3C74A

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
242
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
rcsb
source organism Salmonella typhimurium
total genus 82
structure length 242
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c74A00
4MCHA 4NS1A 4OY3A 2A0YA 1A9RA 4QFBA 1JE1A 4BMYA 1OTYA 3OF3A 1PR6A 2QTTA 1V2HE 4YJKA 5F73A 4JP5A 2OC9A 3FNQA 4DARA 1RFGE 1K9SA 3SCZA 1U1CA 4LKRA 3OZBA 1JDZA 4EB8A 3TL6A 1WTAA 5F7XA 1PWYE 1RXUA 4F3CA 3UAVA 1RR6A 1T8WA 3FOWA 3PHBE 4DA0A 1OV6A 1VHJA 5CCEA 3NM6B 4YMLA 4QASA 1A9QA 4M1EA 5JPCA 2ON6A 3GB9A 4GMHA 4QATA 3UAZA 3EMVA 1T0UA 3P0EA 5C80A 4M3NA 1N3IA 4L5YA 4YO8A 4LNHA 2QTGA 3OCCA 1CG6A 1JP7A 5B7PA 4R31A 4OJTA 4UC0A 5IU6A 3O6VA 4G41A 3P0FA 1OTXA 3K8QA 4F3KA 1PK9A 3KVVA 1PR0A 5EFOA 1Z39A 3U40A 1A69A 1Z5PA 3FWPA 1RT9A 1RXCA 2IQ5A 2HSWA 3PNSA 3PHCA 3DPSA 2QPLA 1LV8A 4MARA 1SJ9A 1TCUA 4I2VA 5FAKA 3INYA 4TS3A 3OPVA 3D1VA 5CXSA 1FXUA 5CXQA 4E1VA 3KUKA 4FFSA 1PR4A 1PR1A 1V4NA 4GLJA 1JYSA 1A9PA 5CCDA 3EUFA 4M7WA 4OF4A 4R2WA 3UT6A 4WKCA 4JOSA 1Z38A 1A9TA 5B7QA 4QEZA 3MMSA 3BGSA 3E9RA 3ONVA 1ULAA 4BMXA 3UAYA 4PNPA 4TXHA 1Y1SA 1Z37A 2QDKA 4NY1A 1Y1QA 3ODGA 2ISCA 1K3FA 4D9HA 1ECPA 3BL6A 2QSUA 2AI1A 1ZOSA 4JWTA 2GUWA 3LA8A 1PF7E 1RCTE 3MB8A 4TS9A 1QE5A 1PW7A 1XE3A 1NC3A 1Y1TA 1K27A 4YNBA 4DAEA 4DAOA 4F2PA 1NW4A 1OUMA 1TD1A 5B7NA 1YRYE 4U2KA 5F7JA 3BJEA 2B94A 4GLFA 5IFKA 4DABA 1ULBA 4TTIA 1T8SA 3T94A 3EUEA 3O4VA 1VMKA 2BSXA 3E9ZA 1OVGA 1U1DA 1VFNA 1RXSA 4TXJA 1YQQA 2A8YA 1T8RA 1ODKA 1TGYA 3NM5A 3BSFA 4RJ2A 5F7ZA 4K6OA 4L5AA 4R2XA 1RSZA 4WKPA 1Z5NA 2I4TA 1SD2A 1JE0A 3KHSA 4G89A 4LZWA 4D98A 1YQUA 1G2OA 3UAXA 4PR3A 4DA8A 1VHWA 4OEHA 1PR2A 3LGSA 1JDUA 1NC1A 1C3XA 5CYGA 1JDSA 1Z5OA 3KU4A 1U1GA 1B8OA 3NM4A 2OC4A 4EARA 4DA6A 1PKEA 3OOEA 2P4SA 1T8YA 1V48A 2HN9A 1PK7A 1V45E 5K1ZA 5ETJA 4BMZA 4QAQA 5I3CA 3PNPA 5F77A 4DA7A 3OOHA 1OU4A 1Y6RA 2RJ3A 3OZCA 1M73E 2HWUA 1CB0A 3K8OE 1TGVA 4WKBA 4ECEA 1Z35A 3FUCA 3DF9A 1U1EA 4WKOA 1LVUA 4D8VA 1Z33A 4GKAA 1Y1RA 2AI3A 1LX7A 2A0XA 3DP9A 4F2WA 1PR5A 3GGSA 4LNAA 3IEXA 3E0QA 4H1TA 4TXMA 3EEIA 4KN5A 4TXLA 3OZDA 1Z36A 4L6IA 3FB1A 3IOMA 1TCVA 2XRFA 3F8WA 1I80A 3DDOA 4DANA 1SD1A 4X24A 2OECA 4D8YA 1JDVA 4OGLA 2AI2A 2OXFA 5EPUA 3OZEA 3DJFA 4MCIA 1RYZA 5KB3A 3FAZA 4QARA 3KVRA 4P54A 1V3QE 2I8AA 1JDTA 3ENZA 4G8JA 4NSNA 1Y6QA 2AC7A 1A9OA 4TTJA 5F7OA 1B8NA 1ODLA 2HRDA 4F1WA 4L5CA 4IP0A 5DK6A 3QPBA 1ZL2A 4LDNA 4D8XA 4TTAA 5F76A 3LBAA 3NBQA 1Z34A 2A0WA 5F78A 4OGKA 1PBNA 1SQ6A 1A9SA 5CYFA 1V41E 4WKNA 2H8GA 4TYMA 1YBFA 5EUBA 1ODIA 4L0MA 4TXNA 2PGAA 1YR3A 5B7GA 3C74A 3KVYA 1JPVA 4BN0A 1RXYA 3UAWA 1Q1GA 2Q7OE 1ODJA 1U1FA
chains in the Genus database with same CATH superfamily
4NS1A 3DVRX 3GFOA 1QHEA 5K51A 3IP9A 3IC5A 1O0SA 5J5VA 3G88A 4WDRA 5MF6A 1XROA 4XWWA 1XIVA 3JXEA 1E3JA 1XCJA 2HTFA 1J39A 2Q5IA 1H5QA 2P90A 2QTTA 1PO7A 3B1KA 3CKYA 1V2HE 3CY6A 3FUUA 3GMSA 2VNAA 4K9DA 4L4RA 4OJKA 3QLJA 4UHFA 3H8WA 5JJ5A 4PPYA 2JGJA 1ZN8A 1EXNA 3CO5A 3WAGA 3FNQA 4D7AA 2G9QA 3QBVA 1OR8A 2DU8A 1M1YE 4BVJA 5I9IA 1GQYA 4HVAA 1QIKA 5EE0A 4J6EA 4LF5B 5K8IA 4OHBA 3LU1A 4LHWA 1C3LA 2A5DA 2BSAA 3DT6A 4HX2A 4RHXA 4F2GA 4LC0A 4KZPA 4W9MC 3A6FA 3OU7A 2GJKA 4RQTA 1X14A 5C4GB 5D3MB 4AECA 1Q57A 1ZMOA 3HTXA 1YRBA 2CCGA 1K68A 3DWEX 2OPBA 1E9CA 4JBWA 4O8ZA 4EG4A 5A2GA 2KMLA 4XM1A 1FTYA 2J48A 2JFHA 3STWA 1NR1A 2JL1A 2W98A 2O1WA 3MTGA 4KGXA 4N7RA 1SY7A 2D6FA 4MHTA 4N48A 2FHSA 3PHGA 3CLRD 4BWYA 4A0GA 5CCEA 4MWOA 4FPXA 4UZSA 4YMLA 3MNFA 3TNFA 2NU6A 1UXGA 5AICA 3ZGVA 4YCLA 2X5XA 3OQJA 2VDMB 4FSDA 4N0PA 3M4ZA 4QNNA 4QNMA 4TM8A 4TYPA 5IYZF 1NE2A 1PGQA 4FW9A 2OUKA 4OQEA 4RCVA 1JJIA 4U7PB 4YREA 3KL4A 1GKKA 2OXRA 1IN6A 1UMDB 2GZHA 3HU1A 2C99A 4KRXA 1N3IA 1H8HD 2FZEA 2OG2A 3GDGA 2JGAA 3G7NA 4HUJA 4N12A 3MIIA 3MTDA 3GARA 4JLSA 1C7RA 4LNHA 5HG0A 2HA2A 1WP4A 4BKQA 4OU4A 1JRLA 4Y9TA 1IEXA 1VCOA 2IUUA 1AKNA 2PLAA 2OFFA 1OLXA 5DW0A 2C78A 5IWAB 4CHGA 1A4XA 1JQ5A 1LGYA 2H1SA 3O73A 2JLQA 4DV3B 3B8EA 4BE4A 3IPLA 4IZ6A 5EJ4A 4QJ4A 4XLLA 1GPUA 2ECOA 2AVNA 1HLPA 4KPGA 3K31A 5K6AC 1MX9A 3OIDA 1NZFA 1M6NA 2O7SA 2O1EA 3ELUA 2V3VA 1F2UA 3GRZA 3NONA 2FH5B 4KDRA 4DVGA 3MXTA 5C9ZA 3SYKA 3QW2A 5KU7A 1GCUA 1LU9A 3M5DA 4DILA 4J94A 1N2CB 5ALPA 2G67A 2JCBA 2OM2A 2X42A 3DE7X 3WLNA 4PHTA 4F21A 1C9NA 4HPXB 1XF1A 2XCSB 1OY1A 3CVWA 4EATA 1NIPA 4XASA 1Q0ZA 5BYJA 4Y2SA 3S6JA 4MA4A 4IILA 4BBJA 2JPDA 1VL0A 4DWJA 5IBCA 1U2QA 3SHQA 4PEVA 2NQ2C 4EZIA 4EWLA 1VZ2A 2A3RA 4CEHA 3DMGA 1MB4A 1HTWA 2ZTSA 4XD7D 4OQMA 4MVJG 4JI4B 2YYZA 1GGMA 3G8BA 4A23A 1K7YA 2B5VA 2HM7A 4FW8A 3D6FA 4I4TA 4PG5A 5EPEA 2WILA 4KPUA 4TYNA 2XQGA 1QH1A 4Q3KA 1ZCBA 2BFWA 5AW2A 4U6NA 2FWNA 5KQRA 2OL4A 3H6GA 1TM7E 2V6FA 2XNHA 1CLEA 3C14C 5H70A 3W2EA 5CFLA 3IUEA 3TSZA 3MRXA 1SXJD 4JVLA 1E5XA 4UU8A 2E4YA 5AT1A 3FX2A 2WEKA 2ZI9A 1KJWA 5K3DA 3IRUA 4LDJA 3L9WA 4OP3A 3HFRA 2O0KA 4WT7A 5CM8B 4ZGWA 2PL5A 2ODPA 1G2QA 4R2WA 3RS5A 5DXJA 2IOFK 4WKCA 1YZTA 3DMHA 3FGPA 3HO6A 2UKDA 4IDEA 3T3HA 3VR0A 1CJVC 5EINA 3VX4A 4PGFA 5FI0B 1JZSA 1XMSA 3HKDA 1QQ7A 5ALLA 1LNZA 5B7QA 5K0TA 2WQ7A 