4JLJA

Human dck c4s-s74e mutant in complex with udp and the f2.1.1 inhibitor (2-[({2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
241
structure length
232
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
publication title Structural characterization of new deoxycytidine kinase inhibitors rationalizes the affinity-determining moieties of the molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 232
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jljA00
3I3SR 1GNPA 5JHHB 5KSOA 3NHAA 4DLSA 1S8FA 2GAOA 2QRZA 4KITB 4N0DA 5FOVA 2JJ1A 4A8JA 2ANBA 1E9BA 4OBEA 4S35A 3LBIA 2MSDB 2ZAOA 5DN6A 5FPHA 5DI9A 1PUJA 3IQWA 3C5HA 1JAHA 2A30A 5EQTA 2GCNA 3VKGA 1K5GA 1X86B 1E1RD 5ANRB 1F2TB 2V6IA 1YR9A 3CO5A 1YE8A 2KE5A 4FINA 1DE0A 3THWA 3A1UA 3QNUA 1BKDR 3EWSA 5LB2A 4TMZA 3TAUA 4M9XA 2F1RA 4JBYA 2VA8A 1H8ED 4PQFA 5TVKA 1E4YA 3FKSD 4S2EA 2RAPA 3OEHA 3LQQA 2J0UA 3MGCA 4I99A 2QG6A 4QOSA 1E79D 3R7WB 1GTVA 4B76A 4HLCA 1VYTA 1OKKA 5HPYB 4MDEA 2PLRA 4N3NA 3TQCA 2NO6A 2X2FA 4JSTA 1SXJB 1NMZA 2GF0A 3TRFA 1XX6A 2CBZA 1M7GA 2OG2A 4LJ9A 1YR8A 2JLXA 4LV6A 3C41J 2F1HA 2V8OA 3R9WA 3MWJA 4UJ3A 3M4YA 1KI2A 1JR3D 2Q9CA 4EPYA 2OCYC 3GJ5A 4OJKA 4PO1A 2WJJA 4GL2A 1VCIA 2Z5FA 4OI2A 4TLBA 3NBZC 1E9RA 4QNRA 1Z8FA 3MWLA 4AG6A 2EWVA 2RGBA 1D9ZA 1KTVA 4ILEA 2QORA 1E1QA 2DYKA 4V0KA 4EQ6B 1AQYA 2CNWD 4LJAA 4Q1DA 4RCYA 3LH5A 5JSZA 3I8SA 1Q3TA 5KSPA 2UZIR 4BFVA 1SGWA 4KVAA 4KO8A 1C1YA 1HUQA 1XMVA 4HB2A 2YOGA 2BHRA 4D82A 1A1VA 3TW8B 3B82A 2CE7A 4XIGS 3A1WA 5DYIA 1Z08A 2RGAA 5AK0A 3OAAA 3QPVA 2JDID 1F2TA 1XFAA 1TAGA 2N46A 2ZI7A 2CVHA 4ON9A 1QHIA 2JJ2A 2QP9X 3HR8A 2ZI5A 3TH5A 4IOJA 1Z07A 1T4GA 4JZKA 1KK0A 1E2EA 4ZKEA 3EASA 4AIIA 5JMTA 1MO5A 2D2FA 3HDTA 1IY1A 1WDTA 2PCJA 1QHHB 3R7WA 2MMCA 5SZJA 2YHSA 5J4LA 3VKWA 5F9HA 5TXGA 5B64A 4JS0A 2ZSFA 3OIYA 3HR7A 1P2UA 4ESHA 1OHHA 1G21E 4H1VA 4YDHB 2F55A 1NVVQ 4OQNA 2MSEB 1XEFA 2CXXA 4BGDA 1AKEA 4ZO4A 2GCOB 4FN5A 1RYHA 4Q4HB 4PSAA 1XPRA 3IHLA 1X1SA 3C7KA 1T5IA 3EA0A 1U2RA 3C4JA 5EZ5A 5HTKA 5CB8A 3VX4A 1FX0B 1N6KA 2BC9A 2ZVQX 2OBNA 4DCNA 2W00A 2GEUA 5F2EA 2DR3A 3FFBA 1M7BA 2YWEA 2W6JA 3TLXA 3FTQA 1E2DA 1Q1BA 1X1RA 2KSQA 1P6XA 3N5CA 2JLVA 3H4MA 4Q1FA 2Z6VA 1T6NA 2D62A 2FDCA 2OEPA 4XSGA 3SHWA 1DAKA 3E2IA 4NYJQ 4QC2A 1OXSC 1JECA 3VR5A 4QM7A 3TE6A 3LW7A 3THXA 4UNSA 1G18A 2P3SA 1FTSA 2ZS7A 4TL9A 5JFGA 4C0AC 2H92A 5IK2A 3BBPA 4TN1A 3KXLA 3AVWA 1NMYA 4FCVA 3QIAA 4LJYA 1ZIPA 1HQYE 3IPYA 1QHHA 2ZIAA 3QVVA 4OHXA 1S9DA 3AF4A 1DAIA 4JLAA 3KQHA 1MO4A 5JJKA 3V9PA 4A1FA 1GL9B 4HATA 4KBGA 3I5YA 5GJWC 2WTUA 4W7SA 1XCPA 2ZJOA 4IDPA 4C0BA 1ZP6A 3E70C 5BQ5A 5A5GA 1KMHB 2F6RA 3HPQA 3QENA 4II7A 4Q4HA 2ERYA 4JJKA 3QVUA 4MKIA 1M1YE 3TSWA 3EWAA 4RVCA 1FX0A 4PHTA 4TMVA 2C9OA 2GBLC 5CK4A 2O0HA 3RS0A 2QQEA 2H1LA 3ADBA 2I1VB 1CXZA 3Q5EA 1KK3A 4Q21A 3LV8A 1R0XA 3GEHA 4URZR 2W58A 6Q21A 3U5ZB 4DRZA 1WBBA 3IILA 4RZXA 5G53C 5BN4A 5KPDA 4B3XA 1AN0A 3CBQA 1E9FA 5CDFE 3T1TA 2BOVA 1XZPA 4CEJB 3BIFA 1Q22A 1TF5A 2ZRLA 1KZ7B 4P4SA 1UPTA 2GILA 3PXGA 2CHVA 1VG1A 4IDNA 3CF0A 5C46F 3IDQA 4W9MC 1G4AE 1ZUHA 3I8XA 3L8YA 3NIBA 1BMFA 2KJQA 4P4TA 3NKVA 2AN9A 5EXXA 4B2LA 4YXWD 2CCGA 1G9XA 1TPZA 3TQFA 3R8CA 4QM6A 1RRCA 5FOSA 1E0AA 1S3SA 2BEJA 3SZRA 3UMRA 2REBA 3B85A 3QKRB 4GOJA 2DY1A 1RFLA 3AKDA 5TMPA 3DEFA 1ZMXA 4HYYA 3I72A 1R8SA 3U7FB 1W36C 2V7QA 5AUQA 2QT0A 3IQXA 3EA5A 3LO5A 4CZ2A 1Z0JA 3DL0A 3QJYA 3NBXX 1ESNA 1ZD1A 5G41A 4US2R 1VIYA 1DAHA 1H8HA 1A2BA 3QKUA 1KMHA 5FOUA 1COWD 1HYQA 4BPBA 3BFXA 3QEJA 4UKDA 3QKTA 1NJGA 1G20E 4G5SA 4PHGA 3RRNA 3PIRA 2EFDB 3VAAA 3Q85A 3Q3JB 3NC0C 4JLDA 4A0RA 4CW7A 4DUGA 3EPKA 3ZD7A 3BRWD 4LBYA 5KU1A 3AEZA 1NBME 2IT1A 1JALA 2EFEB 3EW9A 1E9DA 2IS1A 1U94A 1WB9A 5DIFA 4I81A 4JL8A 1DAMA 2CHQA 4RFSB 4DLTA 4CEIB 1EXMA 2R44A 5LBIA 3BAFA 5FL7D 5JS8A 3UMFA 3HU2A 1E9SA 3K9LA 2XSZA 3CNNA 4LBZA 2ZQ5A 1CRQA 1G291 4DWJA 1JQJC 3IEUA 4LV5B 2W83A 4UNQA 4V0OA 3TR0A 1E2PA 1RYFA 1W48A 1NY5A 1NIJA 3NBYC 3B5JA 4NU0A 2WPDD 2BIFA 2RH5A 3QUSA 3HP1A 4BRWA 4OI0A 4LZZA 3UXMA 4ABYA 1CTQA 3AVXA 1AZSC 4RD3A 5E4FA 3WNCA 1K8RA 2ZRKA 1R10A 5TB5A 2NGRA 2PZEA 3QKRA 3AB3A 5EE0A 3RSOA 4E5UA 1IAQA 1B23P 1G4UR 4TQUS 5HKKA 4TQAA 1Z0AA 2FFQA 5DNYB 3GLIB 4QNMA 3CRRA 1XMSA 2VSFA 1KDOA 4NP6A 4ESVA 2C5LA 2Q6TA 3I73A 3BERA 3FE2A 3PITA 4FI3C 2ZE6A 1OH6A 1EFUA 4D0NA 1N0VC 5FTKA 2E87A 3CH4B 1L2TA 1YRBA 2XJ4A 2YWHA 3TUIC 4YMWA 2R6GA 2NQ2C 2V1XA 2G3YA 3QG5A 1FP7A 1T0JB 1W5SA 1XRJA 4GMXA 3U2QA 2IA5A 1VECA 4IFBA 4C7OB 1CF4A 1E2GA 2OAQ1 3M6AA 4RFSA 3WP0A 5KSYA 1WP9A 1MV5A 3U3RA 1HV8A 2JATA 4LPKA 4QJ3A 3FHCB 2KB0A 3CF2A 4M1KA 2NPIA 4RKFA 5FR1A 1AGPA 1A2KC 4A2PA 3EZ2A 4TMWA 5H1YA 4A0FA 1N6RA 1NBMD 1XB2A 2PEZA 3MD0A 4J0QA 4LY6A 3RS7A 1VPLA 3OEED 2OILA 5FPSA 3NDBB 1N0WA 1D9XA 3I1FA 1VDZA 1Z2AA 1EGAA 4DXAA 1KMQA 3AP3A 4KV9A 3CX6A 3KJHA 3K0AB 2EFGA 3CX7A 3KX2A 2GJ8A 3V4RA 3E5HA 1OIVA 1DS6A 1ZD8A 4N0EA 2A3RA 3L0SA 4Q5IA 3FDIA 1N6OA 4DLRA 1TF7A 3SFZA 1SVSA 5CB6A 5E3HA 1XXHE 2P6NA 3BB4A 4B3DA 4QBGB 5FH9A 1FMLA 4G5RA 3JVVA 2IYWA 2QMOA 2D74A 1W0KD 1R7RA 2N42A 3K70B 4DCUA 1W36B 3LX5A 5FI1B 2ZRCA 4H9GA 