3C74A

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
242
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 82
structure length 242
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c74A00
1PWYE 1Y1QA 1JE1A 1NC3A 1PK9A 1JYSA 4TXJA 1JDTA 1ULBA 1Y1SA 4FFSA 2AI1A 4TXNA 1YQQA 5EUBA 3E0QA 3GB9A 5CXQA 3DPSA 1SD1A 3OZEA 4DANA 1PR5A 4YJKA 1PBNA 1A9PA 3BL6A 1TGVA 3LGSA 1OTYA 3OCCA 4H1TA 1RSZA 3OF3A 3EUEA 3PNSA 1PR2A 4EB8A 4PR3A 5CCDA 1A9RA 3NM4A 5F7ZA 1YRYE 1T8RA 4G89A 3ENZA 3OOEA 4F2PA 2HN9A 1FXUA 4TXLA 5ETJA 5F7XA 5B7PA 5F7JA 3KVRA 4DA8A 4TS9A 1PKEA 1RXSA 4F2WA 4D8VA 3EUFA 1U1EA 1CB0A 4L5CA 2HRDA 4LKRA 1T0UA 2OXFA 5I3CA 4BMYA 4D9HA 3KUKA 1U1CA 4WKBA 3KVVA 4RJ2A 4G8JA 3UAYA 4DA0A 4E1VA 3O4VA 4L0MA 1A9SA 1LV8A 3P0FA 1Z34A 4QEZA 1Y6QA 2OC4A 4IP0A 4MCIA 4R2XA 2P4SA 5C80A 1Y1TA 4U2KA 4KN5A 1TGYA 5K1ZA 4BMZA 1VHWA 1YQUA 3KHSA 5KB3A 3OOHA 3DP9A 2QSUA 1OVGA 4G41A 4I2VA 1OTXA 1JDZA 2HSWA 1CG6A 3EMVA 1PR1A 2QDKA 3OPVA 1ZOSA 4QFBA 1V4NA 1Z5NA 1Z36A 1JE0A 1PR6A 5B7NA 1JDVA 4F3KA 1OUMA 3DDOA 1RCTE 4BMXA 3MB8A 3E9RA 2A0YA 1VHJA 4TTJA 4NY1A 1A9TA 4DARA 4QAQA 2A0XA 3UAVA 4F1WA 1M73E 2B94A 1WTAA 1ULAA 2XRFA 1Z5OA 1A9OA 3P0EA 1PR0A 2Q7OE 3KVYA 3NM5A 3O6VA 1SD2A 1JDUA 1Z38A 1ODJA 3LA8A 1T8SA 1TCUA 1N3IA 2RJ3A 4LZWA 1ODKA 4D8YA 1U1GA 1Y1RA 1K27A 3NBQA 4M7WA 1T8WA 1ECPA 1TCVA 4P54A 2I4TA 3PNPA 4JOSA 1ODIA 4MCHA 4JWTA 4MARA 4TXHA 1RXCA 3ODGA 4R2WA 4BN0A 3IEXA 4F3CA 3DJFA 4PNPA 1RYZA 2OECA 4K6OA 4DA7A 1RXUA 3UAZA 3BGSA 5F76A 1SQ6A 5F77A 1NW4A 1PK7A 4YNBA 1QE5A 4DAEA 2ON6A 5EFOA 2A0WA 4QARA 3OZBA 1VFNA 1ZL2A 1XE3A 4NSNA 1YR3A 3UAWA 4DABA 1V41E 3PHCA 2AI3A 1A9QA 4D8XA 3FB1A 3LBAA 1LVUA 1Z35A 1JDSA 3FUCA 1C3XA 3IOMA 4TXMA 3INYA 1V45E 3E9ZA 4NS1A 1RT9A 4TTIA 3TL6A 2IQ5A 4DAOA 4GMHA 4GKAA 3U40A 5JPCA 1Y6RA 5CCEA 3K8QA 1V3QE 1I80A 4OF4A 4OEHA 3KU4A 1B8NA 1TD1A 1B8OA 5F7OA 3DF9A 3EEIA 2I8AA 1Q1GA 2PGAA 1G2OA 3PHBE 5IFKA 1OU4A 2BSXA 1LX7A 4OGLA 4WKOA 2AI2A 4WKCA 4L6IA 1RXYA 1OV6A 4JP5A 1Z5PA 4LDNA 4LNHA 2AC7A 3OZDA 3SCZA 1PW7A 5CYGA 1JPVA 3FAZA 3FNQA 5B7QA 5IU6A 5EPUA 3OZCA 1V48A 1SJ9A 5CXSA 3NM6B 4GLFA 4QATA 4QASA 5F78A 4R31A 2H8GA 4WKNA 1PF7E 3K8OE 4LNAA 4YO8A 2GUWA 4TTAA 4WKPA 1JP7A 4OGKA 2OC9A 5FAKA 1Z33A 1Z37A 4D98A 1ODLA 4UC0A 3GGSA 2QTGA 1RFGE 4GLJA 1RR6A 4L5AA 1A69A 3FWPA 5DK6A 4M1EA 2ISCA 1V2HE 5F73A 3T94A 3C74A 1Z39A 3UT6A 4TS3A 1NC1A 2QTTA 1YBFA 5B7GA 1U1DA 3FOWA 4OJTA 1PR4A 4DA6A 4EARA 4ECEA 4OY3A 3BJEA 3D1VA 3UAXA 1VMKA 4YMLA 4L5YA 3QPBA 3BSFA 3ONVA 2HWUA 2QPLA 3MMSA 2A8YA 4M3NA 5CYFA 1T8YA 4TYMA 1U1FA 1K9SA 3F8WA 1K3FA 4X24A
chains in the Genus database with same CATH superfamily
1Z0IA 1Y3HA 5COQA 3CG4A 4RA6A 1OI7A 3TWOA 2GJ8A 3N6RA 3RT7A 2PSSA 1CVRA 1LTKA 3N87A 3DOJA 3MTAA 1W5EA 4J1TC 5KYUA 3ONWA 4FFSA 4MLDA 2JJQA 4I4NA 4UATA 4F4UA 5KYYA 3PDHA 4HJRA 2G9VA 1NUUA 2Z5FA 2VDUE 3EAFA 3F9IA 3KG2A 4YYZA 5DJ5A 3CJRA 4ZHQB 4F5WA 1PZHA 2CEKA 4C4OA 3AF2A 3SS9X 3T1VA 5FWYB 4TZTA 4MZXA 4CCYB 2RSLA 1GT6A 3EH1A 3L79A 3PFGA 3LW7A 4ZT3A 3HN2A 1FS4A 3GAAA 2RG7A 4DKJA 1PFUA 2BC9A 2RHLA 4M55A 4NV0A 2PMWB 1WHTB 3LLCA 4UASA 2R8XA 5FTNA 3WKEA 4G63A 1P7YA 2J30A 5F9MA 2J4DA 3DE4X 3WNQA 3ZIUA 621PA 2I0FA 4HDOB 5K4HA 3K5HA 2ZJ7A 3ZJTA 3Q2OA 3V8QA 3A1CA 1FS6A 4YECA 2VTKA 3WWZA 3ZWWA 2RH8A 1RYDA 1NOJA 4GBED 1A9PA 4Z1MA 2C8JA 2IU3A 3FW1A 3EWNA 2ZT7A 2K7ZA 4HVCA 1J9EA 1PWZA 1XZHA 4OP1A 5IUNC 1HDGO 2WJWA 4RLQA 3NXKA 3ZGZA 2O07A 3AUSA 4OKSA 4F3TA 2J07A 1L5RA 3OF3A 2ECFA 2MIIA 2QRVA 3CO5A 3MOIA 4AKTA 4OL9A 1IK6A 2VNAA 3D0RA 4PZDA 2LZ0A 2V7VA 2WZQA 3UXEA 1Z4IA 2GA9A 3NHPA 2BGUA 2EBUA 1KK3A 4DR5B 4LRYA 4JLWA 1UK8A 3C1AA 4TS3A 5A1JA 1T8RA 2W2MA 2ORED 2PUGA 1UXOA 4ACBA 2SICE 1KDRA 1VKOA 4RMHA 4A82A 2CMHA 2WIDA 1JYFA 2FK8A 1TVMA 5T8KC 4NFLA 2FFJA 2J8ZA 2IBMA 4PAQA 1XALA 4E2XA 1DB3A 1NNEA 3P2OA 1E1DA 1FQKA 2QLFA 3K5WA 3PIRA 3I45A 1G63A 2M6KA 4DA8A 2NUTB 3CX8A 4BATA 5LA6F 3DOHA 3WNCA 1T5LA 4DJDC 1AQUA 1TCBA 4ISBA 2JBAB 1JIKA 3CGGA 3LW8A 7GPBA 3B5JA 1GAEO 2ZG6A 1TEVA 2ZS9A 1L3CA 1Z13A 2MMCA 1YFKA 4JI1B 3C3KA 3AJ9A 3KP1A 1IWBB 1VSVA 1QBGA 3D6FA 2IS6A 4I9HA 3I62A 2I55A 3UK2A 3T3HA 4XA8A 1MEJA 2Q6OA 1JT2A 3IUMA 4PYRA 4BVAA 4PGHA 2WNSA 5BW6B 2XE4A 2PD4A 2C2GA 5AVJA 4WOCA 4H7KA 1AS2A 1Y3CE 4B6FA 1IPEA 4FWIB 1T10A 3G02A 1IIRA 3JV7A 5JVDF 3KUKA 3G59A 2NO5A 2QX8A 1Z4PX 3JRNA 2Z5VA 3KVVA 4RJ2A 3T9CA 3CVOA 4BTEA 3V9PA 1J5EB 2A6PA 4CF6A 1M2OB 3S1SA 1X1DA 4PYMA 4LI3X 3VDQA 2KB0A 2YRFA 3TIFA 4CTNA 2P2CA 1ZVJA 3VM6A 1P5FA 1M1UA 2GFIA 4G0OA 1H0KA 4L4XA 3S1AA 2QL9A 2V7XA 4ESOA 3KHKA 4F8EA 2RI1A 3I2JA 4V38A 3IBFA 4W1QA 1BWPA 3SK0A 5KCZA 3HKBB 4L8FA 4BPBA 1W93A 1Z34A 2RH4A 4K8OA 1Q3KA 1G19A 3OSZA 3RU9A 2GJ9A 2K2WA 4X20B 2NV6A 3G2PA 4EB3A 4TMZA 1A5AB 1PR9A 1ZNXA 5DM0A 1XPJA 5ULLA 1EFRD 2H1LA 4C43A 8MHTA 2AOTA 3N9IA 4Q02A 4KXFB 1GFIA 3JZIA 1NMQA 4JFAA 1T5BA 4PCUA 3SZ3A 4A0SA 3C8UA 3QHPA 1ZVQA 1XCPA 1YE5A 3DA8A 4PZLA 5CA0F 2WD9A 4IIJF 4GX1A 2ECOA 2VWPA 4FJ0A 5U9CA 3V6LA 3DBIA 3JSAA 4JC5A 4XDHA 3CCCA 2YV2A 3FNFA 1A8HA 1UJNA 1GEGA 2BAGA 4UFOA 3VZCA 1F8YA 5EKTA 4PR0A 