3HFGA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an sulfonyl-piperazine inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hfgA00
2HMVA 4IM7A 3WSWA 1B0AA 3KYCA 2Y1OA 2QYTA 4IIVA 4FJ2A 2B36A 3KTDA 1X15A 3AI2A 1A9YA 3ZWVA 3I9LA 1HEUA 4HX5A 2ZCUA 1I2ZA 2V6BA 2WD8A 1JKIA 3O26A 3AOEA 3CMMA 2GSDA 5DCYA 2HUNA 2IRWA 3GN2A 3MOGA 4JROA 3W6UA 2ZTVA 1UAYA 1SPXA 4R51A 3NTRA 1PTJA 1XGKA 4GSKA 1EZ4A 4IJWA 4DC1A 5L95A 2X0NA 1E1LA 1B8VA 1D4FA 4J7XA 4YQZA 2EEZA 4RF3A 4E5YA 1ADGA 1I5RA 3DHYA 1PJTA 4W7HA 2EG9A 4IXTA 3VPSA 2PFGA 4W6ZA 1UXJA 1PGPA 4E0BA 1HLDA 2FRDA 2EJWA 2O2YA 4BGIA 3I9KA 3JQ9C 2NTNA 4DGSA 5JC1A 5KVSA 1R66A 2YV1A 4ND4A 3RUEA 2EP7A 5I9LA 4HADA 2O3TA 3ZWMA 1T26A 2VUTA 4KWIA 5JDIA 4R41A 5DOVA 4HFJA 3GUCA 1UZNA 1BXZA 4LRSB 3PLRA 1KVSA 1DPGA 1PEDA 2DQ4A 1IZ9A 4K26A 3ZWPA 4DIFA 1V0JA 1YL5A 5L53A 3OJOA 2FZEA 3GK3A 1ENOA 4RV9A 5A05A 1ZNQO 2OMEA 1RM3A 2ZJ0A 4BKOA 2WYWA 1O8CA 3D4PA 1NQOA 3M1AA 4KOAA 3GAFA 3BMOB 1QLJA 1NWCA 2JKVA 4Y98A 1JTVA 5BNIA 5DF1A 4E2ZA 1E92A 1DRUA 3UFXA 3I9NA 1Y9EA 2ZIZA 2R00C 5COAA 1N7GA 1DIHA 3GEMA 3IP3A 2ZATA 4KWHA 2H1SA 2QRLA 4FOSA 2QHXA 3BMNA 2DUUA 1I2CA 2WEKA 3WLEA 2PTGA 5T6BA 4XYBA 1GZ6A 5AXAA 3RBVA 4YR9A 1HDZA 1VKNA 1GZ4A 4BMNA 1T2EA 3GVXA 1LRLA 2I3AA 4FOOA 2GN8A 4TWRA 3PDJA 3AM5A 4LMPA 2BLLA 3H3FA 3NGLA 4U5QA 4DYDA 1I8TA 3VDRA 4LMRA 3HFSA 3QW2A 2YW9A 4IPTA 2DLDA 3G1UA 4R3WA 1PR9A 2DPHA 3AOEC 1XKQA 3FBGA 3JYPA 2BELA 2Q50A 3PHGA 3PJDA 5L7YA 1R4MA 4CQMB 3DAGA 4I9UA 4JJFA 3KEQA 2Q2VA 4GPD1 4OXNA 1E6WA 4YAJA 3EW7A 2V65A 4CV2A 1H6BA 3ZV4A 1VPDA 1XIVA 3PLNA 5G0WA 3TDKA 2D4AA 2CFCA 1QYXA 2BGKA 1L1FA 5IAAA 1UDAA 2J5QA 3SBOA 3BIOA 3QHAA 1XQ6A 1R6DA 6LDHA 3FTNA 1E7QA 2EF1A 5I9MA 3D5QA 1HRDA 4AVYA 1C0LA 5HWSA 1RM4A 3AM4A 2Y68A 2VRBA 3IIEA 5JY6A 3C7CB 4O1MA 4O59O 4N54A 2AQ8A 5A4DA 3B70A 3JQEA 4FN4A 1KVUA 1I3MA 1ZXLA 4HBGA 3TQHA 2YUTA 4NFYA 1QR6A 1WW8A 5I8WA 1VKOA 2VRCD 5KJ1A 1R0SA 4AJKA 1ZK1A 5JDIC 5A9SA 2BFOA 4WPGA 1U3WA 4L73A 4ALJA 1KY5A 3RIHA 3U5TA 2PZJA 3MJVA 1J4AA 1WDLA 5EINA 4MIOA 2FPIA 1ADBA 1MUUA 4UVIA 1EVZA 4R9SA 1GTMA 1NQTA 3WWZA 4C7KA 3EVTA 3P7MA 1GYQA 1B8PA 3GHYA 4TMFA 3AY7A 4CR7A 3BMQA 3GPDG 3GZNB 3OJEA 5TIIA 3V2UA 4KDEA 4BIIA 3QWAA 9LDBA 2CD9A 2GD1O 2Z5LA 2H5LA 3H2SA 3L4BA 4IDGA 4R68A 1EK6A 4WNIA 2ZYAA 4CQMD 2Q3EA 2OP0A 3PIDA 1GY8A 1NPYA 3BTSA 1ZW1A 1FDSA 2CDCA 2HMSA 1BW9A 5G0VA 5GY7A 2E4AA 3UN1A 1EK5A 1V3UA 1GU7A 1A72A 1G6KA 4OXKA 1P0CA 4I08A 2BHLA 4FDAA 2W98A 3WXBA 1U5AA 4PLFA 4TQGA 4BNHA 4FFNA 4NBRA 5JNLA 3K30A 1JQBA 2B69A 2X5KO 1E3WA 1BW9B 4PZDA 2I65A 4DVJA 5C5IA 2JCVA 1MG0A 3I9MA 3PZBA 4OSPA 3B1FA 1A4IA 3U4DA 2X86A 1ZJYA 5F3RA 2AMFA 4XWYA 1B7GO 1BXKA 1XU7A 2G1UA 2PGDA 4DBZA 2P68A 2YHIA 4CMAA 3GC6A 5AOVA 1DFGA 2O4UX 3MTGA 2CZCA 3GDGA 5ADHA 4YAIA 1EUCA 1V3TA 2HJRA 1GPDG 1NHGA 1PWZA 4UAGA 4PZCA 2X23A 1J5PA 1P1IA 4WCFB 3ZV3A 4BV8A 2YHIB 3DBRA 1LDYA 1XWFA 3AFNA 4BNTA 3DTTA 5A9TA 2RAFA 4DPLA 4BNXA 5I7SA 1JVSA 4XDYA 2ZB8A 5TRTA 1X1EA 1E0DA 2VT3A 1H9BA 1T2AA 3DBRB 3JYQA 3V1YA 3P19A 4ZJUA 1UAGA 3HZZA 4GKVA 4RDHA 4RORA 5FYDA 1MP0A 3NJ4A 5DN9A 2Y67A 4BGEA 2WE8A 4J1TA 4QFCA 5TC4A 2BFMA 4AJEA 4RLSA 2YJZA 1JAYA 3C24A 4CUJA 4E32A 4BQRA 1ORRA 3GGPA 3H4VA 4NK5A 3IL2A 3L9WA 1IULA 1QP8A 4B3HA 5T64A 3ABIA 4LISA 3WFJA 7ADHA 5JDCC 2BI8A 3FNEA 1E3JA 4CM3A 3HADA 4ZGWA 5L7WA 1SOVA 4WLNA 1AHIA 3VZQA 1ZO8A 3L4BC 4FFOA 2ZJ1A 1LX6A 2J6IA 3CXRA 5EPOA 4IZIA 1WDKA 4IIUA 3ROPA 3JQFC 5J23A 3HWRA 1P45A 3PVZA 3WGTA 3OEYA 4MVJD 4DQXA 4ZRNA 4RVHA 3QA9A 2B5VA 4BMSA 2HMTA 3FF4A 3R1IA 4BMVA 3WFIA 2HMUA 2PWZA 3W6ZA 5C7OO 4WECA 2VHXA 2H63A 4JJGA 2XF8A 1E5QA 5IXYA 3UAGA 1GUFA 1DFHA 2C20A 5T57A 4MVJH 5L4SA 2OORA 1H9AA 4W82A 1VRWA 3ROKA 1R37A 3JD0A 1WVGA 4WCFC 3DB2A 4XR9A 4TKLA 4FC6A 2OOSA 3M2PA 4AJLA 1T4DA 4FJ1A 1EQUA 1U8FO 4PIVA 5KJ6A 1U5CA 4B3IA 5L7TA 1HDXA 1CERA 4FD3A 3FNFA 5K0ZA 3E82A 5L4NA 2IODA 5KVQA 4URFA 5G4KB 2CF5A 4AJOA 1N92A 1YDEA 2D8AA 3EGOA 2PNFA 3AUTA 5EIOA 3NDJA 3O4RA 2F00A 4BO3A 4UVHA 1GAEO 3NT2A 4U0JA 4NR0A 5ILGA 3TZ6A 4IQGA 2X22A 2NLOA 3PHIA 5FEUA 5BT9A 1CYDA 5HRUA 4E5MA 3BXXA 2GERA 4P4LA 5TX7A 4B8ZA 3QJ5A 3WYCA 5FWNA 3RKRA 3LDHA 1L7DA 3GUYA 3H9GA 1S6YA 3BA1A 2I67A 5CDTA 3ETEA 4O6VA 2ZB7A 1P1FA 2FOIA 1U4SA 3KSDO 4B8WA 3F3SA 3W4KA 5CDSA 3Q11A 1UP6A 4RL6A 3ZCXA 1XEAA 3NKLA 1DRWA 1C14A 4E30A 3FR7A 2A35A 2O50A 2B83A 2J8ZA 3JQ6A 4YRBA 4NPCA 3ZNNA 5FFFA 2P2SA 3NAQA 4MOWA 1E3IA 2GN9A 1EUZA 5KKAA 4EEXA 3H5NA 1BXGA 4YJHA 4CL3A 3D4NA 3JV7A 3NRCA 3A1NA 4ND1A 3WG9A 2Q46A 4KTTE 3OICA 3ZWNA 3WGGA 4CV1A 4CM6A 3UCFA 2Q45A 1RM0A 2VQ3A 4HNHA 4ESOA 5KTKA 2ZTLA 3JTMA 1BXGB 4NFHA 1RYDA 1V8BA 3DTYA 3ZZNA 4BNYA 3HG7A 4QX6A 3P2OA 3ZWXA 1Q2XA 3PP8A 4RVDA 2HLPA 1P9LA 4GX5A 1K6XA 4DC0A 4G5HA 4F6LA 4CUZA 2XXBA 1M67A 2GPTA 4NBUA 5LC1A 4CV3A 3E5RA 5DBGA 2AG8A 3ZNQA 5A1TA 1GPJA 1GQYA 2DT5A 4XB2A 1DIRA 1M6WA 2NQTA 3LT0A 3WX0A 1UJMA 1YXMA 3CIFA 4W9NA 3TZKA 2JCYA 4GI2A 1QLHA 4FSHA 3VKVA 3SX2A 1E1KA 3MJ4A 4UEKA 4ROSA 5CEJA 1HDOA 2X9VA 2UUPA 4R5MA 4YRDA 3GDFA 3W8DA 3M1LA 1EE2A 1TXGA 2JL1A 3EZLA 3FTPA 