3C74A

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
242
Chain Sequence
b'SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 82
structure length 242
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c74A00
3LGSA 3OZBA 4TTJA 4FFSA 5CXSA 4QFBA 1LV8A 4GMHA 5F78A 3C74A 4D8XA 1SQ6A 2I4TA 3OPVA 3GB9A 1PR6A 2P4SA 4DABA 4K6OA 2AC7A 4TXNA 4LZWA 1T8RA 1K3FA 4TS9A 1SJ9A 5DK6A 1Y1SA 4QAQA 2BSXA 1U1FA 4QASA 3F8WA 3OCCA 2HWUA 5IU6A 1YR3A 1JDZA 1Z36A 1RCTE 1A9QA 3K8OE 4MCHA 1PWYE 4L6IA 3BSFA 1M73E 4MARA 2A0WA 4F1WA 3OZEA 3KVVA 2QTGA 1RR6A 3DP9A 4WKCA 1TD1A 2A0YA 1V45E 5C80A 4D8YA 2A0XA 4L5YA 4OGLA 4IP0A 4UC0A 4JWTA 1Q1GA 1Z5OA 2QSUA 4YNBA 1U1EA 5CCEA 4LNAA 5EPUA 2RJ3A 3OZDA 3OZCA 4DA6A 4TTAA 4JOSA 1V48A 5FAKA 3PNSA 2QDKA 1TGYA 3LA8A 4NY1A 3FNQA 3INYA 2AI2A 3KUKA 2OECA 4OY3A 2HRDA 1Z39A 1PR0A 1QE5A 1NW4A 1N3IA 1LVUA 1PK7A 4X24A 1JE1A 1VHJA 2HSWA 1TCUA 1ULAA 1PBNA 4EARA 3NM5A 1PR2A 4YO8A 1G2OA 5CYFA 1ZL2A 1PKEA 2HN9A 3FWPA 1K9SA 1CB0A 1ODJA 5F7ZA 2QPLA 4L0MA 3FOWA 3BJEA 1JE0A 1RXSA 4DA0A 1Y6QA 4I2VA 3FUCA 5B7GA 4M1EA 3P0FA 1JDSA 3K8QA 1A9TA 5JPCA 1Y6RA 5KB3A 4WKOA 4TS3A 3PHCA 4DA7A 1WTAA 4LDNA 4TXMA 4BN0A 5B7PA 4TYMA 3EEIA 3MMSA 3GGSA 5CCDA 5B7QA 3E9ZA 3UAVA 1I80A 3ENZA 1JDUA 3UAXA 1A9OA 4TXLA 1Z38A 1OTYA 4F2WA 3OOHA 3TL6A 3EUFA 1TGVA 2ON6A 3ODGA 1Y1TA 4OJTA 1OU4A 1T0UA 4DA8A 1OUMA 1YBFA 4GKAA 1RT9A 4R2WA 1OVGA 3NBQA 3E9RA 1NC3A 1JP7A 1V4NA 1ZOSA 4WKBA 5B7NA 4YMLA 4PR3A 1Z37A 1Z5PA 1RYZA 1VMKA 4GLFA 5F7OA 2OXFA 2AI1A 3O4VA 5I3CA 1OTXA 1LX7A 4MCIA 1TCVA 2ISCA 4U2KA 1PR4A 3MB8A 4DAEA 1CG6A 1PK9A 4R2XA 4G41A 1ECPA 3DDOA 4D9HA 1OV6A 2OC9A 1RSZA 5EUBA 2AI3A 5F76A 4G89A 4LNHA 3UAZA 1VFNA 3BL6A 3QPBA 5ETJA 4WKPA 4BMZA 4F3KA 3UAYA 3O6VA 1RFGE 1T8YA 1A9SA 4D98A 1T8WA 4R31A 1Z34A 3DF9A 1Z35A 3KHSA 4M7WA 4TXHA 1JPVA 1PF7E 3NM4A 3ONVA 1K27A 3U40A 3FB1A 2Q7OE 3BGSA 3NM6B 5EFOA 1SD2A 1PR1A 4E1VA 1VHWA 2OC4A 4QEZA 4L5CA 3UAWA 3PNPA 4DARA 4G8JA 5IFKA 3PHBE 4ECEA 1JDTA 4QATA 2QTTA 1PW7A 4OGKA 2I8AA 1YRYE 1V41E 3EMVA 1JYSA 1RXYA 2PGAA 1B8NA 4EB8A 4D8VA 1SD1A 4LKRA 1U1GA 5F7XA 3KU4A 2IQ5A 1FXUA 4RJ2A 1A69A 1RXUA 1A9PA 3KVRA 3T94A 3E0QA 1ODKA 3OF3A 3LBAA 3EUEA 4L5AA 4OF4A 4NS1A 3IOMA 1Y1RA 1T8SA 3KVYA 4BMXA 3D1VA 3UT6A 3SCZA 4OEHA 3FAZA 3DJFA 1XE3A 4KN5A 1V3QE 1Z5NA 1Y1QA 1A9RA 4PNPA 5F77A 1ODLA 2H8GA 1RXCA 4F3CA 5F73A 4H1TA 3DPSA 4TXJA 4YJKA 4P54A 5CXQA 4BMYA 4WKNA 1Z33A 4TTIA 5F7JA 1U1CA 1U1DA 3IEXA 1ULBA 4DANA 2B94A 4DAOA 3OOEA 3P0EA 4GLJA 4F2PA 1V2HE 5CYGA 1ODIA 1YQUA 1B8OA 1NC1A 4M3NA 1PR5A 5K1ZA 4JP5A 1YQQA 1C3XA 4NSNA 1JDVA 4QARA 2XRFA 2A8YA 2GUWA
chains in the Genus database with same CATH superfamily
4DUPA 2OG2A 4B3IA 1I36A 5TPZD 4XLLA 2C9DA 4AZ3A 4DV2B 4A6XA 1U3GA 1U0NA 3LLUA 4GI3A 4BQEA 1BS9A 1SZCA 3GJ5A 3U4DA 4GKKB 4M0PA 1X9IA 5JT1A 2BFEA 4YAOA 5I5EA 2TMDA 3H1PA 3LKDA 1X14A 5JWOA 1VSBA 4I5FA 4IQGA 1WM1A 4ECAA 2DSNA 4WACA 2F43B 3HGTA 3I64A 3OTOB 1YDGA 3NYIA 5P21A 3LTNC 4JZYA 2KPOA 4LSGA 5J58A 2ACEA 1JB1A 4O5OA 1VKOA 2GM5A 3QUQA 3TM5A 2AR7A 3CUWA 2IUYA 1NR1A 3L05A 2UU9B 4RF3A 1Q5PA 1YACA 4J0CA 10MHA 2D0DA 3UK6A 4YMTA 1KOFA 3H0EA 1E9BA 4JJ4A 3PYMA 4X00A 2C2YA 4AFNA 4I1RA 1ZM4A 5IKXA 4IS2A 5JAIA 2H2AA 4OVKA 3C97A 5CFLA 5KPDA 1NI4A 1XLUA 2FX3A 4BUJA 1E1RD 1XQVA 1SG9A 4Q93A 2V1XA 2ZPUA 4D82A 1ETHA 1UQTA 3ZHQA 3WYFA 2X5KO 4XCVA 1M75A 4XB6B 2AH5A 1YR3A 2A9QA 3ANYB 1YCGA 2XUKA 3K1ZA 4IFIA 1Y8AA 4XLZA 5ISMA 3D4NA 2Y0BA 4K87A 3EY9A 4UVHA 5K2MA 4EMUA 3N0TA 2YQZA 1H23A 3UXMA 3V5NA 4EH1A 5JUWA 1Q0QA 3ZCPA 3KU1A 4PN3A 3EEFA 2ZK7A 2QI9C 1EXDA 2WD8A 3L49A 3UPTA 1BD4A 4R0MA 3DLHA 1B3BA 1GY8A 1YBHA 2OV1A 2OFOA 4HH0A 4L6IA 3RVPA 2EG9A 3ZVRA 4CE6A 1CZHA 2Z2XA 4CM1A 2G6TA 1BXKA 3COZA 4P4SB 2JAUA 3L0SA 1RQNA 5C81A 1Y8RB 2A0WA 2QMHA 3GRPA 4EA6A 1SXPA 3GEMA 2C61A 4IZ6A 4F1WA 3NIWA 2Q5EA 4P53A 2JGLA 5REQB 3ZYCA 1ZBDA 4ZQBA 4D79A 1V9SA 4UMEA 5SZHB 2QL7A 4XGIA 4A4DA 3GEPA 4KQ6A 4R1NA 2O8DA 1UIMA 4UNSA 3VAAA 5JNSA 3L0BA 5GVRA 2E4XA 2Q9UA 4XX0A 4DCUA 1J2RA 2HBYA 5CAEB 1AXRA 1UXOA 2CY0A 2UUCB 2BHSA 1I0IA 1KBQA 4WCDA 3IJ5A 2C9CA 2V0CA 4WHMA 1ZCZA 5FORA 1BGWA 2W0SA 4S0ZA 4D8YA 2CV0A 3U61B 4WERA 3IP5A 4JWTA 3GDWA 4IF4A 2FR8A 2EGHA 3O73A 1L5KA 5FO1A 3RS4A 1YVRA 1RACA 3AESA 1DJQA 2ZE5A 4NENB 4P4NA 4GMGA 2VWHA 2RFLA 1FFCA 3IEKA 2AG6A 4NKRA 1IJBA 3OZDA 3OFJA 1E1CB 1DEAA 3RFFA 5KNLA 2CL7X 1KJZA 1GLGA 1NQXA 4X9XA 3WOHA 5CA0F 2ZRFA 1PGNA 4WASA 1CZNA 1I3LA 1Z5GA 1EWVA 2DZDA 3EZ2A 3FPGA 3G88A 3LA8A 4GSYA 4KVAA 5H83A 3WJ2A 4DLLA 3GT7A 4FR5A 4ASUD 4BNMA 1XZIA 1JDPA 4RD3A 1QGZA 1TM5E 2RHMA 2ZT8A 1YFKA 4GP6A 1QHGA 3KQNA 2BEVB 4L9RA 3ILYA 2BGIA 1SZPA 3EH2A 4I1UA 3WGZA 2BCEA 1Q83A 5EINA 2HM7A 3IJPA 5GJVC 2XF2A 1LTHR 1KZ6A 1P9LA 2G4LA 2WB4A 3QOWA 5C31A 4B31A 2GM4A 3LF2A 3EK2A 3I2IA 1IWBB 2E48A 5I51A 4LXHA 2GF9A 3HWRA 4XXHA 4YI5A 5B53A 3HB7A 5MFZA 2RSLA 4MVJA 5FHRA 1U7ZA 1AHPA 3W4JA 5CIQA 3VSEA 1DHTA 3RU9A 4H17A 3ZGVA 2H63A 5HCUA 3F4LA 3OFNA 2ZCVA 5F2EA 1XMJA 1TADA 4XD7A 2Y68A 5HIKA 1WCIB 5BOSA 3CZ9A 2QVBA 4NV0A 5JSFA 1PGJA 3I42A 5C4GB 1JA1A 2AZ4A 3SC2B 3RC9A 