4JLJA

Human dck c4s-s74e mutant in complex with udp and the f2.1.1 inhibitor (2-[({2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
241
structure length
232
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structural characterization of new deoxycytidine kinase inhibitors rationalizes the affinity-determining moieties of the molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 232
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jljA00
3KJGA 2BEKA 1WBDA 1JR6A 2CJWB 1TF5A 5UKDA 1Z83A 1T0JB 3FFBA 1KAOA 1OFIA 3TW8B 2G1JA 2J0UB 4Q4HA 3LQQA 4LHVA 4KXFB 3UMFA 4BECA 1XMVA 3IPXA 4ZDIA 3GJ4A 3T35A 3IGFA 4F93B 3FMIA 4HDCA 1XBTA 2OFXA 3BS4A 3WNDA 4Q1EA 2NPIA 2YWEA 3SJCA 3U6BA 3KKNA 4Q19A 2HT6A 3QPVA 3EZ7A 1GILA 1XZQA 4XVQA 2CXXA 2AK2A 5AJVB 1W46A 5KDOA 2DB3A 1QBKC 4L9SA 4GPTA 1EFRA 3NC1C 3NVAA 2WHXA 4YONB 4NYJR 4DUGA 3X2SA 4OK3A 1CR2A 5FUXA 2HF8A 3ZJYA 4DLZA 2EW1A 1W36C 2OBLA 1XEWY 4P4SA 4TN1A 3I61A 1UKYA 1XD8A 1N6PA 2P5SA 4BFTA 1UAAA 1W7AA 4PHTA 1F60A 4CYMA 4FWTA 4NU0A 2ZI3A 5TMPA 5BN5A 3OFND 1Z29A 4KV9A 3ZQJA 1NLZA 4LJ9A 3P27A 1GNQA 3CWQA 2R2AA 1KYIA 2A3RA 3IBYA 1S1MA 3L0SA 3AP2A 1XRJA 5CK5A 5DO9A 3V4FA 2QAGB 2CLCX 1XP8A 5HCIA 2CVFA 1ANKA 2QT1A 3ZZUA 3VX4A 4D2IA 1E2QA 3BRWD 5KO2A 1N0UA 4ZCMA 1TQ6A 4IVQA 2WSSA 1EFHA 2AXNA 1DVRA 1RYFA 2KSQA 4JSYA 3RYTC 4BZPA 3J81k 1KI1A 1Z47A 3OHMA 4JLKA 4N0DA 1KI6A 5L3QA 4G01B 1N5KA 1YU9A 4R9UC 2W6JA 4AY2A 3CF2A 4A9AA 1E2JA 2ANCA 3BB1A 3K09A 3TNFA 1JQLB 4GBMA 4NE2A 3L8ZA 3QF4A 5JECA 3ASZA 1JQJC 3ECCA 2FMXA 3UANA 4Q9LA 1RRFA 1KSFX 1RW4A 5EUMA 1RVDA 1E2FA 1I2DA 1RJ9B 3Q7PA 1SVMA 1W4CA 5EXPA 2GF0A 5CM9C 1Z0IA 1ZNYA 1QHYA 3ZVLA 1C1YA 4NYMQ 2IYSA 1ZU5A 4PPQA 5AJWA 5C4MA 4K46A 2RGDA 3RWOA 3ZIAD 1OB2A 1KO8A 3H4MA 4MDFA 4RFVA 4AIIA 1H8ED 3O8BA 2XNDD 2W58A 2X8AA 3OEHD 1XMIA 3ADCA 1K6MA 1J7KA 1KSJA 1XXHA 5DYIA 1FOEB 3CRVA 5P21A 3RRMA 3A36A 5GVRA 4MKGA 4PAOA 3KXIA 2GXQA 1J99A 5EXTA 5DSZA 4IW3B 1WBBA 1IM2A 3CBQA 4XH9B 1KSHA 2AL7A 4B76A 1QHIA 2QMOA 5FR2A 4B75A 4JLJA 4YDHB 4D82A 4F38A 2VHJA 1DPFA 1TTTA 4DC9A 4ESVA 2GJAA 1UBGA 1BO6A 2BIFA 4Q1CA 4GNKA 3EA0A 2C04A 1U90A 1KJZA 3KB1A 1E2NA 1Q1ZA 3NHBA 2MSCB 3EG5A 2F7SA 2KWIA 4A8JB 1F2TB 3F0TA 3DPUA 5CK4A 4ACBA 2JDID 2O8EA 4TLEA 2ZRNA 4TL8A 2G9NA 4AC9A 4CEIB 4ARZA 4GOKA 3K70C 5LB4A 2DWOA 2E9SA 3MRSA 2YOFA 2YWGA 1FTSA 5L3SA 3DL0A 4QHSA 4A1FA 3A4MA 4MGZR 4Z8YA 3I92A 2QM7A 2FH5B 3K9HA 1O87A 2CBZA 2ZSAA 3QI2A 4KBFA 2EU8A 5F98A 2FSGA 2IHBA 3D7MA 3TSOA 2AKYA 2FA9A 2ZI4A 4A36A 4LSGA 5TXGA 1LB1B 3MWYW 3SHFA 2QG6A 3I5YA 1OSNA 1E9AA 1DADA 1DO0A 1OW3B 1U0HC 3CR8A 2SHKA 2BCGY 2F1IA 3B1ZA 4PR0A 2A5DA 1QZXA 2QORA 3IILA 3OIUA 4N0EA 4X8HA 2FZLA 2IL1A 4U5XA 2C9OA 3GLIA 4PPGA 2ZRAA 4PQFA 1E9EA 1L4YA 4Q5IA 3TUZC 2IXGA 3BXZA 3W3AA 2LCFA 1NVUQ 2ODNA 4Q4AA 3S1AB 4MH0R 2XGJA 3ZGXA 4M1WA 4C7OA 4WBSA 1XTQA 4G3XA 4LBWA 1G8FA 4PXAA 2ZS7A 4RZXA 4B48A 1KO1A 4MKFA 1UJ2A 4KYUA 4IJMA 3U3KA 3KKOA 1OJLA 4URVR 3SZRA 4URYR 1G3MA 5EP3A 2WWYA 1Z8FA 2HV8A 2ZAOA 3I1FA 3EW9A 1NLFA 4LV6A 3SYKA 1RC8A 4OHWA 2QE7A 1E2MA 1XCGB 2GNOA 2IUTA 2XB4A 1XJCA 1II8A 5BW8A 1W0JA 3QVUA 3L8YA 3U44B 4EQ6B 3AVWA 2C78A 1Z6AA 3THOA 1PUJA 3FTQA 5IK2A 3GJ7A 4Q48A 4EAQA 4C0BA 4EFLA 4QGGA 1XXHE 1Z3IX 2MMGA 3K0FB 4XWOA 3WXMA 2FFHA 3GLGB 1E9BA 1JJVA 4DSTA 4DZZA 4JJKA 4DWJA 5A5GA 4GT1A 3IQXA 1HY3A 1E1RD 5HCNA 4DT1A 2FU5C 3D8BA 5LD2B 1DAFA 1XEFA 4FMBB 4I1SA 4UNNA 4B32A 1XD9A 1D9ZA 2QRNA 3LX5A 3LY5A 3WYGA 3SDZA 4D4JA 2XTMA 4OI4A 1XFAA 1CR1A 1N5IA 2V8OA 2D2FA 2PCLA 1KK2A 5FTNA 5HE9A 4B6EA 1NJGA 3C8UA 4TMTA 1E9DA 3U6KA 1WE2A 4OL0A 3QEJA 5DHFA 4ZCIA 4IFBA 2KB0A 3T61A 1XMJA 5BYKA 5DLQC 1LF0A 4FMCB 1OH5A 1E1QD 4ZPXA 4BWYA 2J9RA 1XTRA 2A5GA 1T3SA 4M8NE 3WYAA 4DCSA 5EQTA 5JMTA 2WAXA 4OHYA 4URXR 5JSZB 4MYTA 4LI0A 5JWHA 4CRWB 1LW7A 2OXRA 3NBFA 4JL8A 4IOKA 3U3RA 3GFOA 4MUBA 1DAHA 4YMSA 4CEHB 3CH5A 4EJSA 3ZVRA 1FP7A 1KO4A 4JT4A 3U4QA 3NEJA 2ZSDA 3QXCA 3OZXA 4AG5A 1HYQA 4ZDJA 1G8PA 1KJYA 1SKYB 4NCNA 3DZ8A 3VHLB 4JLPA 3VR6A 3ZZ0A 2WMNB 5AUOB 3FHTA 1YQTA 1U8YA 1CU1A 1UDXA 4QG7A 4TLAA 2QNRA 1CRQA 1YVDA 4CT5A 3QG1A 4EIWA 2ATVA 1YHNA 1NN1A 4OHZA 2XJ9A 2QBYB 4JKYA 4EPXA 4GMDA 3WBKA 1U81A 4QM7A 4KLNA 1N2CE 1VG9B 5HZHA 2N1BA 2CHQA 3QIAA 2ZU0C 1QHHA 1N6NA 1XCPA 4A2QA 3FHCB 3RS2A 4BFUA 1BYUA 2ZE8A 3MUFA 1CJTC 2Q9AA 3GLFA 3PVSA 3FGNA 1YE8A 5CYOA 3B9QA 4A0GA 2FEOA 4BGDA 2D62A 4IDOA 1UF9A 1Z0JA 1E2GA 2X1VA 1B0UA 5J4LA 3K1JA 4MGIR 2NTYC 4MA4A 4C0HA 3SC3A 4PFSA 1PUIA 2R65A 2XSZD 3ASYA 2RGXA 1TL7C 1W0KA 4HUQB 1KIMA 1E9SA 2NO0A 2ZREA 2BMEA 3QUSA 4QBHA 4I1VA 3K09C 1NVVQ 4XWAA 4D26A 1E9FA 3Q3JB 3CX8A 3M0EA 2ZI9A 4DSOA 4TQAA 4V0NA 4I1UA 1FUUA 1M74A 2VHQA 2ZU6A 1E79A 4Z54A 4KLZA 5JRJA 2JLUA 2FX3A 5C46F 3KQUA 2QZ4A 4RZ2A 3PITA 1GKIA 4A6XA 2ZJAA 4AI6A 4HDQB 1X86B 4OK6A 1CF4A 4LX0A 4PQRA 3AVXA 3KKMA 2ASEA 4YMUA 1NSTA 2OCPA 5DN6D 2OAQ1 3LBNA 4DBLC 2IYUA 4G5QA 1XTKA 3OF5A 4EDHA 1MO6A 2GA8A 5DE3A 1GDDA 3WYFA 2JAQA 3REFA 2QMUA 4II7A 1NJFA 4B3FX 5TY0A 2GCNA 3RWMB 2K5UA 2CMKA 2D3WA 1KDRA 5FPTA 1XTSA 3VU9B 1L7VC 1JR3A 2GBLA 2J45A 3AB3A 2Z6VA 1BS1A 4MGKR 