1MA3A

Structure of a sir2 enzyme bound to an acetylated p53 peptide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
242
Chain Sequence
MEDEIRKAAEILAKSKHAVVFTGAGISAEGLWRKYDPEEVASISGFKRNPRAFWEFSMEMKDKLFAEPNPAHYAIAELERMGIVKAVITQNIDMLHQRAGSRRVLELHGSMDKLDCLDCHETYDWSEFVEDFNKGEIPRCRKCGSYYVKPRVVLFGEPLPQRTLFEAIEEAKHCDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVNAEPTMADPIFDVKIIGKAGEVLPKIVEEVKRLRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein, Sir2 family
publication title Structure of a Sir2 enzyme bound to an acetylated p53 peptide
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding, transcription
total genus 84
structure length 242
sequence length 252
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1ma3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ma3A01
5IMSA 4K9PA 1D4OA 4D5GA 4ZP1A 3CLRD 1POWA 4MPPA 1YC5A 3JR3A 4F56A 4JUBA 4K9QA 3PKJA 1Q14A 4JU8A 3PKIA 2JI8A 1V5GA 4JUAA 1EFVA 4UTXA 5K6TA 2EZ9A 5BWNA 1EFPA 1U28C 2EZ8A 1U2DC 2V3WA 3JWPA 4UU8A 3D4BA 4X3OA 4QQ8A 4BVFA 4FZ3A 1Y9DA 1OZFA 1JSCA 4UTNA 4FEGA 2B4YA 2EZ4A 1M2JA 1XLTC 2WVAA 4TWIA 4GM1A 4JSRA 1N0HA 2VK8A 2NXWA 2A1UA 1SZDA 1YI0A 3HWX1 4MQ5A 4L2IA 3EYAA 1PT9A 2NYRA 2QQGA 5EJ4A 1HZZC 2X7JA 4TWJA 4UTRA 1Q6ZA 1PVDA 4BN5A 2Q5JA 1U2GC 3GLTA 2H2DA 4I5IA 4BN4A 2VJYA 5EJAA 2C31A 3ZGOA 3PDHA 4V1CI 3GLRA 3F6EX 3EA4A 2FR8C 3E9YA 4BVGA 4JU9A 4RJKA 1U31A 2WVHA 1M2NA 2QQFA 4HDAA 4RMGA 1Z8NA 4V1CB 1MCZA 5MF6A 4IG9A 3GLSA 4MPRA 1Q17A 1MA3A 4KPUA 2JI7A 3RIGA 4Y6OA 3EY9A 2H4HA 5MGNA 4RMHA 4K9KA 5BWLA 5DEIA 4GM0A 2VK4A 2Q29A 4COKA 5FYQA 5BWOA 2EZTA 4BV3A 1YC2A 5EJMA 1OZGA 2PGOA 1S7GA 4RJJA 3HWWA 3OE1A 4JUFA 2A1TR 4C7BA 3CLUD 3LQ1A 1T9DA 2Q5OA 5EJ5A 2H59A 3CLSD 2EZUA 4IAOA 4FVTA 2DJIA 4KGDA 4L3OA 2WVGA 1QPBA 5EJ7A 4MZXA 5DGTA 1YBHA 2BRUC 1UPAA 5FEMA 4UTVA 5K2OA 1M2HA 1O97D 3U31A 4RMJA 2H4JA 2PGNA 5EJ6A 1YI1A 4UTZA 4J16C 1BFDA 2VBGA 4JUCA 5EJ8A 2AG0A 1ICIA 1M2KA 4BVBA 4G1CA 1V5FA 2IHVA 1YHZA 4IF6A 4BVHA 1O96B 1T9BA 3F6BX 4MPJA 4KXQA 4UUBA 2W93A 3ZG6A 2OD2A 3IAEA 3FLMA 4V1CA 3CF4G 2Q5QA 4BVEA 1UPBA 5AHKA 1OZHA 2JIBA 2FRDC 2FN3A 2H2IA 2AG1A 4JUDX 4FEEA 1SZCA 1OVMA 3GLUA 4RMIA 1NM5C 2JI9A 4GP9A 2H4FA 1PNOA 3IAFA 4JT9A 2FSVC 4GG1A 4ZZIA 4BV2A 4X3PA 2OORC 1T9CA 3FSJX 5MFPA 1J8FA 2JLCA 4J1TC 3CLTD 2IHUA 4Q9DA 1E3TA 4UUAA 4JD5A 1DJLA 4Y6LA 2HJHA 5MFZA 1S5PA 4JT8A 1Q1AA 4O8ZA 2H2GA 2IHTA 1T9AA 2Q28A 4QPZA 1POXA 1PI3A 2JI6A 4GM4A 1PTJC 4K9MA 1YTLA 5D7NA 2VBFA 4BUZA 5EJ9A 4RJIA 2H2FA 5DGDA 2H2HA 4UU7A 1YHYA 1UPCA 3D81A 4R8MA 1V5EA 2OD7A 1PYDA 2Q5LA 1PNQA 5K6RA 4K9LA 4GPEA 2JLAA 4C78A 4D5EA 4F4UA 2OD9A 4K9NA 4QELA 3K35A 2Q27A 2VBIA 2VK1A 2PANA 4K9OA 2OO5C 1ZPDA 3ZGVA 4Y6QA 1M2GA 3D7KA 3RIYA 2UZ1B 1PO7A 2FWNA 3U3DA 3FZNA 2UZ1A 1YNOA 5K3SA 4HD8A
chains in the Genus database with same CATH superfamily
3BXPA 1WJGA 1RBZA 2X1MA 4WIAA 8OHMA 1UM9B 4OFWA 1XF9A 2Q1WA 4BN0A 4BJ5A 4S05A 1NN5A 2Q6OA 2YXDA 2YTZA 5BRNA 1PD1A 3DHWC 3KU4A 1TADA 2G72A 2NO7A 2XOKD 1MB3A 3A6DA 3HXKA 4GC5A 3SE7A 2V9CA 1S2GA 3C6QA 4O2BB 2ICAA 4OFZA 5TNXA 1C3JA 1S02A 1SVIA 1N9GB 2J1LA 2X8AA 4NOMA 4Q4HB 4TTAA 1PYGA 4X1YB 4XM2A 1YE8A 4F6RA 1A3CA 1POWA 1OHHD 4C0BA 3AM3A 2P6RA 5JG7A 1L5HB 3MEQA 4E21A 2JH8A 3PUJA 1GIAA 4P6VF 3TSYA 4LSMA 9MHTA 4MVJF 3A6PC 2ZWVA 3MTQA 2F2TA 2DRIA 5KSPA 1E96A 1X1BA 2FPGA 2ZWIA 4QUDA 1BHSA 1VLZA 4BMXA 3L1UA 5TLSA 1T43A 1XTRA 4RJTA 3RSGA 5DM70 1W0JA 1HI9A 3HE3A 4EB6B 5JVDF 2ZZMA 1ZR4A 2O8EA 2QAIA 3RGWS 1IZ8A 2BM1A 2CNKA 4ENSA 1JR3D 4PGHA 1TVEA 2FSPA 1LSSA 2JI8A 2NUAA 3KKZA 4ZDIA 1I2MA 3DLCA 2XUZA 4O4HF 3U7EB 2OLKA 4RD6A 1KI4A 4NMMA 3FYUC 1JHQA 2PNJA 3LP6A 3PEYA 3PWZA 4Z2AA 5K6TA 2AVDA 1P45A 4O1IA 5SZHB 4NU5A 3MLBA 4B5KA 3NT2A 5ULLA 1VKNA 1G5IA 1CQXA 4JN6B 3ZCRA 3TYXA 4IDNA 4A6EA 1J5EB 5BN4A 3WGZA 2YIMA 3LHKA 3QYAA 2VH5R 1KHHA 4YT5A 3BTSA 3NC0C 4D3DA 5JAHA 3DSRA 5DX0A 3L04A 1SKQA 1KAHA 4BNXA 4C0AC 3WGIA 3KIPA 1KAGA 1O8CA 4KPGA 5TX7A 5B3JC 4OHMA 1BU8A 2YINC 1A8UA 2WBLC 1R4NB 1WX1A 3N28A 3LBYA 5BQ5A 1Z15A 5K3AA 4BNYA 2XYPA 1T4BA 4M0EA 4YMGA 3F73A 4U63A 3EOAI 1VBFA 2IU4A 1II9A 2WWTA 4F4FA 3MG9A 2KPOA 3ISVA 1OBFO 2CUKA 4IXDA 3UB3A 2ZUCA 1W2GA 3BFKA 2PMCA 1ARZA 2CHQA 2HUNA 1L5NA 5CP8A 1P4JA 3C3XA 4HV4A 1ESNA 1A9RA 1UDBA 2D2IA 3OZWA 2YYSA 3GEDA 5A04A 2LVBA 2ZKIA 3DZKA 1EYZA 3AHFA 4N03A 1CK4A 1H94A 2YZKA 5JJLA 4YCLA 4P3PA 4N76A 4B35A 2X4IA 1KOLA 5IZCC 4GBMA 4K6OA 3SC2A 5ICGA 5A7HA 3T3IA 1JR4A 2V6MA 2F3RA 2FSIA 3CRMA 5CXSA 4DV5B 1RW4A 4B3DA 4LY3A 1RYYA 3BIWA 4BAGA 4BO7A 2V7QD 3MWLA 5B55A 3COSA 4F12A 2FEKA 2VK8A 3JAKB 4PSDA 5KWVA 3W9SA 4TKLA 1FQWA 3BWEA 1QPGA 4ZVMA 4C1BA 3IDAA 3WSWA 5DN6D 4IV0A 1NG1A 1VHLA 3Q9NA 2G8NA 3RF6A 4GR4A 1F2TB 1FS5A 5JWOA 1AS0A 1P1KA 1CS0A 4O1MA 4IGFA 2XR1A 5EIAA 3P5SA 1DX9A 3RUAA 4NAUA 1EX7A 2JLUA 5JXJA 4ATNA 1WPXA 2Q9UA 2VF5X 1SHLA 5T4HA 4W9MC 3SZRA 1RRCA 3BWVA 5JD6A 3PXEA 3AP3A 3OQVA 2WY2D 4PYMA 2WJAA 5HKOA 4G9GA 4UFNA 2XUFA 2PRJA 1KQGA 1ECLA 1PVDA 1RXIA 2VXBA 2C2YA 2ECOA 3KQUA 3BD9A 1SXJE 2SCUA 7GPBA 4LZWA 3KWJA 4OREX 2CN1A 3PGLA 4OQFA 3TRFA 1FRVA 2V7XA 1O94C 1D2HA 1OXVA 2R7KA 1K8ZB 1YS6A 3NKVA 1WUJS 