2XQGA 1SXJE 4EIWA 1RWOA 3VPBA 3PQDA 2K87A 3PF8A 2PGJA 2D5CA 2D54A 1GTL1 1SULA 2Y71A 2ZETA 1PJSA 3KSRA 3M6IA 3DEJA 4KNVA 4C6SA 4L9WA 3N8HA 4X3OA 4OP1A 3Q9NA 1DNPA 3T1YB 1J21A 1MLDA 1G6KA 1QWOA 2FMIA 3O4JA 3PI7A 1CU1A 1WHSA 2A9KA 4CM9D 5ICMA 1PV4A 3FYSA 4O2AA 3GJ6A 5HPYB 1G3RA 4Q4HA 3L7AA 4BNUA 4HX5A 2JRLA 3B2NA 4YCSA 3N2YA 2AKAB 3R2JA 4DSAA 9GPBA 4QXPA 2PRZA 2YW2A 1ADBA 2COUA 4NBUA 1EWQA 3W0LB 1PZMA 3FWYA 3FUCA 3KZOA 4IDPA 2WTAA 3RIYA 1W7AA 3RRZA 1GZSA 1ZMBA 1ARZA 3STVA 5FTLA 2Y93A 4PG8A 3IODA 4QYIB 1IFXA 2DT8A 3LXRA 1A96A 5JSYA 1USKA 3CVUA 4IIVA 2ZWOA 2QD5A 3Q85A 3GZ4A 3BWMA 3AILA 3M82A 4GOJA 4LMAA 1DWPA 3DONA 5ALWA 3UQZA 4MHSA 2XWPA 3TDNA 2H59A 4P7FA 4CMIA 3AFIA 5K8IA 2RGRA 4YCCA 4FFLA 1K6JA 1ZP6A 4JKOA 2FWRA 5K0JA 2YJ5A 2CUTA 4M0DA 3HCFA 2O4CA 3U31A 5HG0A 3R0XA 4TM8A 3D6FA 4QGFA 3A4TA 4U4AA 2ANBA 1YK0A 4G81A 4AX8A 5JBNA 4P5EA 3KV1A 3T3MB 2KWIA 3ZNOA 3I9OA 4OREX 4IGEA 3ITDA 2O23A 1YJ5A 3UAXA 1MABB 1KMMA 1LZKA 1RAFA 1WSDA 4QU0A 1GNQA 1YI1A 1LLDA 4Z0NA 2XCOA 1T26A 1E69A 1XI2A 2FA9A 4X91A 2E5LB 4A36A 1KMHA 1P81A 3IUJA 2PUWA 3OLQA 4AZTA 4JI2B 5FADA 1V6AA 5FJJA 3G59A 4MINA 2ZBEA 3RJMA 3BA6A 1AGXA 4HCJA 2Z3VA 1AA6A 3AR3A 1JEEA 1TGVA 1CUIA 4AJ2A 3M9LA 4F21A 3OEYA 2IYSA 1E2QA 5EAIA 5LMUB 2IIPA 4KTTE 4URVR 3PNKA 5K3DA 4DA8A 3LUAA 3C4VA 2Q6IA 4IKPA 2VSNA 4FW9A 1ECCA 4HH3C 1X7YB 3CJTA 5LDGA 5FH9A 1JSRA 1Y82A 5B1SA 2YJ6A 1RT9A 4P35A 2H1CA 1HDZA 1KYWA 1UAYA 1A0OA 4MO9A 4ZVSA 4O29A 4D80A 2UV8A 3T4UA 2PX5A 2ZEJA 3X0DA 1DAFA 5LQKA 4AMUA 2FR1A 5EP2A 5AM4A 5C4MA 4FE3A 5C37A 2ZRLA 4QJ4A 2VJLA 4JEIA 1GPUA 1K7YA 5EY5B 1G4AE 3QE4A 5EIBD 4GL2A 1F0NA 3QKIA 2WB2A 1U8UA 2CDBA 1FIUA 1YU9A 1DHRA 2GO1A 4XRRA 5TPZA 1KQ3A 3SEZA 2HSGA 1M33A 1P31A 4M0CA 2R97A 1L5FA 1U0OC 5C5CA 3IDQA 1ZIYA 5LUAA 1GZUA 1Z4PX 2ZR9A 1AKRA 5K4AA 2I3ZA 3WHKA 2W0MA 3FF4A 4K9PA 5BY2A 4TV8A 5JS1A 4LZJA 4JR2A 2PTGA 4F6LA 1NV9A 2OXFA 1P8AA 1QRDA 2QJOA 3K2BA 3D02A 4CGZA 1W6UA 1W6RA 1CRPA 3WK8A 2JCBA 4ZYYA 4C89A 3F7MA 1IXKA 1IUNA 1XCMA 4ZQHA 9MHTA 3AOEC 4D4HA 1PJZA 1SR8A 3GJ7A 4IJ5A 5IH7A 4BZXA 4L9AA 5AFSA 1JT2A 5C46F 5JQWA 2IYYA 3MRVA 1EGHA 1E1RA 3GJRA 2MJLA 2C3OA 3NUQA 3T0FA 3OI7A 2ONKA 3FWKA 5DHUA 2IUEA 4DAEA 4DGSA 1CG6A 1A9YA 1PSWA 1ID1A 3H2IA 4KBFA 5TQVA 3TFQA 3TN7A 1BQ4A 1UBKS 4AZSA 3JYOA 2D7JA 4O1MA 5C0OE 4EDFA 1DIOB 2Q3LA 2NUPB 3OMLA 4OIMA 3RGGA 4CEHA 4WINA 1GHTA 1LI5A 1SH7A 2PRIA 2XR1A 3NEPX 3CZAA 5K8TA 1P7YA 4AJOA 2RE8A 2V9ZA 3VRHA 3NMUF 1T5BA 2L18A 3FPJA 1T9ZA 2ZJ6A 4FJ2A 4Z9FA 5AHXA 3RD5A 4PONA 2GS9A 1YVEI 1E5TA 3AVOA 3KQSA 4NE9A 5COAA 3ZKAA 1IG3A 4GICA 4MGIR 4YY3B 1MO2A 1RADA 1YS6A 1SBYA 1UT6A 1ZJYA 2P65A 4MAFA 4QULA 4EB6B 1AK1A 2Q8NA 2CHGA 1T8YA 2BLNA 3P45A 3LWZA 4B74A 3ILHA 1GA6A 1Y6GA 3RJTA 3ZD7A 3BRCA 3CEAA 1MU0A 4R31A 3V7NA 1NW3A 3CLUC 5GOZA 2N42A 4Q47A 3SHTA 3QSGA 3SDBA 3G1WA 1XVUA 3M89A 1UC8A 4LSWA 3EA4A 3KB2A 4RKFA 4ZCSA 4PZZA 1NJ8A 1P2TA 4PW0A 2IITA 2P2NA 4LXGA 1UP6A 3W2IA 4WLFA 1JQEA 4NECA 1N9KA 4N3AA 4URHA 4BMSA 2IXBA 2P0YA 1Y4SA 1XD9A 5CDGA 3KCNA 2J0UB 3BMCB 3IOYA 4F4FA 2R8ZA 3A27A 3DHYA 1IN6A 4FBMA 2HWYA 5A4AA 1HDXA 1BEEA 1NR7A 3JPWA 4PX3A 1GPLA 1L3CA 1MP0A 3EF0A 2YUTA 5IC4A 2FZCA 1BGVA 5JW6A 4PZ9A 2ZBFA 1NWHA 3RIGA 4D9KA 2EU8A 3EOAI 3UGKA 1FZQA 4QNRA 1NVVR 4ASUA 3D43A 4AJKA 3W9UA 3ESQA 4HXYA 5CLIA 4G5OA 2DC1A 1HE1C 3FGNA 3IGFA 4L76A 3ZQUA 1Z75A 4QATA 5D3MA 3CYFA 2TMYA 1EFVA 1YAJA 5T8KC 3RF7A 2DU8A 3RTDA 2BFCA 2G0AA 4H60A 3TIGA 4KU4A 2OYRA 4CBVA 1Y0BA 2VL7A 3ET4A 3KPUA 2W5UA 3CONA 4CL2A 3PVSA 4O4HF 1F2UA 1V41E 4L8YA 5TVKA 3EMVA 1N2OA 3U3MA 3HABA 2QLBA 2B1JA 3IS3A 3RIEA 5FAXA 2B4KA 4ZJZA 5DHQA 2XXAA 4Q1VA 2MYUA 4YI3A 1DDOA 2A84A 2OENG 3Q0IA 1FJXA 5FNVA 2WI8A 4P3YA 3N86A 3CXRA 1KSGA 4O25A 2G9NA 1I01A 5DX0A 5CBPA 1NMSA 3C3WA 1J5EB 2JH9A 3IR5A 4RMHA 1A71A 3FETA 4FFMA 3GT3A 1PWXA 3ENNA 2VRNA 3CG0A 4L02A 4LHYA 4KJXA 3T0GA 4EJSA 5J2TF 4W82A 4P98A 1G8AA 1P6XA 4CXMA 3W3AD 4MRMB 1ECFA 1U0LA 3GRRA 3T94A 5JZOA 1GYPA 3NPMA 1K8RA 3RE1A 3VNBA 4PLVA 4CM9A 1V5EA 4N8EA 2JLYA 3D8RA 4QDXA 4PC7A 1JIUA 4EFDA 1WUYA 4FFBB 4IIFA 2UAGA 3FDXA 5IJXA 3K53A 3JSXA 4NJEA 4P3KA 4PINA 3RQSA 2CNWD 2OAP1 2HQBA 3ZN2A 4N0PA 4A0RA 4H18A 5CEFA 4FMBB 5IANA 4P58A 4I08A 4OI4A 2XTJA 4G5SA 3GRZA 1QG4A 5KEIA 3A3YA 3I12A 1SHKA 1SVSA 3UW1A 5KKNB 1Y4ZA 2ZIVB 4DCOA 5G2OA 3W34A 1XK7A 2CLSA 2Z9CA 3SCZA 1KP3A 1TU3A 4OEHA 2AE2A 3T6KA 5ILGA 4J3NA 5A4JA 3FCOA 2QD3A 3B1KA 2HPVA 1EFHA 2GD6A 3DSRA 5KYKA 1V3QE 1OVMA 3ONWA 4D7AA 2QTAA 4BWFB 2Y77A 5T57A 4RSHA 3WLKX 3H1GA 1QFJA 2B7CA 1LGYA 3GP5A 4GKVA 4Z4IA 5H82A 5KTNA 1S2LA 3R09A 5IMBA 4BVLA 3QFCA 2H8GA 4ZYTA 1HL3A 3EC7A 3JYLA 4EPTA 4KR7A 3ZHZA 2WWWA 4D26A 3CKMA 3JD2A 2I99A 5KNBH 1T0BA 5CB8A 1N5IA 5JSUA 4ZVUA 3TRJA 8LDHA 4KXLA 1PSDA 3P0IA 1H2HA 3HNOA 1VL0A 1IQPA 1J0CA 2FZGA 2QV0A 2RCYA 5AXAA 1GCOA 5FOSA 1S8OA 1E6CA 1VCIA 2VNSA 3QOFA 4N6OA 3TLMA 4EEKA 4CKWA 3A11A 4ZVVA 3UG6A 2WHPB 3BB3A 2XVAA 3ZDQA 1G2QA 1AKWA 3K1JA 2DUWA 1UBGA 2DBQA 3E84A 4UBIA 1STOA 1V2HE 2PSHA 4YBZA 4Z9AA 3UKJA 2ZRKA 1CYDA 2QLJA 2BZGA 3WA6A 1MH9A 4FMCF 3CLRC 4M1WA 2DWPA 5ARDA 