1N9GB 4RCVA 3JQBA 3RWBA 2PH5A 4MP6A 1Y8RB 5K6AC 1PX0A 4F6CA 4CMBA 1N1EA 5DULA 4D46A 4LRTB 3S2IA 1NFRA 2PY6A 1QYVA 2RH8A 2TMDA 4EGFA 4GL4A 3HDYA 4K9DA 1JA9A 2BGMA 1VJTA 1PZEA 3JQ7B 4Z3DA 1ID1A 2E37A 3G79A 4K1LA 4B4WA 1WZEA 1XQ1A 1C0IA 1ZK4A 2DC1A 4RF2A 2OUIA 1GCUA 5BSEA 3IQDB 4ID9A 3G1TA 2YQ5A 2P4HX 3Q6IA 1I32A 3NTOA 3Q9NA 4ILKA 1JW9B 4D0SA 2WYUA 4YA6A 2HJSA 4WLUA 4JK3A 3AUSA 2GZ2A 3ZDFA 1P3DA 4Z0PA 2NM0A 3LQFA 1NX6A 1YL7A 3H8VA 5CPFA 5KNLA 4IDAA 4RVGA 4RZIA 5IG2A 3DXFA 1K2WA 2PZLA 1LLCA 1MFZA 3MJSA 4J1QA 5ICSA 4UREA 1CF2O 3QV1A 1ENPA 1W8DA 1OFGA 3GPIA 4E5PA 1HDGO 3PTZA 4GMGA 4OKNA 1N7HA 3A4VA 3DONA 3MJEA 4EJ6A 4XQEA 4JXKA 2GZ3A 3RC7A 1V35A 2EKLA 3MWDB 2C07A 4BO4A 3DBHA 2NTVA 5KVVA 2VHYA 4I5FA 1XG5A 1Q0HA 1DJQA 3JQCA 1BDMA 4HUJA 1P74A 3IP1A 9LDTA 1FF9A 4AJ1A 4BL5A 1PL6A 5KKCA 4Q39A 4TRNA 4D3DA 4D45A 5A02A 1BG6A 2EJVA 3ON5A 4XGKA 5CG1A 4DUPA 4XQGA 1GDHA 4CL8A 5IZ4A 4IQ8A 3TRIA 2HK8A 1SOWA 3NGXA 1PJ3A 4NG5A 1CWUA 1T24A 2AQKA 3WGQA 1K6IA 4WNCA 4BUCA 1AE1A 1F06A 5IJZA 3JYOA 3JQBC 4NJMA 2OGUA 1HZJA 3ZHYA 4J90A 1PJLA 5KCZA 4CLEA 1E7YA 1PGJA 2JHFA 4PLYA 2OFPA 4CM4A 5A3JA 1GUYA 1I3NA 2Q1SA 1SO8A 4S1VA 4MINA 2BMAA 4TVBA 3VTFA 3VZSA 5C37A 1E1MA 4ALIA 5I8ZA 4NJMB 5IF3A 4J4TA 1KVRA 2A9FA 5JW6A 1OI7A 1NNUA 1GUZA 1UXIA 4LGVA 2RH4A 3ITDA 3NUGA 2CUKA 4CM4B 2QQ5A 3U0BA 3GFGA 3UICA 1H2BA 1KEPA 1FXSA 1PJSA 3RFTA 1P31A 3JD4A 3ONFA 5F5LA 1YS4A 3TOZA 3JQ9A 3AOGA 5A03A 2IEDA 4R1UA 4B7XA 2Q49A 2AHRA 2A92A 1D8AA 3WNQA 3H65A 2A4KA 3MEQA 2VWPA 1QMGA 2VWGA 4BNZA 4YAGA 3A28A 3BAZA 3QWBA 4HY3A 4FFLA 2PK3A 5JLAA 5KWEA 2GASA 4MO2A 1VSUA 1RJWA 3JQ8A 4XYMA 4CMIA 3G49A 2D1YA 3QVTA 4XB1A 4J7CA 1TLTA 1GV0A 4BNWA 1QYCA 3OJ0A 2Y93A 4JCOA 3ADPA 4PLZA 2YFHA 2IZ1A 4YVFA 2YQ4A 1XHLA 4TVOA 4OHUA 2A94A 4JX8A 4MVJE 3TZHA 1HYGA 1NQAO 4J9UE 4HFRA 4CJXA 3DDNA 3ZW9A 3BTUA 3DR3A 3I6QA 4J49A 4AJNA 3EHEA 4R3NA 1P77A 1U2DA 4J16A 3EC7A 4OOEA 5EESA 1G0NA 1EE9A 3HB4X 2DAPA 2OHXA 4FGWA 2E82A 3ZWAA 4GX2A 3PWZA 4MIYA 3E8XA 3HDJA 1R0LA 3OMLA 1BWSA 3ZWYA 5ICMA 3OM9A 3QWHA 4H16A 4ND5A 4IDFA 3GVPA 5F1OA 3CINA 2O7QA 3BHIA 3I5MA 4GSLA 5TGDA 4NU5A 5JAIA 1UH5A 3PFFA 3RC2A 2Q2QA 1I10A 3PZRA 4BO6A 3WNVA 1WP4A 4GQAA 4DWVA 5GZ3A 4GKBA 4NJOA 4EUEA 5I7EA 2Y0CA 4BNNA 4R1SA 3BYZA 4TSKA 3C7DB 4YEDA 1B8UA 3PIIA 4J7UA 1U2GA 2FN7A 1WZIA 2Z1NA 3D64A 3GVCA 3TJRA 4DIOA 1XSEA 4M54A 4Y9DA 3LU1A 1GV1A 4XEHA 1FDWA 3SJ7A 1U4OA 2VN8A 3K6JA 4J4BA 1JAXA 4BNUA 1HETA 1Z75A 5U1PA 4BKRA 2IXBA 3NJ8A 3WS7A 4ZU3A 3SC4A 4B4VA 3GNTA 2W4QA 8LDHA 3HNPA 1HTBA 1ENYA 1FJHA 1SBYA 3MOIA 1P1HA 2PR2A 1DRVA 1NBOA 4Y6RA 3DMTA 3BMOA 4I1IA 3KEOA 4GVXA 2ILTA 3WQRA 1KY4A 2G0TA 3EYWA 4XQ9A 5F21A 2B35A 3KHUA 2VRCA 4HWKA 3GN1A 4TRRA 1ZXBA 3AUAA 4GWGA 3R3JA 4PN3A 4E2XA 3NT5A 2ZKLA 1LUAA 5A9RA 1X7DA 3I4CA 3SJUA 4HXYA 2HKIA 3EY4A 3C1TA 5HM8A 2HQ1A 4P38A 2EKQA 2VTDA 3ASUA 5DP2A 3RUAA 3FWNA 1SMKA 2JFHA 1JKJA 1AHHA 1D1TA 5FI5A 3INTA 3AJRA 1OMOA 5G2OA 3QQPA 1Z73A 1LLUA 3AWDA 4N18A 2HAEA 5AXCA 4WLFA 4DMLA 1YBAA 5T8KC 5JCJD 1KC3A 4F46A 1HE4A 1PQPA 5T5QA 5CFZA 5JYDA 4BNFA 3AU8A 1PQWA 4L4SA 3OJFA 1HE2A 4Y67A 4CQMA 2FR0A 1DJNA 2YHUA 4WEQA 3L6EA 3I52A 4M87A 2X0RA 3G0OA 1I24A 4A73A 1E7RA 1KVQA 4J0FA 3GGGA 3LVFO 4H3VA 4D0RA 4GH5A 5I9NA 4E13A 1TEHA 2AEMA 2O7SA 3LK7A 3LT2A 3HUDA 3S8MA 1C1DA 1L7EA 1H94A 1VE9A 3PYMA 4PRKA 4LSWA 5H83A 3K2EA 1S7CA 4CMGA 4ALKA 4Y6SA 2JFGA 3MCVA 2C5EA 1C1DB 4RJTA 5EQFA 5F1PA 3UXYA 1CQJA 3C1AA 1OC2A 4WCDA 5F5NA 2AXQA 1H6AA 1I33A 1B14A 2YV2A 3LF1A 2NVUB 1NAIA 4BHTA 1GEEA 3DAPA 4D41A 1TT5B 4E2WA 1DC3A 2C29D 2NWQA 1UXHA 1LLQA 3DZGA 2DPGA 3OBBA 5JFOA 3GZ4A 3DMTC 2CSUA 3GZNA 4K28A 4A5OA 4GBJA 1LDNA 3L4SO 4GLOA 2DKNA 1NP3A 3G3EA 2RBEA 3AY6A 1EFLA 1WPQA 1T1SA 2DFDA 2PZMA 2HO5A 5JAQA 4YXFA 3EVNA 3WGYA 1KOLA 1YB5A 1LDMA 2BGLA 1MA0A 2I99A 2SCUA 5JDCA 2PGJA 4X54A 5KJCA 3PI7A 4XJTA 1IYZA 3DZKA 2B37A 3F1LA 2AQHA 5AXDA 3S2GA 1QYWA 2QX7A 3DFZA 4JP3A 4K6CA 1PZFA 4RPHA 4JGBA 2C7VA 4L4XA 5C7IO 4LCJA 3JQFA 3FNGA 3H9UA 3CEAA 3PGXA 4K6FA 3E18A 1U3UA 1LI4A 1NPTO 2JD2A 3BHJA 3P2YA 2VCYA 3SLGA 2VWQA 2VOEA 2IZ0A 3Q0EA 1Q0LA 1CRWG 4CMHA 1PGOA 4DLAA 1JWBB 4PVDA 3E48A 1NTOA 4GWKA 5LDHA 1KETA 2AQIA 3PHHA 5I7VA 3UHAA 5B37A 2O3UA 4IUYA 1LA2A 1ADCA 1E6UA 4BNJA 1PSDA 1VLLA 3GG9A 4MVJA 3RUDA 2G5CA 1EQ2A 5T67A 2X7HA 5F1KA 4OO3A 3WMWA 3Q3CA 5TS3A 4WCFA 4PCVA 2D3TA 4G81A 4XYLA 5JSFA 2X4GA 1HF3A 3COSA 1ZKMA 1XCBA 3OETA 1YDWA 1A4UA 1E3EA 2Q4BA 1JVBA 5GZ1A 3CE6A 1KERA 2JAPA 2HRZA 1B26A 4NHEA 5HS6A 3FCOA 4NFSA 1QKIA 2LDBA 3OQBA 1PGNA 3GAZA 4L76A 4B7UA 1GEGA 1IZ0A 3GFBA 1GADO 1DXYA 2ET6A 1ONOA 2GYYA 5L9AA 1EMDA 2GCGA 3DL2A 4BO9A 1LC0A 2W90A 3L0DA 4RDIA 3VHRA 1HE3A 5BSGA 4HV4A 2C5AA 3RU7A 3JD2A 3VVBA 2NU6A 2D2IA 4O0LA 2I6TA 5DCUA 3C8MA 2FWMX 2CMDA 3OSUA 1LSJA 1QRRA 4L8VA 5CEEA 2YFQA 1HLPA 4RGBA 2J3IA 3QWFA 1FDUA 3KO8A 2JHGA 3U4HA 3TPCA 3AY3A 1UDBA 3TZQA 2D0IA 1YBVA 5TF4A 1LJ8A 4NZ9A 4UUPA 1T4BA 4KTVE 4PLVA 1F14A 3GH3A 1PS8A 4DLBA 4TRJA 4E3ZA 3PWSA 3E6AA 4E33A 3DZIA 1V3VA 4DRYA 4AJIA 4WKGA 2EKPA 2P91A 2YY7A 2F1KA 1ZK3A 1XLTA 3MJTA 