3IJ5A 1X15A 1JKXA 1OKKD 2I2WA 4G5RA 5EJAA 3OJ0A 2GJAA 4ZVPA 2ROQA 5LUAA 3KQSA 3IVCA 3IBTA 4WGGA 4TMFA 1Z73A 5FADA 3GCGA 2FXIA 4EF5A 3U6KA 2XCTB 1CDEA 1EJ6A 3N59A 5DX8A 4B87A 2P3SA 1H2RS 9LDBA 3D3WA 2W6ID 3MJTA 4KQ2A 5C35A 4C0JA 3NASA 1E99A 1N2BA 3OJOA 2BFCA 2QM0A 4E94A 1Y8RA 2JCSA 4XX0A 2D6FA 1I2BA 4E15A 1L7XA 2EHDA 4U5QA 1Z8NA 4NBLA 3G0DA 3OPXA 4RBNA 1MW8X 3ZCVA 2WYVA 4I6GA 2RHTA 4H7EA 1SIBE 1MO5A 2GM5A 5DNUA 1D03A 4YCBA 1TPYA 2XOKA 1U3DA 3MCWA 3STHA 3FVQA 4LZJA 4CT5A 4CIYA 4EY4A 5I7SA 3JD3A 5IKOA 3VC1A 3AZQA 4LJYA 3AUAA 2DQYA 2C2XA 3R3YA 1OF1A 3O1HB 2ZI4A 1YZTA 1TCVA 4YJDA 4XASA 2JI7A 2NO6A 2XD4A 1O9GA 4C4XA 3MLEA 4LDRA 2V5AA 4P4LA 1JJIA 1QIKA 3LHDA 4ZYVA 1K3FA 3IEUA 3WK4A 4MVJP 1OROA 4G5QA 4RDCA 5F21A 2QTLA 3LYAA 1KPHA 3Q72A 1ZX1A 2R5FA 3EY9A 5GAJA 2QIPA 1Q1BA 2I6XA 4LIPD 3F96A 2O2ZA 1B2RA 1ISJA 3O2NA 4Q3BA 1ULTA 3EASA 3ROEA 1D2CA 2LCIA 2DXIA 1X3SA 1TF2A 1ZVVA 1E7YA 4DV2B 4EJSA 1OXMA 3CNHA 1Y9JA 3OQ6A 5FWXB 4HDNB 1E59A 2EZTA 3KUKA 2HA6A 3TUJC 1C1XA 2RK4A 3MWDA 2MYNA 2WV7A 3D4PA 4P4UA 5K0ZA 4FR0A 1YC2A 4KXMA 4PS1A 4MV5A 4Y1GA 2GMWA 3ZQ6A 4CMIB 4ZI3A 3B5IA 1P7WA 2WWFA 2OHJA 4X1KB 1WMDA 1TZJA 3E3LA 4ANFA 2UAGA 4DYDA 3HVKA 5KTRA 2X2PA 1VMDA 2LIPA 1FP4A 2KJQA 3W7VA 4AG3A 4FHFA 4B4KA 4CVNA 4MUMA 3Q2OA 4CQJA 4ZEMA 3IOEA 1OW3B 3FZGA 4ILEA 1L7PA 5T64A 2AOWA 1X8JA 5K0LA 2WWVD 5FBVB 1GHTA 3PL5A 3TI7A 4RJLA 7ADHA 5C0OE 3DCIA 2RHHA 2ZDQA 1ADJA 2LE0A 2CLLB 1W4BA 4BYMA 1H1LB 5C37A 3HBMA 3KTAA 1M73E 1EVEA 1UBKS 1O8BA 3DVLA 5FXMA 3ABIA 3DR3A 3RVQA 2WWHA 2X86A 1FE8A 3MRXA 1KARA 4QODA 4F4CA 5D3QA 1OCEA 2O20A 2MR6A 3PUHA 5JDCC 4TS1A 2RHRA 3LXRA 4C4PA 5B7NA 3AU8A 1L8XA 4HWGA 5EUBA 1LI5A 5HPYB 3ICEA 3R20A 4GX2A 3NV9A 1QBGA 1E1LA 2PKYX 3DUFA 3DUWA 5HKKA 2EJWA 1Y1PA 3Q41A 5HFAA 2IUEA 4TVOA 3SBEA 3VU0A 4M8IA 4TZTA 1CRQA 3LHSA 4KDEA 1KPIA 4NE9A 5GJVC 5A06A 5CEJA 1RZVA 4ETIA 4AULA 4BNTA 1KK3A 2BRUC 3A0RB 3ZY6A 4BFCA 4I0WB 4DMLA 3GZ4A 1R16A 1AHNA 3M6FA 3P0IA 2I91A 1R6BX 2V7QA 5LYYA 4KPYA 2R97A 2XODA 5F4BA 4NOJA 3UVEA 4HUTA 2R44A 1VP9A 3DTNA 3H84A 4N0DA 4X5OA 1KEVA 1YBVA 1N34B 2C9CA 3GJ8A 3GLHE 2VOEA 5DN6A 2WJZB 3M89A 2O07A 4JI0B 3RQIA 2B69A 2JD1A 1FX0B 1Z4JA 3GX1A 3HP7A 4KRGA 4L6CA 4ZO9A 4C5BA 1X7ZB 1ZG3A 4OHWA 3Q98A 3IPXA 4CMKA 1XJCA 2VRWA 4J91A 4P2GA 4NNJA 4UTZA 2ZROA 4KE9A 3WLQA 4HDQB 3WWPA 4AKTA 4DSOA 1JQ3A 1PLKA 5A4IS 3GPIA 3CWZA 4Q21A 3A9VA 1MABA 1NFRA 3VDMA 1AKYA 1PIWA 1Z0IA 1V1MA 1ADCA 4XH9B 1V2HE 2GBIA 1O0BA 5ENDA 1G8HA 1J07A 2ID8A 4IDEA 4KWEA 2PO5A 2WYHA 1MR3F 2CUNA 4AFNA 2EFYA 2NYUA 3PWKA 1U2DA 4A2QA 1EDBA 3KK0A 1CZLA 2P69A 1Q2XA 1AQYA 1HK7A 3BX1A 3DMDA 4LV6A 4P7KA 1E2KA 4CODB 3KYIB 1OKKA 3K1ZA 2QG6A 4Y2TA 3ZGLA 1QGYA 2PKXA 3FZEA 1DRKA 3H8WA 3U0BA 3HDYA 5BN3B 2C5FA 4YIKA 2I4NA 2W6IA 1QIHA 5T57A 2X5JO 1D1QA 4G65A 1UAGA 2VHWA 5JASA 1XCBA 1N6NA 1WV0A 3WGJA 5JMOA 2V3VA 4UCWA 4WGFA 4RIIA 5AHKA 2WICA 3RC1A 1HDOA 1T4CA 3GUHA 3PJEA 4KR9A 3F3KA 3FI9A 2LTAA 2UYOA 5HILA 2IV2X 3KLOA 1YGYA 2NQTA 2ZQYA 1COWD 1M5UA 3NHRA 2BEJA 2ZUBA 4HI0E 3OLVA 1NF2A 4EUFA 2ZRPA 2FA9A 1V4VA 1O6ZA 1ZA2A 4FGWA 1W7AA 3J7AC 2M6SA 3HVRA 4F6RB 4WERA 1SKYE 4GR5A 5H3HA 4WUTA 4F72A 2ERYA 3ANTA 5E7JA 2WHPA 2Y77A 1Y82A 3OWHA 4L9SA 1SXJC 4QNRA 3VR5D 2D0PB 1W35A 1TDJA 1LU9A 1ZISA 2QR2A 4MKRA 1QZXA 1ORDA 1PNOA 1W25A 4JT9A 2C3MA 2SKDA 4FGKA 5E9AA 2GXAA 3EB9A 4RC9A 4ZVOA 4PC2A 1E1RA 3OY2A 3PFBA 2DKFA 3WNVA 6PFKA 2O8EB 2OXCA 3TLEA 1PVVA 1KXZA 4R6XA 5IAOA 2XV1A 2NUAB 4M9ZA 4R4JA 2JC3A 1QHIA 4Y6RA 1WNFA 3LJKA 3FHOA 4Q9DA 3TSCA 3VPSA 1EDZA 4UUAA 2XTJA 3AJ8A 3FRIA 1Y89A 3MS7A 2F8TA 1SC9A 4XFJA 5CK4A 1JDNA 3H87A 4KYVA 3VC2A 3O73A 3PC4A 5HVNA 3HPRA 2IYQA 1CDDA 2PWBA 2XT9A 3ZHUA 2BJHA 2KI5A 2WRZA 2BHLA 2OKCA 1DWPA 4YVFA 5BN4B 1V3QE 3F5DA 3CH5A 3NBYC 3L0OA 4DGQA 1NNEA 1CWUA 3JQBA 1Z2DA 3M3DA 3TLGA 3DAOA 3QPAA 3BWXA 4IIFA 5CK5A 4EPVA 4MS1B 3T99A 4Q47A 3FFTA 4RK6A 4A8HA 5CFRA 1CUEA 1U2EA 4KFTA 3SQXA 1CUYA 2B9VA 1CJSA 2LV8A 3TRJA 2L17A 2QD5A 4JJFA 1F12A 4XYMA 3W6NA 3UICA 1CE8A 2BFDA 3QJGA 4AUEA 1YTLA 3QNMA 5AICA 3DHVA 2FPLA 3QP9A 3OZGA 5EL0A 4K6GA 5IDWA 5D7NA 3HN6A 1BOFA 1MFZA 2VBFA 1A4IA 1IATA 1SUFA 2YHUA 5C5DA 3WAGA 2J3HA 2EW1A 5TF0A 2JHGA 5H4GA 5JFOA 3WYBA 4IVPA 1WQ4A 3DVAA 4ZI7F 2GBFA 4O3MA 2MHCA 2VKQA 3LDHA 4FFOA 4B3TB 1JZSA 3ROGA 3NI2A 1D4FA 2FPIA 1GYRA 2XHEA 3ZDBA 2FUKA 1L5YA 2YMPA 5DCWA 2XB8A 2WPDD 2GJKA 4U3JA 3QLEA 1JFSA 5KIAA 2X5NA 2H63A 3ONWA 4CNQA 5A5VA 3KQYA 5LQSA 1W96A 1QVRA 1UZNA 3WLAA 2RBKA 2OCDA 4TYMA 4X7MA 2HHHB 4K9DA 2HU5A 5LKAA 4RFLA 4HH4A 3HFJA 3O6VA 4JLWA 1UK7A 1J09A 4QXQA 1XZDA 2W4MA 3BMQA 4AX4A 4O02B 4MVCA 2OV2A 4GLLA 3PSHA 1CS0B 3GLIA 3BUSA 1FTNA 1V0JA 3N2GA 4IIHA 4GGPA 2D7DA 1CNEA 7YASA 4RTMA 3C3DA 1KETA 2O9JA 5C8ZA 3IXLA 2O50A 3TLZA 2VBIA 4BRZA 3LPLA 4IINA 1V43A 3T34A 3BBLA 4RVSA 3D43A 5BNZA 1U5BA 3LNTA 2VDPB 3WAJA 2A2ZA 1W0KD 3TXXA 4BEJA 4F2WA 3DEYX 2H3EA 3N74A 4CI9A 4FGLA 3HV2A 2SCUB 4QSMA 1E58A 2I33A 2HA7A 3EIEA 4R69A 3UCXA 3MLAA 3A6HA 5B3LA 4G5XA 1P75A 1M2GA 3WE7A 2YDXA 2GYVA 3LKDA 4RQAA 1UR5A 4UNSA 5B1DA 1VLQA 2HA4A 4MKIA 3VU1A 1GRNA 2W58A 2ZDHA 3AP1A 2J4FA 1NSFA 2RGNA 3AY0A 2WFMA 4JJ4A 3FOZA 4ZRMA 