA 1O6GA 4X6YA 4RCYA 1C3OB 4K9LA 4N7MA 2XUAA 3TRIA 1OQAA 4DNFA 3VPGA 2GT1A 4UTRA 2G67A 3BWEA 2I4TA 5IC6A 3TZHA 5IJ0A 1IPFA 3OIUA 3K9WA 4IJWA 3BC1A 1A9YA 3KJIA 4TMTA 1U8FO 3FWPA 4K6HA 1R88A 3HYCA 4XJTA 4OHZA 1VHQA 3H5TA 3N6VA 3FH0A 2A3NA 2BEKA 1VJ5A 1H65A 3OIWA 5DTIA 5G1PA 3ZIAD 3SF8B 4OYHA 5FPPA 3D3KA 4PLVA 1H69A 2VHQA 4QIHA 2ZUBA 3L6RA 4IGEA 5MF6A 4TZKA 3OWHA 2PSSA 3BWCA 4RYLA 5FOXA 5HKAA 3REQB 2I2AA 2YJ5A 1MXFA 1UBEA 2OOSA 3CZ4A 1V4NA 3L8YA 5A9TA 1W0KD 1NXVA 2B25A 2A5GA 4KFSA 4C43A 6GPBA 1DV1A 1U0EA 2O2XA 3Q12A 3KG2A 3TDKA 1YJXA 1QQ5A 1S6YA 2C88A 3SIWA 4B76A 2BSAA 1SPBS 2UYYA 1S02A 1EFTA 2IHZA 1HG0A 2VDUE 3LCCA 4C0XA 2J3LA 1TMGE 1P0QA 1CVLA 2D0PB 3PDUA 4QTUB 4AF7A 4YRAA 1C1XA 3ZVLA 4QUJA 1GV1A 3AP1A 3LOQA 5H68A 5C5DA 3B36A 5KVQA 4G41A 4OQPA 2BKVA 1AKUA 2BGRA 1R0WA 3SZGA 5AVTA 2ARKA 1O6FA 2AMYA 3ESDA 1RM5A 2QNIA 1YBMA 3DM9B 5DTJA 4A8JA 3MWGA 1G5IA 1ZD2P 5IAAA 2GBGA 4AURA 4ER7A 1TYDE 3N74A 4DDVA 3E1KA 3QBVA 1V3QE 2GRJA 3ZWKA 1Z75A 3NO4A 1TUIA 4Y6LA 3HO1A 1Z39A 4U02A 2QV0A 1ZN8A 1UPXA 2D8MA 3N2YA 5IG2A 1EP1B 1PJCA 1NXWA 1RJ9B 3FPEA 1FSFA 1VHWA 1V5WA 1O5TA 2P6NA 2PTHA 3MCTA 4L5JA 2B2XA 1D7OA 3OOWA 4HI0E 4IOLA 2OWDA 4WLEA 4Q9HA 1BFKA 5CJ2A 4IGAA 4HNRA 2VA8A 3HPQA 4W5QA 4P4GA 5DH9A 1A9ZA 3ROZA 3STYA 2QMEA 4LWQA 3FVWA 2CXTA 2V9ZA 3EPPA 2IIVA 1YU9A 5I7AA 3VU1A 1E99A 3QXSA 2GI4A 2BJHA 2MSLA 3RASA 4EUHA 3GNSA 5CB6A 4W9MC 4CF7A 2VHWA 4U9HS 2PT5A 1L3IA 2N42A 1B14A 2DQ4A 2QYOA 2WBLC 4PYIA 2R2AA 4K9NA 4DJEC 1Y5NA 3TSYA 3QHPA 2X0IA 4RETA 5I01A 1G6HA 2OCLA 1WPQA 5DO9A 4RV4A 1WB6A 2FSUA 4I7EA 3CCFA 5AHOA 5ALYA 1T4CB 3MELA 1UEJA 1ZONA 4HAYA 4URXR 1WLYA 4HRYA 2YYZA 4I9NA 2HYIC 1N2CB 4EOGA 1SBNE 3EUFA 5AJYA 4RFVA 5B57C 3HZZA 1QU3A 1NW9B 2XYVA 1J5XA 1PV4A 2WTXA 3WTBA 