3PQDA 1SEVA 4EJMA 2AE2A 2VNSA 5EN4A 3O8QA 4XJSA 2O2SA 2WTBA 2GZ1A 2GLXA 1ISFA 3N74A 4YCAA 4YPOA 3WOHA 1LDBA 4QXMA 4RPGA 4IDEA 4J91A 5G0UA 1ISHA 2PLAA 3O8QB 1D7OA 1D3AA 4MP8A 4QEDA 5A5FA 4ALNA 2O3RA 1RYEA 1XDWA 3FPCA 1JLLA 4W7IA 3N7UA 1JWAB 5L40A 2NVWA 5BNFA 4C7JA 3RUCA 3RVDA 4JBGA 5G4KA 2TMGA 5JMWA 5IDXA 3LC1O 3S1LA 1DC5A 1A9ZA 4IMRA 1G0OA 1ZVMA 4WE3A 3X2FA 4XD2A 1LSUA 1NPDA 1LC3A 1JKFA 1DHTA 4AJ2A 3DBVO 1J6UA 4I8XA 4M55A 3D1LA 1DSSG 3ZHXA 4YQYA 1QG6A 1U3VA 3K92A 4CM9D 1U8XX 3KETA 4YT2A 3OFSA 4I5GA 2VYVD 4OKIA 2EIHA 2GR9A 1LXCA 3GNQA 4N5LA 3TF5A 3S2EA 1P0FA 1X0XA 2BKAA 4TRMA 2W2KB 4XIYA 3CUKA 1Z74A 4IINA 3U49A 1YB4A 5JE8A 1KEVA 1ZCJA 2V6FA 5H82A 5BNTA 7MDHA 5JAZA 3I9OA 2VT2A 3N58A 3UOGA 3ZV5A 3OH8A 5K6AA 4ALMA 2PD3A 3F4LA 3TL3A 5ITVA 4FS3A 4W99A 3HSKA 3V8BA 3FI9A 5G0TA 3EK2A 4XGNA 3WGHA 1YONA 4RF4A 3JD3A 3P5SA 4YJFB 2R6JA 1NHWA 2C59A 1M6HA 2CVQA 2FMUA 3MTJA 4CPDA 4JLWA 4DIBA 4CR6A 5AQ1A 3WIEA 3OQ1A 5HBRA 4BGUA 4N5MA 1SCUA 3NTQA 2Q2WA 3JYNA 1PJQA 3SVTA 2Y1DA 1X13A 3AFMA 3A14A 3LSYA 2X1HA 2WYVA 4AJHA 2WMDA 2ZQYA 1VL0A 1M66A 1ISMA 4JBHA 2JJYA 1NASA 5COQA 3TL2A 5DBFA 4M1QA 4YYZA 4DL9A 4R4JA 3IJPA 4M89A 1BTOA 2DM6A 4BVAA 3OIDA 2VOJA 3F5SA 4YT5A 1TB4A 4ONEA 1W73A 4GAEA 3PDUA 3RFXA 1DIBA 2B0JA 1LQTA 1YWGO 2DFVA 4II2A 1Y1PA 3VH2A 3WDSA 2GGSA 1KC1A 3JD1A 4A10A 1F8FA 4UUOA 2G76A 2NQ8A 4AL4A 1KEUA 3NV9A 4W4TA 2PGLA 2GDZA 3ZW8A 3KUXA 5CPBA 3X2EA 3UVEA 3RAJA 3IOYA 5IN4A 1DAOA 3HDQA 3C3XA 3FHLA 4PLTA 4EDFA 1Y5RA 1TI7A 1N9GA 2BFAA 3FRJA 1RM5A 1E77A 4I5EA 4J6FA 4Z9FA 1DB3A 1LSSA 1PJCA 2YV3A 1EUDA 2HRBA 4YAEA 1Y8RA 2RCYA 2Q99A 1EVIA 3ZWBA 1X0VA 2X9NA 3ZNPA 1VI2A 1ZMTA 2PV7A 1UXKA 4XA8A 3VPFA 1K0UA 1SC6A 1T2DA 3PPIA 4YT4A 2QZ9A 1UP4A 4L9RA 5CDGA 1ZK0A 3JQ7A 3ETGA 3KSZO 5IFLA 4A0SA 2EGHA 3OEWA 1IHYA 1P1KA 3O38A 4IZHA 1GYRA 4DA9A 1O89A 1VC2A 4PG4A 3DFUA 1HDRA 2CNBA 1T25A 3UW3A 4KZPA 4R01A 3I4FA 3TFQA 2FSVA 3VH1A 4PG5A 2ZB4A 4IGFA 4EYEA 2NTJA 3OA0A 4UUNA 4IJUA 1GQ2A 2DUWA 3PEFA 1ZJZA 3IAHA 4A2CA 1C3VA 4E6PA 3K2BA 1EFKA 2J5KA 5C7LO 4ZQGA 3V2GA 4PLHA 2DTXA 1LNQA 3BMCB 2VWHA 4ZHSA 3FD8A 3MJCA 1UZMA 1MB4A 1O94A 4YWJA 3S55A 5DP1A 3ZN2A 3U9LA 4BGVA 3CMCO 3T7CA 4HP8A 5KIAA 1IY8A 3GVIA 1B16A 5BR7A 3GMDA 2O3JA 4JQCA 3GA0A 1AGNA 3GDOA 4QECA 4QO8A 1A5ZA 1N1GA 4R5HA 4ZQEA 3AUUA 3DWFA 3OQ6A 3B1JA 4FIZA 4PLWA 1B3BA 1C0PA 1NWHA 4GLLA 2YZ7A 4TZKA 2ZB3A 2VZ8A 5AXBA 4BB6A 1PS9A 4D43A 4OQYA 2QYSA 3WSVA 2W8ZA 1NVGA 2BI7A 1W6UA 1LQUA 1EDOA 2DBQA 5CP8A 1GL3A 1YGYA 5HS4A 3NEPX 4QUKA 1K6JA 4TKMA 5COBA 3QIVA 4Z9YA 1T2FA 1IOLA 1DOHA 4YBZA 4OYRA 3E9NA 3DZHA 4E31A 3F5QA 5DNAA 3HFGA 4FFMA 4WK6A 4BO1A 3TSCA 2P9CA 3I23A 3OP4A 4QSMA 2GO1A 2QRJA 3GGOA 4J9VA 2Y1CA 3KLPX 3CH6A 3OF2A 3ULKA 5ER9A 1HYHA 1NYTA 3AI3A 1YQGA 4MKZA 3OECA 1N5DA 3IJRA 1DHRA 3IKVA 4CLRA 2IDZA 3RD5A 2X8LA 3GT0A 1LDGA 1G1AA 1OBFO 1UUFA 3DBLA 1U3TA 1R4NB 1ZFNA 2LDXA 2Z95A 5EJ2A 5ES3A 3STHA 3B20A 1FDTA 1UP7A 1ISGA 1UR5A 2WD7A 2BRUA 4GVLA 3UKOA 4CLRB 2OZPA 2XOXA 2JD0A 1WMAA 1DIAA 4JBIA 3DBLB 3INGA 3JSAA 4KQWA 2CDAA 1HSZA 5AVOA 1YB1A 3W1VA 1LRJA 3QLJA 1PIWA 1DLJA 2WD7B 1U7HA 4GX0A 2IYOA 4B3JA 3NYWA 1ULSA 4XDZA 1V9LA 4MKXA 4CLHA 4EW6A 3O9ZA 4UVGA 8ADHA 4PLPA 5CDUA 5C3MA 4NBTA 3WMXA 3WIDA 2XAAA 4IDBA 3G17A 3RKUA 2Y66A 4M8SA 3TOXA 2QRKA 3ADOA 1DC4A 2DVMA 3U4IA 2GN6A 4KQXA 4LN1A 5LCXA 1BHSA 4MDHA 1KS9A 1H6CA 1EDZA 2J3HA 3IC5A 3WJ7A 3HN7A 4BKQA 3R3SA 1C1XA 1YBMA 3QVXA 5TSDA 1NVTA 5DDIP 5L4LA 4EUHA 3RUIA 1DO8A 1XR3A 4Q3NA 3RBXA 3L07A 5B1YA 3ONDA 5DOZA 4BNKA 4DQVA 1Q7CA 3HJAA 3DHNA 4EJ0A 2EW8A 2FZWA 3OIGA 3ZWWA 2FHSA 1ZIDA 5LDGA 1C1XB 5U4QA 4CM7A 3BTOA 5EL0A 2AA3A 4MVJI 1OC4A 4H7PA 2C2XA 3QRWA 5T8KA 3BTVA 3U09A 4RZHA 4CM8A 4F45A 1EEHA 3D7LA 2UUOA 4XGIA 2IYPA 1HYEA 1UXGA 3B6ZA 3QY9A 4MVJP 5H81A 4BO7A 2DTEA 2NUAA 3FSRA 1SB8A 2FP4A 2O3QA 4Y8VA 5EQDA 4BKPA 4MVJG 3WLFA 1ZSVA 3HHPA 2RHCA 5JCJA 1U28A 4CM8B 3O03A 3DC2A 3H7AA 4CQLB 4WOJA 1ISJA 1U9JA 1EBFA 1Y6JA 1E6EA 1GFSA 2E49A 2EERA 3KVOA 2V6MA 1WDMA 4ZN6A 4D42A 5CEFA 3L9XA 1PL8A 1N8KA 4N7RA 3ZHZA 4FGSA 4ND2A 1EBUA 2X9GA 3DQPA 4D3FA 3S2FA 1JN0A 2DU8A 1QV6A 4IMPA 1ONNA 3ICCA 4U8GA 5EMHA 1LBEA 2P5UA 4NK4A 1JU9A 4OSOA 4P8RA 2VHWA 1MG5A 2AG5A 1K3TA 4CV0A 3PFWO 3VDQA 5G0SA 1KYQA 2POQX 1WNTA 5B4TA 2ZTUA 1Z45A 3KYCB 2IZZA 4CM5A 3NDIA 4AFNA 1O95A 4R1TA 3DOOA 2Y1GA 2HSDA 3OIFA 5JCXA 3EDMA 1PS0A 4PVCA 3A06A 5TT0A 4B7CA 1B2LA 1HE5A 3UCXA 3QE3A 4RLHA 2BFPA 2EWMA 2PKRA 4MKRA 1IPFA 3HQ4O 2QW8A 5A5EA 2WDZA 1DDOA 4DQUA 1PGQA 4OAQA 4DREA 4I9NA 1BVUA 3FWZA 1R16A 1EVJA 1E7MA 4G2NA 5TT1A 4R69A 5GMOA 4AJPA 3PXXA 1K89A 4DTIA 4OMUA 3VZPA 1H5QA 3K8ZA 3RROA 4NNJA 4CUKA 4TROA 1ZUD1 2UVDA 2D5CA 1RPNA 2VUSA 5JBIA 2W2LD 1NM5A 4FCCA 2NU7A 3AK4A 4Q3DA 1LSOA 4M49A 4S3MA 2JD1A 3ENNA 1QYDA 4FJ0A 4GGPA 1PJBA 3I9JA 2Q1UA 2HDHA 4O63O 1BSVA 3KZVA 4FPXA 1E7SA 4AJ4A 4BNMA 2H9IA 4ZRMA 3WJAA 4YT8A 4YJDA 4UEOA 3ANMA 3U4CA 3ICPA 4CM1A 4FB5A 3W4JA 1H2HA 2AE1A 5JC8A 3ZWOA 4Q3EA 3RJ5A 3OJLA 3RCBA 3FNHA 4IY1A 2G17A 3WGZA 2J5RA 3RC1A 2VHVA 2OO5A 3DHEA 3I6IA 4BNVA 3KRTA 2BD0A 