3IAS6 2FSHA 3LHIA 2J3QA 1KYVA 3IE2A 1L7DA 1W8IA 5KU1A 2HFKA 1JDZA 2RGAA 4JJKA 3EWIA 3U40A 5IKPA 5L45A 3JQ7A 5JMPA 1G7SA 5ECYA 1CXZA 1SQFA 4B44A 4K9PA 4I50F 1RAHA 5CT8A 4E07A 4AKHA 2BFCB 3MCTA 4BWFB 3WB1A 5AXCA 4DANA 1RAEA 5L3RA 4WOCA 1XZEA 2VSOA 4DA6A 3GRAA 1YI8A 4GD3Q 3UWPA 3K71B 2J4DA 4UM8B 1COWA 1H8ED 4M1KA 5AJTA 3UMSA 5F7OA 3A3NA 3R41A 1P5ZB 2GWRA 4MH0R 3VHLB 4PNPA 4FYMA 3V7FA 3ZTWA 3EZ7A 4P82A 4QAQA 5LFAA 3BKXA 1E5LA 4KXVA 4YAOA 4LE0A 4MO9A 3V1TC 5HNKA 1R9MA 5INTA 4OLHA 5IVHA 2ZYWX 4EG7A 2ZRAA 5CIYA 3E7XA 3LO8A 3UOAB 7MDHA 3EE6A 2B0JA 1PG5A 1XZHA 3H1FA 3VR5A 4F56A 1YB1A 2B5OA 2VJCA 2AFHA 5BWCA 2EX0A 3E7WA 1R8SA 4O29A 3SX2A 1UWCA 1JFTA 4TWZA 5I4KA 1Q14A 1WQ1R 2ZRMA 3GO4A 4B6FA 4EHIA 3SS9X 2JK1A 3CX8A 4DNQA 4A0QA 2MR5A 1C4WA 3PNSA 1EK0A 2D2FA 4JUAA 2Z6AA 1CV2A 3DG9A 5HWSA 1COZA 5AKYA 4EJSB 5JI3E 5F98A 4N0EA 5J9FA 2HMTA 4XTRA 3DFIA 5H1YA 3VYUB 1I36A 1C1XB 3MWDB 3F7TA 1H2YA 4G8JA 3IKLA 3VNUA 2RC6A 4ZI5A 1FLDA 3GA0A 5FV4A 1LNZA 4L8GA 4REMA 4P98A 4URUR 1DLIA 3PD7A 1K7EB 2QSYA 1E1YA 3BJMA 4G97A 1LWOA 3ZJ4A 1QJ4A 4KV7A 4DILA 5JH7A 5EPEA 2BSQA 2D00A 2ORIA 2VQ3A 3JVUA 4EG8A 1FP4B 1JKJA 4IDFA 5GJCA 3G2PA 4FC6A 3RH0A 4AC9A 1Z6PA 4XWKA 3FIUA 5LPNA 2HCBA 3KZMA 5F5NA 3RTAA 4CWAA 3KJIA 3AVXA 1V3UA 1Z29A 3VH1A 2B20A 4Q02A 4BE4A 1Z63A 1TJYA 1SJ9A 4NOKA 4UQOA 5KYXA 1YULA 1WD5A 4NYJQ 5CR9A 2YS7A 3VPDA 2W6MA 3EQ7A 3D6UA 3KTAB 3IHKA 4KODA 4ENPA 2VDNB 1E77A 4HEA6 4BZZA 2ASVA 4HYYA 4UTNA 1AZWA 1M1ZA 1HDCA 2WYOA 4M60A 4BQIA 2RGRA 5DP2A 4P32A 4C2UA 5HM8A 2ZR0A 4J7UA 4MEBA 4Y0VA 3QI7A 3SBDA 3H1AA 5BUCA 2FP4A 3DUFB 4CKBB 3STYA 4YRSA 4D4KA 3U49A 3M4XA 3V4ZA 4UMDA 4D44A 1LF5A 1RXVA 1JBKA 3NBZC 3HCRA 2IW1A 3PX3A 4CKCB 1EK1A 4G4IA 1FFCA 2C00A 4KGZA 4ES6A 4RULA 2WPDA 3L7IA 1EIZA 1T5OA 4GSYA 4IHQA 2J9ZB 2E5LB 4CMCA 2R86A 2ZUDA 1O77A 3PRHA 4IO1A 4ZU3A 3ZHYA 4BLOA 4EFNA 3DCYA 3OCWA 3UUFA 4BMCA 2X3UA 4LHEA 3WHIA 4H1UA 2HN9A 3EYAA 1OE0A 5JSYA 1MJHA 2C04A 2PNFA 2EFJA 3BJEA 3GU3A 3P7MA 2QAGA 3FF4A 3FW1A 1Z0AA 3B51X 1GSHA 1XYVA 1XKLA 5KYTA 2RMKA 4RENA 4ZJZA 2H5EA 4LHSA 1XTVA 3O8OA 5CJPA 5GVSA 2D1RA 3WYAA 2O6LA 1Y4ZA 1RIFA 4M8NE 1QYIA 2F9FA 1UFRA 4BN5A 1ZH8A 2PAFA 3GJRA 2GUWA 4F9TA 1R18A 1WZUA 3PQ6A 1MABB 2CLDX 4JI8B 4R6WA 1W0KA 5KNDH 3D5TA 4U7FA 1DC8A 1V1MB 2BTOA 2QIOA 1RD4A 1L7NA 1JJ7A 3BICA 1MAAA 3RI3A 8AT1A 1M1UA 2C9OA 4IIJF 2AUNA 3DEFA 4QNNA 4HF7A 1JA9A 3HB1A 4L75A 1XDUA 2C31A 2C99A 2FETA 3L8ZA 5ALIA 4NXMB 2CVPA 2R5WA 4CM9D 3CF6R 4N5IX 1KS2A 4JENA 2VP0A 3U16A 4HBZA 4G8CA 5CB4B 4KGXA 3QQPA 3A32A 2H1FA 4FPXA 4BWYA 3ML1A 2BFAA 1F14A 2VPTA 3HLKA 1FDUA 2E3JA 4FYPA 1Y4SA 5AK6A 5CNMA 1TT5A 3RU9A 3BULA 2B8EA 5JCJD 4TOIA 1B41A 3MWEA 4P58A 4U9HS 1Q57A 3BRWD 2MYTA 1L4MA 3JU3A 2QLNA 4QNMA 3WGYA 4BE9A 2C5GA 2BR5A 3P9KA 4GPTA 2G77B 2ZIUB 4P33A 1L4UA 3WSTA 3HDJA 1ESZA 3G1WA 4JJAA 1JILA 4DIEA 2QAJA 2YN0A 5BW6B 5AKXA 4DA8A 1T4CB 5HYVA 1I4LD 1AQLA 3DW1X 5EZYF 2OY0A 2GF0A 2RJOA 2H1HA 4R54A 4DPKA 4KPUA 5D86A 3EZFA 3O8NA 2PMKA 1H8EA 2I1WA 3N6RA 2BFOA 3E9RA 1FTSA 2WTBA 1DAFA 2YN4A 4IIYA 2VUUA 4WLUA 2W8BA 1RZRD 1OFIA 3ZE8A 3BJZA 4GRAA 4BRUA 5JS7A 1XLTA 1RVV1 2D5LA 3L6DA 5FL3A 3KAKA 1A1SA 3CFYA 3DAGA 4YH1A 4Q7EA 2WHPB 2O7SA 5EUCA 1DCKA 2NVUA 2YHBA 1V8DA 4DUZB 2FEOA 1GFSA 4TUYA 4RPHA 3LUCA 1T8RA 1U6JA 1W85A 1ONSA 1W1WA 4DE5A 4IWXA 1Z0FA 1FK8A 4DV4B 3F5FA 2FW0A 3OU2A 2IEGA 4H1WA 4ZCTA 4NS1A 3MS2A 4PYQA 1T3SA 3K73O 1TM2A 4D3ZA 4IDCA 2C95A 1VE1A 2W6CX 2J7PD 2NV2B 3RVLA 3AF2A 2JFYA 1EJ0A 2GAIA 2Y66A 3BXZA 3EAGA 1YR1A 3KZVA 1FRNA 1QNFA 4JL5A 1HOXA 1Z35A 2WU0A 3UJ9A 2A33A 3OZFA 3QZUA 5CNIA 3E8SA 2DYKA 2RB4A 3L4JA 4GICA 4OU4A 1NUQA 2IHBA 1HE1C 4L4ZA 4CF7A 1KY4A 4ZOEA 3HCNA 3PVCA 5CTJA 3TLGB 1A76A 3LNCA 4BU1A 1RU3A 4LJKA 5AHWA 3HP4A 3G0HA 2JNWA 3D8UA 2VHTA 1XZQA 2OYCA 3F78A 2EJVA 2PLAA 2O2SA 4I1UA 4B6OA 3DLBA 4GX5A 2FTKE 4NBVA 4Q6WA 2I7DA 4EUHA 4NG5A 2DBZA 1CE8B 2CHUA 2BFDB 3DT8A 4LDPA 3DBRB 4FTWA 3H75A 3OEED 3QUCA 4RELA 5AT1A 1T4MA 3E18A 5AJXA 5EJ7A 5KWIA 3RRNA 1P7YA 4BB5A 3TGPA 2X9LA 4G1MB 4N82A 1LZLA 4DY6A 2IDJA 1IFXA 1A5SB 2OBLA 4DDMA 2Y1FA 3LCRA 4OHOA 1YO6A 3DVAB 3QW2A 4KSCA 4U2KA 2Z1NA 4D8VA 3A6FA 2Z2XA 5KX5A 3VAYA 5GGXA 4UCQA 2P1RA 4IDQA 2O1WA 4RHFA 4PSAA 2FPIB 2Q3CA 1K8YB 3GNQA 2ONCA 4P92A 3VJKA 4M7PA 4FT2A 2W6NA 4U3JB 3AR9A 2AHOA 2GPJA 2YL2A 1ZJ6A 2W4IA 4BCBA 4KR6A 4J03A 1E4OA 3BFJA 4ZALA 1TCUA 2WA2A 5FLKA 3RUFA 4CL2A 3P9NA 1G0NA 4PLTA 5AW5A 2FW7A 3IKVA 2QUZA 3JARA 3OA2A 4PO9A 5LXTA 3AF1A 4AK9A 3P0RA 4EGFA 3L8GA 5CFZA 2ILTA 5JZBA 4M53A 4TRJA 4BQSA 2DF8A 4YRCA 2Y27A 3QPUA 4H6VA 3IT0A 3GLIB 1AC5A 3U7QA 4IG4A 3O8CA 3N2GB 2ZK7A 3BN3A 4FOSA 5GONB 2YASA 3D1VA 5HF8A 4F96A 3I5MA 3WKDA 1CZHA 4ZAYA 2ZYAA 5B58T 3P0FA 2HRDA 1SN7A 5KQLA 2DETA 1U63A 1P2GA 2VATA 2P0EA 121PA 5EKDA 1U5BB 1LBQA 5JRJA 1MAVA 2VT3A 1NAIA 2QR5A 3I62A 3HJBA 3KEMA 4Q1FA 2I55A 1YJCA 3EJWA 3LUJA 4LJSA 4O59O 1AK9A 3M9WA 4G5SA 3QVGB 3T95A 1EP3B 1E7MA 2AC7A 4JBWA 1BW9A 2NO4A 3NNNA 1AURA 5IBRA 3RFXA 3UAXA 3VI3B 3QOXA 4EA8A 1BCRA 5J43A 4HWKA 4CM9A 4Y6SA 4UUBA 1QGUB 3WL6A 2VJPA 4RZIA 2ODQA 2N0SA 4LYGA 5C2JB 5F35A 5TGDA 5L51A 4I1VA 3ND6A 4DT1A 2BGUA 1I1OA 3JQFA 