1MA3A

Structure of a sir2 enzyme bound to an acetylated p53 peptide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
242
Chain Sequence
MEDEIRKAAEILAKSKHAVVFTGAGISAEGLWRKYDPEEVASISGFKRNPRAFWEFSMEMKDKLFAEPNPAHYAIAELERMGIVKAVITQNIDMLHQRAGSRRVLELHGSMDKLDCLDCHETYDWSEFVEDFNKGEIPRCRKCGSYYVKPRVVLFGEPLPQRTLFEAIEEAKHCDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVNAEPTMADPIFDVKIIGKAGEVLPKIVEEVKRLRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, transcription
molecule keywords Transcriptional regulatory protein, Sir2 family
publication title Structure of a Sir2 enzyme bound to an acetylated p53 peptide
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 84
structure length 242
sequence length 252
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1ma3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ma3A01
3U3DA 4C7BA 1V5FA 5K6RA 2H4FA 3PDHA 2Q5LA 4MZXA 1OZFA 2VJYA 4RJJA 2OD7A 4L3OA 2H4HA 2JLCA 4D5GA 3OE1A 4BV3A 1YC5A 2NXWA 2H4JA 1OZHA 1YNOA 2A1UA 2EZ9A 4V1CB 1T9CA 4JUBA 2AG0A 5DGDA 1YBHA 4JUDX 2IHUA 5IMSA 3CLTD 2Q5OA 1PVDA 2Q29A 4L2IA 2JI6A 2H2GA 1Z8NA 3HWWA 4V1CI 4UUAA 2WVGA 4KGDA 4JUAA 4HD8A 5K3SA 2H2IA 5EJAA 1ICIA 4K9OA 4O8ZA 4JT8A 3GLTA 1U2GC 5EJ7A 2JI8A 3JWPA 5FYQA 2JLAA 5EJ6A 1YI0A 5MF6A 2FR8C 4QPZA 1YHYA 4Y6OA 4GG1A 2VK4A 3IAEA 1N0HA 1Y9DA 4RJKA 5K2OA 4GPEA 3D7KA 3ZGOA 1JSCA 4RJIA 2VBIA 4KPUA 2FRDC 1OZGA 5EJ8A 4X3OA 1MA3A 2FSVC 4JU8A 4BVHA 1YI1A 4F56A 4BN4A 2WVAA 1S7GA 3FSJX 4KXQA 1NM5C 2Q5QA 2OD9A 1XLTC 1V5GA 2WVHA 3K35A 4GP9A 1EFPA 1YHZA 4GM4A 4G1CA 4Y6LA 4IG9A 2A1TR 5FEMA 4JUCA 1ZPDA 4RMIA 3F6BX 4F4UA 2DJIA 1D4OA 1Q6ZA 1U28C 3CLSD 4K9MA 4JU9A 3EYAA 2W93A 5DGTA 2B4YA 4K9PA 4X3PA 4V1CA 4COKA 4C78A 3PKIA 5EJ5A 3EA4A 1Q14A 4IF6A 4ZZIA 1YTLA 2VBFA 2QQGA 4GM1A 1U2DC 2QQFA 4TWJA 2Q5JA 4Y6QA 4RMGA 3FLMA 4BVFA 4RMHA 1PNOA 4TWIA 1M2HA 4JT9A 1PI3A 2IHTA 1M2NA 5DEIA 3GLRA 2OD2A 5D7NA 5MFZA 1BFDA 5BWOA 2AG1A 4BVEA 1MCZA 2EZUA 3FZNA 2JI9A 1QPBA 1POWA 4JD5A 1T9AA 4UTXA 2OO5C 1O96B 5MFPA 2UZ1B 5K6TA 1UPCA 2JIBA 3LQ1A 3D4BA 1POXA 1PTJC 4UTVA 2Q27A 1PT9A 4ZP1A 4Q9DA 2FWNA 4J16C 5EJMA 3CLRD 3ZG6A 2IHVA 4MQ5A 3EY9A 3D81A 2PGNA 3HWX1 4UU8A 4GM0A 1M2GA 4K9QA 4HDAA 2H59A 1HZZC 1J8FA 4MPJA 4I5IA 4K9LA 4UTNA 4BVGA 2Q28A 3CLUD 4UTZA 2PGOA 2X7JA 1UPAA 2PANA 3PKJA 4MPRA 1E3TA 3GLUA 1S5PA 2BRUC 4FEEA 1T9BA 1V5EA 1SZDA 1DJLA 1T9DA 3ZGVA 5AHKA 4D5EA 1Q17A 2OORC 2H2HA 1O97D 1EFVA 1PYDA 1SZCA 4UUBA 4BN5A 4IAOA 4QELA 2HJHA 1PNQA 2EZ8A 4BVBA 2H2FA 5EJ9A 2H2DA 4FVTA 4MPPA 1Q1AA 4BV2A 2EZ4A 4J1TC 2VK8A 1PO7A 5BWNA 2V3WA 3CF4G 4QQ8A 3RIYA 2VK1A 3GLSA 4JUFA 1OVMA 3IAFA 1M2KA 3F6EX 4K9NA 3U31A 3JR3A 4FEGA 1YC2A 1M2JA 5BWLA 2C31A 2NYRA 1UPBA 2EZTA 2UZ1A 2JI7A 3E9YA 4K9KA 4JSRA 5MGNA 4RMJA 4BUZA 4UU7A 2FN3A 3RIGA 4UTRA 2VBGA 4R8MA 4FZ3A 1U31A 5EJ4A
chains in the Genus database with same CATH superfamily
3AERB 1MAWA 1IXZA 2GBPA 2VTVA 5DT2A 4CDNA 2E7ZA 4E4RA 1IHDA 1I4OA 2IP1A 1VLQA 3ROEA 2PA0A 4OHFA 2XYHA 3WLIA 2R1TA 1T3LA 2G07A 1TUGA 3KB8A 3TVYA 3TLZA 5CNIA 3KYJB 4EJSC 3OE5A 2QM0A 4MQBA 5DYWA 1W88B 1QBKC 2EFGA 2QE7A 3GD5A 5KYYA 1YCGA 2I9PA 3HCOA 1FK8A 3JVDA 4LJ6A 5CLQA 1E2JA 4R98A 3GFTA 5EZ6B 1FEZA 4MGIR 1GITA 1DRJA 4JYAB 5G0WA 1X92A 3ZWVA 1IHOA 3AI3A 2HNBA 4OLFA 3C39A 3ISJA 4OBWA 3Q1KA 4KQMA 3JQPA 3WTCA 3LT1A 1GA4A 1T8UA 1QYDA 3O4HA 3CW9A 2D5LA 1KJZA 2WR8A 4P4SB 2V0CA 4NNJA 1K8QA 2H9AA 2Q49A 3I01A 5CFZA 3OETA 1Q6YA 2WC1A 3ZJ4A 1BVUA 1XT6A 4DSOA 4N47A 2C54A 4UM7A 4BNVA 5HMMA 5HDBB 1V1MB 1ONBA 4M21A 3H18A 1JN0A 1TU0A 3P27A 1JLMA 2JLBA 4FGSA 5CMLA 1DX4A 4JEMA 1KSHA 4ZQGA 3ZTWA 2VC2B 3TD6A 1WDKA 1ZESA 3DPUA 5FOSA 2QN2A 3VXKA 1GGJA 4LVCA 4DR5B 2BZGA 2GHIA 3ODGA 3OKPA 3R74A 1L4YA 1R8SA 1RYMA 2OAGA 2VYND 1E8DA 2WIGA 3GN2A 4JQZA 5BQ5A 4JV5B 3K8QA 4P9NA 1E2LA 4GBED 1L4NA 3MCZA 4B44A 1B2LA 3KJQA 1KK3A 2AG6A 5B1IA 3Q9NA 5KYNA 1PR2A 1Q77A 4GMXA 1QF6A 1U8UA 3C7AA 2IYOA 1YNSA 4JJ8A 1GNSA 4RZ2A 5DCUA 5J5AA 4PSKA 3DZFA 2XLBA 3H17A 1PFWA 5HZHA 1X1AA 3W7VA 2GM3A 3W78A 2XBUA 4EZIA 4XEHA 1TZMA 1E4OA 1U28A 3CUYA 1I3OA 2ORIA 2XV1A 3N2LA 3UGTA 3VPHA 4BQRA 3JQFC 2H85A 1OH8A 2XVXA 3P2MA 2VYCA 2GBFA 4Y2RA 5CCDA 2JI6A 4DIUA 3DQQA 4ZVNA 4RTMA 4C4RA 2XODA 3QY9A 4WCFB 5THXA 2D1TA 4PQYA 3ETDA 1M1NB 3ME5A 2Z8YA 4LW8A 4H7JA 2I6XA 4B4VA 1KBQA 2WVGA 2P8JA 1ZH4A 4Q18A 4NU8X 4CF6A 3EVTA 2H2IA 2I0FA 3EVAA 1GKIA 3HJHA 2RK6A 3RNOA 2YKGA 2BFEB 3WI7A 3B12A 3AY7A 1P2VA 2ZIEA 4LRSB 1GAEO 2CBGA 2PKEA 1OLSA 4KLNA 1UADA 2J3EA 1JHDA 3DXFA 3RRYA 1MRSA 3SBDA 3WK8A 1SK8A 1PK7A 3AESB 1Y4DE 3BAFA 4E2ZA 4G9BA 1IDN1 1V16B 1H94A 4F6RB 4UMDA 5ISMA 1YTUA 4P0TA 4J3FA 3VDXA 2HZ7A 1WX1A 3AM4A 3V1YA 4P86A 1T1EA 2KE5A 3LRXA 3NHZA 4LHYA 1RXSA 3RYHA 5BV1A 5FX2A 4R6WA 3C97A 5IAKA 1U2TA 2HMTA 2Z3ZA 3ZW8A 4B4OA 4JI8B 4MUMA 4R5HA 2XUHA 1NUPA 2BLLA 1Z56C 3HUDA 5ENVA 3U5ZB 3G7NA 1CR4A 2QTTA 2HJRA 4DC9A 2PZMA 3ZE1B 2VJPA 3SKYA 3H8SA 1QGUA 5H83A 4JC4A 1EE9A 4MUNA 5A1TA 1CDEA 3HA3A 5KSPA 1CV2A 5JR3A 4DLTA 5LP6C 1TIPA 3PC3A 5ALPA 1J5PA 4KE9A 3K0EA 3HO6A 4NK5A 4R1NA 3BB4A 2R1ZA 1I7LA 2BHNA 2ZUBA 3NWEA 2UVPB 4HFRA 1JIXA 3N2KA 1XNQB 4ETMA 4NBLA 4WA8A 2HPZA 