1MA3A

Structure of a sir2 enzyme bound to an acetylated p53 peptide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
242
Chain Sequence
MEDEIRKAAEILAKSKHAVVFTGAGISAEGLWRKYDPEEVASISGFKRNPRAFWEFSMEMKDKLFAEPNPAHYAIAELERMGIVKAVITQNIDMLHQRAGSRRVLELHGSMDKLDCLDCHETYDWSEFVEDFNKGEIPRCRKCGSYYVKPRVVLFGEPLPQRTLFEAIEEAKHCDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVNAEPTMADPIFDVKIIGKAGEVLPKIVEEVKRLRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein, Sir2 family
publication title Structure of a Sir2 enzyme bound to an acetylated p53 peptide
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding, transcription
total genus 84
structure length 242
sequence length 252
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1ma3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ma3A01
3EYAA 2JI8A 4KXQA 1S7GA 2FSVC 3ZG6A 4C7BA 2EZ4A 5EJ5A 1OZHA 3CLSD 5D7NA 3OE1A 2EZUA 5AHKA 3U3DA 2PGNA 1YHZA 4MQ5A 1PNQA 5EJ7A 4FVTA 3IAFA 2Q28A 5FEMA 3JR3A 4K9PA 4K9LA 3EA4A 1UPCA 4FEGA 4COKA 3CF4G 2A1TR 3CLUD 1M2JA 2IHVA 4KGDA 1YHYA 1M2KA 3RIYA 3FLMA 1ICIA 1QPBA 2IHUA 3GLTA 4X3OA 5MGNA 4I5IA 1V5FA 3ZGOA 4RMHA 2H4JA 2VBGA 2H2HA 1Q14A 4FEEA 1U28C 2AG1A 5DGTA 1MCZA 3RIGA 1Y9DA 1SZCA 4IG9A 1Z8NA 4UTZA 3HWWA 1U31A 1NM5C 2HJHA 2PANA 1PO7A 1POXA 3HWX1 2WVAA 5BWNA 4TWIA 1D4OA 2FR8C 4V1CA 4HD8A 2OD7A 1ZPDA 1PT9A 2B4YA 1YNOA 2WVGA 4MPPA 4RJIA 4UU7A 1YC5A 2OO5C 1DJLA 2VK8A 1T9DA 4RMJA 5EJ6A 1M2NA 4F56A 3PKJA 2EZ9A 5IMSA 5K6TA 1M2HA 4RJKA 4X3PA 4ZZIA 1V5EA 4JT9A 1PTJC 3CLTD 4JU8A 5DGDA 4UTXA 2IHTA 2H2DA 3U31A 1T9BA 3D7KA 4Y6LA 3F6BX 5EJAA 1PNOA 4UTRA 2EZ8A 1XLTC 3PDHA 5EJ4A 1N0HA 1YC2A 5EJMA 5BWOA 2JIBA 5DEIA 1SZDA 2BRUC 1S5PA 4K9NA 2QQFA 4GM4A 4MZXA 1HZZC 1U2DC 2H2IA 2VJYA 4IF6A 5FYQA 4G1CA 2C31A 4UU8A 4BV2A 1Q17A 2H59A 1T9AA 4UTVA 4D5EA 3IAEA 2V3WA 4UUBA 4UTNA 4JUBA 4Q9DA 5MFZA 5EJ8A 4KPUA 2H4HA 1OZFA 3JWPA 4R8MA 3ZGVA 4IAOA 2FRDC 4HDAA 3GLUA 4UUAA 2FN3A 4TWJA 2EZTA 2A1UA 1OVMA 4L3OA 1PVDA 1U2GC 4QQ8A 5MF6A 4C78A 2Q29A 4QELA 3D81A 2QQGA 5BWLA 2AG0A 2JI7A 4K9MA 5K3SA 1PYDA 1YTLA 3LQ1A 4GG1A 2Q5JA 4K9OA 2UZ1B 4BVBA 4V1CI 3FSJX 4GM0A 2VBIA 1POWA 1YI0A 1YI1A 5MFPA 3PKIA 1O96B 3GLSA 2JLCA 1MA3A 3D4BA 4GM1A 4JUFA 2OD2A 1J8FA 4GP9A 1UPBA 2Q5OA 1JSCA 1Q1AA 4RMIA 2X7JA 4JD5A 4D5GA 2W93A 2H2FA 4Y6QA 1E3TA 1EFPA 1EFVA 5EJ9A 2H2GA 2WVHA 1BFDA 2VK1A 4J1TC 2Q5QA 4F4UA 2FWNA 4ZP1A 1T9CA 3EY9A 1M2GA 3E9YA 4RMGA 4BVGA 4V1CB 3K35A 2JI6A 1O97D 2OORC 5K6RA 4GPEA 4BVHA 2H4FA 2JLAA 2UZ1A 4BN4A 4BVEA 4JUAA 4BUZA 2Q27A 4K9QA 5K2OA 2OD9A 4JT8A 4Y6OA 4MPRA 3F6EX 1PI3A 1YBHA 4FZ3A 4L2IA 1V5GA 1UPAA 3FZNA 2NXWA 1Q6ZA 2DJIA 2PGOA 2VBFA 3GLRA 4QPZA 2NYRA 4JU9A 4J16C 1OZGA 4RJJA 4JSRA 4BN5A 4BV3A 4BVFA 4JUCA 2VK4A 4K9KA 3CLRD 2JI9A 4O8ZA 4JUDX 4MPJA 2Q5LA
chains in the Genus database with same CATH superfamily
2R25B 3HA5A 3CW9A 3WGIA 2OM6A 4LHSA 3OQVA 4TYMA 2JI8A 2XKJE 3WSTA 1P2VA 2BTOA 5EYPA 2CL0X 3UV6A 5FBRB 5C4MA 4RF3A 1HH4A 2YRXA 3R0IA 2OQVA 2NVUB 3S1AB 5KTPA 5AVZA 1JXOA 2BI4A 5I9SA 1YA6A 2HC9A 1TD1A 3N7AA 1NQWA 1DC5A 3FFWA 1G8JA 1LPBB 2SECE 3GEMA 4P4SB 3C1UA 4RLHA 1IEVA 4UFNA 3JYLA 4YO7A 1FL9A 2EAUA 4GD3Q 2P2CA 4IZ6A 4UBLA 5H82A 5BSTA 4E5UA 4UEOA 4CKCB 1DP4A 3KVNA 4AJNA 1WM1A 1JLLA 4KYVA 4P4LA 2QT9A 1TMYA 5CCEA 4KWHA 3A26A 2AW5A 1SIBE 2GBFA 1RYNA 2EGGA 5AVUA 1X8JA 1BCSB 4DQLA 4MS1A 4K9RA 5IH3A 4IRXA 2Q1XA 4EY4A 3A6PC 1FXWA 3DO5A 4XRRA 2RB4A 3ADCA 3MLAA 4XCVA 4CMBA 1FB5A 2WNHA 4LC0A 4E1BA 2ZFUA 3BCHA 1V1RB 5IKMA 4EYSA 4PHTA 4OQEA 4PYNA 5IM4A 2L42A 3SWWA 4CKZA 4OHKA 3MFQA 1KL7A 5IXJA 2OMKA 5CB4B 1VBKA 4QJIA 1EGHA 5D7BA 1GFIA 2IEZA 1Q0QA 2VAWA 2VSXA 2JJYA 3MIIA 4AJ1A 4JUIA 4PICA 3FB1A 2OZEA 1UPCA 1Q1EA 1GNRA 4TWZA 2Q9BA 5BN4A 3WQQA 4KQ9A 1ZMXA 4XQ9A 3DEKA 4EJSA 3LIPA 4F3CA 3KYBA 3DEAA 8GPBA 3BWYA 1X13A 4WESA 1KH2A 4FOSA 3S44A 1U5BA 1QKKA 4MUKA 2OFPA 5HS6A 3HBFA 1W36B 4FP9A 5EMJA 3G0OA 4NIMA 5CG1A 3GLGA 2UYGA 3WICA 2HA0A 3ZWDA 5EZSA 1HG0A 3DSRA 1WRBA 3MG9A 5AJXA 1TJPB 2O54A 2BFBB 3EXEB 4PZDA 4JR2A 4WOKA 1Z06A 2G71A 3FBTA 1P7PA 5EHGA 3GJ8A 4DN6A 4AY4A 1QNFA 2C1EA 5HQJA 4BC1A 4AQ7A 2CMKA 4UCFA 4TS4A 1XF9A 4G41A 4TL9A 3HB7A 3PQDA 2HXYA 3GLFA 3HZRA 2J9XB 4QUKA 5LQNA 5B3AA 1JG4A 4ZQBA 2CCKA 4D26A 4PZPA 1BN7A 2E37A 3ZGOA 2HIAA 3OTHA 4Z4IA 2AK3A 5AYVA 2YIMA 1GXSB 1IRIA 1MV5A 5DHUA 1RPAA 1EWRA 1OREA 1YI8A 2QMQA 1FFDA 2QXUA 3DDNA 5DGIA 1FJXA 1ZG3A 4WLFA 1YZGA 5K0CA 1RE1A 3CUSA 1J9GA 1G6OA 5ANRB 2CDRA 4O0LA 2R97A 4GLLA 3TEJA 4JYAB 3WNVA 4H7JA 1Z8NA 3HGMA 4IYRA 2PHZA 1Z6QA 3NTVA 1II0A 4FFBA 1V3TA 1MEEA 2B3TA 2PBLA 3ZGXA 1LVGA 2QEQA 4R2IA 1FNBA 1Z7WA 5FWAA 3COJA 1PQYA 3JATA 4YA6A 1SUWA 1TKRA 3BKWA 1DPFA 1F6WA 2GXAA 4I36A 1LH0A 3LUDA 3KPWA 4NK4A 5F7ZA 3WXBA 5EKDA 1ESMA 4C0WA 4QJBA 1HXHA 1RPJA 2P75A 3E3NA 3FMIA 4PC3A 4QODA 1M1NB 4U2FA 3W4IA 5A3JA 4J0CA 2YDYA 3UJNA 3SIPA 3BBPA 4TYYA 1P2DA 3IODA 2GX6A 3IO3A 5SZJA 1D1QA 1O0SA 2OD7A 2CNKA 3DBLB 2BTQA 1EFPB 4QT4A 3VYSB 4HUQB 2P40A 2P35A 4YV0A 2FFBA 2R1VA 1JFLA 2XUKA 3B2EA 3KJHA 4FYVA 5JLAA 2GK3A 3K72B 3STHA 4E5MA 5C51B 1R6DA 1HTTA 1YC5A 2C78A 2OO5C 4F2GA 2EIHA 2UUAB 2BD0A 2QTRA 1K7SN 