1J0AA 1UDCA 3PQ7A 1MIHA 4EG6A 2CWWA 4IJQA 1JTFA 1NVVQ 3QY9A 1Z5OA 1L4YA 2EL9A 2Q5QA 1JEOA 1TFUA 1QRRA 4L57A 4R1LA 2YH2A 5JCJA 3WHKA 3BRWA 1F9AA 1HOTA 1N2GA 1H69A 1TA0A 1XD8A 2JIBA 3DXXA 1BEZA 3EXIA 4L6AA 4OBEA 5JHHB 1ZMRA 3HABA 5CA0A 5E2BA 3T4PA 5AKKA 3TZEA 3WKCA 4F5EA 1LWNA 3EGXA 1VFNA 3BZWA 3RU3A 3UN1A 4AMVA 4FEEA 3C7CB 3GNTA 3SR4A 2O8BA 3DD5A 2ZJ0A 3X1DA 5TF4A 3KG2A 3REQA 1FY2A 2WW8A 3TQQA 4YV1A 3U4QA 1UXIA 5TQJA 1B14A 1JG7A 2POQX 3HZRA 5F7JA 2CV0A 1XJWA 3TE7A 1X8KA 2W2NA 4K28A 4ZVLA 3LL7A 5FAKA 2PFKA 1PGOA 2XWBF 5KC9A 2E89A 1L2TA 2XCUA 1RZRA 1FZQA 1UJCA 1EI9A 3QSYA 3GNLA 3VAZA 4DVGA 3ZDFA 3KFLA 1FFWA 2W4QA 4FCCA 1NVMB 2VT2A 4MRSA 3E5RA 1A5ZA 2JFBA 3PI6A 4ZU1X 1XDBA 5EJIA 1KMCA 2AFHB 2QRJA 2V0NA 2F1IA 5EIWA 4HGZA 2Y6UA 3ISTA 1IMJA 1T2DA 4RNCA 4L0MA 3TN7A 5FWYA 1XCGB 4CDGA 5ISMA 1LRKA 2OEPA 4U6SA 2P4EA 3CLTD 3PJDA 2Z43A 4P31A 5DBHX 3S99A 3TAHA 3G9UA 3R0QA 3R6GA 3DKVA 3HFSA 3SNHA 1XTZA 2A5JA 2J7PA 3AVPA 1OOEA 1QQ6A 4GZ5A 3UHFA 2X6QA 2V03A 2H5IA 3DE1X 3HJGA 2DH6A 4UE3S 2AD5A 1LBIA 1VMAA 5BOVA 3T1VA 4M9QA 1K6JA 4FOLA 2F43A 4IDPA 1X9GA 4L51A 1RMQA 1ZA1A 4GMGA 3TFQA 2ZI5A 1FP6A 1AMOA 2V6FA 3PNKA 4UBIA 1M0SA 1NQUA 3IRUA 4L73A 5K2MA 3HDGA 4RF4A 1YUBA 3LBHA 3OX4A 4N1AA 4DB4A 2CHFA 5AVYA 5JH7B 3AEZA 1T9AA 2Q28A 3T52A 3NETA 1JKJB 4O4JA 3OIYA 4QLBA 4Z9YA 2AEFA 3KWMA 3LLVA 2Z09A 4RTLA 1L5OA 1BZYA 2FWPA 4DEXA 2BHTA 4KYIB 4FDLA 5LWHA 2Z2ZA 4IIEA 3NBUA 2ACKA 5KYXB 4PIMA 1TO6A 5GZ1A 2HPHA 1DXYA 2EGGA 1M2FA 2FMUA 2A9FA 2Z3ZA 4JJGA 4PC6A 3A4TA 4M46A 5C9ZA 3FCCA 1TYBE 3BK7A 4GOMD 4I1PA 1IVYA 1BVUA 2H2HA 1M6YA 3OEEA 4U7WA 4U9IS 1GQ2A 3TS1A 1AN0A 1JA0A 1R27A 3FBGA 3D81A 4AMUA 2O2DA 3FG9A 2AG5A 2P2DA 4JC0A 2I4MA 2FP4B 4XVHA 5HE8A 2IPMA 2QXYA 3TLCA 3HU2A 3R8CA 3W6ZA 2G5TA 1PNQA 1O54A 4XGRA 2H16A 4OSPA 2EJBA 2R84A 1L7AA 3EDQA 1SVMA 4OIFA 2IU6A 2QLFA 1KZ1A 3RUEA 5LMUB 2M9MA 2Y99A 3A2MA 2FPSA 3SBXA 2Q46A 3HY6A 1JXAA 3LK6A 3TSOA 5B4UA 4HXFB 5FPQA 1MXFA 4BLVA 1DAEA 1HWYA 4FQ8A 1N8TA 3R8FA 2O0KA 5TGZA 2J6HA 2LIVA 4FFWA 5HG0A 4AF8A 3FTEA 4CXMA 3L7NA 2P40A 2WTXA 4V0QA 2BC9A 2I7TA 3DMHA 4PIPA 4DNXA 4X90A 1R1DA 4LBWA 4OIMA 2ZUSA 1FNDA 4B09A 4CTNA 1CQJA 1RP7A 4Z49A 3F6YA 4I8XA 1GZSA 1A9XA 2V7TA 2O0LA 4PV7A 2AIRA 1KQ3A 2PKEA 4JWTA 5EPOA 4KO2S 2OBMA 2UZIR 3G2OA 5AXAA 3WGVA 4DTIA 4E7PA 4YQFA 3R0IA 4KQXA 1P9WA 4D6PA 1BFUA 3O8OB 2WF5A 3FN4A 2OQVA 1QHEA 1RZUA 4N7RA 3LLMA 2XE7A 1XL0A 4DXDA 4OL0A 5IUJC 1EK5A 2H5LA 1K4MA 1P1FA 1QHXA 2XRMA 4M0FA 2HKIA 2QM8A 1XXHE 4CFZA 5KNDD 5A5EA 1UPXA 1P2FA 1KDPA 5E8JA 3MXTA 4FGZA 4DDWA 1KC1A 4D26A 5EN4A 2GFIA 1FU4A 4AIIA 3C6XA 2NO0A 2NZYA 1EVLA 4FD2A 5EYPA 2IY7A 5IT9A 2LBPA 4OI0A 2ZE6A 2HF2A 3QU2A 5FOXA 1YOBA 2LKDA 2QD3A 3ZJ5A 4YAEA 1J0EA 2X0KA 3AEKB 4DLYA 4DYHA 1L7VC 1O6GA 1U8XX 3AKEA 1DC4A 4DW8A 5F12A 1IM5A 1TT5B 1TAUA 2D54A 3PEWA 3RSOA 1JT2A 3VR4H 3MWEB 2X0EA 3E9QA 5DGXA 3UJDA 1Y63A 4FFDA 1DIHA 3SYMA 3EC1A 1PGQA 3OBIA 1RDFA 2JGMA 1GCOA 2W48A 2ZB8A 2Q7OE 2QOEA 1ZNZA 4C7JA 4ETNA 4YP9A 1ZMXA 1UADA 2ZANA 3QW4B 2GBPA 1RXUA 3TTWA 4KPUB 4B40A 1W4ZA 3ROZA 2JFVA 5HBRA 5K20A 3LXMA 2JBHA 3BDVA 5BV8A 2XXAA 2AXEA 5FNVB 5AVZA 2H1IA 5ICMA 2Z4RA 4H4EA 1OB2A 1QG2A 3H2HA 4A8JA 3D9QX 2FVYA 4G5FA 4Z1MD 1T0HB 4HATA 1QS0B 1KVUA 3TGWA 3C1OA 1G42A 1USKA 2X2EA 3E5NA 3PE6A 1ZRNA 3O47A 2OXTA 3ZWMA 2NVUB 3ZDZB 4EY5A 2D1SA 2QMOA 3FYHA 1TF7A 4TUYB 1W49A 3DGEC 1XDWA 4G2NA 5HMLA 2C4NA 1W85B 4KXYA 3ON5A 4MVJM 1NRXA 5H4HA 2GJ9A 1T36A 3VTZA 5EIHA 2ZJAA 1JQBA 2XEXA 2GVDC 5SYNA 3X3HA 4YRKA 4WZAA 4NR0A 2EZ9A 2Q9BA 1T6YA 5LA6B 1IWOA 1QFXA 3F49S 3OT1A 2IY8A 2ENUA 1RXCA 4OYRA 2LKCA 3TQRA 3LX4A 5I01A 4F38A 3H8JA 2QTZA 3KKLA 4LZNA 4Q3KA 4IEIA 4BRSA 4FYHA 2MOKA 1KDOA 1GGVA 1HORA 5AXDA 1PX0A 3EEBA 2NU8A 4AICA 3O74A 1Y7HA 2IUFA 2XZPA 3RJ5A 2V98A 3WK6A 1X1QA 1P7PA 4X8OA 3X43A 1Y8QA 1T5LA 1XD2A 3L0PA 3V1NA 1N2SA 3IAHA 2OCGA 3KM0A 3OSZA 4I08A 1JDVA 1SXHA 3WFJA 1H0RA 2O7VA 4PGGA 3SC4A 1WHSB 4FFMA 5D2CA 2G17A 4F8JA 2GJ4A 1KFBB 2J48A 2VNSA 3RTGA 3LUFA 3VV2A 1VHQA 4EECA 3L41A 3THWB 4JSTA 5JPIA 1FYWA 3W5CA 4U2EA 1K7SN 1G291 1OAOA 5LL6P 1GGEA 4OBBA 4Q03A 1DBPA 2GBGA 4XLLA 3CR7A 1EHCA 1SBCA 3WIUA 1SZJG 3FGOA 3W7BA 2W37A 5D5QA 4R7GA 4EUKA 3IS3A 2B30A 3GOHA 3RJTA 1RHUA 3WGMA 4E2XA 2IH5A 1XHFA 3LT2A 5JXIA 1DAKA 4IUCS 4AJNA 2IEYA 1KYYA 4WASA 1LQUA 4XVQA 5FL7D 1YKFA 3TAUA 5IJ9A 4ZVSA 3KT0A 4GLJA 3NJ4A 4E32A 2GQ0A 1B8UA 2XNSA 3A1FA 3RWBA 2J45A 5DGCA 3EPHA 1GV0A 1OBOA 3MCVA 4MKGA 1OWLA 1S9DA 1K2WA 2BZGA 3QEJA 5JYDA 3FJYA 1I3KA 4KQJA 2GYUA 2BCJQ 2WD9A 2ERCA 1SHTX 3HWX1 2GFQA 2HHJA 3KUCA 3M7IA 4V2UA 5DE3A 2QVZX 1HETA 3GD5A 5DFAA 3Q40A 1T1IA 2DECA 1ID1A 4RSMA 3BRSA 4JLSA 4BDTA 2XGMA 4IBOA 1Y6GA 3JARB 4MRAA 5EJ4A 5LXTB 3IR5A 3G6KA 5L3SA 1UBGA 2WU3A 3R3UA 2XWPA 3EY4A 1THGA 3QVOA 1NP3A 3NTXA 4PO8A 3U7QB 1R9JA 2G28A 5DF1A 2MSLA 5DCYA 5AQ1A 2DC1A 4N6GA 1GRRA 2CFIA 3MT9A 4ID9A 4KG7A 2WM9B 5AJWA 3IPRA 4OI1A 1SCUA 4FE7A 3DE0X 1SCJA 3USZA 3I5AA 4B7ZA 1M74A 5EE0A 2ZYSA 5C3UA 2QTCA 4GZ3A 1A9TA 1WDMA 1EPUA 1XLUA 3ZWPA 2DR0A 3MTAA 1PQ4A 2Z9CA 1N4DA 5DSZA 3TR5A 4BX0A 3ICQB 1UBMS 1BW9B 3ET5A 3FYSA 3M2PA 3P0EA 5BSTA 5JARA 1BCRB 1GGFA 2ODPA 