2C5HA 1CW2B 2QPOA 2G8NA 3FBGA 4A8HA 2YDYA 1GYQA 2E2WA 1CDDA 5BQ3A 1MR3F 3D8TA 4L27A 1X3SA 1PWZA 1P0FA 4BPBA 1G21E 3HJNA 4LE2A 2C20A 2YXDA 2NU8A 4X91A 1KR5A 1RAHA 3C3PA 4ZV7A 3WAKA 2PJRA 1QYXA 1PZNA 4I55F 2AR0A 1XLTC 2YRWA 4TXHA 4FS8A 2WIAA 1ULSA 3GCDA 1AUVA 3P2YA 2PKCA 4BFYA 4BP9A 1E0SA 2GESA 3PI7A 5T3UA 3GBSA 1D09A 2GPAA 4MKHA 1A9ZA 4MKGA 4YJ2F 1GFZA 1QRAA 5HIMA 3RS3A 1EAMA 1EGQA 1SCDA 1Z0UA 2DFTA 3AR2A 2J9FB 2IHTA 1RM4A 4Z4HA 5DXFA 3DZGA 4PRYA 1XMQB 5JR3A 2VUIB 1M2GA 2H4ZA 1USWA 2WHPB 3AR6A 5DEIA 3DB1A 5JMOA 3ENKA 4ZT2A 2O2EA 1YIOA 2R00C 3HUFA 3IQIX 3D7SA 3GFFA 3D6AA 2N75A 4GEGA 1S3FA 3PG5A 3IS3A 1PCXA 4KAAA 2Q1TA 3SHFA 4MS3B 1FLVA 4UULA 3E8SA 3ISJA 3MUOA 1CJCA 3TS1A 2W6JD 2I6XA 1SK9A 3NASA 4O1MA 4Z53A 4O2RA 4ZA2A 1AA6A 3HBAA 4B71A 1I0IA 2FW7A 3GL9A 4GPTA 2XUQA 3MPOA 4BZPA 1G7SA 1OUMA 2ZYVX 3NHAA 2PGIA 1U4NA 3H1GA 1YRYE 4D43A 1E94E 2JFFA 2ONCA 4C5BA 5HPYB 3FKSA 4ER3A 2QAGB 2HLHA 5FWXA 3KV1A 2NADA 3PGKA 4RJKA 1J8DA 3TIVA 3ZU4A 4LBWA 4AX4A 4YQEA 4KKVA 1ND5A 5DBHX 4GGOA 1UQRA 4ZXFA 2ID7A 2HCFA 2VF8A 4M7PA 3ZY4A 2VT6A 1RWVA 1T3LA 3SE0A 4EGSA 3DTNA 2CUZA 3TIIA 5IM5A 3EGXB 1FFHA 1KMMA 3JQ8A 4TQUS 4TTIA 3W6NA 5C81A 5ICSA 1IOZA 1A7JA 3WYFA 3CW8X 3C0KA 3H83A 3MRVA 3C45A 2PFKA 4J1NA 4HUTA 5K8JB 2G4CA 3W5BA 1ZGCA 2EARA 2HY7A 3L1UA 2XD9A 4MHOA 5ADWA 3F9CA 2OPHA 3BJIC 1QLHA 4PG7A 3HM2A 4OAPA 1ETHA 1YQQA 2OESA 1M10A 3EAQA 3CZAA 3AI1A 4K88A 2FP4B 4KUHA 1E9RA 4K87A 3WNBA 4NFHA 1KVRA 2R2AA 4TGLA 3WVNA 3MQ4A 4GYJA 2OGSA 3IUBA 2Q6TA 2V7EA 1ATIA 5E7IA 1HYHA 3AEQA 5LMCA 1UWCA 4D9IA 1FP4A 2CN1A 2SICE 2VUHB 3GFQA 2XE7A 5CFMA 4K6OA 3VNQA 4EQ6B 1JKJA 3I12A 4RXMA 3VPHA 3SC3A 2UUCB 1GUAA 3B78A 5EPOA 3GLGB 1P1HA 3D2LA 1E3EA 3I2KA 1W87A 2GN9A 2Y71A 1U7TA 4EIWA 5CDTA 3C7CB 2VRWA 3QSYA 4XVUA 1EFAA 2ZBEA 3D5QA 3HMQA 3L7OA 1DKNA 2WYVA 4QGAA 4WZZA 3DULA 3OEHA 4JVSB 5K0SA 1YCFA 3I92A 2XCQA 4NYIQ 4M0CA 1ZD2P 4M4SA 5C8YA 4HGQA 1UFVA 4HDKA 1SCIA 4BNLA 5T8KC 1MPXA 2I54A 3TW0A 3B9PA 4QD3A 1JDBB 1UAGA 1W6UA 2F00A 1I1HA 2OV2A 3A1FA 2HNKA 3GZJA 3W1VA 1FSSA 2ZBGA 4F2HA 1IOVA 1KNQA 1T1JA 5EE9A 1AV6A 5EXXA 2FPGA 2YNMA 1VSTA 3TQOA 1SG6A 4AYWA 1Z5OA 4LYFA 2NACA 2OFXA 3T7CA 1VJ5A 1NMXA 1ISJA 1M72A 1KK0A 1S1CA 3ZKWB 2NO9A 3EZLA 2G8LA 5EHXA 1QF7A 2Y0BA 1G8AA 1IMJA 1JHXA 1U0OC 2GAOA 3CWQA 2X7HA 3HY3A 3M9LA 3TM4A 2OC4A 1F38A 2R48A 3IQDB 1GN9A 4Q0MA 4D4HA 4EARA 2DWUA 4DA6A 2G1PA 6Q21A 3TO5A 2V59A 2DQZA 3C3JA 1SUIA 2WSLA 2P2GA 3NFRA 4I5EA 3A4TA 5HK8A 4YMUA 4WBSA 3ABIA 2OP1A 1ZCFA 1WXEA 2RIPA 2C03A 3QA3E 2VCEA 1NAIA 2HJHA 3K9HA 1UWVA 2VCYA 1Y7LA 1F14A 1U7UA 2XUIA 2ZJZA 3MS2A 3PRYA 2OLKA 4JU8A 4QL3A 3ROPA 5HJ5A 7REQB 5FLKA 3T1QA 4AK9A 3NHFA 5GJBA 3OTGA 5JNUA 4DOMA 3Q3JB 1L5LA 3ZKAA 3LUBA 2RJ3A 3OZGA 1I14A 1NXQA 3WB1A 3QTLA 4RORA 4Z0TA 2Q4EA 2Q6VA 4R51A 4L3OA 4R2HA 3I5AA 2FUEA 4LHYA 1QRUA 3P2MA 2DBQA 3QEMB 1QLJA 2COEA 2E87A 4JR1A 4CKCB 2B98A 1X7WB 3R09A 1HYQA 2R47A 3DT9A 3WGIA 1VE6A 1YHNA 4WY2A 1RI4A 4ICIA 5DM1A 4EJ2A 1UKZA 3I1YA 2IEGA 3WYCA 2TYSB 2JIBA 1K75A 3M9XA 3ZVNA 1WQ4A 3CX8A 5FA8A 3RHSA 5C32A 2R79A 4XDGA 2O0LA 3TDNA 1G5FA 3Q41A 5BRAA 1SAYA 3I2JA 2VDLB 3GGSA 4ETMA 4CDMA 3OQIB 3PXXA 5CA0B 3A3PA 4G67A 5EZ5A 3RWOA 2V1XA 3OZAA 2GBLA 3QELB 1V1MB 2A0KA 1H94A 2XMDA 4HNSA 4LDZA 3AY0A 1F2VA 2DY0A 2GAIA 4KN5A 1T0JB 3OE1A 4JJ6A 1R9MA 4PLYA 5AKZA 4CNQA 5C53B 5FOQA 3MD0A 4JVMA 1E2NA 4GM0A 1B0ZA 1HE2A 1XU7A 3WNDA 2H1VA 2W43A 2X4LA 4COKA 4WFQA 2D2EA 3VZDA 2QSYA 1ABEA 1N34B 4FQ5A 1I80A 4C20A 1FFYA 1ORIA 1PUIA 4AUEA 2FETA 3RYCB 2PR7A 2YVLA 1SC4A 3LWNA 3PICA 4G36A 2FW8A 4D4KA 3HJAA 3FOFC 2PWPA 3L8FA 2R6R1 3AM1A 5BOSA 4CQJA 2GN8A 2HXGA 1QSGA 4OMCA 3SJZA 3AVYA 1G60A 3CUSA 3WWZA 4X60A 1T25A 4DDMA 3UC9A 2Y0PA 3DZFA 3DJFA 1SR8A 4H15A 4YV0A 1NKSA 1AF7A 3I9NA 2PD3A 2XMCA 4IDNA 4TL9A 2XCRB 3HVIA 5HDBB 3MINA 2GD1O 2VNHA 3DXFA 2VYND 1XNQB 1VMEA 2W2VA 4UMEA 2CXQA 2I2DA 4IFTA 3OCZA 3BWBA 3KQSA 4WFKA 1ZBQA 1PJ2A 2Z98A 5E95A 1WUJS 2H5LA 4CEJB 4ANFA 2MDTA 1M54A 1XKLA 4DCVA 3H6HA 4J03A 4YJFB 2VAMA 1IM8A 3HI6A 2DBZA 3ED1A 3OP1A 4NEQA 3X1DA 3Q7QA 4CJXA 4BKRA 1LQTA 4CIBA 2BSQA 4KYUA 1W88A 3K0AB 3LLSA 1XTQA 1Y8RB 3W05A 5IUNC 1TU4A 2C9CA 5L3SA 1S1MA 3TTTA 1IBKB 2R6DA 2X7JA 1G5QA 2CL7X 2R5WA 2QXTA 1F4PA 1Y4DE 4MUJA 4MRNA 4O2BF 1OIWA 3T15A 4DIDA 3B12A 1BWSA 3IJRA 3UTCA 3BJRA 2YBEA 4DQKA 4PAGA 1OZHA 4KPFC 1J00A 5CIQA 5HJ2A 3EZ7A 4UNPA 1C30A 5KPDA 4MVJF 4L8YA 1TQ2A 5EKXA 3ZWKA 3IA2A 3T5TA 3K2IA 4D8XA 3HJHA 1CR1A 2VYVA 4P7FA 1UFQA 4B09A 3GAAA 4CM1A 4XJVA 3E1SA 2GRUA 2HWXA 3R0IA 4PHCA 1D9XA 1VKRA 4R9SA 4BUCA 4K7JA 2PUDA 4WCFB 1KDYA 1TVEA 4CFYA 4OB7A 5HF5A 1ZM4A 3TAUA 3ZWOA 3LVFO 3FRHA 4NDZA 3DTVB 2VF7A 3PKJA 1V41E 4WKNA 4BTLA 4E12A 5EUBA 5AJWA 3T61A 1ODIA 2AR7A 4V0RA 2J5XA 4FP9A 4J9VA 1V8FA 1ZI8A 3FI9A 4UEOA 4GVXA 5KVQA 2OVBA 1WXWA 2Q9UA 4ZAYA 5ESWA 1R88A 4HXFB 1YR3A 3E9YA 1Z2DA 1NW5A 4OOEA 4NBWA 4HF7A 1JMYA 4KQWA 4YC7A 3QFRA 3THRA 3M83A 3KQMA 3ZTYA 3VNVA 3MUFA 2F8MA 3T1NA 1H66A 5B3AA 1Q1GA 2RAVA 4PG4A 1H0RA 2QLMA 4R2IA 4ZAZA 2G1KA 4LF8B 2QD1A 3MSCA 4HDRB 5ARDA 2QX4A 5EE5B 5FV4A 2QAJA 2CHGA 4M1OA 