3TSOA 2A9KA 4KSBA 2QEQA 1A82A 1OW3B 3MG9A 2YC2C 2FE4A 1VCMA 2QSYA 5JI3E 2MSCB 3T61A 3P26A 2YWFA 2LKDA 3NBFA 4OL0A 4TMXA 5DISB 2HYIC 1M8PA 2GBLA 1EG7A 3AVYA 1HT2E 3ZS8A 1AKYA 4DLWA 2WWWA 2YOFA 4NTZA 5C1BA 3K9NA 3B2EA 1E9CA 2QL6A 1FP6A 4UNNA 2XJ9A 1UKZA 3EAQA 3TBKA 4AG5A 4F7WA 2C95A 2FZLA 4WXRA 2YOHA 1KHTA 2OZEA 2Z83A 3WYFA 4QFMA 2CCKA 1WMSA 3REFA 1W46A 2GA8A 2QUZA 2BMEA 4TYYA 4TL7A 3U3JA 3DO6A 1CIPA 1DO0A 2AR7A 2W2TA 4MYCA 3LLMA 1OLOA 4UQOA 1FQKA 1ZW6A 1E3MA 1LW7A 2OM2A 3I62A 4FIDA 1MOZA 3BB3A 5UKDA 1ZAKA 3IBYA 2O8EB 4XH9B 4QJ5A 4BLQA 5KO2A 621PA 3VHXA 4PO9A 1Z2CA 3B1XA 2YINC 2WJIA 4KCGA 2BMJA 1NKSA 1ZNYA 3BB1A 4CRWB 2XEXA 2KWIA 3K0CC 3UG6A 3FMPB 2QE7D 5J5CA 1JXMA 1XJQA 2TMKA 1SHZA 4K46A 4Q9HA 1NLZA 3SQWA 4DEXA 4NONA 3CKLA 2DBYA 2H5EA 4TL8A 1OXUA 4TYPA 2B7CA 2HYDA 2CLCX 1SKYB 4Q7KA 4BLPA 3AQ4A 4MH0R 2ECKA 2O8CB 3PUYA 4D80A 4R9UC 4L8GA 2YV5A 5J4HA 5EXTA 4MGYR 2QQ0A 3TK1A 1RJ9B 1G41A 2IK8A 5BYJA 2JJ1D 1F5NA 2O8DB 4LCBA 1W47A 4TLCA 2IWHA 4D6PA 5DN6D 2OAP1 4MYUA 3U44B 2XX3A 2Q3FA 3GP8A 2HCJB 3CR7A 2IYVA 1J99A 3UK6A 2WJYA 1G8GA 2ZS8A 1ZU5A 2GWHA 3G5UA 5HCNA 4DKXA 1I4DD 3ZIAA 1TADA 3W9YA 4LJ4A 2ZRIA 1SXJE 2VHQA 1U98A 3I32A 4NMMA 5AJZA 5TDHA 2VRWA 1YRAA 4DZZA 4B33A 1G64A 3AP1A 3B78A 2PJZA 2OBMA 3SN6A 4MKHA 2O8EA 1VCOA 2NG1A 4DB4A 4OHVA 3SS8A 3ETLA 2IS6A 4URYR 1OKKD 1OYYA 3CRQA 2QI9C 2QMUA 4RD2A 1KAOA 1UDXA 3I5XA 2WJVA 1VMAA 5KDDA 1RRFA 3LLUA 4FMCB 1KO7A 4ERNA 1PLLA 2QMHA 1M74A 4FMDF 3EPJA 1I2MA 2BKUA 2ZPTX 4IOKA 5CYPA 1NN0A 4IFEA 3WYAA 4X8HA 2XXAA 3RABA 1RJ9A 1OT3A 2BCJQ 3HYTA 1SULA 4HLUA 2IYTA 2O8DA 2PLFA 3RC8A 4TLAA 2ZYWX 4GP6A 1FTNA 2I4IA 1N6HA 2O8BB 3L0OA 2EFHB 2VTKA 3U44A 1P62B 5FPTA 4EUNA 3RS2A 1ZCBA 1ZCAA 3B8HA 1Q1EA 3LY5A 2VHCA 4BLRA 4HB3A 3OAAD 2NIPA 3QG1A 5FBQB 1UBFA 4HEJA 2OFXA 1E94E 1VYUA 4DVGA 2XOKA 3M1IA 2JJ2D 3MSXA 1JBKA 4U00A 2RHMA 4D81A 4HDQB 3U3OA 4JVLA 3FMOB 1Z63A 1HTWA 1T3SA 1W2HA 3MMPA 2P6UA 1LNZA 1MO6A 1XCGB 1ZD9A 1AA9A 4L9WA 4HAWA 2AXPA 2GVDC 2HF8A 3K09A 2RHDA 4Q7JB 3ND9A 4XD7A 4DDWA 3DMNA 1SXJD 3WMGA 4PXAA 4RZ3A 5C4GB 3HJNA 2OESA 1OHHD 4B2PA 3SQXA 1W4CA 3A37A 4PC3A 4PTLA 2J3EA 1JQLB 5E7MA 2VBCA 3SJCA 3UATA 5KUTA 4Z1MA 4F4JA 2IHBA 4MGZR 1G3MA 4KODA 1ZUNB 2ZSEA 2ZVPX 4JT4A 1Z83A 1YQTA 4NH0A 1J7KA 2DWQA 4HI0E 1R5BA 1IN7A 2ZS9A 2AKAB 1X3SA 2PEYA 3W8RA 2REXB 4CVNA 4WW0A 2WJGA 4R2HA 1IXSB 1KZGB 4HB0A 2FEMA 3IUYA 4AK9A 3ZQ6A 4KVGA 1Z28A 2PZGA 2GKSA 2PX3A 3F5FA 1MABB 3LA6A 3Q5DA 2ZUBA 3HYRA 4IXNA 4XTRA 4B71A 4YLGA 4CEHB 3D6TB 4OK6A 3DPUA 4TL6A 5M04A 2J0UB 4BZQA 1UF9A 5EXPA 1IBRA 3EC2A 2J87A 3K0EA 3B6EA 4ASUA 4M1SA 5J4KA 1NF3A 3K53A 4KFSA 1UBGA 1NN3A 1XTJA 1QF9A 4AYWA 5JLJA 1Y63A 2ZAMA 2I3BA 3GLHA 4TQ9A 5IK2D 3PEUA 2IYLD 2FSIA 4HAYA 1M6NA 5DHAA 1G7CA 2ODBA 1W0JD 4NPHA 1OV4A 5CLQA 3LVRE 2B8TA 4O0MA 2KBEA 3OFNA 5G3YA 2QN6A 2IEZA 3U6BA 2DHRA 2ZRPA 4BWYA 2YC4C 4Q00A 2EFCB 3K0FA 1KI4A 4HSEA 4E03A 1CR0A 2BVNA 5TV2A 1U99A 3GLFA 2ZRMA 3RS3A 5JSZB 1JJ7A 5IRCD 3BD9A 4QGGA 3EZ9A 4MDFA 3EPHA 3C14C 4ZCMA 1IQPA 3P32A 1ZU4A 2V54A 2IC5A 3ZVNA 4EPXA 1DG1G 4KI0A 1VCNA 3K0CA 1E98A 3DZDA 1E96A 3ZGXA 3K9HA 1D2NA 1KY3A 1EESA 3VNVA 4ZKDA 2ZU6A 1B0UA 1P61B 4GPTA 5J4YA 1KIMA 4KAXA 1MABA 3GD7A 3TR5A 1E2NA 1ZIOA 2DWOA 3T5GA 4PR0A 4CEHA 5E7IA 4PQRA 3ZYCA 1DOAA 3RWOA 1KGDA 4ITRC 4Q47A 2RMKA 5D3MB 3ICQB 4W5HA 2OCBA 4G5OA 3WYGA 4FCTA 4NL4H 2FF7A 4XVRA 2GRJA 3TSZA 1KNXA 4MUBA 3UKDA 4OI4A 5DI3B 2NO1A 4XWAA 2WWIA 1PVOA 1XJ0A 2CL6X 4KYUA 1GDDA 5JCPA 2ZRDA 4B6FA 2JLQA 3AVVA 3W8NA 3GCGA 4HUQB 2V7QD 3OIVA 2QTFA 4LPSA 5FUVA 4EPWA 2C99A 1HH4A 2VEDA 3TIFA 2FPLA 4L15A 3WNDA 5KSZA 1J8YF 5TARA 3O8CA 3U7HB 1EFRA 4PC2A 3GJ7A 4BECA 4B73A 3QF4B 1G8HA 2QPOA 4KHZA 4TSFA 3AUXA 2P65A 1Z5ZA 3VX3A 1F6BA 2ZRNA 1W4AA 1ZRHA 2GJKA 1F48A 1FMJA 2HCBA 2OCPA 1N6PA 2JIZA 2A7QA 3P1JA 4W5JA 3THXB 1IN8A 4ZDJA 4HZUA 3MAAC 3AVUA 1G8FA 5IT5A 1MH1A 3AF1A 3VR1A 5J4VA 3GFPA 5FUWA 4BFUA 5ELXA 3KZ1E 4ZCLA 2JLWA 1JJVA 4D4MA 4Q9LA 4JJZA 3ZVMA 2WAYA 4QGAA 1NG9A 2D7CA 3GQBA 5G3ZA 2DFNA 2AD1A 1IY0A 1OFHA 2UVQA 5FL3A 3W90A 4D2IA 3H0KA 5D3MA 1E2QA 3T1QA 3NG1A 4PC7A 3IBGA 1AS2A 3OIWA 3GLIE 5DI3A 2VP0A 4G3XA 2L0XA 2P67A 3DHWC 2X8AA 4DSTA 1R5NA 1ZC4A 1TF2A 4GI7A 2EYQA 1TUEA 2IXEA 4AWXA 1DG3A 1VHLA 3Q8XB 4Q01A 3MLEA 1XTQA 2HT6A 2C2HA 1G16A 3PV0A 1LV7A 4HUQA 5HKKD 3QE0A 2JLUA 5DHFA 4KLNA 1ZNZA 4JYCA 1CR4A 3BK7A 2NTYC 8OHMA 1N6LA 2J7KA 2EQBA 3AGPA 4XVQA 1T3LA 5EP2A 1NVWQ 3SJAA 4AY2A 4ZIRB 2F1IA 1Q3HA 2YZ2A 3QF4A 3N2EA 2W6ID 2Q9AA 4AD8A 3IEVA 3P27A 4BEBA 1GG2A 2ZJ5A 4GFDA 5KHOC 3LNCA 2CE2X 1E0JA 2J59A 2OO7A 4GP7A 4TT3D 2NO0A 4A2WA 3OZXA 1CJMA 4P4SB 2QP4A 4M53A 3O47A 4DB2A 4TZ6A 3CZQA 4F92B 4GZLA 5L3QA 5J47A 2LCFA 1GKYA 3QXHA 4G01B 4IVPA 1H65A 5LB4A 2VPPA 1FQJA 2RGNC 4OK3A 1P2TA 3PCRB 4IJMA 4MITA 4ZI3A 1C4OA 3KKMA 4UXHA 3GFTA 2BMFA 4O2LA 1NVUQ 1TEVA 2J9RA 2FOLA 2N1BA 1E2LA 3BORA 4V03A 3REGA 1IXZA 3WXMA 3MJRA 4Y0VA 3KTAB 4JMPA 4PAQA 4UNRA 2ANCA 3CZPA 4RY2A 3SYLA 1NVVR 2YNMA 4LC1A 4RD4A 3ZZUA 3AUYA 3T34A 1T0HB 3O8BA 3UPUA 5FI0B 3BH7A 3LQRA 4C4PA 2CL0X 3P4XA 5FUYA 5BWMA 3DOFA 3A4NA 2V3CC 2VP5A 4ZIRA 