2Z9DA 3FFXA 4ER3A 1KRXA 5ALLA 3CKLA 1X70A 2AX3A 1BDHA 3BXEA 5JDIC 2PS1A 2QVLA 4IW3B 2ZSUA 2ZB4A 4UDXX 2QGZA 4Y2RA 4DT1B 5L7TA 4OX9Y 5KSWB 3A4LA 3IYLW 2O2XA 4Q7LA 1WXFA 5I9IA 4AZ0A 4PU0A 3I28A 1HYQA 2WAAA 5IFLA 1BO6A 4LK3A 3PQ8A 4M0DA 3UQYS 2XRZA 3EXIB 4MLZA 4TN5A 4JK3A 5TMEA 4D6XA 1KH1A 3WKAA 1J1UA 1GV1A 2Z56A 3FNGA 4LY9A 4DREA 3COZA 5CA0B 2XKKA 5BR1A 3EGXB 2XE6A 2BUBA 1MJFA 3FH0A 1P4HA 1FJ2A 1P9NA 2C54A 3IILA 3PXDA 4Y2HA 5HMMA 2B1GA 1E98A 1U0RA 4MKFA 2XNJA 5FFFA 3REQB 1G41A 5K6AC 3UK2A 3U4QB 4TLMB 3N6VA 1A71A 1KSJA 3BIJA 4QVIA 3NW9A 1PZMA 3V4VB 4B47A 4ZT6A 1N2HA 4BCDA 1BMTA 1DRWA 1J39A 4LVOA 5KHAA 1W1IA 1KFJB 4X8LA 4K9KA 1J5XA 4Z1MA 5DEIA 2G1KA 5FUBA 4EPWA 1E3EA 2RC5A 3RFUA 4WDQA 4BE7B 2P91A 3WOVA 4JMPA 4UM9D 2ZI7A 4PAQA 2O57A 4A0RA 4BFYA 1QUEA 5MN5A 2O2EA 3V9AA 2WZDA 3LLSA 1OFTA 4CIDA 1QU3A 4B3RB 1SBTA 5KQGA 2D5IA 1I9GA 1K0UA 1ZGAA 3DBVO 3UJPA 3U7GA 1CUAA 1SA0A 3NPAA 2BKAA 3DOJA 1OZGA 1KJQA 1WPGA 1M33A 4O4IA 3EEQA 5DOZA 2G0AA 2OV1A 4YDSA 2I1QA 3MCAA 3RIEA 2HIAA 1NG9A 1X6VA 1U0HC 2AOUA 3P2MA 3G8YA 5BO5A 5KU7A 1GTSA 1EUDA 2QSJA 4MUBA 2JFOA 4HMOA 4PG4A 4L9AA 5C46F 4DKJA 1LEHA 2RH9B 3ZWYA 4I7EA 1VJDA 4CG2A 1GD1O 1LC3A 1X94A 2A0XA 2AL7A 1XTJA 4GZ6A 4M2LA 2VAMA 5HOQA 4TTTS 3CX6A 4XEUA 4QQRA 4P3XA 4BMDA 1X3LA 4ARCA 4C01A 2PIDA 1L4BA 5JPCA 1L3BA 1W5TA 4PN3A 4GMFA 1SOVA 1UT8A 2D7JA 4O4JB 3F8SA 5BSHA 5BUZA 3PUWA 1ZQ9A 1YB2A 2E4ZA 4TTQA 1ODSA 1QGDA 4KR3A 2H1LA 4NBTA 5DLDA 4AKEA 2P65A 3A25A 2VR1A 4I6EA 2VF7A 2CNNA 2EIHA 2DJIA 5C52B 3PKZA 4QPCA 3IUNA 5FTMA 3OSUA 1ZY2A 3JXEA 1JNXX 1FFBA 1Q0SA 1VIAA 3GLKA 4RCZA 3CR8A 4YB8A 4MGIR 5F77A 4D8XA 4RZQA 4TMZA 2ZYVX 3D8NA 1E63A 4HAZA 5BSEA 4HFNA 3TE6A 2PZFA 3WLFA 1L9KA 1A82A 1W93A 2XQVA 2FN7A 4OHKA 4UNPA 2OCPA 3OFSA 2ODBA 4F86A 4EELA 3JZAA 3ZU5A 4W5JA 3WBFA 2BI7A 4RFVA 1UKZA 3QUTA 5FL7A 2BVNA 3TIIA 1IN1A 2NVWA 3DT6A 1GUBA 2FDRA 3B9QA 3H1BA 1RRKA 1T2UA 1UJ5A 3AHIA 5EHGA 2XDWA 2J9XB 1OYOA 3EBPA 2HIGA 4O8CA 3O1JC 1PN3A 4R51A 1GTG1 1OSNA 2P5TB 2WHRA 2WNSA 2YXBA 2DPXA 4HQ0A 5E4TA 1CF2O 1E6WA 2P9GA 5CLIA 3M5WA 5C7LO 5ITZA 2VZ9A 3LGAA 3EXG1 621PA 1I7PA 3NIDB 2H52A 3K30A 4Y6GB 4MRNA 1CQJB 2K7FA 3CZRA 4OMUA 3NHZA 1A9XB 3QGMA 4ZMSA 2BW0A 2J5XA 2X76A 3P45A 1BFDA 1QRSA 4YUAA 3IT3A 4HZIA 1BMDA 1RHMA 2JFFA 2QN2A 4YUZA 5KYYA 1VL5A 2XTAA 4F92B 4D0NA 5G0TA 2SHKA 3IBGA 1UJMA 2Q45A 2FHSA 5CRIA 3B1FA 4QTXA 5FX2A 2HHAA 1S8OA 5IYZA 4NCKA 2ZBQA 1OC4A 3PNBA 1NKVA 5KPJA 3WOHA 1Q7EA 3PPIA 4MI1A 3OCJA 4D8WA 3C5VA 1CLEA 3LRTA 1ECBA 1UEJA 5HZGA 5D87A 4GAEA 4RDXA 5ENVA 4EL5A 1RE0A 4MI6A 5B1IA 1Q0QA 2PGXA 2AHRA 5DN9A 3VR0A 4AMZA 2GK7A 1VJ1A 5EYPB 3ENZA 3RHTA 3QWAA 2VUHB 1EUYA 1NN0A 3DC7A 2CLIB 2GGSA 3E5HA 4R81A 4IQ4A 4PRKA 2OD2A 1QIMA 4LTDA 4QEZA 5ED0A 2PSDA 3G13A 3RVOA 2O4UX 1NIJA 3H2ZA 4EW3A 4YROA 3CX7A 1IZ0A 1TYAE 2JIQA 1T8SA 4C7MA 1BS2A 3P97A 5K3OA 3VI4B 2O4CA 1IAQA 2H2IA 2QRMA 1TEXA 1NUUA 3DZHA 4KSYA 4YMTA 1NBIA 4LPSA 5JMWA 4XIYA 4PXSA 3H5OA 1NJ2A 4WFKA 3GA5A 4U7GA 3MM4A 4QWMA 4RKFA 1VQ1A 4CR8A 1I2CA 3CB2A 1Y3HA 4DPMA 3G23A 1AIPA 1AKNA 1R0SA 3T35A 2OVFA 4IH4A 5MDHA 1GQOA 1GPKA 3GLQA 3IQZA 2CV2A 2CVHA 4MVXA 4NS4A 4C88A 2EC5A 1TUIA 3FSGD 3BMNA 2C77A 1QNLA 1M2EA 1V8FA 3EZLA 2QUIA 4E2YA 4EHFA 3SX4A 4N0PA 3PI7A 3DE5X 5J2TB 2JA1A 3M81A 4BUJA 5IH3A 1XWFA 4BV2A 1D2MA 2FWIA 3M8KA 4QUBA 4A8JB 3PPVA 1G9TA 2ZXUA 1DKNA 4RZSA 3R7FA 4FE4A 1F5NA 1KGDA 1KHTA 2BD0A 1LUAA 4WXMA 2WJJA 4LTMA 1W9HA 3TJMA 5KOYA 1J8FA 1AKEA 3B78A 3MWGA 1ITZA 2HBZA 2JLCA 5D6OA 3O3NB 4KQ1A 2FY8A 1QM5A 3DJYA 1WZNA 3GGDA 2E7ZA 4BNGA 3I05A 1RCFA 3H83A 2HEIA 5GV7A 3V6LA 1T36B 5IJZA 3K0HA 4MV8A 1QO0D 5G1NA 4Q7JB 1PR1A 1DOHA 4RA6B 3VNRA 1WP4A 4WZAB 3HKBA 4WZ6A 3EBLA 3S6JA 4CGZA 2Z8YA 4M9SA 1NBAA 3H1PA 4NZ9A 3OT1B 1B8NA 1JHAA 1IJEA 4RWEA 5F7ZA 1CJCA 3S2UA 2V9PA 3IO3A 1XTKA 1EG2A 3MSXA 4ZCRA 1MXHA 3QA9A 3IQHX 2RHMA 1AKTA 3V00A 1E5DA 1H0KA 3L4SO 3JD2A 1VE9A 3EUAA 2NU8B 4JX9A 4XIFA 1JR2A 4RTKA 3HNOA 4M37A 4DV0B 1S2LA 1L4LA 1O1YA 3A1WA 3G59A 1Y8QB 1XD2B 1E5VA 3D6NB 3P9SA 3T0IA 1U1FA 1W88A 1U0TA 2NSYA 1DKLA 3N53A 3P9RA 2AJBA 1OR8A 3I9V1 1ZD2P 4KJZA 4PAOA 2Q8QA 3C14C 1EVKA 4L50A 3BCUA 5CLFA 4AQ7A 2HPVA 2G82A 3LCCA 3RTEA 4CMGA 1A72A 1Y9EA 1TVCA 2DULA 3LX6A 5FFMA 4OP3A 3PE4A 2D13A 5HGJA 3R74A 1EFKA 5KYUB 3MN1A 1C7RA 4WKPA 3ZQKA 3AR3A 4G1VA 1DAIA 4X8MA 3IVXA 4OYLA 5CW2A 3NRBA 1X86B 1OA1A 5JJKA 1SU7A 2KWIA 4K40A 2XQJA 3BGIA 1PYDA 4G1FA 4HK4A 1JWBB 4LVUA 1OGYA 2Q2WA 1YB6A 1N7GA 4K9LA 4XR4A 3ETJA 1KMHA 1JG1A 2BBTA 5AUOB 2FSUA 2CNLA 3N7UA 2A78A 5IJ9B 4AY5A 1LTKA 3PUXA 3GYBA 4DMMA 1UC5B 4F93B 2ZB2A 3PDIA 2XUKA 1EP2B 1KMIY 2NUBA 4YHBA 4B0OA 3RODA 1JYEA 3FCYA 2OD9A 4N9QA 4TLAA 1IOLA 1KC3A 4TT3D 4KN6A 4CKXA 5KC8A 3BREA 3ILSA 2Q07A 4YRRA 1DC3A 4XGNA 3INYA 3W2HA 3VNQA 4F2HA 3O4IA 1YT5A 3EA0A 1K75A 3TBKA 4HMPA 3WZMA 2FPUA 4HRYA 5ALXA 3EJ6A 3U9LA 2RONA 3D7MA 5D5HA 2Q27A 5L3SB 1QFZA 1WQ3A 1DIRA 5FOSA 4NCIA 2QS9A 2OC9A 2EVWX 3OQIA 4HUJA 5AR1A 3UUEA 4YRIA 1UMKA 5HUHA 1Z12A 5ER9A 2ERXA 5C80A 5C81A 4HYTA 3RBAA 3X1XA 4CKZA 2K6GA 1RMYA 4LJ4A 2LZ0A 3TNDA 2AEEA 4Y6QA 1TIPA 1WCWA 2BI8A 2UYYA 1H0HA 1UC4B 3DXYA 3GUYA 1SCUB 1ZL0A 2ATXA 