1PLLA 5EXXA 4ACAA 4A0RA 2OG2A 5HKKD 3ADDA 4ZI2A 1OB5A 1QHSA 2VP9A 1NNEA 3I3SR 1XMSA 2PBRA 2VP5A 4IVRA 4WIAA 3P20A 3BH7A 4D4LA 3EZ9A 1JXMA 1M7BA 3IEVA 1LS6A 3OAAD 5AK0A 3QXXA 3U7GA 4IOJA 3SFVA 2XOKD 3P1JA 2GXAA 1BYIA 3IO5A 4TL6A 4ASUD 2ZRCA 2ZUCA 2RGCA 1W1WA 4FCWA 3BAFA 3WMGA 1COWA 2FGJA 2QY9A 2ZRGA 4QXAA 3CLVA 4JT2A 1JAIA 4QM6A 3W34A 1BMFA 5EP1A 3T5DA 4KJZA 4B6FA 3UG6A 1I4TD 2XAUA 4OJKA 4D6PA 1V5WA 2J0SA 2XZLA 3SJBA 2V7QD 3HR7A 3ZDQA 3LXRA 4OQNA 3GLFE 1NIPA 3IEUA 2VHTA 4M22A 4F4JA 3QG5A 1AJEA 3UWOA 2VLIA 4TSFD 3VNUA 2Z4SA 5K8TA 1E0JA 1MO3A 3G0HA 2PMDA 1F48A 4Q1FA 4Q21A 5AJYA 3WNCA 3D6TB 2NGRA 3T1VA 3N5CA 1ZBDA 5JWRA 1M34E 3ND9A 2J7PD 2GILA 1D2EA 3H86A 2GAAA 3NH9A 4LV5B 4UKDA 4BFVA 4GZMA 2YVUA 3PUVA 5H1YA 1OE0A 3DKVA 3VKGA 2OCAA 5G3ZA 4GMXA 4DB2A 1X8KA 1G4AE 3KUCA 4MQBA 3FKSA 3V9PA 3AKCA 5H8WA 3U3JA 2G1KA 2B7CA 3OIYA 4B3CA 2BJVA 4NMMA 4JLDA 5D3MA 2IYWA 1DAIA 4DIEA 1SXJB 4O25A 2D06A 4HZIA 5HE8A 3PFIA 1ZNWA 3HP1A 1E4YA 4QNMA 2JGNA 4YLGA 5KYKA 5B57C 1ZM4A 1D6JA 4RD1A 5KU1A 1G64A 1KI8A 2G0TA 8OHMA 1U8ZA 3W8NA 4TWZA 1FZQA 4D0NA 3HU2A 3HU3A 4B2IA 4LJ4A 2Q3MA 2GHIA 3GPLA 1YR9A 1TUEA 5CJPA 1TMKA 3PQCA 2GAOA 3KQKA 2BMDA 3SOPA 2JLSA 2PX3A 2BMFA 4XD7D 2OILA 2GEUA 2OFOA 2X2FA 4YXWA 5FH9A 1RIFA 2QL6A 4WXRA 3RS5A 1EESA 1UEIA 4PZZA 3UG7A 2V1UA 6Q21A 3ZD7A 1HH4A 4PSKA 2WIBA 2DFTA 1N5LA 1Q3HA 2ZS8A 2YZ2A 1S2MA 1E0KA 5G40A 1GM5A 2EFEB 1WA5A 3R9IA 1P2UA 5AUPB 2OFWA 4FINA 3B78A 5GJVC 2DWPA 1UKVY 4Y0AA 3NIBA 4BFYA 3QJYA 4KCGA 1IXRC 2O0HA 4E22A 3CR7A 4HYYA 4Q7MB 1SQ5A 4WVFA 1Z6XA 2OSBA 2CDNA 4BEBA 5F3WB 2IYYA 5JZVA 1OH7A 2ZQ5A 3QNUA 4M1OA 1NIJA 3QKTA 4EKDA 2DHRA 1AZSC 1IY0A 1NMXA 2DR3A 3PJRA 2O8DA 2R44A 2N46A 2OEPA 1KMHB 2ERYA 1XTIA 3AF1A 1VCMA 3NWJA 4Q4JA 4N1AA 4M1MA 2GK7A 1SHZA 2C2HA 4UNRA 1FX0A 4NKRA 1X1RA 3LNCA 2CCGA 1NY6A 1W36B 4LC1A 3KKPA 1GL7A 3RS0A 4QGAA 2ZRIA 3NBYC 1Q44A 2Z0MA 2ODEA 3A4LA 5HTKA 1ZCBA 1P62B 2FPMA 3B1WA 4EJSC 4ZI3A 1Q20A 4TYWA 4D0LB 1NKTA 1Z5ZA 1A2BA 1R10A 1R0ZA 3THYB 1KMQA 1Z2CA 4NP6A 1OFTA 4QGFA 2O8BA 1UM8A 1CJUC 3DEFA 5JJIA 2GCPA 3KQLA 4JLMA 4C2TA 3AVUA 1LFDB 4RJLA 5FL7A 1PV4A 1VIAA 3EZ2A 3I73A 2WJHA 4EPTA 2J5XA 2J7KA 1KOFA 3C4JA 1Z06A 4GFDA 1JI0A 4IEEA 4Z1MD 3NTUA 5DHAA 3MWKA 3B1XA 3QY0A 1BH2A 4ZIRA 2RGAA 2HJGA 1T9HA 1ZM3A 3T06B 2HF9A 2VSFA 3DHWC 2F6RA 2JIZA 3BD9A 3QKRB 4IVPA 2NZ8A 1HE1C 4MRSA 2BMJA 3KKQA 2P2LA 1T91A 2EWVA 1AS3A 3RDPA 3AKEA 3IIMA 3W5IA 3RRYA 1D9XA 1R5NA 3PV0A 5CLQA 1TX4B 1WP9A 4AKGA 4TQUS 2JLWA 4N3NA 1HURA 3M1IA 4OI2A 4Q7LA 1H8HD 5JFGA 3MWLA 5D3QA 4DSUA 2OV2A 5HPYB 5JRZA 2XZOA 4M53A 1G18A 4TT3A 5L3VA 1LVGA 1UBFA 3N70A 3TSZA 1A2KC 2D7DA 1W2HA 1MKYA 3Q72A 1Z63A 3LD9A 1QHNA 1KTVA 2JCSA 2VIIA 3AGQA 4B3XA 1LV7A 2J59A 1X8JA 4PAMA 1JEEA 2RGNA 3CX6A 3EIHA 3THXA 2AFHE 4C4PA 4RFSB 2WKQA 1NG9A 5CYPA 5DIFA 1KJWA 1GFIA 1ZIOA 4DCTA 5CB8A 2WM9B 4QFMA 1FFHA 4S35A 1GP2A 1XTJA 2H17A 2C98A 1R5OA 2GZDA 3F3YA 4L9WA 1AK2A 2D2EA 2EYQA 3G5UA 4DIDA 4DXAA 1Q22A 1E32A 1GSIA 4PPFA 3BORA 2A5JA 1G8YA 3CIOA 2CE2X 4S2EA 4B3DA 3LW7A 1E4VA 1UDWA 4CEJB 3GLHA 1VYVA 2Q3FA 4M9XA 4TTQA 3VR1A 4A2WA 4LHXA 1KI2A 5FPSA 2GBLC 3SJAA 1ZUIA 4P32A 3BERA 1OHHD 4MKIA 5FL3A 3IHWA 4XJXA 4V0KA 5EE1A 2NPFA 3K70B 4AURA 2V6JA 5HR5A 4CGZA 4PC1A 1KKMA 2UZIR 1T3LA 2DFLA 3IO3A 3BJIC 2QAJA 4XOIA 2L0XA 4RSGA 1G21E 1XEXB 1ONBA 3GCGA 2AD1A 3TAHA 3QE0A 1GAJA 4DEYA 4BZQA 1CXZA 3W90A 2JLZA 1E2KA 1XJQA 4HZUB 2O8CB 1J8MF 3FB4A 5TB5A 2XXAB 1G3QA 2OXCA 4LWZA 3JZAA 3TE6A 1P72A 2IYTA 3C16C 1NN0A 1VPLA 4JLNA 4RZ3A 1QRAA 1KI7A 1NKSA 2GVZC 3NHAA 5DI3B 1I4DD 1U99A 1U2RA 1YJ5A 2AK3A 1ZP6A 2ZJ2A 2J3EA 2DCUA 3QXSA 4HLCA 1CR4A 4FN5A 4U02A 4BQSA 1VIYA 4R7ZA 4LPKA 2YINC 1RRPA 2WJVA 2REOA 4QBIA 5EZ6B 3S1AA 3TQFA 1WF3A 5IHPA 1SZPA 1IN7A 2P6UA 2CNWA 3IKJA 2NIPA 1DBSA 1KHTA 5KSOA 1VECA 2Q9BA 1KZGB 3WMEA 3C5CA 2ZYTX 1TQDA 4XVRA 3CWZA 2RGBA 1F2UA 1S96A 4TLDA 1QG4A 1GOTA 4JVNA 4BUJA 2BOVA 4TMWA 3D3QA 4HSEA 4RCYA 3TKLA 1F3OA 3V4RA 2Y8EA 3LQRA 3TSWA 3H84A 1L2TA 3TQCA 2GJSA 1MABB 3WNBA 1NF3A 1DAMA 1OIXA 2ZPTX 3ZZTA 4TZ0A 1M1YE 2J46A 3PUYA 4X8OA 4A6PA 5DNYB 1Z0AA 2QRZA 4JBYA 3QF7A 2HEIA 1FW6A 1AGRA 3FHOA 3IDQA 4BLRA 4QRHA 3VNVA 4PTLA 4MYHA 4W7SA 3K0AB 4QOSA 1N6OA 2IYZA 2Q0HA 3MAAC 3EAQA 4IOMA 3LH5A 4Z51A 1JNYA 1AM4D 1Y3AA 3EPJA 2HYIC 1SVIA 2N42A 2C9YA 5JI2E 3K8YA 4KO8A 5GVSA 1Z22A 3EASA 1EFTA 4W5JA 1GL9B 5E4FA 5BWMA 3THWA 1P2SA 4OHVA 3P4XA 4TL7A 3TUJC 5BN4A 1R5BA 1G20E 5KPJA 4OBEA 3OE7D 3GLHE 3W5JA 2IS2A 2QM8A 4M9QA 1W49A 1AIPA 1CULC 2IEZA 2ZI5A 4HATA 4US2R 4F91B 2JLVA 1D2NA 2AX4A 3DOFA 4JLVA 2ODWA 2OLJA 4KFRA 4Q4HB 3H0KA 1LY1A 2W6ID 3B13B 4U00A 4Z8XA 2EWWA 3O8CA 1NMYA 2BBOA 3BOSA 1MRSA 2ZANA 1R6BX 1AZTA 5JHHB 4O0MA 2BM0A 1Z2AA 3G82C 1ZAKA 2XTNA 1GNRA 1M6NA 1JJ7A 3OFNA 1GZSA 3LBHA 3BBPA 3AVQA 4P4TA 2O0KA 5GJBA 3N2IA 1KK1A 3RC8A 2ZR0A 2ZS9A 4NCKA 5JEEA 2VL7A 1TEXA 3LX8A 2FZ4A 4P4SB 4ZDKA 1G16A 4KITB 2C5LA 4B35A 3QXHA 4ZV4A 2IWRA 2YHSA 5CJ2A 4DSNA 4M1YA 1FQJA 2CLDX 1L8QA 3IBGA 5KSPA 4LV8B 4NBSA 2RHDA 5KNCA 1NN5A 1ZCAA 3W9YA 5CM8B 4BEJA 4NZYA 3ADKA 3FE2A 1G9XA 5SZJA 4AKIA 1JBKA 4M21A 3NBXX 