4ZDWA 4FMCF 3MWKA 1EX6A 4DLUA 4M0LA 5EUQB 2H16A 5FTMA 1MRSA 2WAXA 3WHKA 2P6RA 3B1WA 4M4SA 1M2OB 4US0R 1GVNB 2CHGA 2HXSA 1JR6A 3NEJA 4NYJR 2QAGC 2GZAA 3KDSE 3CH5A 3OE7A 3F0TA 3RWMB 3EPLA 2V55B 1GM5A 2RB4A 5F3WB 4KXFB 1GAJA 1XMIA 1XP8A 1X8KA 1JPNA 4HAXA 1YKSA 2QRNA 3T5DA 1II0A 1GUAA 2G88A 4Q66C 5FFMA 1DAFA 2W0MA 2BKEA 4DSUA 1ZM3A 3FKSA 3AKEA 2WIBA 2ZREA 5FBLB 3WRXC 1NN1A 1W4RA 3T15A 1HT1E 2F1JA 5FTJA 4M9ZA 1UAAA 1KK1A 3KTAA 1BOFA 3WP1B 1HQCA 1X6VA 2O52A 5E7JA 3VTKA 2GZDA 4WBSA 1SVLA 3LAWA 3SE0A 4PSVA 2OLJA 2CLDX 2GXSA 2R6CA 1JR3A 2YWGA 1ZVQA 1WA5A 3BC1A 4P4UA 1XDBA 2MMGA 1TQ6A 2OUKA 4DDUA 1GRRA 4B3GA 3KKPA 4P32A 3LWNA 1R0YA 4A36A 3QXXA 4AYXA 2J0QA 4GNKA 1MRNA 1KAGA 1SKYE 3L0IB 1D6JA 3X1DA 4NCIA 3K70D 2FFAA 1T8UA 1DPFA 1WRBA 1E9EA 2CNWA 2QP3A 3EZ7A 4M1TA 1W36D 3VKHA 4EKDA 3Q7QA 1IM2A 4E07A 1NKTA 2BBWA 3CX8A 1E4VA 3KQNA 2FJUA 4XWKA 1QHSA 4JKIA 2AKYA 4C3ZA 1AIPA 2CK3D 1N5JA 2R2AA 3QQ5A 4RJLA 2FZ4A 5FBRB 2HDNB 5IHPA 4KFUA 2A78A 4P0TA 1CR1A 2V6JA 4LBWA 5EJEA 2OBLA 4WZAE 3GLGB 1PUIA 3D3QA 4HAZA 4KSCA 2VIIA 3ZJYA 4MQBA 3PQCA 1DAGA 1HE1C 1U9IA 2WWGA 1Q1ZA 1ZC3A 3AH8A 1NNEA 2WV9A 1TL7C 4UNPA 5DH9A 4EFNA 3A6PC 5FR2A 3X2SA 4JVSB 1MKYA 1OB5A 2C9YA 1XCMA 5K8LA 4ZPXA 4U7DA 2J0SA 4G5QA 1I4LD 1NLFA 2G83A 2P5TB 2RKOA 2AK3A 3WRYC 3ZIAD 1GNQA 2F3TA 4B34A 4PPFA 2C03A 3PEWA 3AV0B 1NVXQ 4JL6A 3BOSA 2IEYA 5CITA 1E69A 4IDOA 3KXKA 4Q4JB 4HLUC 2IBMA 1KO5A 1SVOA 5EE9A 4JLOA 4A6PA 4DCTA 3P20A 4NCNA 2GJ9A 1XEXB 2HLDD 521PA 2FNAA 1G7RA 2WZQA 4FMBB 3AP2A 5C2JB 4QBFA 3TKLA 2C8VA 4ZI2A 1DO2A 2PX0A 1G19A 2Z0MA 4DLYA 3U6KA 1ZNXA 2IYRA 4IEIA 2OLKA 1G8PA 2ATVA 4PSKA 4B35A 4BRUA 4NCHA 1IJEA 1P3JA 2XZOA 2FX3A 4DLXA 4LHYA 3NTUA 4MGIR 3GLGA 2D7DA 4R2IA 2QAGB 2ZR7A 2F9MA 3A36A 1CRPA 5CIQA 3ECCA 3QY0A 2ZRAA 4MYTA 4YC7A 4TLEA 2WWXA 1T8TA 3G82C 3K09C 3FPAA 1P2VA 4GDFA 4QGFA 1DBSA 2IUSA 1ANKA 2J5XA 3W6PA 1XNJA 1S2MA 5GJCA 1F2UA 4ZV4A 2QPTA 1U0HC 3AVTA 1WF3A 2GVZC 2PL3A 3BFVA 1T3HA 1ZM7A 1AS3A 2RGNA 2J46A 1CULC 4DIDA 2GJAA 2AHOA 2WSMA 3GJ3A 1U8ZA 3KJEA 4I1UA 2WOOA 4LYHA 4RD0A 4Q4AA 4Q03A 5EXSA 2XOKD 3CRW1 5JZVA 3OF5A 5H70A 4F38A 2X1VA 4PAMA 2EVWX 4Q4JA 1E9AA 2VO1A 1PJRA 2J7PA 3A4LA 5DSZA 3SI7A 3R9XA 1XEXA 2BBOA 2IUTA 1BO6A 2WICA 1Z6YA 3HPRA 4WZBE 4IKEA 2ZROA 2D2EA 1GP2A 5CM8B 1TQ2A 2DFLA 2QMEA 2XTNA 3PENA 4IVQA 3FOZA 1R5OA 1ZNWA 2X77A 4FCWA 2B92A 2WKQA 2CDNA 4B48A 3F3YA 4P31A 1U0JA 2IUUA 3LBHA 4OQLA 1GILA 3W34A 2RGEA 1RKBA 2CCJA 2ZUDA 4Y0AA 3LFUA 3U4QB 2ZRGA 2FH5B 4YXWA 4B75A 1KYIA 3THOA 1PZNA 2ZYTX 4HZIA 2QAGA 4XWOA 3KFVA 2DWPA 3L2OB 1JPJA 1MT0A 2FG5A 4HAUA 1S4QA 3AKCA 3GJ4A 4B47A 1AK2A 2ODWA 1FOEB 1Z3IX 4TYWA 1PLJA 3QPWA 1E2KA 3KKOA 4BLTA 3DOEA 4B44A 3IO3A 1KKLA 1CBUA 2AFHE 1Z22A 3X1XA 3I4LA 2OCAA 3D7MA 1UADA 2J0VA 3BWDD 4LC0A 3ZH9B 5CIWA 5P21A 4LI0A 4IRUB 5SZHB 4V0LA 2RGXA 1KI9A 3JZAA 4Q7LA 3CRVA 3ASYA 5L3VA 1Q44A 2VL7A 3LDAA 1ELOA 2GHIA 1VKJA 1XTRA 5IDVA 4BLOA 4YMTA 1P9RA 4BZXA 3ZD6A 1N6NA 2XXAB 2EU8A 3L8ZA 1LF0A 2FV8A 4URUR 2NMVA 3VFDA 1NI3A 1UBCA 1ZM9A 1QHYA 2FSFA 2HF9A 4K81B 2P5SA 3PUXA 5FL7A 5B30A 2YYZA 4PC6A 3RLFA 3T1OA 2R6AA 1QBKC 1RRPA 5CLLA 1G6HA 1Z6XA 1WQ1R 2J1LA 1EFCA 3ADDA 1SVMA 1G3QA 4A9AA 4DIEA 3RAPR 4URXR 3U4QA 1GRQA 3MWYW 4GOKA 2XB4A 4LYAA 4HDCA 2WJHA 3RRYA 5K8IA 1R8QA 2XB2A 1UEJA 3A8TA 1P75A 5CDFA 2H17A 4WIAA 4RD6A 4R98A 1CU1A 5EE1A 1G7TA 1S1MA 1SZPA 2BWJA 4GSYA 2EW1A 4B3FX 4Q1BA 2QROA 3LXRA 3LX8A 2F43B 2SHKA 2ZM5A 3OEHD 2H7VA 3B9QA 1GSIA 1RVDA 5AJWA 2BDTA 3QXCA 2GETA 2FA9A 5D3QA 2OT3B 1IY2A 5JS7A 2DPXA 4MRPA 5AJXA 2ZTSA 3EZFA 1ODFA 3VR3A 5AUPB 2IL1A 4EIWA 1TEXA 3DM9B 3B7GA 1U81A 1DELA 3UIEA 3B1YA 4FD2A 3E1SA 5K8UA 4Q19A 3PUVA 4MRRA 1FNMA 2YKGA 1V43A 3GJ0A 3RRMA 2HJGA 2ZJYA 2C98A 4Q9IA 1E1QD 4NZYA 1W4BA 1G17A 5DLQC 4JLPA 1AQUA 1UFQA 4TSFD 5SZIA 2ZR9A 3R20A 1CJVC 2J41A 3IIMA 3IIJA 3U3KA 4NYMQ 3CUEF 1M34E 1K5DA 1KO8A 1NBMA 4G1UC 4YONB 1XZQA 3AVQA 1KDRA 3PJRA 1LB1B 1QVAA 3K9GA 1UKYA 3N2IA 4R71A 3UWOA 3BJIC 4TYQA 3NDPA 3OEEA 3PVSA 1VIAA 3CR8A 4LWZA 1Q1QA 3SBEA 1Y3AA 3O8RA 1K6MA 1N6IA 3GLHB 5JRJA 1XBTA 3NEYA 3CW2A 3OESA 3QPUA 4EFLA 1XPUA 2WWFA 4C0KA 3TNFA 3MUFA 2ZI3A 4LX0A 3R8FA 5L8VA 2F43A 1XD2B 2VP2A 4MRVA 2FWRA 4HLDA 4WOPA 2BM0A 2ZR0A 2ZJBA 1J90A 2DB3A 3OHMA 3L82B 3K0FB 3QSYA 1CJKC 1G7SA 3K8YA 1W0KA 2NO9A 4CGZA 2G6BA 4IW3B 4M1MA 1MO3A 1Q12A 4UJ5A 3GLFB 5AJVB 1GFIA 4QL3A 3KL4A 1C9KA 1Q57A 4X8LA 1OJLA 2OV2A 2XITA 4ZCIA 2XAUA 1P73A 2ZI9A 2PCLA 2XNSA 4NE2A 1V5WA 1XTKA 2VLIA 4RD1A 3W3AA 4DLVA 4A15A 4IEEA 1R0WA 4L4UA 1O87A 1US8A 1TX4B 2W6JD 4DSNA 4C0SA 1P7CA 1DTSA 5KDOA 1NP6A 2ODNA 1OIXA 4QHTA 1FL9A 3GMTA 5HZHA 1FPMA 1U0LA 1E6CA 1ETUA 3CPEA 2FSHA 2ZJ8A 4D25A 5KDLA 1OH7A 4CDGA 2XNDA 4AKIA 2ONKA 3DKVA 4M1OA 2HT1A 1XTIA 3TJZA 3WNBA 1QVRA 4AURA 2Z4SA 5KPJA 1E2MA 1KOFA 1E2JA 4MYHA 1YVDA 5JJLA 2PZFA 1OXXK 2R6FA 1GOTA 2XTZA 5FPYA 3RHFA 3I61A 2F9LA 1XD2A 4PZLA 3WHLA 3CPJB 3EIQA 4E09A 5GJBA 1P9WA 2QGNA 2JLZA 5BYKA 3EARA 1P2SA 4O25A 2G1JA 4P33A 4A82A 1KY2A 1IXRC 3TAHA 4IVRA 2XTMA 1Z6GA 2WMOB 4CT4B 4BE7B 3GPLA 1DVRA 1P5ZB 2ZE7A 2P0EA 2QE7A 2VHUA 2Y8EA 1KO1A 3DMDA 