4NBVA 1HL3A 1O5IA 3DAFA 4BO8A 2H6EA 1QV7A 3R6DA 3ST7A 2OL4A 2NVUA 3RC9A 4CLDA 3BMNB 1YQDA 3ZU5A 4MVJM 4KMSA 4J2HA 4IS3A 4RQTA 2NU9A 3ZNOA 1O9BA 4UEJA 1I2BA 1TT5A 3SLKA 4D3SA 5MDHA 3KLMX 4QQRA 4Z0HO 4BO5A 4E5NA 5U9CA 2O48X 3GOHA 5BQFA 5HA5A 4CMJA 4CODB 4MP3A 3EZYA 4NH4A 4R16A 4U0KA 1E1NA 2WE7A 3U62A 1Q7GA 1IPEA 1R15A 4AICA 2G82A 1GQQA 2PD6A 2Y0DA 2Y99A 4OQZA 1R4MB 2UV8A 2E6UX 3AU9A 4R1NA 4PG8A 4ZA2A 1DBVO 3UCEA 4OM8A 1HDCA 5GZ6A 3GLQA 1MFPA 4J2OA 3KYBA 5DCWA 3VPXA 1CIVA 3VKUA 1F17A 1H0KA 3B1KA 3INRA 4UUMA 4FBGA 1X7HA 4IBOA 1DAPA 4BNLA 2I66A 1YQXA 1E5LA 2OP1A 3EMKA 3H5RA 4I9HA 1A7KA 2GN4A 1NXQA 1Y8QA 1OAAA 3M6IA 3I3OA 2EHDA 3LLVA 1B3RA 3ZU2A 5A9SB 3GQVA 1TA4A 1HXHA 4EI2A 1IHXA 3MZ0A 3HDHA 1ZMOA 4J0EA 4WGGA 2Z1MA 1Y8QB 3WYBA 1NFFA 4II3A 2IE0A 5A04A 1HSOA 1KEWA 1WWKA 2JFFA 4NIMA 4EZBA 5JO9A 4A7PA 4GX1A 3DOJA 4D7AA 1I0ZA 1D1SA 4JJIA 4YJGA 4FR5A 2X0JA 1FDVA 4KUHA 2ZCVA 3BMQB 4GMFA 4MPDA 5THKA 1E3SA 1Z82A 5KVCA 5G4LA 4IQ0A 1M2WA 2FPGA 1TVEA 1PQUA 2RHRA 3KYDA 4PGFA 5IDQA 1I01A 3W4IA 4YJGB 1ZEMA 2EXXA 2WWRA 1R0KA 3K96A 4LK3A 5IZCA 1HZZA 3TN7A 3FN4A 3CZRA 5DT9A 3WWYA 3T4XA 1O0SA 4DMMA 1VM6A 3WR5A 4O5OA 4DLLA 4U6QA 3FBTA 3K73O 4I5DA 1WAMA 1ZSYA 2C2YA 4J43A 4QFDA 3KYDB 5JS6A 1UZLA 2I5PO 2IXAA 2YYYA 1SB9A 3RJ9A 1VJ1A 2OBYA 3JCZA 1E3WB 4LSMA 4IGEA 5KOIA 1YJ8A 1SAYA 2GNAA 2XPCA 1P1JA 1K5HA 2WM3A 4PRLA 4D44A 3TWOA 2AW5A 5K9ZA 4CM9A 4YAKA 1M76A 1MGOA 1SEPA 4HFNA 1W0CA 3GY0A 2HU2A 2VYVA 4OGWA 3EAGA 2CF6A 3GMSA 4E21A 1A27A 1VSVA 1KVTA 3D0OA 1I3LA 2CDBA 3LT1A 4FQ8A 4PLCA 3DOCA 3TNLA 3HE3A 2FR8A 2X6TA 4P4NA 4U6SA 3VPHA 2VHZA 3HB5X 1Q7BA 2I3GA 4CLOA 4BO0A 1ZSNA 1HT0A 5JYEA 4MIEA 4XZ3A 4JIGA 3JQAA 4Z3KA 3PGJA 4IDCA 3SC6A 2UAGA 3CPSA 4LVUA 2E48A 5L3ZA 1P1RA 2YDXA 5FF9A 3H9JA 1C0KA 3WQQA 1VJ0A 4CLOB 1X14A 3EUWA 3PK0A 5TJHA 3JQAB 2I76A 4M86A 1GYPA 3VH4A 4BV9A 4NBWA 3I1JA 2CVOA 3RU9A 1NR1A 3WYEA 3GF4A 1X1TA 4ZQBA 3RBZA 3ETDA 3MWEB 3NX4A 5JPIA 1DC6A 4L74A 3VVCA 1XYGA 3SEFA 4A03A 4BOYA 5CHEA 3GRPA 4NI5A 5IXSA 2NV6A 2PH3A 2HK7A 3QP9A 3OHSX 2UYYA 3H3JA 3PQEA 1W4ZA 1YVEI 4G65A 1F0YA 3CZMA 1EVYA 1PWXA 3BZUA 4EITA 5MGBA 3VPGA 1GZ3A 5IZCC 4Z9XA 1OOEA 3CKYA 3E1KA 3WTCA 1Q1NA 1MLDA 2OXIA 3RASA 1H6DA 5ITWA 2W2KA 1MXFA 1VL6A 3H5AA 3LT4A 3U3XA 3VOSA 1I3KA 1LU9A 2C0CA 1PR3A 3A9WA 1RWBA 4DPMA 4H15A 1YL6A 4FW8A 4PG7A 1E3LA 4UVDA 3RUFA 2DBZA 2IEBA 5ENDA 2ZYDA 3ORFA 3RSHA 1ENZA 4IJKA 4P4GA 5JY1A 4GGOA 1B15A 4TZTA 4BO2A 1H93A 3R0IA 1PZGA 1YE3A 4XQCA 3ENKA 4Y6PA 1ADFA 2EW2A 3ZU4A 4YJFA 3H6KA 4ZVVA 4E2YA 3KB6A 5CAEA 3KXDA 2Y05A 1MC5A 4ZQFA 1E7WA 3JQAD 3C1OA 3WTBA 2D59A 3DZJA 4ND3A 3ROQA 1Q0QA 3ZU3A 1UDCA 1HDYA 3GVHA 2PD4A 4KUEA 3DEYX 4RVFA 2QIOA 4E5KA 2NVBA 1I30A 1ULUA 1AUPA 1PL7A 1TT7A 4OL9A 4XX0A 3ANNA 1MXHA 3F4BA 2VZ9A 4DBVO 2FR1A 1RKXA 1F12A 3LYLA 3WGOA 3E03A 3JQDA 6ADHA 2NACA 4E4YA 3PHJA 4LW8A 1MC4A 3LZ6A 1YO6A 1GCOA 4C4OA 4RPJA 1ZBQA 1YOVA 3I83A 4P22A 4AJJA 1XU9A 3RFVA 3UF0A 4BB5A 1PJ2A 2V6GA 2B5WA 4JNKA 2B4RO 2P9EA 4WLOA 2Y0EA 3PHLA 3HN2A 4ZICA 1FMCA 5I7FA 4IS2A 3KOUA 1AN9A 1YOVB 3Q2IA 2CVZA 2C54A 3PYLA 1IE3A 3GNSA 2OBNA 4LVCA 1ISIA 3WICA 3E9MA 5A06A 2XXJA 3PQFA 4YRAA 3PJGA 3D3WA 5CDYA 5ENVA 1A7AA 3Q1LA 2Y1FA 4NU6A 4YJHB 1HKUA 1HWYA 2P5YA 3KSUA 4RVUA 2BF7A 2DBRA 4UVEA 5ILOA 5IDYA 1WXDA 4CMKA 2ZK7A 3D3WB 2O23A 3PYXA 1WMBA 3AI1A 4IDDA 2AEJA 3SXPA 4BS9A 2ZTMA 2BH9A 4MJLA 3GHHA 4WEOA 3FPLA 4NMHA 3WB9A 4RVSA 1Y7TA 3K5PA 3F46A 1DFIA 1MV8A 2R2GA 4J1NA 3RI3A 1BVRA 3GRKA 5JAMA 2O4CA 3QVSA 4NQZA 5L45A 2VZ0A 3F6YA 4RO0A 5BSFA 3TFOA 3RUHA 3VAZA 4EEZA 3GEDA 3W8FA 5ER6A 1MX3A 2C82A 1JDJA 5IN5A 1BDBA 4IXWA 2I9PA 3BMCA 5B12A 3WBBA 2B4QA 1BRMA 3ITKA 3ZV6A 3ZWCA 3AW9A 4XRRA 5JO0A 2D5AA 4DXHA 4ZD6A 1IB6A 4LCEA 4BQPA 4Z0TA 4XKJA 2UDPA 3KBOA 2VUUA 3K31A 2GF2A 2FPPA 2QZZA 2ZQZA 3PJEA 2GUGA 1CDOA 3L6OO 2HCTA 1OZAA 4CMEA 5L51A 1LDEA 1U1IA 1YH3A 4L75A 4Q9NA 5B4VA 1LRKA 4PFJA 4YDRA 5FI3A 4HKTA 1WLYA 3FR8A 2B4TO 3H2ZA 2X58A 4RF5A 2NU8A 1CETA 4EBFA 3LF2A 1GD1O 3LLSA 4INAA 3VH3A 4PLGA 5TQVA 4R54A 2NSDA 3ZI0A 2CY0A 1P44A 2DBVO 3VZRA 4RQUA 3Q9UA 5AYVA 3NT4A 3QWIA 2J3JA 3F47A 1Z6ZA 4WOKA 1Z7EA 3T7EA 1LTHR 3LC2O 2VYNA 3IUSA 4B4UA 4R9RA 4ALLA 4YB8A 3ZHBA 4BNGA 4WJZA 1YJQA 3E5MA 3V1UA 3E9QA 4YTEA 2HMWA 5TLSA 5TNXA 2C7GA 5A3VA 3GR6A 2WJPA 3LC7O 2VNAA 3KM0A 2JCXA 1KIFA 3L77A 3D3EA 4MVJF 4PG6A 1P33A 3WBFA 4OXYA 1ZEJA 3H9QA 4IJVA 4XYEA 3ANLA 3QVOA 3RQSA 4CMCA 1CJCA 4U7WA 3Q2KA 1T2CA 1R4NA 4JN6B 3D5TA 3UH1A 2J3KA 3H9EO 2VTEA 2YDYA 1ML3A 1YKFA 4Z6KA 4QO7A 1SZJG 3AM3A 1V6AA 3DMYA 4JP2A 4D79A 2X5OA 4NDNE 3D4OA 3F9IA 5CG2A 2JAHA 5THQA 3DBHB 3CTMA 1QSGA 3IDSA 3QSGA 1U7TA 3GG2A 4W9NC 3IUPA 1Y9AA 4BNIA 1QORA 3K9QO 4J3FA 4Q3AA 4DYVA 1DIGA 1J0XO 2QG4A 3PWKA 1CEQA 1DEHA 4E12A 1N2SA 3M2TA 1NQ5A 4OH1A 4UULA 1ONPA 3UUWA 2FSSA 4WUVA 4L0QA 1PJ4A 3WGIA 1I36A 1PU2A 4HNGA 5IDWA 4QT0A 4HFMA 5B4UA 2O3SA 4CMEC 5KJEA 3VC7A 5TJ9A 3ASVA 4B79A 2Q4EA 4WLVA 4QTZA 1ARZA 3IS3A 3W8EA 3V2HA 1Y5MA 3IKTA 3JQGA 4RPLA 4KP7A 1Y81A 1J49A 4N5NA 4L4RA 1LLDA 1DLIA 2PA3A 1ZZEA 3KV3O 3ONEA 2V7PA 