3HU1A 1VCIA 2WPDD 3UXMA 2WICA 2VP4A 2ONKA 1KGDA 4C0AC 1TF2A 5C18A 5EUQB 1X1SA 3VX3A 3BFKA 4POAA 4G5OA 2PZGA 1YZTA 5SZHB 1KY3A 3K0EA 1NN3A 2OO7A 3BIFA 3SE0A 1SXJD 4BFXA 1EXMA 5B64A 1KI6B 3DOEA 5L3QB 5M04A 4F4IA 3Q9LA 4A92A 4JL5A 2QU8A 1JAHA 4H9GA 2WOJA 2ZVPX 4FMDF 4EPWA 4C0JA 4HI0E 1HT1E 4NYIR 3NEYA 3QF4B 4NPHA 5KOYA 1UKEA 2XEXA 4KBGA 3C14C 4OQMA 3ZIAA 2ZI7A 2ONJA 4ZO4A 4M1KA 3L43A 3ZVMA 2V6IA 2BKUA 2R8RA 2F55A 1H8EA 1IHUA 1Q57A 1XPRA 3Q5DA 3CH4B 4L5BA 2XNDA 3AVOA 4FMDB 1YZGA 2VP6A 2P3SA 3OEHA 1IJFA 2EQBA 3BGWA 3Q5EA 3AF3A 4IXNA 4EPVA 3VFDA 1SVOA 1WCV1 4DJTA 4M0LA 5FR1A 4B43A 1D2MA 3KTAA 4FMCF 1GWNA 3DVLA 5JCPA 3T5GA 3X1DA 2JA1A 3PEVA 2PH1A 1VCOA 2F43A 2GESA 3H2YA 2XJ4A 4PC3A 3ZS8A 2LKDA 5FOXA 2G88A 2JASA 2FJUA 1E6CA 3GD7A 5FBLB 5J47A 3R20A 2RGNC 1QDEA 2IHYA 4PO1A 2ZRMA 1ZNZA 1TU4A 1EX7A 1XXHB 3KUDA 3ONWA 1P4SA 4PHHA 4LJ5A 4GP6A 1IY2A 4UJ3A 1SVWA 4KSBA 2JDIA 4LRWA 1R4AA 3MJRA 5FTKA 1A1VA 3EPLA 1IQPA 3U2QA 1CS4C 2C99A 2R6CA 4A2PA 1F5NA 4CVNA 4DDWA 2HLDD 3U7HB 3IIJA 3CUEF 2NZJA 5LPNA 1W36D 2PEYA 4XSGA 2QEQA 2F1RA 1E2EA 2GZHA 4PHGA 2QTFA 2ZJ8A 1AA9A 4IDQA 4LYAA 3RS3A 2XB2A 3A8TA 4GP7A 1KDPA 3W3ZB 2O8EB 1TQ2A 5KSZA 4R71A 3I5XA 4ARZB 2KE5A 4LY6A 3EPHA 3EIQA 1US8A 1VKJA 4FD2A 1Q3TA 5L3SB 4RD0A 3OEED 3LDAA 5CB6A 1N3BA 1Q1QA 4PSVA 1DE0A 5JEDA 5G3YA 3W8RA 3D31A 1KI4A 4MRVA 2WWWA 1G19A 2IYQA 4V0OA 1K8RA 3AF0A 1C9KA 2GXSA 4JS0A 3UIEA 1Z07A 2B8WA 4LPSA 5EE9A 4YMTA 2O8FB 4A0HA 4EFNA 1J2JA 5JS7A 5SZIA 5GJWC 3GJ3A 2WKRA 1E2DA 3ND8A 2I1VB 2VHCA 4I99A 3W6PA 3C7KA 2ZM5A 1FUKA 2RH5A 3B1YA 1GKUB 4PZYA 4PQYA 1OXXK 1NBMD 3R9XA 1CEEA 4LUCA 4R98A 3GLIB 5DISB 1FQKA 4LHZA 1F6BA 3IQWA 1M2OB 3R8CA 4BFWA 4Q4AB 5KPDA 3GEEA 4C7OB 1N25A 2B21A 2EVWX 5IT5A 1MO4A 4HLUA 1RZ3A 2GJ8A 1OIWA 1CIPA 4HB3A 3Q85A 4DLXA 3PUZA 1HT2E 3AF2A 5J4YA 1E9RA 5TDHA 4HB4A 4TL9A 4QHYA 3AVYA 1N0WA 1E1RA 3BFVA 3TAUA 1GVNB 1YZKA 1CR0A 4DHEA 1S4QA 2FEMA 1OLOA 2Q6TA 4O3MA 1II8B 5A4JA 2JJ1D 2W0MA 4AK9A 1NL3A 2DWQA 1KDTA 2A30A 4JMPA 1XPUA 4DLTA 4RKFA 4C3ZA 1OPXA 3QENA 1WDTA 5E7IA 1R8SA 1Z6YA 1R0WA 5DH9A 3X1ZA 4JZKA 2P67A 4QKQA 4R2IA 1OV4A 4DT1B 1NP6A 5CDFA 1E1QA 4JYCA 4NDZA 1P7CA 2DY1A 4KI0A 1KK3A 3ZQ6A 5FBRB 2FSIA 3PXGA 3FWYA 2ZVQX 3WHLA 1II9A 2IYLD 4BZXA 1U0JA 3CPEA 3ZVNA 4HAWA 4QBFA 5JJLA 4QJ4A 4LJYA 4HAVA 4BLPA 1ZU4A 4TLBA 4CIDA 5FPHA 3A4NA 3K70D 3LW8A 3K9NA 3EC2A 2R6AA 3C5HA 4PAQA 1YZQA 3L0PA 1EG7A 4OK5A 4W5HA 5AJXA 5E7JA 1GITA 3CB4A 4FI3C 1GTVA 3CZQA 4IKEA 4ZDWA 1NY5A 3SFZA 2XITA 3LAWA 1OKKD 3P32A 3K9GA 2P65A 2CE7A 4AKEA 5LDDC 2W83A 2EYUA 5JS8A 1SGWA 3DM5A 3UK6A 4HUTA 5B30A 1VCNA 4CT4B 2EFDB 3MG9A 5CIWA 4EJSB 3UKDA 3U4QB 5EE0A 4F92B 5FOWA 3UMSA 1QVAA 3WHKA 3WRXC 4LZZA 2YWHA 3OESA 1Y63A 1BOFA 3VKHA 1P61B 1AN0A 2CVHA 1XD2A 1II0A 3SBEA 3MSXA 2CEAA 3M6AA 4LJAA 2NO6A 5F9FA 4DRZA 3FKQA 3QKSA 4KVGA 2AWOA 3AEZA 3SR0A 2G83A 5FPYA 2GDJA 3SN6A 1OXVA 2XSZA 1QHHB 4JBXA 3CRRA 4CZ2A 1B23P 4XTCS 2JJ2D 1ZNXA 5F2EA 221PA 2QQ0A 4LK2A 1GRQA 1DELA 2FG5A 2ECKA 5KNDA 1S3GA 4A82A 1A4RA 3KZ1E 3A58B 3EWSA 1FNNA 4DDTA 2CK3D 3B1VA 3GLFB 1NRJB 4NCHA 4WZ6A 2ZXUA 4YMVA 1N6HA 1ZIPA 4JL6A 2IK8A 4J0QA 2QPTA 2H5EA 1QG2A 1IN4A 4JVMA 5AUNB 3RLFA 3E1SA 3ADBA 1O3YA 2GRJA 4FIDA 5GJCA 4E07A 2XTZA 2A5FA 2H57A 1M7HA 2ZJYA 4BLOA 5BXQC 4MYCA 3FYHA 3P26A 4HDOB 4PPNA 4LJ6A 3TVDA 1Z08A 2KBEA 2ORVA 3CNLA 2CJWA 5DN6A 5KDLA 1J8YF 4IFEA 4JBWA 2CCKA 4QHTA 4TLCA 2J0UA 2ZE5A 2WWXA 1W4RA 4RY2A 2X19A 4JJZA 5CDFE 1XZPA 4FW9A 4IEIA 3VR5A 4BLTA 3ICEA 2VQSA 3GJ5A 3CO5A 3WRYC 4C2UA 2PT7A 3PUWA 5BN3A 1XNJA 5FPKA 4HB0A 1DG3A 1YZNA 4NH0A 2VSOA 1PZNA 1KO5A 2PT5A 1XB2A 5HKKA 2NO1A 4ITRC 4G1UC 3IIKA 3K9LA 1VG1A 5AR1A 1R7RA 3M4YA 1MO5A 5TVKA 1IN6A 2CLSA 1KZ7B 3T34A 4EPYA 3OAAA 1GKYA 2P6NA 2CCJA 3E5HA 2XOKA 2OT3B 3KJHA 3UMRA 2NOAA 3JZMA 4DCUA 1NLYA 4ASUA 2JATA 4DKXA 2B7BA 2I3BA 4LC0A 1RPZA 1G41A 2R9VA 4AYWA 5JBQA 4ILEA 2GWHA 4HAZA 1JEDA 3AKDA 3UWKA 2HYDA 1EFRD 5KSYA 4Q7JB 4DUGD 2IT1A 2V7QA 3KXKA 4GSYA 1V43A 5C2JB 2FPKA 1G5RA 2QAGA 4JIMA 2FF7A 4B33A 2QSYA 4DDUA 4TSFA 3L0IB 2AHOA 4ZKDA 1E2PA 1W47A 3CX7A 2ZJZA 5TARA 1W5TA 4Q9KA 1DAKA 2QMEA 4H1UA 4JVLA 5KTYA 1A5TA 3ZH9B 2ZTSA 3Q8XB 2J7PA 1S8FA 2V1XA 3BB4A 1T5LA 1P2TA 3BFXA 4QNRA 4NONA 4LBVA 5FOTA 5FI1B 3T1TA 1S0UA 4TZ6A 1DARA 2P5TB 5BQ5A 2ZE6A 1HQYE 4JYBA 5FFMA 2CL6X 3B8HA 3CPHA 3ZS9A 3AM1A 1XX6A 3KX2A 3B2EA 2C95A 2WSSD 3OIWA 2E1RA 2R6FA 2X77A 3KJIA 3AVPA 3KXLA 4JSTA 1KDOA 1RJ9A 1DTSA 1E0SA 2VEDA 1WXQA 1YKSA 4IDPA 5CIQA 2W6JD 1BKDR 5TV2A 2JLQA 2I4IA 1OIVA 2FPLA 2J0VA 1RRCA 4UNSA 5DGXA 4MRRA 1K5DA 1EFUA 2BM1A 2PZEA 2IX3A 4B3GA 4LHYA 4Q9IA 3B85A 4JKIA 4D4MA 2H18A 3FMFA 3MGCA 1ZJ6A 2GJKA 2GXUA 4GI7A 5D3MB 1J90A 2C96A 5ELXA 1SKQA 1OT3A 4HAUA 3VQTA 2PX0A 1DOAA 3SEAA 3LA6A 2OUKA 4B73A 3LV8A 4EFMA 2B6HA 4XD7A 3HDTA 2FWRA 2PLFA 4MRPA 4XIGS 1L4UA 4HLUC 4HAXA 2WJIA 3QBTA 3WP0A 2ORWA 3CNNA 3FFAA 3WBJA 2MMCA 4KFTA 1LTQA 3OIVA 1FMJA 4BFZA 1CRPA 3TJZA 5J4VA 3CNOA 2GZAA 1NSFA 4G5GA 2IF2A 2GCOB 4Q01A 4B2LA 1NG1A 5J40A 4G0NA 3VAAA 3LFUA 5F9HA 4XWKA 2OBMA 3VMFA 2B8TA 3GQBA 2ATXA 2ZSBA 3NG1A 4L4UA 3PG5A 3W6NA 1CP2A 