1OAKA 1G5FA 2BP7B 2AEJA 3K6JA 4JX9A 5EZ5A 5T4BA 3Q9SA 2VQEB 1XRNA 2XNJA 4LOJA 3UENA 1I1OA 3SYMA 4EK9A 1EZ4A 2YIMA 3QJGA 3V1LA 4PLWA 2P35A 1P0CA 4EGJA 4X1YA 4V0NA 3E7FA 4DXAA 5HF8A 3C87A 1ISGA 1F9EA 2DLDA 3ETHA 5DHSA 1Z08A 4MYTA 2AD1A 2W6ID 4D43A 2IF2A 4S1TA 1QH0A 1GTG1 1NUQA 3GMIA 4JLJA 4MX8A 1RI2A 4G8BA 1U2DA 2P9YA 2CV2A 4Q7MB 1QC5A 3HR7A 4N9QA 5EMLA 5A62A 1YQTA 2JGFA 4MR7A 3ZLVA 3HKBB 1IY1A 2YV3A 2ZJAA 3Q3VA 4RVUA 1V25A 1RRVA 1O54A 1YJXA 3FVWA 3K9BA 3OZBA 4IHJF 4RGBA 2QJRA 3QVJA 4IQ4A 5JNRA 3DDWA 1WCV1 3MTEA 2PS0A 3GPDG 5AVJA 1G18A 5LP6C 2F64A 1A97A 4E2FA 4AVYA 3S2YA 3CZ5A 2G0TA 3LO5A 2R6AA 3U7QB 4TVBA 4BO4A 3L6DA 2PM8A 5CLLA 3ZW7A 4DJAA 5IT9A 3CS3A 3OPVA 4PZUA 4NDNE 1W52X 4MITA 5KNBD 3BFJA 3T1QA 1QDLB 1YHYA 2FEKA 4YRLA 3OSUA 2C00A 5KYXA 4EQ6B 1COZA 1E62A 2IPNA 4UHFA 3TRIA 1DFGA 2QZZA 3L46A 2AFHE 5DW0A 3GFTA 1WKBA 3BMNA 1WBBA 1BJKA 3BPSA 1ULHA 3P2JA 3W8EA 2PUAA 4KBYA 3LFUA 1BVRA 3SJBA 3WFZA 3NP7A 2VJPA 2O8CB 1Q16A 1XZPA 1SRRA 1UKAA 1DL5A 2RK6A 2XGGA 4L7VA 3D0QA 3OCCA 3LIIA 4XJXA 1JFVA 3AP1A 4WLVA 4BFCA 4COKA 3EISA 4Y2GA 1CJMA 3C39A 2GERA 4IX9A 4RHYA 4FCVA 1VA4A 1NURA 4MJ7A 1PEDA 1A9QA 1Y5IA 1KBOA 2JFBA 3FCAA 3CY6A 3M6LA 4GQAA 4MH0R 1OF1A 1AQNA 2VC2B 3KWLA 2ID4A 4C4YA 1BQEA 3BSFA 5TEVA 5F4BA 1N6LA 2E6UX 2X9VA 4GM1A 4C3ZA 4UD6A 4BMPB 5KX5A 4KVGA 4U2DA 1Z0KA 3PSAA 5HGJA 3EYWA 4XFDA 1Z06A 2GF0A 3BTVA 1N7IA 3TTSA 4U9IS 4R6XA 1L7VC 3DT6A 3MCUA 3PYXA 3JQDA 3OQBA 2ZM5A 4BX9A 1RWQA 1FLNA 2HY7A 4JUFA 2YC2C 1SVMA 1NXXA 4DLUA 3DP7A 3HK2A 3FUVA 3C8DA 5JH7A 2FFJA 3EXG1 1W35A 2H4HA 4FXPA 3FN4A 3PJEA 2GPYA 1P7PA 4V0ME 1C81A 2IT1A 4EUEA 1XCBA 3IO3A 2O8EB 2HF2A 2QTNA 4I36A 1TA4A 4V39A 1FFXB 2AW3A 2AZXA 4D9IA 3G9ZA 1EE9A 1U1EA 2CLIB 4MIOA 3OD5A 3PC8A 1TKCA 1IYZA 2R1UA 2V54A 4G9EA 1JFRA 3OQHA 4PSVA 3RS7A 4ARZB 3IEVA 2F1IA 3KCQA 4RJLA 3D8UA 4TKLA 3NW9A 4KO2S 4NY1A 2ZSEA 1L7MA 1GRQA 1ZQ1A 3MJHA 4BFSA 2I5PO 1UPFA 1E3WA 2XAUA 3E23A 3UGTA 3P19A 4Z99A 2QPOA 3GDFA 2HSZA 4N76A 4LBYA 3W5SA 1U4SA 2GI4A 4M98A 1AKTA 1KEEB 3IOCA 4WOJA 2R751 3TECE 1V35A 1X74A 4OB6A 4YP5A 1P7WA 5BR8B 2D5LA 2PLAA 5C1PA 1MB9A 3N05A 4DW8A 1LH0A 4LPSA 4EHIA 4G1MB 4CQLA 1X1TA 1GPMA 3UYLA 1FP4A 3NUGA 3B60A 3EJ6A 1YB5A 3D4IA 3ZY6A 4BO6A 4I5IA 3L6OO 3ZCUA 3A9SA 3HDQA 3IDFA 3ECAA 3Q8XB 1HYHA 3W78A 2V4MA 3MJSA 2DTDA 4J75A 1JR3D 3GLHA 2R9VA 3M6MD 5GZ6A 4GM4A 4JJIA 1TMYA 3NRBA 5LBTA 1JPUA 3FUWA 1NASA 3G17A 3BD7A 3VUEA 3DVRX 3W3AA 2NSLA 2KSQA 1R0WA 1EXVA 2FKNA 2AOUB 2RHWA 4LHSA 4EKDA 1H65A 4L78A 5AJXA 4LFAB 1XHFA 4MRVA 1FNMA 3QBTA 4DSNA 1NJ5A 1UXGA 1XT6A 4BMDA 1GSIA 1MO3A 1WLSA 2WSMA 3MJDA 4HGOA 3WR5A 1KDTA 3ETNA 2CNWA 3QG5A 1DOZA 2R11A 2WJ3A 3MWEB 2DEUA 4AKHA 4JC8A 4J6EA 3IXMA 3X1YA 3AETB 2NQ2C 2V55B 4QJBA 4NJMB 4UTXA 2QI9F 3F8TA 2CV1A 2NPFA 2RB4A 1MMFB 3ICCA 3A37A 2GEVA 3EGCA 3OTQA 4BQOA 3I5UA 4BQQA 4CMEA 2HQSA 4DS3A 2VJQA 4IDHA 1TQ4A 3FWZA 2Q5QA 2R8XA 3QEJA 2AFVA 1XTPA 3PYLA 5JPCA 3ZZ0A 3ICEA 1NDHA 2O2CA 4NBKA 4Y9DA 3BFKA 2J3IA 4QHYA 3KQTA 3B1ZA 2OHOA 4RZSA 2I4MA 1DDIA 4KH1A 3E9MA 2PT9A 3JR7A 2Q3MA 2BGKA 1ZJZA 4MW4A 3PHCA 5G02A 3AR9A 5ADHA 4DV7B 3ICWA 1X8XA 2R4QA 3T3DA 3GUUA 2WD9A 2ZT5A 2VJAA 2WJJA 3CH7A 1C4KA 2NVOA 2J87A 4GE3A 4GWKA 1UKEA 3MCVA 1L7EA 1X6VA 1VHQA 2OFPA 2PS9A 2Q5HA 3KWJA 4K6GA 5CX1B 4B71A 3D7KA 1N77A 3FRHA 2XUZA 1OOEA 3MJVA 4FMPA 1DEOA 5TT1A 3QWAA 5B7QA 1TQ6A 1JSZA 2QR3A 4OHMA 3FPBA 4AKSA 2EWVA 4B7CA 4BLRA 3L4BA 2Z83A 4INOA 2PUDA 4O4IB 2VK4A 2NUBA 1L7PA 3T5CA 4JJKA 1N3BA 3PUXA 4PYMA 5LOVA 2QMYA 3F6EX 3JWGA 5HUJA 4KO8A 4K9QA 3KKLA 1X19A 1QR2A 1BCRA 5C8YA 4RLHA 2OR3A 3USZA 2F3UA 2FJUA 1Z26A 4M8NE 2WOOA 5KYYA 3LRXA 3W7VA 2ZTLA 5DBHX 1BROA 1YSCA 2CSXA 1T0HB 4TMXA 3MBIA 3R5TA 3VNQA 421PA 4ZN6A 4Z4FA 2WKPA 2C59A 1Y1TA 3WGIA 2DT5A 3MCAA 5CDHA 3EA0A 1CYEA 3EQ7A 1KZ7B 5BYKA 2F4VB 4IH9A 1NAIA 4OB8A 1A5AB 2FWJA 1PTJA 5T6BA 2QT0A 3ELYA 3LBYA 2PNJA 2OCBA 3COJA 4YECA 4NATA 1G5HA 3RTCA 2Y4OA 4JNKA 3SSNA 2K4MA 2B5VA 3AR2A 2W6IA 3L8EA 2OMKA 4PEVA 1T9KA 3B9PA 3ZY4A 3L01A 5K7SA 1XZCA 1E8NA 1BU8A 2FETA 4Z4HA 5ALXA 3CVWA 4XR4A 3K1TA 4C4XA 1B0PA 2R1TA 1U9JA 1R8QA 3ZBPA 1OXUA 1F4VA 2Q7XA 2GK7A 2NU9A 3BTSA 5AVKA 4PR3A 3D8HA 2YWEA 3I8OA 4M8SA 3QOXA 4JUIA 4S1WA 4Y6PA 2JLRA 3PGJA 2P91A 1HYBA 2Z5LA 4F91B 5JJBA 4Z7OB 3AVQA 3BWCA 1JLSA 3HZHA 4M1KA 4YMWA 2QN2A 1OX4B 1T1GA 3JQCA 2JIQA 3OZRA 1GPKA 3K96A 2CNDA 3O91A 3QPUA 3UV3A 1XRSB 1EFDN 3SN6A 5KNBA 1H0KA 2ZVPX 3F6SA 4HRXA 3A1VA 1GA4A 2HU5A 3STXA 2VK1A 3K05A 1UOPA 1LLQA 2GLTA 1AMUA 1GZHB 1Q12A 1U65A 4HZUB 1KFJB 1WWKA 2A1IA 4PQEA 1SWVA 3WX0A 2BRUA 5C3MA 3B82A 3TTXA 3LCCA 4OPMA 5TS3A 2IDMA 2Q9BA 4QUAA 5AD1A 1G0OA 3A6HA 2GB4A 2PQMA 3V1MA 4R16A 5L9AA 4PAQA 3A4LA 4ND7A 1GT91 3MB8A 2A5FA 3V1TC 4DLBA 3SBDA 2R00C 1U7HA 2FG7C 3WY9A 5DFAA 2ZIWB 3T3EA 3WO1A 2ILVA 2AJTA 4GRAA 4LHZA 4FUQA 4QFCA 521PA 3FLMA 2KB0A 4D9HA 4M4SA 3CF4G 1H05A 4ZGWA 1PBTA 5H9VA 3U4QA 1EESA 1N6KA 5ADWA 3HJBA 5BV7A 4OHOA 3JVVA 2R1VB 5AW7A 1E0DA 2WF5A 1VDMA 1TF7A 4RJKA 3HL0A 1NQAO 1BN7A 2NLOA 2AG0A 2P5SA 3B36A 4KPUB 2ZI6A 3TVTA 2W9XA 1C3OA 4FFRA 5ALRA 1KYXA 