3TK1A 3G8YA 1E3EA 3GG9A 2J6IA 3L8ZA 3U3MA 1SIBE 3DAFA 3FYUC 3JVUA 4MRMA 1JMYA 1QDEA 5MFZA 4JXXA 4IDCA 2QTFA 2EVWX 1B8UA 2WU0A 3A6EA 1VJ0A 4WMLA 3A26A 5E6RB 2J3KA 1XA3A 2VF4X 3ABIA 2WQ7A 5CK4A 1PR1A 4YAOA 5AW6A 3QK7A 4K05A 1TAQA 1X7XB 1BE0A 1U2GA 1V4NA 4N0QA 3WHPA 3NQ41 4KMMA 1F38A 2FWPA 2ZYGA 1M33A 2XOKD 2Y1CA 5GZ3A 2WPDD 1F7UA 2NW6A 1MJFA 3FXAA 3KTAB 2VDQB 3PUYA 1NXVA 5BN1A 3VYTB 1E9AA 1L5LA 1JAYA 3AF3A 3N28A 2BISA 2EAUA 5C46F 2Y9PB 3AU9A 3WB2A 4JELA 4Q24A 2E87A 1E2GA 1EB8A 3FDJA 3LBNA 1J23A 4OXYA 3WGTA 1XRQA 3NHFA 3UGJA 5BPFA 2G1KA 4YHBA 1FSSA 1ZR2A 4AM8A 2C2WA 1RWXA 1BJKA 3VOSA 5CEFA 3SHWA 4US0R 1Q44A 1LU9A 3U62A 3QYFA 1VG1A 2I6QA 4JSYA 5KQRA 2DOKA 4RTRA 3Q7TA 4FFRA 1Q0ZA 2I80A 2I29A 1PT6A 2PKXA 1J56A 2SECE 1XO1A 2V4ZA 3I6YA 4ZYTA 1U7XA 4QODA 4LZOA 3LFTA 3UMFA 4KR3A 2CE7A 3CN7A 3D4OA 3PHGA 4H3VA 1G7RA 1JEAA 4G2TA 2QKYA 2C59A 4KR6A 4PSUA 4Q01A 2ZKIA 3UMJA 1UMDA 1CRWG 1NYRA 1Q7EA 1U1IA 2I99A 4MCAA 4E5MA 1NBEA 4TN1A 1YB7A 2XWPA 4MVCA 4DMFA 3LGAA 1Q14A 1KXJA 3OPXA 4B8WA 1CDDA 1UXKA 4PF1A 1WQ3A 3R3UA 2A57A 3KOWA 3CF4A 5AICA 5D7NA 5AHRA 2DP4E 1RXVA 1PTJC 3CZRA 1GPNA 3CVVA 1UBKS 2ODWA 1N3IA 3AVXA 3QFFA 1MRZA 3CH7A 1CRZA 1L4HA 5K0BA 4NFSA 3EGWA 1TM4E 2YJ3A 3CW9A 4FGJA 1ZJZA 4MVYA 4WZZA 4XYMA 3VZSA 3NBQA 4OL0A 5U1PA 4B0OA 3FPCA 1IN1A 5JAZA 1PX2A 4OLBA 3PKJA 3NVAA 4J6FA 4UDXX 5AOAA 1EQAA 1I4WA 3QBTA 1QYWA 4Y2YA 3GHHA 2UUCB 5B1IA 3HFSA 3ZCVA 1IJFA 4QHSA 3W4JA 1T3ZA 1IZYA 1X7DA 4U8GA 4A6XA 2IYTA 4I9UA 4BECA 1Y7HA 2OBNA 2FSVA 5LD2B 5D5QA 4EG5A 1LC3A 4XIIA 1KFJB 1NUAA 2IDZA 3QMWA 2AJLI 4MQUA 4OO3A 4W1PA 2X0RA 1PP4A 1DWUA 1RM0A 1KMCA 3DFKA 3LT2A 3MTGA 3IKJA 1AA6A 2FGJA 3H3JA 3G9QA 2GCOA 3OD5A 1KVRA 3I64A 4INPA 4ZYZA 2DTEA 3H8VA 1I8TA 2A1IA 2RB5A 3PYLA 4WJLA 1TKBA 3BCSA 1V16B 1NJGA 3NPMA 2QX7A 1DCTA 5C7IO 1OMOA 5AVZA 1D04A 1JA0A 2QXYA 3AUTA 1S2IA 3HWWA 3L7MA 1BDHA 4EYQA 2VZLA 3H19A 3SSMA 4CLRB 1UP4A 1ZL2A 3NDIA 3NFYA 1SCJA 1N92A 1Y4UA 3PHCA 3VI4B 1JNXX 4FWTA 4ZZ3A 1R3DA 2H7YA 1WXDA 3RCBA 3PFBA 1A7JA 1VGRA 3UMVA 3VU9A 2VI5A 5DGHA 1OC4A 4LHWA 4EWLA 1RKQA 2NUTA 1SM4A 1NLUA 3OZSA 3ZU4A 4HK4A 3UY4A 3W9UA 4CYMA 3HJNA 5B6IA 2J87A 4ZAVA 4FFMA 3O38A 5KYGA 3R44A 3B13B 3K1AA 1KBZA 2C9CA 4ZCMA 3ZN2A 4KN8A 1HL3A 2CJPA 2C5BA 2QX4A 3OQJA 1G7SA 3ICOA 3M5PA 2BZSA 1I7DA 4JV5B 3V5NA 4WK6A 2X6RA 1N6PA 421PA 4B82A 4DMRA 1EE2A 1BD3A 1T8UA 1JKMA 1H6CA 4RE5A 2GF0A 4WJZA 3H65A 2QPTA 1R50A 1ZBQA 4CU5A 1G4HA 3AEXA 4A8TA 1GPUA 3B3QA 3I9V1 2P5UA 2VJKA 2YMLA 3GLRA 4LYJA 4P22A 4QYTA 4Z6KA 2QN8A 5H80A 4BMVA 4EKNB 4P5EA 1P9NA 3EEIA 1NTOA 4I14A 2IYZA 4H16A 2RHHA 1X1SA 2GTHA 4TKVB 3OUUA 1Z4LA 3CHYA 2DG2A 2B1GA 2ZE5A 4W6QA 4OKNA 1J6UA 5EZYF 3PGKA 3CNHA 3D0OA 2GEDA 4J1TA 3VC1A 2C5EA 3TPCA 1ESEA 2VDNB 3S1AB 3T0GA 2R2GA 1FMJA 1TJ5A 4ETMA 3I4CA 5A7HA 4GSKA 1JAXA 1GYRA 1J22A 1GLNA 2EARA 2XOKA 3BDVA 1TRKA 4JIMA 3PV0A 4KUGA 2PY6A 2POCA 4LK2A 1LJLA 1EWRA 1RFLA 3PUHA 4D92A 3KQLA 3VU9B 4EFDA 3D2LA 1VA4A 1H8EA 2VSQA 2LW7A 1GJRA 2EQ5A 4S1WA 5JQGB 1EBFA 1H9AA 1P1CA 2W11A 4NYJQ 5C5EA 4QECA 3TLCA 2J9YB 1SK8A 3FTNA 4DUGA 4MV0A 5L9AA 5KNDA 1L5MA 2P65A 1NE2A 3VR4D 2JIZA 2VA9A 1G8AA 1L6IA 2W2NA 2Z8XA 4K9SA 4O4JF 4U02A 5H7XA 1OOEA 5EC8A 3SQXA 2W9XA 4L72A 3T4UA 5LKAA 1NQAO 4EHDA 4LYEA 4HX9A 2X8WA 3EWSA 5HMLA 2WJVA 2H8GA 2PUVA 2RBKA 1YS6A 1EMDA 1JQ3A 1PLJA 2H1FA 2JEYA 4TSFD 1KEEB 1GU0A 3ND9A 2GDZA 4O4LA 5CPFA 1VKNA 2DRIA 2FFRA 2R6HA 3ZUPA 5BSGA 3H1GA 4AUMA 2IPNA 2F1JA 2UVPB 4AUNA 2EJUA 1IXRC 4B0PA 1TYCA 3HTXA 3TH5A 1CF9A 4KODA 5IJXA 2TMDA 2XNDA 4HWRA 2BMWA 5FUXA 1YNSA 2HU8A 3RR2A 4D6YA 4CKBB 3QYJA 3C1OA 4V2IA 4HLUA 3D8HA 3ZIDA 3P45A 2ZIUB 2P0AA 4GW3A 4FDVA 2DVMA 4NPCA 3WL3A 2R6CA 4GUAA 2HA7A 1SVWA 4X90A 3KJIA 1ZH2A 3AQIA 4ZVNA 2D2EA 1RR6A 3L6BA 1PL6A 3PC8C 1SBIA 1U3FA 4HQFA 3H2JA 3U4IA 2ZCUA 4NYMQ 1LD3A 4RV5A 4TTPA 4FM9A 2GF9A 1N6OA 3K05A 4PANA 4S1TA 2ZS7A 1RYHA 2F59A 1L8XA 4UJ3A 1BXRB 3CR8A 1L4UA 1NJ5A 2PUWA 4E2ZA 1MRNA 4NBWA 1T3LA 1C2TA 3T94A 4F4HA 1PGQA 1DS6A 3A3YA 3H2YA 3KPWA 4U2FA 5HFNA 4ZC1A 3RD5A 1BTOA 4FSDA 4EUKA 3W2IA 1EWVA 1PUXA 5FBRB 1M6YA 1U28C 4EZIA 4ZCSA 4Z4HA 2RHRA 4YRKA 2Y4OA 1NZJA 2JEOA 2EGHA 4DCNA 2UKDA 1N3BA 4BKMA 3ETHA 1NW7A 1JZSA 2YXLA 3DXFA 3SFZA 4AJ1A 2BGNA 2C0PA 3UNXA 3VKUA 4QA9A 3IIMA 3OEYA 2WUDA 1NNUA 3SX2A 2XDAA 4OI4A 1E66A 1Y7PA 2HNBA 2W8ZA 2F90A 4C87A 4ZI3A 1OH8A 2AR7A 2O0MA 3FCXA 4DR1B 2YWBA 3BBPA 1QU3A 4UAUA 3ESCA 3S2GA 4AFNA 4H59A 3DW1X 4OXXA 3FWYA 3KDAA 5FEUA 2X2FA 1V1RA 2BMFA 2QOEA 3BKXA 4IDBA 4WNYA 4WN9A 1GRCA 1QIKA 2O7QA 2XA1A 4BNWA 1Z0DA 3LX4A 1UCFA 1Y4AE 5B37A 3VPCA 1SA0A 3HV2A 3ZJUA 5JJLA 5HIAA 4ND1A 3HCPA 1H4VB 3V7WA 2ODPA 3M6XA 3OQPA 1XELA 1V8PA 1ISJA 1QO0D 2DFVA 2OGZA 3RYTC 1I2MA 4J0GA 3SXUA 1NUTA 1HNWB 4QU5A 1ISGA 4X24A 2QQGA 4C1BA 3IKTA 3RVJA 3GHYA 5BWBA 2RI6A 3G7SA 5EP1A 3UT5A 4IHJB 3U1VA 1KHTA 1CZNA 2RCNA 1AA9A 1S3SA 3O26A 3H6GA 1H5NA 3HR7A 3IIIA 3JD4A 1G16A 4GOMD 4UJ5A 1QTQA 3HPRA 3LYUA 4F91B 1Q74A 3B7GA 5ESXA 4JN6B 5H68A 3RUCA 3CISA 3O4HA 4JB2A 5K5EA 2WHQA 2Y1DA 4AKIA 1V8DA 1NJ6A 5EJMA 5K7SA 2XIJA 4UEJA 4KP7A 4DG9A 5EUBA 