1DEKA 3H86A 4M8NE 4MA4A 5FOXA 1WE2A 5KOYA 2QPAA 1RE0A 3H1TA 1XXHA 4NCKA 1ZBDA 4Z8XA 3UANA 5CJPA 4DBLC 4PO8A 2GZHA 1II9A 4HZUB 1LFDB 2AWNA 2ZANA 4N1AA 3SYKA 2DFKB 4A0GA 4BLSA 3PR1A 3RC3A 4YQFA 3D8BA 2AL7A 3GJ8A 4OQFA 1JEEA 2GAAA 1OXTA 1HY3A 5IF9A 1KI1A 5AUOB 1WXQA 1ZJ6A 1PV4A 1BYIA 4WVFA 4I4LA 2C9CA 4DSOA 1JEDA 1IONA 2ATXA 2QTHA 3OE7D 3RS5A 1YR6A 3RSLA 3SOPA 1HE8B 1BS1A 3TUZC 3VU9A 1BMFD 2Z4RA 2RGDA 1IN4A 1S0UA 2IYQA 4AKEA 4IDHA 3VR6A 2NOAA 2QY9A 1G3UA 2WSSA 4RZ2A 4B3BA 2ZJ2A 2F7SA 2ASEA 4KFRA 2ZI4A 3HU3A 4DCVA 2VQSA 1ONBA 4R7ZA 4V0MA 5DO9A 2ZI6A 2ZRFA 2IS4A 1VG9B 4MKFA 4RCZA 1X8LA 2G1KA 3EIEA 5C18A 3ND8A 3CNLA 5B57C 1W7AA 4KBFA 1UKEA 1H8HD 4PZYA 1UKVY 1T91A 3LXXA 5HCIA 1RZ3A 2A5YB 4URWR 5GJVC 4EDHA 2RGCA 5C4MA 1Z0KA 4BFWA 1EWRA 3PUWA 2PH1A 4GRAA 5AJYA 4C30A 4BFTA 4U02A 1N5KA 3ZVLA 2UKDA 3CONA 3IHWA 4DUGD 5L3RA 1SQ5A 2O0KA 1R0ZA 1FNNA 4L16A 3ICEA 3SBDA 5FBWB 4QHSA 4HAVA 1NG1A 1U9IC 1YU9A 2V1UA 1DADA 1P4SA 1TU4A 3B1VA 2PJRA 2GESA 2BM1A 1BYUA 5L3QB 4PAOA 3THYB 4TZ0A 3A1SA 1TMKA 3AVPA 3WMFA 3GLGE 3W6NA 4WA7A 2V9PA 2XSZD 5A4JA 1E2FA 4TMKA 1ZM2A 1QDEA 3AF3A 1J8MF 1YHNA 4Q02A 2ZE5A 2IYYA 1P9NA 3LVQE 3ASZA 3L0PA 3W5JA 4JLKA 4A0HA 3QXJA 4LDJA 3ADKA 5EE5B 1GITA 2A5GA 2JLYA 2VP4A 2C96A 2AWOA 1OSNA 1N25A 1ZINA 2CMKA 3IIKA 1EK0A 1UBEA 4LSGA 4Z8YA 4C0HA 2HUPA 4A6XA 4MUAA 1FZQA 4LV8B 2VSOA 4RZUA 2OFWA 3KJIA 4EJSC 4DCSA 4FWIB 1IHUA 1E32A 3VR2A 1SXJA 3KB2A 2R8RA 2HV8A 3C5CA 4PC1A 4Q9JA 4Z51A 4PX9A 1A7JA 4LJ7A 4RFVA 3EZ6A 2WHXA 4UXIA 3CPHA 5CK5A 1I2DA 3DM5A 1SVKA 2ZEJA 3KQUA 1FUKA 2H8KA 3CWQA 2GXUA 4IOMA 4TLDA 1OPXA 1QHNA 4IOLA 5FTLA 2REOA 2ERXA 4XJXA 5FUXA 1GL7A 2XZLA 4AC9A 1OIWA 3BH6A 3P4YA 3THYA 1R6BX 3RNLA 1G3IA 4DDTA 4EQ6A 5DGXA 1KKMA 2FPMA 3DVLA 1N0UA 1KI7A 1UJ2A 2GK7A 2VP6A 3M0EA 3X1WA 1GIAA 4D0GA 2OXRA 1TTTA 2WKPA 2QSZA 4EPTA 2JJ8A 2ONJA 1SKQA 3TUJC 2V4ZA 3SYNA 5JBQA 3VNUA 3IO5A 2YVUA 1NLYA 1G5PA 2D3WA 1KI8A 5J40A 4OHZA 3U7EB 4LGMA 1U8AA 5FOTA 2RCNA 3X1ZA 1RRGA 5DE3A 2XGJA 3NWJA 4TWZA 5CYOA 5B2ZA 2BMDA 2GEDA 5LDDC 421PA 1W0JA 4UXJA 4JKYA 1KI6B 4TTQA 1Z0IA 4NKRA 1L4YA 5GVRA 3T1VA 4F93B 3B13B 2X2EA 1KSJA 2VF8A 1G5TA 1GNRA 1KSHA 1YZGA 4LJ5A 1JNYA 5JWRA 2WWYA 4DEYA 3MJHA 4PHHA 2GCOA 2CJWB 2FFBA 2H57A 4L5BA 4V02A 3ZVRA 1YZKA 5EP1A 2R65A 2WWHA 2WIAA 5HR5A 4M1WA 3VR4A 3LD9A 4JLBA 1P72A 1G1MA 1XEWX 1E1RA 2J7PD 1FUUA 3MFYA 1WBDA 3LRPA 1LY1A 1E99A 3R9IA 2WMNB 3SJBA 4LHZA 4FMDB 1OF1A 3KB1A 2GJSA 4IXMA 4OYHA 4ACBA 1T9HA 5GADl 4AKGA 4OHWA 1H8EA 1CEEA 5SZKB 1E2HA 5F98A 3WY9A 4PZZA 1UEIA 4DLZA 1TU3A 1HA3A 4Q9KA 1RIFA 4BUJA 3U3MA 1E79A 3NHBA 5LD2C 4JLMA 5AR1A 4BFSA 4AI6A 3AKYA 5HE9A 4LJ6A 4Z54A 4LUCA 2CEAA 4JLVA 4O3MA 1I4TD 1QHGA 1QHXA 3RDPA 1CS4C 4I1SA 4MGKR 2GXQA 3QF7A 3S1AB 4LHWA 2IXGA 4H1UA 4DHEA 5JEDA 2QU8A 2ZUCA 3V00A 3MRSA 3SR0A 4A2QA 4C0JA 2DFTA 3PUZA 4O2RA 1KI6A 4KLZA 4D4KA 1LS6A 3OIUA 4US1R 1WCV1 3GEIA 4V0NA 2BBSA 4JBXA 4MKGA 3K70C 3QKSB 2QBYB 4C0LA 2K5UA 4OQXA 1VG0B 1W1WA 4A92A 5FBVB 2CVFA 1YZQA 4JT2A 4TTRA 1D5CA 2PMKA 3TVTA 4NYIQ 4EPRA 3O8DA 3N70A 1XEWY 3AGQA 2CJWA 4X8OA 1E0SA 1OH5A 3CIOA 2ZSAA 1L8QA 4EJSB 4BFXA 2FGKA 2OE2A 4GMDA 1Z0DA 2G9NA 3BXZA 1KDTA 3ONWA 4EAQA 3ZDQA 2D06A 4BASA 2UZ3A 1CJTC 2JDIA 3CNOA 3QI2A 4HLQB 4PQYA 4W5WA 3BFKA 1GKIA 1AGRA 2AFIE 4L9SA 1M7HA 5EE3A 3CLVA 1Z0FA 3WBKA 2EWWA 1A4RA 3QOFA 3FHTA 2QTVB 3IKJA 2B21A 1AZTA 4CEJA 2VSXA 3A4MA 1JXOA 4XSHA 1NMXA 1VTKA 2Q21A 4IDQA 3ZLJA 1BIFA 3H84A 1XD9A 1T5LA 1XTSA 1P60A 2JAQA 3JZMA 4QBHA 3T06B 1F2UB 1N3BA 4I1VA 3S1AA 2Q9BA 1KSGA 2Q3HA 2VP9A 3AF2A 4B3CA 3V4FA 5BW8A 2ZYUX 5HZKA 2GF9A 1Z47A 4WXPA 2CLSA 4JVNA 1D8TA 4Q4AB 3IGFA 1HEIA 3KJGA 4C2UA 1XU4A 1CR2A 5FTNA 2IS2A 2IX3A 5KNCA 5K8TA 3K1JA 1D2MA 3QKSA 2QBYA 3NH6A 3DZ8A 3SNHA 3UWKA 2ORWA 4QHYA 2C04A 5KYKA 1CLUA 1XJCA 5TY0A 1YR7A 2B6HA 4M22A 1Q20A 3LBNA 2FGJA 3PEYA 2W6IA 4NYIR 4ARZB 4ZDIA 2IYZA 3FVQA 3WBJA 1VYVA 4JLNA 1NSFA 4EFMA 4EJSA 1GRNA 4X8MA 1MR3F 2KBFA 3C8UA 2GCPA 4TT3A 1UM8A 4M9QA 4XVUA 2FSGA 1JB1A 3GJ6A 1GWNA 2EYUA 3NVAA 4E22A 2ZYVX 1W2GA 4CT5A 1SHKA 1OH8A 4CEIA 3D31A 5HE8A 2BV3A 3LW8A 3B60A 1W5TA 2G0NA 2C78A 2JLSA 3EIHA 3GLHE 3VHLB 3W3ZB 5JJIA 4BZPA 1G3RA 2WBLC 4JIMA 2ZRHA 2IXFA 1XWIA 5BN5A 1YZLA 2J45A 3DDCA 4B74A 4B32A 1FW6A 2O5VA 1II8B 2YJTD 5CM9C 2GTPA 3TVDA 2X19A 1RC8A 1GKUB 1R4AA 1U90A 4KJZA 2QA5A 5LD2B 5EP4A 2IYXA 2JASA 4KFTA 3HU1A 1QZXA 2LKCA 2ZSDA 2QT1A 3GLFE 1OE0A 2FPKA 3RYTC 4GZMA 2I1QA 3A1VA 3ZZTA 4B43A 1S9HA 4AKHA 5JECA 3GLIA 1OYWA 1S3GA 3BGWA 4G0NA 1EX7A 1W49A 2OSBA 4LYJA 2VHJA 4C7OA 2VF7A 2PBRA 3ZZ0A 4DDVA 4XD7D 4P3YA 2Z43A 4ARZA 3MCAA 3B1ZA 2R62A 1RW4A 5JWHA 2O0JA 1XMJA 2ZU0C 3SEAA 4DC9A 3AM1A 2OXCA 2PMDA 3AVOA 4Z1MD 5JHGB 1N2CE 1Z6AA 1IOZA 2A2ZA 1E0KA 5GVSA 2BJVA 2JCSA 1LS1A 2WVJA 1NIPA 2KI5A 2ZSBA 4GT1A 1SVWA 4M1YA 3W6OA 3ZQJA 5JI2E 1XPOA 2R6DA 1OFIA 4QXAA 4PPGA 5H68A 1PLKA 4I1OA 3KKQA 5FPKA 2IWRA 2XZPA 2HXYA 4LHXA 4WZ6A 3TMKA 4PFSA 4FW9A 1G5RA 3SDZA 4BEJA 2G0TA 3NC1C 1HURA 4PPNA 2RGGA 4QG7A 4URVR 821PA 3GEEA 1VG8A 2A5JA 1F60A 1II8A 2ZJZA 3PFIA 3EG5A 4ASUD 4V0ME 4K8OA 4QRHA 3AF0A 2XNDD 4ACAA 5H8WA 