4ZCMA 2DOKA 3RTEA 3UUFA 3ZXUB 2OCKA 1XKLA 3UC5A 2XCLA 1I13A 1KEPA 4MYCA 3JQ7A 4YAJA 1L4HA 1UKYA 1ZOIA 3CVJA 1JWLA 1E4EA 4GXNA 4ZVUA 1II8B 2HBYA 1XKTA 4IF4A 5AO9A 1WY5A 1XCPA 4PG8A 2I99A 5DGHA 1ZGCA 3DT8A 4YVFA 5A5DA 4HH3C 2BFDB 2FX2A 3A6HA 3CV3A 2UV8A 4QPJC 1V7PC 3OJLA 5HEKA 3WK9A 3EIFA 4D3ZA 2W2LA 1PQ4A 1D0SA 5EWMB 3VUEA 3B13B 4HP8A 1T2VA 4ONEA 5FAKA 1ZUWA 2I6FA 3DUFA 3OCZA 2Z30A 3U19A 4C14A 1GU0A 1TX4B 5CFOA 4U39A 4YAOA 3K8YA 2BZ0A 4PCUA 4RFSB 4TMKA 5CX1A 4UHDA 1ZYUA 4FQ7A 5FOUA 5E4JA 3U7FB 1Y6GA 1G5TA 3NTXA 4CIAA 1Z6AA 3UH0A 3ICVA 1LGYA 1SCUA 4C5CA 4EARA 2MR6A 1JIUA 3K0KA 4OXNA 4P0PB 2YVUA 3AHHA 4WLFA 4RV9A 4IG9A 2FCAA 2JZNA 2VLIA 2GF2A 4GWGA 1MC8A 1B8UA 4N40A 4DBLE 2P2CA 2RFLA 4Z0TA 4B4UA 3DE5X 2NO4A 4IUCS 1MD9A 1SVWA 2GZMA 3EGIA 3HYSA 3L0IB 4I3FA 4QFDA 1QWSA 4WXHA 4ZYZA 3TOXA 4EVSA 4Q4AB 5JS7A 2ZE6A 1WMBA 5JQGF 2QMQA 1RC1A 3V8BA 1L5OA 2VK2A 3HY4A 4JIMA 2QR2A 4FDUA 4LXIA 2WWHA 5SICE 4DQKA 3OZWA 1E66A 4KUHA 1MB2A 1WZEA 4PC7A 4X93A 1CF4A 1ENOA 4CMAA 4ETIA 3KRTA 1KKLA 4UTOA 1JFTA 1NDQA 1ZZGA 2AW3A 3AW8A 1H42A 3N8GA 4XTRA 2B1IA 4FEAA 2F3UA 2GJ9A 4NOJA 3BMNB 1ULTA 1AD2A 1J8QA 5YASA 1DG9A 3HJUA 5L4NA 2OCIA 2O8DA 3KE8A 2CL7X 2AYXA 4G0ZA 3C7CB 5CFMA 3IMKA 2VQFB 3V2UA 2WM9B 3IVXA 1UXOA 1DAGA 3MTDA 5KJ6A 1NP7A 3OPMA 4BZPA 4B71A 4FD2A 2O2EA 3KPYA 1W94A 2BSXA 3LWNA 4NFSA 4ENWA 2O3QA 5DX1A 3C3JA 4UVDA 2JFQA 2VPIA 3QHPA 5IEBA 4B34A 3LY7A 5J5CA 1X19A 1AQJA 2XCSB 1OYWA 2XWJI 3DEZA 4HSEA 2IYSA 4JI7B 3BXFA 3PR2B 1F2UA 2J3HA 1O95D 2PBRA 3IBSA 3E9EA 3O47A 4P34A 5FI5A 4BVFA 3L8HA 1QPZA 3W4KA 1PNOA 2H1OA 2JGJA 4ZAVA 1BWPA 2X1VA 4TWIA 4X65B 4IJKA 2FSUA 1PI3A 3BL8A 1TD1A 4HF7A 4FUQA 2XMZA 2FKNA 3L8EA 2VPZA 3K4QA 5C4GB 4A7PA 4B3GA 3GPLA 3K9NA 4NOMA 3WIOA 1RLUA 2IE8A 1SQ5A 4GXQA 4S1PA 1Y8RB 2ZZNA 3PC8A 4M1YA 4QBTA 3TLMA 4Z4FA 3NMUF 2IU4A 4AIIA 2FGKA 3WLHA 3OJFA 5CP8A 3AWIA 3HSYA 3F3KA 3GEHA 3ESXA 1J23A 4LXXA 2PUJA 2XUQA 2VDNB 4ND3A 4NONA 4EEXA 1EJ2A 3C24A 1TI7A 3DB1A 3BXPA 1BEUB 5I4KA 4DJJA 2RGUA 5EQJB 1Q7CA 3M6AA 4GNKA 1FVOA 1NKVA 2QMHA 4EF4A 1KEKA 4Z53A 3DEYX 5KSYA 1FDTA 1SUFA 1YL5A 2O50A 4PHHA 3PXXA 4QBIA 1YR1A 1D2RA 2CLLB 2VWQA 4NCNA 1GPMA 2HA3A 3BICA 2PYZA 3FY4A 3LUCA 2UZ1B 2WKWA 2B3TA 2E9SA 1UBTS 1R5OA 2C0CA 3PUYA 1E7WA 4GYYA 3QPDA 4DTIA 2EQBA 3FVQA 3TKAA 3P9CA 1BXKA 1IPEA 1NFRA 1VPLA 4D6XA 3QVKA 4IO0A 2OXTA 1TK9A 2ZKIA 5TQJA 1ADJA 1P2SA 2UXBB 3PJDA 4F3TA 5A4IS 2VXCA 3R6DA 4RL4A 4EY6A 2HQ1A 2A86A 4YRTA 4DBVO 1A76A 1OXTA 3U3JA 2XA1A 4AKHA 1NATA 4FJ0A 5ALOA 4O2AB 2FQ1A 4WLUA 3DQPA 1ONOA 2FPRA 2OO5A 3L05A 1EXVA 4AKSA 3QRWA 3R3SA 1UPUA 2OTCA 3AYZB 3GWGA 5DSTA 1KVUA 2XQVA 3AF1A 5KJFA 3ZD6A 4IVNA 1TUIA 1B93A 4LJ5A 3KZCA 1QIFA 3A6JA 4MVWA 3DJFA 1QMGA 1HNXB 1IBSA 1YI8A 1YJQA 2ZS9A 1A1SA 2GAAA 4NEGA 3QPBA 1P6QA 4M54A 1R6AA 2FZEA 3SZ3A 4N3AA 2PXAA 2PGNA 1PTJA 3KR2A 3WLJA 2XTMA 4G1FA 1P1HA 1YIDA 1FUIA 1RHKA 4KPFC 1QIKA 1EFRD 3UB3A 1WPXA 3C7KA 4JELA 1HZZC 2XGJA 1E1RD 1ILEA 3L43A 4BO8A 4HXGA 4KXVA 5H70A 1J8YF 1L3CA 1TZJA 3HRIA 3A1VA 3I1IA 4FYIA 4E13A 2VDOB 1GXSB 2J59A 2P9JA 3CG4A 1DKUA 5DHAA 2PGXA 3FH0A 4YXWA 2Q45A 5DJ5A 3CYFA 3I5XA 3H4MA 3ZBUA 2VDJA 3VYVA 1JFFB 1E1DA 1NVMB 1XA3A 1J2JA 2J5QA 1YBVA 2YWDA 4V0KA 1ZJZA 1U9YA 2Q5EA 4EJ2A 1U0TA 1L7EA 3EK2A 2DQZA 4K88A 3X2FA 1OT3A 4YPVA 4R41A 3QIVA 4A0HA 2OHGA 4Z1MA 1PFQA 3HUUA 5EESA 3HJCA 1WMAA 4IRUB 4M53A 3V5NA 3FPGA 2R7NA 5AW5A 1ZO8A 1Q0QA 3KLNA 3P71T 1SD5A 1XF1A 4RJ2A 2QD4A 3C5WP 3QUTA 5JJBA 4LF5B 5F3DA 3F7NA 4DDHA 4A8PA 4BFYA 1B74A 1DRVA 2D3TA 1QAQA 5JW6A 1OB2A 1GA6A 3MUEA 1I30A 3ICWA 2Q4EA 5ALKA 4U9IS 3CXUA 5J47A 3BG5A 3G5MA 1QHGA 3MCWA 4HUQA 1DNPA 4WZ6A 4B17A 4XCQA 3ZCQA 5LQJA 5CB4F 1BRMA 1XWIA 2MSWA 3DO5A 2O8EB 1NRXA 4L74A 5AK3A 3OA0A 4O4LF 3KWJA 1Z4QA 1H5UA 1A88A 4EPYA 3SOZA 4QUJA 3JQCA 4GOOD 3ZI7A 3IJRA 1TJPB 4NY1A 2A5FA 4FMDB 1SZCA 2PKQP 2AMYA 3U4DA 2Q8PA 3R3JA 4UFOA 1CVIA 2XGOA 1GA1A 2B94A 4CIYA 1N3IA 3KTDA 3ZTYA 1SXJD 4BFVA 4QA9A 2V7TA 4MPTA 4Q02A 3ONWA 4JDUA 4TS3A 5HYVA 1WABA 4NF2A 2PPVA 3L1HA 1RP7A 3SDZA 4J03A 1OY1A 1CIJA 4GE0A 4U5XA 5EIBD 2W6OA 3STTA 3VTFA 4EI8A 3EHEA 2H4WA 1H05A 1QYVA 4I19A 5I4BA 2DWUA 4PGGA 4JY7A 1BU8A 1AURA 3A36A 2C57A 4TSFA 1P9RA 2V3WA 1YOBA 4K26A 3MBIA 4C0LA 3ML1A 1CUJA 1FP4A 1DRUA 1EXMA 2DCMA 1HRKA 3M4ZA 5EE5B 1KIFA 5LXTB 4X66B 3IKTA 4LI0A 5JAOA 1GCUA 1G8HA 2DU8A 1UQRA 1UZMA 3E1SA 4YHHB 2QLTA 4EYKA 2A5LA 5CXUA 3I6BA 4XGRA 3B52X 4QQRA 2XKJE 4E5KA 5D5HA 2DHDA 3FIJA 3RVJA 1IAVA 2QTMA 1S01A 1OAOA 1V1RA 1XTBA 3PDIB 5JSYA 4DMHA 4ZGWA 1DAMA 2CNLA 1MB4A 3CUEF 3PSAA 3U49A 1MIHA 1T36B 3DLIA 5AJHA 2JG3A 3LRPA 2Q0HA 4GYKA 4Z9BA 3ZVLA 4F12A 4XIIA 1M5UA 2BHSA 3OQBA 4X90A 5DTIA 4B74A 3TOVA 1O96A 5KVQA 1PIWA 4BE4A 3OZSA 1M0SA 3WRWA 1MO2A 2JI7A 3A6FA 4TWBA 4BX8A 4DJEC 4HUTA 3J81k 2C77A 1H8ED 4RAQA 4CT4B 4X1IB 121PA 3G5AA 4AZ3A 4BUZA 2WD9A 3ZE8A 1CYDA 3EXHB 4UU7A 3Q87B 3EH1A 4M9CA 5A5EA 1JUDA 1KZ4A 3OM9A 3SPXA 4OBBA 5LZ5A 3WK5A 1TJ5A 1OV4A 1QH1B 3DDHA 3DONA 4WX2B 1U5BA 1E58A 1RJFA 2ZTHA 4MP3A 3TQTA 1NR1A 4GRDA 4WY2A 4DQDA 5K5EA 5KPDA 4F6LA 3TR6A 5EQTA 4Y1RB 4HADA 4AG3A 5BV8A 2O5EA 2OK8A 1I51A 3GQVA 5L53A 2J9YB 4RELA 1V26A 