1PT6A 5CGZA 3UK0A 4D9MA 5BRAA 3RC8A 3VNRA 4QAJA 1GN9A 2XSZD 3SXPA 4ENTA 1LNZA 5A02A 2K7FA 1HK7A 1NR5A 1OXMA 3FG9A 5DHAA 1OE0A 3QXXA 2XA2A 2FRVA 1FVOA 4D8YA 4HEA6 3TQRA 1PLKA 5AHWA 4YJHA 3EEBA 3EMDA 4E7OA 4F1JA 2J3HA 3MJRA 5FTJA 1DWQA 4KIUA 3OUZA 3UB4A 4F6RB 1H2WA 1AK9A 5IDXA 1NMQA 1Z88A 4V0NA 2G40A 1VJDA 3OM8A 2HMVA 2J3KA 2PO5A 2XWQA 3D0RA 4RNCA 3VR4D 2VOJA 4H17A 2Q8NA 1LA2A 3D8SA 3Q0EA 3EVDA 4UCFA 5DX0A 3E9DA 4MYSA 2DG2A 1HYHA 5IEBA 2R4UA 3Q15C 1QTQA 5BN4B 4EO9A 4TWBA 3PEEA 1XZIA 5ALDA 4COOA 1JEYB 2V4MA 4ND1A 4RY0A 5AOAA 1Z4JA 3EXIB 5A06A 3ZBPA 3K1JA 1A7UA 4H35A 4V2IA 5BSMA 4X5OA 1WWKA 3PPWA 2CXHA 3TD6A 4FB4A 2QVCA 1P7ZA 2I55A 3P26A 4H1TA 4H7FA 4MKFA 4UMVA 3ZE7A 3I53A 5AVZA 4XYLA 2WYOA 4RESA 3SEAA 4BLSA 4X65B 4Z4EA 4IVQA 3UV6A 1NAHA 2JHAA 5I4IA 2NAFA 4MOWA 3QKSA 2G9NA 4BEVA 2AIRA 2G5CA 3RUFA 5BR7A 1G19A 1JJ7A 1AHIA 5F1YA 1K8XB 2YVLA 4HPJB 2ZAYA 3FPSA 3UFXA 2FUNB 3VZDA 5JZBA 1Z2CA 2WAAA 3OE7A 4ARAA 1Q5PA 2H1LA 1E2QA 1P9LA 3LBHA 1VCIA 1QNFA 3I12A 4JB8A 2HFKA 4JLSA 5T5QA 1ULUA 3HG7A 1QYDA 4XM1A 2GJ9A 3F9IA 5D85A 1Y48E 3DC7A 1ENOA 3AR7A 1BWQA 2IHUA 4II7A 4XSVA 1IOZA 3IT2A 4H3KB 3P8ZA 2CB9A 1KMIY 5JC1A 1G9XA 2ZQZA 3TI7A 1ZOOA 1SY7A 2PT9A 5L95A 3CVUA 3CUTA 4DCPA 3AESB 1VI5A 3BRWD 4TL7A 2CKMA 2Q6TA 3H5VA 5K6AC 3GMDA 4DL9A 4QT0A 3L4JA 4PTYA 5ERGB 5AVQA 1NRJB 4JP8A 4O1HA 3ZGVA 4A36A 1X42A 1S0UA 3KKLA 1GQ2A 3HYTA 3Q6IA 3L0CA 4OJKA 4HZIA 1GPLA 4AY4A 5JO9A 1S8OA 2DFVA 2FPGB 2J09A 1J5PA 3Q7SA 3EG9B 2WLSA 3F1LA 3O4JA 4EI2A 4LF8B 3PF8A 4B6GA 5BW4A 5HZHA 1PFYA 1EBFA 3EODA 2JAPA 4AJ2A 1TDJA 2PZKA 4P1ZA 3RD5A 2HLHA 3PVZA 4TT8A 3GLGA 3GAZA 2NIPA 3GFTA 4J2TA 1E2EA 4QU0A 4ZT4A 3S8MA 3HP1A 4RD2A 4C7BA 4DG8A 3DTNA 3WAJA 1NBHA 1CR1A 2DH6A 3PPVA 3QFCA 4FTWA 1E7YA 