3ZWBA 3GLFB 2DTDA 3L4KA 4RZXA 2BFNA 1RPJA 3JQ9C 3IR6A 3G8CA 4HLDA 1ZRSA 2FWNA 4QX6A 4WDRA 2DSTA 3A6KA 1VLJA 4P8RA 2Z8YM 4Q4JA 4YGYA 3H3JA 1VZ2A 1ODJA 2Z5VA 3PIDA 4P7JA 4D9IA 4ARIA 1QDUA 4EW1A 5FWYB 1NDUA 4JC4A 2CFCA 5JS2A 3DE4X 2R6JA 3UKJA 4TXMA 3MNFA 3MOSA 1OUMA 3AP2A 4L9RA 3ZYCA 3SWWA 1GR1A 3R1IA 3WGTA 1ORTA 1EIWA 3G0BA 2PUTA 1ZAKA 4K81B 3AWDA 3O84A 5EHZA 1XEAA 1HDGO 4MJ7A 5JSUA 2RKWA 1QQAA 1C7IA 1QDLB 4FILA 4LJ8A 2WC1A 1U8CB 4XSGA 3WLIA 5G0VA 1PAUA 2OR3A 3MJSA 4BEBA 3QFTA 4MOWA 2Q41A 3HSYA 3QIAA 1H85A 3ESBA 2EHJA 3G2MA 2IHKA 5F9HA 1GZ4A 1ZNXA 1Z8HA 4RHCA 3FLEA 5KTTA 1VPEA 5A6SB 1E6MA 3WICA 5AW1A 4X95A 1E3IA 2RHWA 4PZYA 3EISA 1VCNA 1CEXA 1ZD8A 4BLPA 2PBRA 3G82C 1DLJA 3FSGA 1XMQB 4RVCA 3NNSA 3E03A 3EK2A 4FKBA 3X2SA 1D9ZA 4BNJA 2BN4A 3O26A 5AVRA 2VKTA 3HB5X 2Y1CA 3EIHA 3EGWA 1ECFA 2UVQA 3OIFA 1SOMA 3WHLA 4M1EA 5A9RA 1DJMA 3NHYA 4U39A 1NW4A 2HNAA 3W5SA 3ETDA 1RWOA 4E30A 2PHZA 3GRCA 3KJEA 3AL3A 4PFJA 2Q6KA 1WBDA 5TT1A 1MNQA 1E9AA 1GTRA 1DOZA 3FVRA 2SNIE 2CHVA 3NBXX 4GKAA 4GRDA 2FK8A 4KIJA 4KQCA 1C0IA 1SD2A 2O2HA 5BWNA 4QUGA 1SA0B 3DAFA 4Y1EA 4ER7A 1QO0A 4O4IB 3GFTA 4XRRA 4D74A 5CFOA 4JI4B 4MLDA 1ABBA 1XDDA 1TX4B 2AOUB 3GJYA 4RPIA 4DR5B 3OZDA 1ZYUA 1XEWY 4YJGA 4MWCA 4MYHA 1PWZA 1WXXA 1JWAB 3OOHA 4HNHA 2AG8A 4LDNA 4PW0A 3SICE 3PRJA 4EHNA 3SZOA 2J0EA 3WJAA 1EM6A 1G8FA 3KETA 2QK4A 3F4BA 4E51A 2BTEA 3T5PA 1O5TA 1S96A 3QEAZ 1JYFA 3A9UA 3WK8A 4QRDA 1Z26A 3P8ZA 4ZI2A 5IXSA 4HDKA 1Y8CA 3TW6A 1ENZA 4KBFA 5TGTA 1KJ8A 1YL7A 1MB2A 1PR6A 3MTBA 1GY8A 1TFRA 4TYWA 2WTUA 3EXHC 9ABPA 4J0EA 4JVMA 1CQZA 5DB4A 1E9CA 4Z0HO 2BZ0A 3T15A 3T38A 1T9ZA 4NY1A 3UAZA 1C9KA 2IXFA 1XG5A 1O89A 1MV8A 5E6UA 1ZOLA 2YXEA 5AKLA 1V7QA 2NO1A 4WCFB 1K5PA 4E2FA 1JKMA 3PUZA 3PYMA 3QWFA 4JH0A 4DNPA 1B23P 1RXWA 5JI2E 4NYIR 1NN3A 4QQNA 5J40A 3GRZA 4RACA 2H0QA 1Q7TA 1P29A 2WWWA 3IEXA 2NXWA 1VBKA 1ORHA 1WSBA 2CD7A 2GO1A 2TMDA 1M6VA 1QZTA 2YC4C 3CZ5A 3L6CA 5DEOA 3QEBZ 1E5QA 2IP2A 4QD3A 3ZDDA 2X7HA 1H42A 1ZAYA 2C1XA 1MQAA 4IXTA 3V32A 4YCAA 3KJFA 2UYHA 4TT3A 1J1IA 1PS0A 4CIXA 5A3VA 5DNYB 2ZSDA 3SDZA 2OFFA 4CJXA 4TLCA 1Z6AA 2GLXA 2FSVA 2A5YB 2GLUA 2JEOA 2FQ1A 2JVIA 3VJMA 4OHZA 4UD6A 5ITZB 4PHCA 1C9JA 2A88A 4YJ2A 4CEJA 1SD1A 1V71A 1XD9A 2RSLA 3K9GA 4EARA 4DJFC 3HWSA 1Q6ZA 3S8YA 3UTDA 2ZIAA 3GLIE 1CUIA 1BIFA 2YZGA 2A7QA 5IBPA 1AMNA 2OILA 3OLWA 1XAGA 1RXEA 2XUAA 3ONVA 4H0CA 4IDAA 1KE1A 1KE2A 2QE6A 4EO7A 4W99A 2C5EA 5DHRA 2OG2A 3D4IA 1NVBA 3QYFA 4L8YA 4XWAA 4UBOA 3GY0A 3ASZA 5IYZB 1MJGA 1XR3A 3BE8A 4HB0A 5GMOA 4BTLA 2YIJA 4W1RA 4JYBA 2YJZA 3T4EA 1H2HA 1KYZA 3ZU6A 3Q7QA 3T3NA 2DGDA 5H9VA 5D3MA 3CTMA 5E4YA 1IXZA 1VCMA 2EG5A 4BVGA 1PR9A 1Q15A 2BFPA 2FCRA 4FT4A 5AKIA 3CT4A 1JQDA 3LCJA 4YRFA 1QZ3A 3I4CA 4FHDA 4XUCA 5T3UA 2WVHA 4MGYR 5F2OA 3UMYA 3VZRA 3VXKA 1QCCA 4RF2A 2RDMA 2I4IA 1SK8A 1RRPA 2HB6A 3GRVA 4M22A 4NPCA 4GI5A 4NEQA 4D8YA 4YJ3B 2NUTB 5CT6A 1D1TA 3IA2A 2EKLA 1R12A 3MTJA 3GLVA 4L7VA 5KCZA 4NQRA 3RTCA 4N7BA 1JS1X 4NICA 1WMBA 3L07A 1U7UA 3QXXA 4ZT2A 1IQRA 4RQTA 4MMYB 2IXTA 3MWKA 4I46A 3KYJB 4EKYA 2VT6A 3BB4A 1JJFA 1W4AA 2J6CA 10MHA 4C6TB 1PUIA 3CU5A 3PNVA 3TW8A 3V1MA 2VHEA 1SCDA 2QYTA 3D64A 3RIGA 1BXKA 1M1XB 2WE7A 2ZULA 1MN6A 2PBZA 3G9XA 4HJRA 1F48A 4Y98A 5I9BA 3FY4A 3FNFA 4MW9A 1ULHA 3OHSX 4NHEA 4LOIA 2GPAA 2XBUA 3B6MA 5KJ1A 1GQSA 3DV0A 5DHQA 2N47A 1SNYA 3P4YA 4HEA1 4P4NA 2CNWD 3K72B 4C08A 1YR9A 3OMLA 3SI7A 4DRYA 1YKSA 3U17A 4WK0B 4RK1A 1EA5A 4UM9B 3EX7C 4US1R 3PJGA 4BV8A 3HB7A 3S2IA 1SURA 1XHLA 5D3KA 2PGOA 3AF6A 1S7GA 1CIPA 1Z62A 1ADGA 3ZI0A 1YONA 1BRMA 1G66A 4B7CA 1NIPA 2OSBA 3HWWA 1VCOA 3IJRA 3KB1A 3ZWXA 5BT8A 5EMHA 4F91B 4YUYA 2Y1DA 4XDHA 1OV6A 1P9OA 1C14A 1BH6A 1JLRA 1RWMA 1YA8A 2WLSA 3L7KA 3AY6A 1NQWA 1F20A 2FKNA 4IIDA 4M0PA 1K6XA 4WOBA 1J4AA 4K0RA 5HCUA 3HKEA 4QTZA 4CN9A 3CLUD 2GEKA 2BKEA 1QVWA 3KE8A 3C4VA 3WVNA 1EE1A 1LK0A 5HXAA 3DDSA 3L9WA 3B12A 5AP9A 4ZANA 1EJBA 3NWEA 2H59A 1LFDB 1BVRA 1MJGM 3BDAA 1H2ZA 3CLSD 4PE5B 1QTRA 5ALWA 1SRRA 2QVBA 3KLMX 1ZCFA 1C0EA 4IAOA 1W88B 3IQFA 4I66A 4A2CA 3DMGA 1C0LA 1Q0RA 5AM2A 4LXTA 4KGDA 2C88A 1SHUX 2YWBA 2AT1A 1EHIA 2HY7A 1K2VN 3ESAA 3G3EA 1Z4LA 4EHHA 3RC9A 1GU0A 2CDCA 1E79D 3VO9A 5GOTA 2FUEA 3U3OA 3VC7A 2XDQB 1TGYA 3UZUA 2OBNA 1UQUA 2IYFA 3A4IA 3FPFA 4NJOA 1LNQA 2XGSA 5BYKA 2FG7C 1TZ2A 3WAKA 4UNRA 1Z2CA 4N0MA 1OASA 3B5EA 4HYEA 3L84A 2H7YA 4MRMA 5K2OA 3NDPA 1FXWF 1OX4A 1YIDA 2W5UA 2AR9A 4OXIA 3BEOA 4TM8A 3UK7A 1IN4A 3KKPA 1NYQA 1E2PA 2QPTA 3BD6A 4K8RB 1KMHB 1B73A 3HO8A 3TIXB 1IBKB 4HH1A 4E09A 1XXLA 4W1PA 3UGQA 4LE1A 5EFZA 4ZN6A 2YWDA 4M0MA 3PDIB 3GFOA 1G2QA 2P27A 4BP3A 5FWXA 4B2PA 3EBOA 3I2KA 2DB3A 1J23A 2ECPA 1C3LA 2GYYA 4JB0A 4OHXA 1NBMD 3IBSA 3PQFA 1Z0UA 4NJEA 1XO1A 1GTZA 2OYSA 3GROA 3ISJA 1B7GO 3KUUA 4WBSA 1MDFA 1BE0A 3SU8A 4GOLD 3T1TA 3AZPA 3JQBC 2F67A 5FJJA 2ST1A 3R0JA 3OQIB 5IXJA 3ROKA 2FJPA 2QY9A 3EDRA 3EQ6A 3KXKA 1LVUA 2E5WA 4I4IA 2AG6A 3A37A 3GGGA 4JMLA 5B6PA 1ML3A 1LC0A 1P0IA 3MHTA 3GPBA 4RXUA 3A3OA 4F4JA 2Q4EA 4WHMA 4CETA 3SLGA 2FE1A 1H65A 1IHPA 1WRBA 2BWJA 2R2GA 3DBLB 1A96A 2J9FA 3LQKA 4JA0A 4U6QA 4BFVA 2DEUA 4LXUA 5BQOA 1EBUA 4M4SA 1JHXA 4Q4JB 1A2KC 3UY4A 