2EKZA 4TXLA 4RKRA 2XZPA 4R05A 3AKCA 5BVGB 3UMMA 3V46A 4IF4A 2CNWD 3NRBA 3IC5A 3LO8A 4LJ4A 2WV7A 1ULBA 2VJQA 5IFLA 1K75A 4JYPA 3E27A 3R5FA 5JJKA 1XJ0A 2H5EA 3DEJA 1M6VA 3P2YA 2YZKA 1OTHA 1SUDA 4LZNA 3WKEA 4C2BA 1WDTA 2IXTA 2O8VA 3LUCA 3OEYA 4K9DA 3F5FA 1ISRA 4XEHA 2Y4OA 1A2QA 4HRVA 1GU7A 3A70A 5TNXA 1ZNWA 4CEJB 5B6PA 3HCFA 4MP3A 4N82A 3RRJA 4BO0A 3ETCA 3UO8B 3I6IA 4NEGA 3WZ2A 4BNVA 1N2EA 1R9NA 1TF5A 2AFHE 2Q2VA 2YS6A 3DOOA 1ECLA 2FEOA 4Z0NA 3JYNA 1JIJA 3NRJA 2WPNA 1WO8A 3CNEA 4ZGGA 3AM1A 5DM60 4FMBB 2BR3A 4D4JA 1R88A 4WNIA 2P7HA 3JQ7A 3P5BA 3MXTA 1ZJJA 4DNPA 3E9NA 5BP7A 4O08A 4P98A 4BNDB 3IP3A 5JDCC 4ME6A 2CXQA 5FBZA 3VSCA 4QAJA 3UPDA 5H59A 3QNMA 3HXMA 3VJKA 1GCUA 1MX5A 4EFDA 1RM4A 4ZAZA 5TEVA 3RSSA 3RAEC 1YU6A 3KE8A 3GUHA 4S0ZA 2X2PA 2O8FB 3T7KA 1EDOA 3SJZA 2EF0A 3N2NA 4O4IB 2NZJA 1JAXA 5EJAA 5AJWA 2IDKA 2QLBA 5CLQA 1UODA 4BEJA 4MB0A 2ECFA 4LN1A 2PD6A 4OBEA 4Q18A 4XR4A 4DV1B 1AGPA 2AYXA 3NXKA 2QW0X 4N4AA 3GWZA 3WWCA 4ZICA 1FTNA 1P91A 1Q11A 1Z26A 3DAHA 3IHWA 4N8EA 3V8QA 4BO6A 4ID9A 3PRJA 5EJ4A 1NXQA 5ULLA 5A03A 3LRPA 1E1RD 2CNOA 4PFQA 4TRRA 4UM8B 3M5WA 1EHIA 1ZVVA 2PH5A 2Y1XA 3M6MD 1VYVA 3FRJA 2WJVA 2Y66A 4LAFA 4A8JB 4F5WA 5K0ZA 5FYDA 2G9RA 3E2PA 5EMMA 3JAWA 4YP1A 1NTRA 2ZETA 2Z2KA 2R6ZA 1XWFA 1G6Q1 2ID8A 2PQ6A 1G1AA 1CUEA 1Y6ZA 3OU2A 4PX2A 1CJVC 3L01A 5JJLA 3CLSC 4H4CA 3ZHZA 4C1BA 4TWAA 3EEBA 3PGA1 5DJ5A 4MI9A 2ZBEA 4CMAA 1O5IA 4WY8A 3NLLA 3PT9A 3O4VA 4U2KA 2C20A 1GM5A 1CUUA 5BSFA 1N36B 1J99A 3MF4A 2PTGA 4OQFA 4DCPA 4DJFC 3L8ZA 2WEKA 3RC2A 4NY1A 1BS2A 2IYTA 3AI1A 3ZJ4A 1JQBA 621PA 4X5OA 3L8YA 4E11A 5JXHA 1OBCA 3DTYA 2ACVA 1Q17A 1H93A 1T9AA 2H63A 4OQLA 1CTQA 1XRJA 4XIYA 1KJ9A 3WO1A 4BCBA 2DFNA 5HRAA 3TUJC 5LWHA 4OPMA 3A28A 1TO2E 2W2TA 1LBQA 1B23P 2YJGA 5FWDA 4MJ7A 2IK8A 2YWEA 1ODFA 3DAGA 3E22B 4DGQA 2SKDA 5HKBA 4Z4EA 5BQ5A 4JEIA 3HJHA 4O3FA 1X86B 3OFSA 4A6PA 4WLOA 4LOIA 1E2FA 3R7LA 2AYZA 3TE7A 4A8HA 2AFVA 1J0AA 2NU9A 3S27A 1GKKA 4R98A 1VYHA 3EPPA 3U7IA 4C0BA 3VH4A 1QU2A 1VE9A 1OZFA 2CMDA 2QP3A 3KU4A 2DE0X 3LV8A 3RU7A 1R0KA 2ZTMA 1BXGB 1YCFA 4AK9A 3UMRA 3EVGA 1K5GA 4Y2QA 4MJLA 1IZ7A 2FPMA 4HDAA 4BQEA 2BI8A 2BKVA 1EUDB 3CCBA 3EE6A 4GOLD 4WZAE 3QBVA 3TOVA 4P0TA 2RGYA 4MQFB 1FJHA 2EBUA 3QQ5A 4AF6A 2VDWB 3NHSA 1AA9A 2PAAA 1TU4A 2ACKA 3OURA 1VHTA 4PX5A 4B7CA 2Q6OA 2CVOA 4C03A 3NP7A 2VT3A 3QPUA 4ER5A 3PSAA 3TECE 1OHHA 2VL7A 3WE7A 2QM3A 1ND5A 4K46A 5H7XA 4U3JB 1ZMBA 4G5OA 1VI6A 3KFVA 2J9FB 2MYPA 2WT8A 5TPZA 1E3EA 2HSJA 4O4JB 3HP7A 1YAHA 5MF6A 2G1JA 2HU5A 1IAVA 4QOIA 3VHXB 4JP8A 2R47A 3IIIA 1L7NA 3S3TA 5BNWA 2VTKA 3TMAA 3V2HA 1UIMA 4YBRA 4A03A 1DUVG 2HEIA 2ES4A 4PO8A 4KWTA 1NAIA 4TN5A 4GOJA 3RQIA 1Y6QA 3RHSA 5JADA 4HXEB 5TE9A 1HQYE 5DNYB 4D8TA 2X2OA 1E99A 3HDHA 5BT8A 8OHMA 2PX0A 1YB5A 1ELOA 3PPVA 2QIOA 3C5VA 3QUCA 3Q9LA 2HF7A 1WLYA 3AINA 3SICE 5I4BA 4CXMA 1JB9A 1SM4A 4HYYA 5HFJA 1SPBS 1HSZA 1IC6A 2O2JA 5EXSA 2WIJA 4BVBA 1P29A 2NZUG 4CG0A 1N2XA 2VBIA 3NFRA 2V7QD 4L95C 2FMUA 2NV0A 2OCYC 5DGXA 3U0BA 4UCQA 2FRVA 1IONA 1XBTA 4UE6A 2R2GA 1MA3A 1UXJA 3HLKA 5I9BA 1XTQA 4REMA 3ZKWA 4BX3A 3ER6A 3LPAA 4NYMQ 5KQSA 4UBNA 4ZQGA 3RS9A 3GARA 2C7PA 3DG9A 1Y1SA 1ZSNA 3IVXA 3L0PA 2QVGA 2J8ZA 3NBXX 2A8YA 3CLKA 2V9PA 3AEXA 3KZMA 1FNNA 4ZV4A 3ZVNA 4IQ4A 3H8JA 5KTNA 4V0RA 4JKIA 4XWAA 4EW2A 2BZSA 5I48A 1SQSA 5DYGA 1LLCA 3I34X 4BQNA 3HA2A 1U7UA 4CM8B 5FAKA 2BBSA 2G80A 2PK3A 4Y1GA 2CFRA 3OFND 3Q3HA 3TVTA 1VCOA 1R0XA 3KSDO 1AB5A 2LCIA 4IVRA 3TLKA 1U0HC 4KN5A 4CIWA 2AOUB 2F43A 1XA4A 4RWEA 5CH8A 3VR5D 2HYDA 3T1YB 2P11A 1E6WA 2D1TA 1E3TA 2C9MA 2IDJA 1VLHA 3D6NB 1RXUA 3TSCA 4AKGA 2QQ0A 5A3SA 4DL9A 3TZLA 2JA2A 1XGKA 4RKEA 3LJKA 3OZUA 5LBUA 3R0XA 5EIAA 4B43A 3EY9A 3FUCA 2PUFA 2IS6A 3QKRB 4KX3A 1MT0A 4B2YA 3AB8A 3N6VA 2E48A 4NWIA 4J0IA 1DS6A 2CHEA 3H8SA 1JW9B 4RTQA 1TO6A 1RWWA 4JVNA 5BYKA 3MS7A 4ENUA 1E5VA 1OIWA 2IT1A 1SELA 2RHRA 5REQA 4TMZA 1WZNA 3KSUA 5EC8A 1T5BA 4QYIB 4E94A 1KU0A 1FLDA 3GFOA 4GPZA 1XYGA 5JEDA 3OOSA 2NUAB 2FETA 1T8UA 4XUCA 5CVCA 3EFHA 1EDZA 4JCCA 4NE7A 4B6OA 1RAAA 5B58C 1UXOA 2AA3A 3PK0A 4JCOA 5AW9A 2HCBA 2BGJA 3VV3A 2IFTA 4RCVA 4KP7A 4GMFA 1Z5ZA 1XQYA 3N5CA 3KT8A 3VNAA 5DLDA 4GGMX 1CUJA 1ZC4A 3IERA 3ETDA 4XSGA 3RIMA 2YKGA 1RLUA 1MC1A 1SXJB 3DUWA 4NZOA 5TMEA 4Z49A 1FFHA 4DADA 4IR7A 3KJXA 4EO7A 5JY1A 2O8CA 2HCFA 3AJAA 1BNCA 3ADOA 3WRYC 3AUXA 1UBKS 3SAJA 1VL1A 5CCBA 4QTUB 5J5AA 1EUYA 2M98A 3FFTA 4Y9DA 5KYVA 2EW8A 1I94B 3CLUC 1H6DA 2OHXA 2PA3A 1KIMA 4RUKA 1TJYA 3KWFA 3TD2A 5DLEA 1F7VA 3SPXA 3EG9B 4YUAA 2ZJ0A 1AS0A 1HLPA 3GDFA 4Z0PA 1HY3A 3T5DA 5HJ7A 4PR3A 3P97A 4HSEA 3QRWA 4GPBA 1EINA 4P3YA 1M74A 2KBFA 3KOYA 1JX6A 1T36A 4Q9LA 3V97A 4FCWA 2RGXA 5HTOA 4KGXA 3WMXA 5ALNA 1QNLA 5ENVA 2SKEA 4DNOA 2I2FA 3IQWA 4KNYA 4L8VA 3G1WA 2FVXA 5CU7A 2QMHA 1XD8A 2GDJA 4NYIR 1XF1A 4KFSA 4L07A 3JQQA 1V45E 3ZZ0A 4RH3A 4DG8A 2J3QA 4BN5A 1QFMA 2R85A 2VSYA 3P9QA 5KVSA 1YDFA 3CHYA 1XTTA 2W6ZA 3H18A 4N5IX 1X1BA 3PJDA 4OXIA 5M04A 3IJ5A 1A9XA 3OQIB 1XLTA 1GG5A 3ZCVA 5LQUA 5AW2A 1L5MA 4LYAA 4C0JA 1LPOA 1RJ9A 2GBLC 2C5BA 2I1LA 3EH2A 3JVEA 4ETNA 3PICA 3I42A 1H8ED 3M49A 3UXYA 4UMEA 4WHMA 2EG5A 4H0NA 3ZE0B 3SS9X 2UUBB 