2FG5A 3NNNA 3N8IA 4ER7A 4A36A 1U6KA 5HF9A 2C58A 1DCMA 1DKQA 4URZR 4G9EA 2IV3A 2Z3WA 3K96A 2FMXA 1IH8A 3AF3A 3NIWA 3QVLA 3W6NA 3IELA 4G3XA 4C3VA 3DXXA 3KJGA 2DUNA 3K92A 4AZTA 5C3UA 3EIXA 1OWPA 1U7DA 5FJJA 3PDHA 1JQ5A 4YQZA 1SUDA 1JE0A 3QVGA 1T35A 2AD1A 1V4NA 2F17A 3KHTA 3RROA 1NPDA 4YCJA 1MHTA 1JGTA 1QHSA 2C95A 2ORWA 3I42A 1YDMA 4K6OA 4AQYB 1T4GA 2FY8A 4YIKA 2VHCA 4HY3A 4FFSA 2EYUA 1XUOA 1NJ6A 2GPAA 3WQBA 4M9UA 3VKGA 1VM6A 2PS3A 3AUUA 1IN6A 2I6QA 4C0JA 1N6KA 4MULA 3K1AB 2H5JA 5EHNA 5K7SA 2YC2C 3AR3A 3DEFA 1KFJB 3L7OA 7REQB 3M2PA 2EKBA 5H9WA 4HN9A 1KSGA 3RB8A 3JQDA 3WX0A 4LF7B 2R4QA 2JGNA 3JATB 4M0CA 4ZHQA 1SXJB 4Z7QB 4PEVA 5E1BA 2P78A 3OOJA 4KTTE 5DSZA 1BJRE 3VX3A 3VVBA 3RAGA 2OKGA 2ZJ0A 2JJQA 2AFRA 1EVEA 3DHYA 4GEKA 4IXDA 5E6SA 5CM8B 5HUJA 2WTUA 4JGGA 3D3JA 3HC7A 3GLIB 4EJ6A 1YRAA 1GAXA 5FWYA 2DBQA 5K8JB 3BWDD 2J3DA 2C59A 3H84A 3HCPA 5FLKA 2PSHA 4R5MA 1R6TA 3UMCA 4XDZA 1KNXA 3B5IA 4N1AA 3HKBB 2OVBA 4H7HA 2IBTA 1H4SA 1OYYA 1U3CA 2VG8A 2AOTA 4DBLC 2C2WA 4OAQA 2RKOA 3UG7A 3WIVA 1ULZA 1YIOA 5CVUA 4Q21A 2HX1A 1U1GA 2DM6A 2VP0A 1PT6A 1RRFA 1VG9B 2WI8A 1UWVA 3D5QA 3L40A 3CX4A 3IE2A 5DGDA 4K0KB 2CCJA 1ZU5A 3OIDA 6NULA 1CYEA 4IH1A 2MWMA 4TRNA 3C1AA 1I4WA 1PT7A 1RTKA 4U6SA 1JDPA 1KI1A 1WA5A 2IUUA 3SCZA 4YYZA 4XYGA 1SXQA 4D3YA 3QU2A 5C1DA 3I6YA 1QHHB 3KJFA 3SVZA 1H8HA 3LUKA 3WKEA 4B6SA 1SKYB 3W05A 1DAOA 1SC1A 3EGDA 5FNVB 4NH0A 1O94A 1N7JA 4H7FA 4L2IA 4RIHA 1CR0A 1JYEA 3ACDA 4C6TA 1EHCA 4YUAA 3L8CA 1LX6A 1RBZA 2AEMA 3QFSA 2R7LA 3DBIA 2JVIA 3ONVA 3UGQA 3TTYA 4K03A 3CSSA 4HD8A 1H2YA 1U1IA 1YE5A 3GDHA 2CDRA 2FFAA 1V7QA 3JQAD 4EB6A 2QWXA 4IDBA 3ZH9B 3BJIC 4XVRA 5IKEA 2WDZA 4AAYA 3O93A 2BUCA 5EQFA 5KVSA 3JYOA 1G9XA 1TMKA 3CEMA 3L49A 5EMHA 3QA9A 4ROSA 4YJGB 2W2OA 3A1UA 4Z7OB 4D97A 1KFCB 1GDHA 3OLVA 2P2GA 2Q7DA 5LU8A 4NZ9A 3WBBA 4H27A 3L7DA 2ZB4A 3I76A 3JRNA 3FHOA 1I0IA 1QG6A 4JH0A 1VGVA 4KTVE 3LUAA 3E05A 5C7OO 3FSEA 2GK3A 4E31A 5JYEA 1J6UA 3R4VA 1X42A 1U0OC 3FN4A 4QNMA 2CL0X 5FP0A 3SF0A 4OQPA 5IP5A 2FKAA 1Y4UA 3WQQA 1CEYA 1PGQA 1Y1KE 3WY9A 2COEA 5I5EA 5JQWA 1GZVA 1YBFA 4UUQA 4HN4B 1JMYA 1NAHA 2P1DA 1W76A 2V7QD 4KRGA 2IGTA 2R6ZA 4R3UC 4PVCA 5TS2A 4DDWA 1CQJB 1GCGA 1DKOA 4KNWA 1KVSA 4PY2A 3K0FA 2WZQA 2UYGA 1QSGA 5JVDB 5E6UB 1CY6A 1DIRA 1GZUA 3GQBB 2NN3C 5E4YA 1SUIA 1K2VN 4D92A 4PRKA 1FNMA 3SC3A 3U7HB 2I2DA 2Y71A 2FRDC 2OBYA 1G9SA 1OXUA 4BXOA 5K0FA 2YZMA 1JV2B 4HDRB 3PRJA 4AKTA 4X3OA 2OZVA 3FG9A 3DBRB 5HIIA 3RW9A 3L3BA 4BVAA 2WWFA 2ID4A 3NAMA 4FYPA 4MWTA 4RY0A 1V45E 2QU7A 3H13A 3L4KA 3D59A 4NS4A 1EINA 2DE0X 3M1AA 2ECQA 3RLIA 5L3QB 4DR3B 3RT7A 1S8OA 4DEVA 5I9IA 3AHIA 3THWB 4P22A 3PYLA 2O1EA 1FB5A 1I80A 1P8JA 2IEYA 2V0NA 3AIIA 3GB9A 3KQVA 3M9LA 3D3EA 3OJCA 5D1HA 3FDZA 4NQZA 2IHKA 3IAS1 3WYBA 1HH4A 2JJ1D 3OZAA 1ATZA 5T67A 1TAGA 1EZZA 4BNYA 1EFCA 1TEHA 4PX9A 1FFBA 2EAUA 4HATA 2OGWA 1JG1A 4NECA 2A1TR 3WAJA 2ISSD 4UHEA 4MS1B 1G291 1FFWA 1G60A 1XK6A 4YMUA 1V96A 2ZYGA 3OJOA 2X58A 5GMOA 1KAGA 2PMKA 3T9EA 1E2HA 3UV6A 4CMHA 1UJ2A 1YZTA 4UPVA 1MJGA 1D4OA 4IQFA 4Q48A 5JYBA 3CNBA 4PHFA 2AH5A 5TV2A 1X7XA 2PMFA 1MAAA 4X54A 4RPIA 1IZ7A 4PAQA 5EPEA 4I46A 3MQFA 1GLVA 2FLWA 3M4YA 4HEA6 4JP3A 3BXEA 4LSMA 4MPDA 3QI2A 5FIUA 5K01A 3ND8A 4L15A 4NX2A 1MFPA 3GT4A 3LA8A 4Y0NA 4IEIA 1IN7A 2ONKA 1HOXA 2AYZA 2FCRA 2GRJA 3DAYA 4FFMA 4KAFA 3JQAB 1Y63A 5C31A 1BE1A 2EBHX 3R41A 3K8ZA 3W7BA 1T5IA 2B8WA 2EOAA 2WOJA 1LKZA 1JR3D 4ZOQI 1YZKA 2YWRA 2GN1A 2HTFA 1YQQA 2OYRA 3VNRA 3CRMA 4Q7JB 3RFXA 2G67A 2FGJA 4BIIA 1LV7A 4FFLA 4YR9A 1K7CA 2ZVQX 3R0IA 2E82A 2YZNA 1NN5A 2XRFA 2XCUA 1Z3IX 4RCZA 4UUPA 1WXGA 3WJAA 1QWOA 1XDGA 4X60A 5I8ZA 2YR0A 3HBJA 1T10A 3N8KA 4FI3C 1NVKA 4MICA 1G6KA 1NUAA 3FF4A 3RS9A 5BV0A 1ULAA 5K8CA 3B6JA 1PW5A 3RLFA 1GSHA 1NYQA 1M8PA 3C6BA 4LE2A 1YU6A 2WFLB 4V03A 1GPYA 3U6BA 1UWKA 3HNPA 5HHTA 5KTSA 1IY8A 1BXRA 1AUXA 1QP8A 2GASA 3WGQA 3WSWA 4J76A 3R3VA 4JB8A 4Y2XA 4Y9RA 4YRAA 3K4PA 4I66A 3IDFA 4B6EA 1SIOA 2BUAA 4E2FA 4ZDIA 1R4ZA 4GUDA 1Y8QB 1BS9A 2HOQA 1B4DA 4R2XA 4XB2A 3WZMA 3CE9A 1N6NA 4A23A 5JCJA 3ANYB 3PLRA 4H1WA 1ODTC 3PENA 3CNEA 1Y6QA 3ZLJA 2H1CA 2CE2X 4KQFA 2CYBA 3CF0A 4ALMA 4XRRA 2H07A 1NJSA 1O5OA 3GU3A 4LYHA 3V4PB 4C21A 4CIDA 1QM5A 1U3TA 2ADOA 3I2GA 3HB7A 4JD5A 4PNHA 1JWAB 2ABWA 3EA0A 2EG5A 3VYRB 1MDFA 3D6HA 3OOYA 4DA7A 4LPSA 1NVDA 2DPYA 5HQJA 1U8AA 4D43A 2FPGA 4EHBA 3RUFA 2RK3A 3PJRA 3QG1A 4HJXA 1GNRA 1A82A 1NVVR 1WF6A 3TF5A 3L6CA 2DCUA 4LZPA 1XAIA 3C3YA 1N0VC 2Q3BA 2XDQA 3B2EA 3IQFA 4UATA 1U8FO 4YP6A 1ZI6A 5A7FA 4RK7A 4DZRA 3H2SA 3FKJA 3OQJA 4JYCA 4RD2A 5AHWA 8ADHA 1VKOA 1BMFA 3KQPA 2PX6A 1L6IA 2HMAA 5HQ3B 2XUDA 4C7MA 2G3YA 1PJ2A 2MHCA 4G2NA 1SXJE 3AFHA 1W25A 4UMVA 2Q27A 3L9XA 3U2QA 5B4UA 1A8IA 5I7WA 4QLBA 1BVHA 2IZ1A 1FDSA 2OHXA 2RH8A 4J3JA 4A1FA 4F4FA 3FWKA 3S8EA 3ER9A 2ODWA 3CR8A 2BEVA 2P79A 3INGA 5AH0A 2ZM5A 4AF6A 2VAVA 1MB9A 1XTZA 1ZMBA 2PSFA 3E84A 2FK8A 3DTVD 4UVIA 2AN1A 4DSUA 3GLIE 4BS9A 1ZNQO 3OZXA 2G63A 3ND7A 2GHQA 2GEUA 1DBSA 1KE1A 3WRXA 4WT7A 5AW0A 5BT8A 5HKAA 4S0ZA 1RSZA 4GZ5A 4HB0A 1JLRA 1U7ZA 3KEOA 4QO7A 2WP0A 4MQ5A 3EY9A 3G59A 4JSTA 1P2FA 2VVTA 1NASA 3F46A 3WV4A 3BRQA 1GSIA 1S0UA 2I4LA 