1A71A 4YACA 2Q1WA 4A26A 4B4OA 1AXGA 1CQIA 5DZSA 5EERA 1VL8A 4OIMA 3OA2A 4XR4A 1XELA 2VYND 4OOFA 3JQGB 4Q3CA 1FK8A 5DBIA 3GEGA 1QXSA 2ZYGA 3V5NA 2EV9A 1SNYA 1R12A 4FFRA 5JXWA 3NDRA 3L6DA 4XRGA 2P9GA 1IL0A 4BKUA 1LEHA 5KJFA 4CR8A 3C85A 4ZQHA 1BMDA 4Q3BA 4WLEA 4PZEA 3UGKA 2PZKA 3ZGYA 1F8GA 1O6ZA 5JMPA 2FY8A 3PRJA 4CLXA 4DPKA 4KDFA 3C7AA 4RPKA 1XA0A 3VTZA 2PKQP 1X7GA 2NNLD 2Q1TA 4FFPA 1M75A 2AEFA 4XYGA 1T1RA 4A27A 3ROMA 4J1SA 4FC7A 4CQLA 1AXEA 4XCVA 3ZH2A 3T4EA 2EGGA 2EP5A 4KUGA 2RIRA 1ZK2A 3F1KA 1YRLA 1Z7BA 2WSBA 3CSDA 2W2LA 2NADA 2GRAA 1BGVA 2X5JO 2DTDA 3BHMA 3QVWA 1IUKA 3JQ8B 5HTOA 4J4HA 2HK9A 2R00A 4CMIB 1NVMB 3WQSB 4WASA 3V1TC 4EUFA 2PKQO 4ITUA 3PJFA 4OJNA 2Y1EA 3DZBA 2P4QA 1NAHA 3IMFA 4F3YA 2X0IA 1KBZA 1GR0A 3DZFA 1NR7A 4AG3A 1ZH8A 1PZHA 3JYLA 3DO5A 4XIJA 1NFQA 3TZCA 5BSHA
chains in the Genus database with same CATH superfamily
3URMA 4GKAA 2BGIA 4XTRA 4EPVA 4I81A 1DV2A 3NLLA 2ZT7A 3EJWA 3LDUA 1ADJA 3UHJA 1NRXA 3CG4A 2B36A 1F6BA 3ZWVA 1A9YA 2WLTA 2OV6A 1PWYE 3I9LA 2LUOA 4DCOA 1HEUA 4ZZIA 2RC5A 3T99A 4HX5A 4EOGA 5IYZA 2ZCUA 1KP9A 1N9KA 1SR8A 1T3TA 2IXFA 2X42A 2WD8A 4ZEXA 4EJSC 2XMQA 1FOEB 5ELXA 2P67A 2AZ4A 1MEJA 2VZLA 2GSDA 3ABOB 3CMMA 4G56A 2HUNA 1M2GA 1QRUA 3OPVA 4Z7OB 3MOGA 1D2RA 4JROA 4Y0VA 1SPXA 3JARB 3I2YX 2X0NA 5IYZB 3AJ9A 1E1LA 1QHIA 3IQEA 2Y0PA 4D9HA 1B8VA 1OLUA 2Q3HA 1VA5A 3W6PA 4YQZA 2EEZA 4E5YA 1ADGA 4E7PA 4N4AA 2W2VA 1PJTA 3DQZA 4ZT2A 1Z2NX 3N59A 4N03A 4RLQA 1KE2A 3QEAZ 3VPSA 3PR2B 4DDMA 2GYUA 4W6ZA 5K1ZA 5K6RA 3UT6A 1RE1A 2DHRA 3AUJB 5GGXA 3H16A 1KZ1A 1WB6A 4L9WA 4MYUA 4P0PB 2EJWA 1MDBA 1NRWA 1V43A 2WHYA 3MGBA 4QKQA 1ONSA 4HVTA 3RWMB 4JH0A 4ND4A 3L4KA 4BLOA 1I6KA 2F2TA 4QYSA 3K72B 3T52A 4D56A 2H2WA 2VPQA 1T26A 2WTNA 3PNKA 3WGUA 4R41A 3KDAA 3EH1A 3PPWA 5LNK1 4FNMA 4M9QA 1UZNA 1Z0ZA 4LRSB 4W6QA 3B3QA 1KVSA 2VYCA 3OQJA 4D97A 3IAXA 1X86B 3A27A 1IZ9A 3QEKA 1SC3A 3M83A 3R4VA 4K26A 5I4BA 1IBKB 3W2HA 4W5HA 1V0JA 3UJCA 4BLVA 2HBRA 5L53A 3ER6A 1UKVY 1NV9A 1UFQA 4QRDA 5JSQA 1ENOA 3FPBA 4RV9A 5CVDA 1IBMB 1K88A 2FJUA 1HRKA 1J2YA 3MELA 1TUBA 4MWBA 3HO1A 2NXEA 2PSFA 4KFUA 2GJ4A 1AY0A 1HNWB 1AA9A 3BMOB 4IZOA 1RJGA 3M6LA 4I19A 4IWYA 3VZDA 5K8CA 3ZHCA 4EX7A 3MA0A 4D98A 2WG1A 1SQ5A 3GOQA 3VYRB 4P7JA 4E2ZA 4BPBA 4L4YA 1Q92A 2WY2D 3TQQA 4P7KA 4IICA 4OHRA 1PJAA 2R00C 1TK3A 4RBNA 1TUBB 1LBTA 3DW3X 4R9VA 3C3MA 4KNYA 5LYYA 2QV0A 2ZIXA 4CHTA 4OHKA 2Q7XA 3HMQA 1ICIA 3BMNA 2DUUA 3WLEA 1WE2A 4EMUA 2ZROA 1HORA 2DFKB 5T6BA 1KFJB 2HLHA 4XYBA 1JKJB 1T4MA 2ZKIA 2BJWA 1VKNA 1GZ4A 2KBEA 2Z58A 2ASVA 3KL2A 4XWAA 3GVXA 2YOGA 1XTZA 2ETVA 2ZIXB 3C3CA 4FOOA 5CDFA 3AM5A 2WHPA 4RH3A 2BLLA 3ZWQA 3H3FA 3V8QA 3SM9A 2XE8A 4HQ0A 1KWGA 3OEEA 7GPBA 3PGA1 3HFSA 1KI7A 3P0IA 4RGVA 4YRLA 3D0QA 3R7LA 3BRCA 1PR9A 3FBGA 3PEVA 1E96A 2WIJA 3BQNB 2Q50A 3PJDA 2WKRA 4D3FA 4IOJA 3VI3B 5CM9C 4CQMB 3EOAI 4HPWA 2XUZA 3DAGA 4L2IB 4UNPA 4G9BA 4URVR 4D9IA 3I0NA 1E6WA 4YAJA 3KQVA 4NE9A 5L3RA 1HNXB 1H6BA 4OHMA 3ZLVA 2ZDHA 1ZJWA 3RS5A 1Q83A 2BGKA 2AC2A 1L1FA 3OFVA 4M46A 2WMOB 2OCGA 4CU5A 3HYNA 1ZN2A 1E2QA 4F2PA 1E2HA 3D0RA 1KDYA 1XXLA 3S27A 3KB8A 1E7QA 2EF1A 2HA2A 3L1JA 2LCFA 3N6XA 2B2CA 3NYIA 4I2NA 4QWWA 4BJHB 2AVNA 4GSYA 2Y68A 2VRBA 2AT1A 2FRDC 2IF0A 4NG4A 2A5JA 3C7CB 4RKWA 4O59O 5DTMA 5JY6A 1PNRA 2AQ8A 1NBWB 3NAGA 3JQEA 4FN4A 4GBGA 2IZOA 2ZITA 3GD5A 2YUTA 3UMJA 4BQEA 5HZGA 1PG2A 4AJKA 1ZK1A 4WWHA 5JDIC 2ZI3A 3L4EA 2XVAA 1J2TA 3MMPA 4KKVA 3SFZA 5H3CA 5EIAA 2GD0A 4DJDC 1WVMA 4O29A 1VRCA 1MAWA 4HXGA 1BYIA 4MIOA 4RD3A 5F35A 3TW0A 1K0FA 2ZU6A 2FPIA 3OQMA 1E2EA 1WHTA 3EQ6A 3KS9A 4MW0A 4DCPA 3C74A 1T4GA 4CEIA 4DARA 1T6YA 5H59A 1RLJA 5IKMA 2I2AA 2II6A 3FJOA 3R6TA 4EBBA 4TMFA 3DM5A 2P4UA 3GZNB 3OJEA 3LBFA 4RXTA 4XM1A 4X6XA 1C2YA 2FPIB 4WUTA 1WHTB 2FK8A 4X1KB 3Q7SA 3X1ZA 3GLFE 3HKBA 4JLSA 1R10A 3ESCA 2QV7A 4PQGA 1JFTA 4FGUA 3L4BA 3PD0A 1QH9A 5L6LB 3H2SA 4R68A 1IXYA 1EK6A 1NVFA 3R0XA 1NPYA 1RWNA 3VSAA 1FDSA 1J9GA 1SWWA 2HMSA 3LWNA 4AB1A 3WIBA 1Q0TA 3AVXA 2ZUFA 4L72A 1OW3B 5M34A 1NXPA 5F5XA 2YWXA 3DPIA 1A9OA 4FDAA 5IJAA 3WXBA 5BUCA 4EVIA 4PLFA 4BBPA 3EFBA 3D8SA 5JCOC 3BXOA 4FFNA 2GO7A 3MHPA 4YRQA 2HADA 3NWJA 4EY8A 4YUVA 1X1QA 2X5KO 4LYHA 3WWCA 7ABPA 3KJNA 4DVJA 1KSGA 1YGPA 5KCMA 4CCYB 2JCVA 1EFRA 3I5AA 1V47A 3B1FA 3KHTA 1BQEA 3PQ7A 3ZDAA 5JS2A 2HX1A 1W9HA 4M6WA 1J8QA 3VAAA 1QONA 3AJEA 2AGVA 1W2HA 4KXNA 2JBWA 1XU7A 1BXKA 1VCMA 4RSHA 5EUMA 4WOCA 5IANA 3JAMA 4RELA 1NOIA 2JIMA 4KXQA 5KYYA 3A1TA 2AK3A 2GVDC 2K4MA 2QIPA 2TMYA 4UAVA 3RB8A 3RFFA 1LF5A 3HP1A 4YAIA 2PX2A 4LHVA 3AVOA 3PVSA 4IGIA 3RAPR 1PP4A 4RZ2A 2GEKA 1LPPA 3H3XA 2X23A 5DYTA 4YP9A 3E1GA 5KYYB 1QH1A 2WJAA 3DBRA 2NO6A 3KTAA 3RS2A 3PENA 1FPQA 3ESQA 3G2IA 1MAAA 3DTTA 4O4HF 3UMSA 3DZDA 4I3HA 1B6TA 2OZLA 1HLFA 1Y3CE 2IS4A 2C88A 3G9UA 3QVGB 5EE5B 4G5FA 2Q28A 5TRTA 2B2NA 2C9BA 2VVTA 4KACA 1E0DA 2XVZA 1YIOA 4TWIA 1P8AA 2MOKA 4RKFA 5BSRA 3ZGOA 3FF1A 3DBRB 3FDZB 3V1YA 2O0JA 1ISPA 3P19A 4ZJUA 4Z3OA 1UAGA 2JBHA 4FTWA 4QYXA 4PEVA 4OFXA 2Q8QA 3I01A 5DN9A 1T5HX 2Y67A 1QGOA 4AKTA 1D4ZA 3DUWA 3OZSA 4TXJA 