2WYIA 4D3YA 1UH5A 4JX8A 1OPXA 2B3DA 4YUXA 2R6GA 4WEOA 2WFAA 3BFJA 4L5YA 5ENZA 1YQWA 3WLLA 1YKFA 4DY4A 4YFYA 4ZRMA 5EMNA 1L4EA 1LWNA 1I9CA 2RHMA 4U6SA 2YXPX 1G5RA 1MRSA 4EATA 3R23A 3VMFA 4DB2A 1QOZA 2GHIA 3AETB 2VT3A 4A73A 3WDSA 2PH3A 1K6IA 4FZJA 4BO4A 5IBQA 5K03A 1H93A 1UOEA 1ZCZA 2NV0A 4K9SA 2JGDB 2FE4A 1TADA 2P5YA 3C7TA 3H2JA 4RJIA 1RXWA 2P9JA 3CPEA 3KOUA 1QZZA 1CUXA 1XTUA 2QPAA 3C3AA 3DL2A 3O6VA 5T64A 1DAMA 2XWPA 1QQAA 1GU7A 1B6SA 5LLSA 3ORRA 4EB6B 1KMQA 3AHCA 3RM3A 4XM0A 3JAKA 5F21A 2GYUA 2AMLA 2CXSA 3R6TA 3CBGA 3FHCB 4XLLA 1EWTA 1Q0PA 1WO8A 1KEKA 1KAOA 2R62A 2R7KA 1WSDA 3W3AA 2I4LA 3ZHOA 2QJWA 4AQYB 4NMXB 5AVYA 1KSGA 3W5UA 5CMLA 4M0MA 1FTYA 2LP4Y 2Y66A 1ST2A 4IMIB 2IPLA 4KXQA 5CHEA 3GEMA 2JFQA 2JVKA 4PSAA 4I46A 4WDQA 4TKUB 3AVXA 1BA3A 4IVRA 4G86A 1Z68A 1U7WA 4QELA 1BCSB 5HIJA 4ID3A 4C78A 1V45E 1G8MA 1KVRA 2ZVPX 3NJRA 2P27A 2QTAA 3HDGA 4N0DA 2PS9A 4BPRA 1NZFA 2QM7A 3HVKA 2BMEA 4L8FA 4NBNA 4EHJA 4AG5A 2PZLA 5TVKA 4PHFA 1KDYA 1W4AA 2X0DA 1WXEA 4K2HA 1RPNA 1E5VA 5FT9A 3LT2A 4LZLA 3RWMB 3WAKA 1LS1A 1WG8A 3K8QA 2GQ0A 4H0NA 4UHKA 4BMNA 1G4UR 1XQXA 4IDHA 2C9MA 4DHEA 5H1YA 1GQYA 2GKOA 2IYOA 4GVLA 2AQ8A 3QYAA 4HEA1 3D6HA 3UOAB 2GCPA 2ENUA 3BORA 2IYUA 2VF5X 1Y5LA 2PZGA 2WJJA 4AYTA 3BXPA 4WNAA 1E0KA 1C7FA 3BK2A 4MJ7A 2HWUA 4NCXA 3SZOA 1EWQA 3GUCA 1KARA 2GEKA 3EVEA 3QVUA 5KWSA 3FTCA 3W5BA 3FTDA 3KQMA 4YAUA 4BCBA 4ZT7A 1Z2OX 5BUSA 4XTRA 1XZDA 1OCEA 1EFVB 2Q1XA 3LWNA 5K0NA 4DV7B 1KYIA 1VBFA 1ZZEA 3NBZC 2V4UA 5HUQA 2DC1A 4RIEA 4YDHB 3H83A 1IN8A 2FOLA 1C0PA 1WPRA 5EUCA 1SZCA 4BLRA 3G8CA 2UYQA 3OTHA 2ZB4A 4G89A 2IL1A 3GT0A 1RLJA 2QRKA 5T4EA 1NW4A 4OKIA 3VPFA 1E5DA 3WLKX 3O9ZA 2J3QA 5BN3A 4IYJA 2I3GA 1ZH6A 2JHFA 4NZPA 2A78A 1F0PA 5KTMA 3FA2A 3R24A 4UBNA 4ERXA 