4WKPA 2PX6A 3HMKA 4MP6A 3GPCA 3BF8A 3L7BA 4OHWA 1AZSC 2AN1A 3STWA 3LC0A 4BJ3A 5A7GA 1HC7A 3W7BA 1A9SA 3GZNA 3NQ41 5DISB 2XGOA 2OLJA 3PU6A 4XWGA 3H2BA 2WIAA 3VTZA 2JGDA 1F2DA 1T3ZA 5AKXA 4RPLA 1FFSA 3K0FB 4UDYX 3C45A 4M6WB 4PYNA 4RDCA 4JI5B 4D0GA 1NBEA 4G25A 2AXNA 1SY7A 1W85B 2BFBA 3DBHB 3H9CA 1HXHA 3R3UA 1WDLA 1BNCA 4YRDA 1CE8A 2O8NA 2I7DA 5HKLA 3WICA 4EX6A 5C4IA 3AZPA 2NU7B 3NNNA 4P36A 4J4TA 2DWOA 1XLWA 4X44A 1W9HA 1DKNA 2X4IA 5CX4A 2GWRA 4DILA 4C3VA 4UUQA 1PYOA 2B4QA 2OV2A 3SLGA 4MW9A 3WLQA 1BE1A 3R40A 1K27A 4AO8A 4IHAA 1J8FA 4EI9A 1UXJA 3TD6A 1TYCA 3I9JA 3CCCA 2QYOA 4OM8A 2UXBB 5EKXA 1XQ6A 1GDDA 1W88B 3UAOA 5KWIA 5ELXA 1DJMA 3AR7A 4XYMA 2WIJA 4F97A 1D6NA 1NW7A 2ZJ2A 2Z8YM 3HFJA 4LV6A 2JGMA 1ZGZA 2QVCA 3C85A 4C43A 4JFAA 3ZZUA 2SHKA 3MLEA 5JS2A 3VZDA 1Y6JA 2IP1A 4KDEA 4OU5A 3OZTA 4I50F 1KR5A 2O3RA 1DWOA 3E3OA 4RSMA 3SNKA 4DG5A 3WGUA 4NMWA 2I3GA 3GEEA 3VOTA 5JBIA 4RY2A 3H75A 1QFZA 4PAOA 4X1KA 2EHDA 3MAJA 4H7IA 3V4VB 1N0WA 4N7MA 4U00A 4DBVO 4GF5A 3FDJA 4U7WA 5FLKA 2RB5A 4EY8A 1PJLA 3WQSB 1HYQA 3NDIA 3W5IA 1G5RA 3IEIA 1V1RB 4G85A 4RFVA 3MTQA 5C8VA 2B82A 1QK3A 3QU5A 1H2AS 4B6PA 5CIYA 1P33A 1JYSA 4HP8A 5KREA 1X7WA 2X5NA 1BFDA 3NGLA 1BW9B 3T34A 3G8BA 4N5DA 5GOTA 1JR3A 3OJFA 3TMAA 4HYEA 1Q1QA 5H3CA 3RSGA 3MWDB 1ZONA 2AW5A 4I4TA 1FW8A 1VCMA 3R6GA 3D7LA 3M6VA 2LKDA 3IR7A 1FXWA 3H5IA 5FV4A 4H4DA 2IQIA 4I1OA 2GBCA 2YXDA 2J3JA 2I2BA 2KQUA 5J1SB 5KKCA 1NQTA 1UJBA 1NLUA 1R4NA 2H31A 3I4FA 4XZ3A 4IMJB 2AMYA 4U0JA 4DJFC 3LI2A 1QKKA 2QL6A 3PUJA 4N3GA 3EE6A 1EIZA 3Q11A 1FVHA 5GTDA 2F9MA 3LRTA 4OX9B 4EHKA 2C98A 1UMDB 3JQBA 4RA9A 4Z1MD 1TYBE 5DBIA 3HXPA 4G4SO 4LX0A 4LXIA 2GJ9A 3PPWA 4QO8A 4U9HS 4YJGB 3GRKA 2HJSA 1KC3A 3I9FA 4PAMA 4BLWA 3QKTA 3JAMA 2PBFA 1IULA 3SQMA 3IAM6 4YV1A 3M9WA 3ADOA 3C70A 1DJNA 1TF5A 5FWYB 1FDVA 2D8MA 1ABFA 1UQUA 3KPVA 1P6UA 4HGQA 4UTNA 4G37A 1X86B 1U0FA 2IU3A 2OCKA 4FFWA 2H5EA 1U7WA 5EJMA 3CX6A 1CZKA 5J5CA 4HWRA 2JZOA 1G6Q1 2QTBA 1NW6A 3QLUA 3QXJA 3TAHA 2AEFA 5AXBA 3SBOA 3KVOA 3NTLA 4I55A 5CK5A 5JFTA 3LHFA 4RL4A 2IOHA 3MELA 1KRXA 3NTOA 2XVYA 2BV3A 3SXUB 1QCYA 4DEVA 1UEJA 5BUQA 1R0ZA 2DPXA 3DEIA 4B8YA 1YQXA 4N39A 1Q0SA 1X1DA 3T15A 2I03A 2C9ZA 4PZEA 2XKJE 4Q16A 3CNEA 4H1TA 5F73A 1W1WA 1OE0A 4PO8A 4DPMA 4KE8A 1M1YB 1PNOA 3MVEA 4JVLA 3ZU2A 2W37A 1TCBA 4GVLA 2W2OA 3I6MA 2W7TA 1LK5A 1QMPA 4TTIA 1BX1A 4MRSA 3ZQKA 1HLPA 1QQ5A 1O57A 2MCFA 3ADPA 3OM1A 3LBFA 3PWZA 4FHFA 4GZ5A 4WA8A 4WQMA 3L0YA 1QHHA 1EQAA 1YNSA 2DYKA 3HA5A 4QOIA 1G8GA 1KERA 1MNQA 4DANA 4OXKA 1PI3A 4H1UA 4YTEA 2ZULA 3F9IA 3K1AB 3R4CA 4UMVA 2XB2A 1T6ZA 3R1IA 3Q10A 3WWYA 3KOYA 4L8WB 3NIBA 4UUBA 1QHEA 3KSMA 4O08A 5HDBB 3NH6A 3TQHA 3Q2OA 3ZGNA 4RQTA 1FLDA 1M74A 5GWXA 5FEMA 1RAGA 1W4BA 1J2YA 4L4RA 3FG9A 4NULA 4NBSA 1EUCB 1G21B 3AYXB 3PRKE 3SLRA 2IXTA 3LL7A 1USWA 1R4AA 1XP5A 3NVMB 4L0QA 4UARA 5ED0A 5EJ5A 1NU8A 3EEQA 4K88A 4R84A 4FB5A 4G3XA 1PFQA 3A2MA 1IXYA 3GFVA 2C9BA 4IH4A 2WOJA 3IVCA 3L04A 4WVLA 1THGA 3TG8A 2HPAA 4NSNA 2QR2A 4A26A 4A1OA 1Q17A 2NAFA 2QHXA 1B15A 2LCIA 3L5KA 4I7EA 2KBEA 1TZKA 1FF9A 3D3EA 4DLZA 1FX0A 5JMTA 4WBNF 2JFXA 3ES9A 3L9WA 3PDHA 5LQAA 3LC2O 1C3LA 5CD9A 2XYPA 1L8LA 1R37A 4CW7A 1HNZB 4AF6A 1WO8A 3WIDA 1KSFX 4LFCB 1Y1KE 3VH2A 3FKSD 2FYTA 1PJTA 3E5RA 3OC0A 1YS7A 1BH2A 2FMFA 1DDGA 3C6ZA 1WV1A 3WXBA 2ZRIA 4BX3A 3MPUA 2O2DA 1EU1A 1WAMA 2F43A 4RA6B 3TZLA 3HVRA 4M1QA 3GHYA 3GGDA 4BECA 1M8GA 3LVRE 4QUHA 5JC1A 3TL3A 2P4SA 2W2VA 4K6OA 3VSAA 3ZI7A 2OPBA 3L41A 4RY8A 1BXZA 3IVRA 3JTEA 4GPAA 4FHZA 1K4MA 2FAXA 4LZWA 3E61A 1JHDA 2P41A 3GDGA 1C3JA 1UWCA 5HEKA 3MS7A 5B1IA 2V5VA 3KOOA 3KK0A 4N5IX 3I3SR 5B12A 3HNPA 1HE3A 1VP9A 1VL1A 4PXAA 4ZJYA 4HDSA 1WZNA 4JYBA 2XT9A 4FSHA 5DHTA 3AVWA 3CZMA 4RHUA 1R7RA 3KKMA 1TEVA 4U2BA 3ZLJA 4U2EA 1KEVA 4ND8B 1NVVQ 1Z7YA 4EY4A 3RC8A 1J25A 4CM5A 3I2HA 4CM6A 3QU9A 4X3PA 4KR6A 1CFJA 1R88A 3MS2A 4KLNA 4XVRA 3CUUA 3PJRA 2HF7A 3WSVA 1S2MA 5GZ1A 3T38A 1UJNA 1L7QA 1RCTE 4F92B 1JKIA 1TJPB 5LWHA 3NC1C 2FQXA 3JZFA 2JLWA 3KKOA 2NU8B 2C20A 1L4NA 2RGDA 4B46A 3H2YA 2VNAA 3COVA 4FDTA 4P4SA 2XAAA 3CO0S 2O0LA 3QJ5A 3N07A 4MS1B 1Y8RA 2WE7A 3RUHA 2H48A 2EKLA 1RD4A 4K6HA 5LB4A 5BWOA 1P77A 5EQTA 4B4UA 3M4JA 4X20B 3ZCRA 1U2EA 5REQA 3H4IA 5TMDA 1ZN9A 3B2EA 3ZQ6A 1ZNYA 4GYWA 1L5SA 5DV9A 4M54A 4YRCA 2D1RA 5KZMB 3E9EA 1DRJA 2GAJA 2XCUA 2D5BA 2E0IA 4RKQA 4XM2A 3KSBC 1TJYA 1N9GB 1E4OA 1VJDA 4W7IA 3NV9A 4DQVA 3DC7A 1JQAA 2BE7A 4JP2A 1P9RA 4AP5A 5K0BA 3IPAA 3U3ZA 1ZXLA 3KQPA 3Q98A 4YROA 5JZ9A 5D3QA 1SMKA 1RFLA 2BI7A 4UC0A 1JHUA 2X76A 4IHQA 4X54A 2JLUA 3BWDD 1IE3A 4L73A 4X3CA 1WF3A 2CLOB 2Z1MA 4DADA 1E1CA 2PH7A 3ZQJA 5FBKA 1KGDA 2ZYUX 3E9QA 1QYXA 2PD6A 3DDZX 4POAA 5TB5A 4UDOA 5IF3A 2HRRA 1MEJA 1HG0A 3IIJA 3DHEA 4HFNA 4KXFB 4U0KA 4FNMA 4JIMA 3A2NA 2C99A 4Y2SA 4OXQA 4BNVA 1E2BA 2JVKA 2VATA 3FNQA 5TS2A 4AURA 2WWIA 2QROA 2QIOA 3GFFA 2AI2A 4YCBA 2BEVA 1PJ8A 2E4ZA 2OECA 4TKUA 5CUQA 3D8NA 5JTTA 3NBKA 1OTHA 1I3CA 2BDUA 2VYND 4N49A 4MRAA 5AI8A 4D5EA 1CY2A 1NVEA 1J39A 1SBNE 2HMTA 5JCXA 5JYDA 2GD0A 5LP6F 2A5GA 2FSGA 1T1IA 4LMPA 3QNUA 4JXKA 3G2HA 2YXNA 