4L72A 5F9MA 3R9XB 5AHRA 5D3KA 3SLKA 4GE3A 1L4NA 1M2EA 2PKRA 4PNHA 1CUIA 2Q0HA 1EX9A 5CTAA 2DFNA 3QXGA 3BK2A 4M76B 5AM5A 1YZVA 1JSZA 3A9UA 2Q07A 3I09A 3RV3A 3WTBA 3UNXA 3RCBA 1NYQA 2J46A 1ODTC 4CTNA 2BFPA 5IXYA 4C4ZA 1F6BA 2BFBB 1Q21A 1XZNA 1P4HA 2PYZA 3FOCA 2WTMA 4QTTB 2PV0A 4R8LA 3S3TA 4Y6SA 3OPXA 2HGSA 4CDRA 1BE1A 5J47A 4FZ3A 2GZRA 5F7XA 2MWMA 3PVCA 3A58B 2IZ1A 3IBGA 3HVJA 4KIFA 1W1WA 4B2YA 1GILA 1PL7A 4EJSC 2WJVA 4ZWNA 1KJIA 1G0OA 4RWEA 2PE5A 4OU5A 1N6OA 2ZWMA 4RD3A 2J59A 3FOWA 3HU3A 1II0A 1OLOA 4M0KA 3JAKA 1Y5IA 1WPRA 3B6KA 1WV1A 4OBWA 5PGMA 3WOHA 3UPUA 2AK3A 4TMWA 3U7HB 3SNHA 3UM9A 4QELA 3F74A 4IJKA 2JVIA 1WPGA 1EVLA 1Y6ZA 2GNPA 2YR0A 3HV0A 3ZVRA 1QS0A 1TFRA 3ZIAA 2ANBA 3O8BA 4TMZA 4BQFA 4AJ2A 3KOMA 2BFEB 3NV9A 5GONA 1Z8HA 4MH0R 3AUYA 5BQXA 1BKDR 1GWNA 1YULA 2Y77A 3AY7A 3L2OB 4JBXA 5BQFA 3LCUA 1AQYA 5IJ9A 1HO3A 1YZGA 4QA9A 5C8XA 3PUHA 5LDDC 1Y3IA 4RKFA 3RG8A 5JCJD 4LSZA 3N6XA 1BEZA 4URYR 3IVRA 3T8YA 2UZ4A 5FWYB 1IHUA 2C9BA 4EHNA 4RY2A 5KQLA 3CIFA 4COOA 4TRNA 3VDMA 1FU8A 2RI0A 4B3IA 1ZKDA 2SKEA 5IH7A 3U6BA 4HX5A 2GAFA 5JJCA 4OGWA 3THWB 1DC6A 1UADA 2GSWA 2W90A 1GQRA 2I7TA 3R7WB 1W7AA 2FLKA 3CGWA 2GPSA 2ZVPX 3NNDA 1GZUA 2E5WA 4WAUA 2J3KA 1PEAA 5A7GA 4XTRA 3TXXA 1NI5A 3O9MA 3TUJC 5ECGC 5I9SA 4ZO9A 4P5PA 1LLQA 1PK9A 2NYAA 2JFYA 1KO7A 3T5BA 1VL5A 5EWMA 2YYYA 4G5YA 2B1RA 2Q1WA 2QAIA 1KFKB 3R24A 4Y1EA 5FTMA 1Z39A 2H00A 2O2XA 3JZMA 1B15A 1DOHA 3Q2KA 3DZKA 4HQKA 3WLSA 4UTZA 4YGXB 2D4HA 3O4FA 1KMHA 4JDUA 1Y98A 4MV3A 2W6NA 3SSNA 4ZJPA 1E63A 2Q6KA 3TVDA 5GOZA 5FL7A 4DLBA 1EDDA 2HU7A 2EX4A 3AW8A 4D9KA 1FFCA 1TZCA 1E6MA 1SC3A 1E66A 3KZKA 1M0TA 3EGOA 1X7DA 3EXAA 1YI0A 1I1QB 4MUMA 1Z29A 1ORDA 3UHAA 3IUPA 1GLVA 2ENWA 3ZY3A 1JG4A 1UBTS 4GUAA 1DIBA 2R96A 2IH2A 1U3VA 4OO3A 2IBTA 1J06A 2PX4A 3NC0C 4NDNE 4K6KA 4QJBA 1GSOA 2VH5R 2NZWA 221PA 2YJTD 1TAHA 4FR2A 1KO1A 4RPCA 1G2IA 3FFWA 1DQSA 4M60A 3UUGA 3L4EA 3QUQA 4D3DA 5LQAA 5EHNA 2YIVX 3UB3A 1TMGE 4YAFA 4BP3A 1JYSA 2Y1EA 3LX4A 5K3EA 3JQ7A 1IXSB 5IRCD 4DLAA 4L8GA 1YRQA 3GLVA 2VHYA 3E9QA 3T7KA 1HT3A 1XU4A 2CJWA 2V98A 5JPDA 3PDCA 5DWQA 4RV5A 2J0UB 2P9QA 3A28A 2P8SA 3QOFA 1ZIPA 2O7RA 4UCXA 3SI7A 4HDAA 4LUCA 5HUHA 1FBTA 1KJQA 3Q3EA 4UVIA 2ZBUA 4NXNB 2HQ1A 1O5TA 1WUYA 2OD2A 1II8A 2XB8A 3IIJA 4NJEB 4PIMA 4TUYF 3A6PC 5JW6A 1LA2A 5JNRA 2WWXA 1R0ZA 1S89A 2GCPA 2GEBA 2CNBA 3ZHUA 1AKYA 5FJIA 1ZN9A 2IXBA 5TMEA 1WB5A 2B34A 2X22A 4IUDS 5KC8A 4LVNA 4KXFB 4I1SA 1G7RA 2EL9A 1ZFNA 4X63A 4EDHA 1UMKA 3I3OA 3KLNA 1MX3A 1Q0TA 3B7GA 1CJTC 1IPHA 5CT6A 4ZZ2A 5H80A 5AR1A 3A32A 1VJDA 3NANA 2D0PB 4EUHA 4R8SA 5IG2A 1L1EA 2X6RA 2WKRA 1B74A 3FMOB 3FRIA 1X70A 2FMHA 1PLLA 2YXNA 1QP7A 4IIUA 3I9V6 1RYDA 3RBZA 3IILA 3J81A 3VO2A 5IHPA 2JIZA 2ZITA 3IODA 1S2GA 3M6MD 4PXSA 5KQSA 4GH5A 4KKXB 1ZHOA 1LW7A 4TS9A 3E9MA 3G1TA 4LMRA 5B1SA 5SICE 2VVTA 3UB4A 3TZHA 3ZCVA 2W6PA 5K8CA 4ISBA 1IB6A 3KYCB 4REQA 4CF6A 3HFSA 4MLZA 1WLSA 3HCAA 2FEMA 4JBGA 4U3JB 1N75A 2G9VA 1ZYUA 3AL0C 3F9IA 2EP8A 2PL1A 4GM1A 3DWGA 3GDOA 4IDFA 3CWCA 5CBPA 1ZP6A 4LDRA 4Q82A 3TX2A 1S4QA 4QBKA 2JAUA 3VVLA 2BMAA 2BN4A 4WK4B 4F5DA 3H16A 3BIOA 4BEVA 2AZMA 3LOUA 2FAXA 2FFHA 3DO8A 5F7JA 8LDHA 1GZDA 2CDAA 4IX9A 1I24A 3DBIA 3LX6A 3RIMA 4CMBA 1YOVA 4EW3A 4WFJA 4QOJA 2DULA 4IO1A 3OLWA 2OHVA 3TR0A 2FSGA 4F85A 5JIBA 4QJ3A 4B43A 1VIYA 2IYXA 1T4BA 4NQRA 3V6LA 4X1YA 3I5UA 1I3MA 3JQAA 3IBCA 3OIFA 2XMZA 1UC9A 16PKA 1L7QA 3DVAB 2Q3BA 5E9AA 5LFAA 4NV1A 3LC0A 1GGJA 3G8YA 1Y1LA 3MWLA 4UOQA 3EPJA 4BGEA 1TK3A 1M7BA 1KEUA 3B70A 1YCGA 4A2CA 3UFXB 5JG7A 2V7PA 2NZYA 1KI3A 4LF7B 5BVHB 1GR1A 4EG3A 1FFAA 5BW8A 2J9RA 3AEYA 3CEPB 1T6YA 2ZLBA 4MTCA 3QVLA 4RDXA 1BXGB 3AL3A 4R8VA 3LUGA 4HWRA 3WMXA 3IAHA 3MF4A 4K03A 5JQWA 1NMQA 2C4KA 4MWBA 5KI6A 2XXAA 1KFJB 2NXNA 4PS0A 1R3DA 1YGPA 1SB8A 4DDVA 3OG9A 3L3BA 3VOBA 4DCGA 2P2SA 2QR2A 4BAGA 3ELBA 4KL8S 4FWIB 4D98A 3WDLA 4AKHA 4OMUA 1A4UA 3D3WA 1P4SA 4IOJA 2Y3IA 2A57A 6PFKA 3Q85A 4L57A 3WLRA 2J8ZA 1WV0A 5B12A 2Y2VA 3OEEA 3JQRA 4QU5A 1DB3A 1C7IA 4PSCA 3UWOA 4HDNA 1L9KA 1ENPA 1DFHA 2IYSA 3KTOA 4V2IA 3I5YA 4NIMA 2FWPA 3PJRA 1MRZA 4IICA 1BXRA 4MGHA 4RHEA 3OZVA 2YMMA 2OBLA 3EIXA 3FPLA 3IMEA 5EGNA 2QD4A 4MP3A 3WGNA 1BEEA 2GLTA 3HV2A 4CWAA 1DQPA 2HPVA 3Q9NA 5FR1A 4BB0A 5IYZA 1LNSA 2CFCA 2I03A 2CBGA 3MRTA 4LXIA 4MR8B 4QBTA 4UDNA 4D02A 4Z1MA 1ZIXA 1XCGB 4MPDA 1YJBA 3WB2A 5FFMA 2QROA 4ZJZA 2AEMA 3DAGA 3GNTA 1NSFA 1IWBB 1RM3A 2EC5A 2Q6LA 3R7LA 5BVGA 2OUIA 2JLAA 2QN2A 2XHEA 1SVSA 2OD9A 1KZ6A 3GJ3A 3NYWA 2H2IA 1NQUA 1NX9A 2WTXA 3A9CA 3MAJA 4G0PA 4IHJB 1BGWA 3QEKA 1SXJB 2FVYA 1IC6A 3PEYA 1XNJA 1M2JA 1EM6A 5ETJA 3GR6A 2XEXA 4DLRA 2BFFA 3S7ZA 3FLMA 4HTAA 3TIGA 2QLBA 1AOXA 1NBAA 2F4NA 3G0GA 2FX3A 4GP6A 4RVUA 5DXAA 4TMYA 5J63A 5FI1B 1J24A 3L04A 3OMXA 3PNPA 2CXPA 3L41A 4IJVA 1KFCB 3QUBA 4G65A 4UARA 5A3JA 2PR2A 4FYMA 4II7A 1KEZA 1HBJA 3SBOA 1PWHA 1TZJA 1J2EA 1T6NA 4FGZA 3CW2A 3LP6A 4I1RA 1WF3A 1M73E 3C4QA 3DOJA 3OZCA 2XZOA 4U1RA 1WCWA 3TNJA 3QNMA 5LU9A 2PLWA 3HL0A 3G2PA 2YV1A 1GUZA 1PFYA 3CUUA 3LDAA 4E30A 3IT3A 2RH9B 1JZTA 4HXGA 1JR3A 3DD5A 4ZZ1A 3L7YA 4U2DA 