2FE4A 4IXMA 3EC1A 4B3BA 1IBRA 3QEOA 4NCJA 4IRUB 2IEYA 1RE0A 1IY1A 1F2TA 2GF9A 3AKYA 521PA 5FI0B 4A8JA 4BE7B 4BRWA 3ZD6A 4C9BA 4X8LA 1GUAA 1TAGA 3REGA 2YWFA 2ZSFA 2WBLC 3R7WB 4CEIA 1HTWA 1OFUX 4OQFA 2FDCA 3DKPA 2H7VA 4DLWA 2RHMA 2JEOA 2C8VA 1ZC3A 2GTPA 2ZYWX 1G3IA 4BFSA 4D81A 1G7RA 4KSCA 3F5FA 2H8KA 4RZUA 4B74A 1TF7A 1GL6A 1CJVC 1AS2A 3SHWA 5FBQB 1DEKA 4UJ5A 1CBUA 2FFQA 1IONA 5FUWA 4OI0A 1N5JA 2WWIA 2XZPA 4L16A 4NYJQ 1TQ4A 3U7EB 3VHXA 2O8DB 3U5ZB 4OKSA 3MMPA 3Q7QA 3U3OA 1ZMXA 4DEXA 4OQLA 4Q4JB 3CPJB 3A1TA 3IHLA 1P2VA 1FX0B 3PUXA 3RRNA 3HYTA 1NMZA 2IXEA 4US1R 3RNLA 2G3YA 2WZQA 1GRNA 1OXUA 2CHGA 1E3MA 4RKEA 2QROA 3DM9B 5G53C 4JLAA 2OM2A 3TMKA 1GNPA 2DBYA 3EPKA 1SVLA 4LOAA 1G8HA 4Z1MA 4KFUA 4V0LA 3N2EA 5G41A 4DLVA 1CJMA 2O8BB 2EFCB 4YC7A 4Q1AA 5SZKB 1A82A 1FNMA 4PO8A 2AR7A 1KK0A 1Q12A 2WWHA 3A1WA 2HCBA 4Q47A 4B34A 2Z43A 3UPUA 2QGNA 1ZW6A 4DCNA 4MKHA 1QVRA 3HR8A 1E2HA 1UBEA 1W4AA 5GADl 1JPNA 1W4BA 4RCZA 2I1QA 3U44A 4NYMR 4PZLA 3R9WA 4EQ6A 2BVNA 1A7JA 3SYLA 3MJHA 2AFIE 1G291 1ESNA 2ZE7A 3A1UA 4Q66C 3NXSA 4E03A 1IXSB 4PSAA 3DO6A 1H8HA 3RHFA 2QP4A 4ZIRB 5FBVB 1UPTA 5EZ5A 5J5CA 3SBDA 3K0FA 2ZEJA 5DYGA 5IF9A 3TGPA 3GMTA 3C15C 3GLGA 2VSXA 3C41J 2FV8A 1R0YA 1R8QA 2FGKA 2IA5A 1U0LA 1AKYA 4ON9A 4UXJA 2VH5R 1DAEA 1E2IA 1SVSA 2QE7D 4PC6A 1VTKA 1YRBA 1W0JD 3B60A 1JB1A 3L2OB 5FOVA 3KB2A 2BC9A 2JLXA 1Z6TA 2IW3A 2ZRDA 2ANBA 1P75A 3EWAA 3GEIA 1P9NA 3MD0A 2HT1A 5IK2D 1S9DA 1T0HB 3CRQA 3RVBA 4LJ7A 2WTUA 3AVVA 2QGZA 2W2VA 4M4SA 3BK7A 5K8LA 5JLJA 4FCTA 2JJ8A 5IDVA 4CDGA 4DLUA 2FFBA 5C1BA 4CF7A 1YR6A 1EGAA 1ODFA 5EXSA 1FL9A 3LXXA 4Y0VA 3L0OA 4Q1DA 2GK6A 4P0TA 3SI7A 4IDNA 5KNBA 1N6RA 2ZRHA 3EZ6A 1DS6A 3RSOA 3NDBB 4BASA 5JSZA 2IS4A 1P60A 4TQ9A 4URWR 1FTNA 2C9CA 1JECA 3THXB 5DI9A 1Q21A 2BV3A 2WSMA 4Q03A 4V02A 4XSHA 3FVQA 2F9LA 4DCVA 4CEHA 3CZPA 5FOSA 1OHHA 4P4UA 3JVUA 1DO2A 4DB4A 2CL0X 3MFYA 2PMKA 4DDVA 1Z6GA 1JXOA 5JCZA 1MT0A 4GZLA 4L15A 1X6VA 3VR3A 4M9SA 1ZRHA 2ORIA 3E2IA 1E0AA 2QQEA 4NCIA 1BIFA 1W2GA 1G17A 1T8TA 2ZRFA 1QHGA 3GLHB 3WMFA 3WP1B 4BRUA 5IRCD 2QBYA 1EWQA 2REXB 1R0XA 2ZITA 4WAUA 4B71A 2ZJ5A 3DMDA 1U9IA 1G6HA 2O5VA 4GOXA 2NO9A 3CONA 5K8UA 1G4UR 4QL3A 3F8TA 4TYPA 1E98A 1XWIA 4RD6A 5E3HA 2AD5A 3QXJA 4HEJA 5LBIA 3HYRA 3DDCA 3BE4A 2HJVA 2KI5A 1RYHA 1YRAA 3RABA 1VG8A 2ZR7A 3TK1A 4LDJA 3CF6R 4QBGB 2QAGC 1P6XA 3U7FB 1IXZA 2H92A 2O8FA 3TRFA 4RVCA 1P3JA 4LBYA 1S1CA 1ZD9A 2UVQA 1KSGA 3AQ4A 3AUXA 4B2PA 1HE8B 2CL7X 4UXIA 3EX7C 3GJ8A 1ZUNB 4XTRA 3GFTA 2ZRBA 1OFHA 1VG0B 3NH6A 3CM0A 5EP2A 3TW4A 4B44A 2G0NA 2DFNA 3SQXA 5FTLA 4KHZA 4HUQA 2GEVA 4AKHA 2QUZA 1Z28A 1TPZA 1G7TA 3SU8A 4P31A 1AQYA 3BWDD 2O52A 3GLGE 3IUYA 3HJNA 4M2LA 2ZETA 1WQ1R 3LLUA 3TR0A 4RD3A 2PCJA 2BJWA 3AP3A 3AH8A 3TLXA 1TADA 2YC2C 3PENA 3RSLA 3SYNA 3AP1A 4QJ3A 2R6DA 2RGEA 1VYUA 1F2UB 2R62A 3TUIC 2ZJBA 3RRZA 1W0KD 5K8IA 4DLSA 3MLEA 1YR7A 1KI3A 4OI1A 3AVTA 1PVOA 4MYUA 4D0GA 2OE2A 4Q9JA 3E70C 1E79D 2BWJA 1KI9A 4KVAA 4NL4H 1JALA 4G5SA 1Z0DA 4US0R 4NYIQ 2B92A 4C0LA 3B7GA 2IYXA 1KAGA 2QPAA 4LYJA 5FUYA 5LB2A 3DMNA 1KY2A 4DLYA 2VBCA 3U60B 4E5UA 2WJGA 5AWFC 3OE7A 3VKWA 1QF9A 4V0MA 3VU9A 4Q7KA 1UBCA 1ZC4A 2NQ2C 3GJ0A 3GJXC 1VHTA 1G8GA 1XJ0A 2HCJB 3ZYCA 3PCRB 1N6IA 4C0SA 4ABYA 1HUQA 4EUNA 4PO9A 4HAYA 4OYHA 3BH0A 4UNQA 5C4GB 1X3SA 2IF0A 5B2ZA 2GVDC 2W6IA 3RC3A 3FPAA 1G3UA 2BKEA 1SKYE 4QJ5A 1AGPA 1XDBA 4TTRA 2V4ZA 2Z83A 1JPJA 2G6BA 2OHFA 2VP0A 3THWB 1TEVA 1EFCA 1YZLA 2ZYUX 2Q9CA 3GEHA 1T6NA 2UZ3A 5FOUA 3A6PC 2AKAB 1JR3D 1OF1A 3KL4A 4A8JC 4M1SA 5JWOA 1ZM9A 2QP3A 2YJTD 4YDSA 1EWRA 2EFHB 4LYFA 4C0KA 3ICQB 1MH1A 2GEDA 4K8OA 1VYTA 4WZAE 2A9KA 4ZCLA 3O8RA 3AUYA 1UKZA 1P73A 2WMOB 4KFSA 2W2XA 4TMZA 2FNAA 5E7MA 2RKOA 1HV8A 2MSDB 2YOHA 2VP2A 4W5WA 1AS0A 4DVGA 2YKGA 1SHKA 3KQNA 1LS1A 3B82A 1D5CA 4KU4A 1COWD 2QTHA 4F7WA 2QPOA 1Z0FA 3EXAA 1BMFD 3GJ6A 2OCBA 3LRPA 4NTZA 4YMWA 5EE3A 2BDTA 3EZFA 1M7GA 1CTQA 3GLIE 2VRWA 3K0CA 2WPDA 2V9PA 2F1JA 2F3RA 4UNPA 4JVSB 1N6KA 3A1SA 2GETA 3O8DA 1P5ZB 4O2RA 4AG6A 3KJEA 3QPUA 4M1TA 1WRBA 3IPYA 3KFXA 2WAYA 1Q1BA 4LJ8A 2QA5A 2D7CA 4K81B 1TUIA 4WA7A 3RS7A 3K0SA 1U98A 1WMSA 2BEJA 2W0SA 4TYQA 1NVVR 1SXJA 1U94A 1P9WA 1XU4A 3QKUA 4JLOA 2V3CC 1N6LA 3PEUA 4IOLA 2HXYA 2LKCA 4ZKEA 1CLUA 3K53A 2HXSA 1VDZA 4TMVA 2ZAMA 2F3TA 4BPBA 2F1HA 2RCNA 2ZRKA 4PC7A 1G7CA 4PC2A 4H1VA 1LNZA 2VO1A 3FKSD 2AXPA 1G3RA 5HZKA 2D4HA 2ZUDA 4QGHA 3X1WA 1FPMA 4Q00A 4BLQA 1HEIA 4KODA 4CW7A 3DZDA 3T15A 1KKLA 1I4LD 2A7QA 2RAPA 3GP8A 4YQFA 2V54A 4A4DA 4NHOA 4URZR 4UQOA 3NDPA 4V0ME 2FSFA 3W6OA 2JLYA 4KYIB 5FTJA 2OLKA 4Q02A 2ZROA 5A0FA 2ZYVX 4WOPA 1M8PA 2BBWA 2VF7A 2IXFA 3B6EA 5CLLA 3KDSE 121PA 4ESHA 1CJKC 5LD2C 1GIAA 2GJ9A 3SNHA 3JVVA 3TIFA 4I1OA 4U7DA 1T4GA 2WKPA 4D25A 2F9MA 2IUUA 1OH6A 2LWIA 3QVVA 4YXWD 3U61B 1E96A 2ZRPA 1G1MA 2DFKB 4L8GA 2J87A 3KTAB 5KDDA 1FMLA 4Q4LA 1PJRA 1KMHA 4WXPA 4A0FA 1E2LA 1W5SA 3RANA 3EARA 2F43B 4W9MC 2HLDA 3CW2A 3AV0B 3MCAA 2RMKA 2W00A 4I4LA 1TU3A 1XCMA 2XX3A 2WIAA 1KNQA 3MWJA 1IN5A 1G7SA 1NI3A 3CRW1 3LVQE 3O47A 4IHQA 3TVTA 2FFAA 4R2HA 4V03A 3EA5A 3CRMA 2REBA 2IS1A 1HA3A 2VF8A 2BBSA 3ETLA 