1E7SA 3L0BA 2CXNA 4H9GA 3CLTD 1NGSA 1O2DA 1U3TA 3V34A 5H9WA 3T4PA 3C3JA 4FQ5A 4XCXA 4CKEB 2XRMA 1CNMA 4GL2A 3O2SB 3ROPA 3H1FA 3T3HA 2FV8A 1JEJA 2J7PD 2C7QA 5MGNA 3IELA 2ECOA 3GDFA 3LK7A 3KD3A 5CFZA 3QV1A 4OM8A 1X7YB 1EEXB 4WDRA 1LFDB 3GDWA 2QD5A 3FSGA 3HWX1 3LPDA 5K8CA 2R8BA 5M5BA 4QBFA 3FUUA 4C0QC 1N2CE 2EZ8A 4JNKA 1SHTX 4M1OA 2PX6A 4IDFA 2WNSA 5A6VA 4GOJA 1PQ4A 5HIIA 3E9YA 1HE1C 2YRFA 1YMQA 3COVA 3NATA 4G8BA 4ZVTA 2XCQA 2ES4A 2IYNA 4E70A 2BKUA 4P7KA 5ECDA 4BB0A 2CHGA 3OESA 1IZ8A 1T6BY 2KX7A 4V0SA 3KS9A 4KMOA 4FWBA 3OFNA 3D5QA 2F8LA 3QFSA 2Y1GA 4L4XA 4M4SA 4YAIA 2XYGA 1B7GO 4FI3F 4O8ZA 5AFSA 6LDHA 4ARUA 1QUEA 3LKBA 4W6QA 1B42A 5DM70 2IHKA 4KVZA 3M82A 3VHXB 2GRUA 4MS4B 3SPXA 3UAWA 1D4OA 4AECA 4AY6A 3HO8A 1ZRMA 5J1TB 2MMGA 2JBAB 3DE0X 4YP6A 1P44A 3RPEA 4BNXA 1Z62A 5DHFA 2DCMA 4ER0A 4C2TA 1H05A 3ZQ4A 3EGDB 3PGA1 3GUVA 4EVQA 2BFNA 4NZNA 4X66B 3EC2A 1W36C 4EG8A 3CF6R 4DIMA 1TJ5A 1XLVA 4FYKA 1U0JA 5EIBD 5T4FA 1NJ1A 2VQ3A 1BU8A 3C74A 4DY6A 2XDYA 1HYBA 3GVCA 3HB5X 4NBWA 4N3CA 1MPTA 1X14A 1TRHA 4U7PB 1YMUA 2OUKA 1T1IA 3IOBA 3HXLA 3KTFA 3ZZNA 3QX8A 3WGUA 5AJZA 4YRIA 1A76A 1JDNA 4N7RA 4O2BB 4UU0A 5FQOA 3OPXA 3QVOA 4QJBA 4DLYA 4IUDS 3U7QA 1E1KA 5ALIA 1BXGB 1VG1A 4PX9A 4X60A 2A67A 1TYAE 2APJA 2GF2A 2J9FA 3F46A 4Q6WA 4CFZA 3JQBC 2HF9A 3WGYA 3AQ4A 4UUMA 5C8YB 2FETA 4IFBA 3R74A 2B5VA 5FPHA 4BGIA 5KWEA 1A2OA 3L41A 3B2EA 5THXA 1H0HA 5JI2E 3WAGA 4WLNA 2QBYB 4NEGA 3GRYA 1XYYA 2NZJA 1QH0A 2YDXA 5K0LA 2GUGA 1T9CA 5SY4A 1M2EA 5KYYB 2DBYA 3BHNA 3QE9Y 2CMFA 3RAGA 1HRDA 2VLIA 1QX3A 5IJAA 1VB5A 4E3WA 16PKA 2CDBA 4US0R 1Z5ZA 2WV9A 3VYWA 1E0AA 4TLBA 1JBEA 5LKAA 1QP0A 1CRWG 1PGOA 2B92A 3OQBA 2Q5LA 4K1LA 4QYMA 4X63A 2YWCA 3OC6A 2OPHA 3V8QA 2IZ7A 3I01M 1H8EA 5HUHA 5E9JA 4DB4A 