3HNOA 1MGPA 1P2SA 4R83A 3WGVA 3BK7A 1DGQA 2GCOB 1C0PA 1BDBA 4LX8A 1I2AA 3ZQ6A 4YS6A 5CB0A 3AFGA 4URYR 5H4GA 1YTLA 3AJDA 2QMQA 4ID9A 3U09A 3BZWA 2BBTA 5EMLA 1MOQA 2VRBA 4QBHA 5LOVB 2WTEA 4JLJA 9LDTA 3JCZA 4UXHA 2C7PA 1ZI9A 4Y1RA 4QUBA 3RSLA 4IUCS 1TF5A 3H5VA 2MJLA 2O1SA 3KJZA 2DR3A 1H2ZA 3WV5A 4YJ2A 1NR5A 2X1LA 3EQ2A 4IDDA 4UBIA 3I04M 1W2HA 1I3LA 4MRAA 1A2QA 3TD9A 3NIWA 1FFWA 4Y2HA 4HN4B 2JIDA 3Q3EA 2WD7B 3H9UA 4MQBA 4QIHA 4X7BA 4NULA 1OXVA 2X2PA 3CZCA 1BD4A 5I8ZA 1V1JA 1T5TA 1HT2E 4M21A 1G20B 4HNAA 2H5JA 2UZ3A 2BUAA 4ZIRA 2G83A 2WWHA 1PG0A 3UMRA 3HKBA 5AVXA 4KE8A 1KI8A 2JAHA 3SZLA 1H3EA 3JR3A 1WBBA 1JF8A 4QPZA 5KDLA 4DIBA 4EB8A 3ZV4A 1E1CB 2IZ1A 4TMKA 3RUHA 1G8MA 3EMKA 1T0JB 3GDHA 1YRYE 4RPHA 4UM9B 3A9CA 4PTZA 3WZMA 1K6EA 3VU1A 2FEMA 1S2OA 4QUHA 5KTMA 4YAJA 2QIOA 3LZ6A 1PQ4A 3RT1A 3WKCA 3SVZA 3OE1A 3O90A 5TPZA 1Q0PA 3EHEA 1WZIA 1JQLB 1N5JA 2W6NA 4XFJA 5HQJA 1AGXA 1EXNA 5KWVA 4X62B 3QKWA 5KZMB 1B74A 5DTRA 1N0IA 1U7DA 1AMUA 2Y93A 5DP1A 1GUAA 3AIMA 1EFVB 1NIJA 1VLLA 2HNAA 2IF2A 3T7SA 3UHJA 1U2SA 3JTEA 2V6FA 2XVMA 3HCFA 3TLGA 1PYOA 1TJNA 3CLRD 3X1XA 3GOHA 3N6VA 2PAFA 4F84A 1GEEA 3D54D 5IVKA 1CEYA 2QVLA 2IQIA 5JXHA 1I4DD 2JGDA 3S28A 1FW6A 1X7WB 1DG1G 2PZBA 2EX4A 7ADHA 1KAEA 1SULA 3FUWA 4LF6B 1BCSB 3MJHA 1VHTA 3M33A 1G8YA 2VAXA 3KTOA 2JFFA 2IS4A 2PH3A 1C0EA 3I6MA 3L8GA 2FPGB 4Z9AA 2NM0A 3MINA 1BGVA 4LISA 1EINA 1CIPA 3DO6A 3ZU2A 2HAEA 4AG5A 5DSTA 4WY5A 2MSKA 1ADFA 1ODFA 2Q9BA 4OCZA 4AICA 1P75A 4BMYA 2J9FA 1C7QA 1ZD9A 4QFMA 5GPBA 4F3YA 5J47A 1RYYA 5DSZA 5JAHA 2FR0A 3VUEA 2XCTB 2XGMA 4DDTA 1M54A 4GVLA 2OCLA 4HWKA 3PNYA 1CY2A 4HRYA 2UAGA 4E1VA 3VSBA 5HQ3A 1JIXA 2W71A 2UXBB 3WWPA 3B78A 1COWA 4B79A 4LW8A 1E7WA 4NZZA 1XQ6A 3LHSA 4TVBA 2OESA 3KR1A 4ZVLA 5TPWB 5JD3A 4URVR 2BGLA 1ZJYA 3EMDA 4Q12A 4TX1A 4DLRA 3P0FA 1UXIA 2GYWA 1GKKA 2P27A 3P1JA 2AFIE 3TLMA 3V1KA 1RKXA 1UQRA 1X0XA 3HEAA 4LGVA 3PLNA 2HEGA 1ACLA 2QUBA 1LCIA 2EDAA 1D6SA 2X8JB 1FE8A 2Z9DA 1CE8A 2NU8B 1ZO8A 2NACA 2QRNA 4ZT6A 6AT1A 3IJEB 4URHA 4K9DA 1NNSA 1U99A 2FX3A 1IOLA 4M1MA 1D2CA 4R2XA 3TSOA 1U0TA 4IIXA 1GQSA 1P9RA 3ZW7A 1EM8A 1Y5LA 2PG3A 2G0AA 4U2KA 4A1FA 3V8VA 1AM4D 4JD5A 4KCGA 3K96A 4C76A 4M1QA 2PX3A 1A4IA 3RAFC 1GU7A 4YB8A 1KMMA 3R5TA 4JLSA 1O96B 1AQ6A 5JWHA 1BHQ1 3E0XA 4L0QA 2VNHA 2V1XA 4LTDA 3PGXA 3UH0A 5C3MA 3OCVA 2CYCA 2N47A 3DP9A 4XCXA 3SSAA 2AQHA 4QGAA 1Y9AA 3EQ7A 2J32A 4JQSA 4QNNA 4Z3KA 5D2CA 4JVOA 1M34E 3DG9A 1YUNA 2LKCA 1XTTA 3AGPA 1FB5A 4R6XA 2BEKA 4RHXA 1W1UA 3CLTD 4M53A 3W5VA 3P2IA 2IV2X 4D1YA 3LT1A 1J7KA 1H65A 2ANCA 4JA0A 5FL7A 2PVCA 2H0QA 2QRGA 1Z36A 3GLFE 3DQQA 1GN8A 1KYQA 3RS3A 4B6JA 1PV2A 2C20A 3VX4A 1OAOC 3RC7A 2XSZD 4D80A 2OM6A 5AMXA 2H59A 3OMWA 4RUKA 2FN3A 1YZGA 1CNFA 3NBAA 4NDNE 4BFWA 4F38A 4US1R 4AJ2A 1J8YF 4EJSB 3BVPA 4CIVA 1SR8A 1QIIA 3QVGA 1D2AA 3BB1A 4KDEA 4L8WB 1L4YA 3VX3A 3PDCA 4W5HA 3AB3A 3RRZA 3E9DA 1OFTA 2GPWA 5EMMA 5F1YA 1MH9A 3OE7D 1KI4A 1NP6A 3PDIA 3FNBA 1IWOA 5HF9A 1JMVA 1DRVA 2QAGC 2I33A 1KP9A 4BAGA 3KYBA 3KHUA 3KWMA 3ZCUA 2Q27A 5FQNA 2X4LA 4RLHA 2VJCA 1KE2A 4DR2B 4F21A 3IR7A 4V0MA 5AK4A 3T7DA 3M9XA 5HOEA 2XT6A 2CB0A 2AYYA 3O91A 3AHDA 3HEBA 5K3SA 4BVFA 5ARDA 4BP1A 1OCEA 2LXNA 3GJ5A 2NIPA 1VE9A 1XMQB 1YWGO 2VTDA 1EP9A 2H4ZA 5LZ5A 3A06A 4RTKA 4R8SA 1TQHA 1ULAA 3T12A 2J0SA 1OLOA 1TYEB 2XRFA 4ZARA 2DH6A 1NHWA 1UOEA 3SF8A 4FKMA 5B1EA 4BXOA 4FGSA 1B14A 1WXGA 1BKDR 2JB9A 2GASA 1IB0A 1CX9B 2Q5EA 1ZIPA 3BWCA 4OUDB 3V8BA 2F9LA 1CDZA 2I1LA 5TQ2A 4NK4A 3RS7A 3WRXA 4AG6A 6ABPA 2O7RA 1SBCA 2BEWB 2IZ6A 4DCSA 1Z38A 2YQ5A 2DQSA 1P31A 3PRHA 3U7JA 1DO0A 3QLVC 1RJFA 4RH3A 1TMOA 5B3JA 1ZH0A 4M22A 3ZHOA 1YFZA 3DVSX 3LUFA 2F43A 4GNRA 2O6LA 4IIFA 4RZSA 2CVHA 3EVEA 3GYBA 4PWYA 2ORYA 4X1KA 5CHYA 1MX5A 3GJQA 1NVDA 1HL7A 3PRJA 2VJOA 4ZOCA 4P54A 1D7OA 2I4TA 1VRWA 5CEEA 1R3UA 3KQMA 2C61A 4FGZA 3EPRA 4OHPA 1LWNA 3D4IA 3HVJA 1QGUB 2GVZC 3VSAA 4R0VA 3B36A 4XIFA 4NEQA 4I4LA 4JWTA 4R8LA 2C99A 2DU8A 3OCWA 4R2WA 3KKKA 4BN0A 3LQ1A 4EG4A 3CS3A 3KOZA 4D56A 1YS7A 1G98A 5E95A 3DJFA 4C6TB 3B2QA 4K6OA 5K6AA 3Q8LA 4ZHQF 5GOTA 1PW5A 3KT8A 3W77A 4FUQA 4FYHA 1TA9A 4BUZA 1Y3DE 1ZHHA 2LKDA 5IJ0B 2FJPA 2Q6LA 5BMVB 1RWPA 2FW8A 4IGIA 3WRWA 4Q4JB 3OE4A 3SF8B 1RVDA 2QTHA 2VCYA 1W4RA 4JEMA 4N7JA 1TQ6A 1V4BA 2VJNA 1YR3A 3FJOA 4NSNA 4TV9A 3A0RB 4X1OA 4Z9FA 4DABA 5LQMA 2AI3A 4IOJA 4FFOA 4MUBA 3S2EA 4L15A 5FFFA 5I7SA 4C7OB 3ZR4B 4BB0A 2JJ2D 2WAAA 1LXCA 1JLRA 2UZ0A 3L0YA 2YHBA 1SMKA 2PA3A 5EE0A 1X87A 4ZQBA 2GB4A 4YUXA 2AIRA 1UDRA 4DLVA 4BFVA 2Y1LA 1JEOA 4WBNB 2NXWA 6GPBA 4JUCA 4O6VA 3QMPA 4CM9A 1I3CA 3N86A 2OBBA 4O1HA 4R1LA 5JSZA 4BTVA 5T3YA 3T7AA 2QW1A 4CLOA 2OLJA 3GMSA 4QYSA 4EPRA 3HRHA 4O5AA 4DUYB 1T35A 1OFGA 4CKEB 3F8TA 1ESNA 1CJTC 1I2CA 2VS1A 3P32A 1YKFA 3ICQB 4NMMA 4U00A 2M2IA 2AS0A 3STWA 1ZOPA 3ECAA 4TM7A 4OHZA 1IOWA 1DAKA 4E33A 1X7HA 1A5BB 2PGNA 2YQ4A 1IATA 3QNWA 4KQKA 4O2RA 3ZDRA 5BSFA 4TLCA 4D9NA 1ZMBA 2ZIFA 2YDXA 1XRSB 4P3NA 4G5HA 4H6VA 3A28A 5TJHA 3O4JA 2IS1A 4CM6A 1A1SA 1PS0A 2Z1DA 3W5CA 2P35A 4W7IA 2F55A 5TR9A 1T6YA 1UM8A 4QYMA 4G5RA 3TBKA 4JJ4A 2C8KA 