4KYIB 5BXQC 3FKQA 2WM9B 4LK2A 1Z06A 1COWA 3U7GA 2FU5C 3SFVA 2AXNA 2H18A 3PG5A 1TNDA 2R9VA 3NH9A 2IW3A 3ZS9A 3TGPA 4NBSA 1G8YA 3K0AA 1EFHA 4C2TA 1SVIA 2GDJA 1OFUX 1L7VC 2Q0HA 2QENA 4MRSA 5KNBA 4OHYA 4WAUA 2JEOA 4Q4LA 4LHVA 4JYBA 3OFND 5KNDA 4JBWA 3WMEA 3BE4A 4YMSA 4Q1AA 4A8JC 3NXSA 1NJFA 2QM7A 2ZJAA 2AK2A 3QXSA 2Q3MA 2O8FB 2NO7A 4RSGA 4GBMA 2GK6A 1TQDA 4AYTA 2E9SA 3A58B 3Q9LA 4DT1B 1QRAA 3EC1A 3FMIA 4QGHA 5B58C 3UG7A 1OFTA 4NDZA 4QBIA 1VHTA 4Q1EA 2WPDA 1BH2A 1TQ4A 3VMFA 1LTQA 2CK3A 2VYFA 3SC3A 1X8JA 4JVMA 5E95A 1YZTA 2GEVA 4YMVA 1LVGA 3PEVA 4NHOA 2B8WA 1KSFX 3JVUA 4NCJA 4PPQA 4M2LA 4D0LB 2ZXUA 5EZ6B 2OFOA 5EP3A 1QG4A 3SHFA 3KKNA 1J2JA 3L43A 4FXPA 4OJQA 3FGNA 1NN5A 1S96A 3QEOA 3UMSA 4BFYA 1AM4D 3FMFA 2P2LA 1CJUC 1Q0UA 4QJ4A 3QBVA 3RS4A 5KTYA 1OXVA 4PHFA 3F8TA 4BQSA 3H2YA 3U60B 1RPZA 3EX7C 2WKRA 1LF5A 5FOWA 2HEIA 2WSSD 1J70A 1XD8A 2C77A 1S1CA 221PA 4M21A 5F9FA 5JRZA 4C0QC 4FWTA 1N5IA 4Q48A 1EWQA 4C9BA 2QAJA 5LPNA 4CF7A 4QKQA 2HLDA 4LOAA 4F4IA 2O8FA 2E1RA 5A0FA 2LWIA 1CKEA 1GL6A 1US8B 3Q7PA 3QBTA 1NSTA 3IPXA 4TTPA 3T12A 4Q1CA 2AD5A 1EFRD 2A5DA 4DT1A 2VH5R 2NPFA 3ADCA 1TUIA 4BFZA 2ORIA 2F3RA 4F4CA 4B6EA 4B2IA 2BBTA 4EPVA 2ZETA 3KUCA 2JLRA 3FB4A 2ZE8A 4F91B 2B7BA 2ZITA 1KNQA 5BN3A 1NY6A 1KK2A 2CL7X 3KFXA 2JIZD 4JLJA 5AWFC 4IHQA 2O8CA 3X1YA 4YMUA 2WOJA 3TW4A 3HWSA 1KJZA 1JAIA 3W5IA 1YZUA 4JL5A 4OI1A 1Z29A 3BS4A 3T35A 3U61B 1DARA 3Q72A 3G0HA 4GOXA 2ODEA 1IN5A 1GZSA 4DJTA 1SXJC 2A5FA 3FWYA 3KUDA 3C15C 4M9SA 3I92A 2G77B 3J81k 2ORVA 3CRMA 2FEOA 3FFAA 5CJ2A 2DCUA 2IYUA 1EFTA 5AUNB 2FMXA 1KJWA 3KXIA 5JWOA 1AJEA 1AS0A 4LJ8A 4TYNA 2GNOA 5G40A 2BEKA 4HDOB 2IYSA 1DAEA 5L3SB 2GXAA 3A1TA 2PT7A 1XF9A 1KDPA 1CP2A 2ZRJA 4POAA 1OB2A 5JCZA 1YZNA 2QZ4A 1L4UA 4TMTA 1XXHB 4MRNA 1IJFA 3SJZA 5JEEA 1KI3A 1Z6TA 2AX4A 1ZYUA 4XTCS 3DKPA 1D2EA 1UDWA 2IF2A 1Q21A 4OKSA 4Q7MB 4D26A 4HUTA 4A8JB 2NZ8A 2IF0A 4OK5A 2JGNA 3RANA 4OQMA 2W2XA 4D4JA 3K0SA 4NYMR 4U5XA 4G5GA 1QG2A 4RKEA 4Q18A 1YJ5A 1U8YA 3CM0A 3EXAA 1ZM4A 2OHFA 3VU9B 4CIDA 1N5LA 4ZDKA 4XOIA 721PA 3THWB 1E2IA 2FFHA 1ESMA 2NZJA 1NL3A 5EUMA 2O8BA 3RVBA 4HB4A 3BH0A 5DYGA 1NRJB 4D4LA 3KQKA 3C16C 2IHYA 4A4DA 1JR3E 1A5TA 1IN6A 2PT5A 2W2VA 2JA1A 2W0SA 2ZRBA 1KO4A 4LBVA 4CYMA 4LRWA 1G6OA 1R2QA 3VQTA 1JI0A 4JSYA 1KJYA 3FHOA 2VHTA 3CB4A 2QM8A 4YDSA 2QNRA 1W44A 5L3SA 1FFHA 2BCGY 2FN4A 3CWZA 3B9PA 1ZUIA 3GFOA 3GJXC 3RRZA 121PA 2D4HA 2QGZA 3SU8A 1F3OA 2BJWA 2HJVA 3KQLA 4PANA 3FYHA 3CF6R 1O3YA 4LYFA 4KU4A
chains in the Genus database with same CATH superfamily
2QTBA 4F96A 1GNPA 5JHHB 2ZJ3A 1EM8B 5AK3A 3GA0A 2GAOA 3KSUA 5CH3A 3JPWA 4U2BA 4LVOA 5FOVA 3RV3A 1RWQA 1HDCA 2HI0A 2MSKA 1BWPA 5EPUA 4S35A 5HFJA 2AFVA 1SBYA 1H1DA 3LBIA 4BVGA 5DN9A 3F6SA 4MR7A 3CLUD 5DI9A 3IOEA 5DN6A 1PUJA 1QE5A 4FXOA 3MERA 1UFRA 1N2JA 4OF4A 5EQTA 1Y3DE 4H18A 1X86B 4LRYA 1SVNA 5ANRB 3L41A 1M6HA 4EF5A 3PNSA 4ZCSA 1YE8A 2KE5A 2Y9PB 4Q3AA 1OAAA 4ZAWA 1BDJA 2BE9A 2XT9A 1RBYA 4ZARA 4G84A 1LDYA 2F1RA 4M9XA 2X8WA 3REOA 2BZ1A 4JBYA 4QTUB 7REQB 4BP8A 4DV6B 1H8ED 5JS1A 1XQ9A 1E4YA 3K73O 3TTUA 3AY3A 4S2EA 2NZYA 4U63A 2J0UA 4LMAA 1WDLA 3VZPA 1XDDA 3OQOA 2FK8A 2G04A 5J43A 3S55A 5HPYB 1U9ZA 1BW9A 1VYTA 1W88A 2FY8A 3THRA 4MDEA 1GHTA 5I9LA 2NO6A 5HMMA 2X2FA 3DHVA 3D3JA 4GECA 4JSTA 4FU0A 3ENZA 1LNQA 2A59A 2YMMA 4MARA 3GK3A 1PE0A 3MOGA 4KQGA 2P27A 4U7FA 2OG2A 3U37A 1L8LA 3DQPA 3C41J 5A04A 2NZ2A 2V8OA 4DJEC 2P9ZA 5HVNA 1E6MA 4EPYA 2OZLA 3QEMA 2X0JA 4YDQA 4B45A 1N2IA 3DBIA 4OJKA 4L0CA 4PO1A 2G25A 4PYKA 2QR2A 4OI2A 3T95A 4TLBA 8LDHA 2Q4BA 2Q9UA 5EIHA 4QNRA 2QE6A 2G1AA 5JQGA 3OWOA 1P4GA 3MJSA 1KIFA 1KTVA 4KLCA 4ILEA 2VJDA 2YJZA 5CNJA 3ZE6A 1E1QA 3FA2A 4V0KA 4EQ6B 1AQYA 2H1HA 4Q1DA 5E6SA 4RCYA 3LH5A 3WJ7A 1WUHS 1X1QA 5JSZA 1E3WB 1Q3TA 4ZEMA 3D6HA 1EVYA 1Y9AA 1C1YA 1CEQA 4HB2A 4MLZA 1A1VA 1QAMA 4XIGS 5I7HA 4EKNB 1ISGA 1Z45A 4C4RA 4PNHA 3SM3A 3Q8MA 4H16A 4HGQA 5K99A 2XUJA 1GKLA 1E5VA 3G8YA 1I4OA 2MYUA 2JJ2A 1RFGE 3LY9A 4GXNA 3N2GA 4F5WA 3AJ8A 3OIDA 1Z07A 2V98A 1T4GA 1YBVA 1KMMA 1K3TA 2Q3DA 4IJKA 4JZKA 1JEAA 4AIIA 5LCXA 1Q0TA 6NULA 2CVZA 2FR1A 3HDTA 1IY1A 1VDMA 4MA5A 3JZIA 4YRCA 5DRTA 5EPEA 3IQZA 4IG4A 5SZJA 4F04A 5J4LA 4U7JA 4RKQA 3UMJA 3GFSA 5B64A 1QTRA 1Y33E 1WW3A 1EFDN 3OM9A 4QJIA 1IRXA 2RGYA 1CUIA 2ZSFA 3OX1A 2HMUA 3PVZA 1MDBA 4HGYA 5K0NA 3RVPA 2I99A 3Q0EA 5H0IA 3ZNPA 4ESHA 1N32B 1NVVQ 3TGWA 3CJQA 5CAEB 1XEFA 1XVLA 4PZ0A 5I7FA 1Z7GA 2WJAA 4FN5A 3TD2A 1F0KA 1MPXA 1ZO8A 3ORRA 4RLFA 3ZI4A 5ED0A 3CVXA 2P6PA 1MVLA 2BC9A 1XQYA 3FVWA 3WIDA 4F7DA 3FPFA 5F2EA 3CX4A 4IV0A 2B34A 3FFBA 3I28A 4RA9B 3FTQA 1Q1BA 1X1RA 2ZR8A 1P6XA 3N07A 4KUEA 5CEFA 2JK0A 5HM6A 3H4MA 4ZO6A 2UZ4A 2X8BA 4Q1FA 2D62A 2MR6A 1QO0A 3EA4A 1AZWA 1R4NA 3FIUA 3FZNA 3HQ4O 2FPGB 4TXJA 3NIFB 4UMEA 5B6JA 4WNCA 3E2IA 4CL8A 4QC2A 1RQ2A 1N0HA 1YFLA 3F97A 1RAEA 4QM7A 3KAPA 3KHTA 4QYIA 1G18A 2P3SA 2ZS7A 3GBSA 2H2DA 2ODPA 4RK1A 2P7HA 2M6SA 1YDMA 3G9UA 4IV5A 3QUTA 1ZOSA 1UR5A 4TN1A 2J0EA 3EZLA 3PX2A 2WQ6A 5EKTA 1QP7A 1FFYA 1C3OB 1I10A 2R25B 1PQYA 4F3RA 4HTFB 3HYSA 4DQKA 4FZVA 1UWVA 8AT1A 3AY7A 4YNBA 4I46A 1Z26A 5LZ7A 