4FPXA 1WOYA 3K1AA 1R00A 2CXUA 2DHQA 2QMEA 3R6GA 4OV6B 1N75A 1VFPA 4O2RA 5C8YF 4I6JA 4MLPA 2HGZA 4GI5A 2FHPA 2Q5IA 3BTSA 4YALA 4I0WB 4ZMSA 4N7BA 1YFLA 4W6QA 1ZZEA 4OHCA 4I4IA 2XAAA 3O3MB 2XDQB 5GVSA 2JZNA 4BP1A 4DQ0A 1SJ9A 2YVQA 5EJ5A 4GRDA 4DXHA 4Q24A 3DBOB 3NHLA 2V59A 1MDBA 5DASA 4CTOA 2Z9CA 4P33A 5TC4A 4GGOA 3HRKA 3QOYA 3H7IA 2XCSB 2E49A 1U7OA 3ERCA 3IRUA 3FCSB 2R6CA 3CNBA 3I04M 3P96A 2HQOA 4IIBA 4M2LA 3TCXB 3JVVA 3E58A 5CA0F 1NW7A 3C7KA 1FDVA 4QIHA 4Z86A 4YP6A 3HKBB 1AKQA 1ZUWA 1I5RA 1MQ8B 2ZZNA 4M8SA 1JEEA 4MQ5A 2D1QA 4C06A 3OPXA 4HDCA 2ZIFA 4TOIA 3MJFA 3PX2A 3PT5A 3T7EA 3TBFA 1MF7A 4ZO7A 3M33A 3GIDA 1VHQA 4PXSA 3VZPA 4HWKA 1YHNA 5DCWA 5J5CA 1E59A 3CCCA 4B71A 1Z7GA 3QBEA 4C14A 3B82A 2BHNA 3R40A 5B57C 5AVVA 3RRXA 1G9SA 2GH1A 4IVNA 2OV4A 4DV6B 3P9KA 4E32A 2H9IA 3VFDA 2QJTA 2BCGY 2UZIR 3TDMA 3F3YA 4R6WA 1FSPA 1JH9A 3PWSA 4S2UA 3N9IA 4FEGA 1RTKA 1WPRA 3ZD6A 2KLBA 2EATA 2HADA 3HKEB 3JARA 3OEHD 3KIPA 4QLOA 5AKEA 5EWLA 4RQTA 2HXSA 1C8BA 2X42A 1E2DA 1XZAA 3L1KA 3H3XA 5CYPA 3RQSA 2PY6A 4OHWA 2IVZA 2GF9A 2IYSA 3UAVA 2KMLA 1AB6A 1EM8A 2DFDA 2I80A 5JVDF 2M6SA 5JISA 1ZXXA 2F7SA 2OV6A 1PJBA 2QX9A 2C54A 3FPFA 4JZYA 3RS0A 4BZZA 5LQRA 2F55A 4YO8A 5DK4A 1QPBA 1T4CA 2DWUA 1A5TA 1PL8A 3OCVA 4YJ2B 5DXJA 3ZCXA 3U4MA 3ONNA 1LQTA 4ZD6A 4S12A 1J39A 3ZU4A 1EVIA 1FYEA 4F85A 4Z0TA 4ZVMA 1TZBA 1WUJS 4MR7A 4LOLA 1N77A 1QPZA 3P8ZA 4OP3A 1W0KA 5HZMA 1ZI6A 4CN8A 4QBFA 3VXKA 1GLNA 3EAQA 3T61A 2CJPA 2EX0A 4PU0A 5SY9A 5KTSA 3BFXA 1MW8X 3UB4A 4ZJUA 5LNK6 3K9NA 4AO6A 3DS8A 1SUFA 5LD2C 2OK7A 3DC7A 3W34A 5IANA 5ICEA 1A9SA 3G0BA 3HN2A 2Q45A 4K8RB 3T7SA 3IOCA 4O2BA 5DTQA 5ADVA 5HS4A 4B74A 3NO4A 1M83A 3D7RA 1AN9A 1GZHB 3SBEA 3FR8A 2WMYA 3BH7A 3SF8B 3A3YA 2C2OA 2WU3A 1ZVJA 4FFNA 5ARDA 2FN8A 1QGUA 1Z5OA 3E7XA 2QNRA 4W5JA 4DOMA 5AW4A 1O6FA 4WKGA 1AHIA 1U04A 2EFDB 2WU4A 1YRWA 4HY3A 4M1YA 5FWYB 5T57A 1ADYA 4F4IA 4LX0A 4NU5A 2FMTA 1ISMA 1SD5A 3A04A 4TWIA 5FT9A 3OC0A 4NPCA 2I6UA 1U3TA 3RKRA 5FL7A 5ALPA 4X95A 1DT3A 3AUTA 3BFKA 2JS7A 1CEYA 3M1YA 1UPUA 1I4WA 3ZU3A 2QK4A 3AK4A 5BR1A 1JVNA 4LJKA 1CNFA 1DTSA 5ECGC 4GL2A 1LLDA 2O52A 1PT9A 3KPUA 5EJFA 5C4IA 2LW7A 4QO7A 1J42A 1LUAA 1X15A 3Q7IA 3IQXA 1YBMA 2MINB 2KW5A 3F4KA 5LYJB 3MJTA 1R3UA 1U1GA 2VZLA 4L0CA 3LPCA 4GPAA 1W46A 1XEAA 5SY6A 2QN7A 3ZE2B 3RTEA 3RW9A 1X1AA 2OYRA 2IYXA 3ER9A 1UBFA 5FNVB 2D2EA 3LBIA 1V43A 3OE5A 2HCTA 1N8SA 1USKA 3U13A 1DQYA 1AMNA 3VQTA 2IYRA 3KQTA 2NNWB 2E3JA 4R1UA 3WLFA 2P0AA 5ALLA 3CO5A 1E0DA 4XM0A 4FYPA 3ZZTA 2NZ2A 1DIBA 4WK4B 1IUKA 5HHTA 1Z75A 4I81A 2Q49A 4GYYA 1BGWA 3AIOA 4CF5A 2DBZA 2G1AA 5HEKA 4F46A 1EWVA 3O8OB 1Z4JA 4OIFA 5K6TA 5LJLA 1AKWA 1JDUA 5JO9A 4EQ6A 3D6AA 1KGSA 2E2WA 2VDKB 3OZ7A 3TLGA 3AF3A 1WUKS 1U1EA 3D4PA 3OKPA 4IQ0A 5FQOA 5K0TA 1BE1A 1XTBA 3DXXA 1V6SA 1VE7A 2B1GA 4YIKA 2IZ7A 2HJSA 4B80A 3MBOA 4MIYA 1G7RA 3ZWAA 4BQFA 6ABPA 3W5JA 4UAUA 3NJRA 3FA2A 3GBPA 1GNVA 2GS9A 2XXAA 3VKHA 3NHRA 3N74A 3P71T 1GZDA 1XRLA 4H31A 4HQNA 4XOUA 3DEFA 3VOAA 4TV9A 2BGNA 3UG7A 4YMWA 1W2HA 4BO2A 4EUNA 3RROA 1WCYA 1Z6GA 4JLUA 1X9GA 1AS3A 4MEAA 1E69A 4IS2A 2B4KA 4WUTA 3CBGA 3AJDA 4A3SA 1R4MB 2RG7A 3A9SA 1CY4A 5LB4A 5D51S 1KY2A 3UXMA 3EVBA 1E2IA 4MRMB 1FMFA 1CUIA 1BE8A 2FUCA 2JCYA 1Z9BA 4NFSA 5EGSA 3OWHA 4OBXA 2G88A 5TMDA 4BO5A 5AP9A 4DPLA 5DT2A 1ZNXA 4BFUA 5KWEA 4TX1A 2N0SA 2DB3A 2FPSA 2W6JD 3CA8A 1Q57A 1GPJA 2HSWA 1U0GA 4OK5A 4RL6A 4AECA 4LBYA 1DBPA 1KKLA 2XGOA 4BLRA 1V8OA 3M6FA 4HOYA 4CFYA 4J16A 4B44A 1PHRA 5G41A 3T95A 2TECE 4H7KA 3ROZA 3LVQE 3AFIA 1DTWB 1N5OX 4PX3A 1RC1A 1REQA 1SA0B 4U5XA 3S55A 3CMMA 3SK0A 1BEUB 1TVKA 3FWZA 4QEDA 3BFJA 3QXSA 1YCDA 2HF8A 4FINA 3A6DA 4AZTA 3KSAC 1MRZA 3X1DA 1KSFX 2FMKA 5IEBA 1M9NA 1I2AA 1QUFA 1P1CA 3EZ2A 3T5AA 3PVCA 1VBMA 2AZXA 1MABA 1UT8A 1NY6A 4FNOA 5KKNB 2ZAYA 3LUBA 3FNBA 4MKIA 4F97A 4KH0A 4ESEA 1BHO1 2W43A 4B3TB 1ISHA 4UDXX 1IHPA 5DNEA 3K20A 3AVWA 1HL7A 1SXJE 4I1UA 2ZRIA 1H2HA 3OBBA 1A8IA 1O77A 2YZ7A 1HKHA 2AVDA 2ZBRA 3IESA 4B3BA 5CM2Z 4RZ2A 2V8BA 2BUBA 1E9BA 3OE4A 3EEOA 4CMEC 4ZOLA 5EIEA 2R8OA 5CNIA 2H59A 1Z0IA 2OLKA 1D8AA 3K8ZA 3FZYA 4LC1A 3FN4A 3IQGX 4IGAA 3VJLA 5L4LA 1L4MA 5CHEA 1A0OA 5B4TA 5IK2D 1VKRA 4MKRA 2WTXA 4FBMA 3K2BA 1E5LA 1WS6A 2JH9A 1RMQA 4Q5IA 1OFIA 4EYOA 4UNRA 2YHBA 1FP1D 4AM8A 3RFXA 1T35A 3PHBE 5KMGA 5KNCD 1XN1A 1CJCA 3PNSA 3BWCA 3JQ8B 1G64A 3M6XA 1Z62A 2NO7A 4YGYA 1PZXA 1KZ6A 1PNRA 4TSRA 3JWPA 4FOTA 2H48A 4BDTA 4IQFA 4R8MA 2I62A 3ZGVA 3Q3VA 4MS3B 4EATA 4NPHA 4JEMA 5LMCA 2PT5A 5EZYA 4NBNA 2C88A 4NESA 4H7EA 4I9UA 4DVJA 3G7SA 3U80A 5KQRA 1WTCA 2G67A 1QO0A 2XE8A 5IT5A 7AT1A 1SC4A 4HWRA 2I3AA 2H3EA 1Y4AE 1J09A 4PRZA 2P9JA 1P0FA 1OVMA 3TD6A 2ZGVA 5HIKA 1RE0A 3MBIA 2X3FA 4OH7A 3PXGA 1PVDA 1EFVB 1GKLA 3OA0A 4R41A 4OMCA 4NE9A 1KDTA 4REQA 1YL6A 1VTKA 3IBTA 3JZMA 5CFQA 3ISVA 1GPH1 3CT6A 4K7JA 4OHRA 4CI0B 1Y5RA 3DZFA 1CUZA 1IL0A 2ZPTX 3F67A 1ST3A 3N86A 1MO4A 3NHMA 4HZUB 4O2AB 4P34A 3RUIA 1ZN7A 4BZXA 5C18A 1N6KA 2ZB8A 2BVNA 3JX9A 4MA4A 3ETHA 4YH1A 1N8TA 1OPRA 1Q7GA 1TUBB 1TZJA 4F6RB 1QRDA 6ADHA 3IEVA 4YASA 3WB0A 1IN4A 1NXOA 3K9FC 4ZYLA 3I28A 4PPNA 3GDGA 1DCFA 3I2HA 1WUYA 2ENUA 1MQAA 1VGVA 2CVHA 3DR3A 