3HFGA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an sulfonyl-piperazine inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hfgA00
3PHJA 1UP7A 3N7UA 4YB8A 3P19A 3HJAA 2NU9A 4BKRA 4D45A 1O6ZA 1M6HA 3K9QO 4YJFA 5FYDA 3PQDA 4MVJD 1VPDA 3AY3A 4XWYA 1LA2A 1XELA 1GFSA 3NTQA 2JCYA 3I6QA 1QYWA 4YJGA 3NTRA 4N5LA 1T1SA 4BO0A 5CDSA 3BIOA 3SC6A 5L53A 5AXDA 1SMKA 5IAAA 2B4QA 3MCVA 3Q6IA 4RVDA 3FSRA 1V3VA 3BTSA 4HNGA 2AEFA 1B15A 2GO1A 2O3JA 2Q1SA 3JD1A 3MTJA 1SOVA 3EK2A 3TN7A 1R0KA 2HMUA 4GMGA 4MVJM 5IFLA 4IZHA 2EKPA 2VHVA 4GH5A 1F0YA 3C1TA 1NFRA 3C8MA 3L4BA 4BQPA 3SLGA 4B4WA 5A06A 2DC1A 4FC6A 3H9QA 3D1LA 1U4SA 1P1HA 4J90A 4ZQBA 5DNAA 1MFZA 1SBYA 3EUWA 1UZNA 3Q3CA 3NUGA 5JCXA 1HDCA 1MLDA 4NI5A 1Y7TA 4MVJE 5GMOA 1Y81A 4OH1A 2ZQYA 1I3LA 3LT2A 3JQBA 4PLTA 3KSZO 3FPCA 3G0OA 1JW9B 1TT5B 3VAZA 3WX0A 5AXCA 1CIVA 2RHCA 4U6QA 3C7AA 1T4DA 5FI5A 2Y0CA 3RFTA 1KBZA 3AOEA 4GBJA 4A27A 4IDCA 1EVIA 1WNTA 5AVOA 3GY0A 3GNQA 3FBTA 3MWEB 4MP3A 3WNVA 3AU8A 1W4ZA 1GL3A 5F1PA 3JQEA 2AEMA 1PJ3A 4M55A 4Z9XA 4Z9FA 5EINA 3NT2A 5L95A 1D1TA 1ZXBA 5A9TA 4FS3A 4J0EA 1T2AA 2VZ9A 4II3A 2Y1CA 4AJPA 4TROA 4GLLA 4CMJA 4BL5A 4K26A 4CLRB 4FFPA 3WGIA 2VT2A 1ZSYA 3EHEA 5MGBA 4NMHA 1QKIA 1RPNA 1ZK3A 4INAA 2V6MA 1KVUA 3MZ0A 5TRTA 3KYCA 2DFVA 1KETA 4R1SA 3T7CA 3PHLA 5GY7A 3IJRA 1HDGO 1K6XA 1KY5A 4W9NC 3TZKA 4CUKA 1H2BA 4CLEA 1E5QA 3DBRB 2DPGA 3WFJA 4WCFA 3AJRA 3WSVA 4WOJA 1I3KA 1E1MA 1O8CA 3I9MA 1E6EA 1FDVA 3ZWYA 1MGOA 4TRMA 3U4DA 3EGOA 4FDAA 4WJZA 3W8FA 4QT0A 4YAJA 1VL0A 3I6IA 5BSEA 1XQ6A 4N18A 1LRJA 3GN1A 3PQFA 3TZQA 1IUKA 4CPDA 3ENKA 1DC6A 5U4QA 2VZ8A 4WLNA 3FR7A 4ZJUA 1V3UA 5EPOA 3RBVA 2P4HX 3NDIA 3LZ6A 1H93A 4AVYA 3R3JA 3PGXA 1H6AA 4H15A 4H16A 2PLAA 3S1LA 1HE2A 1XLTA 4IDAA 1PGQA 3PYXA 4IQ8A 4FD3A 3C7DB 1MA0A 2GYYA 1E7WA 4XYLA 5TJHA 3RI3A 4OOFA 1IZ0A 3SVTA 1UZLA 3I9KA 4OIMA 4GSKA 4DIBA 3H6KA 3AUAA 1H9BA 3W4KA 4YYZA 3JQ7A 2OP1A 1DB3A 2DFDA 1CDOA 1I2ZA 3PWSA 3VDRA 3PLRA 4DGSA 3HFGA 5HRUA 2EP5A 4B3HA 5KJFA 3RJ5A 4K6FA 1QLHA 4P4GA 4ITUA 1M67A 4BNVA 1Z82A 4XYMA 2WJPA 4Q9NA 3I83A 4E2WA 2DAPA 2HCTA 