3CZAA 2YXPX 3SY8A 2Z2XA 2H9IA 3CO0S 2ONYA 3PQ8A 2Q4RA 4HDAA 3RC1A 2Y93A 3VZRA 3P4YA 4QOIA 3HKEB 2CYCA 5B1HA 3O8CA 1W6UA 1EK1A 2IA5A 2IZZA 4JX8A 4MPJA 4Q3AA 1YB4A 1DIBA 4JLDA 4BUJA 1L7VC 1YE3A 2AG8A 3VVLA 2OAP1 2ZRKA 3Q88A 1QNLA 4IH9A 1SKYE 3ZCPA 3PPIA 1GU1A 3ZCTA 2R7MA 1ES9A 1OPRA 1CRLA 4NNOA 5FULA 3KEFA 4RENA 1V47A 2P9YA 4YONB 2X7JA 3GJZA 4TQGA 1UFOA 5DYNA 5AOCA 2JH9A 4URFA 2OOSA 4X7PA 1M2VA 2DFVA 1T9GR 2C29D 2QL6A 3ETJA 2O2XA 4LZWA 1JXMA 3VM6A 1ORRA 3EPPA 3CRW1 4GPD1 1LCIA 2C5AA 3D3WA 4QXOA 2JEZA 1ODFA 3KX2A 2PZBA 4JB2A 4V3BA 1J9EA 1MNAA 1W93A 3H5OA 2QSYA 1Z29A 3AR5A 4JLAA 4YP7A 3UJPA 2IKQA 4ENUA 1YONA 3M7IA 3OUTA 4UM8B 5F1YA 3GLFB 5GM2A 4MLDA 4OATA 1UMKA 2ZI6A 4M1ZA 4XD7D 4FNGA 5CDYA 3HEBA 1EHIA 4CMGA 1FSSA 1UJCA 4AG6A 2NTJA 3QENA 2PNJA 5JIBA 2JLUA 1CUUA 1AUOA 1BEZA 1E7MA 1UBSB 4IJWA 3AKDA 4RJTA 4YR7A 4YQFA 3UB4A 3OC6A 5JJCA 4J8PA 1I1HA 3UHJA 3VX4A 4BY9E 1S2OA 4H17A 3U1VA 1DPGA 5B58T 3FVVA 4ZVSA 2CFRA 1CQIB 2J07A 4PHCA 5K0EA 1WXEA 1KOGA 1LSUA 3KFLA 5TQ0B 1OH7A 1HDGO 3W8EA 2QTZA 3E61A 3S68A 1W87A 1Z4OA 3AVUA 5AVUA 1M75A 4IHKA 3H5VA 4LJLA 3FGOA 4MQ4A 5JSHA 2BRUA 3ETLA 1JHQA 5I5GA 1EVZA 2NZ8A 5COAA 1MORA 1O87A 1J0AA 4JI1B 1JDNA 3Q3IA 4C3UA 5TT0A 4MYDA 4PNZA 5EJ9A 1I0LA 2X8JA 3FKSD 3IDOA 4IZIA 4WCFA 4AP5A 3AL0C 4L8WB 5ICGA 4LNHA 3ETHA 5ECDA 2QAIA 2WABA 3HCNA 4BQEA 1Y37A 1DLIA 2O3SA 2ZJYA 1C50A 3LBHA 3V1LA 4BEWA 4B09A 2PSDA 4WAUA 1KE2A 4EY7A 4G07A 2VK8A 4M86A 2GBLA 1CVLA 3OEED 4I3HA 2C2ZA 5KTMA 3QOFA 4KNVA 4XPIA 1P9LA 1UZUA 3V8NA 3LVBA 2VQDA 3CF4G 2BJHA 2R6R1 4JQOA 3TSCA 3PTAA 1U4SA 3NTQA 4RKQA 3O9VA 4UNSA 5I7HA 2QP9X 5FA8A 4P4TA 3RIYA 3HKDA 3ZLBA 1WXWA 1TYCA 2GCEA 3D4PA 3T7EA 4CFSA 2VHYA 3QNWA 4EPWA 1U6IA 5F1OA 1M8FA 3AESA 1BX3A 1MO3A 3DTVB 3HRHA 3FTPA 4Q1FA 4O25A 4QVGA 4GO1A 1ZJWA 4D25A 3H05A 4GL4A 4PQFA 2HI0A 2J9GA 2ZULA 4KGXA 4BIMA 1ZUNB 3B6KA 4BBPA 2HF7A 5DBOA 2JKYA 2WZCA 2W11A 5FI3A 1MZVA 2DRIA 2JRLA 4R3NA 2C7OA 2X6RA 4GLOA 4O2RA 3H1FA 4OGWA 4C0HA 4Z9FA 1RJ9A 4D96A 2BFBA 3B3JA 2G83A 2XB8A 3JQ9A 4L5IA 2VH1A 3BMCA 1JEQB 2HRBA 3ESBA 3NR2A 3VNSA 4OHYA 4ITRC 3SAJA 1BHQ1 1RT9A 2JAWA 4GZ3A 4M99A 5SYNA 3T7DA 4ZJYA 1AA6A 4NZYA 3VKWA 2XKAA 2CUNA 3K6SA 1ZK2A 2ZSJA 2D2FA 4TLLB 2CDAA 3WNVA 2DP4E 5IYZA 5LIRA 3JTMA 3IPXA 2ERCA 4QM6A 4AN1A 3B9PA 3AU8A 5IH7A 1F1JA 4YAUA 3PCTA 5CX4A 2R66A 4DABA 5DGXA 2NAPA 5JSQA 5KB3A 4UTRA 4MEAA 1YJBA 1II9A 3K94A 4GOLD 2OV8A 3IFSA 2WJVA 4KQXA 1K7YA 3Q7TA 1OIXA 2HU2A 1YF3A 4R8MA 2WHQA 5FD8A 4ZHQF 4KPGA 4IDGA 4QUIA 3ZK7A 1N5IA 1XU9A 1RABA 2HR1A 4MR7A 2AD5A 5FI1B 5K3FB 4JJKA 3DE0X 4OXXA 1H0KA 5FT9A 1GO2A 1T2UA 1TYAE 1NP3A 4P5PA 3TBFA 1WHTB 3RRBA 3B3QA 3NWPA 2C2BA 1VJRA 4KFTA 4MTCA 3IV6A 4CEIA 4RXMA 1PGJA 1BN6A 1R12A 1ZH0A 2Q3MA 1W85B 1XCLA 5LZ4A 2H4FA 3WKBA 2D13A 3ZU2A 3DMRA 1BCRB 1E99A 1QGDA 3FFTA 3FOBA 3BE8A 4P7GA 3KAQA 1CB7A 1CFJA 4RETA 4MCIA 1ESNA 1E96A 3RSHA 4NESA 4UDYX 2GEDA 5CK4A 4B85A 1MV8A 1V3VA 1MGOA 3DMTA 1E7SA 2G4VA 4U2DA 3P26A 4QOSA 5E9AA 4W7SA 2C04A 3QLJA 2VXBA 1Z63A 3QPCA 4P3XA 3CNLA 1KJWA 3E6AA 4FBMA 4TRJA 1ZD5A 2SBTA 3RIHA 1H2ZA 2OCDA 4ZAYA 3I30X 2E4XA 1Z39A 1KQGA 2Y92A 8LDHA 1V6CA 1LDEA 3BK1A 3RC8A 1SUBA 3TCKA 4MARA 2ZWIA 4LWPA 1H65A 1SCDA 3RUHA 1QLWA 2ZU0C 3KQKA 2P69A 3ND9A 1F9AA 5TSDA 1KXZA 3UENA 3CVXA 4ZOEA 2B4KA 1HYQA 4PLFA 4BMYA 3N53A 4B3HA 2FRXA 4TQAA 3WWYA 5KSZA 4MO2A 2J32A 5IT0A 1WB9A 4PYKA 1YZHA 1EWQA 1ECLA 1T3ZA 3SSAA 5HK8A 3OQOA 4BCCA 4JL5A 3B5JA 3KVNA 4Z4QA 3UXMA 1JQEA 1QOQB 3MJDA 4GI5A 4EYQA 4PR0A 2WD7B 3LY5A 2AWOA 3T5BA 4EG4A 1E61A 2H08A 5HQTA 5FQOA 3QG5A 2Q7OE 5D85A 2FHPA 1H0RA 4XGKA 3MAGA 3N6VA 3MRTA 1X74A 3OFJA 1VGRA 2ZATA 3B1ZA 3C3PA 2WV9A 3TIFA 4G5QA 2NYVA 4IHJB 3WJ2A 1EFVB 1LFAA 3CLTD 1VCHA 3HVIA 3N74A 7ABPA 4LMAA 1QGAA 1Z12A 3TTVA 2DWCA 3E7PA 3NDPA 1Z4JA 4BRZA 5KSWB 1PVDA 3GX1A 3L8YA 1QK3A 3IUYA 3LM8A 4LNUB 3K53A 4Q24A 5DM2A 2PRJA 3C6QA 4AQ7A 2OSBA 4L5BA 2GEVA 3BZUA 4DC0A 4EKIA 2Y1FA 2ATIA 3DVAA 3V7WA 1RADA 2OGUA 4INPA 3M4NA 3G13A 4A1OA 5F9HA 1J21A 1OXKB 4PO1A 2DT8A 1H69A 1GGKA 4YRFA 3GJ5A 1C3XA 2ZUTA 1ZM4A 5A06A 3LY8A 4JWTA 1B6GA 1GARA 3K6RA 4JUAA 3UGKA 3PR1A 4MA5A 5HGJA 3WL3A 1P60A 4EZBA 1XTIA 2V7PA 1Z25A 5L40A 4HAWA 3F98A 1X38A 2EX0A 3E3AA 4JT8A 1NPTO 1CUGA 4LZZA 2C2XA 2CVPA 1N25A 2FRVA 1W49A 1XHLA 2AX3A 5ES4B 2B7BA 4FX5A 4OGKA 2GO7A 2J85A 2BFWA 5BN5A 1LI7A 2QYTA 3TH5A 4E5YA 3EXHC 2VDMB 4O1MA 4ZT2A 2PQ0A 4XWKA 1K98A 1MN6A 2LCIA 5ICCA 5IXSA 4YAKA 4M6WB 4L5CA 2HFKA 1IQUA 3EVNA 4FE3A 2JLAA 1JR3E 3EUWA 4KVFA 4PO9A 3UIEA 3ZDBA 1KORA 1FC0A 1JU9A 3OICA 3V1TC 3S0JA 5MF6A 3L6RA 3K6KA 4QJIA 4MI6A 3CH7A 1WDWB 1XZIA 4RA9A 1YHYA 2YV3A 5CLHA 1DBIA 2DGDA 3HHEA 3QJYA 4UNPA 1L5SA 1SCKA 2WZBA 5CFQA 4NHEA 4OYRA 2XUPA 4B3XA 3JAKA 2O0JA 1W2WB 1GEGA 1N9KA 1L8XA 3OCUA 2G5GX 2HNAA 3GEGA 4FDMA 4KO3S 2R8EA 5FBVB 3F6CA 2FP3A 1XDUA 2HA2A 3F3MA 4P3OA 1NBMD 1NVBA 5IT4A 4RTKA 3NDBB 5IS2A 1LLQA 4GX2A 4QBKA 3GLGA 2RAFA 2ZYIA 4R3WA 3WWEA 4Z5XA 1FPQA 3RSOA 3V2GA 2COUA 5AW4A 1DQNA 1LW7A 2HLNA 1NXWA 3L02A 3O8DA 4WY5A 1MQAA 5HS6A 3EZNA 1ZJ4A 1DXOA 4JLKA 4IWNA 4CV2A 2FSVC 4JU8A 5J2TB 3GLFE 4CLHA 1FP1D 3DZ8A 4Y7CA 3QX8A 3N6RA 3BDIA 4BN4A 2BZSA 