5CXSA 1VZ3A 2OE2A 1SZJG 1PBTA 2JAQA 1W88A 4AP6A 1RWXA 5DYTA 3KTAA 4ZK2A 1MTOA 3U17A 4ZARA 1VSBA 2NQ8A 2OT3B 3N0WA 4ALIA 2HL6A 1Z2PX 4RKFA 5BV7A 4R2XA 1U2PA 2VUTA 1RIFA 3CSSA 3RRNA 1T4BA 3ROMA 2VNAA 2RJ3A 4G36A 4PIVA 1MNAA 3NAQA 1D6NA 4GWKA 4H7FA 1BQ4A 2JLCA 1IJFA 1ZK4A 5IZCA 3ZWQA 4D0NA 3IQDB 5E38A 2OB2A 3M4YA 2B5VA 5AJUA 1NFFA 2MJLA 4W8OA 2QUBA 4UUOA 4MVJF 5HUQA 2QTGA 1DXOA 1NYTA 1I32A 5C8ZA 1P73A 2V3VA 3TLEA 3K16A 1BX3A 2Q5OA 3LXXA 3KQWA 4DCGA 4EI9A 3WQSB 4CT4B 4DLVA 2B34A 3LLMA 1VSUA 2GAJA 2O3JA 3PQ4A 3VR4D 1NQOA 1K27A 1FF9A 1T3LA 2B4TO 4TMWA 1D7AA 3RFCA 2VHUA 4AS1A 3W5AA 1E3WA 2VEDA 3BMCB 4EA6A 1NDHA 4OTZA 2PYZA 4RC9A 4GS5A 1G9XA 1WPQA 4GPIB 2GFIA 3GGCA 3LYHA 2C2ZA 5DBGA 3J80A 1GL9B 2JVIA 1FDSA 3HJRA 1DBIA 4ZXFA 2BDEA 1Q3TA 1T4GA 1IUPA 2B98A 2HREA 3LIIA 2QPAA 1JLKA 1JR3D 1SUEA 1VCHA 3HM2A 4KVGA 4L1KA 3RF6A 1GO2A 3KG2A 3HXKA 3OJEA 3E9YA 4JSTA 4F4DA 4GIBA 1QVZA 4QDOA 1P5FA 3I58A 1P4RA 3EVFA 2VA9A 3H9QA 5DSXA 2EC5A 4GX1A 1ZD1A 1Q2XA 5JH7F 2F1RA 2REQB 2CFTA 1XRSB 4ZPJA 2H17A 5FA8A 4G1FA 1Q3HA 3HG7A 3T5MA 4G9GA 1DXYA 3N8HA 5AM4A 3JD4A 1HDCA 3HBNA 3SE0A 5IASA 5B64A 2X0IA 4F9EA 3AR3A 4D9GA 2IV2X 2R6GA 4BPRA 5A4FS 4XWKA 5JRDS 1W0CA 1NU6A 1Z4LA 2XHZA 1Y3FE 1ZM9A 3E8MA 4M9RA 3EH1A 4U0KA 3BD9A 1ZM2A 2BCEA 2GPYA 4HQLA 2HH9A 3SC6A 5MN6A 3VYRB 1D07A 4KQMA 1HFKA 1NBAA 2UU9B 2DPYA 2V8OA 1E0AA 4WZBA 1LRLA 1T5OA 3DM5A 1WWKA 3IP6A 2LCFA 4BVEA 4PLWA 1GG8A 5JU6A 2I76A 1SUPA 3GEHA 5DYWA 3ZHXA 4D99A 4GX2A 1OV4A 4NZPA 2DCUA 4RQAA 4L4ZA 2Z57A 2OM2A 1BW9A 4UMFA 1CERA 4HEQA 4Y6OA 1GPAA 1KR5A 1NBMA 3EXIB 4YI3A 3PF9A 3OEEA 3P0IA 3HXPA 1EUCA 1IXKA 2J6CA 3EVAA 3F5MA 3FNEA 4JL8A 2G6TA 3UPTA 1E1KA 3B8HA 4WEQA 4RADA 2MSLA 2DTDA 4DR6B 1V1MA 4AY2A 3HA3A 2WHPB 4YJ3B 4F96A 3O3OB 1RWKA 4F5DA 3FZNA 1OSNA 3QPCA 4HAYA 5CT4A 2WV9A 1XFDA 3UAWA 4TQUS 1E4YA 1U9ZA 1Z2AA 4OB7A 1PK9A 4OQPA 5EWJB 4RTRA 4ABTA 1X0VA 3ZXYA 2BW0A 3T5TA 2L69A 2P5TB 2HBQA 3U4QA 5KYNA 3OCJA 1Y1TA 2X8JB 3O4RA 3WAKA 2JHGA 3QE9Y 1FSGA 4RWZA 3AZOA 2X9QA 3F5DA 3KCNA 4X7BA 4IO1A 2F62A 4LJ6A 3SIWA 5HDQA 4INAA 1QIHA 3B70A 2CKDA 2GK7A 3CR8A 2OP0A 4U63A 4IRUB 4D8VA 1ODTC 3UUEA 2AC7A 5A4MS 1JBEA 2V4ZA 2HHHB 3UGJA 2IXAA 1P17A 3M3DA 3SZMA 3D3EA 4JP3A 4X93A 1N2ZA 1P9WA 2VSQA 3VH3A 5LDHA 3EGOA 4PO9A 3MTJA 3GRZA 1CP2A 3FHLA 1Y3IA 1BX1A 2L82A 1XKLA 1TA0A 4X54A 1H3EA 1AHHA 2DBYA 1EFHA 3BB4A 4K9KA 4B4OA 4BECA 5A2QA 3FNRA 4TXJA 4Y2XA 5FBQB 1I6MA 1I0IA 3UGTA 1J5XA 1EVZA 3RJZA 5A1TA 4O8ZA 3SZ3A 1U6KA 2I6GA 2LE0A 5BWMA 2XODA 3N0XA 4HDMB 5JAUA 1J2YA 3D2LA 3LPNA 3USZA 1QG6A 5DNWA 3RK4A 1C2YA 5EPOA 2E5LB 1ECGA 1G3UA 2C58A 2ZUWA 5KCMA 2AG6A 2CDNA 5EHXA 2XQVA 2IU6A 1K89A 3X2EA 1HZZA 4BBPA 4BMDA 1XAHA 4HAUA 2XRMA 2FJPA 3NWOA 5KX5F 1QYVA 1UBTS 2VF7A 1GGVA 4NU0A 5FA6A 2JIZD 2M1XA 3L6EA 4L16A 4AP9A 4OYHA 2ZJ1A 3CLSD 1SC9A 1TQ4A 5EZQA 3EVNA 1UMCB 5FOVA 2IWHA 5I7FA 2O8BA 1NUAA 2C77A 5JASA 1Z36A 3F0TA 4MICA 1FA9A 4GMHA 1ABFA 5HGJA 2AR7A 1O5TA 3QY0A 5FTLA 1X1QA 2QRKA 4HH4A 1L3CA 4BJ5A 2Z98A 2OGSA 4JJEA 5FTWA 1TT5A 2AD5A 1T5TA 2CHUA 4XR9A 5B7PA 2IEIA 1C9KA 3G2HA 4J0QA 4QOHA 2OKCA 3BB1A 2FG5A 4AJPA 4O4LB 1CUYA 1LRKA 3W1WA 3FNGA 1QTNA 3D8RA 2PRZA 3G59A 1HEYA 1R5BA 2J3HA 2QTFA 4N0EA 2XUHA 5DOVA 1ESDA 1TAGA 5G0VA 1KY4A 4YRDA 3C3DA 5T6MA 3ZLUA 4GGPA 5CBKA 2IPXA 2VCEA 3IT3A 3KXKA 3OUUA 4HB4A 1Z2OX 4MUAA 5AKZA 2OCBA 3KTDA 3URMA 5C5CA 1AOXA 4WXEA 1SIOA 1DPGA 3EEIA 2WT9A 3KEFA 3T5BA 4Y7DA 3UK2A 4TSFD 1L5NA 3LDHA 4R5MA 2DHCA 3S8EA 2VP5A 3ZV6A 3IAFA 2VF4X 1A7UA 3PC8C 4BL5A 4ZRDA 3GCZA 3CNQS 5THQA 4L0QA 5CK4A 3NGXA 3KUDA 4B45A 4PVCA 5CTAA 4G24A 3V9PA 3UJ3X 5CX1A 1J2UA 2H1LA 1M33A 3VOSA 4JR0A 2LD4A 4AAYA 5DHQA 1WHSB 3ETLA 4COKA 2FDCA 4F9GA 2C7RA 4G0VA 3P9PA 1EFRD 1M5TA 1C1XA 1JSRA 5LIRA 1EHCA 3L04A 2WYHA 1XUOA 1CRPA 2IBMA 3SBDA 3OPQA 1U2GA 3GLHA 5LXTB 5DULA 1QU3A 1YQTA 4BNIA 3UFXB 3DZGA 1E2JA 3G6WA 2WU0A 3PHHA 2PLRA 1T3SA 1WAMA 4HGZA 1ZR4A 3FLMA 3OT5A 4M1WA 4Y30A 4CTMA 1GDHA 1UJ5A 4B83A 2HHCA 2ROQA 4GZLA 1RPZA 2VH5R 1KEWA 3T12A 2XGJA 3PFGA 4Q1CA 1AD2A 3ZY4A 5KTMA 3CEHA 3AOEC 5JECA 3SNKA 3EQ8A 1GLGA 3ZDDA 2YQZA 2MR6A 2RC6A 1D6MA 4KK3A 4M1OA 4HTFA 3TAXA 2RJNA 2GZHA 1ODIA 4JEUA 4J0KA 4WKCA 2VHQA 3M6UA 3N1UA 5LLSA 4GPTA 1R3DA 1IY9A 1NT4A 1AHPA 4I9HA 5T4BA 1M2EA 2PJRA 3WHPA 2UDPA 4MGIR 4QPPA 3TG2A 3V8EA 4CE6A 3I5YA 4DIKA 3MRXA 1HDEA 3PUVA 3HCEA 4R1LA 2QRQA 4V02A 4C3VA 1Y9DA 1KO5A 2COKA 4CIDA 1L6IA 4ZYWA 3O47A 4RD2A 1U31A 1QYXA 3S40A 1NM5C 4X20A 1R27A 5CH5A 4OB8A 2ZS8A 1PWZA 3TUIC 2GNPA 1T5IA 3U1VA 3EGDA 4HI0E 2PANA 5J40A 4Q9KA 1PZMA 4FMDF 3PIRA 2QNIA 3BYZA 2FFAA 3H11B 4OQNA 5DHSA 4YN3A 3QEOA 1KVQA 2RH5A 2V7VA 1GPLA 1O97C 5T4EA 3OQMA 3TJMA 2JGIA 1IY8A 2IHKA 2OFFA 3SZUA 1JDJA 1MZVA 2WM2A 4AZSA 2G36A 4PAMA 1W8DA 4J3FA 4DYDA 2AN9A 3JWHA 1XROA 2NO0A 3ENQA 1XCJA 4GSKA 3R5HA 4JBWA 4L9RA 3WV5A 1TZMA 2R6R1 3B2NA 4HDNB 3TNYA 4RKQA 1NI4B 2F8LA 1QF9A 2RBKA 1YNOA 3MMNA 1W93A 4RJIA 4F5EA 4MCAA 5BYBA 4BGDA 5D3QA 1AA6A 5HIJA 1DJPA 3L1VA 2IYZA 1V6AA 3FKQA 1E7QA 4TL8A 4DRXB 1BA3A 3L46A 1NJ2A 5DBFA 3IV6A 4URHA 1HGXA 2A94A 2ZRLA 2XRFA 1XJ5A 2X77A 1OXXK 4AWAA 1P0IA 3N2GB 2VPQA 4U6SA 1E3DA 1IJKA 4U7FA 