3CWCA 3KLOA 4IY1A 3T54A 2Y0BA 2JLAA 3F6BX 2AA3A 2W83A 4P5EA 3VH1A 3WBFA 1CTQA 3DCNA 4BNDA 2J45A 3D2BA 4ZJUA 1MDBA 1G21B 3NTVA 4PPNA 4U7GA 4IMJB 1EJ0A 3FFWA 4QUHA 4U7WA 4QT4A 5JCJD 1XJWA 4AP6A 3GW8A 4Y6OA 4RHTA 1LNSA 3NORA 5EE5B 4J0QA 2AZMA 4X1KA 3HKBB 2YHIA 3N2KB 1E2MA 1KY3A 2PGIA 1G3UA 3HGTA 3OF3A 1QK3A 3PGLA 5MN5A 1J99A 5CBKA 3ZDAA 1HDXA 3CNBA 4IQ8A 2X58A 4RWEA 1SGWA 1HDEA 1X80B 4JLJA 1JXAA 2ZJ1A 2XGMA 1Y7LA 2I4OA 2LCFA 4NJEA 2LW7A 4N5DA 1Y3HA 2ZSFA 4D0LB 2YWJA 5DV9A 3EPKA 3V4PB 3O0TA 2WQ7A 2DH5A 4GZ3A 1XTPA 2OCPA 2E4AA 5BO5A 5AIBA 1CVRA 1L5YA 2I2DA 3MNFA 3IPXA 5E4TA 2G5PA 1PHRA 3GGPA 4PYMA 3ZXSA 1MAVA 2HW8A 4EA6A 2W4IA 4QKQA 4YXFA 3LYLA 5A4JA 3PQ4A 2V96A 2ZU0C 3D3JA 2OYCA 4EVIA 4I1IA 4QXPA 4IHJB 1JKMA 2YFKA 2XTNA 5HQJA 5AVVA 4A6EA 1WV1A 4WY2A 4ARCA 3GA7A 1AKTA 2WSIA 2H7VA 1QS0B 2XXBA 4HRVA 5GADl 3TGWA 4M1SA 1QZUA 2JI7A 5REQB 3HFRA 2HA4A 4R8VA 2QAIA 5ERYA 4WZZA 5TS2A 2AD1A 5E8JA 3TNYA 3ZNOA 5K3SA 4QQFA 2GSDA 5FNVF 4P93A 4XYBA 1N3BA 2VP6A 2WY2D 3HJBA 2IIBA 1NHWA 1ZHFA 3FUVA 2IEDA 2H1CA 4XDZA 3IAUA 3WWCA 3KJEA 3S28A 3SBXA 4BN5A 4DHWA 1MT3A 2R44A 1FTQA 2XJ4A 1QGUB 3B6KA 2IPAB 2WSMA 2ZCUA 1HZJA 3RU3A 1BIFA 1FRVA 3VDNB 1NJ6A 1EUDB 3I83A 4GPBA 4B32A 4XIFA 2NT4A 1ZI6A 5DBGA 1YBVA 3QM1A 3S7TA 4CHTA 8AT1A 1KYWA 1UBJS 1KMNA 1AX9A 3MD9A 3PNOA 1UBLS 4N12A 4C6HA 4PSCA 4E2FA 2VCYA 1RW4A 1RYNA 2HSGA 5ITVA 3KYIB 3RVKA 1K6JA 1D0IA 1PT9A 3QHAA 1K7SN 3IEXA 5LQAA 1XQWA 2YJ6A 3G9XA 3QPDA 5HQTA 3AP2A 4UVHA 4LIPD 3UBTA 1RXEA 3PA6A 4F4UA 2HO4A 4IGIA 3HFJA 3C5WP 4DV5B 1GILA 1C0LA 2O0HA 4QFMA 2DSNA 1ORVA 2VP2A 4INJA 1BVHA 4I5DA 1XPJA 1FX0A 5GZ1A 1N7HA 4FLFA 7ADHA 3I0MA 1GTSA 3QX3A 2G25A 3IUNA 2FZLA 3TX2A 4A7PA 4TTJA 1T35A 1KMMA 5ALOA 5BVHB 1RXYA 1SELA 2EZ4A 3ZY3A 1XMOB 