1HYEA 4H3HB 4ALNA 2G8NA 4HAIA 4IFIA 4UVHA 4BX3A 1SXJC 2AVNA 2V7UA 1J22A 4DIEA 4U2CA 2RAPA 3GUHA 4DY6A 2VWHA 1QHIA 5BN3B 3QBDA 4ISBA 1Y1QA 4B84A 1WE2A 4V0SA 5EIBC 4MW1A 1GXSA 1KMIY 2QMOA 2WVJA 3AR7A 1TM2A 4X44A 3AUJB 4ZAXA 3RVMA 4D4IA 2W6MA 1DTSA 1SU8A 2BR4A 2JFNA 5DF1A 1Q57A 5B1YA 5C46F 4TXJA 4DAOA 3A32A 1Q0RA 1F2VA 1WDMA 1NRJB 3FBGA 1AHIA 1S7CA 2QT1A 3ZIAA 3H75A 1KO8A 2Q1YA 5E38A 1O95A 3D7LA 3MIZA 1ADFA 3ESYA 3L46A 4LY3A 2EFYA 3TNLA 4NULA 2QP4A 1CXZA 2PXXA 3TQSA 4II7A 1TFUA 3ZHTA 5KYGA 1I7PA 1U28C 3DBLB 1U9IA 3L4BA 5ALIA 4KW7A 1FDWA 1R50A 5CA0B 2P4HX 3SU8A 4N5NA 2IV7A 4F9EA 1N8NA 1YK0A 5BR1A 4JEIA 4LJAA 1LBQA 1N9GB 3AVPA 1XNRB 3OJEA 3GA7A 2ZBEA 3H1TA 4W9NA 2V7VA 1NXSA 2YHIA 1J90A 3OCXA 1L7NA 4J2OA 4LTDA 5AJVB 4AJHA 4E46A 5BQ3A 3TLYA 3NUGA 4P4GA 4GH5A 5DSXA 4BNFA 5L3SB 4AKIA 1A97A 2JHCA 1O2DA 5ITZB 1G8AA 3FCSB 4A6PA 3CWZA 1CPYA 2CZCA 4NV3A 3I32A 1MU0A 3RTGA 1S3IA 5LLTA 5HWSA 3UFXA 1O54A 3BGIA 3A9SA 1TKCA 1Z6PA 1SAYA 1QH8A 2Y68A 1LTQA 3GXBA 3LZCA 3N2GB 4I4TB 3LUJA 4D3XA 2BGTA 2HY7A 3BA1A 3VR5H 4ID9A 2CUKA 4ZAZA 5JV5A 1YV9A 2I34A 2MYUA 3QK7A 3CISA 2WU3A 5LL6P 4D0SA 1YQ9A 2E1PA 4L5YA 4QBHA 3H2BA 2H7CA 3ZWPA 4TSRA 2I3ZA 4QVKA 2FDCA 1E3MA 1PR3A 3L9WA 1FU4A 3RSSA 3IE0A 3CZ5A 2X9GA 3QM1A 4OL9A 4BMOB 3KQTA 5AR1A 1NVXQ 4BNMA 2CV0A 4GLJA 4CCAA 1WUIS 4HVCA 4MS4B 4TMTA 3GLRA 1PNVA 2QTFA 3WGJA 5BUCA 4DV0B 2ODEA 4G67A 4Q4JB 3RVPA 2R62A 5EQDA 3ST7A 4INZA 4JP5A 3IPAA 5CLIA 4DWWA 3UTCA 2FSHA 3C4VA 3IUJA 2SKEA 3CVUA 4BVEA 2VEDA 4BAZA 3T3EA 1ITZA 1KJYA 3MTGA 3PKZA 3A9UA 5MN4A 3Q7IA 1XRSB 2R4TA 4FLMA 1VLMA 1IQPA 1HEUA 1EFTA 2PUWA 4K46A 5DBIA 4X1YA 1RPZA 3ZD9A 4UTXA 2FPIA 5CJJA 1QB8A 3UJNA 2FPKA 3GPCA 4C0BA 2XMSA 3TSWA 2JRCA 1EFRA 3AB3A 3X2EA 2TMDA 3KELA 2XT6A 4JNCA 4P3NA 5KKNB 4HAYA 2EIXA 2XITA 3ORQA 1QLJA 1U98A 4H15A 4CKBB 1NR7A 5KZMB 2IYTA 3RI3A 3A2KA 1Y3FE 3HNOA 4AKGA 3L1KA 5EIEA 5JSKA 5JY6A 3UAOA 1POXA 1BXGB 1WUHS 2QN3A 1BDHA 2C42A 3MOGA 2A59A 4GU5A 4HNQA 1P1JA 2FN7A 3FOZA 4XWAA 4R1MA 4TN1A 3QU9A 3VKUA 5I3CA 5JHHB 4X62B 1IM2A 3P4UA 4E5UA 3NHLA 1VMIA 2M1XA 3KCNA 4WKPA 2J48A 4ZP1A 1K1EA 4J4HA 1C80A 2CGEA 3P2OA 3DWIA 4U0JA 4ALJA 3TW4A 2K2QB 2VH5R 1UINA 4WZZA 2ONZA 2J9FA 5KVCA 2BP7A 4MHOA 5EP2A 3D54D 2ZUFA 3V1KA 4PM4A 2ODAA 3EEFA 3MWDB 2QOEA 1JJAA 4YMSA 5I9TA 4KQ6A 3SXUB 1JPJA 1Z4IA 3ZYZA 2Y9MB 3NJ8A 2WHEA 2F1OA 1EUDA 3ABOB 3AV3A 2JAUA 5GVRA 2ANBA 5EIXA 1MOPA 2ACVA 1LF5A 1I33A 3P9IA 1G6HA 3GMSA 5TGTA 5J1SB 2NNWB 1M2GA 4BO1A 3O3CA 2D5IA 3KP1A 1FTNA 5FOQA 1BCSB 1E1LA 1OVGA 1SQ0A 4I9NA 4TYMA 2ZBGA 4GHWA 4LRQA 3OC0A 3N0RA 5E8JA 2O1SA 3F2VA 2HJ9A 2ID8A 5H3LA 4I50B 3WWOA 5HJ7A 4JJ7A 2AR7A 4M0DA 3EBPA 3EVGA 4XDHA 3A37A 4A92A 4BNDA 5BNWA 3AV0B 3CLUD 1XEWY 1GV0A 1UFVA 3JATA 3NQ41 5J4YA 1APBA 2HLDD 1ZGBA 2R1VA 3AUXA 5C34B 2BFCB 2RGAA 5KCZA 4OG2A 1NUHA 1NF2A 5L4SA 3ZY2A 4ZYVA 5KC9A 5MGBA 4EKYA 2NZWA 5INTA 2WF5A 1K08A 5E3JA 1LLFA 2P6NA 3MG9A 3U9SA 1NLFA 1NURA 1M34B 1VGQA 2D0IA 2I1QA 3DO6A 3R3ZA 4O4JB 3VYSB 4C6SA 2B4QA 1QTIA 1GT6A 3NUQA 4NU0A 4Z9YA 3PEYA 1N32B 1EPUA 3AFIA 3L82B 2UYQA 2UZ3A 1ZS9A 5CNJA 4UD2A 1SCQA 3WLEA 4BFZA 1OWOA 2N47A 3K0BA 4LRWA 5J2UB 3VSBA 2PU5A 3CMMA 4F93B 1FP7A 4NE2A 4ZT3A 1JNYA 2QRQA 3VV3A 4JIGA 1UJMA 3BAZA 2A3RA 1V43A 3LP8A 5CVDA 1W0JD 3PVZA 5A05A 3W1VA 3I4CA 4R9SA 1P5FA 4KC0A 1N6PA 1THMA 3ZVNA 4ZJUA 3R7NA 4L16A 1ZKDA 4NU5A 2ZXEA 4CU2A 4GOJA 1YS4A 1O97D 4HH4A 4IQ0A 2XMDA 4CE6A 5JS6A 2IPMA 4C08A 2YV2A 4D44A 2HRCA 4BVJA 1A7JA 2Q41A 2C2KA 2P11A 1KJIA 3QBEA 3OQPA 3CW8X 3R8XA 4C2UA 2AXQA 2B37A 2X19A 4NSNA 1VZ3A 1HDZA 4RK1A 4WESA 4NOKA 1PJCA 4W6ZA 1PFGA 1RHQA 2RB4A 1T6XA 5CDHA 2VT6A 1BD3A 4EA8A 3PYXA 3ZDYB 2C9YA 3IAS6 4LS3A 1G6Q1 3LOQA 4AM8A 4HS4A 1NC1A 2FPPB 5AI5A 4ENQA 4E2XA 1H8EA 1RYNA 3ZN2A 1JKIA 2X0JA 3BTVA 3SKXA 3SLGA 3FZEA 4QXRA 1BNCA 2O0KA 1CE8A 3W2IA 2GQ0A 5IYZF 2HF8A 3GLQA 3OPXA 1ZJ5A 1TQ2A 1NPYA 4ES6A 3I6MA 3HSKA 4N6OA 3GJTA 1CDZA 1SBTA 2EJVA 2H0AA 1J0CA 2XB6A 3EQ6A 2A84A 2O1WA 1GZHB 3LPNA 3Q4GA 4QQ8A 2VHWA 4B3MB 3DHVA 2VBCA 4DZTA 2IVFA 3NEPX 1WV1A 3IVGA 2E4AA 1I6WA 1KEVA 4LN1A 3UCFA 2O59A 4HB4A 16PKA 1NOKA 1E1MA 1O6BA 2RBKA 4UCWA 2I8AA 4CFYA 2RGRA 3K0AB 2ZJ2A 4QSHA 1V0JA 3NXSA 5DASA 4Y6RA 2ZI7A 3A26A 1DQSA 1GT91 1IC6A 1J2EA 1XMPA 1VPVA 2Q07A 3IAM1 4UAVA 3O8QB 2M6KA 4PN7A 4J1TA 3GRZA 2QX8A 5HKOA 2IOHA 3PGXA 4DCVA 1RQLA 3ZOZA 3IMCA 2WYWA 4HLDA 2QGZA 1OUMA 5FPYA 1G2OA 3LTEA 1Q15A 1D0IA 3O0TA 1M2JA 2IP2A 2QZZA 2YY6A 3PNSA 4DV3B 3V80A 1J07A 4JA2A 1USVA 4D02A 5K0GA 1ADCA 2OECA 3ESDA 4RVFA 3Q1LA 5JPCA 2D2IA 3VR5D 1KJNA 4YRBA 1XMOB 3NDIA 5ALEA 4G5SA 3S27A 2BFPA 2Q3HA 4XJSA 1OMOA 3VR6H 4OI1A 3K2BA 3OZCA 1D8TA 1AS2A 1JDVA 4NH4A 4TXMA 2QLNA 5DV9A 5TMPA 3QI7A 2NO1A 3FOWA 3AOGA 3KPVA 5F4BA 1AQNA 2J3KA 2X14A 3D3QA 1DLJA 1NWCA 4PZDA 1E6MA 2I4RA 1T3HA 1FYDA 3H19A 3BYZA 4MMZB 4OLHA 1BO6A 1H2BA 1BYUA 2TRSB 3HB0A 4Q7KA 4TTAA 5GJVC 2YVAA 3THYB 4H4CA 4JI4B 2ARKA 4GRIA 3STVA 3IJEB 3V3KA 1E6KA 3I39X 1AQLA 2OBBA 2N75A 2AK2A 2XUFA 3GFSA 3HYNA 5DP2A 1OH6A 4FZVA 4PWZA 4O2LA 3E9QA 4KZKA 3AQIA 3R9KA 4QASA 3SS7X 3LVQE 3THWA 2FPOA 1QDLB 4DMUB 4BDTA 3ANMA 3IMEA 3TXAA 3U6KA 2BM0A 4R31A 1D04A 3U3OA 