1KO7A 2OESA 1SVKA 3B5JA 1UFQA 3NKVA 2ZIAA 5FUVA 5H70A 2A78A 2OCYC 2OAP1 2PL3A 2YC4C 1CKEA 4TYYA 2MSEB 3RS4A 4C0QC 1YR8A 3THYA 2PJZA 3B9PA 5KHOC 4RD4A 1W44A 3TR5A 3OEEA 1E94E 1IN8A 3AF4A 3H1TA 4G5RA 4PHFA 2NO7A 4HLQB 2HUPA 1ZD8A 3HPRA 2WVJA 1ZYUA 2YV5A 2KBFA 2QSZA 5JHGB 3WY9A 1DAGA 1T5IA 1U9IC 2Z4RA 1NVXQ 3V00A 1EK0A 2YNMA 3RAPR 2HDNB 1S9HA 2AWNA 2UKDA 4MITA 821PA 3BH6A 1SXJE 3ZLJA 3QPWA 2YYZA 1UADA 1T8UA 2H16A 5ANRB 721PA 1US8B 2FN4A 1NBMA 1UEJA 2WOOA 3I32A 3GFPA 3FMOB 4AWXA 3QKRA 3TBKA 2WJYA 1TNDA 5FL7D 4LBZA 1DG1G 4IDHA 1PLKA 3FDIA 2Q3HA 2BHRA 1ZVQA 5H68A 5JI3E 2IBMA 1ZM7A 5J4KA 3I62A 3HPQA 4OJQA 1ESMA 2ERXA 1J70A 1ETUA 4LCBA 2IUSA 621PA 3L82B 1MR3F 4TTPA 1R2QA 5E95A 1OXTA 1E69A 2XNSA 3I72A 4MGYR 4MRNA 2O0JA 1ZD1A 2V55B 4LYHA 2JIZD 3SJZA 1W48A 3NC0C 1OYYA 1YZUA 3LO5A 1OXSC 2NG1A 1Q1EA 4ERNA 1Z0KA 2YOGA 2PZFA 2DPXA 2JJ1A 4M9ZA 4GRAA 4I81A 5B58C 1K5GA 2FOLA 4URUR 4RFSA 1FP6A 1X8LA 2GCOA 5AJZA 4EPRA 2J1LA 3T1QA 2BBTA 2QT0A 3QBVA 3I8SA 2DYKA 3LLMA 2ODBA 1D8TA 2WJJA 3LBIA 2W2TA 3VTKA 4TT3D 2G77B 2QMHA 2ZUBA 4TMXA 3UATA 1IAQA 2TMKA 5EJEA 1OH8A 5BYJA 3T12A 3SQWA 4WZBE 2J0QA 1G5PA 4JLBA 4PANA 1RRGA 1IJEA 1VHLA 1ZM2A 2D74A 3R8FA 1ELOA 2RGGA 1GG2A 1JR3E 4B47A 2QTVB 4WW0A 2PJRA 1C4OA 4XVUA 4CEJA 4GOJA 1ZUHA 3R7WA 3PEWA 2PEZA 5JJKA 2P0EA 2IYRA 4OHXA 2IS6A 2R6GA 3FOZA 5L3RA 4RD2A 5J4HA 1H65A 1NVWQ 3PEYA 4KAXA 4TYNA 4QC2A 1S3SA 3LVRE 2WV9A 3BC1A 1XEXA 1T3HA 2AN9A 3A37A 4GL2A 1KNXA 1EX6A 2X2EA 2OZEA 4AD8A 1OKKA 1MRNA 1QHXA 2OBNA 2JLRA 4HZUA 2O8CA 5FBWB 2XXAA 3X1XA 1AQUA 2VPPA 4D80A 4AYXA 5KUTA 1ZINA 2FSHA 4D4KA 4DLRA 2ZI6A 2Z5FA 4LGMA 3TH5A 1PLJA 4E09A 1P9RA 5DI3A 1E9CA 1RKBA 3KQHA 2RB4A 3NBZC 4FCVA 1Q0UA 2A5YB 2BCJQ 2VHUA 5EE5B 2IC5A 2VA8A 4OQXA 1NBME 2ZRLA 1U8AA 3BB3A 4A15A 2GKSA 1XF9A 3A1VA 2A2ZA 3CKLA 2J41A 4GDFA 1LF5A 2ZRJA 3VR2A 3EIEA 2VTKA 2QENA 2Q21A 2EFGA 1MV5A 3PR1A 2JJ2A 3KFVA 2IWHA 3AGPA 1XEWX 3VR4A 2NMVA 3T1OA 3CF0A 4AYTA 1I2MA 4BLSA 2ZJOA 3I8XA 2QI9C 2CK3A 3K0CC 4TMKA 1GRRA 1VMAA 3FMPB 1XD2B 3HWSA 4Q1BA 1G5TA 5EP4A 4UXHA 1IOZA 3LWNA 2IYVA 4P3YA 4MDEA 2ZR9A 2CNWD 2QN6A 3QKSB 3QQ5A 2QP9X 4P33A 3X1YA 2WWGA 4LHWA 1N0VC 2P6RA 5L8VA 5FTMA 1SXJC 1MABA 1RFLA 4HLDA 3PIRA 2KJQA 1OYWA 1WB9A 4X8MA 1MOZA 2WWFA 2VYFA 2C77A 1G6OA 3P4YA 2ZSEA 4O2LA 3I4LA 1E99A 4FWIB 3U3MA 4C30A 4F4CA 3K0AA 4MUAA 5CITA 2E87A 2H1LA 4PX9A 1AKEA 1SULA 3QSYA 4FXPA 3QOFA 4Q18A 2CHVA 421PA 4HB2A 4Q9HA 3SS8A 5AUQA 1XPOA 1HQCA 2C03A 2PLRA
chains in the Genus database with same CATH superfamily
1ZXLA 1XKXA 4NG4A 5EWLB 5K3DA 3ITNA 1GT91 1KP3A 4BO8A 4KW7A 1MB9A 2DR2A 3SE7A 1A9PA 3MM4A 1TF5A 1EHYA 4HGNA 5DSTA 3WFJA 3FAKA 3FZEA 3FFBA 3L4EA 4CCYA 1ZD3A 5CA0A 5F3RA 2JVKA 4BQNA 4DMRA 3FTEA 1BXRB 1PGQA 3KOOA 4J1TA 4KXFB 5CBPA 4GRDA 4BECA 2FXVA 3EYAA 4PR3A 1MOQA 3SEZA 3GJ4A 5IH7A 4OAOA 1VI2A 4OB8A 3EVCA 4HDCA 3LZ6A 4IAOA 3ZEIA 2YHBA 2YWEA 2WG0A 5BN3B 1ZS9A 2FPOA 4Z99A 4XX0B 5ALUA 3V7UA 3QHPA 3AR5A 1QGAA 3K92A 3TKYA 3NETA 5MFPA 2HU8A 3O8RA 2Q5OA 2HSDA 1LPNA 4JX8A 4C7JA 1GGFA 3OETA 5MDHA 2YN0A 2QQGA 1UPXA 2Q4RA 4GEGA 5JD6A 5ADUS 3DHVA 2E5LB 3H18A 4NYJR 1KH1A 5DXAA 1CR2A 3UAOA 2CW5A 2POQX 2GAJA 4IIDA 2CEKA 5T41A 1W36C 3BWEA 4HDRA 3H9EO 4P4SA 1LTKA 4BDTA 4OQDA 3DJYA 1V9LA 1VA5A 4XSVA 2BP7A 2HSZA 3WAJA 4UU8A 1C0LA 4E70A 4IQ4A 3Q6NA 1W7AA 4CYMA 2BR4A 4KKXB 3KSMA 3U7QA 4FWTA 1BQ4A 3SSNA 1DJPA 2YQZA 1B15A 4NJEB 4EA8A 4F4UA 4X6UA 4F56A 1UBHS 3HGTA 3NGLA 1M2FA 5SV2A 4XLZA 2P3LA 2I8AA 2YZ7A 3C6QA 1C0IA 3P27A 1GNQA 1EI9A 1KYIA 4D02A 1X9IA 1YR1A 3NUZA 3CVWA 3QUQA 1S2NA 1ZWKA 3JWGA 3HBMA 1L4HA 5EUCA 4AQYB 4RPJA 4MWSA 1V4BA 2CVFA 1ANKA 2NAPA 3ZU5A 2Y0PA 4D2IA 1PWXA 1ACLA 2AW3A 3BRWD 3BTUA 2WUVA 2HMYB 3NYRA 1C1XB 1UZNA 3K8OE 4X7MA 1IWOA 2AXNA 1OLSB 2HZBA 5KYXB 4IDDA 3J81k 5KQSA 1KI1A 1ISFA 5KNCD 4N0DA 1KI6A 4LDZA 3MWGA 1CWUA 3UJ9A 1N5KA 4N8DA 4DARA 3LL4A 3AZPA 4IUCS 5AI5A 3K09A 2A0KA 2ANCA 3BB1A 1CD5A 4GBMA 4J94A 1XZFA 3RT7A 3WFZA 3L8ZA 3MWDA 1CDZA 5I5GA 3GWZA 3ASZA 5HBGA 4GZ3A 1QOQB 1ZGAA 2FMXA 4FYWA 3UANA 1A4XA 2SKEA 2IZ5A 4KWEA 4Q9LA 5F5NA 2QJOA 2O1SA 3KKEA 3D43A 1A4UA 1RW4A 2R7NA 2QN7A 1KFCB 3DZFA 1HG1A 2A0WA 3E8SA 1RJ9B 2QN9A 3Q7PA 2JI8A 5CX4A 2W6NA 1M75A 5CM9C 2AJLI 2CV2A 1Z0IA 3KS9A 3TFOA 4B6PA 1QHYA 5ECWA 4EX7A 3DONA 1JMKC 3GGOA 5C4MA 1CNMA 3O2NA 4K46A 2WSBA 3RWOA 3GDWA 4RFLA 3H4MA 2FZVA 4BNVA 4JU8A 3BIWA 3QLTA 2PSEA 3ZBPA 1EU1A 1LSSA 3T9DA 3GFVA 2AFIB 3ZWDA 4BU0A 1R0SA 3A04A 4M8KA 4FOSA 4ZRDA 3TRHA 4DG8A 1CUIA 1XMIA 4NOLA 1LDNA 1ZEMA 3DMPA 4WY8A 1ZSYA 1C3JA 1MH9A 1FDUA 2G5CA 2OQIA 5DYIA 4CLEA 4DKJA 1FOEB 2GR9A 2P9JA 2Z2YA 3CRVA 3SHTA 3SC4A 1CVRA 3KXIA 3N8DA 4MJXA 5JZBA 2FW1A 4UDOA 4M6WB 4IW3B 1G9TA 1E5QA 3A32A 3AUTA 2RAVA 5DFAA 4U8HA 4Q12A 1QHIA 4B75A 2GQ0A 3B3QA 4GI5A 4JLJA 4KZKA 5AI0A 2IV2X 1ZN9A 1P81A 3KZXA 1UBOS 4PGFA 3WGQA 1BROA 3JASB 2NADA 3HYNA 4HDAA 1QGZA 2GJAA 1UBGA 3DAPA 4LJLA 1NM5A 4FDAA 4FGKA 3OZRA 3UWMA 3KB1A 1YHZA 2B4YA 1B26A 4RA9A 3WB9A 4R7TA 2MSCB 4LJSA 3EG5A 2F7SA 1JPVA 2PLNA 5EHXA 2C1EA 4IF4A 3I6QA 4PIVA 4YO7A 4TRJA 1E6WA 4BO2A 5LWHA 4ENVA 1LEHA 3DDSA 