3BXOA 3I2KA 4GC9A 1YBAA 1VHJA 3RRJA 1VIDA 2I71A 2OV8A 3H83A 3SNHA 3GT0A 3GYBA 3EEBA 4JMPA 2YOFA 4BO3A 3M1IA 4UKDA 1XJWA 2H1FA 5IBQA 2ZAIA 2NXWA 1SWWA 1WCIA 5I48A 5IAKA 4U6SA 3HV2A 1YE3A 3G9QA 4B87A 4KFCA 4LSZA 1XMVA 2JS7A 1IZ0A 5DGIA 3SBEA 4DLSA 4Y2UA 1MORA 3BERA 3UMGA 2O59A 2IHYA 1A8QA 2JVIA 3VNAA 4FX5A 3RARA 2WYUA 4Z1MA 4OQMA 3N7AA 4EW6A 2YVUA 4QEDA 2JFQA 1BHQ1 3IA2A 1TNDA 3RU3A 5F7ZA 3KL2A 3ND6A 2ZRAA 3RSFA 3I6ZA 1SB8A 4QQKA 3H3FA 4RZIA 1E99A 1G17A 1JW9B 1KP9A 2VH2A 4DNQA 2ZZMA 3EXFA 3KAPA 1EFPA 3BJEA 1G1MA 1B6TA 3GMTA 1RXSA 4MQEA 4WOPA 2B34A 2GN8A 2P75A 3H6KA 4P33A 3KG2A 5FBQB 1KJJA 3HWSA 1E9SA 5LXTF 5IXJA 1BFUA 1I3OA 4NPAA 1GZ5A 3VPHA 5L95A 4JLMA 4OGFA 2IP2A 3JYQA 4PBTA 1SIBE 3P9PA 1C9NA 3VTKA 1A9TA 4QYIA 2RK4A 2H1OA 1W96A 4L15A 4P3PA 2GZMA 1XNGA 1T4DA 3CF2A 4FZ5A 4QX6A 1QX4A 4WWHA 5FL7D 3T1OA 2ACKA 1P2SA 2RHTA 1KI2A 1E98A 4TXMA 4DQ0A 3L40A 2XMSA 5KS2A 5FIUA 4PG7A 1O4WA 3MMSA 4HXGA 1WR8A 3PQCA 3P94A 4HPWA 3RSOA 4BZZA 2GUGA 3DE0X 3LFTA 1FS6A 3KLOA 4YJ3B 5U4XA 2R5NA 3CVXA 1HPLA 3FSRA 2VK8A 2H0QA 5K20A 1XZDA 1NBHA 2QP3A 2QRZA 4BC0A 2PHZA 3KYBA 2EX4A 3AFHA 4MWTA 4FFVA 1HKUA 4ZRMA 4XWTA 1P1KA 2PMKA 3DO6A 3UAVA 1I80A 2QB5A 1II8B 3QELA 5F5XA 2Q7DA 3UOGA 4RZ2A 4D2IA 1XCPA 1MABA 3N87A 1JDUA 1UUFA 1YMVA 1IC6A 2XW6A 2VDRB 2YHUA 3DO8A 1UBSB 4JAVC 1T8TA 2HNKA 2J67A 1N5MA 1CIPA 2VWQA 3G2MA 3ONFA 2QN7A 4G4SP 5HP4A 4FYPA 4Z7JA 2C4MA 4AY2A 4QYWA 2R44A 5EQFA 3WDMA 2W4IA 4J43A 4RS4A 3LSTA 3JAKB 3GT4A 1Z7BA 1WP9A 3A6PC 1K86A 3K2EA 4W5WA 4Q9DA 3WQHA 1UDWA 4H9GA 1JAZA 1YFLA 4J1NA 3V4OA 2ZIXB 3GFSA 4HMQA 2RHOA 5TQ0B 5A4DA 5JLJA 4LC1A 3PFHA 2PZBA 4CR6A 4IOKA 3KL4A 1X7YA 5CG2A 4MPPA 4TQGA 2C03A 1PLJA 4Y2TA 5CVTA 3JQ9C 2HQ1A 5EE1A 4FWBA 4S1NA 1P5HA 1FFAA 1S8NA 4RL6A 2Y0DA 3BJZA 4PNHA 3EQ6A 3FWNA 4QDTA 2ZT7A 2IV7A 4J7UA 4J76A 2P11A 3NTUA 1IQRA 2DHEA 3I01M 1LJUA 3A1NA 2HA0A 2YV4A 4QQRA 5DTIA 4U7DA 1T5OA 5A6SB 4EW3A 3VMFA 5A7FA 4TMZA 4MDFA 1VB3A 1SVWA 2UVDA 1KIFA 3GEIA 4BU1A 1OXTA 5JJ5A 1T2EA 4JVMA 1L2TA 3CUKA 4OSEA 5I4IA 4PTLA 3FKSA 1AU9A 2GEBA 1L3IA 3A9CA 3QUSA 5CJJA 3GXBA 3FZYA 3S81A 1Z4JA 3PKIA 1ZK3A 4KI0A 1LJLA 2X14A 5AP9A 2EFYA 3O7MA 3U16A 1F0YA 4IJMA 1Z0ZA 2Z2KA 1E2KA 2FSVC 2A9PA 5EJ9A 3SVLA 2POQX 3FVTA 2BKEA 1NF3A 4YV2A 6REQA 2QUZA 4M37A 2CHVA 5AKIA 4M0EA 2GZRA 3VR6H 4JP8A 3H5VA 2YZGA 4FK8A 4C29A 3R5FA 2WKSA 3O2QB 2ADFA 4UBKA 1CUDA 1ZUWA 4TKZA 4JI8B 1ZGJA 3GZTB 3RF6A 1UAAA 2DULA 3JYNA 1RQ7A 3I0ZA 5E7QA 1DEHA 5JD4A 1PGOA 3AWIA 1U2RA 1G59A 4QYXA 4NVRA 4NK5A 5GIPE 4R71A 3RIMA 3AHGA 3FMGA 1EWYA 3UA4A 5DM1A 3DDOA 2G28A 2JLBA 2WA1A 3THWB 1QIKA 3B6IA 3S99A 1KK3A 1VJCA 1RRPA 4BQPA 2OV4A 4K6CA 4PCAA 2FSIA 4ZOCA 3UKOA 4F46A 3ZWMA 4R51A 2VSOA 4TSKA 3NTVA 4O8CA 3U4CA 1X7ZB 1D2MA 3CF6R 3PZBA 3U39A 3VH4A 5HZKA 2H57A 3MJRA 3AL3A 3ELUA 3TOCA 3CIFA 1EWTA 1EJ6A 1P45A 4EB6A 3J81A 4YN3A 1OASA 4G67A 3LSYA 1E1QD 2R96A 4K9LA 3TTYA 1P72A 1K4KA 4E2WA 2IDJA 4OFZA 5FD8A 3TR5A 4FGUA 1S2OA 1ZM7A 5EXPA 2YVLA 2CNBA 2I34A 1G7SA 1YQ9A 3ZU3A 2OWDA 3BXFA 3DTVB 1I3KA 1YCFA 3IBCA 2RGXA 4F8JA 4WFQA 5C5IA 5DF1A 2VAMA 4D3SA 1ANKA 2XB8A 1A4UA 4BJHB 3P0RA 1PF7E 3BMOA 2PMBA 2YHSA 4QPNA 3HVUA 4EYQA 4UHJA 5ALHA 1A5ZA 2J0UA 2IYWA 1CLEA 4QELA 1DFHA 1LK0A 3EQZA 3PC2A 5KDLA 5J4LA 5JARA 1PSZA 1LI7A 5DXAA 3SAJA 1C9MA 3W7AA 3TQFA 3VGJA 1X7DA 4Y67A 4X95A 4HSGA 1D0VA 1T9DA 3DDCA 4PPGA 2XBMA 2BFNA 2O05A 3ZJVA 4NICA 2G17A 3EPKA 3VNSA 4BNYA 3A6FA 1S89A 3F71A 1WNFA 1Z5UA 1AQLA 3SVZA 4LTMA 2BUAA 2WJ6A 2RGNC 1JHRA 5JDCC 2PZ8A 5B6IA 5IFKA 1FVOA 2VYNA 3LWBA 2WTBA 4NE2A 3QYJA 4ESEA 1W36B 3JARB 1Q1EA 3RUCA 2UZ3A 1RQPA 2G3YA 3H2HA 3WLRA 3ZHTA 1PW7A 1O5TA 3U62A 1EP3B 1VE7A 3QQPA 1DX9A 3EDOA 3LPNA 5CT8A 4GR5A 5DKFA 3W05A 4PPQA 4MV6A 2BSAA 2OCLA 3PPVA 1YZQA 4G8DA 3SBXA 1RXYA 1BS2A 1A95A 1D07A 1HEYA 3EMKA 5KVSA 1AVTA 1KRHA 2IELA 4LSMA 1FPQA 5L6LB 4JLPA 3ND8A 4K1LA 2IHZA 4BBAA 3R5SA 3RUFA 4DRZA 5C7IO 3UMSA 5GM1A 4OH7A 3S6JA 4BWYA 4BLSA 3AKZA 2QW0X 4LKRA 3KZMA 4INPA 4N5MA 4RJJA 1XTRA 4CTNA 2ETVA 5B2EA 4YB8A 4N8SA 4WBXC 4M89A 4CVNA 4YRBA 2RBGA 4OFBA 3Q3HA 5BR4A 3LT4A 3E6AA 2OHVA 4XPZA 2TMKA 2C9MA 5DOVA 2WVHA 3KVRA 4UUNA 1MJ5A 5AM5A 2VHEA 4LJAA 1TCCA 2NZXA 3E0QA 2OQ2A 3I72A 3IBTA 3LBAA 4JT2A 2CB9A 2JCSA 3A4YA 3FSJX 4RMNA 1Y9ZA 5EOVA 3ZV3A 1GARA 5EI5A 1DRUA 1B0ZA 2PANA 3AU8A 2CB0A 2MR6A 2JZNA 3E8MA 4I9FA 4RD1A 3DVQX 3IOMA 4LXXA 2L82A 1WSAA 4OXNA 4D81A 3DXFA 2Q1UA 3D1VA 3CKYA 2DTEA 3FGOA 4JI0B 3G89A 5DLDA 1I32A 3WAGA 3GRYA 4ABYA 3DXYA 3QLJA 5FL7A 2FMUA 4GX0A 4HRYA 2IU0A 3CGGA 1N92A 3G1UA 1OBOA 3OZIA 4RVSA 5JOQA 5KVVA 1R66A 3QLVC 2XBUA 2A2ZA 4LZZA 2KYRA 2NYUA 1T9BA 2Q0SA 3R3JA 1O7JA 3PRYA 2R8RA 3SHOA 2ODWA 4PNPA 4CEJB 2BM0A 3DCIA 5EJIA 3DFKA 2IZ0A 4FZ3A 4Q3OA 3R6DA 1U5AA 1J09A 1UM8A 1DKPA 1KQNA 3T7JA 3VM6A 2R1ZA 3PE3A 3AFMA 3VKHA 5AK5A 1GFIA 1WPGA 3CRW1 2JC3A 4LDZA 1UFVA 1KSJA 2OKCA 5ALOA 4C6TB 1DJOA 4IOLA 4Z4CA 5AT1A 4A6DA 4EECA 2PZLA 4JUBA 1HDOA 2PT7A 2QGFA 4WKNA 5I3ZA 2VVTA 3RC1A 5F7JA 1YH3A 4ZTBA 4FM9A 2VHWA 4R3NA 2JA1A 1NOIA 5E6UB 3RWBA 1RIIA 3I8XA 5AW6A 1BMDA 1ODTC 3FNHA 1ZVMA 4P9NA 