1F1JA 2YVQA 3OKFA 4XEUA 1N2ZA 4CT0A 2NUTB 3AV3A 3G2IA 5L95A 1B76A 3ONFA 3WDSA 1XAJA 1XCMA 3HJFA 1VKNA 1YK0A 1L7OA 2PGXA 4K3VA 1G8MA 4G4SP 1JU9A 2A0XA 3PPYA 3NHJA 2IX9A 1G3UA 5JZOA 1E4EA 4UUOA 4P93A 1Q74A 2F3QA 3R0XA 2GD2A 3TUZC 2XT0A 2UZIR 3HSKA 2POQX 4BBAA 4NHOA 4U7DA 2V3CC 1BU8A 3EEIA 4HNVA 3A10A 1UANA 3HB0A 4X94A 3NEPX 4Y30A 3H7AA 1LSJA 4PYKA 4TXLA 3RRXA 3SOZA 5HSGA 5MDHA 1WO8A 3Q3CA 4HAOA 3S68A 3X1JA 4K5QA 3ICPA 4YMWA 2GWRA 5AW6A 1DEHA 2P78A 4A36A 1CHDA 3FJ1A 4RTQA 1T3TA 2FQYA 5AKJA 4G5RA 5F2OA 2ZJ6A 4L6AA 1JWAB 4D9NA 1SUSA 4G1EB 5JPIA 1A76A 1L9XA 4F6CA 3CNHA 4RIEA 1ZPDA 1U3CA 4UPEA 1C5KA 1T0BA 2Z57A 4G5HA 4X1IA 3GOHA 1ZH0A 3LH5A 3CLTC 3R41A 3VC7A 5JNSA 3AFGA 3ZX5A 1E5VA 3WAJA 2CL5A 4K2AA 1ZUNA 3H0EA 3O7MA 1JIIA 4PS1A 4O4LF 5EPUA 4HWOA 2VHXA 1SVMA 3L82B 3JQEA 3QF7A 4ZDWA 4ZFNA 1WD7A 1GRRA 4G23A 3LXMA 1N7GA 2XV1A 2I4OA 3FBWA 3FAZA 3F3SA 1EU1A 1NSTA 1RRCA 1MB0A 5TQJA 2ORVA 1BKYA 4I55A 4ND7A 4UBOA 5ALRA 5LPNA 1MOPA 4FNOA 1NNEA 1E1QA 1NBWB 2TS1A 3FHJA 1L5NA 4LECA 1RWNA 3ZGXA 3GHHA 3G1UA 1RTKA 4YJ2A 3GCXA 5A06A 4TPKA 4BLVA 2D8MA 1SKUA 1GYRA 1WDLA 1BTOA 3HKCA 1TZKA 2K6GA 4FMBB 1UBSB 1SCUA 1Z07A 8ADHA 2AC7A 1W4CA 1R5BA 4ZVRA 4HUQB 3P0JA 3IMFA 4CT5A 4NHEA 1KAGA 2R0QC 5JV5A 1AUOA 4HN9A 1PV2A 1GCAA 2PAFA 2VDWA 2Y4OA 5EVJA 1UXKA 1IEWA 3A6DA 1B8NA 4QJ5A 2Y66A 1NXSA 2Q3JA 1CRZA 3RVRA 1C7JA 3VYTB 4ME6A 3GT7A 1B93A 3EZ9A 1Z0AA 1M2WA 1CERA 3NJ8A 3PI6A 2EVWX 3QPBA 1UT5A 3RAPR 4AG5A 4RGYA 1CC1S 4O1HA 1N2IA 1QGDA 1OH7A 4CN8A 5DN9A 2HRBA 3OUUA 4OHMA 4E5MA 1EUCA 1GKUB 3RPEA 1TIBA 1CT9A 1R18A 3NYQA 3AKZA 1KEVA 1O96B 3GT3A 2FWMX 3H04A 3SSOA 2OV8A 1RRFA 5A0FA 2AG0A 2H2GA 3OZ7A 4N7JA 4MP8A 4KSBA 3P94A 1QKIA 4PLTA 4QRHA 1OWMA 1QCDA 3I73A 3WNCA 2ZJOA 4NS4A 1SQ6A 2CWWA 1F0YA 2FUG1 1E79D 2NO1A 1WMFA 3O8OB 3QV1A 4L4XA 4NBUA 4XRRA 3WHIA 3ZDFA 1NR5A 5GMOA 3G8DA 2A33A 3OCJA 1T13A 1XQ1A 4EJ6A 5CVJA 2J6CA 1SPXA 2RDMA 4PCLA 4ZHSA 5DX0A 2R66A 3AEUB 3E9EA 3OX2A 3HC7A 4H4EA 5BQ5A 5B7GA 5I6DA 3EGCA 3JZAA 3CN7A 4DMKA 4YY3B 4Z86A 4IVRA 2QZ9A 4L9SA 4UM5A 2IZZA 3CEAA 3KR2A 5KX5B 4YCCA 2PMWB 3V8VA 2HYDA 3JWGA 1HDGO 5EZYB 1M2FA 3LXRA 1E7SA 4L8LA 3QBEA 1EDEA 5F5NA 1GKYA 4X90A 4CMAA 3RC3A 2WDPA 5J4YA 3RSOA 3QLVC 4NONA 3YASA 4MGKR 3BXOA 1J8VA 3OE4A 1OXXK 1XB2A 2EZ4A 3TTVA 5EIXA 4XUDA 3UT5A 4TWAA 4Q1EA 3QX9A 5ARBA 3M7IA 3HCNA 1I8TA 5AOCA 2E9SA 4MPPA 4FCVA 1I7PA 4Z2YA 4HAYA 4OI4A 5TQVA 5H8WA 5H3LA 3P71T 3GVIA 4NBNA 1PE0A 4DCPA 3Q7PA 3H99A 5HFAA 5BURA 3TOCA 3L0YA 3IA7A 4L28A 4QQRA 2W37A 1PSWA 1J8FA 3AP1A 4HDSA 3RLIA 3SC6A 3ZHOA 1WCV1 2GYWA 4Q18A 3CMCO 2J9XB 4Q9DA 5SY9A 5TY0A 1Y1KE 1WTAA 1LJUA 1ZHHA 1OC2A 1W4AA 1WW3A 4JUFA 5DNCA 4O5OA 5D7NA 4BRUA 3B7WA 1EWQA 3BXEA 2VZ9A 1QHYA 1TF5A 2ECQA 3MS4A 4FN5A 4KQHA 1RHKA 3THXB 1ZEMA 1OZ0A 3NS7A 1XA3A 3GLFE 2JJYA 3DPIA 4OK3A 2VHTA 2ZUTA 2WV7A 4LMPA 5CLHA 4HVTA 4XYMA 3PQEA 1NKVA 1G6HA 3WMRA 1TZMA 2SBTA 2WA2A 1XMXA 3FNBA 3L93A 1ST2A 3R77A 1SCAA 3NM6B 4RENA 4CMGA 4P83A 4CMEC 3F7MA 4YT4A 1QQ5A 2EGGA 2Z1MA 1MG0A 3ZPXA 5ICEA 4BGDA 1Z18A 3K70D 2I5PO 1MB3A 3RJTA 3VYVA 1U3UA 3TLGA 6LDHA 1X7XB 3CH7A 4LTDA 1RRPA 3LHIA 2OCBA 1QUEA 2SCUB 4LOLA 3K09C 4RA6B 2ZJYA 4NBVA 4Z9XA 3U62A 3LVQE 3RT1A 3HDJA 1KZ9A 2O3RA 5JO0A 5HE8A 3LPDA 4AWXA 5KDDA 1EKXA 1WB4A 1BW9A 4S24A 1Y4AE 4Y2HA 1CUJA 3UMRA 2MSDB 2BGRA 3RSGA 2QRVA 3IPXA 3VZCA 1JP7A 4D81A 3V1YA 5B4UA 1Q3TA 2XTJA 4O29A 1Y89A 1P5JA 2P1ZA 4X1OA 2CNLA 1EFCA 4F7DA 5KWVA 2FE4A 4E6EA 3UC5A 4KJXA 3F97A 4F86A 4EUKA 5JRZA 1IZ9A 3KOYA 1BQ3A 4IXTA 1Q1NA 5HQJA 3TNLA 2HDOA 2ZU0C 3K0FA 1PQPA 3MWGA 4FBMA 2PIDA 2X2OA 2CDNA 4BFXA 1A2OA 1WCXA 3PCXA 1DTSA 4OQPA 3URMA 1NUAA 3NUQA 1J33A 3WYDA 5AESA 4TZ0A 1YAHA 3VR6A 1HDEA 4RHTA 5BNZA 2PGLA 2XDQB 4EW6A 3VUFA 4CGYA 3KQTA 4CI9A 1J0BA 1T26A 2LZ0A 4K46A 4O59O 2CLFB 4RVDA 1JHAA 4C0BA 5A5EA 5EHQA 1AMNA 4JUBA 1P3DA 3IHLA 4X3PA 5I4CA 1XO1A 3JD2A 4EB6B 3R9KA 4YIKA 2FI1A 1JEQA 4R7TA 2AFHB 1R6DA 2X3YA 4L0CA 1UZLA 1BMTA 1MTZA 3KOZA 4QDZA 1PYGA 2CJXA 4UTOA 4ZEWA 3HWWA 4S04A 1Q1BA 4YRNA 5IJ0B 2JAPA 2FK7A 1EE9A 5DEOA 3SEFA 2WUGA 4A8JB 2O5VA 5IK2A 4KZKA 2JVKA 3L8HA 3U9SA 4F71A 5FAKA 2DWOA 1BXZA 1R4MA 2O52A 4U2CA 5CVVA 4LY6A 2I7CA 1RE1A 4FFBA 4GT1A 3SDSA 1G6OA 2QZJA 4TM7A 1XTZA 1J49A 4K9KA 4ZI7F 2PT6A 1D2CA 3IUNA 4HEA6 1RPNA 3JQBA 3RVKA 3KUKA 3JV7A 4FFSA 2XOKD 1PR1A 4P7JA 4NMLA 1LLDA 3V7NA 3COZA 4MV1A 4LRXA 4WOKA 5I47A 1A9PA 4CKEB 2R11A 4X6UA 1NLUA 5SV2A 4QC2A 4Z9YA 3VMFA 1EX1A 3P9QA 5F3DA 4Y8VA 1P3Y1 2QMQA 2IU4A 2RK3A 2YV4A 5AIAA 4NOMA 5K5EA 1Z38A 3PTAA 4J0GA 5GZ1A 2G36A 2ZJ7A 1ADGA 1GAWA 4KRGA 4OLJA 5AHKA 4L75A 1GCIA 3WSWA 2J33A 4CI0B 1ACJA 2TMYA 3JQQA 2OBMA 4KR0A 2WAAA 3ONWA 3PFHA 2QGNA 2AK2A 2BHNA 3ZNQA 3DP7A 4FSHA 3EEYA 4M0DA 3OTHA 1VKOA 3U81A 1SIUA 4G5XA 2ZJFA 4LSWA 4O4IB 3I2HA 1ID1A 2R8RA 3PJGA 4JI3B 3UAYA 1IONA 4WX2B 2CJFA 1BVYF 2B92A 2K2QB 3KWLA 2P5TB 1DFGA 1NWCA 4Z1OA 5KNDA 1M2OA 5FIUA 1JIQA 1NRJB 3UOWA 5TPZD 2A5GA 4C1BA 4ZQIA 1XQ6A 3BCSA 1A7KA 1DJNA 3KT6A 1Q0UA 3PQ8A 4GPD1 4O2BA 4E14A 1ZOSA 3PCTA 1YMVA 2XH8A 4MGIR 3NBFA 5CURA 5DTIA 3HP7A 3ZY5A 3W5CA 3DDZX 4CBVA 