1RZRD 3AFHA 4WJZA 3HI6A 4J94A 3QBEA 3VZQA 2WZCA 2GUWA 3LUKA 1S9DA 5AK5A 5LYJF 5JJKA 1Z4MA 1JZTA 3I5YA 3LIPA 5GJWC 2WTUA 1N5MA 5T6MA 3VHQA 4YEDA 5ALVA 5IDQA 4DMMA 2JFHA 1GO2A 4IDPA 4WASA 4C0BA 1Z4QA 1O9GA 1ZP6A 2JS7A 3BGVA 3E70C 1LEHA 3ID6C 4ZT3A 4K7JA 1T1RA 2WK1A 4AUNA 2XGSA 1S01A 2ERYA 4KO4S 4JJKA 5LMUB 2OVFA 4QLAA 4XIYA 4HAIA 4FTWA 4HQOA 1U0RA 1J0XO 4TMVA 5HJ2A 3E9YA 5CK4A 3G89A 3MS2A 2O0HA 3CUKA 1K3FA 3FYUA 3RS0A 4BNYA 5BUCA 1OREA 1ZOLA 2H1LA 1Z4JA 3BHMA 5J2UB 3F3MA 1VHWA 3MC1A 3QV2A 1BCRA 3QLVC 1KK3A 4Q21A 1LX7A 1W8IA 2ISCA 1P29A 1R0XA 2GKGA 3LV8A 4M86A 1RU3A 5E8RA 3UH1A 2W58A 1B8NA 3PA6A 4OP2A 2I29A 4OHCA 1ZD2P 3ZBQA 1WBBA 1ID1A 4MVJH 5G53C 3HNPA 5KPDA 1WVMA 1LFAA 1RYMA 4B3XA 3QRWA 2BOVA 1UODA 1PI3A 1Q22A 3BL5A 3R7LA 2Z30A 4H0NA 2Y1FA 2F67A 1UPTA 1N9ZA 4K28A 5M2QA 5FA8A 1UC4B 4CV2A 3CF0A 5BSGA 2JFZA 1QP8A 2XUFA 2DLDA 5JVDA 4N3BA 2P1ZA 1OJ7A 3ZUPA 3NIBA 4QDKA 2FP4A 3NKVA 1NVDA 4K86A 3TD6A 4F5EA 1G9XA 2RBKA 4X44A 3VVMA 4D3DA 1UMKA 2FKNA 4R84A 2JI9A 1RRCA 1N1DA 5FOSA 4M83A 5KINB 1OAKA 1J09A 4LRSB 2XT6A 3H5IA 2HJSA 3RSSA 4EHAA 5JMWA 3O75A 1RFLA 2H5JA 3DEFA 1ABEA 1R88A 3G0IA 3HCDA 3OETA 4MIOA 4OPMA 5KYXA 2X2OA 1K4YA 1A98A 2XT0A 1K6EA 3BN3A 3VOBA 1RKQA 3QJYA 1ECFA 1OUMA 4RPJA 1ESNA 4E32A 3S8EA 1RXUA 3ILSA 4NSNA 1A2BA 1MB9A 4HQNA 1QIGA 3EDYA 1VMIA 3BFXA 5DP2A 3WQSB 4XYBA 2IEGA 3CF4G 4RXUA 2WVHA 3O8OA 3PIRA 1U3DA 2EFDB 3D6MA 3OP1A 3VAAA 1XLTC 2PGNA 3F7OA 3P0RA 2G82A 2NZUG 4DUGA 4DR7B 1GAWA 4LG1A 5G0VA 1A9XA 1RBZA 3EW9A 2LZ0A 1E1CA 4LDZA 3IH5A 2WR8A 5DIFA 5ILGA 2CHQA 3INTA 5AH0A 5A4DA 5DV9A 3HN2A 3H65A 5JS8A 4PPYA 1E9SA 4TV9A 3L93A 1BC5A 2XSZA 2Z9CA 3CNNA 1IG3A 1G291 4N12A 1VBKA 1PBTA 2QUBA 3IEUA 1CVRA 5FWNA 4ONEA 2C88A 5AKLA 4RJTA 1B1AA 1XRNA 2AOWA 3NBYC 1TAQA 1U3CA 2BIFA 3L84A 5FF9A 5DGDA 2Q6VA 4OI0A 1KYXA 3AFIA 3UXMA 5HA5A 5C5CA 4ABYA 1L4EA 3P5SA 1U0TA 1AHHA 4LWOA 5E4FA 3RBAA 1HE4A 2MWMA 5BOVA 3OI7A 5SY4A 4WBNA 5ICCA 2R7NA 2ZRKA 3T5CA 5A9SB 4WOKA 4X1OA 4D8WA 1AC5A 4JIGA 1UDBA 2PZEA 1KVUA 2V03A 4CPDA 2CLFB 3P2OA 4E5UA 4Z9XA 1MVNA 4C4SA 3EDOA 4EA9A 1EWKA 4TQUS 2J4DA 3HV0A 1ECJA 4IAOA 3OF3A 4KQ9A 4LRQA 3O9ZA 5CMLA 3VKFA 4IS2A 3KSMA 5ILOA 1GAXA 2VSFA 8MHTA 3ZY6A 4G1EB 2ZBGA 3P45A 4PM4A 3I73A 4Z0HO 4ZQBA 3R5XA 1J6UA 3FE2A 4FI3C 3KB6A 3OVMA 1PN3A 2ZE6A 3A6EA 5KTOA 1R00A 4D0NA 2ZQYA 4I4TF 4JASB 1R6DA 2W4MA 3A70A 2HBYA 1J2RA 1KVSA 2JI4A 2VXOA 3E05A 3HCEA 4BAUA 2DJIA 2IEBA 4YMWA 4IWXA 3KZCA 2WU0A 1PFWA 1T0IA 1XRJA 4GMXA 4C3UA 1VECA 3K94A 5LQAA 1RXSA 3NRBA 1E2GA 4C7OB 4QQKA 2WJWA 3IFSA 3QU4A 5KC9A 4X97A 3X0DA 1MP0A 3RE1A 2OR3A 5SYNA 1HV8A 2JATA 4LOKA 3U3RA 1BXRB 5KX5A 2NPIA 1O97D 2JRLA 3T3HA 2BGUA 3WLAA 3GAZA 4FGSA 4EHNA 4M9RA 2R68A 4YAEA 5LZ8A 4A0FA 4GQBA 2D0OB 1WETA 4D6XA 4M9CA 4HNAA 5JASA 1AKMA 1XB2A 2AI1A 4PG8A 5D6NA 1NQOA 2GD6A 1V9SA 4HVAA 2XUAA 4DV4B 4DREA 3CVYA 3TAXA 2D5CA 1ISRA 4RF5A 3M6FA 3ZE7A 3AWDA 3EXG2 3IAS1 4KXNA 2OYRA 4PLFA 5KI6A 2BF7A 4WWHA 3WMWA 1JHDA 5AKXA 1Z2AA 4IUCS 2OV6A 2RJ3A 4YREA 5JALA 1H42A 4TRMA 3DDWA 3PXAA 4BAGA 1Y6ZA 1O77A 1E5XA 3NEPX 4KKVA 2A3RA 4N0EA 3VSAA 4KR7A 4JGBA 1UBNA 1F2VA 3FDIA 4JB3A 5BSWA 5EIFA 3SFZA 5CB6A 1BRTA 4YWJA 3EGXA 2VTBB 5E3HA 4F72A 4FHZA 4FS8A 4B3DA 4BO2A 1DBRA 5FH9A 1C7ZA 1PSDA 1V39A 2C5SA 2JAHA 2QMOA 2EW8A 2B5WA 2D74A 3QFHA 3KQNA 3UZUA 1YRQA 4K88A 4DCUA 1TT5B 5D3KA 2C7PA 4J0HA 1K6XA 4MUNA 2NUPB 2Q7DA 2WKWA 1P3DA 3UJDA 3OX2A 3JVEA 2VT6A 4RZSA 3MG9A 3TMAA 4JITA 4L4SA 3HEMA 5JI3E 3WLKX 1ULBA 4HRVA 3P26A 2YWFA 3GMDA 2PMCA 3KVRA 2OA0A 2F90A 3LZCA 4H3VA 2HYIC 1CD5A 1M8PA 1MG0A 2GBLA 2OUIA 4INOA 4QQ8A 1MJHA 2VWPA 3JQFC 3DT9A 4LISA 3ISJA 4UUMA 3LP5A 4M1QA 3NGXA 2DTXA 3AX6A 5K3OA 3NHWA 3L8DA 3B2EA 1I9CA 4JI0B 3HS3A 4ZAZA 4BVAA 3WAJA 4OXRA 4FQ5A 2RSLA 2X6TA 3A2NA 4OJYA 3U3ZA 3CSSA 5JZ9A 4O1IA 3EAQA 4M8IA 3ZHCA 3R3ZA 1KHTA 1P44A 2OZEA 4QREA 3B12A 4QFMA 4WKGA 5CVEA 3UAZA 4ZCRA 4YRAA 2QUZA 3VXKA 1EQAA 3U3JA 4BMOB 1DO0A 4GGMX 4J03A 3AEUB 4MYCA 4OUDB 4F46A 1ZW6A 2Q0SA 1R64A 2CHFA 3FGOA 3LU1A 3BB3A 2XVMA 4AZ3B 2X4DA 2G7ZA 1NP7A 4JAVC 2O8EB 2BFBA 4PVCA 1XELA 2VKQA 4ND8B 4XH9B 3RRFA 1W9MA 4TRJA 3UUFA 1WZEA 2F8MA 5KO2A 3NDRA 4URHA 4EZEA 4PO9A 4OCZA 4OLFA 4Z4QA 1Z2CA 3V1LA 3B1XA 5DCWA 1K8YB 2BMJA 2G70A 5B55A 4AZVA 2C3UA 4AF6A 5BQOA 3FMPB 3MJEA 1WMBA 3H9UA 2TMKA 3S2IA 2I2AA 4FFMA 4HLNA 3FWHA 3QPAA 3I9OA 4CFSA 4CG3A 4NONA 3CKLA 4QUIA 4X63A 1M6VB 3DDOA 1WXDA 3DHEA 3BK2A 5AW3A 4DV5B 5CPFA 3GJSA 2ECKA 3PUYA 3UJPA 1V6CA 1CUEA 2NWQA 1P5HA 3GWZA 2QQ0A 3KJNA 5J4HA 4AS1A 2ACWA 2XUKA 1G41A 4R2JA 3E3MA 2IK8A 1RCTE 5JOQA 4TTJA 3E23A 2DLNA 4BBJA 4YUAA 4YAFA 2AKEA 1QIMA 2OV4A 1F5NA 1OZHA 1LDGA 4LCBA 3FCEA 2CZQA 1KJIA 3LFHA 4D6PA 1O95A 5DN6D 2OAP1 1FA9A 1UFKA 2YRXA 3I45A 2W6OA 3GP8A 3MXOA 1JFRA 1G8GA 3RVMA 4ND6A 2FETA 2GWHA 4DKXA 4LCJA 2OCIA 3LKDA 3NW9A 4M8LA 3IEXA 4WVLA 4B17A 3ZDAA 1Z2DA 2FHPA 1U3FA 5BORA 2XVZA 5H02A 1U98A 2WINI 3E9DA 4M8SA 5AJZA 3UOGA 4YMLA 1YRAA 2RE8A 1G64A 2ADOA 1O08A 3B78A 2PAFA 4P7GA 1C1DB 2ODTX 1NV8A 1C9YA 3JATB 1OLSB 2GAIA 4OLHA 1I9GA 5IYZA 3LGAA 5H83A 2QZPA 5IBQA 1FSZA 2D0IA 4L72A 3BDIA 