1T13A 2BEJA 5P8WA 1SWWA 1OLXA 1PG5A 2FFBA 4LBZA 3W7AA 3ENQA 5TPWA 4E4YA 1TB4A 2EEZA 821PA 2B6HA 2OHXA 3GRVA 1BFDA 2AI2A 4X3PA 4RANA 2IU6A 1CFJA 5CG1A 2XSZA 2D3TA 4MGYR 2Q2QA 5AKEA 2H2DA 3ND5A 2PEYA 5K0ZA 4BLSA 1B15A 4FLFA 1L4GA 2G04A 4NCJA 4TWIA 2AKEA 4QOHA 5K3FA 4MULA 3LLSA 1PVDA 5JI3E 1L5VA 3KZXA 4B43A 2QLLA 3CUSA 2ZRLA 1FJHA 2ZSAA 1VJGA 7AT1A 4EX7A 2QGNA 3JATB 4DMKA 2ZVQX 2DLNA 4WDQA 4CLOB 3A14A 3PPXA 6LDHA 5AXCA 5E1BA 1WMDA 2YVAA 1YQDA 1DFHA 1N1MA 2WWIA 1RZ3A 2NZ8A 1GCIA 1WIWA 1KQ3A 5EERA 5FBLB 4A2PA 4D02A 3EOAI 3VAYA 2V5UA 3PVSA 1JA9A 4JQYA 3EYWA 3O4IA 3PFHA 1UK9A 3FM9A 5IPFA 1B4DA 2JAOA 5JWRA 1U2QA 3I6ZA 4LJRA 1BVRA 5J58A 3CJTA 4OHRA 4Z53A 1UAGA 4K87A 2PO7A 4GZ3A 2Z8YA 3SJCA 5KYWA 2AEEA 3NHAA 1FU4A 4GPIB 1BWRA 1FF9A 3FF1A 3MGAA 3QVLA 3QWBA 4TSRA 4CPDA 8AT1A 3TTSA 3H4VA 1VCNA 3NPAA 3RRNA 2GEKA 1KI6A 4DMMA 4DSNA 4L9WA 4EI9A 3HI4A 3BSSA 1VFPA 3MOSA 1FDTA 1IZ8A 1CR0A 4N3AA 3CLVA 1DKRA 1KEUA 4AK9A 4ITUA 3RFVA 3GGOA 1TT5B 1Q7BA 4IRXA 3LXUX 4HNSA 1XCMA 2Q0HA 4GI2A 4DRXB 2C78A 1FDOA 1IU9A 3FWPA 1IG0A 4CCSA 1YOBA 4DOMA 5EJ8A 1UT6A 4JBIA 3RVDA 3PC3A 4P7GA 4A0RA 4MQEB 4UKDA 3TSAA 2JAQA 4PC7A 1DDGA 2Y6UA 3FX2A 3OZAA 4PRLA 2MYPA 2NPOA 3K9LA 3EZLA 4N82A 4P4NA 2QW0X 3GWZA 3G89A 3L77A 2A1TR 2ACEA 1R10A 2WDZA 4P81A 4RKQA 1VTKA 1QHFA 4A8JB 5LXTB 1AC5A 3M82A 1AHNA 3L9XA 4NU6A 1B6TA 1MXFA 3RVBA 2D2VA 2X6QA 3FOWA 1O54A 2DFTA 3IQZA 5JH7B 3LDAA 4CM4A 3IV6A 1WHSA 2D1RA 4BQIA 1WW8A 3BJIC 3AEKA 3ZNPA 4YVFA 5DNWA 3QOFA 1BKYA 2AOUB 3BK1A 2CXUA 3BRWD 1KVQA 1V8OA 1XI2A 4I6JA 4RY2A 1K7FB 3K20A 2O2SA 1RD4A 1YR6A 1RZVA 3NONA 2WZCA 1E2NA 5EVCA 2J59A 4L5YA 4NZ9A 4CVNA 1L5QA 1K7YA 1XZJA 3AVOA 3COVA 3UJ8A 2IPOA 2W58A 1JALA 4FW9A 5FPTA 3VKFA 2HPHA 5J40A 3OQOA 1XA4A 3AW9A 3CV3A 3M83A 5GM1A 1IPHA 4BJ3A 5F23A 1POXA 1TU0A 1YDHA 5HJEA 1W1IA 1R4NA 3L7NA 4ZAXA 1X7XA 4XLTA 4TVOA 1GZ4A 3RS4A 2J4FA 1XNQB 1O5OA 4C0LA 2HCRA 1EVKA 1K6MA 5JPIA 5D6NA 1EZ1A 4ZN6A 2R87A 2QJOA 3C3WA 3IIEA 4MYTA 1JPUA 3T3GA 1QGUA 4RZHA 1SA0B 3IMEA 3DMPA 2OZVA 3W5DA 3EBLA 1NF9A 1Z2PX 4ZODA 3OFKA 5G2OA 5BMOA 3V46A 3OWXA 4G56A 1Y1SA 2NZWA 3CLUC 1E58A 3O2NA 4Q1FA 2D1SA 2P68A 4KRYA 4BN5A 1MA0A 5HGXA 1MJGM 3EGIA 2GBLC 1PQYA 2PZJA 2X1VA 3RU2A 3ZHXA 2OHJA 1VYHA 2A33A 2E21A 2B92A 2JAPA 4DBLC 1JQKA 2ADMA 3S5UA 1LI4A 1VLJA 1JG1A 4GOXA 4HZUB 3WGLA 4GOJA 2VQ6A 1C1XB 2VWGA 3JQBA 3K92A 4QD3A 4C9BA 4MEJA 3FFTA 2D3WA 5HS4A 3F74A 4N8EA 1P29A 5FI5A 4AWAA 1ELOA 1Z5UA 2H9IA 2UDPA 1EFDN 3EJ6A 4V02A 5KWIA 3E1SA 1G4AE 1OFVA 1SXPA 1FSZA 4G85A 4DANA 4TV9B 3RKRA 3QA3E 2XLBA 4II3A 1GADO 2Q29A 5DGDA 4ZTBA 1CC1S 4FSXA 4TWZA 3A05A 1NRIA 3LKDA 1YS9A 1V1MA 3GMTA 3L6CA 3BL6A 4AYTA 3D1JA 1XRPA 3IILA 1HE1C 1OTYA 4UHFA 4I4TF 2RDMA 4CMIB 4HFRA 3BAZA 1GY8A 3IESA 3KR9A 3NU1A 4PLFA 1BDIA 1XQ1A 3QTTA 1TF2A 2QD5A 3D4PA 4IDAA 5CCDA 5L3SA 4F92B 4MDEA 1G6HA 1O5TA 4YPVA 1BQEA 1P7CA 3D02A 3A1NA 1L1EA 3ESDA 3H5RA 1ORTA 4QG7A 4B6QA 1ICIA 2XDQA 4LGCA 4UE6A 4BMCA 2HT1A 1P80A 1SELA 3R3WA 4X3CA 1UF9A 4JBNA 1Q17A 5E4TA 2X7XA 2B36A 1V5GA 2O2EA 1Y3FE 1DC4A 3FY4A 5KDOA 5B4VA 3L0OA 1NBIA 2Z04A 3MF4A 1JIIA 2B5VA 2H7XA 1CUZA 1SUAA 2MINA 4Q9HA 4D8VA 4P3XA 3U4AA 3M6MD 2KBFA 3HJFA 4JI8B 3B20A 4Y9SA 4FJ2A 2V6BA 1QQ5A 3GIWA 1Q1QA 1ZXLA 1SCKA 1GA6A 1S8FA 4Y7CA 1ZZEA 2ZPTX 3DUFA 3IB6A 1G4UR 4MVJD 3ZI7A 4B4DA 3R0JA 5KCMA 2RGNA 3OIUA 3DLCA 1EFVA 1ZUIA 2HF9A 3N74A 4PM4A 2RGGA 1CUGA 1JUDA 2PGLA 3CZ5A 1BE1A 4MEBA 2VATA 1MABB 2VQDA 3CT4A 4WNCA 4E94A 1DDIA 2AG0A 5CYOA 3GU3A 3GR6A 3A6DA 3LCRA 1QIDA 1AKRA 4L75A 4AU1A 4EFLA 2CLSA 2JS7A 2C9ZA 1HLFA 1A2OA 5AJYA 5AVKA 2XECA 3T5CA 4IV5A 4R16A 5L3SB 2QP3A 2WWRA 4BV3A 2A30A 3JVIA 4P98A 2XUQA 3H9QA 1H2FA 2V8OA 3G17A 2XV1A 4RGBA 1GG8A 1YA4A 5LQKA 3ERCA 3IBYA 2P3OA 5IXJA 1AQJA 1P39A 2CV0A 3KJXA 3FMPB 4K9OA 4F9TA 1JEDA 1M0SA 1R0BA 2W2QA 3F3SA 4Y67A 3RVPA 3SZOA 2VLIA 3K35A 4MR9B 4REQB 4TLEA 2O3UA 3QE0A 3B6JA 4L85A 4ZCLA 4QEZA 1Q83A 5KDDA 2VSXA 3NBFA 1BE6A 4BV2A 1AURA 2OC4A 1NN1A 4YRPA 3MCAA 2ZI4A 3MZ0A 1GCGA 2O4UX 3VU8A 3GRPA 5CB4B 1BC5A 1H05A 2P4SA 2ORIA 2QSYA 4X91A 4CDGA 3AR7A 2P1RA 5KMGA 1SEPA 3A37A 2C2MA 4DLKA 2OBLA 1F51E 1WU7A 3WQRA 4JYMA 4FFNA 1PR3A 3LF1A 4KBFA 4GH5A 3LVRE 3GROA 1NONA 2HA5A 1RTKA 2FZLA 3H5LA 4KO4S 3KZKA 3UFXB 5M7EA 1UZLA 1FTWA 4R54A 1S3IA 1VHWA 2ZSEA 3KZOA 5DWQA 3CC8A 3TZKA 4IJKA 3TW0A 4EGQA 1QYCA 3DMRA 3SOZA 3S4YA 2VJQA 4I5DA 3D7SA 1AXRA 1RZUA 1WNFA 2CLHB 1TZ2A 2H18A 2OGUA 3E81A 3R24A 4QM6A 1BS9A 5DNAA 1PLLA 1TVKA 4DJAA 1ZIYA 3QA9A 3FOAA 4UDYX 1GM5A 4BCCA 5DXAA 2GN6A 1R64A 1UBTS 1XCOA 3ASVA 3UZUA 3BXOA 4F86A 4WBSA 1BMQA 3IQXA 5F5LA 2I54A 4ENSA 3ZJ5A 2DPGA 7MDHA 2AXEA 3DE6X 2ATEA 4D3ZA 4P80A 2YICA 4HLNA 4XD7A 4YIKA 2AJTA 5JMTA 1TEXA 3U0BA 2H4XA 5KOHA 1B76A 3E35A 2DBVO 4GYWA 4JROA 2WD8A 5K05A 1WV0A 3LL7A 1ADCA 3EVFA 3WI7A 4C4TA 4E22A 5ALWA 4S35A 3J81k 2YMPA 5SY4A 4KQEA 3KM0A 1K88A 4CV2A 3IUEA 4RM3A 3R9WA 4HCJA 2XQFA 1CBUA 2FI1A 2ZIWB 4R2JA 1OJLA 4Y8VA 1Z8FA 1BXKA 2PX8A 2I7DA 5B3LA 1KEPA 4MVJA 5AKXA 3K31A 2QROA 2Z1MA 2PZGA 3A32A 5CFZA 4P0PB 4JUFA 2LWIA 4UPVA 4H60A 4KACA 4AIRA 4GQIA 