4BGEA 2OZLB 2X0EA 3H7IA 4RLSA 2YJZA 4L5BA 4AMGA 4AWBA 2ZPTX 1RQPA 4QBKA 4CUJA 2QRQA 1ORRA 1RHKA 3FUTA 3OTGA 2VK8A 1QP8A 4OJMX 2EZTA 3I62A 2EZ8A 3MWEA 4U2FA 2RKBA 4K6KA 5G53C 3E8SA 3WFJA 2C1XA 2J9GA 1E3JA 4CM3A 4ZI3A 2XAUA 3HADA 3KDPA 4R81A 4TMWA 1K68A 1SOVA 1U2ZA 4HAZA 4U7PB 3S68A 3WYDA 4BZQA 1G4AE 4CG3A 3G7NA 5BW8A 3VZQA 4Q01A 4B5LA 5J3JA 2ZJ1A 3CXRA 3UGJA 4IZIA 4QOHA 3JQFC 1U4NA 5C0OE 1J42A 5J23A 1B41A 1U5BB 5AVJA 5KNDA 1P45A 1PQ4A 1TZCA 1K8QA 3KUCA 2IBMA 2WZCA 1ECLA 1M2EA 1OFTA 1FBNA 2QPLA 3A9VA 3HHEA 1H65A 4OHFA 4X7RA 5AJVB 4L1KA 3X1JA 1F8YA 3QA9A 4ZT4A 4P5PA 4BMVA 2PLFA 3EF0A 3FVRA 3COWA 2PWZA 3C15C 3QFRA 2VHXA 1FYFA 2HL6A 1ZU5A 1I9CA 2RH5A 3F5MA 4IG9A 1P2GA 1V39A 2Y6VA 2EKZA 4TSFD 1JHVA 3H83A 3R7FA 4COOA 5IXYA 5KNCA 4AECA 4DL9A 3R5XA 1QGAA 1IEXA 3O74A 4RXUA 5L4SA 1JH9A 2DPLA 1NOKA 2OORA 3QX9A 3ROKA 3O2NA 5AUPB 3KHSA 4B48A 2WTEA 3KG2A 4ZYVA 3TLEA 2KQUA 3CG0A 3C43A 1QO7A 2XVMA 1SU7A 5BWNA 1OXVA 1PG5A 2OOSA 3SIWA 5MGNA 2VQSA 1T4DA 3BRSA 4FJ1A 1F2TB 1AB6A 1ZAKA 4REOA 4ZEMA 3RHFA 3RVNA 3NNNA 4Q3KA 5IULC 5K0ZA 1GGNA 3E82A 3RFUA 4URFA 5G4KB 4AYTA 3VOTA 1HE8B 2CF5A 3KT0A 1Y6FA 1WMDA 2D8AA 2IUTA 3EGOA 3P9ZA 3GP5A 4ISCA 3IX7A 4UVHA 1KGSA 5ILGA 2XUOA 2F3QA 2NLOA 4MVXA 2R0QC 3A7DA 3TTTA 2ISCA 2DGDA 1YVPA 3VR6H 1QB8A 4E5MA 4OAOA 4G0PA 2PJDA 4PN7A 4HRYA 2HD4A 5TX7A 4PBRA 2XKKA 1AXRA 2F9MA 2R65A 3LDHA 4KFTA 2BCGY 4PONA 4RABA 1WB4A 1Z6GA 3JZIA 5JNVA 5CDTA 1HYQA 4O6VA 4PNEA 5L3QB 4QEKA 1IZ7A 5F1YA 1R5JA 1U4SA 2FN4A 4KK3A 5JATA 3SN6A 1D4OA 4UMFA 5SYMA 1REQB 4IYRA 4K81B 4WA8A 3A3KA 2ZIEA 3P20A 1T5BA 3NKLA 2V7GA 1RI4A 1DRWA 3RU2A 1L4BA 2PX6A 2AC4A 2UYQA 3R75A 3U3JA 4PCLA 2L17A 3FR7A 3WHLA 4C6HA 5K99A 3R3ZA 4NLLA 3N2GA 5JVDA 3B3GA 4L15A 3DVAB 3SPXA 4Q9JA 4YRBA 3L1VA 1BIFA 4EI9A 2VSFA 3MIIA 2DQZA 4DV2B 2IP1A 1GAQA 3NUZA 1XLTC 5KI6A 1MJ5A 1PZNA 1E20A 1ZQ1A 5BW5A 3TQOA 3LBNA 4S1TA 3N87A 3QELB 3C14C 4K88A 3BIXA 5CH3A 4J3JA 5HILA 3A1NA 3UO8B 2DR2A 2W2NA 2H0QA 2QTGA 2FHPA 1NVDA 3WGGA 4CV1A 3UCFA 2AV6A 1MNQA 1HY3A 1RM0A 3B9BA 2UYOA 4HNHA 5KTKA 3E61A 3PD1A 5F2NA 3IAM6 2PT5A 2HSJA 3C3EA 3FVWA 5AJZA 1A5AB 2HDOA 1N0IA 3GRUA 4EYQA 4FMBB 5LVAA 2XCSB 2ZI7A 5DNCA 4HSEA 1WSWA 5D00A 2D4HA 3EX7C 1OWLA 5JALA 4RVDA 2OV8A 1Z0AA 3W1EA 1U8YA 3CNLA 5ITZB 1ECFA 4LE2A 2QWXA 4MUEA 4NHOA 4B85A 2ZS8A 1H4QA 2IHNA 3GX1A 4Q21A 1QK5A 1AGPA 5EZ5A 4JI4B 3CF0A 3QU5A 4BVKA 1Y4AE 4PNZA 4TMVA 4INJA 3IIIA 1UMDA 4NBUA 2MSDB 2ANCA 4A92A 1FLVA 4CV3A 1A2OA 3TR5A 2AG8A 3RVBA 5BUQA 1JR3A 5A1TA 3H86A 3CKMA 5AKEA 5HGXA 5ALKA 4BATA 2GDJA 2OVFA 2Z2IA 1M33A 3F6RA 1DU4A 3CIFA 2Q4TA 5CVCA 1L1EA 4ETMA 1NVBA 1UMDB 3EEBA 1P91A 2O0MA 2XNJA 1QLHA 3NGMA 3I1YA 4ZV4A 5HJEA 3SX2A 2PMDA 3HJRA 2JCBA 4X94A 2X9VA 4F8YA 4GI5A 3GDFA 5JH7B 5ALDA 4KMOA 4Z7QB 1JZQA 3R9XB 2O8VA 3SKYA 3NDPA 2ICAA 2FN8A 3M5CA 3EZLA 1C3EA 2WFLA 3V3KA 1PTKA 1RHUA 1YC2A 3QPVA 3L41A 1IJBA 1UBKS 1Y6QA 3LUAA 1LB1B 3LLMA 4MP6A 1Y8RB 3L92A 4BUZA 4DG5A 1E0AA 2YW2A 1OA1A 3IFSA 2A0FA 1UWLA 5IK2D 4DV5B 2I6FA 2R11A 1CY8A 4LRTB 3S2IA 2PY6A 4RESA 2RH8A 2QTMA 4BY9E 1PZEA 1M6NA 1IVYA 4Z3DA 3VKFA 2FKAA 3UB4A 4Y30A 3UYKA 3F8SA 2EC5A 2B61A 3VNAA 3ZU6A 3G5LA 4NS4A 4RKQA 4F60A 2O07A 1UBCA 1LI5A 2CNWD 1US8A 4QDXA 3TW8A 1P3JA 2G5TA 2DC1A 7AT1A 1OV4A 4PCAA 2WPDD 1V16A 3SDZA 2Q3LA 2E5FA 2C2BA 1MIOA 2I80A 3BWBA 3TAUA 5D3MA 1EZ1A 1T34A 1CFJA 3FZNA 5FUWA 4DM4A 2HQOA 3EPRA 4ECEA 3MFQA 4D25A 3BFPA 2HJSA 3K09A 3OPQA 3R9WA 3TGWA 5C18A 5KYKA 4DJJA 3M5DA 3TW8B 1R8QA 4IWXA 4NH0A 3C6QA 1KAMA 2FW7A 1V16B 1P3DA 1MX1A 2YR0A 3PTLA 4WZBB 5EUQB 4LC9A 3JZAA 1N25A 5D3MB 1ODCA 1YL7A 1Y6RA 4TTVA 5ECGC 5KNLA 3I73A 4RVGA 4L3OA 5EHQA 3O4IA 2PGAA 4PZPA 1O58A 4P81A 5IG2A 4AQYB 2PZLA 4HB2A 1MFZA 1FE8A 4J1QA 3ILYA 3GUZA 4UHDA 4MKHA 3RIEA 3R23A 2CSXA 4KPUA 1ENPA 5CLLA 1OFGA 3GPIA 4HYYA 1JDUA 2AFIA 3EIQA 1PVDA 2VEOA 3TLZA 3ZIAA 3QXSA 4KW7A 4U00A 5FUBA 3IT0A 3BUSA 4YMWA 2MR6A 2C07A 1FDRA 1Z8NA 5BRAA 2BHNA 4RHEA 1H8ED 4AULA 4FZ5A 3STWA 3RAFC 1CUWA 4I4NA 4W5WA 1XG5A 3M6FA 4CT0A 4YDSA 5J4HA 5ARDA 4KPUB 1MJHA 4V39A 2AFIB 4AJ1A 13PKA 4I4IA 1JG1A 2WUWE 4BQFA 3IQXA 3X3HA 3D6FA 5HR5A 1DKPA 4BZZA 3JALA 1Z06A 2IH5A 1D0SA 1BG6A 1DZ3A 3NRJA 1V8DA 3ON5A 3PKIA 4K9MA 3DWEX 2YHBA 3OU2A 3I2GA 4XQGA 1GDHA 1NUTA 3TOSA 1J39A 4D5GA 5CIYA 5KOJB 1SOWA 1ZA2A 1GNRA 3WAKA 4K9PA 1K6EA 5I01A 3JALB 3IEPA 4ZGBA 2G28A 4LK2A 5M04A 1EHCA 1X3LA 4F3CA 1F06A 3K05A 4JHXA 5IJZA 5ALUA 3JQBC 1SZDA 4ICIA 4NJMA 5GVRA 3RT7A 4DV6B 1NOJA 3PA6A 4J90A 1PJLA 5K0LA 4BQOA 2PKYX 1E7YA 4BUJA 1PGJA 4YDQA 4K6HA 2OFPA 3BXPA 4LDQA 4MJXA 1GUYA 2FJPA 4CG1A 5ARBA 1OYVA 4TT8A 2XW6A 4MINA 5AM0A 4OGKA 4B35A 1Z7GA 4TVBA 2B8WA 5C37A 3DAYA 4WJKB 4G63A 4FYMA 5I8ZA 4TX1A 4NJMB 4NV1A 3ISTA 3FDJA 4X7BA 1OV6A 2O8CB 2PQMA 4G4IA 3DFIA 4H1VA 1OI7A 1DWUA 1NNUA 2F64A 3ADKA 4K9RA 1UWCA 1QP0A 4W9RA 3K70B 2IZ6A 4QUIA 2QQ5A 2J32A 3B2NA 3WK5A 2AZXA 4J29A 4JVMA 3D2BA 3LUKA 3UICA 1GP2A 2IH2A 1PJSA 3B8HA 4C7MA 1SHLA 5G02A 1TL7C 2M2IA 3FFXA 3JQ9A 1EP3B 5ECWA 1H2ZA 2IEDA 3G0DA 1BCRB 2M98A 1J8MF 4R1UA 3SZ3A 1UT6A 4D9MA 