1ADFA 2A58A 2AQ8A 2ZJ8A 3DV0B 4WADA 5MDHA 2WHPA 3PDJA 4Y98A 7MHTA 4ZVNA 2FP4B 5AM3A 3WWCA 4ID3A 3SR0A 2F9LA 4C6RA 4R2HA 2ONYA 4K3UA 5B37A 4ZVOA 3TQCA 3U19A 1IIBA 4M0KA 3V4RA 4U6QA 1NQ5A 2EGGA 4IVPA 5IDVA 2XE8A 2BP7A 5JC8A 3BJMA 4CDMA 1EVKA 1LBQA 3N8GA 3SQNA 5BSUA 4EAQA 4C4PA 1HK7A 3MTJA 3OX3A 5G1OA 4C7MA 4ND4A 3ZD6A 1N75A 1TDJA 1XVIA 4HLUA 2GD1O 1MCZA 5AUOB 5JEDA 4C0XA 5BT8A 1PE0A 1MAVA 2DB3A 5TQ2B 4A82A 3OLYA 2CLHB 5HJ7A 2Z0MA 3ZS8A 1F2TB 2V5AA 1C3XA 3B12A 5BW5A 1ZUD1 2AOTB 2PVSA 3LPCA 4I9GA 4DCVA 5JISA 1CUJA 3FWHA 5LNK6 1B2LA 2COKA 2FP3A 4G1FA 1OROA 4GG1A 4JGGA 4RD6A 2IBSA 3WRXC 3NV7A 3KQOA 5T67A 4O1HA 2CHQA 1AQ6A 2OGTA 3A0RB 3HKBA 4BPRA 3HDYA 1RLJA 1J1UA 1NHGA 2V6IA 4GM0A 2YL2A 4H7JA 4MJXA 5G1NA 1QAMA 5BUSA 1KETA 3UB4A 3IA7A 3W5DA 3TGWA 3D2CA 2G8NA 2G1JA 4DGQA 3HA3A 3U7QA 3FGPA 3ZX5A 2JB9A 2VPQA 1DAIA 3P4YA 2AMJA 5GONF 5A0FA 4D6PA 2F55A 1SEPA 1H5NA 2JCGA 4ZI7F 2JFYA 1VI2A 3T1HB 2INGX 1D1PA 1RJFA 2HL6A 3E4CA 4C4TA 1X0XA 1T36B 4TROA 5L51A 1ZXXA 3BXXA 3PFKA 5J63A 5DK6A 4CIWA 4TLDA 4X7BA 2NO5A 3LK7A 4R1QA 4EG0A 6ADHA 4DVGA 4X97A 3F0TA 3R5KA 4YCMA 2O8CA 1Z83A 3BAZA 4I9NA 2BSXA 5CXXA 5BN5B 4EG4A 2G5GX 2X42A 1EA7A 2AZMA 1NIJA 2EZ4A 5KHAA 4BRZA 2WWHA 3TM4A 2MIIA 1TM4E 1BD3A 2WSLA 3ASYA 4L72A 8AT1A 4DLVA 3WVNA 3LD9A 2FQQA 4KV9A 3SP1A 3OPYB 1AK2A 2VHXA 4DLRA 4IJQA 5KHLB 4RLFA 2I9KA 1GEGA 4KSCA 4FNOA 4RTSA 4ZGBA 3UFXB 1E20A 1E1QA 1YJQA 3GNSA 1AS3A 4K1XA 4F96A 3QFSA 1B42A 1I6WA 3ZWDA 1OI7A 4EG5A 3FOBA 3U3DA 2OOSA 4UM7A 1W46A 1I2DA 2PJRA 2HDOA 1MT0A 3NHFA 1DBIA 2AJ8A 5L3SB 4MQFB 2DH6A 2WMDA 1G63A 1RIFA 3DXXA 3H9JA 3QENA 3Q8WA 1BCSB 1VG9B 1YE5A 4F5ZA 5KTTA 3PGVA 3M8KA 3KPJA 1COWD 3IPCA 4GX1A 2VHYA 1FDUA 1ONOA 3AERB 4HQ0A 1JH9A 4US0R 5DNVA 5FPYA 2X4GA 3S2SA 3UMBA 4QPCA 3WNBA 1OLUA 1HMPA 2A0YA 2MU1A 4DIMA 2FXIA 3L3BA 2W00A 2O8EA 1XZFA 4BO2A 1Q2UA 3BXHA 4FOPA 3TXXA 3RHFA 1RZRD 1L8OA 4KREA 1DV2A 4DV5B 1FFXA 4KFSA 3RBZA 5L7TA 2HIGA 1TRHA 1N4AA 2IVZA 2YZKA 1KKUA 8ABPA 4RV9A 3CF4A 4LNAA 4ARZA 2FUG6 3M6XA 3QPWA 1SURA 1T1EA 2PL3A 1SXJC 2QN6A 1KL7A 1FSZA 2WWRA 3WK7A 2IH4A 5FAKA 2BFOA 4OFXA 1TGYA 1T1SA 2ODAA 1E3EA 2VFAA 4C7KA 1XQYA 5EKUA 3GPIA 1UWVA 4R83A 4CMKA 3CMMA 4D9EA 2QYSA 3THRA 3EZ9A 2WUEA 3QWBA 4PF1A 3A8TA 3ZK7A 1CJKC 1K0UA 1ZLXA 1KHHA 2R4TA 2QLLA 3ISVA 1KEEA 2ZTSA 5KOJB 3OSZA 1S9DA 4Q39A 2DBVO 2YV5A 2R6JA 3TNYA 2HO4A 2YHIB 5AUQA 4EJSC 1CQXA 2CDAA 1OFVA 5KWSA 1JL3A 3VZRA 4ZICA 2QTZA 2LDBA 3FZEA 4OJNA 5IKPA 2CXTA 4Y2JA 2P9FA 1QIGA 1PK7A 1V71A 4G0UA 3AUXA 4FKZA 1MD9A 1WU8A 2Z43A 1JE1A 3HCEA 1O0SA 4F1JA 4LWPA 1W19A 4KXYA 1OILA 2PPLA 4EHJA 4ROTA 1JHOA 5SICE 2NO6A 3HP7A 3V4FA 3VHXB 121PA 1B43A 2GCOB 4GZMA 2C1XA 2HJRA 2JF0A 1G41A 3JQ7B 1IK6A 4RQUA 3B48A 4YO8A 2N47A 3K31A 4YRAA 1YB1A 5ITVA 2AOUA 4JC0A 4DIEA 3GJ3A 2IP4A 3GA0A 1GAEO 3A1DA 2C95A 1OLSB 1PKEA 4LE1A 1L7OA 1P0IA 4TT3D 5FWAA 5K03A 1QBKC 4Q82A 2ODNA 3A14A 1CB0A 2JD1A 4OGGA 4LE2A 4BB6A 2WTNA 5EKTA 2JANA 1VPEA 2I4OA 1WA5A 2QPLA 3LQFA 4BNJA 4IJUA 1MQSA 3MWEA 2PCJA 2PKWA 2Q29A 2YWRA 1NYLA 3LKBA 4IYRA 2C2WA 4CLDA 3AETA 2DJ5A 3KM0A 1WXXA 3M4NA 3KWFA 4NJMA 4Q3LA 5JAQA 1ZD9A 3V6LA 2PUJA 4M49A 4RACA 5LBUA 3VGPA 4XRGA 3F3MA 5K05A 3SZRA 4RBNA 4F45A 2KHZA 2EP8A 4G0YA 3H5RA 1OXKB 2GJKA 2P68A 3NGXA 2CHEA 3G5MA 2FX5A 3HEAA 3O1LA 1Z4NA 1WJGA 1NZDA 4OHPA 4EA9A 5KB3A 2J41A 3WYGA 1Y4AE 2YWCA 2FDXA 5AKLA 3CX7A 1DO2A 3OFVA 5IRCD 3G2NA 1XEFA 2QAGA 3E53A 1FBNA 2HRCA 4G86A 2QS9A 1VB5A 1D6JA 2VDOB 3CKKA 3EEIA 4ISBA 4JLVA 4MOWA 4O3MA 1JMYA 4ZC1A 3I53A 1XVTA 4MO2A 1WVIA 4E03A 4O5AA 3GL9A 3R9XB 1CUUA 1MX9A 1ZINA 5CX1A 3HJHA 1DKQA 2IV2X 3UJDA 5JNLA 1LNSA 5IN4A 3BQNB 1MIOB 5KQRA 5EXEA 5EZYF 5CCDA 3K9GA 3TBKA 2C4UA 4FKBA 4W8HA 1T3SA 4JLUA 4BZQA 5J4YA 4WZAE 3U1TA 1ZIDA 3D6HA 2WUDA 5H3HA 5AW4A 1X80B 4W63A 4LJRA 2Y05A 3AJ8A 4ZAWA 3S55A 2O5EA 3PEEA 3RYHB 1NKVA 1ZSVA 3ZVLA 4F2WA 3D5QA 3FFWA 1JEQB 4B6JA 4NH4A 4XEHA 5ALJA 2QKYA 4F8YA 1ZH2A 4CF7A 5EIBC 4KMSA 1M1YE 1RJ9B 1PJBA 5EHQA 2UZ1B 2D0PB 2J9XB 2YZ7A 5AOCA 4C0HA 5LQDA 4DM3A 4B85A 1U99A 2F3RA 1FYWA 2NT4A 3QUAA 2ENUA 2XWQA 2XY4A 3PGXA 4NG4A 4QDUA 4A10A 3JQFA 4B9AA 4BVFA 4AAYA 1WCXA 4QVIA 1Q50A 3H8WA 2EZ9A 3E3NA 4B7AA 2R0QC 4RQAA 3I62A 3AHCA 4FWTA 2WWXA 2YRWA 4GKAA 5AW5A 3RTGA 4KUGA 1WDMA 2W2LD 2ZKIA 4PGAA 4TPKA 1XTUA 4JJ7A 3OWXA 4ZOBA 1MF7A 2P62A 1UKYA 2P2GA 2O5RA 4US2R 5F23A 3RWOA 2QZPA 5CVDA 3V4PB 3L4KA 4URXR 2PLFA 1LY1A 2QZSA 3PUIA 5F52A 2AMVA 1YCDA 2WUGA 3TX6A 3NTQA 1W87A 1D2RA 1V4NA 1F9AA 1MB0A 5HUQA 5E2AA 3GRFA 3CC8A 4HG2A 2WY2D 1W9MA 1Z25A 3OCJA 1REQB 2V59A 1NLMA 4E30A 1ZFNA 1GQQA 3EG5A 4R68A 4ZQEA 4BNHA 3IQXA 1EGVB 3Q5DA 4F38A 1VLLA 3FVQA 3I52A 4ZI7A 1U6JA 2XVMA 2QPTA 3ZTYA 2H52A 1P2DA 5ALIA 1QPGA 1U9YA 1CUHA 2F90A 2VPWA 2Y3IA 2ZBVA 3I45A 4OYHA 3SX0A 2O9JA 1MQ8B 3O38A 1T1RA 1UPCA 2JH3A 4RKYA 5CNKA 4YJDA 5K3SA 3RUPA 4BGVA 1U8FO 1O8CA 1IAVA 2D2IA 4EYSA 4RCVA 3W8FA 4HZUA 5ER6A 5I9TA 2HNBA 4EJFA 4B3GA 2B69A 1DIAA 2BF4A 3SIWA 4CNBA 3GFGA 5L3VA 5JD5A 4PVDA 4LOKA 4DJDC 3A04A 9LDBA 2DFNA 3LUFA 3P52A 2C31A 4EGCB 2FFQA 3B6JA 1YVPA 3VHLB 1F6BA 5AR1A 