1L3BA 3MYRA 3D9QX 2XTAA 2YHSA 2VJBA 2NO6A 4MVJA 1K4KA 4P2BA 2JF0A 2HKIA 4RDIA 3NTQA 4HDQB 5D84A 3SR3A 4E4TA 5K8UA 5KWSA 1QC5A 1QAQA 3WP0A 1H69A 3PEUA 3UH1A 2J6HA 3WQQA 2QL7A 2XNCA 3HZHA 3U9TA 1VIDA 1Z45A 4EYKA 1HL3A 5DSXA 1IPEA 4OL9A 2NVUB 2AMJA 2WT8A 1SUBA 1QK5A 4MAFA 1E8MA 2DPGA 2NTVA 3HN2A 4CL2A 1NM5C 4M46A 2CFIA 2CUNA 5E6SA 4LGYA 1RC1A 2C2ZA 2PQMA 2ZIXA 2EJBA 4B7ZA 2N47A 4NBSA 4XE5A 3BEOA 2C0QA 1NVXQ 3OX1A 4GHWA 2IDMA 2EFJA 1NY5A 4GYKA 3A9VA 1KDOA 1RJWA 2IYQA 1JALA 2XMBA 3GUHA 3H5OA 4LY3A 5EE1A 3O0DA 1OPXA 2FZKA 1KY2A 2RGYA 2PGJA 4KWHA 3SSAA 4C0WA 3M2TA 4YLGA 2Y8EA 4M22A 5HTKA 1HFKA 1R9GA 2GBPA 2PH1A 4ZCTA 4ZOLB 5K4GA 3GUYA 1SVIA 2IP1A 2FGJA 4IIDA 4RD4A 1Q19A 1WZUA 4Q6WA 1XZJA 4G5GA 3DVSX 3MSXA 2A8YA 2ZRFA 1C9JA 1VLHA 2OWDA 4TWJA 1N7JA 2HBRA 5KVAA 2OOKA 4LHSA 3U1TA 3WV5A 4DJFC 1YRAA 1Z83A 3BUSA 3OPNA 4X61A 2R8EA 3C6XA 1JQBA 2HSEA 4CN9A 3JX9A 4XQGA 1CWUA 1CZNA 1J97A 1EK1A 1K86A 3AJDA 1KIFA 1Q7EA 4WGFA 1EJ2A 1MZVA 1D8AA 1UMBB 4WK2B 4C07A 4BECA 2SECE 1PNRA 2QQ0A 5JALA 4FONA 4WKPA 3BMQB 3QKWA 3PGVA 4UBJA 1Z5NA 1VP9A 4M9ZA 2JH8A 3EZNA 3TGWA 4DN6A 3N2EA 5TDHA 4X66B 1U9JA 3V34A 5L40A 3KRTA 3BTOA 1AN0A 1LZKA 1RYFA 3LKVA 3WC4A 3CPJB 4RPIA 4ZO8A 4N5IX 2CYCA 1Z6XA 1YKGA 2HBZA 3GDHA 4OXXA 2IS1A 4C04A 1GGHA 2X5NA 3FMPB 4W5QA 2P69A 4K9SA 4XFDA 4EKNB 4M38A 3WHKA 1QKKA 1EFPB 1A50B 5LLDA 3QEAZ 2P1RA 3A8TA 2DUMA 1F17A 3UWKA 4D46A 1XHEA 3GLIB 1QV9A 2FLWA 4MUKA 3KQLA 1LSSA 1TXGA 3N86A 5GM2A 4NBRA 5ECYA 2EZ8A 2ZUVA 3ZJYA 1ISIA 1LY1A 4GU5A 2W93A 3ZEAA 2VHQA 3VUEA 4M83A 4P53A 5J2TB 3TNDA 1XPUA 3M5CA 2I4LA 3ZV3A 4U7FA 2QGFA 1AXRA 1FUIA 4BLPA 2GEKA 1U98A 4YRDA 4OGFA 1QG4A 2FPWA 2KHZA 5KOYA 4PC6A 1LW6E 3GVHA 1LSUA 2BJVA 3SF0A 2V7GA 2ZIGA 2B4AA 4BNZA 3B13B 1ZCZA 3OD5A 3B1WA 5JT1A 2IS4A 1H1LB 2LCFA 4J3JA 3NIDB 4JYPA 3RRYA 1Q7CA 3WJ7A 3OZWA 1PK7A 1SXPA 1H1DA 2FZ4A 1K7SN 3ZGNA 5TQ0B 1IMOA 4TV9B 5D3ZA 5JE8A 1P31A 4KNVA 4WXMA 2PD4A 5TNXA 3IKTA 2QD2A 4NR0A 4KUEA 4HMQA 3QNUA 3EAFA 1L5YA 5BUQA 2O5RA 3OU2A 1F8YA 1L5ZA 2VQEB 5HJEA 5DWVA 5ED4A 2Z2JA 1M2VB 3HNOA 1VJ0A 3I5MA 4UHBA 5HKOA 3ICQB 3AILA 4QPDA 2EGHA 1X86B 3L0BA 2R6HA 4G56A 1RPJA 1KY4A 1GPAA 2AJDA 4D3XA 4PYLA 4YV7A 3HSSA 5JEDA 1Q17A 3LDFA 3OT1A 4E6PA 4IKPA 3D3EA 4G9BA 4H31A 4OTZA 1EGMB 4CF3A 1OT3A 2Q3EA 3G5UA 3KHKA 4QXAA 3KKNA 4W9NA 4F93B 2HMUA 3QX8A 2ICAA 2ZTVA 3AM3A 1PP4A 3OFSA 2XQKA 3L06A 3OICA 5BSRA 1SQSA 3RBVA 5IJWA 4MX8A 2CBZA 2M1XA 3CCFA 4RKRA 1L5HA 2RGWA 1WMDA 2CFRA 1CY4A 3QLTA 1N2OA 5HYVA 1JFFB 1QVAA 3NRBA 2CEAA 3E0QA 1NW7A 5CAEA 1KDPA 1M34A 3OA0A 4ZIRA 4BCDA 1Q0PA 3ESCA 2Z30A 2CK3A 3KJXA 1L2TA 4PGAA 1VMDA 5JNVA 1KY5A 1ZH6A 2AV6A 2C5SA 3BZBA 3SF8A 4NOJA 1CQPA 2ALJA 3PNLA 3NTRA 4Q9KA 2MR6A 2OHFA 3O1LA 3FB1A 3OOWA 1TCBA 1UDWA 3OKCA 4DJTA 4JT2A 4ARZA 2V9CA 4HLCA 2QW8A 4NV3A 3OI7A 3L5KA 1FXWF 3RTAA 4KX5A 1T4CA 4L16A 2XKJE 3DQZA 4DLXA 3NEYA 4MMZB 1UBUS 1JL3A 5BN5A 1BJTA 1QNFA 3CRW1 1SVUA 3MEQA 1WHSB 3EXEA 4FKBA 4KFSA 3B5IA 2A86A 2X2FA 2PZMA 5K3AA 3DV0A 1POXA 4ZYWA 2VCHA 1FFXA 4DCCA 4EPYA 2MINA 2R1TA 5A1TA 1DPFA 1XJQA 2P9GA 4TUYA 1NJSA 3NHSA 2AN3A 3OUZA 3S1AB 5JXJA 3CRZA 4X41A 2JJ2D 4JK3A 4GP9A 3L1JA 4ZV9A 2P77A 1SHUX 3Q4GA 5FF9A 3JRXA 3AEQB 2B61A 1Z26A 3NEJA 2WTAA 3VC1A 4A82A 1R7RA 1W36C 5TS2A 2NU7B 3KKMA 5A4DA 2PU5A 4KXXA 1CRPA 4A0FA 3DGFC 1U8EA 4UCWA 3GMIA 4ENVA 5HUJA 2O9JA 3M4XA 1XNHA 1T9ZA 2BFDA 5CX1B 3E7FA 5IT5A 4RK5A 2XLBA 3ID6C 4KFTA 3VTKA 2QRUA 3EVDA 5EZSA 4CIXA 1BCSB 3QKRA 5AUQA 5KJCA 2YXBA 1ZWLA 4L9RA 4RA9B 2P2DA 4NI5A 2MCFA 3LS2A 5LQCA 2CY0A 2D5AA 3ICEA 1X13A 1TO2E 3SJAA 1IHDA 3IOYA 1PJLA 3K9BA 2PSFA 2WLTA 2B8JA 3P2KA 3U49A 4DMFA 3U4QB 1VHLA 2PM8A 1I9GA 5JMTA 3EEOA 2XQVA 2C0PA 4Z6KA 1HYGA 1N2HA 1ADFA 1WUKS 2XDYA 4RW0A 4F5YA 4JQCA 1E2PA 2KX7A 3FWYA 3PNYA 4BJ5A 2GM4A 1W29A 3BIJA 1E2MA 2Q9CA 1L6IA 3DZJA 4QT0A 3VKVA 2JFXA 3EDMA 4EHIA 2B99A 1E2LA 1Q12A 2W2LA 4IQ8A 5BV0A 2ISSD 1DC3A 4FBGA 4IG4A 4XDZA 2EJTA 3R3HA 1SKAA 2J5RA 4ZYLA 4YK7A 4EENA 2Q4RA 2F8LA 2JDID 1P2FA 1RLUA 1FP6A 3HFGA 4EHKA 1P74A 3AVXA 1JHMA 3NHPA 4DNXA 5I9TA 1PBNA 3WGHA 2VTEA 4BMSA 2CVQA 2YX1A 3BF7A 5THKA 3OQMA 4K3UA 3PL1A 1GL6A 4HI0E 5LZ5A 1R74A 5HZKA 3EF1A 4UMFA 3JQCA 1JH8A 4RCZA 3U6KA 2PGAA 3HUTA 2IPXA 5J59A 1NG9A 3H6KA 3G2QA 3D4PA 4JROA 5TPWB 3RTDA 4JC8A 3CO0S 2H9IA 3JASB 3ZK9A 4C29A 2RGNA 5FCDA 1CP3A 4UZEA 3K72B 4ZZIA 4XVCA 5MN6A 5A9TA 1FMTA 4O3MA 1KU6A 5KTYA 3SQMA 2BL4A 5BN1A 3OJ0A 4XUGB 4KWTA 5FPYA 3X3HA 2XDAA 3LSYA 4X3OA 4D25A 5K6TA 4EI9A 3C5CA 4XWAA 4GZ6A 1DEAA 4YP5A 3TTUA 3WK5A 1MH1A 4R0MA 5B58C 1JE1A 1P6QA 2E4UA 1XK7A 2IX3A 1PR6A 2QK4A 3OQVA 3F8TA 2IDZA 1EQUA 1WXQA 2Y1XA 1E99A 1LVGA 4RFVA 4EG0A 4F12A 5E6RA 4MV4A 1XPJA 1DSSG 1T34A 4NCNA 1KYWA 1YBMA 4E2XA 1E96A 3HU5A 2GPBA 2QEQA 1UM9B 2WF5A 3GEPA 1RFGE 2QMUA 5YASA 4EUEA 2NW6A 3EVFA 2IP4A 2AN5A 4KH0A 5G0UA 3LK6A 4CQNA 2FSVC 3G17A 4J9UE 3IQZA 3HY6A 1LF5A 3L07A 4ZT6A 2UYGA 2QPAA 3E9CA 3FW1A 5AK5A 5ECDA 4FHDA 4EJSA 4YDRA 4MRMA 2Q62A 3RBAA 3EBPA 4PRZA 4N76A 2AOTA 4Z7QB 1QOQB 3DHVA 4NU5A 5F35A 3ZVMA 4RNCA 4V1CB 1XELA 4NK4A 3ZGZA 4WQMA 2P67A 2C9DA 3WIUA 