4WAUA 2RAVA 3NI2A 5GIOE 3N2IA 4GMDA 4OP2A 3LOUA 5EP2A 1UEXC 4P31A 4MIYA 5F4ZA 2B34A 3ZNQA 4Q4AB 4MS4A 1QH0A 4RZQA 3JQDA 3FTFA 4JXZA 4BFTA 2LUOA 4XGKA 4RVUA 4WSOA 2PIDA 5F3DA 5CVCA 1EHIA 1DKMA 1PR0A 2FHPA 3EN0A 5DBHX 4D9FA 2QLNA 1LBSA 3Q0EA 2P0YA 3PQ3A 4X92A 5A4FS 2CV2A 5GJBA 3DT9A 4KOEC 2JW5A 1SD2A 3HNRA 3J7TA 4MGZR 3R6GA 3ROGA 2BGTA 1H6BA 1TOAA 4GE0A 4NPHA 1TVCA 1D2GA 3AHHA 3KLPX 3L04A 2HRZA 1ZA1A 3T8YA 4F4FA 1IE3A 3EGXA 3OA2A 3ANNA 1G2IA 1WVMA 3AR2A 4PRKA 5EJ2A 1VPWA 2RJ3A 3C48A 5H8WA 4JC8A 4PHGA 3KSZO 4M9UA 4WOPA 1DJPA 4BXOB 4FFLA 3P4UA 4Q1DA 1Z6ZA 3TD6A 5AXAA 1IN5A 5BWOA 1ZEMA 3CBQA 3F6YA 2FPXA 2MYTA 1JN0A 2P2LA 2Q45A 4W7SA 4O33A 4X00A 3ZWPA 2JVIA 1WUHS 5BN5B 3LM8A 4F12A 2XDWA 5FUQA 3FPEA 4DHWA 1YS2X 3PHLA 3T7KA 5IC5A 2UZIR 3THSA 1HE8B 4BQSA 4KZKA 1MHTA 1SZDA 3DWGA 1NSYA 4RFLA 1BX0A 1XBTA 4LMBA 4YJGB 1YJCA 4AZ3A 4BVBA 3EZXA 5FLYA 3CEHA 4PPGA 3I5MA 5EKUA 2V7BA 3IP8A 2QMYA 1D6NA 1PDWA 3PNBA 1T3HA 3QXXA 3CF2A 4YR7A 1JLHA 3ER8A 3QU2A 3VZBA 5C1OA 1HM5A 1KIAA 4EGCB 3EC1A 5CLQA 3C87A 1P17A 3GZNA 4H1HA 2AD5A 1BVYF 1KPIA 3UPUA 3Q6IA 2XOXA 1CUBA 1MP0A 3ZDYB 1NY5A 3EDYA 2BMAA 3KOYA 4FE7A 2ZREA 5EWLB 2NYAA 2GCPA 4KB5A 5F1PA 1Z4QA 2ZAIA 4Y9DA 4A5OA 1ICEA 1SQ6A 1CKEA 2D2XA 1ORHA 4A16A 1HTWA 4G5QA 5EXSA 3BMOA 3GP5A 2JFWA 3K72B 3T7IA 3WXBA 2ON6A 4U3JB 4XR4A 1DP4A 1V43A 4JODA 2Z2YA 1CEXA 4CM9D 2QPOA 3VNVA 1EFTA 2ZTMA 3FMGA 3SX0A 1H3FA 3PGA1 3RK0A 2ABWA 2R4QA 4L1KA 1AIPA 3LBAA 4DG5A 2R5NA 2ZJ6A 3JWGA 2O57A 3TTTA 2C7RA 2EJTA 2V1UA 5CXUA 3FUCA 3MBOA 4ZVPA 3AK4A 1JU9A 1MAVA 1ZLXA 2PH5A 3CKKA 2O2DA 1PJTA 1RHKA 1QTIA 1CQWA 1JDNA 1JQEA 3NTXA 3QU5A 5EKDA 1CRQA 4YWJA 5TXGA 1PUIA 5K3CA 2HUPA 5B58C 3FPLA 4H0FA 3EG9B 3ASZA 4OJMX 4MS3A 2ZP1A 2XEDA 2JFHA 4G1UC 4Z1MD 3VZRA 4DAOA 5JMOA 1UZMA 1TA0A 4JSTA 1R88A 3ZE6A 3WLFA 2PT6A 4ZO4A 3U40A 2LGJA 3L1HA 4C4RA 1XTUA 4YUAA 5HFJA 2IC5A 5JPCA 2GCEA 5JI2E 2PSDA 4OH1A 2UYOA 4B3GA 1I80A 4M1TA 3GEDA 3WGHA 4C01A 2BDTA 3QEMA 3PS9A 3FBGA 4WBNA 5TQ0B 5BWCA 2I9PA 3G5LA 5FBVB 2IITA 5IDXA 2WUFA 2QRUA 2V3WA 2X41A 3CLKA 4I3HA 5FOSA 3IVRA 1B0AA 1WQ1R 1C3EA 1K68A 3I2KA 2X1MA 3WGKA 3HV0A 1VL2A 1Z29A 1NDQA 3HUEA 5F3RA 3W2HA 3AVWA 2GAFA 4G5YA 1KOJA 4XWAA 5ALJA 4DCMA 2XXAA 5GP1A 3LT0A 1JI0A 1SO8A 3EEYA 1OFIA 4EB0A 1G20A 3PYMA 4X93A 4TL9A 1TPYA 4AULA 4W1SA 2RK3A 4QEDA 2C96A 3TSCA 1XWIA 1ODCA 3NVMB 1P4RA 4XR9A 5G40A 3PXGA 2Q5LA 4C0WA 4ESHA 1D9XA 2XUIA 3LX5A 1VKZA 4YMVA 1L5HA 1V3TA 3O3CA 5ERGB 3OFSA 5B57C 2D8MA 3WGNA 4TMXA 4LQCA 4YBRA 5CJJA 3RIHA 1E1RD 3GO4A 4KNVA 1P19A 1GGVA 1PV4A 3F6SA 1Z3IX 4D9KA 3AWDA 1COZA 2PR2A 5DHPA 5EKSA 3R74A 4A8HA 2D1YA 5KPJA 2VWHA 4PZZA 4TUYF 2BFFA 2VHVA 1GPYA 1PW7A 4XZ3A 4MWGA 5ES4B 3CNEA 4ZALA 3D8UA 2OV4A 1QH8B 4QUGA 2ZOSA 5IHPA 3OZCA 3D7KA 2J67A 2QJWA 4HLQB 3SM9A 2G7ZA 3G6KA 4B45A 4Z3OA 2O8DA 1PT7A 2H48A 1QFZA 4L6CA 4TKLA 2XKBA 1PHPA 3LUCA 1W88A 5FWNA 1ECLA 10MHA 4L27A 3JYLA 1CZKA 2PWZA 3W9SA 1FFXB 3O9VA 1PWXA 2WFMA 4YRNA 3WOVA 1CJMA 1SXIA 2IXEA 3KT6A 3F4BA 2VHJA 1TCCA 3ZJYA 5DHQA 2RK4A 1FSGA 2OOKA 3HB1A 3HDTA 4YLEA 1AKWA 5LB2A 3W06A 1XD9A 1V6CA 4MPPA 1NULA 4WKPA 1F1JA 1VECA 2JD1A 2VXBA 2AXQA 2WA1A 3OG9A 4AJEA 4NCXA 4XSVA 4BO7A 3VNQA 4EY6A 3QFRA 2Q8NA 4PU0A 2OMEA 4NAUA 3L7OA 3WBKA 3DV2A 1QXSA 2JLXA 4M1YA 4RVSA 3E7FA 5ECGC 2XE8A 2GT1A 4NL4H 4OLAA 3IVCA 1SUBA 3IPRA 3MINB 3JQRA 5CT6A 3ZCTA 4BU1A 4EHHA 4GFDA 4MUJA 2YWEA 4IVQA 2QTGA 3VSCA 3RBXA 1KVTA 1G42A 1IC6A 3N3AC 4UOQA 4TZKA 1ONOA 1S1MA 1KZYC 2Q0QA 1VMEA 3I6BA 1MDBA 3MEQA 3LLVA 3CONA 4UMDA 3GDWA 2F3QA 3NC1C 2TYSB 2CXNA 4RZ2A 2GNAA 3C6ZA 3IEUA 2CJYA 3R5SA 3GZJA 1WDWB 3LT4A 2V8BA 1EGHA 4L3OA 3O3NB 5EP4A 3SIRA 3GJYA 2GLXA 4KO2S 1H0RA 1GTMA 1LPPA 2NZXA 3IQEA 3ED5A 4CEHA 4LXQA 4P0TA 2W48A 4MVJI 4YXWA 2R8YA 4QBFA 2Y4NA 4MI6A 4Z4IA 3C1UA 3ZZ0A 3WQHA 4DJFC 4BQQA 3FA2A 2QLTA 1SNYA 2BE9A 2QMUA 3MFQA 4X41A 3UMCA 4B4VA 3AY6A 3UJCA 2AN3A 1FBTA 2PM8A 3A2KA 1U1DA 3GJRA 3PEEA 2E55A 3A11A 4FHDA 2QENA 4E11A 4G0VA 1OT5A 3K4PA 2AZXA 4CEJA 1J97A 4MJXA 3HWX1 3W9BA 3JD2A 4IL5A 1Y37A 1U0BB 5IYZF 4ECEA 4BLRA 4F2DA 3EULA 1U31A 2AA3A 2SCUB 2D5IA 2JKYA 2QA5A 3B8HA 4C2BA 1C30A 5GOZA 3IA7A 4Q1VA 1DIRA 2X5OA 2NVUB 1YDFA 2OBXA 1GTZA 4BAZA 3IOYA 1X1EA 1OLUA 1VSUA 4LJ5A 5KTRA 3TZ6A 3BG5A 3ONEA 1MN6A 2GM9A 3GJ7A 4H4EA 3TUJC 2ECKA 3IMCA 2OOSA 1O58A 2GEVA 2XR1A 3CWZA 4BAUA 1E6KA 1BS1A 4S1NA 1KOGA 3ZWVA 3T1YB 4YTEA 1J90A 3DWIA 1IONA 2QPLA 4HDAA 3QFSA 1QOZA 4KQFA 1TYDE 5FWXB 3QXCA 3QIVA 1XXHB 1LDYA 2NZYA 1KGSA 3O8LA 1CZRA 3BEDA 4HUTA 1W5BA 2FR8C 1U1FA 2E3JA 2QVGA 3EXFB 2YY7A 4MINA 4LHXA 5ALTA 3STUA 1P6UA 4TZ6A 1ZK4A 4U9HS 1K9SA 2F1KA 4MYCA 1V8FA 4RLFA 2XKAA 5IBQA 1N2BA 3LC1O 3NBMA 3WV4A 5L3VA 5T7BA 5AKIA 3VO9A 3VPFA 4CF7A 1Y1QA 4YJGA 4IJMA 2IXFA 3ZV5A 4COOA 2G36A 4XRRA 4CU2A 4JL5A 2ZVPX 1TL7C 4N6NA 3S5JA 3BREA 4BO8A 1TQ8A 2OZLB 1PL8A 2J6BA 5IDYA 4GBGA 1C9EA 4OI2A 1H8HA 3DE3X 3Q0IA 4UBLA 5JS2A 1LNSA 2FMHA 4DWOA 2VAWA 1W4ZA 2PWYA 4CT5A 1M0EA 1UFOA 2AI1A 1ZD1A 1CP2A 3CLSD 1G7CA 1WCIA 3BMXA 3OTHA 3H13A 5JNLA 1EK2A 1O77A 2OXRA 1G7TA 2HBRA 4FMDB 1UK7A 5IM4A 3MJTA 2CKMA 