2DXIA 2A92A 3ZKWA 4XIFA 5JZ9A 4G4SO 1PAUA 1P0IA 2QD3A 3H65A 2NO4A 4ARSA 1Y3DE 4KMMA 2A4KA 1P7WA 3LO5A 2VWGA 3ZI7A 2GKSA 4OD0A 5EJ9A 4GRAA 5FAXA 3BAZA 1U9YA 3QWBA 2QM3A 2ZBQA 3GD7A 2B1QA 2PK3A 4KYVA 5KNBA 5JLAA 3VBEA 3WKAA 5EFZA 3UM9A 2PA0A 2XCRB 4M36A 3LZCA 3KQSA 3N8GA 5I3ZA 1SHUX 1FQWA 5IPFA 4YROA 4XTCS 2B3TA 2D1YA 2ZAGA 3H5OA 3QVTA 2FWIA 2JLBA 1TLTA 4XB1A 4Y0AA 4DA7A 3BS4A 2C2ZA 4PLZA 1E99A 3ZVKA 3LS2A 5DIFA 4KLRA 3M4YA 4YVFA 1C50A 3MQ4A 2PGNA 3QOWA 3PC3A 4MVJE 5BORA 5IJWA 1NQAO 3I28A 4IFBA 1LV8A 2XRFA 4ARVA 1E64A 2PR7A 4ZI5A 1ABBA 5BVGA 2RGNA 3DR3A 3I6QA 4J49A 5KWIA 3WGJA 2UZIR 1P77A 3DSRA 5KDDA 1OU0A 4FN5A 4OOEA 4URZR 1G0NA 1EE9A 1G64A 1TCCA 3ANXA 2Q7OE 1ANKA 3NHAA 2CB0A 1QTRA 2DAPA 4FGWA 4JL6A 4RZQA 3ZWAA 3PWZA 3COPA 4MYTA 1MEOA 4MIYA 3E8XA 1ZR4A 3H05A 3HDJA 5LQCA 4OU4A 4QJ4A 5FOXA 3PRYA 3DKPA 1R0LA 3G2OA 3ICOA 1ESDA 1L8XA 3KELA 4H16A 3WGNA 1JEEA 2NZJA 4C6TB 3ADDA 4PM4A 1S2OA 5F1OA 5TB5A 2CBZA 3QI7A 4TQUS 1PN3A 4LIPD 4RHCA 2YCBA 3TM4A 3UJBA 3VYWA 5BMOA 4WXHA 2AN4A 4X3PA 4KXLA 3CY6A 2PT9A 1BOFA 2CFIA 2H3HA 3FTDA 1E6MA 3ZJTA 1B23P 3KK0A 3Q10A 3GP3A 4ZKEA 3AIMA 2JLYA 2X5XA 5K2OA 2BGNA 1NC1A 4L8FA 2QENA 3QXCA 4PAGA 1LBQA 4R1SA 5FLKA 3Q7EA 1BJTA 5EMMA 4CFYA 4F4FA 2X15A 1U2GA 4YIHA 3D64A 4TXNA 2SNIE 3TJRA 2C4TA 2C31A 2F3TA 3GPCA 2YJTD 1XSEA 1LPOA 2VPZA 4HI0E 5LZ2A 3JZFA 4CKCA 5I4CA 4WADA 2ZP1A 5JZBA 2PUCA 3LU1A 1I3CA 1GV1A 1U2QA 2XLCA 3KJEA 4MB2A 1EXVA 5EVJA 4AKGA 3KTOA 2QL7A 3K6JA 5KYUA 2ZJ3A 3G1WA 3R9IA 1V7CA 1W5TA 4ECAA 3RF6A 1PW7A 2IKSA 4B4VA 5LBUA 4CKCB 1SBTA 8LDHA 3HNPA 3MOIA 5IJXA 2PR2A 3L0OA 1X3SA 2JB9A 4LS3A 5T4BA 1NDUA 4I1IA 4GVXA 3WQRA 3U7GA 1KY4A 5KYUB 4LNHA 1C1HA 3EMDA 4BYGA 4ZDIA 2RG7A 1IJFA 4YRFA 4ARCA 2B35A 1ONBA 2VRCA 1XK7A 3GN1A 3HU2A 3BSSA 4KH1A 2H5JA 4R8MA 2O7VA 4Y9RA 3S2UA 1FP7A 4M2LA 4LWOA 2Q9AA 2ODAA 5A9RA 4FZJA 3D02A 3IO5A 3I4CA 3S29A 2B34A 2XYHA 1U0BB 1KPGA 1WB5A 4WAUA 4Q3OA 5HM8A 4P38A 1DUVG 3AUFA 1Z5OA 1Z29A 3VJMA 6GPBA 3R7WA 3U1BA 3QE0A 1SMKA 4C2UA 1GZDA 4XVCA 1Q1ZA 3AJRA 3QQPA 1LLUA 4CN8A 4N18A 4WNYA 3HXQA 4G26A 2XTJA 2HAEA 4HX9A 4NDZA 5B1EA 3CLRC 4L8WB 4Q7KA 4QFBA 4R0VA 5FLXA 3SVLA 1HE4A 2H2HA 3AEQB 1D09A 3KSAC 1EH5A 1PQPA 2F9LA 5J4LA 5JYDA 1PQWA 4MWGA 5DGCA 4WXYB 2JI6A 3MWYW 4PXAA 2X2EA 4Q1EA 3RVSA 4UNRA 2DWPA 2FR0A 3FG9A 2ZE6A 2VYQA 2ZJ2A 4B45A 3OCXA 1G3QA 3U7RA 5EP1A 2EP8A 4BPRA 3M6AA 4C0KA 3WC4A 2F67A 5K6TA 3USZA 1I7DA 1CZOA 2QTBA 1NT4A 3FGPA 4KEAA 3EOZA 4J0FA 1B00A 5AKLA 2CXNA 2OPBA 2R7KA 1C4WA 4H3VA 4D0RA 1U2SA 1FLDA 3UMFA 1XMOB 2C2KA 1IBSA 1TEHA 5LZ8A 4AZ0A 1JZTA 4GOOD 1YE8A 3JX9A 1OH7A 4TKUB 4UASA 1L7EA 4LWZA 5J9FA 5CCDA 1Z36A 1H94A 4ZRDA 2HGSA 2R84A 4JQOA 4RVCA 5H83A 3DEZA 1EX7A 5EFOA 1TU0A 4JC8A 2DPYA 3CNEA 3K5IA 1GKIA 3MXTA 4IDPA 2JFUA 3RRBA 5HYVA 1O8BA 4BMOB 6ABPA 1FA9A 1TCAA 2JAUA 4OMDA 3RUPA 2IEYA 2ZWIA 4D3ZA 4RJTA 1RYMA 2Q5EA 3MD9A 3O1HB 3T4UA 4MQMA 1E9RA 1BWQA 1TADA 1SELA 3BE6A 1N6HA 3MTDA 1H6AA 4G36A 3RS4A 1F4PA 2RJOA 2XRMA 1XAIA 1Z25A 2WF5A 3ZOZA 1TKBA 1VL2A 4AP5A 1VZ2A 2FVYA 3QBJA 4KMRA 4QGHA 2WPNA 3W7VA 1ZOLA 2IIVA 4EKGA 2C29D 3IP8A 1RR6A 1UXHA 1SCBA 2CGEA 2DPGA 5LLDA 5JFOA 2CSUA 1YT5A 5BR8B 4GLOA 4D9JA 3AY6A 3ZD9A 4KN5A 3BG5A 1KE1A 2LV8A 1IATA 1JTEA 3BB1A 1HI9A 3B9RA 1IU9A 2IHJA 1EM8A 1XTBA 2QG6A 2VSOA 2WFMA 2ZTHA 3COZA 3M8KA 1NJ5A 4LDPA 4DG9A 2XD4A 3KXIA 2JLSA 5KJCA 1SG9A 3PI7A 1TAQA 3A25A 1RXUA 3DZKA 2B37A 3FE2A 1VP9A 2C61A 2QVCA 2AQHA 3U26A 4DA8A 4LJKA 2QX7A 4UOEA 5DW0A 3C8UA 5G3ZA 4CT4B 4ZJPA 2Q27A 5FR1A 1WCWA 4LFCB 4L0MA 3RYHA 4JGBA 2DEUA 5AKHA 3NWOA 4C4TA 2J0UB 3CEAA 4ZJZA 2BMWA 3E18A 2DJ5A 1CNFA 4NYJQ 1LI4A 4CL0A 3T0FA 1YZTA 5D6NA 3P2YA 2JJ1D 3MWJA 5SV2A 1KFEB 2VOEA 2IZ0A 4Z2YA 1PGOA 1GITA 2PLRA 1OBCA 2G1JA 1JWBB 1W4AA 3RYHB 5A1JA 3SC2A 5EJ5A 4RY8A 4LHXA 1KETA 2ZWPA 2CNNA 3QTLA 1G19A 1Z5VA 4G37A 4LJSA 2O3UA 2W48A 4C30A 3ZV7A 1LA2A 3D3NA 1VLLA 1W4RA 1WXEA 2ZQ5A 3KB2A 3RUDA 3B5JA 1AURA 1EQ2A 1XE3A 2ZVQX 4OO3A 5F1KA 1XFDA 3ZE6A 1I4LD 3SC2B 3OOJA 4X44A 2NTYC 5F78A 3T5BA 1UOOA 2E4XA 3KUKA 5KQPA 4D9NA 1NE2A 1E5XA 1XOIA 2E85A 1HF3A 2LCIA 3OETA 4V1CA 3D59A 1A4UA 2EBUA 3MNFA 5F2OA 5GZ1A 1NONA 3CE6A 3AH8A 1P3Y1 4DA6A 8MHTA 1UQUA 2XZPA 2O2ZA 3QPCA 2QTTA 2FU5C 3TLYA 1CDZA 3PITA 2IXTA 3OX4A 1L7NA 5HS6A 4DHWA 1H22A 4F3TA 3TQTA 3A2MA 3GAZA 4L76A 1U0EA 5EZQA 2JARA 4V1CB 5KTPA 1CQZA 4ZWNA 1SVKA 1OR8A 3H2BA 4YAOA 2BHSA 3W2FA 2ET6A 3KPYA 2GYYA 4Y3UA 4EA7A 4Q6BA 3CNOA 4BO9A 1V95A 2W90A 4RDIA 3VHRA 1DKUA 2OCYC 4TTRA 3VBCA 4XWKA 1J2RA 5JZVA 3IAM1 5B6PA 2P6UA 1K2VN 1M0TA 2PYZA 1PD1A 2VRWA 3BWEA 3EGCA 2NU6A 4PZZA 4WZBE 5FTMA 1TEZA 1NTRA 5BPFA 2OHJA 2OCIA 4RJLA 3OSUA 1DAIA 2C78A 2WBLC 5JJKA 1QRRA 3BK2A 3ZW7A 4MULA 2QRVA 1M0EA 1HLPA 4ETNA 1EFAA 3AHCA 1QIIA 3P0HA 1FDUA 3UHFA 1MIHA 5JARA 4DCSA 2JHGA 4D0GA 4Y1EA 1IOZA 1YBVA 2C58A 1VKRA 4HDNA 4UUPA 1T4BA 3BCSA 3ZY2A 3EFHA 3GH3A 3ESRA 5CIQA 3WRVA 3OPMA 4M1OA 1YMVA 2G7MC 4PF1A 2QRVB 3SU8A 5IMBA 3ILHA 1V3VA 1TC2A 2DUJA 2I1WA 3QVMA 5BY2A 2QLJA 2L69A 3T61A 4U7FA 2HWXA 2F1KA 3UUEA 1W5AA 4H0NA 4HDNB 1RC0A 1VYUA 