3MELA 2I91A 2ZRNA 2O8EA 1Y5LA 4RNDB 1GQ2A 1M67A 2G9NA 5LU8A 2P40A 1JHVA 4CU2A 3OKCA 5AYVA 1XUOA 2DWOA 1DBIA 4DV2B 4OMCA 2VZ0A 1FTSA 2CKMA 4L50A 4X90A 4H7DA 1C3OB 2X0FA 3A4MA 3D4PA 2MINA 3JW8A 2WMYA 2QM7A 2FH5B 3BA1A 5L4NA 1ZK2A 4V3CA 1L4FA 1WPRA 1GPYA 2QV0A 2IHBA 3CNBA 3SD7A 5F98A 2AKYA 2FA9A 1W87A 2IZ0A 2WNHA 3IL2A 1LB1B 2HSWA 1PTJA 4U0JA 3RTGA 2JLCA 3W4IA 1E3TA 5MN5A 2OD2A 3I5YA 3VHRA 4HXEB 2FW7A 1UPBA 1VMDA 4F12A 1DPGA 4CM3A 3ROMA 1I9CA 5J2TB 3BQNB 2KM1A 3JYQA 3OQNA 4BOYA 3HWWA 4IIXA 4M36A 4ZJUA 2BGGA 4BEWA 3O03A 1EBUA 1L4YA 4K9OA 3TUZC 5CVTA 5E6UA 2CJPA 2C8JA 4IDEA 2YL2A 2O54A 3K9QO 2LCFA 2ODNA 1U0SY 1WLSA 1H2WA 3JTEA 3EHDA 1XTQA 4KQ2A 4U3JA 5AM0A 4CIVA 3AL3A 1FQWA 2AOXA 3BK1A 3CUSA 1R9JA 3BL6A 2FR1A 4HRXA 1P5RA 1T25A 2HRZA 2CUZA 1PEKE 4INJA 3K5IA 3E0XA 4URYR 3WLOA 5DHUA 5AKZA 4YRMA 1YFJA 2VKTA 3K2BA 3JQEA 1FYWA 4QQ8A 4FU0A 3QVJA 1XPJA 3G8AA 4IUYA 3H4TA 1EIZA 5DRTA 4HFMA 3C5EA 4RORA 2VTBB 1U8EA 5KYUA 3I1FA 3HYLA 3AEQA 1NLFA 3LNTA 1RC8A 4OHWA 1VSTA 2EJWA 1ZIXA 2GNOA 1U2PA 2IUTA 2PWBA 1HO3A 3YASA 2B83A 1R4NB 2YYAA 4MO2A 4IHJB 3L8YA 4H31A 4EQ6B 4DC0A 2I71A 1NMEA 2C78A 3ROZA 4RTSA 3THOA 2CLEB 3CMMA 4NJOA 3GJ7A 2XW6A 4R1TA 2XH8A 2IDZA 3IXLA 1XXHE 3E7WA 1A8QA 3K0FB 4ZU3A 2QNBA 1L5KA 2GX6A 4R0MA 1TZKA 2CNLA 3OUZA 1E9BA 1JJVA 2W2LA 4Z0HO 4QO8A 4CN8A 4WLNA 5A5GA 1E1CA 4OH1A 5IKPA 3P2YA 3PKIA 4P0QB 5KYWA 1P29A 5HCNA 1HWYA 3KSUA 3RVMA 3EF3A 2EV9A 2FMKA 1XEFA 3L04A 3SC6A 2HSEA 3LHSA 1M2EA 1ZONA 4QULA 1HZZC 1XD9A 4NNOA 3KIPA 3COJA 1P1IA 3LY5A 4EVQA 2RC6A 3SDZA 2XTMA 4GPBA 5TLSA 1ECJA 2PUVA 1ZPDA 2Z9CA 3P45A 4OB6A 4HPWA 1H5QA 3W2EA 2PCLA 1KK2A 2RH4A 5FTNA 4MVJM 1YB5A 2VP3A 1MQ9A 3N8IA 2R7LA 5BYAA 5LOVA 1JEQB 5DHFA 1XOIA 2KB0A 1DDGA 4YJFA 1DV1A 2RKWA 5LP6C 3HYCA 3B6KA 4NK4A 5EQDA 4A23A 2IHJA 4J1TC 3IUNA 4AJ2A 1H69A 1ADYA 1U2TA 3L5OA 1XCBA 3WYAA 2KYRA 1YI8A 5EQTA 1VHDA 5JMTA 1A9XA 3MPOA 3TZQA 4FBLA 2H1FA 4OIFA 3ILYA 4D8WA 4LI0A 5JWHA 1LW7A 2OXRA 1WHTA 4IOKA 2GPYA 3PA8A 4G8CA 4CEHB 1EAMA 4EJSA 1BAPA 3QX9A 1C30A 3WB2A 4D25A 6REQB 1QQ5A 3DMGA 4AG5A 1E3WB 1EE1A 3K4QA 4K6OA 5K3OA 4I5GA 3VHLB 1SKYB 3FHTA 4NCNA 3VR6A 1NFFA 2C7OA 3FUXA 5IJ0B 2D54A 4ETIA 1U8YA 1CU1A 1DIBA 3TS1A 3HWRA 3FLMA 2HPAA 3H65A 3H2JA 4EIWA 3NVKI 2VJCA 3V5NA 3RREA 5LQAA 3GGJA 3ND5A 4F4DA 2QBYB 4G09A 2IHTA 4GMDA 3WBKA 2IEAA 3C7DB 2Q1TA 3ZU6A 5DBOA 2WI8A 5GM2A 1N2CE 2N1BA 3EGOA 3QIAA 2ONZA 4HDKB 1REQA 1W2WB 4F04A 3P97A 3DP9A 3O94A 5DNDA 3IIEA 1CZNA 2ZE8A 3NTLA 2Q9AA 3RU2A 3RYCA 2VK2A 4IV8A 1YDWA 3HCFA 1YBAA 4JBIA 3SDSA 3GLFA 1YE8A 1I5RA 2BFPA 3BMCA 1A97A 2BL4A 2D62A 2FEOA 2I6QA 4DN6A 1L5MA 3MGKA 3BWBA 3HFRA 5TT1A 3STXA 3K1JA 5ILQA 1OT5A 4EUHA 4MGIR 2UXCB 4MA4A 4RMJA 3SC3A 2LIPA 2R6JA 1YV9A 2IJGX 4A7PA 4D3YA 5K0JA 4D56A 1PUIA 1CRWG 5A6VA 3UMBA 1NW4A 5AK6A 1NC3A 1SOMA 3O4GA 4U9UA 3ZEAA 1DKPA 3UUWA 3IE0A 4HUQB 3TL3A 1KIMA 1E9SA 2NO0A 2FHPA 4I1VA 3K09C 2IP4A 3H11A 3J7TA 3Q3JB 4XWAA 3IT0A 3FPBA 2VKQA 2OG1A 2ZI9A 2MR6A 4CLXA 4BNMA 4V0NA 2PJDA 3F5SA 1M74A 3KD2A 3OM9A 1U1DA 3QVOA 4YASA 3RIYA 4Z54A 1IN1A 2PD3A 3PL1A 1PD1A 4BU1A 5B6PA 4MQEB 1Y8RA 4CQLB 4HHEA 2CHFA 4KLCA 1LBQA 1NOKA 4HAOA 1GKIA 4TKVA 3L6UA 3PEFA 2QYSA 5E0KB 2GZMA 4A6XA 3PHJA 3RADC 2PAFA 5EJ8A 2FUKA 2AZTA 4OK6A 4Z7NB 1UOOA 3IKVA 4UTXA 5J3JA 1HG0A 4QT4A 1YB7A 5IU6A 1UFKA 4ND1A 2OAQ1 4GXNA 2H08A 1XRQA 5AXAA 1E3IA 3NCTA 4RVHA 5BSWA 3GCXA 2DUWA 1U7HA 3QTTA 2H85A 2CBXA 3BGVA 1F0YA 4Y2PA 3T7EA 1YFLA 1MO6A 2WHQA 2GA8A 5KKCA 2NP7A 1QZZA 1RWMA 5H7XA 1UBUS 2JH3A 3NHFA 1BQEA 3REFA 4II7A 2P90A 4D92A 3PLNA 3HKBA 1ZLYA 5FPTA 4R1NA 1KVQA 3VU9B 3T1YB 1G6KA 1D6SA 1JR3A 1P1BA 1YI0A 2B1IA 1V7CA 2ET6A 3AB3A 1GQFA 3DC2A 4YN3A 1K4KA 4A0RA 5HKKD 4BFLA 2O1XA 4B84A 3EWIA 2ILTA 4IIYA 2VP5A 3ZZNA 4ALIA 1C1DA 2J32A 4I8IA 4D4LA 1KA9H 3EZ9A 3NTVA 4CM5A 3G0GA 3G2HA 1ZHOA 4BV9A 5AK0A 4GG1A 1NX6A 1E20A 3QXXA 1ULBA 4IOJA 4MI1A 5EYPA 3WQRA 4QAJA 3HZHA 4CMGA 3P1JA 1NM5C 2GXAA 1N1DA 3AR3A 3PCTA 4WE3A 2FXIA 2I5PO 5ALWA 5JY1A 2ZUCA 4RMNA 1SBCA 1W35A 1WKVA 2RGCA 3UMJA 3WMGA 3BAFA 1DDIA 3QSGA 1VE7A 2QY9A 2P2ZA 2WYOA 4KAAA 4LXGA 1UDBA 3GT0A 1Z39A 5EP1A 5KWSA 2NU6A 1FRQA 2CNKA 3TGWA 4EJFA 5EEHA 1W29A 2B61A 2VHZA 4GR5A 3WLJA 2XAUA 2YN4A 4KYVA 5ITVA 3F9CA 2PMWB 1GGKA 2HBYA 2V7QD 4KDFA 3LXRA 3DE1X 3VO1A 1P5HA 3B12A 4WBNF 1SCUB 4FHZA 4QTZA 3STYA 2ATIA 2VHTA 3IEUA 3P9YA 4M22A 3TD2A 1F3LA 4TVBA 5K8TA 1E0JA 4C76A 4RETA 1KHHA 1NLUA 2OP0A 3G0HA 3GD5A 3S44A 2P75A 5DCWA 2RK4A 1PTJC 3U9TA 4D98A 2HMAA 1DJOA 1OMOA 3ZV4A 1UINA 3T1VA 5ICMA 1ZBDA 5JSQA 4LQDA 4ZHSA 5JWRA 1M34E 2J7PD 3NJRA 4UKDA 3CVYA 2GAAA 1P45A 4LXIA 3ZDDA 2VPWA 4GZMA 1ZVMA 3PUVA 3ZU3A 3HXOA 3DA8A 3DKVA 3GLUA 5G3ZA 2N3ZA 1B6TA 1T1RA 4H7EA 1G4AE 2B98A 1NBAA 3FKSA 3A0UA 5AH0A 2PD6A 3AKCA 1NUPA 3U3JA 1ICEA 2G1KA 2VXOA 3UQZA 2GYVA 4NMMA 2YXBA 1UP7A 4UBJA 3ZJ5A 2G9RA 3I6YA 4HZIA 2GDZA 4R1MA 1U9ZA 4YRDA 1NYQA 2G4VA 1H4TA 4UPVA 2YW9A 3SDBA 3DZCA 5ENDA 1GKKA 2A0UA 3VJKA 4AS2A 4WERA 2FPGA 5EKTA 1D6JA 4J2OA 3VSAA 4K0KB 5TIIA 4YUVA 3BSSA 4B9AA 1KI8A 1TKBA 3W8NA 4TWZA 1FZQA 2QZ9A 4D0NA 4WFQA 1R3UA 3EJ6A 3IHTA 2Q3MA 