1UFKA 3MJTA 1J70A 1GRVA 2GRJA 4LRQA 4UW9A 5FUQA 1JFSA 1E8DA 5ADUS 2W2TA 3N2NA 5DNCA 3MEQA 4X6XA 3ROXA 4CFSA 4TLLB 4QD3A 1T3LA 3VI3B 2M1ZA 4B6SA 1FJGB 3QF4A 3N0VA 3BULA 3EQ8A 3TEJA 1GZ4A 8OHMA 5K0EA 4MHTA 3M5WA 3V7UA 2ZJBA 5JAPA 3EGDB 3I37X 2DUNA 3FLAA 1NNI1 4C7JA 2R1VA 1ICEA 2UYCA 3C48A 3I23A 1A98A 3ER6A 4FPXA 1Z4OA 4KPUA 3TAUA 2GZAA 2IY9A 2FEPA 4Q4LA 4YRPA 1M0EA 1ZR4A 2EW8A 2PMFA 4W9NA 4G2NA 2JK1A 2H3EA 2HQRA 4CPDA 4ZIRB 3I73A 3KNZA 5LR6A 4F71A 3PC8C 4G0XA 4DLKA 3AL0C 1COWA 1W85A 3DBHA 2FN9A 3OVMA 4DREA 2P27A 1IZYA 3BN3A 3PA8A 3DYVA 4JR0A 3TZHA 1THTA 3CJQA 3V3TA 2QXTA 2P67A 4RGVA 1ESEA 2HZ7A 4AN0A 1RZRA 1RC1A 4ZEXA 5BV1A 1S96A 1BXRB 2BZSA 4LISA 4YIKA 4DYDA 4QDKA 3EVEA 1ML3A 1LUAA 3WQRA 1W88A 3NM6B 1CUYA 1YIDA 3PLNA 4L8LA 4Y7DA 2PPVA 3VAZA 4Y6GB 1PLLA 2AN5A 1EDBA 3ICPA 1B00A 3OIYA 1AKEA 4DQXA 4J7AA 5KTRA 1EYZA 2ORVA 3HU3A 2OVFA 3INTA 4LDPA 4R8LA 4CCYB 1Y48E 1UBMS 2B1QA 1JLRA 3BE5A 3PICA 4TYQA 3M6UA 5DGHA 3MWFA 1TVEA 3IVMA 1RC0A 3QVVA 2KE5A 1HLGA 4Z5XA 4GI5A 3WZ2A 1KOGA 3AVPA 2ZAMA 2IYZA 3CN9A 4U7GA 2ZXUA 1A9ZA 3CNLA 1MVOA 4KWTA 4N5LA 4MQLA 2DCUA 4XB1A 3MILA 3KSUA 3O82A 2VHUA 1YMUA 1ZN2A 2W71A 3DPUA 4KPFC 1Q57A 5CFPA 4KO3S 2WMOB 2E18A 5E1MA 3K0EA 3VDNB 2PUFA 1PN3A 3CLVA 1BW9A 3DEKA 1BHSA 1QONA 4YA6A 3WKBA 4EKEA 1E3DA 5IAJA 2VJYA 3EGIA 3NNDA 1Z6GA 4AUEA 1KAHA 1KXZA 3QMVA 1NJ1A 1B26A 4FVTA 4NAVA 3ZWBA 4M36A 1RWBA 4KHPB 5C3UA 1A9XB 1LSJA 4YS6A 1LDBA 2HF9A 4E14A 4QXMA 4GI7A 1ADGA 4D8VA 3KAQA 1ZMXA 4L3OA 2ZKLA 3ZX4A 5HGXA 5H1YA 1GZ3A 2JAXA 4WXYB 4M0MA 1JSCA 4CMEC 2YS6A 4Y9RA 2JLZA 4KMMA 4TT3A 4OAQA 5GJCA 2RJOA 1L9KA 5DVZA 5AHKA 2WSIA 2N1BA 3C8HA 3PQ3A 2Z8ZA 3DM9B 1LSSA 2Q1SA 3RS0A 4A3SA 1JSLA 1ODKA 1ZLYA 4DUYB 3W6PA 1XZHA 5FL3A 3LLVA 4MWBA 3GLSA 1UMDA 4S1VA 2BEKA 3G68A 3VV3A 3R7NA 3N9IA 3D4LA 1TM3E 4YVFA 5K3FB 1I13A 3LU1A 4YJGA 5T41A 4DCSA 4F04A 4QGSA 2ZE8A 1E66A 4UEWA 4EVIA 2IH2A 1JI0A 5H5JA 4BDTA 2Q1YA 5FWYA 4PHFA 3I39X 3IUYA 3TLEA 4YDSA 2XB9A 4OLBA 1XTBA 1G9SA 1XDZA 2IF0A 1MEOA 1NPYA 3QWIA 4QVKA 1QH9A 2QNBA 3NWPA 2CSUA 5DO9A 3T3NA 2YZMA 3D5EA 1LTKA 3ZU6A 1MAWA 1H0HA 2ZJ4A 3GGJA 1KY5A 1L9XA 2D0OB 3EH1A 4TM7A 5KTSA 1J56A 4WECA 1Y1QA 2VP4A 2GYUA 2SECE 4B5LA 4MYRA 2B2CA 3TNJA 2FPLA 1M6VB 3R7BA 2VTBB 5KYUB 2ENWA 4MV9A 5IKEA 3KYCB 1E4EA 5EHZA 4X66B 2FN4A 4ENQA 4X8OA 3F9RA 4PO1A 4E0BA 2A57A 4ZYWA 1IVYA 5CCXA 3ZGXA 5JG7A 4BLPA 1BXGB 3JWIA 1SK9A 1XQ9A 3HWX1 4BTEA 2ZRPA 3RS9A 1PTJC 2F1RA 2IHBA 4B7ZA 4RDXA 4K9KA 4UZEA 1NXVA 1YUBA 1JHPA 4J2OA 5FTJA 2KM1A 4GEKA 3ZWYA 3CUTA 4MVJF 4RVHA 5IWCA 3D8SA 1CQZA 2BLLA 4JLWA 3DAHA 3RVRA 1IH8A 1P4HA 3K1AA 3Q88A 4YHHB 2RC6A 4K03A 3HM2A 3ZXUB 1HFEL 3IP6A 2QMOA 1F3LA 2HAEA 3REGA 4U39A 5CYGA 3CGWA 2E4UA 3MGBA 3ESRA 4MVJI 1NLFA 3SDZA 9ATCA 2Y27A 4OXIA 4TRMA 1EUCA 1G21A 4HNVA 3EGXB 2QAIA 1I5OA 2X1LA 3MF4A 3MJ4A 5DTJA 1ZH6A 3ANMA 2W2LA 4PFSA 1RBZA 2FEXA 4NBRA 4RZ3A 3LJKA 3PXXA 5C7LO 5HK8A 2AE1A 1CNMA 3BXZA 1VOTA 3EY4A 4AYWA 1XIVA 4UFNA 2B30A 2F7SA 3EN0A 4O2AF 4BYMA 4R40A 1TYZA 2UUAB 3RCBA 3KTOA 1KYZA 1VMEA 3H87A 3K2IA 4XIFA 1GZ6A 2LXNA 3I61A 2ARKA 3IDOA 3JASA 2I4IA 1XV5A 2ZBPA 1OFTA 4R5MA 3LGSA 2ECFA 1GFSA 4EYKA 4Z3KA 3EDQA 3DA8A 4PWZA 1CUFA 1VL6A 3EDYA 3CZQA 3WLAA 1N1EA 1E1MA 3KHKA 4GMHA 1WXDA 4W8OA 3Q8MA 1LQTA 3OM9A 2BAGA 1ZKMA 3ESBA 4MUGA 3IE0A 3LVQE 4DCJA 3C3EA 1KJQA 3HC7A 2W8BB 2GRAA 3LNCA 1ULSA 4PO9A 2HHLA 5AKKA 5FYDA 3GEGA 1I6MA 2Y99A 1J7KA 2YJGA 2O1XA 4V2IA 3OZSA 3N0WA 1Y8ZA 1NDUA 1QJ4A 3W3ZB 2BH2A 4OIFA 2H9YA 3TMYA 4CG2A 3UJHA 2B4RO 3ANXA 4KFRA 4H3VA 2HKIA 2LNDA 3KUDA 4NZYA 4ZANA 2G4CA 4IFTA 1SUIA 1M6EX 3KOZA 4PYJA 4EGFA 1Q1BA 2SKEA 1KY3A 4Y1GA 5LQCA 4XFKA 4DQKA 2WQ6A 4LGCA 4ARAA 3T12A 3IHLA 5SYMA 3E1SA 2CBZA 2B1RA 4EHBA 1IWOA 2JRCA 5DYTA 4BNWA 5C32A 2P2SA 1G60A 2O7NA 2RK3A 2ZUDA 2PNFA 3WKAA 5FBVB 5LM3A 4B4KA 2WTMA 5DCWA 2VJDA 5DIFA 4H7PA 3VR3D 4DTCA 4C4OA 4HNUA 2BC9A 1LS1A 2NU8A 2NZ8A 7AT1A 3DZBA 2QRUA 3L02A 5E1OA 3B1YA 5EL0A 1I3MA 1CUEA 1NTOA 3DOHA 4MS1A 4CKZA 5IAAA 4OD0A 1IHPA 1C1YA 2IRWA 4JQSA 4RQBA 1E7YA 1W2HA 2CFSA 3GNQA 4X20A 3NORA 5B3KA 1E7RA 5A7HA 3I9MA 1XX6A 4G0VA 3PQ8A 3U1VA 4IYJA 4ENWA 1E96A 2C8JA 1AGNA 2IX9A 4WUVA 4DMMA 1GLVA 2GN4A 3CWQA 3H5OA 4J2TA 3TLGB 4GX5A 3MQFA 4NS4A 1K89A 1SVIA 1ZNZA 1PVDA 3DTVD 5HE9A 5KAPA 4AUNA 3KVVA 1H0SA 5IK2D 2IEGA 4KAFA 5FV7A 1FK8A 1GQFA 1GV1A 1PU2A 5JSZA 1ZK0A 4P1ZA 3W8NA 4A03A 2GAFA 1CQIA 4RFLA 2JLAA 1ZRSA 2FX2A 3JZAA 2BEWA 5D85A 5GM2A 4URWR 3GG9A 4PTYA 4OGLA 4WZBB 5IBRA 1GNVA 3RLIA 5LIPA 1E7QA 1RLIA 1VFPA 3L1KA 3R5JA 1GUAA 4JUDX 1OXMA 3HHEA 3HN6A 3LLMA 3DEAA 4RV5A 4U9UA 4A8HA 3G0DA 4W1RA 2C5LA 1P3Y1 3ASVA 3QEKA 2AJBA 2CE7A 3H2KA 3OZCA 4UFOA 3ZY2A 2ZI3A 3QW2A 4YP7A 1V48A 4ALJA 2QDXA 1OA1A 3EAGA 3PNSA 1HYGA 4J0IA 2QDKA 4O2BB 5AVZA 1W5TA 1YZKA 2C0PA 3FDZA 4UUMA 1HQDA 2I54A 4UVGA 2QORA 4S05A 5E2BA 3GI1A 1IZ7A 1R6XA 4WLEA 1JNXX 2HH9A 2AEMA 3CO5A 5C8DA 2OQRA 4HX2A 1PJAA 5FLXA 4M21A 2VZEA 2D2VA 2ONCA 4YHBA 4YDRA 1EB8A 4BTLA 1L1RA 4CIAA 1NFQA 1N2CE 1NW4A 2EV9A 3EWIA 4B34A 1I2AA 1VYUA 2L69A 1D4ZA 3EBOA 1P80A 1G9TA 1UBHS 2CCJA 3LT5A 4MQBA 