1THGA 4Y1FA 1RZRA 2XBMA 5C8YA 1ZQ1A 2ZYDA 2XIJA 5E7QA 1ISSA 2O0HA 3F7MA 4R0MA 3AV0B 5C5DA 4RV5A 3VVLA 1J7JA 1O6BA 2ODPA 2JD2A 3IP5A 1SVSA 1A95A 3C3JA 5IAOA 3W5CA 1JB1A 1ABBA 4JT9A 5IX8A 5C8VA 2Q8NA 3THWA 1R18A 1E4OA 1JQAA 3C45A 1RDFA 4N47A 2X15A 3Q3GE 4NJOA 1VP3A 2ZYIA 4EQZA 2ZAGA 1E1NA 1ZXBA 2AFRA 4LBZA 4R69A 5DGDA 3ZWXA 4ND8B 1EEXB 1EGQA 1XZBA 5CDGA 1DQPA 4D43A 4FQ8A 4LYHA 5A5EA 2I1QA 3BSWA 1ES9A 1E6UA 3EZXA 1BQEA 2CN1A 2GXSA 4NYJR 3GUUA 4WFIA 3D7KA 2B20A 2PZGA 1EWQA 4A8JC 4F9TA 3IQFA 1IU9A 3SI7A 2X0RA 3DYBA 4V0SA 2YW9A 4XLLA 3EFOA 3R76A 3TEFA 1ESZA 1Q0SA 2PGJA 3GY0A 3G7NA 2FZKA 2RCYA 4JMPA 4XA8A 3RYIB 1DBQA 1CCWA 4D0RA 6YASA 1YFKA 5I7UA 1KE1A 2UYQA 1MJGA 5G4KB 3U2QA 4CIAA 4IMJB 2IC5A 2QLMA 2XBLA 3AIIA 4KIWA 2WPDA 4P93A 2IX3A 2ZSJA 13PKA 1Y0BA 2PUHA 2RHLA 2UAGA 3BTVA 4FQ5A 4RYDA 1NMXA 4O1MA 1BYIA 1XD2B 3BOSA 4E5DA 2HLPA 4E46A 4P86A 4PNEA 3E53A 5BN3A 2BDUA 1Y80A 1WNTA 3LAWA 1E6CA 3M89A 3ZI0A 5F2NA 3I62A 3AVVA 1VP9A 4ZZ0A 4G9BA 5L40A 3RSOA 5G1NA 4B6PA 2G70A 1H69A 3UANA 5LQDA 1VJ0A 2LGJA 4FDVA 4US0R 1XHLA 3ZDYB 1UDWA 3KOXA 1Q2UA 4TLDA 5K20A 2F17A 2VJPA 1G5TA 3ZI4A 1UMBB 2IOYA 5TSDA 2QQFA 1WEHA 3OE7A 4EGJA 1EFTA 1P0CA 3TKYA 2C07A 1BDJA 2PMEA 2O6HA 1U2DC 3WRWA 2E6KA 3OSUA 3EF3A 1NYQA 1Y6RA 2XT6A 5JATA 1QMPA 1DZIA 1L2TA 1WF3A 3FX2A 2BGIA 1BS9A 1KI3A 3K9BA 1U3VA 4MUNA 4M49A 4PG4A 4Q4AA 4B3RB 2JB9A 4WNCA 3MWDB 1N5JA 3JQPA 3VU1A 3UKDA 3L6OO 3EZ6A 4RA9A 4D9JA 4EVIA 1LKZA 1NOKA 5CB4F 3IAEA 3LP8A 3TBKA 4IG4A 2IZ6A 3BMQA 4X63A 1RLJA 3NETA 2XUOA 3ZHVA 3UMYA 3SHTA 5ETJA 4DXAA 2C2MA 3RHZA 1KK1A 1W35A 3DMTA 1GFZA 4YS6A 1S8FA 2QD2A 4MKXA 4GI3A 3TLBA 1GN9A 1N57A 1G291 2YJTD 1CY6A 3P32A 5DV9A 4X62B 6REQA 3N59A 4LZAA 3IUJA 4ZYVA 2QTCA 2ZI5A 2QZZA 4KYUA 5C3MA 2ZTUA 1XEFA 5FJJA 4ZCPA 4I3HA 1QRTA 3ONVA 4HAVA 2NXEA 2WJJA 2X76A 3QPDA 3RRFA 2FOXA 2YJZA 2FRDC 1D1PA 4FKMA 1L5YA 3NCTA 5SV2A 2AMLA 1OASA 3U44A 4RY9A 4EFLA 1DCTA 3OVMA 1JFVA 1JLLB 3HR8A 1XQXA 4G0OA 4TLCA 3RVOA 4ETWA 2NT4A 5BN5A 3NHPA 4DQXA 4ZODA 4CIVA 3AF4A 4H16A 1ZHHA 3G0DA 1DT5A 2CF5A 3U5ZB 4US1R 3E7DA 2BBWA 3OZSA 1JI3A 4F0JA 4XVHA 1XQ1A 1MIOA 4ZPXA 4RFSA 1OWOA 4V2UA 2CD9A 4NR0A 2XNDD 1XNRB 1WB5A 2G06A 3CVUA 1J9ZA 1O95C 2B61A 2Y67A 1FFSA 1OILA 3JASA 5TGTA 2O20A 2OZVA 5B4UA 1NX6A 1YS4A 3IVCA 1ZINA 7REQB 1Z18A 3QVWA 1RQ2A 1ULTA 2G9UA 3AI3A 4BB6A 4ZYTA 3F96A 4DYVA 2O7RA 2Y0BA 5BUZA 1ZRSA 3KRTA 5HIAA 1N7GA 1QH1B 3MWJA 4Q4CA 3WGYA 3Q3CA 2PX6A 4AG3A 1PYDA 3SSOA 5EHZA 2RG1A 1UOPA 4G25A 4WESB 2WWVD 5FLEX 5C46F 4QVGA 4YWJA 4BAUA 2VUUA 2PUEA 3INGA 4FYXA 3FPBA 4I4TB 1PD1A 3GLGB 1B3RA 2V7UA 3K6KA 3BXZA 1E8NA 3PJGA 1AG9A 2BGUA 4L7QA 4GM0A 3TQQA 1SMKA 3CN7A 2GAOA 4XW2A 4LJAA 3MBKA 2XLCA 1YR1A 3MW8A 4KPGA 5KOJB 2OCAA 4K6OA 5SZKB 3OU7A 2EHDA 3LXMA 4JKOA 3T3DA 2JLUA 2DOKA 1N5KA 3SJAA 2D5LA 3COWA 4EI7A 3CO0S 2PKQP 4O3MA 4UBKA 4FIZA 3C43A 4IV5A 1V11B 4LV8B 1EVEA 4L8WB 3DHNA 1IN6A 1C1DB 5HQTA 3AQ4A 5JZSA 4K0RA 3LP6A 2JRLA 4OXQA 5KJCA 4LF8B 1SUSA 4G0PA 2FQWA 4HDQB 2D1RA 3TZKA 3H2SA 5KOHB 3PRYA 2NT3A 4RJLA 2UZ3A 4WOJA 3AKDA 2FXVA 4ZDWA 3TSYA 1RNLA 2BMJA 1O2DA 2NPIA 1P9RA 4KQ1A 1MXFA 2OYCA 2GD0A 3EZNA 1GQRA 4HWPA 2BISA 3MTEA 1JHMA 4KE7A 1M8JA 4Y7CA 4HGOA 3WGNA 3RSCA 2AEEA 5B1HA 3P9CA 4L5BA 4J0EA 3T1OA 2PUGA 3BILA 7MHTA 2GJKA 2PVPA 2WINI 3A2MA 3C4QA 3LUGA 4OJQA 1O5OA 3C70A 1JJFA 2IYYA 4ZP1A 5JQGB 3QQPA 1FYDA 5HUJA 3WKBA 1U0BB 1DLIA 2P5YA 3PUJA 4RMGA 1F8XA 1ZM7A 4PGMA 4XAQA 1XX6A 3FYUB 1PQWA 1A2KC 1YZKA 4IY1A 4DG5A 1PYGA 1XE3A 4EGCB 5H70A 1II8B 2EFGA 2XYPA 4HJXA 4P5DA 2DUMA 1NT2A 4OUKX 1SK8A 3BZBA 1F1BA 5CA0A 1A1VA 4KOEC 4MUJA 1GQ2A 2CJYA 5ALVA 4L5YA 2ZKIA 2BTQB 3GD5A 3PUYA 3LOQA 4KAXA 1DOZA 3R3HA 4HQOA 1SXJC 1YJCA 4II2A 1L4LA 3Q10A 1U7WA 1R4AA 3D1JA 2X9NA 2F2TA 4OU5A 2AN5A 3C15C 4RQUA 4ZT4A 5J2UB 4ZI5A 3K6JA 4O4IF 2RHWA 5KEIA 4JENA 5ALRA 1BMQA 4E07A 2ORVA 1ECJA 3ABSB 4V0NA 3VISA 2J9YB 2Q50A 2DRIA 1I2MA 4ZAWA 2XWPA 3VUEA 5CDTA 3W5BA 1FIUA 2VXBA 3IULA 1XHFA 2FH5B 3ABOB 3DZBA 1SBYA 3RTGA 4C7JA 2JLRA 4GU5A 5D6NA 3W3AD 2JK0A 1E63A 1R0SA 1T3TA 3D1LA 1A27A 4X92A 2PZFA 4HFJA 2UKDA 4PRLA 4V0OA 5DSZA 2CC2A 2GI4A 1CRZA 2QM8A 1O9HA 3EN0A 3RVPA 2YWCA 3ZV4A 2D5AA 2WM3A 4EG1A 4JHXA 1Y33E 3OCUA 1FVOA 2YXNA 5EJEA 5I7RA 5D5QA 4HWSA 5JIBA 2K7ZA 3PI7A 1M2VA 2VG8A 5LN1A 4ZO8A 3UJ7A 2PZEA 3SGLA 3WLQA 4YRBA 3AJEA 5JVDA 2HT1A 5ILQA 3SHFA 3TRHA 1N2IA 1WQ1R 1IOLA 3IDFA 3JQ7B 3GVXA 4RCZA 3ZWPA 3VNQA 3G5LA 4KFTA 3MCVA 4DJJA 2GESA 5KS2A 1UQTA 4L28A 4B6EA 2VTEA 5BMVB 1RXSA 4R4JA 1Z4NA 2GWHA 4WT7A 4XYLA 2FZWA 1RBYA 4POAA 3WLLA 3M1IA 4U2EA 1AMUA 1LPNA 4LZPA 5KREA 2DY0A 3UXHA 1H94A 1TF2A 1KOLA 3K96A 3V4PB 2WIAA 2ZQZA 4HAWA 4DNQA 3NYWA 3S2EA 1XPRA 2OZPA 2BEWB 4DMHA 2A9FA 4KQKA 3DW3X 3CBQA 4CCWA 1XKXA 3UAGA 1ISJA 2LV8A 3O9MA 4ZI3A 5C35A 3ICQB 1RJEA 3PXAA 3ZW9A 3MRTA 5B58T 2GZ2A 2D5CA 2IXFA 2HPZA 1P2SA 4YCJA 4HK4A 3EMVA 4B3IA 1WMBA 1RP7A 3SN6A 2OQIA 4OSPA 5TGDA 3CVWA 1D9ZA 3H0KA 1DO8A 2RB5A 1ZEMA 4WN9B 3JAWB 1C3OA 5DYYA 4PZYA 3WDMA 1BEEA 2NU7A 1GG9A 1IHOA 1B6RA 2FPIA 2QGNA 2XRYA 3D3QA 3GCXA 2GN1A 3NNSA 3OTIA 4PQRA 1G6HA 3A4VA 3OOHA 4B3FX 1IQ0A 4UVGA 3SEAA 1D2HA 2C5SA 1PWEA 2J5BA 