3M6UA 2GHIA 2IQ5A 1C0EA 4NRDA 5CJPA 1XP5A 4BY9E 1XKQA 3H75A 4MS3B 7ABPA 2GAOA 1TYCA 3ENKA 2ZB2A 3B1FA 4FX2A 5IHXA 3QLUA 2BMFA 3R0VA 3KE8A 4X92A 1EESA 4WXRA 1U6JA 1T4CB 3IAM1 3QIVA 1QIMA 4PZZA 5CNKA 1FDSA 2LNDA 3RT9A 3Q6IA 4OQPA 1HH4A 2WIBA 3H5LA 1JEJA 1Q3HA 4XI9A 5TS2A 1S2MA 1EQAA 2NXJA 3R9IA 2FLVA 2OFWA 1DC3A 4FYIA 5T4HA 3BGDA 4FINA 3UJHA 2OD7A 3N6RA 3ZCVA 1IRXA 4NWIA 4KCGA 1WB4A 3H2GA 4NMXB 4DJFC 1JHAA 3MPUA 5AM2A 1V8BA 2IZ1A 1I6MA 3HN2A 1ZJJA 4AUEA 4EO9A 2CDRA 5JH7B 1L1RA 3V8QA 3CJRA 3QNUA 4P58A 4QYSA 2REQA 1NIJA 2DHRA 1PT7A 3BRSA 3GCWA 3ZCSA 2E21A 1JSRA 4Y6RA 5K51A 5WRFA 3WBBA 5AKEA 4DLLA 1FDIA 1P4GA 5F64A 4J1NA 4HL6A 2Z8YM 1A77A 1A8HA 1R4MA 2E1PA 1DOZA 3AF1A 3L9XA 1Q7TA 3FPLA 1CYDA 3D6UA 5HUQA 2V0CA 4N1AA 1KQFA 1A0OA 5CGQB 4G0ZA 2AOTA 4NKRA 3CO0S 4QDOA 2R25B 2CCGA 2IPLA 4TV9F 1NY6A 2DVMA 4L7VA 4Y6OA 5AM4A 4YAGA 5BP7A 1W36B 3KKPA 1GL7A 1QB8A 4ZVKA 4JYAB 3GBSA 3GVCA 5IVIA 1WMFA 4GF5A 2Z0MA 2ECOA 3H1FA 2PNFA 5JYEA 1W85A 1VJGA 1ZCBA 2BEVA 3SYRA 3UAZA 4EJSC 1X1QA 4QTTB 3NB0A 2C00A 1K63A 2BSXA 5FPQA 5JLAA 1NKTA 4G1VA 1A2BA 1GZUA 1R0ZA 3C0KA 3LCJA 1AXGA 3FI0A 1YRQA 4Y6LA 1RZRA 4ZOCA 4CQMA 4I7EA 1K0FA 3R6GA 4MTCA 3U1TA 2I87A 3JVIA 2JIOA 2O6LA 3KNZA 4CXMA 4FEYA 5BMVB 1YJBA 1PV4A 2PD4A 4RTPA 3KOMA 3I73A 3C4JA 1LPMA 3G9TA 4OM7A 5E6SA 3CY6A 4GFDA 3T4UA 3A0RB 3NBUA 3OQIA 5DGCA 4NS4A 2NTNA 1F9AA 1M6WA 1BH2A 2OK7A 3QY0A 4KXYA 3KL2A 4FTWA 4ZCSA 5EJ5A 3ORRA 1J5EB 1EXVA 3OJWA 3EPPA 3T06B 1CFZA 2VSFA 3CC8A 3I0NA 4FB5A 3QKRB 1YI1A 4XFKA 1VFPA 4XUEA 4M1QA 1HE1C 2Y6UA 2BMJA 2LUOA 2Z1NA 3KKQA 3KWFA 3WA7A 4IMIB 2EWVA 1AS3A 8ADHA 1JQKA 3RDPA 4INAA 3RRYA 3L1VA 4Z49A 3Q1LA 3A4VA 3FVVA 5F35A 3FFTA 1IZ9A 2Q5IA 2VH1A 4RK6A 1DG9A 3L1IA 4GMHA 5CCEA 1BGXT 5DULA 1ENOA 1M6VA 4XRRA 5JCOA 4G67A 1C7IA 1ISGA 1K0UA 3TSCA 4DSUA 5JFGA 3E9YA 3VPBA 4KR3A 4R9NA 1H2ZA 4O08A 3ZXXA 1UXGA 2XZOA 2B2CA 3Q3EA 5CEEA 2OD9A 1IH8A 2VJAA 2H0AA 5HX7A 4DR3B 3TSZA 4J07A 1A2KC 2X2PA 3Q72A 1MKYA 1X7XB 5TX7A 5IUNC 3KK0A 2PBZA 4CFSA 2BLLA 1Z7YA 2LCIA 1XELA 4B3XA 3ANYB 4PAMA 5DM0A 5A1TA 5JNLA 1GCOA 3INYA 1J56A 2RGNA 3CX6A 4G0VA 4KPYA 1H4QA 1IJBA 3G3EA 3B52X 5DCYA 4L27A 2K7ZA 2PS9A 3NHWA 5DIFA 1SXQA 1HXHA 1KJWA 1UMDB 1ZIOA 1J4AA 1SOWA 2M1ZA 3ESAA 1RLUA 2WM9B 3FTDA 3KZOA 3QU5A 4X7BA 5A1JA 5KMGA 2IZ7A 2JFGA 3E6AA 3I42A 5FHRA 3UW3A 5ADWA 3PU6A 5CB4A 3GUZA 3AIIA 1VJ1A 1W5AA 1OXKB 4QGBA 2WD7A 4S24A 5EFZA 3PDIB 4L5IA 2C98A 5IN5A 2IITA 3BWXA 3QPAA 4LZNA 4RH1A 3A3NA 5CEFA 4L9WA 4O4JB 3G5UA 4MV0A 5FWXA 4DIDA 4DXAA 2PS1A 1WULS 2M32A 4H08A 2R4UA 4M38A 4Y1FA 3W9SA 3E9QA 3U16A 2ZIVB 1AG9A 1ZGBA 3BORA 4XB2A 5BSFA 1G8YA 4UCQA 2CE2X 5F7OA 1G20A 4PU0A 3IAXA 1UDWA 3EVBA 4A0SA 4MUMA 4TTQA 4A2WA 1D4OA 1PQUA 3F46A 3R5KA 1W9HA 1A71A 5T5QA 5LM3A 2UYOA 2AG5A 1XZNA 4YRLA 3BERA 1YUNA 3AIMA 1CUBA 4XCQA 3IHWA 1JLSA 4KQGA 3D64A 4PCAA 4TROA 4XJXA 4V0KA 3T0GA 3U4MA 5HQJA 5JD4A 3M3DA 4AURA 3RK1A 2V6JA 4GKBA 2WKSA 1WUHS 4P3KA 2UZIR 2VJNA 3IO3A 4CKWA 1NC1A 4BNNA 1KEEA 2QAJA 5KC9A 2Y1EA 2ATCA 2WWRA 3TKAA 1M1NA 3RUHA 1JIQA 3QE0A 1GAJA 4DEYA 1E2KA 5AIAA 3Q1KA 1J8MF 3UW1A 1E0DA 1NGSA 2OXCA 5FQOA 3IMGA 5L6MB 3GFFA 5AI8A 1P72A 1ZUNA 1F8UA 3OJLA 3C16C 3U80A 1VPLA 4JLNA 1P91A 1UJ5A 3CURA 2H9AA 1I4DD 1Y5NA 4L6IA 4PZ9A 5EJGA 2J85A 4NE9A 1OILA 3T3DA 4AN4A 4D0RA 5B7PA 1PO7A 1J21A 2DCUA 4FZ3A 4GUDA 3T4PA 4Q6WA 4N4AA 2QG4A 3DMHA 1O6CA 3KTOA 3QE9Y 5EZ6B 3ISJA 5BUZA 5JCJD 1BTOA 5IHPA 2J31A 2YIDA 4NJMA 1DBSA 2AMFA 4MWOA 3DF7A 1CQIB 1VECA 1WHSB 3ABOB 4CTKA 3W5UA 3BILA 2PZJA 3HP4A 1J8VA 4MJ3A 5E9AA 4XVRA 2B25A 4RHXA 3N0TA 4TMFA 2O2XA 1EEHA 2RHLA 4FYYA 4Q7QA 2VUHB 3TIIA 3AJ8A 2DH6A 4CV3A 4R54A 3TTSA 1T4MA 1HEYA 1TYZA 4G1BA 1Y33E 2P79A 1OTYA 4Z7JA 1L8LA 1SBZA 3D3QA 4TMWA 3THRA 1VXRA 3BMNA 4LNAA 3R3YA 4DC1A 1B0AA 3TKLA 4RUKA 1TQHA 3V4RA 1TM2A 2XA9A 2Y8EA 3LQRA 1JQBA 4D8YA 1GXSB 4D97A 1L2TA 1WZ2A 4DA6A 1XZLA 1MABB 3WNBA 3P0EA 1B2RA 2ZPTX 1X7WB 1JNXX 1M1YE 3MA0A 3ZLUA 3OZCA 3NTOA 3OF3A 5BWOA 4JX9A 1APBA 3OZWA 2QRZA 2C94A 1ISPA 1EG2A 2HEIA 1MCZA 2VVTA 2W2KA 3QF7A 5H59A 4UNIA 3FHOA 1GCUA 3UHPA 1ZR4A 2B0JA 2GO7A 4QRHA 3K0AB 2BGUA 1AD2A 1XZDA 5LLDA 4Z51A 1AM4D 4JNCA 3H42B 3TOXA 2N42A 2H3EA 2CSXA 3K8YA 4LK3A 2XUKA 5DK6A 1KOLA 1Z22A 5A02A 1RJFA 2A1IA 2VPYA 4M76B 5I4BA 3W7AA 5FLYA 3ZBUA 3QLUC 4W5JA 5E4FA 5IJWA 1MN6A 1PNVA 1MX5A 3THWA 3TM5A 1P2SA 1QF6A 3P4XA 4OBEA 1K7XB 2BGRA 3QZUA 3JAMA 1SURA 2W5UA 4Z9FA 1B73A 1X7HA 3U3DA 2OCLA 3G02A 4BGVA 5LP6B 3OQMA 1XRRA 3V7NA 4CCYB 3AV3A 5CA0B 1N1MA 4US2R 1U0BB 1VRWA 3RRXA 5CBPB 1JR4A 3OM0A 4HF7A 3X1MA 4M83A 3H0KA 1LY1A 3EQ7A 1UKCA 4O2AA 5KQGA 1HT3A 3LRXA 4IBOA 3O8CA 4MAFA 1XYGA 1MRSA 1YQGA 4MS4A 4XGKA 4RHCA 3KWJA 2VSYA 1AZTA 4TTJA 3B51X 4P54A 1U8CB 4O0MA 2BM0A 4E4YA 1YRHA 1HSOA 1FNBA 1Z2AA 2IEGA 1Z8NA 2PN1A 4RAQA 1RC0A 2VQDA 4B45A 4UHJA 3FYSA 4GE0A 1JJ7A 3OFNA 1GZSA 4OSEA 4Y7DA 4DJDC 3H2IA 2JNWA 4C20A 1JXQA 1YCGA 2O0KA 2VUUA 4P38A 1IFXA 2CXTA 1QOZA 3RC8A 2ZIEA 2VL7A 2Y27A 1ZIDA 1TEXA 1O4WA 4AS3A 4S05A 3L92A 4HDRB 4PLPA 3HBJA 4P4SB 4YRJA 1EDBA 2P4EA 4KNWA 3N7UA 3B3GA 4KITB 1PR9A 2BP7B 3A6HA 3G9XA 1ZNQO 