4DC0A 4YRZA 1YR7A 1SAYA 2VDWB 3QEAZ 4Y1RB 1OFUX 4P34A 2MSEB 3EDCA 4M7OA 4TWRA 1LV7A 2OORA 3WRVA 3X1DA 4E3ZA 3PCXA 4I5DA 1DTWA 5EKSA 1U6IA 3GRUA 1R5NA 4KO4S 5J2UF 4D5GA 3FOCA 3UT5B 3QQ5A 1OXXK 3RG2A 3PGMA 4HAYA 2YN4A 2BTQA 3HGQA 3MJEA 1R9MA 2BMWA 2GCEA 2PR2A 2X8JB 3WLLA 3LOUA 4G4IA 1J9ZA 2BR4A 4KQCA 4KAXA 4QIHA 3K2QA 3CW8X 3GA7A 3MD0A 2QD2A 5HJ2A 1YDWA 1JZQA 3NKVA 4LK3A 3X1JA 2WJYA 1Z5ZA 2ZJYA 1JU4A 3QLUC 2IYVA 2JHAA 2GDZA 3DLTA 3R3VA 2A5LA 3P0HA 5FFMA 1PWHA 1VXRA 4QOHA 3TSAA 4PRKA 2ZBGA 4MGYR 1G20B 5IKOA 2MTBA 2EWWA 5KMGB 3EX7C 3HY4A 2Q46A 2LKCA 1H42A 2Z9BA 3AI3A 1N6HA 1DADA 4J0HA 4MYUA 3R7AA 4CM8B 5LD2C 4F5YA 5BVGB 4CCAA 3RYTC 1N0HA 4FFDA 3KQKA 2VDUE 1U7OA 2FEWB 2HU2A 1P5JA 3A1CA 1U2QA 3W5UA 4AKGA 2JCVA 1AC5A 1IVSA 1DQZA 1VLHA 1M83A 3O92A 1OZAA 4TUYA 4YAEA 1JEAA 4FKMA 4TZKA 1WTAA 3SQDA 1E6MA 1I7NA 2YS7A 3A28A 5HILA 2XKKA 2RGEA 4AK9A 5KQSA 1DE0A 1CQWA 3C98A 1BVUA 4N7RA 5FWXB 4ALNA 2DQSA 4HEA1 5LA6B 4V0KA 4YJ3A 2X2FA 3JD3A 2G1UA 4YAWA 2YXBA 4FEGA 1BHO1 4PLFA 1PQPA 2PKYX 1LNQA 1Q3KA 1UBLS 2BSQA 5GV8A 2OMEA 3IUBA 3OIWA 1L5ZA 1OB2A 1HYEA 1QGOA 4B73A 3TJMA 1II8A 4EPRA 1D4OA 3HXTA 2ODTX 3JU3A 1EGMB 1JFLA 5IYZB 3PE4A 4K81B 1RLUA 3IPXA 2ADOA 4H27A 2Y8EA 2NXNA 1AK9A 1RKXA 3OEED 5AI0A 4BQRA 1LNZA 1WZIA 1APBA 4BEBA 2ZI4A 1NUAA 5FNVF 4R9NA 3L6RA 3FTPA 2F1HA 1Z9BA 5E7IA 4AG5A 5K3OA 4WNAA 1QCDA 2CFCA 3JAKA 4J7XA 4C4RA 1J7JA 2ZYSA 3NH9A 2C57A 3HHPA 3EHDA 4LXTA 3RSQA 3PEUA 4ARBA 3BK7A 5BMVB 2ZIXA 821PA 3HXQA 4C7OB 4PSCA 2B9VA 5TQ0A 4NCHA 1A8PA 5BYAA 1O97C 2VPZA 2WG1A 1JKJA 4RVNA 4EF6A 1NXOA 1LLFA 2IOFA 4EB3A 3TFOA 2OBXA 2GD2A 4J07A 3IUMA 1KRWA 4B6RA 1M2EA 2IY7A 3BVPA 2HBQA 4J49A 3A6EA 4IXMA 1MOSA 1KI8A 3QV2A 1SUAA 3GX1A 4H7FA 4QHSA 1F7VA 4V3BA 5DH9A 1PFUA 3AUUA 1G7CA 2E4AA 2OP1A 2YDYA 4BIIA 3E58A 3RYCA 4FEAA 1YDFA 3AB7A 4ZP1A 1J24A 3ZWOA 3Q1KA 1E1NA 4LRYA 3ROTA 1N8SA 4MLDA 5C5DA 1FP6A 5D6NA 5CH5A 5ESRA 3OQNA 1V11B 1BMFD 3IMCA 4QOGA 3U80A 5EHXA 3CCFA 2YMLA 2GM3A 1GADO 4RYDA 2JGJA 1E3MA 1Q6ZA 4R1TA 2AI1A 3D1LA 2JIRA 3GLKA 2RH9B 3K9HA 2JLQA 4LMBA 3ZBUA 1LX7A 3JQAB 1Z28A 1PRYA 3SWWA 1DUSA 4RLSA 4D0NA 4IL5A 1UL1X 2PS1A 4HN2A 3DTNA 3RSZA 3USCS 4HDNA 1UEIA 2Z6AA 5E1DA 1LS6A 4RMJA 2VDNB 3CVVA 2XQKA 1KAQA 2V7EA 3CSDA 5FTKA 2HA3A 5AJTA 3V1UA 4QSHA 3K70B 4CFZA 2AFIE 2VUSA 4OUKX 2O8FB 2D2EA 3VHRA 4TLBA 4D3YA 2ISSD 3HKEA 3FRIA 2J4DA 1M5TA 2GZ2A 4R3WA 1ZD2P 4R2XA 3PWTA 3THWA 5CM9C 3WAJA 1ECPA 4D4GA 5HKAA 1XXHB 2BYTA 1DJLA 5JATA 3MUFA 1W44A 3TTWA 1P5FA 2X6QA 3KSAC 1Z4QA 3DKPA 3G8AA 1GFZA 1X7ZA 3DZCA 3H84A 4J16A 1P75A 4LNHA 3RREA 2ZYVX 1EQUA 3RSLA 2EKDA 1EVJA 3QPBA 3W2HA 1GG9A 1KMNA 4AJPA 4CT0A 5BNZA 3HYRA 3ERCA 1XD2B 1RFGE 2DKOA 2PSDA 1NSYA 1GGNA 1VBFA 2FLVA 2JHGA 2QRPA 1ECJA 4ZV9A 4EELA 1ZR2A 2VDLB 4B32A 1Y7LA 2VBFA 3VH1A 2XSZD 3DTVA 1JXOA 3H7AA 4JN6B 2VPPA 1BQ3A 3KKPA 3WSWA 2H06A 5IK2A 5I8WA 4TV9B 2JLCA 1HFWA 3EWNA 1LDNA 3RV4A 5AW0A 5JROA 1L5HB 3C3KA 3DWEX 4DB2A 1KZYC 4UM8B 5IARA 5K0NA 3DT8A 3MS4A 4C6HA 1JEYB 3L06A 1DIRA 2WPNA 1T9HA 3JVIA 3KXPA 2V4ZA 1H5QA 3MPOA 3V00A 2PKEA 5EJ4A 4CG1A 3K4PA 2Q6VA 3WLFA 2IZZA 1Q14A 1Y42X 4ZKDA 5FUYA 1LQ2A 4EWLA 4HHEA 1KO5A 2RBKA 2V6FA 4M1SA 2NSHA 1AE1A 3EW7A 1SIUA 2IGBA 4B43A 1A4XA 5K0ZA 4YRKA 3P9CA 2HDNB 2CXOA 3PRHA 5TMEA 1IN7A 1ZXBA 4IX1A 3GJ4A 3QVLA 3NTRA 3Q0TA 3OQOA 3F5SA 2QV7A 2F67A 4MULA 1QP7A 3IULA 3QHPA 4HQLA 1ZD5A 3JARA 2X6TA 5L3RA 3ZPXA 2E4WA 3PGKA 4DE5A 5C1BA 3TCKA 1DIBA 4Q1BA 5JECA 4HRAA 5TGZA 1HY3A 1T29A 4UBMA 4LJLA 4EG3A 4JNCA 2WTEA 1P18A 2Z8YA 3AIIA 1KZGB 3DBLB 2EJWA 2B99A 4NZZA 5L3QA 4NK4A 1FS5A 4DF3A 1GRNA 2X2PA 3Q5EA 3H5NA 4XYLA 3I04M 5EHGA 2R7LA 5IDQA 3ZJ5A 2GKGA 3IX7A 2GF2A 2V7TA 5BV0A 1JG4A 1RZ3A 2DFKB 2XADA 5JHGB 1K7SN 4YJ2A 4G26A 1UJ4A 1XTTA 2REQB 3E70C 4B3FX 4CG0A 1XMSA 2H4FA 3DZDA 3D6MA 2H2GA 3K0AB 1IXZA 3LMKA 5KYNA 1NPDA 2QG9A 4QEKA 1EGQA 1L7NA 3N7UA 2J9RA 3U9SA 3CA8A 4YUZA 2E6KA 3H1BA 1OIWA 3JATB 5KYWA 1THMA 2P2DA 2PD4A 2DWCA 2QJWA 3BG5A 2E85A 3K3PA 4MW6A 3UMRA 3WAKA 3CBQA 1UK6A 2P4EA 1JBQA 2M6LA 1A2QA 1AMOA 2ZUSA 5KX5F 2EZUA 2HK6A 1CHDA 1YOVB 1ZCFA 4PRLA 1AMNA 2V4UA 3NAMA 5HE8A 1KAEA 3QFRA 4XM1A 2GESA 4N0QA 3S2UA 4YRNA 3NEJA 3RRYA 5BP7A 1CK4A 4Q5IA 4DMHA 4D25A 3DS8A 2VT2A 3CLHA 1HZJA 1PYGA 1UJMA 2MWMA 4KR3A 2WHXA 4NS1A 2G83A 4Q21A 2BUCA 5JH7F 5JO9A 3ZWNA 4CMAA 2CJPA 3VBCA 3LYUA 4HGZA 5EIWA 1TKAA 5C1IA 4O2RA 1YQDA 1NTRA 2CGEA 4DCNA 5AI5A 3B5IA 2G5TA 3LW8A 1LDYA 4TLMB 4URYR 2GASA 3I2GA 4C06A 4M76B 1C0LA 1BVHA 1HT1E 2ECQA 4XX0B 3NHKA 3RC2A 1RC8A 1Y5LA 4DSOA 3M9XA 3MYRA 1BMQA 1FOEB 5KSWB 1EG7A 3WRWA 4Q0MA 2XT0A 4RPHA 1KVSA 1N7GA 4YXWD 1QYCA 4ZZIA 4CEJA 2P3QA 5LZ4A 2NT3A 3D6JA 4NNJA 1P1IA 3ZXYA 2JW5A 5JD6A 4MICA 4KYVA 4ER0A 1AZWA 1EK5A 3FCEA 4ZVLA 3EUAA 5HQ3B 1JPJA 1L1FA 2P2ZA 1WNTA 4F3CA 3AY3A 1VPVA 1ZWKA 3OLXA 3NG1A 3ZTTA 4C03A 5H8WA 3FTFA 4DCTA 2HMYB 1F5SA 1MKYA 1L6IA 1ZIOA 3TIIA 4RS3A 3KLBA 4F9EA 3PK0A 4PG5A 4EJ2A 3K9LA 2Q3FA 3OEEA 1U1CA 2IOQA 1M54A 2GEKA 5E6UA 5K9ZA 4PSUA 1CRZA 2JFNA 1Y3HA 2F3SA 3DV0A 1SQSA 1AS2A 2ID7A 1JEDA 3QA3E 3BFVA 1ETUA 1MJGM 1AUOA 3F6PA 3QM1A