1IHUA 1QZXA 1YSCA 5EKUA 2Q6OA 3OIVA 2J0UB 4IXNA 2LCQA 2FW1A 3C3AA 1PV4A 3RVBA 1T26A 1EFPB 1O03A 4V39A 4PXYA 4E1VA 1UFQA 5ETJA 5CDUA 1T2DA 1GDTA 3PR3A 4HX9A 1P3DA 1KIAA 3RKUA 1RW4A 1I9GA 1SZPA 3N5CA 3SGLA 1XALA 2RONA 4D1YA 1FSZA 1BA2A 4E33A 1AK9A 1MX5A 1JJBA 1DBVO 2K87A 2O23A 2R8PA 3CF2A 4MEBA 4IS2A 4PF1A 4J0DA 2VOJA 1NRIA 1A9PA 1U7HA 3NHJA 4YUXA 3ZJYA 2I78A 3BTSA 4E11A 4D4KA 1MOSA 4B0PA 4XPZA 4KMRA 2PO7A 1RKVA 4C2TA 4FZJA 4WKOA 1EA7A 1NLUA 4QGBA 1N0WA 1XNHA 3LPLA 2WJ4A 1ISJA 2OZPA 5IZCA 4X85A 3LT5A 5IWCA 2EZ9A 2PKCA 2VJMB 1L8QA 1NBME 4CR7A 4OPMA 2GDZA 5ALZA 3SVTA 3EPLA 1IB0A 3L7CA 1ZGZA 4JUBA 1XZBA 2NU9A 3LXXA 5CXSA 5KWEA 3Q8XB 3SDSA 1GUAA 4JP2A 3ADBA 3EIQA 3BFPA 2P2DA 1WSWA 3HL0A 3ZJ5A 1A9QA 1UC9A 1VTKA 5KQMA 3M4JA 3NVMB 4N82A 2RI0A 3A3NA 3HXLA 3H5AA 4CFZA 1DV2A 4MUHA 1T6YA 2GESA 1OREA 1GAQA 1RHRA 2V74B 1KEEA 4FSHA 5JHGB 2IXGA 5HFAA 5T8KC 2NUAA 2JH3A 3BL5A 4RD6A 1I01A 2JCBA 3TLKA 1LH0A 4N0EA 2O3UA 2I6UA 2NO7A 1V9SA 2IY9A 3DZIA 3F6YA 5IVIA 1KI7A 2CMKA 2O3RA 3Q6MA 1EQAA 1EK0A 4PX2A 4QG7A 2RIRA 4KUGA 1G8FA 2V7QA 3IUSA 1K5PA 1MUUA 3KEQA 4WLVA 5AM1A 5BQXA 2GD1O 1OROA 1RVV1 1KH1A 4EY5A 1SUCA 3QPAA 5JROA 3KU1A 4FILA 4Q82A 4AJ2A 2BEWA 1TIBA 1MJGM 5FBQB 1QV7A 4CGZA 2XYPA 2ZSFA 2YZKA 3B3AA 3PD0A 4DMFA 5B3JA 2R00A 1OLUB 4PG5A 5TY0A 1Y89A 5J4LA 3F5SA 5T64A 1E3WB 5CAEA 4RHCA 1HFKA 2XMGA 3KWLA 2QA5A 3IQIX 2C7BA 2WT9A 5DHQA 2F67A 2Q99A 4MHTA 5BSUA 5E7JA 1J8VA 1XP8A 4AK9A 3M1YA 1NQXA 3RCBA 2VJBA 3L7BA 4UMFA 2WWIA 4ED9A 4CMIB 1D1PA 4HDMA 4POAA 4BKQA 1DE0A 1RHJA 4OHUA 2I7CA 2IHNA 4F4HA 4EABA 3UAWA 2JI8A 3JWPA 3F1LA 2DTEA 5FYQA 3HK2A 5A5FA 2EL9A 3ZHBA 3ZJUA 4UASA 3EAFA 3FYUB 5AVWA 2C7PA 3KZVA 1XTRA 4TQUS 2I4NA 3VC2A 2J7PA 5KS2A 3RK0A 4QIHA 4U1RA 3AHEA 5K51A 1E32A 3CBQA 3BORA 3F4LA 3L7AA 1ESDA 2YHUA 3I28A 4WSOA 3STUA 4N5LA 4E2WA 3LT2A 2MMGA 1C8KA 1GM5A 2FF7A 1J20A 1RRMA 1H85A 4CEJA 1QQ6A 4QFMA 3CVYA 4R1SA 1TAHA 1R3UA 1ISGA 2ZLBA 5SYAA 2IX3A 2D7JA 3SHTA 4UHJA 1C3OB 5AKLA 4J2TA 1XCMA 1M34E 1TXGA 1UOOA 1WUKS 1R0RE 3GCDA 4KPUA 1FFXB 1FYXA 3KAPA 3WB9A 4EG3A 5L51A 1Y3DE 2WF9A 3EG9A 1PD1A 1E5VA 4DDKA 4GMFA 3AF6A 4ECEA 1EK6A 3H5NA 1E7QA 4M9SA 4MWEA 2W6JD 3KKLA 1DPFA 3NBUA 3T54A 3QWIA 3V4ZA 1WETA 1G20A 1RU3A 3LWZA 4QGHA 1V3QE 3OE4A 5ARDA 5IN4A 3Q2KA 1GAWA 2Q2QA 3GUYA 1D5CA 4MS3A 5KJCA 2VAPA 2H11A 3KYCA 4UEJA 2WUEA 1NFQA 2XVMA 2NLOA 3FSJX 4KSCA 4B1FA 4D9NA 2OWDA 1EDZA 1T13A 3Q15C 4HHEA 4ZALA 5IUKC 3H8JA 2JDIA 1X80B 5GAJA 3V55A 1G2IA 4OH1A 3FPBA 5E2IA 5TRTA 4F3KA 5HUHA 1CUIA 2VYVA 2PHZA 3RU2A 4P3KA 3ZHZA 2GM5A 3BIXA 4MA0A 3K35A 4MV5A 3SHOA 3ZHOA 4D8YA 2I6GA 1AKQA 1VJ1A 2FP4B 2Q3JA 4ESHA 4HGZA 2JHAA 1ML3A 1R10A 3M70A 3IT0A 1U0NA 1BH2A 3OIGA 4DKXA 1R9JA 5CEJA 2WSYB 3B7PA 3A4LA 4B81A 2I2XB 3PNBA 2NU7A 4ZOAA 3WMEA 1V8BA 3KOUA 4MRSA 2O2GA 2I55A 3CJRA 2MR5A 3N87A 3MXTA 4F4UA 4D6PA 2GAFA 5JSZB 2O52A 3TECE 2AEJA 3VR6D 3K70D 4C4XA 4EYSA 3R8FA 1TTTA 2OZEA 2ON6A 1M2OB 1JI0A 3PIIA 4L9SA 1EBBA 2W93A 2GAIA 3IA7A 3TW8A 2PD3A 2B4YA 3RIXA 4BVKA 2Z6AA 1UODA 2IOFK 2H1IA 3RHZA 1BHSA 5F7ZA 3P9NA 3UMMA 3PUKA 1GGEA 1Q1BA 1FNNA 5P8WA 3RKRA 1HWYA 1YB2A 1XZHA 3KD3A 3ZV3A 5CFNA 3ADDA 5K0LA 4PYLA 4QOEA 4YALA 1CQIA 4I2NA 1EQUA 1SWVA 2CLIB 4OLJA 5EJ5A 3ZGZA 2OZLB 1P4AA 4Y6GB 2YJ5A 3H2KA 4EB3A 2JIPA 4FONA 4YP0A 1WCIB 3BEOA 2VBFA 4RIEA 1KI6B 4HEQA 3QELA 1XN1A 2HZBA 3DFZA 4L9AA 1CSEE 1Z0SA 3J7TA 1W52X 4J0JA 4MP6A 3P0HA 4I08A 3P2KA 2ZJ4A 1XTTA 4PZLA 1F12A 1GFIA 2YBEA 2O14A 3IT3A 4L4RA 4U2EA 4MCHA 1YCHA 4MUFA 5F9MA 1I3CA 5KQLA 2PUCA 4KL8S 1HYHA 2PQ2A 5CH3A 3QVMA 1KKMA 1PFYA 5EOVA 3AF4A 3KZKA 1VBFA 3EC7A 4EEKA 2ID9A 1Y48E 2H7YA 2R6FA 2WUFA 4H6XA 1M2HA 3G2KA 4ABTA 4C43A 1Y1LA 1YR3A 2X8WA 2ZBQA 3QSYA 5U4QA 3G8BA 1DDIA 4L8YA 4BNLA 1RACA 3G0HA 1J0XO 4WKBA 1YFKA 4J0KA 5D7NA 3UJDA 3X1ZA 1XN4A 3N2ZB 1OJ7A 3I0ZA 3QH4A 1OBVA 3NTRA 3SZGA 2WKPA 2WSMA 3SICE 1UEIA 1NMYA 4KHZA 2NW6A 2HSJA 2PGIA 2CBZA 3TRJA 2EG9A 1C3VA 4TXHA 1EU1A 1U1FA 3U44B 2REOA 2G77B 5ENZA 2YCLA 1SPBS 3AETB 5B4VA 2EV9A 1Y5IA 4KG7A 1BHJA 3A9CA 4Q19A 3GFRA 2R2GA 3FCAA 1DIGA 2CMDA 3AQ4A 1KAHA 3D6FA 1VL5A 3ASZA 3DDUA 4RHFA 1DCTA 4RD4A 2F1JA 3GRRA 1I10A 3QQ5A 2I6TA 4LI3X 4XX0A 2J4CA 4ERXA 1E0JA 4I8DA 2WAMA 1QQBA 4Z4IA 1DADA 2EERA 1MEOA 1LXCA 2PWPA 3BD6A 1I6KA 3GDWA 4TV8B 3UWOA 1WU8A 3TLXA 4MGHA 4C07A 3FMPB 4TT3D 1XPRA 3WLOA 3QEBZ 3BFVA 1NDHA 2JCXA 3LCUA 5I3ZA 1IYZA 2PJRA 4PW0A 3HXOA 4NBNA 3A1SA 1DI0A 3OX4A 3GK3A 4RC9A 2BKLA 3FVWA 2GHTA 1JTFA 3MJRA 1TL7C 4MW7A 3T5MA 3GNLA 1S3GA 3HXKA 1GQYA 4PS0A 1LFDB 3HY6A 1SA0A 1Y3AA 1QUFA 2QM8A 4HX2A 4TTRA 2X3YA 5LQDA 3K70B 4QYTA 4CQLA 3LQYA 5B3KA 1Z3CA 5HCUA 4X6UA 3HSSA 3DE3X 2VP3A 3B38A 3Q40A 2WV7A 3R3HA 4RVHA 5DXAA 1DDGA 2MMCA 2Y67A 1GG5A 4MGYR 4X20A 3LCVB 4Y98A 2PH5A 4GXRA 3T15A 1J06A 3ZI4A 1KR5A 4HB2A 3QPVA 1P0QA 1X9GA 2ZWMA 3IT1A 3LHDA 5ELXA 3ELDA 4PSVA 1SQSA 1HQYE 1TYZA 5F21A 3NOOA 4AJLA 4WOKA 1XR3A 3HWX1 1WEHA 4KLRA 2I66A 1KEZA 3ZKWB 5I51A 5AW9A 5M34A 1NMEA 4JI6B 2Q5FA 3RTCA 1L4MA 3GGDA 3M89A 5ULLA 5JARA 5F3RA 1JFLA 3NETA 4DUPA 1ZMOA 3PGA1 4Q1VA 2AS0A 2NU6A 5TVGA 1ULUA 2J5KA 3A6GA 3OHSX 4LWQA 3QU4A 5GGXA 3S5JA 2KI5A 3WKCA 4BL5A 1II0A 