4U5QA 3QXSA 1PG2A 5TGDA 2HOQA 2N0SA 3NETA 1X1RA 3AZQA 2IV3A 3UATA 1KPHA 5KX5B 2V0GA 2I3AA 3SR4A 2I1QA 2Y77A 1UPAA 1T2VA 3SQOA 1I3MA 1ACJA 3L7LA 4ML3A 1IJBA 1MPTA 1UFQA 2KLBA 2QK4A 5DCYA 1ZAYA 5A3JA 2NV0A 2XMRA 4HZUA 2VJPA 1ZUHA 4RK5A 3DV0A 3E03A 2OHHA 3JQAA 1QHXA 3CNLA 3O4GA 4ECAA 3JQFC 5IJWA 3NASA 4CG1A 3LY9A 4FDUA 5ECDA 1M0TA 4U4AA 1ZIOA 3PC2A 5I4BA 5G1OA 1DX4A 3MBKA 4REQA 3UA3A 1P4HA 1A50B 3ANTA 4C30A 4WESA 3RM3A 3ZOKA 1N2HA 2XX3A 1RHUA 4QM7A 1SUSA 1M1YA 4QPNA 4Z9BA 1WB9A 1ISHA 2NUAA 5IBPA 4PZ9A 5E1DA 3ZW8A 5HF6A 2OCXA 3KXIA 1EK1A 3EIFA 3NJ8A 1F2VA 3DCNA 4V0LA 3A7EA 1FRVA 4FQ8A 5BOVA 1JSCA 2I2BA 3X2EA 5AKKA 3QEMB 3OJ0A 1GDDA 3CSSA 4OJYA 1UDAA 1VL5A 3ZKWB 1C7EA 2WIGA 3AYXB 5GV8A 2ILTA 4P8RA 4WN3A 1YOVB 4R81A 4RVFA 4L8LA 2ZSJA 2V03A 2ROQA 1O9BA 2WAXA 1FP6A 4M4SA 3BBLA 4GKJB 4B74A 1B0ZA 4YRBA 2ZYSA 4PO9A 1JB9A 3HL0A 5AHOA 4DIEA 4TS9A 4ESEA 1PKEA 3IT1A 1GG2A 1K3UB 1MAWA 4BLVA 3ZE2B 4Q03A 2PZEA 2OV1A 4ZOBA 3N7AA 4C0BA 4J16C 3FVTA 1G60A 1U1EA 1W94A 2ZYVX 2YN4A 4K9KA 4EZEA 1QRRA 1CB0A 4QUIA 2FY8A 3THYA 2VHYA 4AX8A 3EH2A 2BGJA 1YBVA 2C9DA 1NA5A 3CIOA 2FW6A 4WA8A 2QZZA 3LX6A 4IUYA 3MN1A 4LWPA 3OTQA 3RSCA 3OE7A 3B6MA 1JEEA 4Q4JA 1PI3A 2Q46A 3AF0A 4NJEB 4IJVA 5L95A 1U2DA 2VYVA 1CUCA 4LVNA 4EG6A 2ZJFA 3DZJA 4FVTA 1HT3A 1WCWA 3DQPA 3TSZA 2BFFB 1D2RA 4RNCA 1SN7A 4D4HA 3LC7O 1ZHFA 2I8LA 2NQ8A 2WDPA 1W8DA 3UPDA 1MR3F 4R8MA 1Z9BA 1Z6GA 3W2EA 3O83A 1Z45A 3EVNA 4DEYA 1QPBA 4LE0A 4X95A 1LUAA 3JD3A 4DSAA 1IVSA 2JLWA 1RKVA 3WDMA 4M46A 3IV9A 4AO8A 4LZAA 1GZDA 1IUKA 3OMXA 3L7KA 3U44B 1D4OA 3JAWB 5BSKA 4YJHA 4Q9AA 5DCLA 2ZIZA 2BGMA 2ID7A 4GOLD 4LE2A 2M9MA 4U6NA 1M8FA 1OFHA 3K0CA 4P3OA 4BVLA 4C0HA 2ZANA 2QNIA 3G9UA 2OORC 4ZU6X 4Q4AA 3BH0A 5EOVA 1ITZA 4D43A 4KXXA 3OFJA 4BKQA 1I7LA 4UVDA 1QCZA 2R2AA 2ZR9A 4ZYWA 5CLGA 2YL2A 3M3HA 2VSNA 3PKZA 2IZ7A 3WNZA 4ND7A 1ZD4A 1EGQA 1H6AA 2LVBA 2VPIA 4O1IA 1FUKA 1WBDA 3JQGA 4OMDA 1MCZA 5D87A 5JCOA 3SC3A 2FOLA 4JAVC 2WUGA 3GK3A 2ZTHA 4WI1A 2A4KA 5TS3A 1WUTA 3D5TA 1O8CA 1AQNA 1DX6A 4WOKA 4QDOA 3UENA 3YASA 1SQFA 4CIBA 3BKWA 4RMIA 3BDAA 4KAJA 1K08A 4D2IA 2NSHA 2IDMA 4LXXA 4Q3BA 4R8RA 2ZTSA 2EJWA 1Z2NX 3QGMA 4CTOA 5IJ9A 1M0WA 4O2BF 3VC3A 1QX4A 1P9LA 1UKZA 5FUBA 3VNAA 4WACA 2WYOA 2Q50A 2Z3ZA 1Y4ZA 4I8DA 3E3NA 3MAAC 3TMAA 2AQ8A 2WFLA 5C1PA 1XDBA 2GCNA 3BXHA 4KXUA 4QELA 2HPVA 13PKA 5ER9A 4Z8XA 1QH1A 1KNXA 4ABYA 1B0PA 2R44A 3C8ZA 3TEMA 1P0PA 3IX7A 4MDHA 4ZI7A 2V7PA 2J33A 3GCGA 2RH5A 3GDOA 4UHEA 4ZEXA 3T5MA 2HQRA 2OGWA 3V3KA 1RI3A 3DB1A 3ND7A 1L4KA 1UKVY 4FE4A 4Y2RA 3VR3A 4BMXA 5JDIC 1PZNA 3I5XA 3PP8A 4F2GA 4KDCA 4FOLA 1HWYA 1RJGA 2PNJA 1UC4B 3OLQA 5D3ZA 1UBLS 5HA5A 4BO2A 5F9FA 1A2KC 1W85A 3V33A 4EECA 2WIFA 1RPAA 3F71A 4XJTA 1WDMA 4OYLA 1T6BY 4UNPA 3TZQA 5SZKB 3REQA 2JA1A 3INTA 1KI1A 3F5QA 2WJYA 1U9JA 2VVTA 4ZOEA 5EWMA 1B6RA 1EFKA 1Z17A 3Q40A 4PYOA 5DMHA 1N6RA 1TKCA 4QXPA 2P9TA 5AM2A 2C1XA 4X1IB 1E2FA 4Z0PA 1FDVA 2XMDA 4Z9XA 4NFHA 2FV8A 3JALA 3OQIA 4F1WA 4PCLA 2VQSA 1Z0KA 2GLTA 4V0KA 3SR0A 5CAEA 2CDBA 4Z5XA 5B3JC 1ORVA 1Z5OA 1M1YE 4LVCA 1REQB 5JSYA 1I94B 5CTJA 4GDFA 2ZBUA 1XMPA 2YV4A 4HYYA 3SSOA 4MJ3A 3UHOA 5BW5A 2R47A 5BURA 5EUCA 2DE0X 5BN4A 1R8XA 4PTYA 4RIHA 1GILA 1IYZA 3ES9A 4I19A 1CIJA 2LIVA 2HZBA 3BEOA 4BMSA 3F6RA 1XEFA 1NF8A 1U3DA 2HMYB 2IY8A 3ZGYA 3CVJA 3PFWO 1QHEA 3L7BA 2COUA 1YFLA 3IQFA 3KLBA 3ZY3A 1M7GA 3FNHA 3IE1A 4WINA 2FRXA 3WGYA 2VH1A 1CIVA 3R3SA 2QRPA 1K98A 3G5AA 4GPAA 4NBKA 3NAGA 2GJAA 1WW2A 1WXFA 4K40A 1ID8A 4CN9A 1OGYA 2IIBA 2JGDB 1EK0A 3D8SA 2NO0A 1NZFA 1QDUA 1D4ZA 1M6EX 1ODTC 2GAIA 3HC7A 3IXQA 3K0EA 3KEFA 2HF2A 2BEUB 3O82A 4MSUA 3KV3O 3LQKA 1RBZA 3F3KA 3RRFA 2XXAB 1E94E 5G53C 4MARA 3CNBA 4C2AA 5J4YA 3ZYZA 1WHTA 2FSFA 5DM2A 3WADA 2GS9A 1EFPB 1HLGA 3KKQA 1YU6A 1DRKA 1QIHA 2B25A 2I4NA 4L78A 4BGVA 3BGIA 2C83A 2JJ1D 1CUIA 1RYZA 1Z2AA 3F96A 3HB7A 1DQZA 4H4CA 5FXMA 3NX4A 5EQTA 2EZUA 3M1LA 2NO6A 4JU9A 2WABA 1RWMA 1QLHA 1QZTA 4ZEMA 5KNBA 4IO1A 2CV1A 1Y1LA 3BGSA 1ULHA 1REQA 1ONPA 3DVQX 3KS9A 2IOHA 3QOXA 2WK1A 1D4AA 3MLBA 4G0PA 4KIUA 4KK3A 4XQEA 4TYQA 3GMIA 5EFOA 3W04A 2RC5A 1KAQA 3Q4GA 1QH8A 1TIPA 1ZRNA 3WLOA 5BRJA 2PS1A 5KJCA 1K7EB 1JXMA 1KI7A 2AT1A 1DE0A 1N6KA 4JCOA 4S0ZA 4KPEC 3U7FB 3HO6A 2BFMA 2O3SA 3GH1A 3C3AA 4FEEA 2RGBA 4BO9A 3ADCA 4GP7A 4B75A 1V9CA 1X14A 1Z35A 4N3NA 4QQRA 2JIQA 3MTJA 1P0IA 1PSZA 2PCJA 2HM7A 1I1QB 3JQFA 2DGDA 2ZBVA 4EY8A 5FJIA 4DM7A 5EN4A 2GK6A 4CKEA 2H2GA 1DJOA 1MVNA 3G85A 4ZWNA 2QN9A 3AKZA 3NWBA 1RNLA 5K0TA 4PZYA 1Y6RA 4LG1A 3T5GA 1YU9A 2D5LA 1NLFA 1OKKA 2FN4A 3LHDA 4KWCA 3B1XA 2FTKE 3IURA 2ZTLA 2NYUA 3HYRA 3LUGA 4M0UA 1AU9A 1X39A 4RD1A 2DULA 3FFBA 3SFTA 4IXTA 5EZYB 4UW9A 5AVQA 4ZHSA 3DNPA 3GRFA 1FJGB 1CUWA 3MJVA 4IFEA 1W6UA 2RHGB 1JKIA 2YJTD 5LNK1 2ZJBA 3CE9A 4J91A 2MSLA 1Q77A 1U0EA 1R5BA 1RLOA 3CM0A 3N2NA 1P3Y1 2VLBA 3QIAA 3H2SA 2HQ1A 3LHIA 2AH5A 5AXDA 3KJGA 4E08A 3EDOA 2DQ4A 3EBPA 1R6DA 4FCVA 1QCCA 4X71A 5IT0A 3EQ6A 2FHSA 1IN8A 3FLMA 1GL9B 3G7UA 3ZWBA 1RHQA 2RAUA 1LV7A 4REMA 3UICA 4CEHB 5TMBA 3W5AA 1PFVA 4XWYA 3JAWA 1QB8A 3R5HA 5L6LB 3U81A 2WLTA 5BR4A 