3BJZA 4MKHA 2M1XA 3AKZA 1JR3E 4RXUA 1MAUA 5HRUA 4HBZA 1RAEA 3AB3A 5F5LA 3OPVA 4MI6A 2DHRA 3P9KA 1QG0A 4MLCA 4OIMA 2I5PO 4ITVA 1VFNA 3U7HB 1O95C 2L69A 2XNDA 1I13A 3I8XA 3SC2B 5A4AA 1Y5MA 4O33A 1DU4A 1P2FA 2JLRA 5BWBA 2GX6A 4MRPA 4CEIB 3IUMA 1B0UA 1VE7A 1I2AA 1ICEA 4KZPA 1NVVR 4Q15A 3NGXA 3PEYA 1XYGA 4CLRB 1MAWA 4QC2A 2JGEA 3CTPA 4DYDA 3FOWA 4AIRA 1P0FA 2QRMA 4UC0A 4XX1A 4GWKA 5AKHA 1KC3A 1K3UB 1PAUA 1XSEA 4RCVA 5FCDA 1OXKB 4HN4B 3ZGNA 4BUJA 1Z28A 1HI9A 2D7CA 2OAQ1 1EVIA 4A5SA 1Z2EA 4EUFA 4JAVC 1JJFA 5BQXA 2BFCB 2FQQA 1OT3A 1QH8B 4MIOA 4PTLA 5IVDA 3W9BA 4CI9A 1S5PA 1RTTA 1AT1A 2QT9A 3G2HA 3G2JA 3Q98A 4FQ8A 4MP3A 1PK9A 3VNQA 2VHUA 2OYSA 4K6OA 3BJRA 4DIUA 3DEYX 1LQTA 3JVUA 4ALLA 4EWLA 1PS8A 3A37A 5AKYA 1VI6A 3SM9A 2AOWA 4OBEA 2PMKA 4KN5A 1DP4A 1M8FA 1XEXB 2WF9A 3KSRA 3AOEC 4S1OA 2GCNA 4LYGA 4ZPJA 3PWKA 1E6EA 2YBDA 2XCLA 4TL8A 1HA3A 4OAQA 5K0ZA 1E1QD 3ROTA 2HU2A 3PC6A 5CDGA 1CJCA 1IWOA 1VLLA 1GPUA 3HCAA 4LZOA 5EHIA 1DKPA 2QVLA 2Z2JA 1ZUD1 1XNQB 1RC1A 2ODAA 3RSOA 2Z58A 4FHCA 1ST3A 1VLMA 2IPXA 2ZRIA 1Y9EA 3DE5X 1ZM4A 3IILA 3PL1A 5FOUA 2UKDA 4OP1A 1A77A 4JLWA 5J59A 3T4EA 1QPGA 4Z9AA 1H5UA 3H1AA 3L82B 4BVJA 2UUAB 3ZZ1A 2GDJA 5CBPA 1G8HA 4WKBA 1D1PA 3N87A 4I5EA 3E8XA 5DK4A 1CLEA 2EHJA 3RTEA 1T3TA 3D0KA 1EXVA 4QU5A 1H1TA 1IY9A 1TC2A 1RRVA 3P2YA 5GM1A 3ZK7A 5EJ5A 3ZDDA 1HFEL 2I8LA 3G5MA 1F20A 4JJ8A 3PJEA 5C1PA 5B6IA 2EFGA 3CB2A 1JSRA 1HSOA 1W47A 3KAJA 4MIYA 4OMFG 2OHHA 3UG7A 4EHIA 5C2JB 4ZZ1A 3DWIA 5KHOC 1RAGA 1V43A 2X4GA 3DEFA 1Y4ZA 2ZU6A 1V39A 4UBJA 3G2KA 2FW8A 3M70A 5KC9A 3IJ5A 1Z16A 4N5LA 5G1OA 1CQJA 2Y71A 4FCCA 3DDZX 2I6FA 2NSJA 3KR1A 1E2GA 2XUOA 3LWZA 3NT2A 4H4DA 3DDWA 4J0FA 4ZV7A 5CX1A 4DCSA 4OQYA 1AGYA 3QOYA 2X5NA 1R9MA 5HOEA 4RVGA 2P4UA 2G1AA 2O8FA 