5TPWB 3SIWA 2BOVA 4EFKA 3JASA 4FN5A 3VPGA 5HKBA 1T5DX 4GS5A 1H1LA 3D8SA 5E95A 3RFUA 1GNTA 1CZNA 2P9HA 3AEYA 1UCFA 1LSJA 3AEUB 3PUIA 4FFOA 4N3CA 1HLPA 5HF8A 4TSKA 1JA9A 2OV4A 2B1QA 5JTTA 2PBLA 2PYIA 4IIUA 5AWFC 1QZUA 4L0MA 4MAMA 5F98A 2WKQA 1Q0LA 1RRKA 2B1GA 2ZWVA 3RM3A 4OHMA 5DLEA 5AYVA 4G09A 3F74A 4QTZA 1NA5A 3OEEA 1S5PA 1MABA 2WMOB 2O8NA 3HA7A 3JZAA 3L8ZA 3LFTA 3PVCA 5ALSA 3RKSA 4E32A 4YV1A 3REQA 4QWWA 4H60A 3WGLA 4BCBA 5ERYA 1OX4B 4FDLA 5AKXA 1HZJA 2GPYA 3DF7A 5FB3A 4INOA 3USZA 1DU4A 4B3TB 4PG7A 2CK3A 2AFHA 1YB1A 1MRNA 2C61A 2GVNA 2PE5A 1C9MA 3LQ2A 3TLEA 1E94E 4JR1A 3EVEA 2NZJA 4D7AA 4CF7A 1EFVA 4HDSA 2LIPA 3JALB 1M72A 1XQXA 3EF3A 1X94A 5D01A 3T7IA 1UKAA 1GIAA 4R7GA 2O9JA 4BGUA 4UUBA 4GPAA 2JJ2A 2AG5A 1G2QA 2FYTA 5KOIA 4MUIA 1JBEA 2ZIWB 4R51A 1KWKA 1W48A 4RPJA 4HQNA 3WHPA 3ZCRA 3OM8A 3MCVA 2EFHB 2FEXA 1XEXB 1FX0B 4JLMA 1Z0IA 1DAFA 3ICEA 3R8CA 821PA 1C1DA 4FR5A 4L7QA 3GN1A 1A0OA 4DSTA 2E5LB 4XXHA 4O4HB 5BUSA 4GC9A 2V45A 2J8ZA 2AHOA 4BV2A 3GVXA 1AK2A 5ALVA 5C2JB 1ORHA 1CUBA 1J9GA 3GRCA 3MWEB 5CUQA 2FZLA 4KE7A 5IASA 1RYDA 2L42A 3C8ZA 2FAXA 5FOTA 3PGJA 5G1PA 4I99A 4NBRA 3NKLA 2KSQA 3QUAA 1OBHA 1IK4A 2C03A 1J8DA 3PJEA 3WGOA 1VECA 1M0TA 3C1UA 5EHXA 1TF7A 2G76A 3E2PA 4JA0A 3WQSB 2VTEA 1EUZA 2V98A 4XM1A 2AN4A 4FR2A 2FU5C 4ZPJA 1UMCB 9ATCA 4G4IA 5I45A 4OXRA 1PJLA 3G3EA 3TJMA 1EM8B 5CIQA 4ECAA 1CQXA 1KETA 2W6IA 1DAHA 2CFOA 4OU4A 1DBPA 5ECWA 5JMTA 3HJFA 3S28A 2RMKA 2VJCA 3KBBA 1EUQA 3PCRB 3ISTA 1PNTA 1BHO1 1O7JA 1N2CE 1QR2A 1KXJA 1X3SA 4MYHA 2V9ZA 2P35A 1JALA 5BWLA 4WCDA 3BE6A 3RS8A 3THRA 1LK5A 1YZGA 1LLCA 3FPAA 1UPBA 2DTDA 1QAOA 2D7CA 4BQOA 1CWUA 1P4JA 1RWVA 3C2QA 1GUBA 2EQAA 1X2BA 2CNWA 3ZDDA 4JKIA 3BMQA 4TL7A 3WGMA 4HWGA 4D56A 2PFGA 3GJ8A 1D2CA 3ZUPA 2I7DA 4TGLA 4PIVA 1RAHA 2LV8A 4LGCA 1CFZA 3G9TA 4M1KA 1YFJA 2J5RA 4YCMA 3N7AA 3K6JA 3Q7QA 2VTKA 1U04A 2G9RA 4FOPA 4TOIA 2X7XA 5JLAA 1ZG3A 3ZVMA 5F2EA 2BTQA 3LT4A 2V9PA 1N6IA 4OHXA 4R8RA 2W0SA 4OXQA 3F5DA 5C8YA 4JZKA 3ADKA 4C2BA 4NCHA 3Q3JB 1HG1A 4Y2JA 3AKCA 2F6RA 3S2IA 3D9QX 2A9QA 4JXZA 1TOAA 2AT1A 1PUXA 1K27A 3ELWA 3L6BA 1EP1B 1C1HA 1Z6XA 4JODA 2ZIAA 4Q0MA 4XUGB 3UF0A 3SZUA 4RM3A 1GRQA 2BF4A 1GL3A 1D1TA 1PG2A 1L4LA 3MUFA 2LTAA 4TXNA 1ULBA 1XGKA 2G17A 3WK4A 2E18A 3WBJA 4X5OA 2ZVPX 1QIJA 4B3DA 2CD9A 3GRPA 3HMQA 5JAZA 3U3XA 4BLUA 1P2GA 4F45A 4ZREA 2H4HA 1G21A 3E03A 1SKQA 5LJIA 4CL2A 4YS6A 1O77A 5ADVA 3THXB 2WSLA 1G5IA 3AI2A 2UUAB 1GTG1 1KEUA 3DW1X 1XVIA 1V6AA 3LX8A 2V4ZA 4WXPA 3VJMA 2HSGA 4C03A 3WLAA 1QQ7A 4PYJA 2Q5HA 4ZOLB 3SC2A 4YEDA 2QZJA 4UE2A 3N28A 4XUEA 1T24A 5T4BA 2XTJA 4MCAA 1ISSA 1RWBA 2FW0A 3HDHA 2NP7A 1H22A 1RVDA 2H4JA 2HIAA 4QXMA 1Z7GA 3QFRA 4ZT7A 2AE1A 2DR3A 1SOMA 4DR7B 1LEHA 2HJSA 3UHFA 3VR2A 1H6BA 1TK2A 2QY6A 2XI4A 4MVYA 2JGFA 1KYIA 1MEJA 1TPYA 2QN9A 3DMNA 1IDOA 2F9MA 1U99A 3H4IA 2PZGA 2GEKA 3BTOA 2BGRA 4I1RA 1LQ2A 3QV1A 3IVRA 1IM5A 2J9ZB 3AUKA 3FRHA 3R6GA 5I9MA 1VLHA 4AT1A 4F2GA 4KRFA 1AVTA 4IY1A 4IMIB 4OFXA 3FFBA 5HKKA 1DCFA 4U7PB 1K0UA 1ZRNA 4G4SO 5TPZD 1KERA 3WICA 2CF6A 4R2JA 2IYYA 1Z2AA 1XVTA 2Y1GA 1I7DA 3BBLA 3JARB 1GZ3A 2C7GA 2VP4A 1Q21A 1JQAA 1KPHA 4MRRA 3HCWA 5EJFA 4YCDA 4OHZA 4CF3A 2ZFUA 2E6UX 2WEKA 2H2AA 3GFOA 2ZITA 3OIFA 3OTOB 1M1YA 1Y4AE 4HZUA 3I52A 1XPOA 3T4UA 3TFOA 4U3JA 3ZZNA 2IZ6A 2VI5A 1PLKA 3BXGA 4WXEA 3UTDA 5LQAA 1UJ6A 1FCJA 1M3SA 1GFZA 2OBFA 3AJAA 4TL8A 3K0SA 3GG9A 2AK3A 2QTAA 3FOAA 5FR2A 3I5YA 4EENA 4BYMA 1A2QA 2XNCA 5JBIA 1AQ6A 2JF0A 3UJ9A 1TM1E 1W47A 5GV8A 2ZRHA 4YECA 3RS7A 2ZRMA 3Q3EA 3LQFA 5CLLA 3VR4H 4HV4A 3DV9A 4N41A 4KU4A 3TQQA 2INGX 3GBVA 3ASVA 5F52A 5ED4A 3J81A 3S7ZA 2PXHA 1HFJA 1NN3A 3MIIA 1I6LA 2Y0EA 5D51S 3D43A 3W1EA 2RJOA 2JFYA 1TADA 3WLPA 1DFGA 1XLWA 1QZTA 3G2QA 1AO3A 1RI4A 3CLUC 4FGJA 2I1VB 3MJTA 5EFOA 3L7JA 1IL0A 2XNDA 2WKRA 4NPAA 4U6NA 5CT5A 1R16A 5PNTA 4GZLA 3ELUA 3IQXA 5AK4A 5IC6A 5DM4A 4CKBA 5F1KA 4D3DA 3RVKA 5TARA 4XJTA 3D3KA 3AHJA 4YDRA 3V46A 3H6KA 1B76A 4CG2A 2VHJA 2B2XA 4MV0A 1EVLA 5ALTA 3IIJA 4X8MA 1SNYA 1QF9A 3CM0A 1PEAA 4RS4A 4DA9A 2OMKA 4RPLA 1QX4A 1YS6A 3NTUA 1XDWA 2GILA 3IPCA 4NABA 3SD7A 1I2BA 1A5SB 1S9DA 4HTFB 1YRLA 2Q2WA 2VTDA 3JD2A 1KZ7B 2IXTA 1RFLA 3PPXA 4OHKA 3OESA 1Z2OX 2WUDA 1MEEA 3B85A 4UBOA 3SYTA 5HZGA 1XFDA 4XWWA 2DERA 1V39A 1XD2B 3FUXA 4LOLA 4GECA 2Z4TA 3Q3GE 4RPCA 5EUQB 3IV9A 2SICE 1T29A 1CD5A 4RK0A 1ZD1A 1HUQA 4YH1A 2E37A 3LI2A 1USIA 1E77A 1ENYA 2XPCA 4F5EA 2ECPA 2XHEA 4I1IA 2M1ZA 4CU5A 3A11A 1C0PA 1T3TA 3ANSA 1I2MA 4QLOA 1TAQA 1QO0A 1PGPA 3DFKA 4H7EA 4KDCA 3TCNA 2WUGA 4FT4A 4QQFA 1P1KA 3CBGA 3JQ8B 1N4DA 2CDCA 1WOYA 3ECAA 4OEHA 4NCIA 5GY7A 3GP8A 1GG9A 3CURA 4TS9A 4H2DA 3X44A 2AZTA 1FFCA 4G8JA 2PJUA 3KLMX 4EHAA 3TUIC 4PYQA 3C6MA 4R1PA 1PL6A 5BO5A 1NW4A 3PFHA 4JJ4A 5CTAA 1LZLA 3IAM6 5A3VA 5JCXA 2O8BA 3M6MD 1SVOA 3HRKA 1YMQA 2E1RA 2P2YA 3DPSA 3EXFB 3G89A 1FS5A 2YW9A 5JS1A 3CGWA 3CZ4A 3LKZA 4YRQA 3G0OA 1SXPA 2IPNA 3S44A 4A4DA 5KUTA 5FOVA 1OD6A 2GTHA 3G82C 4DIKA 1SVKA 2QW1A 2YHAA 1MDBA 1WM1A 3OP4A 1UK9A 5BQPA 5CBPB 3MVEA 3LT0A 1D4AA 3VC1A 1OFUX 3ZR4B 4OK5A 5DNVA 2GCIA 1Z8FA 1NI4B 1V5IA 4IGKA 1D8AA 3L0BA 3JQGA 3UAVA 5BW8A 4NIMA 3A31A 4QBFA 1NHWA 1YVEI 