3GPIA 1ZM7A 3MTIA 1Z08A 4UQOA 1NJ1A 1AMNA 3UKDA 2B7CA 3TKAA 5BWMA 4FHCA 2GWHA 2X3UA 1NVWQ 1NT2A 2TRSB 4JS0A 1VCMA 4LDNA 4RQAA 4PPQA 5LQSA 3WX0A 2RAPA 4Z7JA 1YMQA 2AC7A 4B3BA 1NF3A 3SCZA 2NX2A 3A4VA 3TYXA 1E1YA 4NK5A 4X6UA 1OBOA 4PFJA 5IU6A 2CJFA 2WSBA 2EP5A 1C8LA 4GNKA 1IDN1 4HH1A 5E7MA 3VSDA 4CKWB 3RAGA 3RI3A 1JIUA 3HE3A 3QKTA 3QPDA 3I9V6 4WNIA 3TSYA 1Y48E 5DLPA 5C31A 3NVDA 1RLIA 4W5RA 3FSJX 4WKNA 4W5TA 1THMA 2Y27A 1F12A 2GCGA 3BX1A 3GEHA 1PV1A 3LHKA 4RW0A 2UVQA 3GLTA 3JTMA 1NP7A 2OXEA 4HPJB 4BYGA 2ZCVA 5LMZA 2JLYA 3LUAA 5MDHA 2Z58A 4FBLA 4AZTA 1L9KA 3FCOA 4MIEA 4FS3A 4FHEA 1DINA 2H57A 3UK7A 4LEIA 4CMEA 5GTDA 3DD5A 2Q9UA 4PV7A 2H2HA 3TQIA 2QQ5A 1EDEA 2XUAA 2VXYA 5IEBA 3FOBA 1JG4A 2VHCA 3AHGA 3N8DA 1W88B 4PYKA 1BGWA 3OPQA 2IHKA 3QENA 5FUMA 4WEQA 4R0MA 1M5UA 3KKOA 1XT6A 5I7UA 3VNSA 5KQSA 5FULA 4HDRA 5TARA 3LKBA 1JHZA 3JYNA 4GT1A 4LCBA 1O0SA 5LMNB 3OICA 3AL0C 4UTRA 1WLYA 3QFCA 4V0ME 1Q95A 1UKYA 1G5IA 1WLSA 2OZLA 4NZPA 5BUZA 1CRPA 1KY4A 2V6IA 5HM6A 3TX6A 2QZJA 4R9VA 5KIAA 3TZEA 1ULTA 3H6KA 1YZKA 1CQXA 5EIFA 2WT9A 1EAMA 5KJ1A 1NUSA 4YDHB 1R66A 2JIPA 5A7FA 2TECE 4P4UA 4MOWA 3QW4B 1HYBA 4JI0B 5CBPA 1FRFS 2ZUSA 3NYRA 3NFRA 5FUWA 2IHYA 2CNBA 1CY1A 1F5NA 4Q3OA 4ZCRA 1T43A 2C00A 3D5QA 3Q3IA 3OOYA 4KREA 3C43A 3G3EA 5BVHB 3G2IA 5DN6A 3LK6A 2N42A 4A0QA 2DB3A 3HFJA 3I8OA 3AEQA 5E2BA 3QRWA 1X0VA 4MWDA 2HJGA 1S8AA 4N6GA 2ZJ1A 3KV1A 3OJXA 1G8FA 5EJ7A 4J2TA 1R74A 1Q2UA 1YONA 1AQIA 5ADWA 1XMXA 5KEIA 5LYYA 4UAJA 3ZJVA 1L5YA 1UZAA 3N2EA 2XMPA 5E4JA 2G63A 4PYIA 5FD8A 3WDSA 2X4GA 4AMVA 2O8FA 3JR7A 3V8PA 4EARA 3HPQA 2X15A 1HSOA 3BXEA 2J9XB 2B4YA 3OEHD 1FPMA 1KBOA 3MQ2A 1OD6A 3FG9A 2DWOA 2H1IA 4IUBS 3WMXA 2VDWA 1EFRA 4N5MA 4WK0B 4UM9D 1EDBA 1Z22A 3ZWAA 3QX8A 1EVZA 1LF5A 4Q7EA 1RI2A 2R25B 2WYWA 1MPXA 2G0NA 1SXJB 4H7IA 4JLNA 2ZB8A 3BSFA 1W36B 1U2TA 3PRKE 4FFDA 5HHTA 5J4KA 2CUKA 3AEZA 2HWUA 4R40A 1JB1A 2IYYA 3M6FA 2R5FA 3MVEA 2BDUA 1S8OA 3NWOA 1TMKA 3OEWA 2HMTA 2D5CA 5HIJA 4B8YA 2AZ4A 3IAS6 4QXQA 4OQEA 5G4KA 4QDZA 5EQJB 3EZ2A 2GN8A 2UU9B 3TQSA 3LYLA 5KJFA 1N2SA 2VYND 3DZKA 4EGJA 5AW9A 1WBJB 2P11A 3VPGA 4MQ6A 5AI5A 3PKIA 5BXQC 5JAIA 2HQBA 5DOZA 5E7JA 4JC0A 1FQJA 3LBIA 1O94C 3EPPA 3RUIA 4MR8B 1VMDA 3DEAA 2BH9A 2YIDA 3S0JA 4QFDA 4M7RA 3SN6A 3FUXA 3GUHA 2WW8A 4H1VA 2E4VA 1I5EA 3QJ5A 2FN9A 3ZBUA 1ZRHA 1MBZA 4KYVA 5F33A 1VCOA 1W87A 5C8ZA 2PLWA 2PGJA 4CEIA 4KQWA 3WGUA 1E7RA 1HUQA 2YJ4A 4IDPA 2A9FA 5I47A 4AXBA 3IDSA 1YACA 3DFZA 3DT8A 4GEKA 4MQ4A 1UBSB 3SC6A 4B46A 1U7PA 1Z0JA 1S2LA 3RSGA 1L8QA 3HN7A 2R6R1 3UG6A 5LD2C 1FEZA 2FPPB 1VPEA 3CEAA 3DPSA 3FSEA 3ORHA 1SD1A 3N75A 1DQPA 4K03A 3ODPA 1N3YA 4KGVA 5DHUA 1JDBB 4KO1S 1MTOA 2P9YA 2OK8A 3I4FA 1S2MA 3UJHA 5HJ7A 4ND6A 1NN5A 1A72A 3FHLA 4PG6A 4XGNA 2QUJA 4JNKA 4K9MA 2BFOA 3QQ5A 2V3CC 2NO1A 3TZBA 4DIFA 5K8TA 1YT5A 2CWDA 3B85A 1U8UA 2ALJA 3RHZA 3HDYA 4OOFA 4OREX 3LNTA 5HUQA 3LHFA 3GRRA 2NPFA 4BQOA 4DLZA 2PUAA 2CNLA 4QRIA 1R6XA 4II2A 1UMCA 5IH7A 4R3WA 3DYIA 3DMNA 3REOA 2IY7A 4DQXA 1EUYA 3DOEA 3QYPA 1QYDA 1RBQA 2GXUA 1BE8A 1T2FA 1ISRA 2A0FA 2B8NA 3PQFA 4A03A 1QQ7A 3HXKA 4EO7A 4J0CA 3BORA 2CF6A 1L7XA 2QV0A 3HZOA 1NVTA 3LNCA 3O9ZA 4OI1A 4C4SA 2ZRBA 4WESB 4DCGA 2D4HA 1GAJA 2IU0A 3ZXSA 4JKIA 4B7AA 1NLZA 2B98A 1POWA 3LCJA 4KQIA 2M6RA 4XQ0A 3EGDB 3C7TA 1U81A 3EC2A 1OILA 1R8YA 1O4WA 3KLMX 1E89A 4CFYA 3UWDA 1FZTA 4DDWA 2R9VA 4AJ4A 4HF7A 4OSEA 4C0KA 1L7NA 1RXSA 1MU0A 2CDCA 1BXRA 1JWBB 3C3EA 3SDBA 3K9CA 1P72A 4PFQA 5CVEA 4PIPA 3N2KA 2UYCA 4XYEA 3G0GA 5H83A 4Y6RA 4AT1A 3DUFB 1F7VA 3THWA 1EQ2A 4B7UA 1LRKA 1IHUA 2HXYA 2EIXA 2QRLA 4K2HA 5EA2A 3U1TA 3LUDA 3IMFA 4D0RA 4LC0A 3WK8A 3CWCA 3IJ5A 2F6RA 2GPJA 1JBEA 3DVAA 1IWPB 4RJKA 2GFHA 3UF0A 3LBYA 3P2EA 4P7FA 4AJJA 2C7VA 4RZ3A 4D9GA 4K28A 4MYRA 3NORA 3WISA 4KYUA 1ZN7A 1WVGA 4JI5B 5BNFA 4IWYA 2WPDA 5CT5A 2GF2A 2GZ1A 2XRZA 3IOCA 3VVLA 1RVV1 3Q7RA 3HDHA 2W6MA 4AY3A 2Z5LA 1P62B 2WTBA 3AG5A 4C89A 4IIGA 2XRYA 4QNRA 1CJKC 1U2EA 4C7XA 4G5FA 5BN3A 2IHZA 4CW7A 1SVLA 1S2GA 1TX4B 3WVNA 3I0ZA 2YN0A 3E5MA 1PZEA 5DYTA 2IKQA 4HSEA 3VOBA 3G8BA 2DFPA 1L4EA 1M34A 3EGDA 5DF1A 5CLJA 2PT7A 5CA1F 5B53A 1KMQA 3E9CA 4EG1A 1P8JA 4K46A 1YS1X 5CX1B 3L1VA 5KOYA 2DPLA 3E23A 5F9HA 1Q7TA 3P0JA 1IRXA 3DYVA 4RH1A 2I62A 1Y8AA 5E9WA 1YJ8A 5EIAA 1E8DA 1OGIA 2AG6A 2FWAA 3ZXXA 1O9GA 1F60A 5KVQA 2OGSA 2ZQ5A 3REGA 1TE2A 4I1RA 3R3YA 4QPJC 4TLDA 2LD4A 3PXEA 3ORSA 3U4GA 3ZWYA 2C7OA 3IMGA 3VJKA 5D51S 1YI0A 4JYAB 2NMVA 2FZGA 2JFNA 4H7DA 1UANA 1CRLA 4TSFA 1A27A 3SYRA 5ESDA 2FW0A 4GEGA 2AHOA 2RGDA 4BZQA 2W43A 3F5FA 1AUQA 1BS2A 3JQCA 4WLVA 1MXHA 1NBOA 2HV8A 5G0SA 1ZNYA 5CXXA 1P0MA 3JQ7A 2ESRA 1CWUA 1NWCA 3QXHA 4MW2A 2XHEA 2CUZA 1GCUA 1JDZA 2A1UB 4MKRA 5I4CA 1IIBA 4IGAA 1A7AA 4S3MA 1MG5A 3L8HA 4KMSA 1OXUA 1ANKA 1P73A 1PD1A 3WIVA 1XHLA 1CF4A 1ZZGA 4OK6A 4YDSA 2G06A 5IMBA 3I5UA 1N6LA 5EHGA 4DQDA 2BSQA 1NJ2A 1M74A 4GZ6A 4W9MC 3TUIC 4P4LA 2GRAA 3ZE9A 3WKDA 4I50F 1C1XA 3TR5A 1EP3B 3ZOZA 3VTKA 2VNSA 4E7PA 3Q87B 5JZ9A 1CD5A 5TMPA 2XGOA 4IDQA 4L28A 3G0IA 1NBWB 2JVKA 4JGGA 4QJBA 3HSSA 5H0IA 1ZUD1 3EMBA 3SEFA 3NTOA 3NYQA 