4B35A 4ZV4A 2HV9A 1FNSA 2HXGA 1CDEA 5TT0A 3U7QB 5CJ2A 1EUYA 4DSNA 3PA6A 1H3FA 3PE4A 4GX2A 4UAVA 1XDWA 1LDBA 4YRTA 5KSPA 3I09A 2WT9A 1U3GA 1DIGA 4LGCA 1N0IA 3SLKA 4C0WA 3ADKA 3FFWA 4ND4A 4DEVA 4RVUA 4AKIA 1JBKA 4N40A 4M21A 1P44A 3ANTA 5BY2A 1GO2A 1HLDA 3UXMA 3WIVA 4E5NA 3F6CA 4WT7A 4YB8A 5LA6F 5CJJA 4Y18A 3VX3A 1JG4A 2PZGA 3K0EA 1NN3A 5BVHA 1U1CA 3AKZA 2GFIA 3CBGA 2J6BA 1T4BA 4B7ZA 2OO7A 2RARA 2J5KA 3RSCA 1SA0B 1EXMA 1E3QA 1KI6B 4EG1A 1T2CA 2XUJA 1NJSA 4DCPA 2WIDA 3ICPA 4F4IA 4TS1A 4A92A 4S0XA 4JL5A 4MVJE 1H0KA 2FWBA 3UT5A 1SWWA 2QU8A 3FLBA 4M0UA 4H9GA 1QTNA 2WOJA 2I2AA 5AHOA 2FZKA 4IH1A 1V8OA 4C0JA 4BRSA 4BJ1A 4RPKA 4NYIR 3MWDB 4GYJA 5KOYA 1UKEA 3WQQA 3C14C 4OQMA 3ZIAA 2OOKA 5F51A 4RHYA 3NJ8A 4QXPA 4XKJA 4OHBA 4RVNA 2YASA 1E7MA 2DGDA 2R5WA 1H8EA 2E4XA 1VHJA 3RVJA 3SZUA 3CH4B 2R68A 2Y1GA 3AVOA 3H17A 3S28A 2I3ZA 4DRYA 4IFTA 4S1NA 2P3SA 1QAQA 2CWDA 1SUSA 1K88A 1J09A 2JFBA 4N5MA 3BGWA 3Q5EA 4HT3B 3ESYA 5EJ7A 5JCOC 4FM9A 3ND6A 5FR1A 4XWTA 4Z0NA 3WWCA 3R76A 2IXAA 2XGGA 3KTAA 3MLAA 4XFDA 3T5GA 1NZDA 4XW2A 4UCWA 4TYMA 1Y89A 1VJDA 1GFSA 2Q1YA 2HOQA 5LQNA 1YE5A 5EIOA 4YUZA 1V7ZA 2XHEA 2CYCA 3I9KA 2LKDA 4QUGA 4GX5A 2WFMA 1BCRA 2C31A 3DSRA 4Q93A 1WCWA 2R6ZA 2P6OA 3B89A 2JASA 1TXGA 3RK4A 4EG5A 2C7GA 1AB6A 3BHNA 3U17A 4IR7A 1EUZA 3WE7A 2RGNC 3MGGA 1QYIA 2VSQA 1MGOA 4DCCA 4G26A 4GE3A 1OLXA 1SBYA 3ONWA 4HZGA 3KUDA 3ZV3A 2Z4TA 3ETNA 3L93A 3UBMA 4LJ5A 2O6HA 1KVTA 3AY3A 3DEHA 3WDSA 4CODB 3GGPA 4KSBA 2JDIA 1FU4A 4EHDA 2OTCA 3FIUA 4JA0A 3WK9A 3AW8A 5JATA 4UHFA 1CS4C 2BE7A 2GYYA 3IP8A 4A2PA 3NMUF 5JS2A 2GHRA 4DDWA 3BMQA 3Q3GE 1T2AA 4WKGA 5TQ0A 3QYPA 5AKJA 2V5VA 3FCUB 3S1LA 1W36D 1DKLA 3AUSA 3NQ41 3BL5A 4ZK2A 2Z98A 1E2EA 2GZHA 2IELA 2PIAA 1Z68A 3DEKA 3EVEA 4RA9B 3BYZA 2X7XA 5EHZA 4C6TA 4LYAA 4XCVA 4L4ZA 1QR6A 4YUAA 1O6ZA 3MXTA 2PRSA 4GP7A 3VRHA 3Q4GA 2O8EB 2HH9A 4IIJA 3I5XA 4JZYA 2KMLA 2XMQA 4MMZB 3NWOA 4PIPA 1CHNA 4K9SA 2O3JA 3EPHA 3ZW7A 5EOVA 1GUBA 2R3SA 2XUHA 3FPFA 4N0QA 2V65A 2HWKA 2QRMA 2YV4A 3EVNA 3LYLA 3TB4A 1K9SA 4RD0A 4ZJPA 1E1MA 3LDAA 5TF0A 1WD5A 1U1FA 5E3IA 2AB0A 2MINB 2H2FA 2RHOA 4OSOA 3UPTA 3EE6A 5JEDA 1W30A 3E9DA 3GXBA 4TVKA 2QAIA 1KI4A 3D31A 3UJCA 5FUQA 3NHSA 2IYQA 4B3SB 2V4UA 1QO0A 2WVAA 3EMKA 3P0FA 4I3FA 2JLAA 4L78A 2CXQA 3ZU2A 3PNMA 1ULHA 2RH8A 3EEOA 3GJ3A 5D5PA 2WKRA 3M83A 4I99A 1U63A 2YYYA 3G49A 1FUKA 2DQ4A 3AONB 3KD3A 2JK0A 1R88A 3WBFA 1PGPA 1KRWA 3QVWA 4LFCB 4PQYA 2FW8A 3GRVA 1AE1A 1OI7A 1F7UA 1GYQA 3BRQA 5KYTA 4B3RB 2C4WA 4KTVE 1EH5A 3REOA 2JZCA 4W82A 1QTIA 2HGSA 3U7RA 3TOCA 4YQEA 3U4AA 1WCIA 1J8FA 5E6UB 1UQRA 3V7FA 2HA0A 3BJRA 3TLBA 4BFWA 5F33A 4QSMA 4HMQA 4RSRA 5GINE 5HGXA 1T9KA 1UXOA 3D4LA 3FHLA 3O3NB 4EFDA 3FNGA 4U3JB 3WIBA 2PRJA 2C88A 5F7XA 3E8XA 4JJAA 2XNJA 3HRHA 3K16A 2ZQYA 1CIPA 1BS9A 1NF9A 2VHVA 4HN4B 2NVUA 3G1TA 5B55A 3M8KA 3QE4A 1QBGA 3AF2A 3FRIA 1E9RA 5TDHA 2ACKA 3DMFA 4TL9A 3LK7A 3AOGA 1URPA 4LEIA 4G24A 2G63A 5KYUB 2C42A 2ZAIA 3AEQB 5I48A 3H8SA 4NBRA 4DHEA 1N4DA 2PX4A 1JVNA 4G0OA 1DXHA 3VR4H 3ZDXB 1B0PA 1TZBA 1BVYF 1LSOA 4IO0A 1UPUA 4X93A 4AK9A 4F7DA 1OBCA 1ZICA 1PFGA 1X1BA 4G1EB 4HRVA 4NNPA 2HCFA 2ERCA 1ZGCA 4J3FA 1EB9A 4MX8A 4UBNA 5F76A 3UENA 4DLTA 1W8IA 4KQ6A 1IWPB 1CEQA 2R60A 1YK0A 2HMVA 4HFRA 4ND5A 3MB8A 4YRPA 1KQPA 4JP2A 4S04A 1E1CB 3PNBA 3ICCA 1ODLA 2CFOA 3H5IA 3ND7A 2P67A 4IV5A 1YDFA 4P5PA 4R9VA 3NVDA 4R2IA 1OV4A 5KYWB 2PYDA 4GIBA 5CDFA 3LPCA 4LY3A 1PFQA 2VYQA 2QTAA 3QM1A 3VAZA 4PX5A 4FZJA 1TZMA 1Y4AE 1KK3A 2J5BA 4IIFA 3ZDYB 3ZQ6A 1BEZA 2V6MA 3WHLA 3FTFA 2O2GA 4AULA 2W4QA 1U7TA 5MFZA 5F73A 1XKTA 3GEGA 1Z2DA 2DFPA 3ZVNA 1WW8A 3MK31 2M1XA 5LOVB 1TVMA 5JJLA 3DKRA 2F8TA 1WY7A 4YJFB 2O05A 2OZVA 4UCFA 2OMKA 1JEOA 1QZUA 1H5NA 3K9NA 2R6AA 4HMPA 1YZQA 2HL6A 3L0PA 4OOFA 3ZXIA 2BELA 4A2CA 1QZ3A 1GTVA 3GAFA 3GK3A 1WZCA 3RIGA 3TPCA 1ZUWA 3WLMA 4AICA 3IAFA 1JSXA 3TXYA 3LAWA 4Z3DA 3D8TA 4CV1A 5JAPA 4O4HF 2OV3A 2R5FA 5JMPA 3PNKA 2MSKA 2W9XA 4JGIA 3GNTA 4YVFA 4WPGA 1WHTB 3ZWVA 4GECA 4AKEA 2W83A 2EYUA 1DKRA 3PJEA 3GVHA 1O8BA 1UPAA 1VCNA 2DTDA 3BD6A 3KCNA 3M6MD 3UKDA 4EJSB 2IEBA 2EP5A 2X8LA 2FRVA 1C30B 2QI9F 4MJ7A 1NBOA 4PLFA 2Q8NA 3G5LA 1HOXA 3RU3A 1QVAA 4CMAA 5C9ZA 2I03A 3HKCA 4JB0A 3TRIA 5GTDA 5LBTA 1RWNA 1C14A 1Y63A 3TNDA 2YWRA 3IAUA 4QYWA 2CVHA 2XYGA 3AZOA 1YJXA 3MSXA 3M6AA 2C3OA 2BGTA 3FCCA 3HLKA 1U3VA 3CLHA 3QKSA 4KVGA 3QPCA 2H07A 4K0RA 2P1ZA 5JZ9A 3OFSA 5FPYA 2EL9A 1EDDA 1QFYA 4G0YA 2APJA 1REQB 1BC5A 4TWRA 1QE3A 2JAXA 221PA 2EIXA 5MHTA 4LK2A 1GRQA 3VR4D 1DELA 1GNTA 2ECKA 3CG4A 4I66A 5KNDA 1A4RA 2YS7A 2H3HA 3KZ1E 4MRMA 3RYCB 4DDTA 3GLFB 2CK3D 2ZWPA 3LJKA 1NRJB 1PR6A 2FWPA 3KV3O 4KDRA 2GLTA 3BMCB 1O5IA 5HILA 4AKSA 2QTLA 1WOMA 1ZIPA 2WJ4A 3LX4A 5AHRA 2QPTA 2YDYA 1FP1D 1FSZA 2AF3C 3D7LA 5AUNB 2J48A 1CNEA 3BRCA 4C5CA 3ZWYA 3ADBA 1DNPA 1C81A 2LZ0A 3PK0A 4IJWA 1QIIA 4INZA 1GGMA 3MN1A 2DHQA 4FXOA 3C3XA 4J1SA 3DE3X 1AKTA 3QUCA 3K5WA 4IS2A 2JHGA 4OKNA 5IEBA 3PXXA 4JLSA 3ROPA 2BFCA 3H11B 3HXTA 4PPNA 3T3IA 5B3LA 1UP4A 3A9CA 1NQOA 2IHVA 3V6LA 2ORVA 5DN6A 2CJWA 2QX9A 3MQFA 1CDDA 5BMOA 4C4YA 8LDHA 1XLUA 3EB9A 3T9AA 1O0BA