1QG6A 2LXNA 3ASUA 1QFMA 1R0LA 3Q9UA 4CG0A 4DM4A 3A1CA 3PC2A 2OCYC 1Z0SA 3CLVA 4TWBA 2P9CA 4DADA 2RBGA 2YOGA 4MUGA 4YT2A 2YKGA 4NOLA 1WVIA 1CQJA 1ILEA 1QM5A 4GIBA 2RH4A 1M0WA 3HM9A 1XVIA 2Q3CA 4BQNA 4BCBA 1P1IA 1DWOA 2J30A 3KWMA 4FYJA 3KU1A 2PWBA 3IAAA 4GI1A 3BRSA 4LY9A 4GQBA 1XJWA 3QWBA 4NJMB 5C1IA 4X6XA 3WKEA 4EZEA 2R6CA 2XRMA 3E82A 1JDPA 3PDIB 4KDCA 2E4XA 3C4VA 1GRCA 1NLYA 3Q7IA 4L5YA 5L4LA 5DHPA 3O2QB 2P7HA 3UQZA 1R6BX 1DKMA 2YTZA 3Q1LA 3UWMA 1CSEE 4FFOA 1OFUX 1H42A 3OCUA 3F4KA 5JAMA 4D4LA 3TPFA 2HLNA 1XL0A 1FYDA 2XITA 2ZYAA 5B7PA 5A4KA 1YVDA 1YVEI 3AJ8A 4I1OA 2NZVG 4BWGA 4B33A 2C2WA 3LKZA 2ZTMA 1ZOPA 3F46A 5BRJA 4R1TA 5AVYA 3LLVA 5LM3A 5AI5A 1SBQA 4ALMA 1V9LA 2R1VA 4BVHA 1CUHA 2Q4DA 4KGVA 4BV9A 2Q4TA 1TCCA 3RKSA 1CZKA 4P4NA 2IYVA 4TV8B 4DSTA 3FJOA 5ITZA 5L7TA 2QUAA 1L4GA 4EM6A 1F7VA 1YVUA 2QDXA 1T1RA 3MRSA 4B3HA 1N8TA 4JNCA 4OV6B 4Q1VA 3G9ZA 2BFOA 3KTFA 4X20B 1P77A 1SVOA 2ECPA 2Q6OA 3UUFA 2DUJA 1V39A 4KMSA 3ND5A 5ENVA 1CVIA 4I4IA 3DOFA 3B89A 3FN4A 4KK3A 2WICA 1NQ5A 3NDIA 2IYWA 1XQYA 4UE6A 1EUDB 4EHJA 1XG5A 4FEGA 5DOZA 2R7MA 3DZCA 3IO5A 2BGUA 1E3SA 1EG7A 2DKNA 3M6FA 3OJXA 1KC3A 4XB2A 2KPOA 2ZRAA 4L4ZA 4MICA 4RIHA 4EBBA 1UBRS 3HDGA 2BZGA 2CXSA 4MQEB 4P35A 1PT8A 2IXGA 2VFAA 1OX4B 1QRRA 3T06B 3L92A 3TLAA 3NXSA 5E3JA 3EK2A 1E89A 3GROA 2J3IA 3OPVA 2C5BA 1ES9A 4S1PA 1DCKA 4OXKA 4Z99A 4C87A 1H2BA 5AW7A 3D81A 2J0EA 1O58A 3GT4A 2CLDX 4G84A 4OJMX 4WE3A 1MGPA 1ST3A 3U7GA 2BTEA 2Q7XA 2K5UA 2NU9B 4LHZA 1WZNA 1LDBA 4FU0A 4I8IA 2H06A 3ND9A 4JKIA 4PYMA 3EUFA 1HUQA 4I8XA 2VEDA 2BW0A 4EX6A 1JECA 3CE6A 3D3JA 4TYQA 2GEUA 5K0NA 2WHQA 1N0IA 3KPUA 3DMFA 2EJVA 3RVLA 3MLEA 3UUWA 4BNJA 1QFXA 1FNSA 5AQEA 3W34A 2QJFA 2QTVA 5EMJA 1TB4A 1GIAA 5CHEA 4DC0A 5KYUB 1EVYA 1IBCA 1P2DA 1Z9BA 2F3TA 3HB7A 1ECFA 4JOSA 4O4LA 3SGLA 5KYWB 4TVBA 1OBCA 5CTJA 4GOJA 4JI5B 1KYTA 2P0YA 2DOKA 1XZQA 4PYIA 3CWZA 4L2IB 3BGSA 2BISA 1YZFA 3OLCX 3FOEC 2FV8A 2WJJA 5EIAA 1AUQA 4GDMA 3G9TA 2YWFA 4UUNA 4EY8A 4XPIB 5B3LA 3TR6A 3PE3A 4PX2A 3PWSA 4EHHA 3IQFA 4NU6A 1MB9A 4RSGA 5FB3A 3VR5H 1BHSA 3TL2A 4N0DA 1P1CA 1N0VC 2QX8A 1GN8A 5CK4A 2JFQA 4PQGA 1K7CA 1G20A 3LUDA 1HSZA 2RC5A 3O84A 1WHTB 4AQDA 5A62A 1U3TA 2Y0DA 5AW4A 1NVVR 1FOEB 3UGTA 2NV6A 4AYXA 4EB3A 4MR9A 5FQOA 1ISGA 1GZ5A 3QMMA 3TTXA 3A4NA 4YUXA 1W1IA 5AI9A 3K35A 3FTFA 5M2QA 3T7EA 5AK0A 1HE1C 1PDVA 2R4TA 1XTIA 1HLFA 1HE4A 1PF7E 2CMHA 1DBVO 4J43A 3WL8A 1M6VA 1QYRA 2G82A 4M99A 5E1DA 1HEUA 1OFUA 5FPHA 4BNNA 2D0DA 3IOCA 3OKPA 3O8QB 1Y6FA 2W2KB 2O50A 1NUSA 3U3KA 4IQGA 2VJMB 3H1PA 5EEHA 5DT2A 5KKCA 1TIPA 4WN9B 2WUWE 4XVQA 3L7MA 3T3GA 1KK3A 3ECAA 3IR5A 1Z56C 4NNJA 2A92A 2XIJA 3BYZA 2E18A 4OUKX 3THSA 4MVYA 4G9EA 2PRIA 1LPPA 2GLUA 3BWYA 3ORFA 3UJDA 3I6MA 1F8GA 2FK8A 2VL7A 3BN3A 3GA5A 4JCOA 3AG6A 4EFKA 5BUZA 5JJIA 1COWD 1UOOA 4U2GA 4WESA 5IT4A 2Y1WA 1LXCA 4V0OA 5D8DA 1C14A 3N2NA 5AVUA 3EXHB 1I6WA 4MB2A 3KYBA 2ZR9A 4MITA 2QBYB 3NB0A 2Q4OA 4YQZA 2OO3A 4IG9A 4OHOA 3H3XA 2F55A 2VRCA 4FYHA 3C3DA 3A2KA 3BVPA 1W5FA 2XECA 2VF5X 3U44A 3AYXB 1VMKA 3QPUA 4UVGA 1MP0A 4GC9A 3VNAA 3K70B 1CEYA 2OCLA 3HCDA 4JJ7A 4OAOA 3PQ2A 4ZVVA 1IBSA 4TLEA 3U1VA 4PC3A 3R0VA 4MQFB 3SZOA 3KAPA 1YS7A 2WT9A 2AC4A 3WWPA 4FUTA 4OMFG 2ZB7A 3QHAA 5L4NA 1ODKA 3R3JA 3ZXSA 2HV8A 3KJIA 4YRAA 2ZRBA 4G85A 3ZDCA 2G40A 5AKLA 2X9VA 5I8PA 3PEVA 1XLVA 2F9FA 1EWKA 4P58A 1XXHE 3WWCA 3FTPA 3ESXA 2O14A 3L05A 2ZDHA 2NUPA 4TROA 3CVYA 1YZHA 3I4LA 5LP6C 3ONEA 3RRZA 4AKTA 4BU1A 3PC8A 2QP9X 1KYQA 4KDEA 1YBVA 4KJZA 4M9UA 4UW9A 5ALHA 1DDGA 5JNTA 1TQ8A 2A35A 5JD3A 2EWVA 3GGDA 4AO6A 4YJ3B 3KEMA 4OAQA 4BDTA 3FWZA 1Z0DA 3KHSA 4XZ3A 4ALLA 3G2LA 4HL6A 1CRQA 2Q5FA 2Z5FA 1SVNA 2GBCA 1GU0A 1Q2UA 3KTAA 3EGDA 4BIMA 1V7PC 2JJ8A 2ZSAA 1JPNA 2UVDA 2C61A 3P9PA 3IBFA 1ZJJA 3IXLA 3FZEA 2NYVA 4V3BA 2VT3A 4RZ2A 4HQ6A 4PLZA 4BNIA 3L0PA 4JCCA 1XZIA 1TOAA 3UICA 3CEJA 1OH8A 2ZAIA 2YC2C 1LWOA 1NC1A 2B9VA 2Y1GA 2IIPA 3IEPA 4AN0A 1F5NA 4GVPA 4RTJA 1TUBA 4BFTA 3GWZA 2GXUA 4Y18A 3E7XA 1UPFA 2RGEA 5CW2A 1X39A 4EA7A 3KJGA 2AX3A 2XQJA 4O8CA 1E9FA 1EFVB 1NNLA 1NPYA 2QQGA 2OHOA 4HTFB 5EQTA 3W5UA 1CR4A 3ZWBA 4CMKA 1R6AA 4F4CA 1KJ9A 1JU3A 2X9NA 4BYGA 4E2WA 4DCJA 3A11A 4PLWA 1P17A 1KK1A 1C3OA 1WKCA 3JALB 1EM8B 4JT4A 1NVMB 4KIGA 5ERYA 2VSQA 3KX2A 5KQPA 2FRDC 2RG1A 3DNPA 3GH1A 4PLHA 2B0JA 3RUEA 3UG7A 4A2WA 2P4SA 4PO3X 1SHJA 1TA9A 3D0RA 3T7TA 1O57A 5D1NA 5CA0F 3RJZA 1E6KA 1BGXT 3ME5A 4LDPA 4X0EA 4RYLA 1G7TA 3KAQA 1ZM9A 2ADMA 4JYAB 1LH0A 1O03A 1E6CA 1IVNA 2Z2IA 2OZEA 4US0R 5TV2A 3NHWA 3LUAA 4P3KA 3H5IA 4IRXA 4V0ME 3VC3A 4F2DA 5B1EA 2VNIA 4RTSA 2F9LA 2QTRA 4G63A 4MPTA 3USES 1SEVA 1CFJA 3ECCA 3PUVA 1ZK1A 5C1BA 4IZOA 1KQGA 4WA8A 2YWRA 4HFJA 4ZQHA 1FNDA 4ZT5A 2GX6A 2O8FA 4F4IA 1CEXA 1Y8QB 2OK8A 3EFBA 5AKHA 1ISRA 2OMKA 3ONNA 4RDCA 2CUKA 3SM3A 5M34A 3FTNA 3TQIA 3OLXA 4LZAA 2OSBA 4XYBA 2X8AA 2OOSA 4RTRA 3AB3A 4R81A 2WINI 1VMAA 4ND6A 3RHTA 3TINA 4AZ3B 4KCGA 2PO7A 3S7TA 1T5IA 1Z35A 1HDZA 4RPGA 5UKDA 3T9CA 4H6XA 4C6HA 2QN6A 4FDUA 1DJPA 4G1VA 1U1EA 4CODB 4GKAA 1JHZA 1F2TA 1W6RA 2HWKA 2FQQA 1SCBA 5EFZA 3RKUA 4KYIB 1TJPB 1E2EA 