3MJTA 4FEEA 4JCCA 4ZMRA 4O1HA 4AP9A 1TZMA 5EA2A 4V0LA 1E2NA 3AR8A 2ID7A 3VKHA 3VR3A 4NOJA 3RWOA 4A6XA 4XJSA 2WUVA 3LCRA 2GZ1A 1ISFA 3N74A 5H3LA 4DNQA 3WA7A 4Y9SA 3K6SB 2BL4A 1UOQA 4YCAA 3U1VA 2Z3VA 2FWJA 1HR0B 3SLRA 1T5DX 3KR0A 4QXMA 2C97A 2C3UA 4FXPA 4UDXX 1USKA 3C6MA 4ZVSA 2WAXA 1DKNA 1E4EA 1L2TA 1Z6QA 4GC9A 4MP8A 4I6EA 4RYDA 5BSTA 1SQFA 4F1WA 2FQXA 3RKSA 1RYEA 2ZRKA 5AVZA 1DPFA 1GCAA 4J0QA 3N7UA 1KFBB 1JWAB 2X2PA 5L40A 1E2JA 3KD3A 3VAYA 1RHJA 4O8ZA 4B44A 5IDXA 1F8XA 3S1LA 3I6ZA 1DC5A 4A82A 4PW0A 1FTQA 4MMZB 1UEIA 5ERYA 5JG7A 10MHA 2F1HA 4LRUA 3STTA 1SCJA 1JKFA 1OJLA 1Z37A 3BGIA 4MV4A 5ECYA 5I7RA 1KKUA 1CQWA 4J0KA 1U90A 4UDYX 1NATA 3A6HA 3D1LA 1U7PA 2YWFA 4TOIA 2HSEA 3CLUC 1J8VA 4HEHA 1GT6A 1YNOA 4JP5A 4YK7A 4CM9D 4KR6A 1OXUA 2C4HA 2FZVA 3IDAA 3PXEA 4X6LA 3TX2A 3KETA 1ULHA 2J7PA 1PUXA 3IA7A 5FOSA 3R74A 2F8MA 3Q1KA 1PJRA 3MQFA 4LI0A 2GLUA 2IYUA 2ZJ4A 3OVMA 2D1RA 2VJMA 1Q1QA 1LXCA 3D1VA 3GNQA 4MIKA 3SEAA 3S2EA 5JMOA 3QMWA 3TF5A 3FSGD 1D07A 3FETA 1ZR2A 1R6TA 1RW4A 4JUDX 4EQZA 1Z74A 721PA 1GRVA 2OD9A 4PPYA 4WACA 4WL0A 1VIAA 3U49A 1KEVA 3R7NA 3WVNA 2C5HA 3K9HA 3BL5A 3I9OA 4BLQA 2RAVA 1YUMA 3BC1A 3E3NA 1RABA 4RE6A 3DYBA 4WVFA 3OH8A 3MXOA 5K6AA 5BOVA 4FS3A 4DM7A 3HSKA 4LF5B 4NQRA 2IV7A 4C22A 4CTNA 4OCZA 3L7BA 4I1YA 1CNEA 4XGNA 1N4AA 1L5OA 1QG0A 1YONA 3JD3A 2Q8NA 4BP9A 3PSAA 1Z0FA 2N47A 1O0BA 3NIGB 2PMFA 1M6HA 2CVQA 2FMUA 3QLUC 3CQ9A 1P9OA 1XZDA 5F73A 5D85A 4EG8A 5HBRA 5CURA 4C6RA 5JASA 1NVXQ 1JFFA 3V97A 1NUAA 4KPYA 2I2DA 1RSZA 4P4TA 1DO2A 3OTQA 2Q6IA 1M2OA 2RGCA 3NTQA 4P3XA 1PJQA 4EMSA 3D6JA 2WOJA 4P34A 3LSYA 3BBPA 5E1BA 2PE5A 4QU8A 2P6OA 4AKHA 2EATA 2WMDA 3JZDA 4DMHA 4DJAA 1M66A 3MRVA 5EPUA 1NASA 2PRJA 3BF8A 1G4HA 1C7ZA 1WBDA 1ULTA 4A8JC 2IL1A 3O93A 4RQBA 3R5HA 3RGGA 3L0CA 3IJPA 2ABWA 1YS9A 2WU4A 3IB6A 1H4SA 1DCKA 3WLTA 3CE9A 2VOJA 3KQMA 2H4XA 3A3YA 3I72A 4F9FA 4TSRA 1RZRD 2H48A 1NBAA 2RHTA 4G89A 4YT5A 4MDEA 5KUTA 2B98A 2JFQA 4ENWA 1HFWA 3RVJA 3UJ3X 4LOLA 1HNZB 4QIHA 2DFVA 1TF2A 3TE7A 4C03A 2FMIA 3EZ2A 1KC1A 2R1VB 1GG9A 4UUOA 2NQ8A 2XHZA 1M1YB 4PYNA 3RG8A 1RQRA 3EE6A 4G0UA 2GX6A 4P6VF 3UWOA 3KUXA 1R1DA 3MMSA 2V3VA 3X2EA 4B31A 3AKZA 4BNDB 2XIQA 2JIZD 3C3XA 3FHLA 2Z6QA 4QLOA 1N6KA 1SUFA 3G23A 4PLTA 4D8UA 5E3HA 1TI7A 1UC8A 1N9GA 5CHYA 4QPDA 4I5EA 4II7A 1KR5A 5KTNA 1XF1A 1VOTA 4I4TA 2YV3A 4TQ9A 1EUDA 3E9ZA 3SF0A 3AZQA 4ZVUA 1UPUA 2Q99A 3IJEB 3ZWBA 1OFIA 2LR0A 1USVA 1VI2A 1ZMTA 1UXKA 1PR2A 1RI3A 1T2DA 3FFWA 1GIAA 3PPIA 4N3NA 5EE0A 1UCFA 1JNYA 1T3HA 1ZK0A 2WZBA 4I4TB 4YYEA 4A0SA 3ABRB 2BPOA 3QE4A 4WHMA 1YR9A 3ZHQA 5CFOA 1LX7A 3JU3A 1N2ZA 1ZNZA 2OGSA 1Y42X 3FRHA 4HGNA 3UW3A 4EVSA 1R88A 2JI8A 2PL1A 4NCIA 1FU8A 3WL3A 3TFQA 1HQKA 4PZAA 3VH1A 4PG5A 5FBRB 4LY0A 1QDLB 2NTJA 5J58A 4IJUA 4TT3A 1LFAA 2OILA 1XCGB 2C9YA 3E2IA 4ZVOA 2QBYA 2IYSA 2QTRA 1Y1LA 4DSUA 5IUNC 5A3RA 1DTWB 2V8BA 2TECE 3IBYA 5C7LO 1YAJA 3CO5A 3QEBZ 2Z30A 3K7EA 2HA6A 5E1OA 1SU6A 3ROTA 3V2GA 3F74A 1M2NA 3BMCB 2N75A 2JA2A 4ASUD 1QHGA 1TD9A 3KT8A 1O94A 1GVNB 1OCEA 2A0XA 3ODPA 3S55A 3ZN2A 2Z6AA 3IXLA 1JEAA 4HP8A 3ZE8A 4JT4A 4IUCS 2IBSA 4PTZA 1F20A 1AKUA 4IOLA 4MYDA 4NYJR 4P4SA 4R5HA 1WABA 1GUBA 1M7BA 2QYHA 3B1JA 4HDOB 4QQFA 1NWHA 2QJTA 4BMDA 1MAUA 4EKEA 5IVKA 2YZ7A 2VZ8A 4MPRA 2X6RA 3B36A 4Y6LA 2V7TA 3B2QA 4OQYA 2R6HA 2WIGA 4D4IA 2GEJA 1FTYA 1LQUA 3CT6A 3D8TA 3DDSA 3N6VA 3Q5GA 4G0OA 4AX8A 3NVMB 2LD4A 3FYSA 3WHIA 4TKMA 4L4UA 3TLKA 4R9UC 5COBA 4TTTS 2AFVA 3ZHUA 5HNKA 4P54A 1KY3A 5E1DA 1Q11A 2RC6A 4BU1A 1R9MA 3E0QA 4XVQA 3EG5A 4M7PA 3KQKA 2ZOSA 3DZHA 1XDGA 2W2PA 4K86A 2EBFX 1IQUA 2Z5GA 4MB6A 2HT1A 1JAZA 3TD6A 1QKKA 2DOKA 2BTQA 3N1UA 4M38A 3BULA 1OBVA 2QRJA 3UGTA 3QQ5A 1D5WA 4L0CA 4Q00A 3CRW1 1AQIA 1DE0A 3CV3A 2O8FA 2CYBA 3FYUC 2ZSEA 4NTZA 3CH6A 4DY4A 4B6PA 2OXFA 5ER9A 3IBSA 3VC3A 1U6JA 2ZCJA 1T0IA 5CYOA 5LUAA 2BTQB 2VPIA 4UU0A 4S0ZA 1UBTS 3OWHA 4Q9IA 1FYEA 3IQFA 3SXUA 1N5DA 4M0EA 2JJ2D 2QUHA 4P82A 1L7AA 5A4AA 2O8FB 4I1VA 3IKVA 2XYQA 2IVZA 4DADA 2OWDA 5JNWA 2X8LA 4BQIA 1G1AA 2HNKA 4K3VA 1N4DA 5EJ2A 4F4JA 3GPLA 5ES3A 3PPYA 1Z5GA 4OXXA 3STHA 2WQ7A 1DP4A 4O08A 5GM2A 2FSVC 1Z4JA 2G04A 2GILA 4FE4A 3WYFA 2WD7A 4P4UA 4UBIA 3RRYA 3EWAA 3BJZA 3A11A 5DIZA 4GZMA 2HHLA 2XOXA 2JVIA 5EHZA 2FZLA 1Z34A 3FHCB 4H7HA 3HP4A 3MCUA 3G59A 3FOEC 4JYBA 4O4HA 4LC1A 3MINA 1HSZA 3KYIB 1NN0A 4IDHA 1WUYA 2CL7X 1PIWA 1YZVA 2WD7B 3EVZA 3Q7RA 1CY6A 1QPBA 4GX0A 1RD4A 4B3JA 4C7BA 4RMHA 2PWPA 5LWQA 1ULSA 1WJGA 1GFWA 1MVOA 4CLHA 3UW1A 4EA6A 4UEQA 3THSA 1NW3A 2PGOA 2VAWA 5CDUA 3MINB 5DTIA 4AZTA 5C3MA 5DJ5A 4V02A 2XAAA 3IT3A 1H2FA 2RHLA 3B5IA 3PCXA 2OUKA 3SQNA 3WRYC 4XUGB 2DVMA 2Z8ZA 4MUYA 4JQYA 4NDAA 5H68A 2GN6A 4KQXA 3FCYA 4LN1A 2ACVA 1BHSA 1SQGA 1W75A 4MDHA 5AJWA 5LCXA 2JIOA 1EDZA 3F7OA 4G4JA 3CVJA 3G9XA 3HN7A 3WJ7A 5HKKD 2ROQA 2LIVA 1C1XA 1RAGA 3QVXA 3EAQA 4GXQA 1NVTA 3AHDA 1JU4A 3WGLA 4G8CA 3R4CA 3TCKA 1T0PA 1JAIA 2OM6A 4Q05A 1RWKA 5B1YA 2P11A 1VG8A 2IYTA 3FPKA 1BKDR 1M6YA 1G7TA 1K4KA 3HJAA 5BXQC 5KQRA 2EW8A 1T29A 2JEOA 4L8YA 3ZWWA 2ZSBA 2CXSA 3AIIA 1C1XB 5LDGA 3U39A