1NUSA 3IHTA 5LYJB 4B7XA 4KR6A 3DBOB 1G98A 3MT7A 5D5PA 1NX9A 1JSZA 1KNQA 1QTNA 5LA6A 4B4DA 5JADA 2C07A 3DP7A 4KR2A 4LF8B 2B4TO 1F8FA 1TU3A 1CJVC 2C5SA 2QG9A 3BXOA 4DLPA 4GPIB 2EBUA 4C78A 1S8FA 1U2SA 4PSDA 1ZIOA 3PKIA 3ZY3A 3NV7A 8OHMA 5BVHA 1KMHB 3AVWA 5AVTA 3L0YA 3PXAA 1SHTX 4AF8A 1PWEA 1F5NA 3W2GA 3W4JA 8GPBA 1K5HA 2QRHA 1R37A 2IPAB 2PZEA 3FNBA 3G9UA 1TUBA 2ZREA 2O48X 2C5BA 1KU0A 1XP5A 1G63A 5F51A 5DW0A 1IEWA 2SKCA 1K8ZB 3AZPA 2FA9A 4B6FA 1DZIA 3IIMA 2F90A 3RYFA 2AX4A 5AKEA 2X9NA 4C88A 2WSBA 2C92A 4TLAA 1F8XA 4JYMA 4Q9JA 3UKOA 2QR5A 2VKTA 4Z3KA 4JT9A 2QRVB 1VJ5A 2FMKA 2IKSA 1E7RA 4J4BA 1GLNA 2WD8A 4MCJA 1LB1B 2CLCX 4K6FA 3PPVA 2V7XA 4RIIA 4RK4A 4ZD6A 3VI3B 2O8CA 1YK1A 1SB9A 1U2DA 3I34X 2DH6A 5DEIA 3TNDA 3FYUC 2VDPB 5KTRA 5JJKA 4LJYA 3PEVA 3WZLA 4KWEA 3ZK8A 4AMVA 1RDFA 4KQIA 5CDFA 3HDQA 3ZH2A 2X22A 1WG8A 3PDWA 3NG1A 4XLZA 4B47A 3WHLA 3R7DA 1XMXA 3FJ1A 1MCZA 1F0YA 3O8BA 3ROGA 3SHFA 2Z4RA 1IU9A 4TV9B 2X6TA 3F7OA 1A9TA 2NIPA 3R5JA 4L0CA 1JQJC 4MR9B 5KEIA 2GFIA 5G0VA 4DNFA 4DQLA 5IULC 2ZBFA 3G1WA 4MVXA 1BS1A 4B5LA 2F4VB 1XZQA 4O2BA 3ZGLA 1X8KA 1UAYA 5KYVA 3E53A 3F49S 4REQB 3H16A 5DBGA 1N7GA 3FJOA 4AY4A 1QNFA 3UK6A 4YAGA 1LQTA 3A0RB 4PZYA 2X76A 4C4TA 3GO4A 1V8DA 2L2QA 1LBSA 3LQ1A 4HFNA 4IFBA 3CUUA 1QP7A 1AN9A 3DOJA 4COOA 4G5XA 4Q05A 1B16A 1KJ9A 1QBGA 1AB5A 3NFYA 3W8DA 1MJNA 1CP3A 1ZOPA 5CHEA 1HRDA 3W8RA 1QIDA 4IJ6A 1WZUA 4K6KA 5IF3A 2ET6A 1ANKA 1BVYF 3EFOB 1GGNA 8ATCA 1A71A 1OFHA 1XJWA 2BGKA 2XF2A 3WGNA 2REQB 3SLKA 1PQYA 2G4CA 3VOSA 1H2AS 1E0KA 4PXSA 2OR3A 3SC6A 1QCDA 2XBLA 4J16C 3VR4D 1FDIA 3QUCA 1A4RA 1KHHA 2FDXA 2IYRA 3DYIA 3PHLA 5DTRA 3UK1A 4C7JA 2AKEA 5BV2P 5H8WA 3NJRA 5D8DA 1T5LA 5BW4A 2GRUA 1FUYB 5KOJB 4QUAA 2VJOA 5ICSA 3W04A 2O8FA 1VE1A 2J0UA 2PAAA 2QRNA 2XKBA 1GUDA 2DFNA 2R7KA 3R4CA 4WL0A 3ZZMA 2BCJQ 1PF7E 4M3NA 3ZY6A 3TSZA 2IBMA 3ZE6A 1LS1A 1EDEA 1UBKS 1VLLA 1IG3A 2RC5A 4OQLA 4UCQA 3CB4A 4YT5A 1L5LA 1ADGA 5JFOA 3RG8A 4UTNA 2YQ4A 4AI6A 4IGFA 2XCTB 1C1XB 3BPSA 2R60A 3PRHA 3ZX5A 1QU2A 1Q1GA 1C7FA 3B9BA 1Y33E 4UARA 4Q6WA 2OQIA 1C0KA 2CBXA 1RCTE 3EXG1 1AU9A 5DOZA 3ABIA 1E5QA 2DUUA 3DM5A 5LC1A 4DLYA 2QX9A 6LDHA 5CB8A 4RY9A 2IL1A 4V0MA 3K7EA 1GFWA 1ORDA 5IC4A 5F5NA 3EZYA 1FNSA 2PBZA 3RU3A 3JAWB 4I55A 4M0PA 4N3BA 3AKZA 4I5DA 4Y2SA 2O2HA 4NYIR 1IXSB 1N0UA 3NCTA 3W79A 1KQFA 5H02A 4B3JA 3BZWA 3OZGA 1QKJA 5H4GA 4BMVA 4DILA 4OGGA 4M60A 1NU8A 1STOA 4HVTA 4ND7A 2JIMA 3TQFA 5LQKA 2IS6A 3IXMA 1SG0A 1YH3A 5K2MA 1IHYA 4JAVC 5CDSA 2CLEB 3RRFA 2GM9A 1NY5A 3ZWKA 3GAAA 4Q1AA 1Y98A 1H2HA 5LOVA 5AUOB 1M76A 1TM4E 5KYTA 4M7WA 4KQKA 1MQ9A 3KEGA 3B60A 1R4NB 2BFNA 4NK4A 4JCCA 3T06B 2CVZA 3I4FA 3OFSA 1ATIA 4B7AA 3M82A 1DC6A 1X70A 2IF0A 4LYFA 4GX1A 4HGQA 1R0KA 4IAOA 1INLA 1Z0UA 3ZIUA 4D82A 4I5FA 1M6WA 2HT6A 1HFWA 3T7SA 4R2MA 3IA2A 2NVUA 3WWZA 1GN8A 4QBGB 1L9XA 5JNSA 3IVMA 1PZNA 5HGXA 3BSFA 3FMOB 3U4QB 2GJKA 4G97A 3I2YX 1GNPA 5ANRB 5FPPA 2XZLA 3PZRA 4G65A 2PJDA 1A8UA 1TLFA 3EJWA 3T9CA 2OLKA 1ID1A 2XECA 2Z56A 4JMPA 2OBLA 1JXAA 2RH5A 5AM5A 1NMXA 3BHMA 3LX6A 2H1WA 1MXHA 5EMKA 4D0RA 1T4CB 1UPXA 3AEQA 2Q6LA 1Z6ZA 1U65A 1IN4A 4DLBA 1IOLA 3U16A 3VZBA 3JY6A 4OL0A 2QD5A 4XGIA 1KAOA 4LJKA 1A4IA 4EDFA 4F6CA 2AVDA 2RHOA 4US2R 4KGVA 3O3OB 2B9EA 4ND8A 3WHKA 3BXXA 4C22A 3TFWA 3R5SA 4M8SA 5BYKA 5AKIA 3TZKA 1U8EA 4GBJA 4YGXB 2XYVA 1DIOB 1OJLA 4L76A 4RZQA 1DTWA 1N6RA 5C8YF 7YASA 1ZNYA 2OQRA 3JYPA 4RLFA 2BEUA 3VU0A 4UMEA 4IZHA 1JKMA 1Z5OA 2OQVA 1X7YA 2OFWA 2V4UA 3O1JC 4GI3A 1SPXA 2DWOA 2C00A 4G5FA 3DG9A 3B9RA 4W99A 2WWVD 3WGGA 2WU8A 4FQ8A 4TVSA 1WPRA 2AR9A 4ILKA 3DHEA 4QXPA 2I54A 1V1JA 1G4AE 1XQWA 4KXNA 5D1NA 3EN0A 1Y80A 3SX0A 1IZ0A 3TOSA 3FI9A 1QR6A 2A0XA 3AINA 1U5AA 1L4FA 3I8SA 2ODQA 4FFBB 3HCCA 3VDRA 2FN8A 3K70C 3SM9A 3H2JA 1D7AA 3Q0EA 1JR2A 2JI4A 4W5WA 5IX8A 3SIXA 4CM8A 1J56A 4Q1BA 4M22A 2QLBA 1OKKD 2ZJ7A 3HACA 2ZJ6A 3HNRA 3Q2IA 4UXIA 1WXDA 4ZARA 3V2HA 4DUGD 2SCUA 4CM9D 2XWQA 3CR7A 5KWJA 4RY2A 3P2YA 5JWHA 3DCNA 3NZEA 1XTPA 4MQ6A 5BN4A 4AD8A 1LY1A 4HMQA 1IEXA 3EXG2 4JLOA 3WC4A 1XWFA 1L5VA 5LLDA 3UVEA 1TT5A 3IODA 3AY0A 4ZV7A 3EIUA 2ZCJA 2WYVA 1CUWA 3C5CA 3DL0A 3EVDA 3EVCA 1RQXA 3LZ6A 3OUZA 4IIVA 1KQNA 4B6RA 4BEBA 2K2WA 2YJ6A 3FB4A 2P7IA 1XVVA 1IULA 3PX2A 4LDRA 1KDPA 1X80A 4CBVA 4TUYB 1IY9A 2YWGA 1RZRA 3BIFA 2ZIZA 2DEUA 2JFUA 4J1NA 5I7FA 2CV1A 1CULC 3GUVA 2WA1A 3URMA 2P2NA 1L5HB 1KJ8A 2AJCA 5JNWA 5ALJA 1VSUA 1ZICA 3KKPA 3NHRA 3R76A 3MMSA 4EYGA 5KTNA 3F8TA 2O5CA 4JJFA 4UC0A 1L3IA 3G8CA 4MVJI 5A4FS 4RL6A 2P1RA 2FETA 1JJ7A 3L7NA 4BP1A 1G5HA 3LU1A 4W82A 4UBNA 5HRAA 2XR1A 1FVFA 2O57A 2ZU6A 4U0KA 1GZDA 5BWCA 1HE1C 1MVOA 1SHLA 2WIAA 4J1SA 4KODA 4V0QA 1KP3A 2LR0A 3NXKA 1B0AA 1FU7A 1XZNA 5EP4A 3S8MA 1ULSA 5B1DA 1ACJA 1EE1A 1OOEA 1ODKA 2VRWA 1G42A 5FPHA 4RHEA 5CVJA 5JYDA 1E79D 1TVCA 1YIAA 1GYQA 3AKYA 4CLOA 5GV7A 1V8FA 1X7ZA 2EW2A 4TKUA 3ZCVA 1MH1A 2A1UA 2WAXA 4MGZR 1BFKA 1J25A 3M4XA 4YMVA 4BGDA 3QITA 2YVLA 4WXRA 4AJ4A 1T9CA 4D9IA 5JNTA 1A1VA 5C7LO 2GNPA 4GEGA 3EUFA 4LZNA 1R9NA 3T95A 5IW8A 5DX0A 1KDOA 2GM4A 5KX5A 3I1FA 1PQWA 1WZNA 5TS3A 3CXRA 1PK8A 5IJXA 2HPAA 5EMMA 3GJXC 5DBFA 3HJNA 3R5XA 1WW8A 1B6SA 4E12A 1MQ8B 3K0CC