3OMWA 2YY6A 4R5HA 3GMTA 2O6HA 3FPBA 4LF9B 1ZD9A 1YS9A 4ZQEA 3MBIA 5LUBA 1D7OA 4ZAXA 1RLTA 1OH8A 3TKYA 1SC3A 2J87A 4UFOA 4H4CA 3UG6A 1G3MA 3JCZA 1EE2A 4M99A 3ZPXA 5FUMA 4HAVA 4BBPA 1KS9A 3RW9A 5K0CA 3UOWA 4P0QB 4V39A 2CBGA 4L4XA 1HURA 1OX6A 5DYNA 3IUQA 4AXXA 4CT0A 1NGSA 1QIDA 2A59A 4H6PA 2Q1YA 4RYLA 3PEVA 4FEYA 2V7WA 2QGFA 3I0MA 4RY0A 4V03A 3D3EA 1X0VA 5CYFA 3VH2A 1UF9A 4DA9A 1NQ5A 3UEOA 3TW4A 2GD2A 2AC4A 5BQFA 2ZRQA 1JU4A 4Q05A 2AKAB 1U7DA 2RAFA 4EL0A 1GNRA 2GT1A 3K4QA 4H9GA 4QPPA 2JI9A 3BKWA 1DKRA 3NFRA 1Q6YA 4NLLA 1Y5MA 4IV8A 5SICE 3GAMA 1TW3A 3PUIA 2QTTA 3IAFA 4J0CA 2QEQA 5DXJA 3RS8A 3IVGA 2NMVA 4F7DA 2HO4A 2SBTA 4HQOA 1T26A 1G4AE 4NENA 3OFJA 4KPEC 1T9CA 3FSJX 5MFPA 2P9CA 4MTCA 1G64A 1S4QA 3H0EA 5JADA 1K8XB 1GPYA 2CNWA 3E8XA 3NTVA 3NIFB 3C5CA 2P3QA 2RI6A 3L7YA 3N39C 2O52A 4L0CA 1G1MA 2KM1A 2LNDA 4DG8A 4A0SA 4ER6A 3OT5A 2GPTA 3GIDA 3UH1A 4TVBA 4AROA 3U44B 1F7VA 1J0XO 2QRVA 1JEAA 4D99A 1TE2A 1CJMA 3IEPA 3EMDA 1HNNA 3NATA 4KLNA 1NWHA 2RGNC 4UVDA 1ZLXA 1K7YA 4DCOA 1IIBA 2HBYA 3PPYA 3KPJA 4N8SA 4CZ2A 4D9EA 1EUCB 1MX3A 2C4WA 1QG0A 5MFZA 3OZXA 4HLUA 1KJJA 2DSNA 2FEAA 3DYBA 4DV7B 4O8ZA 3RM3A 1Z0JA 3HCDA 4B6SA 1EAYA 2A6PA 2AN5A 3F5SA 3GEEA 1PK9A 4L8FA 4YJGB 1Q7BA 5JPDA 3H5IA 4P3OA 3ZY5A 5I7AA 4AIRA 3K0AA 3I9JA 5BVGB 1NMSA 1IC6A 2JJQA 3KU1A 3OX2A 4WH0A 5F1KA 3PPWA 2RAUA 2ONJA 5JD5A 3ZGYA 4M0LA 2EEZA 4B8ZA 1FC0A 3GDHA 3N5KA 5C51B 3T7IA 4HDKB 2JAUA 1OB5A 3N8NA 3R5KA 4L5CA 4EEKA 2UXDB 3BG5A 2HGZA 4H17A 1LPSA 2XH8A 2A0UA 5T7BA 4B8WA 1AOXA 4CV0A 3IQEA 5DASA 1TC2A 1KU6A 2DTXA 1P4AA 1E79A 2IGBA 4IFEA 2C7VA 3BC1A 5LD2B 3OUTA 3X44A 1XV5A 1FNBA 3RJZA 2MYUA 4A0FA 2UU9B 3BL8A 5E2IA 2ZBVA 2QPLA 4BQOA 1Q95A 3T5AA 3K1YA 3AIKA 3LC1O 5JAQA 3AEUB 5CB4A 4EPXA 5AMXA 2Z5LA 2BH2A 1VTKA 1X13A 4LF7B 3IUEA 2GSWA 5DNVA 5HOEA 3I53A 1U7WA 1YB7A 4CUJA 4CPDA 1Z4MA 3GEBA 4HB2A 4PVCA 4A27A 4I4NA 3FCUB 3Q8XB 3AB7A 4D56A 4RD3A 5FR2A 3V8BA 1T15A 1RNLA 2MJLA 1XZPA 4X84A 1DSSG 1NF8A 1WMEA 1Z34A 3QU9A 2IYYA 3WYEA 3JAMA 5BV2P 4QYIA 1NBMA 1ZW1A 4NBKA 4J3NA 4A03A 3NG1A 2XY4A 4YJ2B 1C30A 2ZOSA 1SD5A 3DFFA 3E0QA 4EKNB 2K5UA 4YRMA 2AE2A 2XX3A 3GFBA 4F8YA 1QRDA 3FJOA 2RH4A 2VQFB 2VQEB 2P5UA 1LFAA 1NHGA 1EWVA 2Y3IA 4PO3X 1VE7A 3DEKA 5FBLB 1TZKA 3G1UA 2AUTA 4C29A 4ZAVA 2FX3A 4ILKA 1MO6A 4XIGS 2PUJA 4KKVA 2JI4A 3PXGA 2YXLA 3CRRA 4KNYA 2UZ1A 4Z9FA 3UJBA 3C85A 1BDJA 2WIDA 5JQGF 4GL2A 1AXRA 2PD3A 5I8PA 5JSHA 1SBZA 1QVAA 3EAQA 4KLZA 1QBKC 1S8AA 4ICIA 4OP1A 3OUZA 1NRJB 3ACDA 4W7HA 2C3UA 4EUEA 2ACWA 1FZTA 1J8YF 4D9JA 4UAGA 3W3AA 5TXGA 5DHFA 2VAXA 4HZGA 4WNIA 1GPBA 5G53C 2VPZA 5KNDA 4CMHA 1CC1S 4R40A 5DV9A 1E6KA 2MT9A 2QJTA 3O7MA 3OLXA 1SGWA 3GBVA 2WSSD 5D85A 4CL0A 9ATCA 1NVAA 2OHXA 4E13A 4E5SA 3PQ3A 2QRZA 4RHUA 1MEEA 4EY8A 1K97A 2IIQA 2HA2A 3CLRD 3L3BA 1XN4A 5CLGA 2DPGA 1S1MA 2CUZA 3DB2A 4OHBA 4XGKA 1PD0A 4YP6A 3P2OA 5TSDA 2WAYA 2XOXA 4I1YA 2D8MA 1K5HA 1NAHA 4YBRA 1O2DA 2B8JA 3RASA 2AUMA 1DINA 1FP7A 2QAGC 3NXSA 3HJRA 2WJ4A 1XCMA 4JLDA 5C34B 1IG0A 2NSJA 1Z5ZA 4LYYA 1DBQA 2X0RA 3TW8B 2JH3A 1YB5A 2BBOA 1UPTA 4OMDA 2F4NA 221PA 4CTJA 2FZGA 4BO1A 2SECE 3VU9A 3HXOA 1QRAA 2AB0A 4B3MB 4M98A 3VSCA 1UC9A 1QVVA 4PGMA 3V7WA 3DV0B 1FYEA 2AFIE 2B82A 3HUUA 1NJ1A 1HRKA 1R10A 2RGXA 1M6EX 3A28A 4DLBA 1B00A 3M6IA 2VSXA 4NZMA 3FOCA 2Z2IA 1JDBB 1P0FA 1U7HA 4XA8A 1RKVA 5J2TF 1A7UA 2AZMA 4RMNA 1I33A 4BLRA 1NW6A 4CLDA 2WUWE 3TNLA 1RP1A 2C4UA 3GRUA 3NV7A 1XJ5A 4D0LB 3P2KA 2P9FA 3UQZA 3NTQA 1AS3A 1VZ3A 2IV7A 5CFPA 4R1SA 3BL6A 3EWNA 5I6DA 1FL9A 2WFLB 1K6EA 2WP8J 1LDBA 5JHGB 1RM0A 2IKQA 5CHYA 4LFAB 3NHLA 5PNTA 1X87A 2GN0A 1ODTC 4CL8A 3KTFA 1PT5A 4Q3OA 3U3KA 3SJCA 3ZWDA 1DIBA 1PLLA 3GFGA 2PT5A 1Z06A 4AJKA 3QKSA 1NBOA 4BKPA 2R62A 2IITA 2WD8A 2BMWA 3QXSA 4LHWA 4D9GA 3T7JA 3TG8A 2F6RA 4IOLA 5CIWA 4BP1A 3E84A 1H2EA 2HHLA 2FGKA 3TIVA 4O2BF 5E0OA 4BIMA 4AMGA 5I4CA 4EKGA 2ZREA 4NU6A 4H3VA 1XLTC 1N5DA 1QYCA 4GP6A 4RKQA 4QSHA 2K2WA 2PBFA 5ANRB 3S68A 1BD3A 3SN6A 4DSTA 2P35A 5DLYA 4MICA 1I4EB 2B2NA 3F7MA 4N0QA 1CEQA 1UKYA 4KXNA 3WLPA 3PNMA 2OZPA 1I0ZA 2FFAA 4DF3A 2PLNA 4QJ5A 4TN1A 4JSYA 4XWWA 2G07A 3ENVA 3VOAA 1OX4B 4KLCA 1U8AA 3CIFA 1YI0A 3KCNA 5P8WA 1QAMA 3TEMA 2ZETA 2AZTA 2FP3A 1Z0ZA 1OFHA 1V96A 3KSZO 3W4KA 1KQFA 4PM4A 2WJVA 3IH5A 4DPLA 5M04A 1YFJA 3M82A 3B3QA 1L7QA 1I7QB 3W9YA 1FFDA 1XZCA 2EBUA 2QT1A 2W2XA 4MVJE 1THZA 2DKOA 3BK1A 3IQWA 4OJKA 3NHMA 3OY7A 4YUVA 3T1NA 3IEVA 2J33A 3ONEA 3DNFA 1O6FA 4TWJA 4NJEB 1NASA 4G3XA 3Q7RA 1TZBA 3QQ5A 2O1SA 4DZRA 2R48A 3CEJA 4LE2A 2NVBA 1B4DA 1VGVA 3Q6NA 4R8KA 1FSFA 3NHJA 4RVDA 1ZICA 4X94A 1U2GC 3FF1A 3QFFA 2CDAA 3OEHD 4P84A 1NJ6A 3E9CA 4FZRA 1CZUA 4WBNA 1M34A 1BX1A 1PJLA 1KDYA 5TIIA 4HWRA 4MQEA 4WE3A 3KCQA 3LSTA 3M4JA 3PQ4A 2Z04A 3OZSA 3PQEA 4EITA 1MX1A 1FJGB 2A1TS 2HPZA 4KWTA 3NWJA 5ALTA 4DLAA 4EFLA 4TKVA 3OLQA 4GOKA 1L7MA 4JU9A 4RJKA 1Z08A 1HG0A 4YRQA 1CTQA 1AH2A 4HGYA 4LHZA 4D0GA 3MGBA 1EA7A 1OZ0A 2FFBA 3VOSA 2Q4BA 5AIAA 4LZLA 4DNFA 3O2QB 1XK6A 2ORYA 3MW8A 4OG2A 1MCZA 4Y2VA 1CY6A 1ISIA 4GECA 4ARZA 2WSSA 3SIPA 5LJIA 1GNTA 5HTKA 1ACJA 1EK6A 4AZTA 1WUYA 4I2NA 4M83A 4YMVA 4MW4A 1KGSA 1EVIA 1DPGA 4G26A 3QEOA 3FUCA 3EMVA 1ODIA 