1R7RA 1P6QA 5EJ6A 2FX2A 4XH9B 2BN4A 4Q4AA 5DN9A 5EWJB 3VPBA 2G0NA 2FWMX 3LT1A 1XB2A 1Z35A 2J5XA 1TZBA 1UBSB 1C9MA 2C7GA 3DTTA 3L4BC 3Q5EA 4W82A 2OE2A 3S6JA 3OP1A 3PC7A 3CNEA 2R8EA 4TPKA 1BE1A 3KLNA 2PBFA 1NPDA 5T67A 5IASA 1X1QA 3H8JA 3R3HA 3CEMA 5LB4A 3WQRA 3T12A 3ABZA 3CR7A 3GL9A 3QK7A 4G0UA 1IU9A 5FBKA 5KPJA 1OX4B 2IYLD 3JR7A 3R3YA 4R0VA 1QQ6A 5BV7A 4MZXA 4NQRA 2POQX 3EZ2A 2PU5A 4GNKA 4B8WA 1GUBA 1NVBA 2XLCA 4Z86A 1OX5A 2XW6A 2R87A 4K9DA 1HT0A 3ZTWA 2I87A 3DQQA 2FPOA 1TF2A 3MQ2A 1MVOA 4RGQA 5DKFA 2B5WA 5G0VA 4IJQA 2HJSA 2QAJA 4UUNA 3WRXC 4FLMA 3U7GA 1N9ZA 1SD1A 1UOQA 1PQPA 3MBIA 3PYMA 4FYIA 3ZWDA 1WUYA 4EB8A 2VKQA 1L6RA 1JNXX 3H2HA 1M6EX 2XQGA 2IP2A 3NPMA 2VA9A 1HV8A 2ZRKA 3ZQUA 1AUVA 3Q8WA 3SYLA 3OMXA 4Y9SA 2PKEA 3G2PA 1XJ0A 3LLUA 4Y6PA 1QHHA 1ZM3A 3UMVA 5KTOA 2FHSA 4Q05A 2GBFA 4AFNA 3FCUB 1RZ3A 3I9FA 1ESCA 4XW2A 1LSJA 2WJ3A 3NDJA 2SBTA 4QRHA 1XALA 4E5DA 3PQ6A 5C8DA 3GRRA 4FPXA 4LHYA 1HFKA 1QB7A 1ZEJA 4LEIA 1N1EA 2H08A 2JI9A 2CLOB 3O8BA 3B9PA 3TR0A 1THTA 4X24A 3BRQA 3O9VA 3NHBA 3SHVA 1I3OA 4D97A 4ZAZA 1JJIA 3ANTA 3D6AA 1FJXA 3DH0A 1FFAA 3MMSA 4N3NA 1QC5B 1S8FA 1ZEMA 4O2LA 1U0OC 4K0RA 3GJSA 2C82A 4PSUA 1MABB 4UUQA 3SDSA 2IBMA 5HIAA 2OAEA 1HLPA 5B1YA 4L8WB 4L15A 4RPLA 1UMDA 1WTAA 5EWLA 1Q17A 2AZTA 4G5OA 2X86A 1V26A 3OZCA 4M9QA 4ND8B 5TR9A 1V47A 4H6WA 4GM1A 1X1SA 1EUCB 4Y2RA 1TNDA 4BNUA 1UKEA 4V1CA 4RSMA 2LE0A 4QGBA 4F9GA 3TD2A 1EFHA 1KXJA 4D98A 2PGJA 5C7LO 3FCCA 4RULA 4UAJA 2RGWA 1DC5A 4S1TA 4RL4A 4G0WA 2BKLA 2IPOA 2ZYUX 4A0SA 3CKMA 3A11A 3L1IA 3V1LA 4PQGA 2ZIUB 1GT91 5ES4B 3GOQA 3L8MA 1I4EB 1SCIA 2AUMA 5J63A 2W2MA 2ZCJA 1BXRB 4JVOA 4DRXB 1QFMA 4XB2A 3I5XA 3E5NA 1FNMA 1E62A 2R8RA 4FX5A 3WNCA 5AVUA 3DAFA 6NULA 4D3ZA 4OY3A 1QKIA 2GCOA 3BMNA 3E1SA 