4N0MA 3RSLA 4EKYA 3HU5A 4FJ1A 5HQ3A 3WLPA 2OL4A 1J1ZA 3NC0C 3PDWA 4DWVA 5CFMA 1LU9A 2Z4TA 2ONCA 1PR4A 3OQJA 3P9SA 2BM9A 1GYPA 2FWPA 1D1TA 2AYYA 2Q3LA 1UCFA 4OAOA 2O8EA 2JFFA 3T0GA 1YBAA 4BE4A 5CDUA 2VRBA 1VB3A 5D7NA 5KYGA 4O4JF 3OE1A 3R5XA 2BONA 3ONEA 1JDVA 4C6SA 3DZCA 2ZWVA 1KO8A 1P2UA 4XFKA 2WIFA 2OYSA 1CIPA 1XCMA 2VRCD 4I99A 4KUGA 2Z09A 5D3KA 4EI8A 1G5HA 5IWAB 2NYVA 3V4VB 3Q8WA 3OZVA 4F2HA 3TVYA 1EM6A 5GV7A 1XU7A 4X1KA 5BW5A 1Z38A 2BBOA 1RPNA 4W4TA 1F2DA 2JAXA 4GMXA 3ZK8A 4YB8A 1VHWA 3RT1A 1D2EA 1C41A 2E7ZA 3HFJA 4PYLA 4CT5A 2LIPA 1W4CA 3F4BA 5G2OA 1DEOA 5HRUA 3KK0A 2EKLA 2OESA 3PJFA 2IU0A 1SXPA 1NATA 4ENPA 1EZ1A 1MJHA 1AIPA 2JIOA 2RIPA 3HNOA 3WRYA 1ZRHA 5I9MA 5K8LA 5BR8B 2CV2A 4D4LA 1AS2A 1QH8B 1ZHFA 2ZSHA 4JI3B 1SXHA 3ORRA 3P7MA 3VYWA 3EF0A 5AQ1A 1GAQA 3C39A 1JAYA 2CT8A 2QAJA 3BGVA 4HLQB 5F7OA 1DEHA 4XSVA 1EI9A 2ECPA 4JLOA 4Y0AA 3UY4A 4QG3A 3JR3A 4A0QA 4Z6KA 5C7OO 3EA4A 3L5KA 1G5IA 3CX7A 4C7OB 3V48A 4UVIA 5A3RA 3OCZA 4E08A 4JX8A 2QY6A 2ID4A 4BGEA 4RTSA 2ZRPA 1FTGA 2IY9A 3G3EA 3L82B 3PIDA 3U09A 4FC6A 4E5PA 5FPHA 3S5JA 2PSFA 4NEHB 4OA8A 1W0JD 1KYZA 4KLZA 3QMWA 4LPSA 2VQSA 1DCKA 1QCCA 2I2AA 3D8NA 1MX3A 2V4MA 4TZTA 4EG5A 1I4OA 3TGPA 4KZKA 4MV7A 5CPFA 1QTQA 3U9LA 1PNVA 4HQRA 2FSGA 3DFIA 2IHUA 3FTQA 3H5LA 1MQSA 2X5JO 1U0EA 2R11A 1L7OA 3HKCB 3HVUA 2EKBA 3K0CC 3N87A 1NR5A 2FFQA 2HJRA 3GH1A 1GVHA 5FO1A 1G5QA 1W34A 1WMDA 3AL3A 1JKIA 3DLBA 3ZEIA 3NVAA 3PEFA 4M6WB 5HM8A 3HYNA 4ENRA 3GVHA 1GZ4A 2QYHA 1ECPA 2IYEA 2JBWA 1PG2A 1XB2A 3ESQA 4GBGA 3K0HA 1UANA 1Z6YA 2O48X 3ITKA 1GADO 1D8TA 1R6BX 2JIDA 3DT9A 3I4LA 1MCZA 1UPFA 4HB2A 4QUJA 2CMFA 1JL3A 5L4SA 1XQVA 3KJGA 4HLCA 1PGQA 4FOPA 4D41A 2CLCX 4ZKEA 1E1DA 4IWXA 3GFSA 1T0PA 3R7WA 3C98A 4W1PA 5JWHA 1G3RA 4CQMB 1PO7A 3EJWA 2IBSA 4K1LA 5JMWA 3HWX1 2XDAA 3QPAA 4M21A 2OTCA 4LF6B 2P3OA 1TQ8A 4BP3A 4Z4QA 5FLKA 3WYAA 3QLUC 4O6VA 1CZRA 4ADSG 4JHLA 1Y5LA 1C7JA 1FYXA 1LK0A 1MLDA 4J03A 3VR3D 1N6HA 1U7TA 2F1KA 2RH9B 3VVBA 2ZAIA 2F43B 2D1YA 2FP4B 3GI1A 3QWAA 1ZLYA 1ZPDA 2ORIA 3HS3A 4GUDA 1HE4A 2X9VA 3EXFB 2DULA 2JJ2A 1KO7A 2B4YA 2JHAA 1G8MA 2R1TA 3AERB 2W6NA 3PXCX 4WCFB 5ENDA 2H1CA 5CVVA 1MZPA 4NBTA 1DJLA 3VSBA 2LP4Y 3LWNA 1T9DA 4M1KA 5LZ7A 1Q20A 2QTLA 3GLGE 3QX9A 3A7EA 1L7AA 1RC8A 2C2BA 1NR7A 3ESCA 2Z08A 3BWMA 1UBOS 2F9LA 3BGIA 2UV8A 3QFFA 4KDCA 5CVTA 2KQUA 2XVZA 1Z68A 4RTJA 4DBZA 3O38A 3VTZA 1W76A 1IZ9A 1XZEA 2V6GA 2RAUA 3ELWA 3KLOA 4MW2A 3WDSA 4BOYA 3LL4A 3QA9A 3RUPA 1KJQA 2OV2A 3L0CA 5IXYA 1TAQA 3AU8A 3BB3A 3I01A 4IIUA 2AX3A 4LY6A 1SIWA 5GVRA 4BAGA 2H1VA 1CB7A 2QJFA 3AETB 3MUOA 3RABA 2ATEA 3TKAA 3GN2A 3V4FA 2NTYC 2E85A 4KDEA 4BAZA 3M5DA 3FUWA 4KXLA 2EFYA 1W5TA 1HDRA 3MT8A 2AH5A 2PL9A 4E5YA 2R84A 4YAGA 2F8MA 3A3NA 1CQXA 3BA6A 1CEQA 1CV2A 5K2MA 3J81A 4EL5A 3A1VA 1YCGA 2XZDA 3Q72A 3I30X 4GYJA 1A4XA 1RQPA 4MVJH 4NE2A 3ZCRA 4IDDA 1T9ZA 4OYYA 1XI2A 4URVR 1YWGO 1XTZA 2QMUA 2A1TS 5T41A 2NWQA 3LF2A 5U4XA 4HNQA 4UHFA 2C92A 2H2DA 1WP4A 3Q2IA 3LYUA 1A8PA 3BQMB 3I9FA 5DT9A 4NMHA 1XXHB 1X77A 4ZN6A 4FLFA 2YW2A 3HB9A 5IAAA 4FONA 2WKPA 4I1YA 4MRAA 2W7TA 2Q3HA 2X5XA 2GYWA 3FTDA 3GFPA 3GEEA 2Q9AA 5I47A 1Z88A 4LSWA 3HXOA 1CUVA 3I6ZA 4S0XA 2DQZA 3MB8A 4D74A 5DSTA 4CRWB 4FW8A 2HNAA 4IOLA 4YRPA 2JGRA 3D5QA 3CSUA 1U8EA 1SUBA 2LDXA 1IPHA 1J0DA 5CVEA 3KSRA 4CT0A 1C7ZA 1P5ZB 3IT1A 1R0RE 3CJQA 3E05A 1T9HA 3NYIA 1JWBB 4EYGA 2WSSA 2C9ZA 3W90A 4NMMA 3IAS6 2C9OA 2OGWA 1R0WA 5DDIP 3CNLA 4MVJA 2PUAA 1QFSA 4MLDA 1X6VA 2FPRA 2Y1FA 1L5QA 1S1MA 2H5IA 3WLIA 2QTAA 5BY2A 1ONSA 3OX4A 4BJHB 1ODCA 3JYOA 4R16A 2FG7C 2C4VA 2Y1LA 1PDWA 2Z8YA 3BMNA 1HETA 4GZ6A 4K8OA 4U2CA 2C98A 2HCJB 1JG1A 1TYEB 1HFEL 4U00A 3VH1A 1CG6A 2RHCA 2C2XA 3R3WA 4MZXA 1KP9A 3UCEA 3B1XA 1G3IA 2CVZA 3ZWYA 1ZVKA 1MP0A 4UEKA 3HVRA 2XXBA 1KVSA 2Y99A 5JSYA 2CHQA 3O26A 2XZOA 2ESRA 1RJ9B 2KM1A 4MROA 4RVOA 1RJDA 4W1QA 3TW8B 1D0VA 2OFXA 4E5SA 3TM5A 1SOMA 1FYVA 2QENA 4JYMA 3VU9A 4AZ0A 5CLGA 4ITUA 1QFYA 1WVGA 2C2YA 3E8XA 1KBQA 3KYIB 2JFHA 5EA2A 3UBMA 3K1AB 3O4IA 3IEUA 1E64A 1XO1A 3K73O 2JH3A 3WRXC 5JH7A 2G9QA 1N3YA 2RONA 2DXIA 1P7WA 3KB8A 4OAQA 2AKYA 4G0QA 4ZC1A 1WD7A 1FX1A 5KQLA 3MAJA 1FJGB 2INGX 3BRQA 2CB9A 4QTYA 2CXOA 5A9SA 3DB2A 1YR7A 5CAEA 1XZGA 4OOFA 1NP3A 2RCNA 5KVQA 4ARAA 1Q0TA 5FNZA 1MAWA 3HL4A 2R8ZA 3R6LA 4B76A 2WIGA 1Y1QA 3IILA 2FWAA 2Q0SA 3LY8A 3LPLA 4LW8A 3GV0A 5ALUA 4C21A 2ZUTA 4DLZA 5C5IA 4DR4B 5I7VA 3SYTA 1UK9A 1Z4MA 4UUAA 5CHYA 4AB1A 2PBRA 2BF7A 4IIVA 2O50A 3WXMA 2HTEA 2E4YA 4N65A 2O7SA 3EWSA 3HWSA 2R6HA 5C1IA 4YJ2F 4ZT2A 3W2FA 1JKMA 2X1HA 3W5DA 1X7YB 2FZLA 2QN8A 1I7NA 2VQDA 3WKAA 1AC5A 1VLJA 1QK5A 2WABA 4IBOA 4EAQA 5DVZA 3DTVA 1HK7A 4IKEA 5KYYB 2AOTA 3IDZA 3QE3A 4JWKA 5JAOA 2CW5A 4NZ9A 1YRBA 3SMVA 1LQUA 2ZVPX 2VHEA 3CGWA 4M9SA 2D59A 5K6AA 2YIDA 4PS1A 5KWJA 1RXYA 2XQGA 3PYLA 1FRNA 2WDZA 4C88A 3HKDA 4DCSA 4DMUB 4LF4B 3U0VA 4LVOA 4QELA 2CJFA 2EP8A 3E18A 3EWAA 2AI3A 3RO7A 3I2IA 5E2BA 2AJ8A 2ZQ5A 5E6UA 1XZFA 4J2HA 3DCYA 3DUFB 3VYUB 4CKWA 1AKUA 1JXMA 2QZ4A 3B6MA 3HU3A 2GD1O 4IM7A 4B6JA 4OUDA 5JSUA 3MOSA 4YCBA 4GRIA 4NQZA 3ZTTA 2PQ2A 5L7TA 5JHHB 2CCGA 1QKJA 2GRJA 4DHWA 1F2TB 2BSXA 4P81A 2I4NA 4DBLE 1K3FA 