4Z2YA 2ZJBA 5DNAA 1ZH0A 3T7SA 3W8NA 1PBTA 5A7GA 2PZAA 5LQRA 2PG3A 1PJTA 2ZPTX 3CZPA 4ZJPA 3E4DA 1BWSA 3VR4D 2IOQA 1GTL1 4QDUA 5JU6A 2QM3A 3FAZA 4D4LA 1WCIA 4LEIA 4MDFA 1WB9A 4EYSA 1JNYA 1RHKA 2C2OA 4Q3NA 1G8AA 3I30X 3MFQA 1MEJA 1C5KA 1XQWA 4RCVA 1E2GA 1DWUA 2VRBA 4XE5A 5EHIA 5ERYA 5EZQA 2WP0A 5JSKA 4TYNA 4GGMX 3L7OA 2H9IA 2ZAIA 4FYJA 4G0PA 2XKBA 1R0LA 4J0JA 3GARA 1VDZA 3Q15C 2F3UA 5ESRA 4A9AA 1FF9A 2G80A 5AKJA 5KEIA 3DE3X 1ICEA 1QB8A 2OWDA 3SSOA 2DUMA 5AW2A 4UQLA 4F5WA 2QRVB 1Y8AA 4G5GA 2D2EA 3Q1KA 1KBOA 1UAYA 1WDWB 2O8BB 4P0PB 2OOSA 1XX6A 3LT0A 5THXA 3JR7A 2ZVPX 5A2QA 3HUDA 2I03A 3UAWA 3JQFC 4G0YA 4XKJA 4DBVO 1J2JA 1L5ZA 1L7RA 1P91A 4RE5A 1OFUA 1OYWA 2R00A 2AZXA 2GN4A 4UZFA 3LQ1A 1WW2A 1XRSB 1EESA 3UMJA 1C1HA 3P96A 5EJ5A 2GJSA 3V8VA 3CY6A 3F6RA 2ODNA 3W7AA 3GEPA 4Z99A 1FYDA 2V45A 1JEDA 4KCGA 4L3VA 3VVMA 4C0WA 4JFAA 2HWKA 4FVTA 1IXKA 1ORIA 5IHXA 5GIPE 3ANMA 1UINA 4G6ZA 1QDEA 2CEAA 3GRKA 1KI3A 3DMNA 4P93A 4UBNA 2WIFA 2P9BA 2B3DA 3LGSA 3O7WA 1H3FA 5CH8A 5CT4A 3KD2A 4LYEA 1WUKS 2PZMA 3WKBA 1CX9B 4E11A 1PT8A 3L7AA 2NAPA 4M9CA 4C05A 3IDQA 4G5OA 3K9LA 3VKHA 4OVKA 2H08A 1PGJA 4DR7B 4KV9A 1HL7A 2P4HX 4NDZA 3CYFA 3QY0A 2AJLI 5I9TA 3SEQA 2J6BA 4QBHA 3W05A 3GLGA 3ELDA 1WS6A 1XTBA 3DM9B 2BHRA 2P4QA 2W00A 3HDTA 4JITA 1M2HA 1NTOA 1O87A 4R1TA 1XZJA 1YH3A 3DJFA 1XPOA 1RQGA 3O94A 5JAUA 4M1QA 4RAQA 4XJSA 3BWCA 1A7AA 2NSHA 3HRKA 5MHTA 1PL7A 2D1YA 1JI0A 1KAQA 1S3SA 2ZI9A 1KQNA 3B2QA 1NKTA 3AZOA 3DHEA 4P35A 2CXXA 3ZNOA 1C29B 2FUG1 5LSAA 5M5BA 1J0BA 3QPVA 1SQ5A 1R8YA 1MZPA 4JOQA 3LF1A 2ZWAA 4ZDWA 1W5SA 2X1VA 1L4FA 1ZM7A 4EZBA 1OI2A 2P9ZA 2UYQA 3BRCA 2ZUWA 4KQKA 4TRNA 1TOAA 2ACVA 4R01A 5FUXA 3UA3A 3UW1A 1RRMA 5CCXA 1R0WA 1YL6A 1OILA 4QYIB 1N7JA 5CDFE 1UJ6A 1SVNA 5F1OA 2AG0A 4BL5A 5EJ8A 4UULA 1PKXA 1VSTA 4ZZ0A 1B0UA 5M2QA 1C30B 3DM5A 4B3HA 2IVZA 4DDKA 2I4OA 5CBKA 1E8NA 1T2NA 2VLIA 4Q9KA 2FW8A 3KELA 2PSJA 2PSSA 3TOZA 5B7PA 3OEHA 5CLQA 2R11A 2IYNA 2R6HA 4ADSG 1S6YA 3I3OA 3H9BA 3THXB 1OLXA 2CLSA 2A5LA 1QTNA 4X7BA 1YASA 2AMLA 1Z2EA 5DOVA 2C3YA 5K8LA 1ZGGA 3C8MA 4G8DA 4WNAB 1T9BA 4B76A 1KWGA 1GQRA 2W6QA 4BFLA 5EESA 4BNNA 2OHGA 1WB5A 3N87A 1F8FA 1MVNA 3GHYA 1VJ0A 2P5SA 4K1LA 4Y2SA 5KVAA 3ANLA 3COYA 3LFHA 4U2BA 4PHFA 1RC0A 2FPOA 4XJVA 5TC4A 2M98A 1Q21A 1DEHA 2GO7A 2P4SA 3IPAA 4H16A 4HQRA 4KUHA 5HZMA 5FRDA 1UBTS 1ZR2A 4M36A 2R6R1 4RTPA 2O0HA 4V0ME 2F62A 4QGGA 1Q11A 4HKTA 4QU8A 3MTIA 4W5OA 4KWHA 3ANSA 3CNBA 3N7TA 4HH0A 4UE2A 4L74A 4YXWA 4F2DA 1DUIA 4HVLA 3R7WA 1ODLA 3ZHBA 2I4TA 2UZ3A 2GCIA 4HNVA 1PNTA 2R87A 4HRAA 2ZUVA 5ARCA 3F1KA 1TJPB 1CJTC 3KV3O 3PVSA 4IIGA 4JKYA 4WZBE 4Y2JA 4F4HA 1E7WA 4MWOA 3R5FA 1AN9A 3TZQA 4EW2A 2MU1A 3S70A 3SIXA 3BK2A 4MGKR 3EC7A 1I6LA 2OE2A 1VM6A 5ENZA 3AUYA 3PHIA 5TQ0A 3OWXA 1M9NA 1XZLA 5JANA 2JHAA 4GQBA 5EERA 3WK9A 3I9FA 3VR4A 1I2ZA 4B7XA 1YZVA 5H82A 3AFIA 3C7AA 1QGAA 4GLBA 3A58B 4U2CA 3A2KA 1FFYA 4RZ2A 1QV9A 4JVSB 3SG0A 3T3OA 3VU9B 2PX4A 4IIUA 4F9FA 2FZ4A 3QX8A 4G0UA 2BMVA 3FPSA 4MGZR 2PL3A 3PTAA 2Y0BA 1W36C 3C6ZA 3A7DA 2WJHA 1T34A 1RI5A 3WB2A 4GX0A 2BM0A 3HUFA 5EE1A 1T5SA 3UMBA 3BGSA 3R3XA 4NATA 3HZZA 4II7A 4MV3A 1A9QA 2V7PA 2W2QA 3PPXA 1H2FA 3GBPA 4D1YA 2I4RA 1CIVA 5HTOA 2Q3LA 2QDKA 1DIGA 2AJ8A 4MPTA 4XWOA 4BPRA 4Z4CA 4KHZA 3GZNA 4I36A 3M1YA 1DKOA 2JPDA 1DTEA 3LUAA 5A5GA 1YDMA 3TD6A 3QLTA 3ERCA 2OP0A 3C3CA 3DWIA 1R8JA 4Z4HA 1EFCA 1GCAA 3E61A 4G84A 4GGOA 5KJEA 4FXOA 3GOQA 5ERXA 1J9GA 1MB4A 2VP6A 1G55A 2QRHA 3L6OO 1R6AA 4JBXA 2QT0A 1RWWA 3E3AA 3I6IA 3R6WA 3U3JA 4MTLA 5DU2A 5C7YA 1A77A 2R68A 4KUGA 4IICA 4Q9JA 4OHVA 3OLZA 3K6KA 4GOND 4GRIA 3QKSB 2VNJA 4FNMA 3C5HA 2XSZD 1G16A 3H2GA 3B8HA 4ALKA 4FWIB 1E1CA 2G40A 2G0NA 1EWKA 3G9ZA 3UMFA 4RKRA 2WF9A 3I32A 1DDIA 3BFXA 1T9HA 1GKYA 2E55A 3H1TA 2HSDA 1P7CA 2FFHA 1HDYA 2NQ8A 3DKRA 2WMDA 1IRXA 1WEKA 2PR2A 3GCXA 3U1VA 4DM3A 4DIUA 4YRNA 5FUQA 3EIOA 5LVAA 3M6XA 1ISHA 1KI2A 4Z53A 3A1NA 1DWQA 1XNGA 3LS2A 4O2LA 3SJUA 3KTOA 3ZK8A 3LYUA 3U26A 1NVGA 2QRGA 3QIVA 5FI1B 1KDZA 1T8UA 1X8XA 2EERA 2O8FA 5IZ4A 4RIGA 3AETA 1N2ZA 5KWEA 3KP1A 4C22A 5K03A 3K2IA 4IQGA 5G41A 1FDTA 3QPBA 4D7AA 4MAMA 3CLTC 1AKQA 4AN1A 3CVOA 2PYDA 1HNWB 1GCUA 3FE2A 2XNCA 5JWRA 3L0IB 5BSFA 5TDHA 1ZLYA 1W87A 1IQUA 3H5NA 1Q16A 4I3FA 4ZD6A 4AWBA 1G3RA 2YVLA 3MCUA 5HKKD 3UUGA 3DVRX 3ILXA 4DSUA 4J2OA 3K9NA 2OCBA 4JI6B 5KSYA 3MJCA 1QB7A 1GLGA 5IKXA 3PGJA 4EHDA 3ZIUA 4AAYA 1X39A 2B4RO 1BCSB 2Q3JA 5C1OA 3OFKA 5EXSA 2YQ4A 4ZVQA 5ILGA 1D5WA 1ZNQO 1NSTA 3CONA 3KHUA 4ZEOA 3JALA 1ZGHA 1E2LA 2ZG6A 4NCXA 3SAJA 5JRDS 1BKDR 3HA2A 4GZLA 4XSHA 4TYYA 4WBNB 3B9RA 1ECCA 1GJRA 1A8HA 1PL6A 1E3MA 1ZMOA 4Z4EA 1P72A 3TQHA 4MQEB 5AVQA 2AWOA 3AF4A 3CRNA 3LBIA 1VYVA 3LUGA 4J1QA 5K3SA 1EH5A 3WA7A 1JT9A 1S3IA 2WLTA 2Y1EA 1Y6RA 3NT5A 4I1RA 3S2FA 2XB2A 3WBKA 4DIBA 3NTOA 1D6MA 3FVWA 3BA1A 1RWBA 3FRJA 4TKVB 1G7CA 4URYR 1QSGA 4WA7A 5GVRA 1EVJA 3VYWA 4UTPA 3WP1B 4EVRA 1TECE 4HNAB 1NJGA 3QVJA 4P4GA 5ILQA 5KOJA 2HRCA 3WIEA 1S2OA 3HB9A 4RESA 2VYCA 3TZLA 3ZWAA 3ZDQA 1CQPA 3UBMA 3ZCQA 1K66A 3KJZA 4A0HA 1V5IA 2JIMA 1TA9A 4QFDA 1J9ZA 3HI6A 2WEKA 2VJQA 4HGNA 4MAAA 4TXLA 4ARZB 1GKIA 4B6QA 4E4TA 4LZZA 4M8KA 4B31A