2C95A 4LNAA 2NGRA 3B53X 4LJ7A 4MI1A 1ENOA 4N5NA 1L7DA 1ZEJA 2GZMA 2ZSFA 4BU0A 1OOEA 4KE6A 1L5MA 3V00A 4WBNB 3LCMA 3HQ4O 4YDHB 4ZI7A 2IWRA 4YV2A 2ZDQA 2QZZA 4ZU3A 4KAJA 4LC1A 3V4RA 3ZYZA 1VJRA 3T1VA 3QU4A 3VHXA 1KRHA 1CB7A 2OCIA 4X6LA 1Y81A 4G5QA 1BDIA 2G09A 3HU2A 4A1OA 3DL2A 3K0BA 4IX1A 2QTBA 3GG2A 4ZAGA 1X8LA 4A2QA 3ZLVA 4JLMA 2BUCA 3L6DA 4HAIA 4X00A 2QX9A 3PFWO 1WUHS 3DCIA 2O2DA 3HKBB 1MVNA 2ZAMA 4CR6A 4S05A 3LPCA 1ZISA 4LHVA 3ZWNA 2QUJA 2P2YA 2Z09A 1HDRA 1N8KA 3AR4A 3V4LA 1S8FA 3UXYA 3ETJA 3M70A 3PVZA 4GS5A 3RUDA 2VQDA 4ZTUB 4RQBA 4RV4A 1G9TA 1OU0A 4NE9A 4QYMA 4XLTA 3F5DA 2MYUA 2E1PA 2GOYA 3W90A 3K9CA 2ZI3A 2ZRCA 4LK3A 1LI7A 3AFNA 2NZXA 1A2QA 3WKCA 4HEHA 1SG9A 3M4YA 5AKKA 2HU2A 3O9ZA 3F6PA 5IVDA 4PR0A 5AFSA 1VG8A 4Y2PA 1FZQA 4L0DA 5E8JA 2ISQA 4HAXA 4CQMA 5B3JC 1W0KD 3CLRC 2E7ZA 2K4MA 1NW6A 3WL3A 4ZO6A 5G0SA 3PYXA 5BOVA 1N4AA 1VKZA 3DOHA 5AQ1A 2GF0A 3BE5A 1FFDA 2VTVA 4NSNA 1P7CA 3IPAA 4GWGA 4P4UA 4K6MA 4O2LA 1V16A 1B6SA 4AY3A 4EELA 2VNSA 3OJCA 1CJSA 4DNFA 5EJ5A 1XF9A 1EIWA 5AXCA 1YQEA 5I7AA 3W5SA 2RKOA 4BQQA 3N2GB 3ZCPA 2C3MA 5BQOA 3RC2A 3DBHA 4G01B 4BNDA 2A67A 5BW4A 3RK0A 4ZVPA 3NWBA 3OCXA 5L8VA 2VZ0A 4X8HA 2LD4A 5EXDA 1P7YA 3V1NA 3AF1A 3F0TA 1ZXXA 1NBMD 4FHEA 3AZOA 5C37A 1M75A 3DEZA 3KB8A 4R2JA 3TAXA 4ZYTA 1AG9A 4QT4A 1LC3A 4CCYA 5E2BA 1KZGB 1Z0FA 2KLHA 2QHXA 2VDOB 1A9XB 2Z0MA 3EXG1 3KKOA 5IMBA 5HFNA 3VPCA 2TSYB 4EFNA 1U28C 5JYDA 3JAMA 4D4IA 2ZTHA 1HDIA 1S2LA 1T9CA 1VSBA 3FR8A 3F6RA 3NHLA 1S3GA 3D8RA 1G4AE 5LYJA 5H9WA 3PLNA 4IKOA 5CU7A 3GRFA 4RFSB 2CVHA 3ACDA 4Y67A 3ZD9A 5HMMA 2HJVA 3A4VA 4B3FX 1FPMA 4BTEA 4D3FA 5J4LA 3BGDA 5EIBC 5K0ZA 3N59A 1ONBA 1XVLA 1U8ZA 2ST1A 3FGNA 4OH1A 4CF4A 1TEHA 2IHVA 2JCSA 3KD3A 5JLAA 4DQXA 1DTWA 4R9NA 1PFGA 2VJAA 3ED5A 3SQXA 2IHKA 1RYHA 2BGNA 3VTFA 3L6BA 4FDAA 4L0MA 3NIGB 2VP0A 4BN5A 1ECLA 3VV3A 1H2WA 2H2HA 3E27A 1TT5A 4AJ1A 1I2ZA 3DG9A 1NXXA 1ISPA 2QD3A 4A27A 4ZMSA 4YAUA 1W581 2XRZA 1H4SA 3AOEC 2C82A 1KI6A 2O48X 3TTWA 2ZIUB 3VGJA 2QG6A 3V8PA 2A0UA 3IEKA 4C4XA 4DB2A 3W9SA 1XRPA 3HVUA 2OFOA 3LPAA 3MK31 3QLVA 4MCHA 3FCEA 5HQ3B 4WK0B 2GN1A 2GN4A 3MC1A 4ITUA 3DQPA 1OTYA 3E7DA 4XLZA 1UP6A 3GRAA 3I6BA 4MS1B 1T2AA 1OLSA 1GYPA 3A6LA 5K3SA 3MWDA 4JP5A 1F48A 1OIVA 2GZ1A 1GXSB 4I14A 1K9SA 3LT2A 4OJYA 4MCAA 5SYNA 4MINA 1TJNA 3P9SA 4KG7A 4QOSA 3W8EA 4W1RA 5CD9A 2E37A 3D6JA 2OZLA 4H60A 4D97A 4DEVA 2JFBA 4HWSA 2EJCA 2P6RA 2CCJA 2JBHA 4C7KA 3LBFA 4ZYUA 2D5CA 4L8VA 3EC7A 2QI9C 4EEKA 4LPSA 4M6WA 4RGQA 1UKAA 4YXWA 1RR6A 2DR3A 3UAVA 1VBFA 1LK0A 1CYEA 1C4XA 4MW9A 1HORA 3CB2A 3RS9A 3IYLW 4GSYA 4O3FA 3VHRA 2HZ7A 1BXKA 2GD6A 4ZRMA 1E2BA 3EIFA 1N8SA 2AG5A 2B36A 4MW2A 3RU3A 1XD2A 3G2OA 3QXSA 1D7AA 3D7NA 4CMEA 3UZUA 1AQLA 1R6VA 3Q40A 3WNQA 4MR7B 3WMWA 2WYHA 4HFRA 4BFZA 3QXHA 3MWJA 1R0CA 2CBXA 4B17A 4D8UA 3WRVA 1Z6TA 3EB9A 4GMHA 4DM7A 5F1OA 1YFJA 1V5FA 1ZN7A 2HDNB 3R6LA 1NG1A 4OLAA 1P9LA 4KXNA 2X6TA 1NI4A 1ONOA 5AXBA 3ZV6A 3LCCA 1J4AA 2D1TA 2EJUA 1L7VC 2XWQA 1EK5A 4OLFA 2O5CA 3F47A 1JEYA 4L08A 3NUZA 4AM8A 5HCUA 4YP7A 4OUDB 5GOTA 3A26A 2O8NA 2JH3A 3OCCA 3U9LA 3BMNA 4B75A 2PWYA 2UUOA 1SU8A 2WUDA 1C81A 5KOJB 3QLUC 2BH2A 3RFUA 2OKCA 5TJHA 1XN1A 2GGSA 3A6HA 4OHRA 3OOYA 2RK6A 5DYGA 2Z6UA 5ED0A 3ZUGA 3A4YA 3LG2A 2NZUG 1C0KA 3KJHA 3ZE0B 5KZMB 3QKSA 1JSXA 4RMIA 1R10A 5DTJA 5BV7A 3ROQA 4M0PA 4Q4HA 5DISB 1EBUA 2W6ZA 4KI7A 4FMDB 1QFSA 1JIKA 3AY3A 3OQHA 3DO5A 1WULS 2WJAA 4ZC1A 3RNOA 9ABPA 10MHA 4X1KA 2TMKA 2QU7A 2QRNA 3U4CA 2HCJB 3WGTA 1IXZA 2C4UA 4OYRA 4UKDA 3RADC 5IC6A 3JSXA 3S8MA 4Q1CA 2Q3FA 1MENA 2DRIA 1QYVA 2Z2YA 2BUAA 3U4HA 4YCSA 1HT2E 2PPLA 2VTDA 2X2PA 3BMOA 2AZXA 5E9WA 1U0LA 1WWKA 3DPSA 2NTEA 2R87A 2IRWA 3HXKA 1XTTA 3GLHA 5AVSA 4O33A 4AIIA 5JLJA 1ZM2A 2V4ZA 4C4SA 3LECA 3GYGA 3BGVA 3OPQA 4YMVA 4P3OA 2RKBA 2X6QA 1U5CA 4TZTA 2NO4A 3HHPA 2FPPB 3SEZA 2FZGA 4J90A 5FBVB 3GLFA 3C1OA 4A15A 1YHYA 1Y9ZA 4M9SA 4WL0A 1KSGA 7ADHA 3UGJA 3VX3A 1FXWA 3CJRA 3W7AA 4BS9A 2BRUA 2I2XB 1CPYA 5E4JA 4GX0A 5FLYA 4BDSA 3GDFA 4ZK6A 4R1QA 3GF4A 4MWSA 1KQNA 5C5CA 1CDZA 3V2IA 3UWPA 2JFNA 3PXAA 1L4UA 3M6XA 1IYZA 3GGOA 3NBXX 3FUWA 4LG1A 4HDMA 1D3AA 1DC4A 1Z4QA 1S7CA 2VDUE 4C3UA 5CT9A 4XXHA 1V5IA 3ENWA 2QTAA 1T6XA 2V6JA 1ITZA 2Q5OA 4W99A 4GOMD 3M34A 3QPVA 1XUOA 4WNIA 3DYBA 3AJRA 4KLAA 3PQ6A 2OB1A 1VRWA 1B43A 1CJMA 3DEYX 2HJWA 1T5HX 1XWFA 3VA7A 4TRMA 2Q29A 1LEHA 1IN8A 1DP4A 3ZJ4A 1D5CA 1WNFA 3SZ3A 3C1TA 3NWOA 5HKBA 2ACWA 1YR7A 2OXIA 3ZI0A 4R8MA 2HMTA 1JW9B 1BCRB 4CUKA 3DMDA 2GF2A 2PMFA 4CM5A 1NAHA 1VBNA 1YSCA 4ALJA 4DMLA 1Y9EA 1ABFA 2COUA 3EMBA 3ZR4B 5LKRA 2DLCX 1GL3A 2QMOA 5KJEA 1A4RA 3MQ2A 1NF2A 2JGRA 3OA2A 4DMUB 5BMOA 1D0VA 2A4MA 1BDBA 1YDEA 5GVSA 2Q2NA 3Q9SA 1TKCA 4WZAE 5G0TA 3S2ZA 3KXDA 1C7ZA 2VZ8A 1M6WA 3AX6A 1F51E 2UV8A 2I6FA 1G98A 1IHOA 1HRKA 2D54A 4MUIA 5A4FS 3I64A 5LOVB 2GSDA 4KWCA 2P7IA 3FPCA 1NW8A 2Z1DA 4AS3A 1EAYA 4D2IA 1WZIA 2BKVA 3CF6R 3RVOA 4GMKA 4P4SB 3QQPA 1RMYA 1UBHS 2PGDA 1VC2A 3CSSA 2I4RA 4KO3S 4NRDA 2PT5A 2XA2A 4INPA 4MIEA 2BI8A 2XW6A 3E23A 4LJ5A 5HDQA 1SQFA 3LQ2A 4DW8A 5IM4F 1OAAA 3V6MA 1G59A 3WL6A 4WBXC 2Z08A 1KMIY 