1MFPA 2X1VA 1KYYA 4TWRA 4CR6A 2WIDA 2O2EA 4MQ4A 1QG4A 3ANLA 1JBQA 3DE4X 1CUHA 1POWA 2IV7A 4EDFA 2WYVA 2VPXA 2A9JA 4C6HA 3TO5A 5AXDA 1YS1X 2V65A 2EL9A 3OD1A 5L3RA 2W6QA 3BL5A 1RXIA 1G9TA 2A0KA 3X1JA 4YAKA 2K2WA 3VPSA 2V7WA 2WIBA 2HQ1A 1G98A 2GN0A 3TOSA 1ULZA 3LRTA 1AHNA 4KODA 5CXQA 1NW3A 5LYJF 1AGXA 3PD0A 3E84A 1M7GA 3L0OA 3Q6IA 3W4JA 5CXXA 5CDHA 2W2VA 3GWGA 4P58A 2JATA 2V74B 4EL0A 4XWOA 2X7JA 3CWQA 4F6LA 2ZJ8A 4BX9A 2B94A 5JO0A 1BWQA 1J5PA 1P2BA 1T2UA 3QF4A 5HIIA 4OAPA 3LXUX 4HLUC 5JZBA 1AKMA 1BX0A 4ZVNA 1E6EA 1FRVA 1X80B 2GHRA 1B43A 2XXJA 3BGWA 4QEZA 2FEKA 3RBVA 4RVNA 2O2IA 4AL4A 2ZEJA 3GELA 3VSEA 3BEDA 3KR0A 4BE9A 5EP2A 1CRLA 4R9SA 2J0SA 1OX6A 4OCZA 5DM0A 2A7QA 4FFPA 3FKSD 5BMOA 4L8LA 5KX5A 1QGUB 3CCFA 3PQ7A 2ZCJA 4G67A 4M7RA 4I5EA 3LCUA 4FI3C 1HEUA 1PVOA 4P35A 2F1OA 4E12A 1CW2B 1V16B 3A0UA 3O1JC 3P9RA 2J07A 4RD6A 5JAPA 5FTKA 2BCJQ 2ODBA 2LCQA 1P0PA 1OW3B 3UW3A 2EP7A 3SC2A 1AN0A 1C0LA 2OQRA 4QM6A 3RR2A 1VMDA 2FR8A 1ZGHA 5JZVA 3V2GA 4UJ5A 1Y7HA 4OJMX 3RRZA 4CG3A 3V1KA 2UYOA 2AF4C 4MX8A 5GOTA 2YYYA 2C94A 3V1NA 5BR7A 4B3SB 1O97D 3HUFA 3M7IA 3QUQA 4MW7A 3OPYA 2GWRA 2PO7A 2OEPA 4V38A 1L5SA 2WZCA 3UMFA 2QQEA 1WULS 3CLTC 5IBPA 3RVNA 4X91A 2KB0A 2WJ4A 5KWIA 1YONA 3K71B 5KSPA 2Y9PB 4C4AA 2GEUA 2H4FA 1ZH4A 2JFWA 4BO8A 1G42A 3SQMA 3KVVA 2EKDA 4E03A 2FPOA 3ET5A 5GJBA 2BC9A 1JE0A 3TZEA 3L7AA 4E3WA 1C29B 4Y2JA 3ZGZA 3USCS 2POQX 1TKAA 2H6EA 3AEQB 3T6KA 2BE9A 2CKMA 2X8AA 4RXUA 2NSHA 1BN6A 4X24A 4R51A 2R7MA 2AJBA 3MK31 1B73A 2AMFA 4MAAA 1DAGA 1KEVA 4GECA 2DWPA 2P3SA 4JGGA 4XWGA 1U7DA 3H1AA 1IUOA 1BROA 2OGUA 3C5EA 4NFYA 5I7SA 3EK2A 4YR9A 3W8FA 5KO2A 2ZBFA 4M37A 2VP2A 3ZH2A 4TSKA 4JZKA 1XQ6A 2TRSB 3EIXA 2GHQA 4LDNA 4RF5A 4BWGA 2AFHA 3TLGB 1E9SA 3GGDA 1PTJA 3IIMA 4L6CA 4JB8A 1M1UA 5A5DA 1AQLA 1KHTA 2VRWA 2GPNA 1L1EA 2QP4A 2IXEA 1ULSA 1U11A 4G5SA 4MR8A 4TKUA 3O8NA 3KNZA 4RAQA 2C2KA 2V45A 2OZLB 2XXAB 3KZ1E 2ON6A 1A4IA 3AHEA 4ED9A 4RDXA 5LZ5A 4QPZA 1MBZA 1RT9A 2EP5A 2OOSA 3PNBA 2P6OA 5G3YA 1E2QA 2DQSA 1NR1A 1JNYA 3E2IA 4RJJA 2DVMA 4FGSA 4XUDA 2GXQA 1U8AA 1GQOA 4ND2A 3EPLA 3TINA 4A5OA 4E2YA 1G2QA 4L57A 3TQHA 2WQ6A 3O31A 2O4CA 4JLKA 3AM4A 3WIDA 4EVQA 1TW3A 1BJRE 1JALA 2I5PO 2O57A 3AG5A 3BE5A 1L5WA 3GRPA 4IIEA 3B38A 4IFTA 4P7KA 2K6GA 4PAOA 5EVCA 5LBIA 4AUEA 4E4YA 5AD1A 4NOLA 1H8HD 2AN4A 4Q9HA 4F1JA 7GPBA 2YOFA 2QZSA 4KGZA 4BNHA 4NNPA 4RKYA 4D57A 3VR5H 2HOQA 1DG1G 1HNNA 5EMLA 4TMFA 4RIHA 2V7QA 2BGMA 2HV9A 2JJ1A 4GSLA 4MV0A 4WLVA 3EGCA 3V8PA 1R9JA 4IJ5A 3EWNA 4M1EA 2PIDA 2NTVA 2DUJA 1FYWA 1N2HA 2Q3EA 3SYRA 2R5NA 3WP1B 4CR8A 2RARA 4Z9XA 1TA9A 2BFEA 2OLEA 3KQUA 2A0FA 1KDZA 2HMTA 3RTAA 4RGBA 2ZSAA 1XKQA 4RY0A 2VKQA 4XJTA 3CM0A 4CM6A 3U7HB 3CB4A 4UCWA 4KQCA 5TPWB 1X1CA 5LZ2A 4C7BA 4XDGA 4OL9A 1IWBB 1FMTA 3PXXA 3F97A 4I50B 2G0AA 5A4IS 1EIWA 1SAYA 3GDWA 1QWSA 2IJGX 4OXXA 3OJLA 3OFNA 2BGKA 5T7BA 1BVRA 4NFLA 2AFIB 3FYTA 4RSMA 1NIJA 16PKA 1P4JA 1XXHE 2ZUDA 1QMGA 4UEWA 4CLHA 2VC2B 4ROTA 4O2AF 4J4TA 4ZYZA 2OENG 3KPJA 2IHBA 4PHCA 3GN1A 5J47A 2QSUA 1O94C 3KLNA 3C3EA 1I0LA 1NAHA 1COWA 1GEGA 1RSZA 3UWMA 4Y9SA 5FH9A 3ZEAA 4QDKA 2JL1A 2FX3A 4XSHA 4LFAB 1KZ1A 3FMFA 4AZWA 3KYDA 3KQVA 3L77A 1L7XA 4GDMA 4LECA 3B6KA 1G8GA 2WP0A 1M3SA 1LGYA 2WYIA 4MPTA 4NPAA 2R1ZA 1JUDA 4LDQA 4Y1EA 5JANA 3BULA 4B7XA 1MVNA 2OHIA 3CVJA 3K8YA 1PNQA 1K88A 4G63A 4QUGA 1H2BA 3JWIA 3HEBA 4E3ZA 2ZBQA 4A23A 1OJLA 4MEJA 3T9CA 3GAAA 2RAFA 3M5CA 1NA5A 3U4AA 2FPLA 1SVLA 3VBEA 3RE1A 5LQCA 3DBVO 4WGGA 4WZAA 5EFOA 1X7ZB 2QTTA 3KQSA 3VU0A 3PEYA 3NS7A 2IS4A 2ZJ7A 3U48A 3HYSA 4RPHA 2J3LA 4R2MA 1DDOA 1CLEA 1I80A 1BHSA 1PZNA 2X6TA 3JYQA 3K0BA 3UTCA 2JCVA 5IKXA 5K8CA 3GAFA 4RDHA 5AUQA 5H4GA 5LQKA 2ICAA 4MRNA 3H4MA 4HNUA 1XEWX 2R62A 3ABRB 1I3KA 3CMCO 2A1TR 5F2EA 1HF3A 2D13A 1D2NA 4XLTA 4IPTA 1B8VA 4R8LA 2VRNA 3V6LA 1TA4A 2IHVA 5HOQA 1WBDA 2XF8A 1CDZA 1PEYA 3VZCA 1G0NA 1FDWA 2CLFB 4QUDA 1E94E 1Q91A 2QUKA 3OF2A 1BRTA 3HU2A 4QM7A 3R8FA 1JG2A 2OZKA 4X44A 4EEKA 3RDPA 5EKSA 1PJZA 1BMFA 1Y8AA 2JD1A 4UFOA 4BJ3A 4M99A 2DR2A 2XB8A 4N8SA 1O95D 1WMSA 2NVUA 5FBKA 3H3JA 3S1AA 1CUSA 5AFSA 2ONJA 1PSWA 5AESA 4QKQA 1GSOA 1HT3A 2FV8A 1T1IA 1N92A 3R24A 1BTOA 3ENVA 3RSGA 1SC3A 2XOEA 2P2LA 2RHBA 5KSYA 3FPCA 4MWCA 1X8LA 2CL5A 2CNBA 3OMXA 4OJKA 4C20A 2BFAA 2PGIA 2JIPA 1E3JA 2VBGA 2VHVA 2NXCA 3LC2O 4CKCA 4ARIA 2IYPA 3A7DA 1SQ6A 2I66A 3G2PA 1VG8A 3G9TA 3A9WA 3D6TB 2W2LD 4YX9A 3LKZA 4A0FA 3ABIA 3HCOA 2I3GA 2F4NA 1K6IA 1V95A 4D9MA 1AGNA 1KDVA 5JD6A 5ENZA 3KT0A 4I9NA 1BCSA 2A3RA 1W5EA 1TYAE 3SOZA 3AKYA 1XZNA 4AJ4A 1QCDA 2FR0A 2OOKA 4QSMA 3ITEA 3G85A 2PU5A 4D02A 3PHIA 1X8XA 2WWFA 4FI3F 4UATA 1SVUA 1IQRA 3VKWA 1U8UA 4QFBA 1NVBA 3L8MA 4LI3X 2DT5A 3AP1A 3A9TA 4CM5A 3ANXA 4MQBA 3JAMA 4QC2A 4QOGA 4X41A 3T8YA 2VIIA 3C7TA 3CF0A 3RS7A 4IDHA 3HJNA 1C8VB 1PK7A 3ZYZA 4PGGA 1H8EA 1ZH0A 3QLVA 1EWTA 2X40A 5AM5A 3I92A 3KB2A 2OPHA 4RULA 2JBHA 2XEXA 5HA5A 2QN3A 3HYLA 1KA9H 1P9LA 2CLOB 4PW0A 2Q21A 5CLJA 2BH9A 2EGHA 1TEXA 3JPWA 1AM4D 3H6KA 1T9KA 1QC5B 3TIIA 2CXTA 2WHRA 4DUPA 2HRDA 1AXGA 2PH3A 2YR0A 4Y67A 3G23A 3HA7A 1EX1A 3H6HA 1NFQA 4ZOAA 5H68A 4ND4A 2BFBA 3EXEA 1YIOA 2ZWOA 1VRCA 1W75A 2WFZA 3AWDA 