2XMCA 4J0IA 4HDCA 3F2IA 4PY2A 1C9MA 1ECBA 5AR1A 3GJTA 5JJ5A 3U4MA 2VIIA 2VDWB 2A0YA 1UH5A 3ROQA 1I1HA 4RWZA 5BR8B 4RTSA 3NATA 4M54A 3C15C 1E5DA 1W35A 5CFMA 1IJEA 3RSFA 4R1UA 1D1SA 4ENQA 3AXTA 3LLUA 2ZB7A 4KNWA 2P9EA 1MW8X 4EP1A 4ZT7A 4Z54A 5KJ6A 1QOQB 4KVZA 4LJ4A 1GRNA 2MSCB 1LNQA 2K7FA 2AOWA 1ZMOA 4R1QA 1JPJA 3IP5A 5EFZA 4IAOA 4ZOLF 3IO3A 4E5KA 2KPOA 2QP9X 4NIMA 1XYYA 2PZ8A 4ZGGA 3D43A 4M1OA 4ND5A 1JDJA 1MZVA 5LLTA 4EABA 2ZRAA 4RKRA 4GBMA 2B7BA 1SB9A 3RFXA 4Z4CA 2PZLA 4L3WA 5DI3A 3CUYA 1MB0A 5L53A 1C50A 5A9SB 2GTIA 1ZK1A 2QD4A 4H7FA 3BXZA 4HR7A 4S0XA 1QO7A 3GNLA 4TTRA 4D9MA 3CX7A 4FCWA 2WNHA 4OQYA 4HVTA 3SHQA 2ZRIA 1DZ3A 1T8SA 3A3NA 2OLKA 2NNLD 1YVPA 1ODKA 3G68A 4CL3A 5I7WA 1ONNA 3DBHB 2PT5A 3BAFA 4TTSA 2P8JA 4H6PA 3HBMA 4EEXA 4RQBA 1TLFA 2BR4A 4YUWA 3BK2A 1ES9A 2YBEA 5AT1A 4Y9RA 3SY8A 4FYWA 3HR8A 1T8WA 1P5ZB 1TCVA 4XTCS 1ETUA 4Y6GB 1KZ4A 4FNOA 3ZV3A 3CXRA 5A5GA 3GIDA 1MMFB 1ADBA 1ODIA 1SOVA 1YJQA 3QQPA 3UB4A 3GFPA 1DV2A 3TOSA 5MFPA 1UJBA 4TUYA 2V7GA 5DNEA 2J5RA 4N3BA 3MJ4A 4Y1RB 1E4EB 3B3GA 1RXCA 1J8MF 4D45A 1Q7CA 3I9JA 4R69A 2H1CA 4R5MA 4WCFC 1VSQA 2I4OA 5CLLA 2HD4A 4EJ0A 3FOFC 4MAFA 3R8CA 3M34A 3F8SA 1AUVA 3HP4A 3ILYA 2B8JA 1GD1O 4KX3A 4PGMA 5DNCA 1T2EA 2X8JA 1F9AA 1C7JA 4AWXA 5B3KA 2W2OA 3LPMA 1C4KA 3EASA 4OH7A 3W6OA 2Q4DA 3RBZA 3Q8KA 4NABA 4JEIA 4QHTA 5H02A 3U7QA 3IUBA 4R98A 2CJWA 4N76A 4D4IA 3PI7A 5THKA 4HL6A 1T4MA 3QVKA 4TKMA 2BBSA 2CK3A 3NS7A 3NNNA 1XE3A 1E6LA 4OU5A 2WV9A 2R65A 4RTOA 1V41E 3FI9A 1GFZA 2WSMA 1A88A 4FKZA 1JU4A 1H0SA 4G86A 4GGMX 4XWTA 1NXPA 2GHRA 2IYEA 3S8EA 2MT9A 2W0SA 2WJGA 3MB5A 5E3HA 5IYZA 4DV1B 4G26A 1KP3A 3WAGA 4R1PA 3AP2A 4JUIA 1U98A 1P9WA 3PQ2A 4ZANA 5BW8A 9LDBA 1TZKA 4HNUA 2V97A 3L1UA 1XPRA 1SKQA 1K6JA 2VF5X 2F48A 3DPIA 1BVUA 2VCHA 3K32A 1DOHA 3L8YA 4HGYA 3K2EA 3KHTA 4RE6A 5A3QA 1ZGHA 1SUPA 4EENA 2FWJA 4EI7A 5IJZA 2XKKA 1TIKA 3WO0A 3K8QA 3O2QB 3X43A 2N75A 1SUFA 3K6SB 1JL3A 4IIHA 3T0IA 1GTG1 1H93A 2JCXA 3H2HA 5E2IA 3HXOA 4B2LA 5E9QA 1OV4A 5ALUA 3THRA 1E9SA 2I2XB 5LZ4A 1M2OA 4AMGA 1J7JA 3P0HA 4KE9A 2PL1A 4KIGA 3WWOA 1TVKB 5AIBA 4OUKX 2WMDA 4EG8A 1XMOB 2VCEA 3K70B 2XADA 3U9TA 4EW2A 2CWWA 4N65A 4JOQA 1HZZC 1OX6A 1PGPA 1SOMA 2SKDA 3IAM6 3K30A 3GLKA 3M81A 4XJSA 3UB2A 4LPKA 1C7ZA 1G2OA 3LYAA 3KC2A 4QHYA 4MGHA 3RVLA 3WK5A 3PUZA 1PJ8A 4V0NA 3EXHA 4X7PA 4HT3B 3H1EA 3Q88A 1TAUA 1TM1E 3G13A 1JEJA 3TOCA 1X38A 1YK1A 4GP9A 2B2CA 3QV1A 4CXMA 4AO6A 2GN2A 2HADA 3HRIA 4XD7D 3V4SA 5KC8A 1YIAA 5GQSA 3HADA 3QEJA 2HKIA 5AW5A 3V80A 3M49A 4LSMA 3WLIA 1Q11A 5L4NA 3UYKA 5HF5A 4G65A 9ATCA 1N7IA 2XB9A 4AD8A 1Z5PA 1GTJ1 3EGOA 3QVWA 3BA6A 4WLEA 4UCXA 5TMEA 4LNHA 1UBOS 5L3QB 1S01A 1MQSA 1QGZA 5FNVF 3EPHA 1QHIA 2B21A 1TJYA 4LV5B 2ADFA 3FNQA 4QJIA 1DAMA 1YA8A 2QT9A 1S8NA 3PA6A 5PNTA 2CBXA 4ZQEA 4AMUA 5CNIA 2NV2B 5EZSA 3NHRA 2GZ3A 3I53A 1YI1A 4QATA 4QASA 4R9RA 4O3FA 5AJZA 3V9AA 3MT7A 1P3DA 2JD0A 2QWXA 4BC1A 1PVOA 1EWYA 4WTOA 4AY6A 1EVQA 2RGRA 2H92A 3ELBA 1U0GA 2J31A 2KMLA 1IUNA 2O1EA 4L8YA 4X6LA 3HJCA 1VL6A 3FBTA 4IG9A 2F1HA 2GUWA 5B4UA 4FT4A 1JU3A 3RKUA 4PSKA 1SCQA 4Z86A 4DIKA 5G3ZA 3QWAA 4XI9A 4ZVRA 5I3ZA 1JP7A 1K6IA 5JC1A 3LP6A 4FU0A 3RGWS 3FZNA 3G0HA 4ZHQA 3R5JA 5F2EA 5JLAA 5IAGA 2JGMA 2EJVA 2V4UA 5GONA 3O95A 1L4MA 3EVCA 4GMFA 1XMSA 1G59A 4ZT5A 3GLVA 1NVAA 1QG6A 4OD0A 2OHVA 3ZXYA 4U2GA 1LFAA 5H59A 1MENA 5LMUB 3ESZA 3GL9A 4GYKA 4RIIA 3L6RA 2XUHA 4PICA 3GJ6A 1U65A 1QONA 4BQNA 4BZXA 1APBA 3C5WP 2Q3EA 2YV1A 2Q41A 3CE6A 3EIEA 1XDSA 5KX5A 3TRFA 2DCUA 2R1TA 2ZJOA 4N5DA 3TDNA 4Y2UA 1UDBA 1E69A 1RQPA 3O21A 3PC7A 2H0RA 1QQBA 1FFCA 1ZWLA 3ER9A 4M0DA 1X2BA 1U6KA 4XW2A 2QYHA 2F3RA 3CF0A 2IT1A 2V5VA 1UMDB 3TXAA 1RAGA 3ZYCA 3KUXA 3R3HA 3ZVRA 3VKGA 3G2HA 1HA3A 1LJ8A 1S9DA 1J1ZA 5GWXA 2GPYA 4H35A 5EYPA 3ZQKA 1E63A 5LC1A 5HE8A 5FI3A 2BRUA 2P2YA 3M9LA 3GN2A 2ATVA 2C4UA 3R77A 3COZA 1RKBA 4P84A 1T36A 4BIIA 4K0KB 2XYRA 3HU1A 1C30B 1GGKA 1EUZA 3KB8A 4JC4A 2YWDA 1QPZA 4M89A 3C2QA 3KPJA 2BLLA 1LX6A 2X3YA 2FLKA 4BMNA 3W34A 4WY2A 4DYDA 3VR5A 2RBGA 1JAHA 1QFXA 3VJMA 3EPJA 1JH9A 3E3MA 2Y6VA 2G1UA 4UTPA 3F78A 3T3MB 5FPKA 2X13A 5KVSA 3BD7A 1AK9A 4L0CA 2GXAA 4Q7MB 3BIWA 3T7EA 1MJ5A 1J8FA 3PNLA 1EFUA 1LPAB 1YZUA 4P38A 3GWGA 5G0UA 3RUPA 1IVNA 1ND6A 3AEUB 4U7PB 5CBKA 2O3QA 2FMIA 2GD1O 4B3FX 3DM5A 3R23A 4DLUA 4HH3C 1GPDG 2WMOB 3OQBA 4MS3B 4YJ2F 3WP1B 3SLGA 1LVHA 4BS9A 4FHGA 5JH7F 1Y6GA 1MV8A 3KSBC 2OT3B 4NS4A 1S4MA 2J3IA 2AKAB 5BNIA 1OA1A 3IAXA 4RS4A 3T7JA 2J7KA 4RSHA 1CS0A 2DFNA 3ZWMA 3HL4A 4WADA 3M1YA 1T9BA 3PC6A 5HCIA 3RYIB 5E4FA 5AFSA 2BUCA 2J0EA 1CXZA 3ISJA 4U7DA 2R96A 5E9JA 4N3GA 4GX0A 1F6DA 4LOLA 1E3TA 3R7WA 5ICSA 2BUBA 3QLEA 3OQNA 4OFZA 3G9TA 1XZGA 3I9NA 3K5PA 5G41A 1IB6A 1NDUA 4WLNA 4YP0A 4ZXFA 1H4SA 4HDMB 2OWDA 3KRTA 4A0FA 3E05A 4PNEA 2Q6IA 3DTYA 3AVTA 5ELXA 4MRPA 4D4LA 1OX4B 3FB4A 1UBHS 4WLOA 2FZCA 2WKSA 2QD2A 2XQVA 3IP6A 5JANA 4CCWA 5AVTA 3I0NA 2BFAA 1Z6QA 3A6FA 2XJ4A 3RFUA 4BNJA 3QKIA 1L5HB 1RJWA 4F2HA 4RK0A 4B85A 3B7WA 4DJ5X 3IKMB 4B7ZA 2BP7B 3DEIA 1L3IA 5FTJA 2YKGA 3PE4A 2QI9C 1QANA 3HP7A 4RAQA 3RRYA 3ZVNA 3ELUA 2