3DAFA 2C77A 5EHGA 2JI7A 5C8DA 2YOFA 5CLFA 2R85A 4KOEC 1EDZA 4K6FA 1JQLB 4G07A 1A8QA 3I8XA 2YV2A 2VWPA 4CG1A 4X6YA 2PO5A 1D0IA 4NTZA 2O8CB 2JGDB 1EVIA 2IL1A 1ZVKA 4KQ1A 1NM5A 5FHRA 2VWHA 4RF3A 1WMEA 2P9BA 1L5VA 6ADHA 1VPLA 1UC5B 3WJ1A 2Z3ZA 1FYXA 1X42A 2CZCA 1W47A 3DKRA 3S8EA 4FDMA 2MSKA 1BWRA 2I6SA 4ER6A 5E8RA 3UW1A 3GUVA 5D3MA 3ZWXA 1ILWA 1SN7A 1T8PA 1PI3A 1TQ4A 2VP3A 4GLFA 1NMYA 1XVTA 2EP5A 5K3FB 1G2PA 2QRVB 2IY8A 1PJTA 3C97A 4LWZA 2P0AA 1FSZA 4L3VA 1MIHA 4MDYA 1JDNA 4ZK2A 4IGAA 3VDQA 1T8SA 3NIFB 3IVAA 3STTA 5IPFA 5MHTA 3PNKA 3ABRB 3LT5A 1P6UA 4J4TA 4IHKA 1ESCA 1KOJA 1MJ5A 4E2FA 1EFRD 4WACA 1X3LA 2QGZA 4LZLA 3AONB 1NYRA 3L1VA 3GVXA 4FD2A 2BM0A 4YPVA 2JFWA 4C4OA 4DCMA 3FCOA 1RACA 4ENPA 3HL4A 2G5TA 5E7JA 2C5FA 1W5TA 3WO1A 3W5IA 4Q9NA 3BBLA 4KLCA 2H48A 3WRWA 5COBA 1VJTA 3L0SA 1J22A 1JG1A 1UMDA 2EATA 3EW9A 2F6RA 3FAKA 1IOLA 3HB4X 3K0HA 3KFLA 4RIIA 4Y98A 1XZ8A 3ICVA 2O2JA 3FNRA 1MRSA 1GG2A 3IELA 2H5EA 4IHJF 4L50A 4QHSA 3QJGA 4XIGS 3VQTA 1QK3A 1R8SA 3LI2A 4GKBA 5A1JA 2IU6A 3LBIA 2QRLA 3HKEB 3QUAA 1Q3HA 3RC8A 3KOOA 1G6Q1 4IIXA 2QZSA 2W2OA 4TSFD 4W9RA 5AOVA 1QV6A 3LBHA 3PSHA 4OQLA 3MCVA 1IVYA 4PR3A 3RDPA 1PDWA 4MQMA 1DEOA 1KH1A 3N0WA 4ARCA 1K88A 3LRTA 3I53A 3IR6A 3PWKA 4KQ6A 1FW8A 4PYQA 4U8HA 3W04A 2J5BA 1ODFA 4X44A 2VQSA 3GG9A 1YDFA 4KHZA 3LGSA 3E3OA 4R8KA 3LQ1A 4S35A 4B4KA 1N2CA 1IATA 2CE7A 1T2FA 4UNIA 4CCSA 2OM6A 2WPNA 3KTDA 4M1YA 2V45A 4M49A 2IEIA 2OBXA 3HP4A 2YXPX 4PWYA 4BB6A 2IUFA 3QJYA 4ABTA 4KXWA 2WVHA 3CT6A 4CIWA 4I50A 1VXOA 1PD0A 4AZTA 2NZ8A 3ER8A 2O6LA 1E1DA 2PZJA 4RF4A 2C9YA 1NVWQ 1RQNA 1P18A 1E2KA 1XZFA 2A14A 3AHCA 3FD8A 1EXWA 4KIJA 2H2WA 4LZZA 3D6HA 5T6BA 3UMJA 1D07A 3W5VA 1AKQA 4XH9B 4X7RA 2XKKA 3LD9A 3AF0A 3BH0A 4A8JC 1AY0A 1HFJA 2FFQA 3FMFA 1MIOB 4LXUA 3BILA 2ECKA 4YRIA 4N6NA 3B9QA 3W2IA 3UJCA 1UK6A 1V95A 3K6SB 3MWKA 1QONA 2J07A 2RHWA 4QDKA 3O75A 3CRNA 2VZEA 2R751 3B85A 1J0DA 1PT6A 2F1OA 1P81A 3O4GA 3QWHA 7GPBA 1EHYA 1TC2A 1W48A 2L82A 2LKDA 3NHMA 1ZJ5A 3UFBA 2XIQA 4B7XA 4KBYA 3OFVA 1KVUA 1B6GA 2QU8A 4MKZA 1FU4A 1S0UA 2D7CA 1L8XA 4KVZA 1WCIB 4JNKA 3CX3A 2YQZA 3V80A 1XZCA 2CLIB 5D87A 2RHGB 3WB0A 4AJHA 4CIDA 1KYYA 1O89A 2W6IA 5EQFA 3UV7A 3OIVA 3PK0A 1L5RA 1IQ0A 3K1AB 2QRJA 2IHNA 1P7PA 4TVKA 1BHQ1 4L4YA 1LBHA 1NOJA 1XZLA 3DFFA 4B74A 4MHSA 4OQYA 1KYZA 3PNBA 1IAQA 3VR2D 1MAWA 4E5PA 4JLKA 1V9CA 1ZD4A 1SC6A 5FNVB 5KJ6A 2HD4A 1X1QA 3FDZB 4RK1A 1C1YA 5KSPA 3IERA 1QPZA 4Z54A 3LQQA 4YIHA 1CQIB 2NVBA 1BROA 2BF7A 3L0DA 4DR3B 1NVVQ 1TEXA 3CNNA 2D06A 4ZVSA 1C0IA 3TZLA 4C14A 3ZH9B 3T4XA 2KSQA 2XKBA 5KIAA 1KY3A 2J9FA 1R1DA 4U4AA 3ETGA 3GAMA 3H1TA 1SCKA 3KR1A 3P4XA 4MB6A 4YUAA 1OYWA 4DDHA 3ZVKA 3DDUA 2R5FA 2WHPA 2AJBA 4PGGA 4B0PA 5GWXA 5T4BA 4HNQA 1DG9A 3DWFA 4WN9A 2NXWA 3BREA 1Z6YA 2XRFA 4URZR 2I4MA 2VHCA 3HJGA 4MS3A 1UBLS 4NX2A 1XMOB 3GC6A 1QU2A 4YN3A 1Z6QA 2M9MA 2PS9A 1A95A 4E4YA 2UYCA 3NTXA 5U1PA 4TKZA 2RGRA 4MYTA 1D6MA 4C5AA 2R8XA 3ZHZA 3EVGA 5IBQA 2IHUA 2QRQA 4KFCA 1M5TA 2UZAA 4PAWA 4LGMA 1E1YA 1HOTA 2XKAA 2QAGA 4X97A 2OYCA 5HHTA 5KUTA 2P1DA 5HOEA 5IKOA 4Z8XA 3OM1A 2CHFA 2QMYA 3FG9A 1RQ7A 4C03A 5CFZA 4X9XA 5H5JA 1HNNA 3FXAA 1RYZA 3ABSB 1AHHA 1ND6A 2Z4SA 1OJLA 3KZ1E 4AXBA 1FMFA 1JBQA 3FSGD 4UNRA 4I1PA 3OFKA 3ZNOA 2G71A 2YZ2A 2DFKB 1G8SA 2VF2A 3EGXA 3UK7A 2RGBA 1WAMA 2HLPA 3H86A 2RHDA 1NA5A 2XRYA 6REQB 4N41A 1BDHA 3VU9B 3K05A 2FJUA 4DIOA 2EX1A 2XYVA 2KBFA 3VZSA 4J8PA 5LD2B 2I22A 3AVPA 1A04A 2D1FA 2QUHA 3ZQ4A 1O2DA 1IB0A 3KYIB 4KSYA 5L3VA 3L6CA 2YBDA 4V3CA 4DZRA 2L69A 2J41A 4KPEC 1ICEA 1MV5A 4JP3A 3MQFA 1H5NA 3FPJA 3WWEA 3AI2A 4H08A 1AKUA 2GXQA 4TOIA 5KX5F 2DBYA 2AXPA 2FP4A 2H2DA 5DPMA 1WPXA 3DL7A 4B8WA 5JAPA 3LTNC 1E6LA 5AM0A 1TYCA 5EZYF 3I0ZA 4DM3A 1BDJA 2HRDA 2V74B 2ZRLA 1KSJA 3FHOA 3K1ZA 4KU4A 2HTEA 4PE5B 4K9PA 3RODA 3TOVA 2WB2A 4DB4A 2WYIA 2QYSA 3KM0A 3X2EA 1UKEA 2X15A 4JT9A 3IXMA 2LRHA 3BGOS 2WF8A 4EQ6A 4WKGA 5BSMA 3GLGA 5DRTA 3SN6A 3UJBA 5KYVA 1W5BA 3U48A 1KWKA 5G1OA 3S8YA 4XWYA 3O92A 4EGFA 1G17A 1JLHA 1YQDA 1OB5A 4G0WA 1AKWA 2FEPA 2W8BB 1E3LA 2B4TO 1C2YA 3UK6A 1F5SA 4DJJA 4G86A 5CH3A 3CVUA 4LHEA 2H5IA 1AXGA 3NALA 3T52A 3W3AD 3L8EA 1MAUA 1UT6A 2RHMA 3C6BA 1AURA 3ETHA 4TQAA 1TYBE 3V8MA 3W3ZB 5A03A 5A9RA 5JZBA 2EHDA 3TE7A 3WE7A 2CLHB 1DWPA 3SK0A 2H65A 4YEDA 2PPVA 3NTOA 4RE5A 3THOA 1BRTA 1UJ4A 2QSJA 3EF0A 4I2NA 1W96A 5DNDA 1L5GB 1BGVA 1REQB 1UDRA 2OCDA 4DBLE 4NFSA 4BX2A 2HJRA 2ZAGA 3KE9A 4LCEA 3G59A 3ZKWA 1N77A 2EBFX 2F64A 2LV8A 4MO2A 3V4PB 2PX8A 4DIUA 3LJKA 4HYTA 5B2ZA 2DPXA 4BVKA 2JZNA 3PR1A 4UQPA 4AJIA 2ZM6B 1A27A 1WKVA 3OAAA 2OYRA 2AG6A 4B3XA 2I9KA 4D9JA 4ZVQA 2QG9A 3C85A 1YL7A 3WGOA 5FPTA 3IQXA 3N7AA 5KYXB 1JR6A 4PCVA 1O6FA 1ZGZA 5IABA 1QGZA 4OY3A 2FPIB 2C5AA 3GDWA 1GQQA 1UAYA 3DKKA 2D74A 3D3KA 4TS4A 3CNQS 4NCHA 1EA7A 2CF6A 3DE1X 2BHSA 2WJWA 3V97A 4YRBA 3HO1A 1I3KA 3GEIA 3SYLA 1I5RA 5SYMA 1YE5A 4M7OA 3QKTA 5T3YA 2HDHA 2VN8A 2ZRQA 2AG8A 3O21A 3EW7A 3PGMA 1VL8A 3OBBA 5CRIA 3EZFA 3IESA 5LXTA 2OC9A 3QWFA 3QBJA 2WR8A 1GHTA 5IAGA 4C89A 2CMFA 1EK0A 7REQA 1HI9A 4GD3Q 3AVTA 3LIIA 2WYUA 1R9JA 2OYSA 3S55A 4E7OA