4YJ3F 3HZOA 1Q16A 5B3JC 4FD3A 4I19A 3LC1O 5E4FA 1TM2A 1SHKA 1B74A 4TLEA 3T4XA 3T7CA 2UXCB 1DIAA 1MOQA 2PFGA 3GZNB 4H0FA 4JVMA 4N9QA 4MAFA 1JKXA 4Z4GA 1N0UA 4R6XA 1L4BA 1X3SA 1E9FA 2Q62A 1V5EA 3SZGA 4QUEA 2DHDA 3T9FA 3WGVA 2QMYA 5ED4A 2GZSA 1W2GA 3O9VA 3TCNA 1X9HA 2XYQA 3BRWD 1N4AA 1KP3A 1Z7BA 2PXHA 4O8CA 4QNRA 3QJGA 2FVYA 3AR8A 4K2HA 1VL6A 4MR9B 3UVEA 2WHQA 4GDFA 1TO1E 1BDBA 1FFXB 1OIXA 1R15A 1STOA 3CEMA 3EODA 4DR5B 1ORIA 2P9ZA 5HF8A 1TECE 2DF8A 3OZXA 1KE2A 1P1HA 3TW0A 1GR1A 1RS0A 4YJFB 2QVZX 3DLHA 2P8JA 3PITA 2E18A 3DQQA 2NGRA 1EUCB 2R96A 4RABA 1SVNA 3LFTA 1XCBA 1X70A 3M2TA 2J6IA 2WZQA 4J8PA 1IZYA 2EOAA 3COZA 3EGEA 4Q4JB 4ESVA 5H16A 1XP8A 4FNGA 4CPDA 5ELXA 4FS3A 4IGIA 1IXRC 4BLSA 1U6JA 2PRYA 2RGNC 1M1NA 1YE8A 1RCTE 1OCEA 4W82A 5E2AA 1TCUA 2JDID 1WTAA 4UVEA 5M5BA 4KO8A 1RKQA 2EJTA 2X8BA 3BE8A 3MD9A 4PFJA 3BGSA 3PFBA 3DBLA 5A04A 3JD0A 5DM2A 5EQJB 4Z7JA 2G8NA 4YQYA 2ZPAA 4JXZA 1YZHA 2Q4EA 3O7WA 1MT3A 4HUQA 5FADA 3ESDA 1GCGA 2JFBA 5B1DA 3PFIA 4CZ2A 1FTSA 3EF1A 1DBRA 1OTXA 3FUTA 4OF4A 4XM2A 4US2R 2QV7A 1ZN8A 2NUPB 5C8DA 1XCGB 1ID8A 3F74A 2VHYA 3JQFC 2ZKLA 4DLPA 3VSDA 2XJ4A 4F72A 3ANYB 5JUWA 2DGDA 4ZAYA 2GB4A 2ZVDA 4KAAA 3JYPA 2NAFA 4NLLA 2R7LA 4LSGA 3TI9A 2CVPA 5BVGA 3MTQA 4AQYB 3AC0A 4B31A 3MQ4A 5E4YA 4O4LF 1S89A 2Z8ZA 5FUYA 3IXLA 1W2WB 3R75A 1X7DA 3PLAE 1Z0AA 1CYEA 4XUGB 3ENZA 2ECKA 2NTEA 2IKSA 1H1TA 2FZ5A 4DSTA 4JJ6A 2BR4A 2GMWA 1NQVA 4LOJA 4MYSA 1NPDA 3SFZA 5IWCA 3WFJA 4CEJA 5I7OA 3REOA 4OHBA 1VLMA 2AJCA 3ILSA 4HBZA 3BHIA 1CR4A 1XXLA 2VHJA 5IDXA 1DEXA 1BDIA 3TTUA 3FGPA 4R2HA 1X38A 2FN7A 3MSCA 1YZUA 2O05A 4FFRA 4RO0A 1KZHA 1WXIA 4BLTA 4YXFA 1HOXA 3P52A 3GMTA 3JQDA 4LJRA 3AUAA 3HDYA 3PUWA 5KJ6A 3ZH9B 4BNDA 3GJ4A 4E13A 3ESZA 2Y1CA 4IHJB 1R5OA 2ZDHA 4S3MA 3WY9A 5LXTF 1XL0A 3KAQA 2AQIA 5K8IA 1N6PA 2IEYA 3BBLA 3K70B 4B4KA 1X7XB 3VGPA 3LQKA 1I7LA 1BCRB 1QOQB 2O8FA 2A0XA 4IOMA 4O4IA 1ST2A 1SIUA 2PYDA 3KBOA 3U4CA 3PU6A 3DT8A 3U3JA 4Z7QB 1P0QA 3DDOA 4A2PA 3PJRA 1MUUA 4R2KA 2YTZA 4FM9A 4B84A 1BH6A 4G0MA 2I9KA 4WBXC 1E3SA 4INJA 5DIZA 3WGQA 2PJUA 2KPOA 3HADA 4EJSC 2ZJ4A 4F6CA 3U4QB 1Z3CA 3L5OA 3ZXSA 3GVIA 1E5TA 1FVHA 2B1RA 2BE7A 4J7CA 3S0JA 2QSYA 3EUAA 3IMCA 4YTEA 2P2GA 4A8JA 4BZQA 1W8IA 5EXDA 1BMTA 3OAAA 4U6NA 1X1DA 1PJSA 4PAQA 5JC8A 4IDOA 1SCUA 1E0SA 1YZQA 2XUPA 4KN8A 4J2OA 4ZU1X 5F78A 1QX3A 3KJQA 3D8BA 3KLPX 5BOSB 1DUSA 3D9QX 4UW9A 5DHPA 1YQDA 3TTVA 3DMNA 4ZVLA 3A6ZA 3LQFA 4ZT7A 2VQ3A 5JTTA 4BFWA 1C1XB 5K3SA 1XVVA 5CX4A 4B73A 2JLZA 3P0RA 2R66A 1Q50A 1DC3A 1ENOA 1Y34E 1YOBA 2QRGA 2EV9A 2XNHA 4P80A 3DL7A 4UBIA 5FOSA 2IW1A 2QRJA 1YRQA 1R10A 3N0RA 1QE0A 3HGTA 3WJAA 3ILXA 3K0FB 4HFNA 4LXYA 4FYYA 3IB3A 1BXKA 1WXGA 2AG5A 3KJZA 2HIMA 4V1CI 4W5WA 3BZWA 4HJRA 4Y2SA 2W2XA 4ZVQA 4CDNA 3PKIA 2B83A 3E22A 1VE1A 1QDUA 1U2DA 2NSLA 3D3NA 4GM1A 4P4NA 3R3SA 3ZK9A 1KEPA 3ST7A 4AMGA 2JGFA 3RKUA 4QDJA 1ZSVA 1K4YA 4J43A 2GYYA 4HEJA 1JH8A 4N1AA 1Z3IX 2B2XA 3WL6A 1M6EX 1NNSA 1YRHA 3ENNA 5IJ0B 4LE1A 1BXGA 3SLRA 3PWKA 4YRIA 4N39A 3GC6A 1TJ3A 2GEJA 1RKVA 3I9NA 4C7MA 1I1OA 3CB2A 3EASA 1S4MA 1PEDA 1CFJA 2XA2A 3FYUC 3PEVA 4K6FA 2QRZA 5AM1A 3ZD9A 2CF6A 5JSZA 1EUDA 1E9AA 2CYAA 3AXSA 4UHKA 5IP5A 1YIAA 1FSFA 4M53A 3ROKA 1YBFA 4D3FA 2YV2A 1E4EB 1RD4A 4IXDA 4MQFA 4U8HA 2VDWA 3G2JA 1QHHB 2P1RA 4EMTA 3PFWO 5KNCH 2X4LA 5E9JA 1KVUA 3A6HA 4LGVA 4A7PA 2J3IA 4U3JA 2RGEA 4JITA 2J9FA 3G02A 4BQOA 1YASA 2PLNA 3EMBA 3FHOA 3KZKA 4O4JA 1TVCA 4HH0A 4IILA 2X2EA 4OGLA 1L1RA 1F0YA 1Z5GA 2QUAA 3VHXA 4BNMA 4E88A 4YCCA 1KZ7B 1QHSA 1F48A 2X7XA 2F00A 2X7HA 3ODPA 1QORA 2YIVX 5D86A 1YKGA 2IYVA 1KYQA 5AW1A 2V5VA 2CHGA 1X1SA 5LUBA 1VA5A 3TQCA 3FKJA 3I2JA 4JLPA 4R3WA 2VQFB 4LTMA 3K7EA 5EG5A 5GY7A 1NQXA 3DONA 3F98A 5AI9A 1OJ7A 1VIMA 4K81B 2OO7A 1P4SA 1FPMA 2WD9A 2ZBPA 3GJSA 3V5NA 2YXDA 3F6RA 1FUYB 3O2QB 3PDIB 4PYRA 5B53A 4A15A 3QFCA 2PH7A 4D46A 2CSXA 4B34A 4JIMA 2JLAA 3KD2A 2QP9X 1T8WA 2A6PA 3DOIA 4GKAA 4EGSA 2WG1A 4F06A 4M54A 3Q87B 1SBTA 4G0ZA 4CNQA 1NJSA 4PFSA 4GC5A 1RYZA 1T26A 1S2LA 2F9FA 4E1VA 4QTTB 3PEEA 3SR3A 3TSOA 4F8YA 2Y2UA 3ZI7A 4JXXA 2WQ7A 4FFDA 5P8WA 2JVJA 2OD9A 2ZS9A 4HRAA 3SS7X 3V7UA 3FF4A 4GO1A 3ZWKA 4DR3B 4DBVO 2D3TA 5CEFA 3A3PA 4EG7A 4PHGA 1RWBA 2SBTA 2HSZA 1J1IA 2Q2NA 2VWGA 2GO7A 2ODNA 2XDWA 1T6XA 4LBVA 1JFSA 4BKPA 3H2ZA 4TXHA 2IIPA 4CM8A 1W1IA 4QPDA 2XOKD 3TDNA 4L4XA 2FI1A 1T1SA 2I6SA 2Q5FA 4MV6A 1H4SA 3BERA 2HK9A 2QG9A 5IDWA 4ER0A 4LXQA 1LBIA 2Q1SA 4E2FA 1ZAYA 1QV7A 2MSDB 4Q1AA 1ZWKA 2EX1A 5E2IA 4UHHA 1GZUA 4EKDA 2ZLBA 3JXEA 4QO8A 2X0DA 5KC8A 5JS7A 2HIGA 3HBJA 2PWYA 3ZR4B 5IU6A 2AWNA 3QKRA 5DTRA 3NRCA 3VR4H 4Q1DA 4AVYA 1UZUA 3L0ZA 2B7CA 2D7JA 1OXKB 2H1SA 3IAAA 4YRMA 1B76A 2H11A 3QUSA 4UNSA 3ASZA 3I2YX 3UJDA 4BUCA 3Q15C 1FNMA 3G2IA 4HSGA 2G4CA 1HMYA 2IQIA 3KYCB 4ID3A 1L7VC 1O6GA 3KQKA 3AONB 2NUAA 1BU8A 3DKKA 3H5NA 3PL1A 3O4JA 3G0IA 5DB4A 5A5GA 1NUUA 3JRWA 3T54A 4TKVA 1CUCA 2D2FA 2Q4RA 1DX4A 4XDZA 3S28A 4Y3UA 3R4CA 4X71A 2R7KA 1M2JA 1KIFA 2CHFA 2J1LA 2H00A 3C3WA 4AJLA 2DCMA 4UHDA 3V1TC 1X92A 4AJ9A 3MJDA 1T0BA 2H1WA 4WCVA 4DREA 4FFMA 2OCGA 2DR3A 4WRRA 4YXWD 3P0JA 1T0IA 2Y0EA 4WI1A 3SLKA 3EDRA 1SXJA 3D3WB 5HK9A 2PS3A