4L5AA 5E9AA 4MCJA 3V4VB 2IS6A 1LGYA 2QRQA 2DUJA 3FDXA 3L6BA 5EQFA 1NVEA 2QI9C 1ZKMA 3ELUA 4MW6A 4NIMA 1U65A 2QMUA 1UDXA 3JARA 3I5XA 3DMYA 1VSBA 3HDVA 4WA8A 2EX0A 3MPUA 6REQA 4DA8A 4BMNA 1WG8A 4ERNA 2QMHA 4R2KA 3U0VA 5ALOA 1M74A 1XZEA 1C7IA 2QSJA 2V5UA 2VJQA 5I48A 3LY7A 1T9KA 2NSJA 2OVBA 2FWNA 2VS1A 2CBXA 3IRVA 3OUUA 4IFEA 4X8HA 4E14A 4WOJA 3L4KA 2XXAA 1RXWA 4MDYA 1J5XA 3HYTA 1SULA 1V47A 2PJDA 4D99A 5KOHA 2IYTA 3RAJA 4L27A 1YB4A 2P2ZA 1VGVA 2C5AA 1HL3A 1K1EA 5HUHA 1JLLA 2CB9A 2EFHB 2AUNA 4G0YA 2O6HA 1NUPA 4IILA 1I7LA 1K7YA 5DT2A 1ZCBA 1ZCAA 3B8HA 4WESA 3UV7A 8ADHA 1UMCB 4P7FA 4IP0A 4BLRA 1VI5A 1HZZA 3HACA 4WZAA 5AM5A 1GNVA 3URKA 3ENVA 3L5KA 3Q7TA 4OTZA 3GJYA 1N1EA 2GARA 3H5NA 2IUYA 1TUBA 4AN0A 3EMBA 5JMPA 2JJ2D 2G28A 2IRWA 2H0QA 4ML3A 3ZX5A 2YWDA 3EFOB 5DCYA 4RTOA 1DDOA 2W2KA 3TG2A 1T3SA 4MWGA 1T26A 2QDXA 3JQ8A 2NAPA 3F6BX 3TIVA 1JYEA 3ECAA 1YK0A 2PMBA 3M1AA 4L9WA 1WW2A 3IHKA 3MYRA 3T12A 2WZBA 3WGGA 4XD7A 1DBIA 4KX5A 3DMNA 3GFFA 1YB2A 4BPRA 3KEMA 4EW1A 3RVRA 3P71T 2VAXA 3I5AA 5J5AA 1RWVA 4WCFA 4ROSA 1J0BA 4E33A 3A37A 4PTLA 4NEGA 2G76A 3SIPA 2O20A 4NBUA 4LDQA 3JCZA 3SCZA 1YRLA 4KRYA 4NATA 4Y2HA 4MR7B 3BD7A 1ZJJA 5GONB 1DCTA 4OH7A 1E5LA 5G0TA 2O05A 4LGVA 2PZJA 4NE7A 4AJ9A 1YQTA 2IW1A 2DWQA 3IRUA 5CLJA 2ZS9A 2AKAB 1X3SA 3WLQA 4WFQA 2A6PA 2PSDA 1CUUA 1X1DA 3L92A 4KXMA 4W6QA 2FUKA 2FEMA 2O48X 1KKUA 3ICCA 4Q3KA 4AK9A 3V4OA 4YT8A 1Q3KA 2PZGA 2H9IA 3F5FA 1P1BA 1MABB 1X15A 4DIBA 1YHZA 1DINA 2A1TR 4R6WA 4E13A 3HEAA 3OUTA 4XTRA 3TR6A 3PQ7A 4B71A 5KWIA 3FDZA 1W59A 3PXEA 4XIJA 4U7WA 4OK6A 5FPPA 2DAPA 3HKDB 4TL6A 3TE7A 2J0UB 2K87A 5EXPA 3K0EA 2HADA 3B6EA 2CZGA 3EB9A 5G0WA 5BOSB 4RABA 3VOTA 3ZV5A 3K53A 1NN3A 3STUA 3W06A 3WDLA 4CFZA 5JLJA 4K9MA 1YQGA 1WJGA 2NACA 3BCUA 5DASA 4XLTA 1EB8A 2HMWA 1G7CA 3EZNA 5DU2A 1W0JD 4A91A 5EI5A 4O4JB 2FPOA 3TRHA 3M4JA 2B8TA 4DBVO 2B83A 2EBHX 2XRMA 1ZEMA 2YY6A 4O0MA 1GNLA 1H6DA 1HO3A 1M8FA 3EXIA 4MCHA 4B4WA 2DFPA 2ZTUA 3M9LA 4HX9A 3HFGA 4N8SA 4O59O 1QBGA 4Q00A 2AFHB 2E49A 2EFCB 2W7TA 5JQGB 3II6X 1PSWA 4HSEA 4OA5A 1CR0A 3JWHA 3BE5A 5KYVA 2ZB7A 3AG5A 1YS9A 5ALMA 1P8AA 3MT7A 4BTVA 2HR1A 4KFCA 3BZWA 4IWYA 4HTAA 2X4IA 1XRSB 3Q2KA 3AY6A 3RFUA 5JSZB 3R6DA 2A84A 4F8JA 1FYDA 3O92A 4QGGA 3T5MA 1UT6A 3IDOA 4MDFA 3P32A 1BJRE 1J8QA 2PIAA 2IC5A 1HFKA 3IP7A 2AQ8A 4RM3A 3CUTA 4JC4A 1DG1G 2Y2UA 3MD9A 2OPBA 3JD2A 4IPTA 3RC1A 3UMCA 2GB4A 5A7FA 1Z18A 3R3WA 3MIIA 4AP6A 3UPDA 5J9FA 4F3YA 2ERCA 2D3TA 4L74A 4LGCA 4WY5A 1GQ2A 3FOWA 2NU8B 3OQMA 2A67A 3VPFA 2X5JO 4RWEA 1GPBA 2SNIE 3N2GB 1E18A 4X92A 2JCXA 2WSBA 1WHTB 2I2DA 5DPMA 4PR0A 3OU7A 4UBKA 2WD7A 3A1FA 3QUBA 4YUZA 4R3NA 3GQBB 4C88A 3JQ7B 4ICIA 4L4ZA 2C2WA 3CFYA 1VJ1A 4ITRC 4Q3LA 2QTWB 1ULSA 5ALZA 4HXGA 4W5HA 4X90A 1X13A 1XR3A 4FCTA 1ENPA 2RHTA 4MMYB 4ND2A 4WY8A 2GRJA 3TSZA 1E6LA 1T6XA 5IBRA 3TM4A 4O4LA 5IT4A 5BR1A 5JZSA 3BGSA 1YONA 4IIGA 3GA5A 1E1DA 2P1RA 1HTTA 4U6NA 2W8BB 5LU9A 1PV2A 2WWIA 1WLSA 2G67A 2WA2A 4KYUA 4ZOBA 3E7FA 3UT6A 3X1JA 2CSXA 4MP3A 3HBMA 1XTUA 2EBFX 2FSVA 4PZCA 4S2UA 3FUCA 4BO8A 4HDRA 3RYCB 3TPFA 2G1UA 1M3SA 3D7RA 3FN4A 2QTFA 4LPSA 2PMEA 2JB9A 3NPMA 3G3EA 2AJ8A 3BIXA 2FPLA 3H7AA 4XE5A 1R9GA 1WQ3A 1J8YF 3S2EA 3ZEIA 4FEYA 5ALSA 3CEJA 4HDSA 5AXCA 2XQKA 3HKCA 4KHZA 1RKXA 4TPKA 1F6BA 4G97A 1R4NB 4RNCA 1LH0A 3JQGB 2MYTA 1W4AA 2WABA 1Y1KE 1ZRHA 2H11A 1AT1A 2OOKA 1F48A 2JH8A 2V5AA 1DDGA 2OCPA 4Q34A 1EFVA 3BWBA 4BUCA 1O94A 1IEVA 2A7QA 3IVCA 1RPNA 3AVUA 1M6WA 5IT5A 1MH1A 3A3KA 2X8JB 3VR1A 4EVQA 3GFPA 3HGTA 1KORA 4Z2YA 5FUWA 3DAHA 4ZCLA 4CCWA 4W1RA 2OYCA 4OQ4A 4Q9LA 4IG9A 4JJZA 2B0CA 4M38A 4HDKA 4P5EA 4TUYF 5B12A 3ZVMA 1KZ1A 3PFWO 5BPHA 1NG9A 5IMSA 1T4DA 1T5OA 2D1TA 4D2IA 2HQBA 1SBZA 2GBPA 4YRDA 2VR1A 4OB8A 3H0EA 4KYVA 1DOHA 3KYIB 3M3DA 1NR7A 5J58A 2NP6A 1AS2A 4GSKA 2G5CA 2VP0A 1NPDA 2Y1OA 2GDZA 1QFYA 4ZZ2A 2HW8A 2D2VA 1NOIA 1XALA 3EVNA 3ME5A 4CTKA 1WZUA 2EYQA 2CFCA 2IXEA 3F1LA 3N2NA 3M81A 1DG3A 5I7RA 1DQNA 1Q7RA 2YDYA 1U7DA 2P77A 1K4MA 3I9V6 3O95A 1ADCA 4FP9A 4ID3A 3T38A 3BXHA 4HWGA 4J76A 2JZCA 1DP4A 1N7JA 3HWRA 4HUQA 3NPAA 5DHFA 1KZ6A 1I5EA 5DVZA 5I9SA 1DEHA 3OJFA 3BK7A 3ZDZB 1S3IA 5EOVA 4CJXA 1ESDA 2EQBA 1EXNA 1JZSA 4EW2A 3DLPX 4H6PA 5T64A 3SJAA 4DPMA 3VKVA 5H3CA 5B3JA 3N2EA 2Q9AA 4HF7A 3MTBA 4AD8A 1WO8A 2AOXA 3P27A 1Q7TA 4LOIA 2WM2A 2YXLA 1FYEA 4MW9A 2CLEB 4ENSA 2W2LA 1E0JA 4TT3D 2PXXA 2UXDB 1Q0RA 2DH6A 3OZXA 3PIIA 2VDWA 3SQMA 4Y6GB 5MN6A 1W93A 1A97A 4J0KA 1KQNA 1REQB 1T43A 2HK7A 3S70A 4GZLA 3KBBA 2C58A 3OD1A 5IM5A 2PAAA 3IXMA 1B3RA 5J47A 1Z2NX 4PLHA 2PBLA 3RUIA 1D5WA 3IQHX 3W3AH 2ET6A 4UHDA 5DWQA 3I23A 2GD1O 4G01B 1FMFA 2V96A 2LNDA 4JQSA 3T4EA 1BVRA 2P75A 1FQJA 3EUFA 1X38A 1GA1A 1Q14A 3E9NA 2GZ3A 3NUQA 4MITA 4UBNA 2XGOA 3PIDA 3CUVA 4QWMA 4ZWNA 2BMFA 4R2WA 5C35A 5F5LA 1TEVA 1Q7CA 2J9RA 4E4RA 4G9EA 1E2LA 3N3BC 3EVCA 3T3OA 3REGA 2V7TA 1IXZA 4PG7A 3PF8A 3JRXA 4O1MA 2I6SA 4Z9FA 4B79A 2AG0A 2V59A 4PNEA 1U02A 4J0FA 2P2YA 2VDNB 2X3FA 3PXBA 5FIUA 3T54A 1G8JA 2HHCA 2YNMA 4RD4A 3ZZUA 1QWSA 3E8SA 5CH5A 1XFDA 5JRDS 3O8OB 4GX5A 5JD3A 1FBTA 1FVFA 1H6AA 1R0SA 3D81A 3FRHA 2J31A 3D3WB 