4PN3A 3AY6A 1I2ZA 5FTMA 1A82A 2GLXA 2R6CA 2NU6B 2FFJA 5JCXA 3PHJA 2Q6LA 1QXSA 2QM0A 2A0YA 4PG8A 4AMGA 2VZ0A 3KCQA 4C0HA 1F9EA 3PHCA 5A5DA 3H1BA 4MITA 4HDRB 2VDWB 3WYEA 3LPNA 1ISMA 1OLXA 5KKAA 3V48A 1E6KA 3MQFA 2C59A 3ES9A 4DGQA 3BJIC 4YRMA 5LSAA 5EERA 4JXXA 3T3GA 1XNHA 1CEYA 1N3YA 2O0JA 3QE0A 4BBAA 1QRSA 2G82A 3A9RA 3IMFA 3KJHA 1OREA 3H8SA 1SVWA 4MW7A 4HVTA 5CTJA 1Y9DA 4QYIB 4GX0A 3D3NA 3UTCA 1NOKA 3WA7A 2HBQA 5DLQC 1C81A 3IERA 4GEKA 4TVKA 5ALSA 1H6CA 2WJPA 4KWTA 5IYZB 2VJNA 2D8AA 2JD1A 2OD9A 4NNJA 1U7PA 4PU0A 1WXHA 4CMHA 3SP1A 3ORYA 4UHFA 1L7DA 2C3PA 3IDOA 1RC8A 4B3CA 1U2GC 1GZVA 1J9GA 2H9YA 4QU9A 2IBTA 4B6OA 1GTMA 4FIZA 1GZ5A 1WBJB 3KAKA 3SLRA 4CTJA 1JDPA 3GJZA 4M6WA 2D0OB 4KJXA 4W4TA 4WLOA 5AJHA 3GYGA 4YT4A 2HL6A 3CVWA 4GX2A 1UQTA 4DIOA 3IB6A 4HDSB 1YA6A 2ZYSA 4AUNA 1SBZA 2Z2XA 3FPCA 1JT9A 1X0VA 4TZ0A 2VSOA 4MHSA 1WQ3A 3R3VA 4F5WA 3AFNA 5E8RA 3TQCA 1W52X 2HXSA 3IOEA 3L7JA 1ADFA 1JDBC 1P5ZB 3QWFA 3GD5A 4WK2B 3SX2A 3TIVA 4LI0A 1H4QA 1XOIA 3CLHA 2BBSA 5BSEA 1GKIA 2BSXA 2GPBA 1GQOA 4MR9B 1RWWA 1Q57A 3HKDB 5SYMA 4M9RA 3ZCRA 3LBFA 3O8NA 2R8XA 1CX9B 2ZRMA 3GFOA 4JQYA 1LI4A 5CLGA 4KR3A 1E1YA 3NXKA 3QUBA 4ZDJA 3DE1X 1ZLXA 1DKQA 1FS5A 3SMQA 4G4GA 4NECA 3CISA 5J9FA 2PNJA 3RI3A 4UHBA 1O7JA 5ILQA 4ETMA 5AESA 4LGVA 1X8LA 2GKSA 2YVAA 3GDOA 3JARB 5A9SA 3BILA 1BW9B 1FS6A 1ZCAA 2YJTD 3OLVA 2X4IA 1KZGB 3BF8A 3DW1X 1USKA 1WZIA 2PPLA 1RHKA 4FFWA 3VJMA 4XEUA 1MGOA 4GVXA 2GHRA 1JU4A 3R3SA 3VBCA 3BREA 1U1FA 3O5AA 1V35A 3SHFA 1K75A 3BGDA 3SM3A 3LLVA 1ODIA 3RS9A 1ZMTA 3K6JA 4JXJA 2JCVA 2JJ1D 2VRCD 5JU6A 4YRTA 1P74A 2GSWA 1KRWA 1BOFA 4DARA 4J8PA 3HEAA 4A15A 1AS2A 1V8BA 1NLMA 2PJDA 4XD7D 3RSZA 5FBVB 1EVJA 3AYXB 3OZGA 4R16A 3UV7A 4UOEA 1SHUX 2FJ0A 2FG5A 1M2OA 1DQPA 2XUGA