3KUKA 3LQRA 4RMHA 3AONB 4C4PA 5I7VA 1A9XB 4ZGGA 4WOBA 4FW8A 5FUYA 1FFDA 3A4NA 3Q3EA 1MJGA 2HC9A 3H2HA 1WUYA 1ZH8A 4AB1A 2R3SA 1ORVA 3ET5A 4CGYA 2X41A 5TJ9A 3DXYA 3MWKA 4DLUA 3R7FA 2GD0A 2NXCA 3GN2A 3KWFA 1X9IA 4LA4A 1CFZA 1WWKA 2WAXA 2X9NA 3RFCA 4R7GA 3NC4A 2HJ9A 4OGLA 2CHGA 2QAGC 3KJFA 2PUFA 2BTEA 1GAJA 4LSWA 2CN1A 4HAXA 3RROA 1D6MA 4RC9A 3AO0B 3IUEA 1KYVA 3D64A 2G88A 4ZO9A 2HM7A 3DWFA 2EG9A 1JEQA 4PBTA 4LHEA 4RL4A 1OYVA 2I6XA 3R5FA 3FKSA 3L7KA 2HDHA 2O1SA 3AKEA 2WIBA 3G6KA 3N39C 3NYQA 4OBBA 4NV3A 3IULA 5MFZA 3ZWBA 2JD0A 1HT1E 3K1YA 3MT0A 3S5JA 1CY8A 1ZG3A 10MHA 2DEUA 3U81A 1KK1A 1L4NA 1DC7A 2FYTA 2JLCA 4H35A 4NVRA 4WY2A 4BNDA 1PZXA 1HQCA 1MV8A 1RYNA 2R1UA 3G02A 2O52A 5LM3A 1SCQA 1ZQ1A 2GZDA 3VTKA 2NUBA 4AO7A 1SVLA 4F9EA 2PBFA 4E15A 2CLDX 2QXTA 4ZOEA 3Q9NA 1RXIA 1Q7GA 1MENA 2BTQA 1KJNA 1WV1A 2FP3A 1WA5A 3QVMA 3NB0A 4CIAA 1XDBA 1B4DA 4JLWA 2MMGA 5F2OA 1TQ6A 1TO6A 1Q0PA 1GRCA 3DMTC 1T6YA 3ESBA 4P3KA 1R0YA 1SUWA 2GPJA 4IGEA 1KAGA 5IBCA 2FEPA 5JT1A 3HCRA 1O95C 2PQMA 1GG5A 1SK9A 3K70D 3O1IC 4RA6B 1VL1A 1DPFA 4TVOA 4BP1A 3UJHA 2CV1A 3E2MA 4GAEA 5I7WA 1L6RA 4GX0A 1ECLA 5F4BA 1ESZA 3GRZA 5EHXA 3C7AA 1E7MA 3DEKA 2VAVA 1OWOA 2A9PA 4HNAB 4XR4A 4XJTA 4JKIA 1F1JA 3S7ZA 4R0MA 3CEAA 3LDFA 2VP3A 4QLOA 1WZNA 1ZVJA 1AIPA 1N5JA 3DUFB 1UIMA 2FZ4A 1KS2A 4UU1A 4DY6A 1QCCA 3OZRA 4X93A 2V6JA 3NASA 3P9RA 4JSRA 4DM3A 3X3HA 2OBLA 4WZAE 2Q46A 4HAZA 1D0VA 1NMSA 1X7WA 2P5UA 2VIIA 2ZSHA 1X39A 2AZMA 2FMFA 3BIWA 5KKCA 4MQBA 5LKAA 3OPYI 3PQCA 4GUDA 4EMSA 2PUHA 4C5AA 5CEJA 1ZN8A 2DHEA 2PGDA 1LVHA 2X0KA 3AH8A 4GO1A 5BYAA 4L85A 4CM6A 1JAZA 2H51A 2WM3A 4WXYB 5I7AA 2QD2A 3SZGA 1KH2A 4WI1A 2Y1WA 1GT91 5K8LA 4ZPXA 3VZRA 3SVTA 5JNLA 2ENWA 3SPXA 4KIWA 1GQRA 2J0SA 1WZCA 3O4IA 3D3KA 3JQDA 3T9EA 3WRYC 3VZSA 1GNQA 4YRTA 1E7RA 1Y9DA 3BULA 1QSGA 4L08A 2FLVA 1GNSA 3QNWA 1C8VB 2W4QA 1WB4A 1ODCA 1RQ7A 2O8NA 3IOBA 1A8IA 4R1PA 1P19A 3P2MA 4OFZA 1Q50A 2H2WA 4DARA 2R6JA 3A7EA 5KQMA 2PBZA 3TPCA 4IIXA 5EE9A 5KSWB 4GC9A 1YVUA 4P0PB 1UQTA 4RKWA 521PA 1NBIA 2PU7A 2FNAA 1G7RA 3DF7A 3HJTA 3TD9A 5B58T 3DULA 3IA2A 2RHBA 4YCSA 1U0NA 1TMOA 2QV0A 1XN4A 4QBFA 5HWSA 3ZD9A 1ZCZA 4R31A 1ZNXA 2QRJA 4ZYXA 3U6KA 2XDWA 2IYRA 4RHCA 4IEIA 3B48A 2FQQA 4B1FA 4DG8A 5G1PA 5CVDA 4W99A 4BRUA 1IIRA 1YJCA 1DEAA 1IJEA 3CW9A 1X42A 3DOHA 1VMDA 1M5TA 2BEVA 3PXDA 4MGIR 2JANA 4EG3A 2XHZA 1GU7A 1I7PA 2QAGB 3BXOA 2IFTA 1QIIA 4Z9BA 4F6LA 3ECCA 3QY0A 1I8TA 3A1DA 2QHXA 1UUFA 1M0WA 2F4VB 4ZAFA 3UO8B 4LQLA 1R9JA 3BMCB 2PT9A 3WOHA 1BE8A 3K72B 4QGFA 4GDFA 3UCEA 3SMVA 1ANKA 1Y5LA 2X0EA 3IR7A 3EIFA 3KQOA 4EY6A 5AJHA 1Q0ZA 4OLBA 2QPTA 4OMUA 5CD9A 1X1EA 2O6LA 1J9GA 2P6MA 3ANLA 1BXKA 1N8NA 2X5XA 1T3HA 5NULA 2RGNA 3SDBA 1CULC 1JKJB 1NF2A 3GJ3A 1U8ZA 2QVBA 3KJEA 3PGVA 2WOOA 4Y9TA 5AK4A 3L8GA 4BQPA 1EIZA 1J33A 4KQIA 4EGSA 3AOEA 5EXSA 3CRW1 3TNDA 3WOVA 5H70A 5ED4A 3PHLA 4F38A 2CC2A 1PKXA 1RCUA 1IZZA 3EIXA 4Y3UA 1ENZA 4YJKA 5IKEA 1D04A 4X1KA 3DMHA 2J7PA 4MEAA 3A4LA 1VJ5A 4KZKA 2YZ7A 3EEBA 3SI7A 1CQIB 1XEXA 4C5BA 3R9XA 1ULUA 1G38A 4M0MA 2B82A 4WZBE 1GADO 1OAOA 2QJWA 1ZK2A 2W2QA 4L8WB 1TQ2A 4QFDA 4QUDA 2XTNA 3U1BA 1KYQA 1R5OA 4HRXA 4IV8A 4P4LA 4RMGA 5EJFA 1H0SA 3SK0A 3PDJA 3EBPA 2QLFA 4PIMA 1EP3B 2SKDA 5DX1A 2PUCA 2CDNA 1JWLA 1UJMA 3F3YA 5EFOA 5K09A 1RKUA 3C6XA 4KOAA 4REQA 2FCRA 2JFVA 4Y2RA 2E4XA 1ISFA 4IJUA 3EGVA 2RGEA 4L4XA 3OF2A 1SHUX 2ZRGA 2FH5B 2W71A 3RRXA 3TNYA 1KYIA 3T5AA 3THOA 4Q7QA 2BT4A 1YNOA 2FEAA 3EZGA 2DWPA 1BEZA 1JPJA 2MSLA 2FG5A 4HAUA 3PWTA 4FBLA 2PD4A 3OLQA 1PWEA 2FRXA 3LKVA 4YJGA 5BNFA 2JZOA 2ZWOA 3JALA 4JJAA 3BHJA 5E3IA 3SVZA 5J3JA 1OGYA 3IKTA 4MX8A 4XB2A 2EJTA 5J2TF 3V55A 1HG0A 2CSUA 1FXSA 1GN8A 2LIVA 4FEAA 1N78A 3C98A 5I5EA 3OO0A 2J3MA 1IBSA 5AI5A 4MVXA 3GCDA 3QU7A 4FOTA 5A5EA 3PHIA 2XE8A 3U62A 3JTEA 4LC0A 4MV5A 4D9NA 4JC5A 4QEDA 4FYJA 4LI0A 1HFWA 2C94A 6REQB 3ZHUA 2RGXA 1UAYA 1NRXA 1TEZA 3ASYA 3LK6A 4LDAA 5F7ZA 5H9WA 3LLSA 1A9TA 2BGLA 5SICE 5L3VA 2GHIA 5IW8A 5DM1A 4DR4B 1CDOA 1XTTA 4BLOA 1P9RA 2Z8XA 3PC4A 4BZXA 2D5LA 4NI5A 1SUBA 4JOBA 5EEGA 3ROXA 2XXAB 3L8ZA 3MF4A 1LF0A 2FV8A 1DJPA 1UBCA 1XWFA 2HF9A 3JQBC 4QOIA 1YRYE 3TJRA 5B1HA 1YIDA 5LJLA 1TCUA 1ZS9A 3C6ZA 5CLLA 2HRZA 3HKEA 4UFPA 1D4OA 1ZJ4A 2J1LA 1EFCA 3OUZA 5D1HA 4X64B 5JAUA 1EX1A 1SVMA 4OSEA 4B4DA 4KEAA 1P0FA 2C8LA 2ZW9A 3LO8A 1DOZA 1DWOA 4QELA 3G9QA 5H3LA 3U4QA 1OT5A 3O31A 3NBAA 4GOKA 2XB4A 4LYAA 4HDCA 2WJHA 3DNMA 4C7VA 2DSNA 4GXTA 4AJLA 4ETMA 3REQA 2W4IA 2NTEA 4R6XA 5CDFA 1TUBB 3NWEA 4KLRA 4Q82A 1THTA 4UD2A 1QQTA 4R98A 3VNAA 4EB0A 4MR9A 3OZIA 1I13A 1S1MA 2WTBA 5EHQA 2JIRA 4LF6B 3S6JA 2BD0A 4ZMRA 1GXSB 2W2KB 3LXRA 2F43B 2ZM5A 5EYPB 2B4TO 1A2OA 3B9QA 2TS1A 4E70A 3GGDA 2ZBVA 4D57A 4DADA 4JWTA 2GETA 5D3QA 5K0JA 4QARA 4EZBA 4ND7A 1T9CA 5CB4A 1PGPA 3JWGA 5AJXA 5DLDA 3EZFA 3I34X 1QK3A 2Z3ZA 3N6VA 4AJPA 3VR3A 4I55F 1LWNA 2VPXA 4RCVA 1NJ2A 2IL1A 3AHDA 3OCZA 4WCFB 4D0SA 1VIDA 1GD1O 2JAWA 4BCDA 5J2UF 3VJMA 1GGEA 4J3JA 3W7VA 1R3DA 3AILA 4W5QA 1CQJA 3TSAA 3UIEA 3N0WA 3B1YA 3HVHA 1QIFA 4IMIB 4U0JA 2VJKA 5D5QA 1GTSA 3EXFB 2IBTA 2YKGA 1VIVA 2IPOA 2VJYA 3VMMA 5KQGA