3ZW8A 2CMDA 3GDFA 1IPEA 3MTGA 3TL2A 1BRMA 3VH4A 5EMHA 4E32A 2CDBA 1B0AA 1NFQA 3P5SA 1QV7A 3NEPX 3H7AA 3ITDA 3PI7A 1YJ8A 1C3VA 1D7OA 1G0NA 1Q2XA 3DC2A 5H82A 4D3FA 1HXHA 4BNZA 1ONOA 4DXHA 3AFNA 1G0OA 2VWHA 1L7DA 3ON5A 4R01A 3KYDA 1M66A 5ICMA 4ZQFA 1R0LA 3DZIA 4R9SA 3CH6A 5L7TA 3JTMA 2YHIB 3OA2A 4WK6A 4CM4A 3JYQA 3CSDA 4NU6A 1ZXLA 4GX5A 1X0XA 3SX2A 1S6YA 1LC3A 5COQA 4ZQGA 1ML3A 5IXSA 4BKOA 2EWMA 2Z95A 1ZK4A 1GYQA 2NVUB 4KUHA 5GZ3A 3PHGA 4W82A 3BMCB 3JYNA 4IJUA 2JFGA 2A35A 4R4JA 4BQRA 3KETA 2A9FA 1O89A 3WDSA 1BSVA 2E82A 3GF4A 3P2YA 3Q1LA 5I7VA 4YVFA 1LSOA 1GYPA 1NYTA 5JBIA 4JXKA 4IDFA 3RC9A 4WECA 4MVJF 2JKVA 5DF1A 1HETA 1KVTA 5C7IO 5IDXA 1TI7A 3JQ6A 4AJNA 4I5DA 2GUGA 1YQXA 3CUKA 2I99A 4XB2A 2OBYA 3HZZA 1ID1A 4WUVA 2EJVA 2IYOA 2G76A 1CQJA 3JQ9C 2PY6A 4RLSA 4TKMA 2RBEA 1P3DA 3ULKA 5CHEA 2CDCA 4PFJA 4CLRA 4Z0PA 2IDZA 3MWDB 4RVUA 3RBZA 2JJYA 3AK4A 1GADO 3OHSX 4EYEA 2GR9A 1A72A 1XHLA 2NQ8A 4PLWA 3JD3A 3WGHA 2PR2A 2P2SA 4ILKA 4BNJA 3GAZA 5JNLA 2X0RA 2WD7A 4XA8A 4BMVA 7ADHA 2WE8A 2G0TA 4E13A 1Q0QA 3V2HA 5KCZA 4ZA2A 4OKNA 4MVJA 5H81A 3VTFA 3BA1A 3RBXA 3HDYA 3S2FA 2FSSA 5DCWA 5T8KA 4DREA 4G2NA 2P68A 1YRLA 2B4TO 3SJ7A 1CJCA 2E37A 2OP0A 2P9CA 3ROPA 4CMKA 2NU8A 1E3SA 5KJ6A 4BKPA 4P8RA 1FDSA 2Y66A 1WPQA 3H3JA 4GX2A 2J5KA 1OC2A 3MOIA 1Y9AA 4WPGA 4ZU3A 4CMCA 3ROMA 4RPLA 1DIRA 4QECA 4WLUA 3AOGA 2E48A 3G17A 4O0LA 4BNWA 4PZDA 3QWFA 2H63A 1YDEA 2BHLA 1C0IA 4UEJA 1P0FA 3FR8A 1PWXA 2I76A 5IG2A 1UXGA 4WLOA 4XDZA 4NBRA 1YBMA 5B1YA 1DHRA 2C59A 4Z3KA 1I10A 2VYVD 3NGLA 1D8AA 4PLVA 3QA9A 4E2YA 5DN9A 3R1IA 3KB6A 3CPSA 2VYND 5TIIA 3HB4X 1I32A 4BO1A 4PLYA 2G5CA 5JY1A 1PS8A 4J7CA 4YCAA 4JNKA 4I9NA 4J2OA 2R00C 3CZMA 3WTCA 4IIVA 5C37A 3L0DA 2QZ9A 1UDBA 2AG5A 2FPPA 5A5FA 3ZHZA 3SBOA 3WFIA 3WSWA 1PL7A 1CEQA 1GCOA 2PKQO 4U0JA 3K30A 3JV7A 2C20A 3QVWA 3ROKA 4J1SA 1IHYA 4D7AA 3STHA 5HTOA 2AA3A 1X0VA 4IQ0A 3ZZNA 2VQ3A 1BVUA 3ZI0A 3VVCA 3PDJA 3TFQA 4ZQEA 5ILOA 1M2WA 1ZEJA 2EKLA 2VTEA 1H94A 2C7VA 4F6LA 1BG6A 3D4NA 4WKGA 2RH8A 3C1OA 2HMTA 5A3VA 2AHRA 3VZRA 1CERA 5CPFA 3ZNPA 3DZBA 1WLYA 2SCUA 3HADA 3MJCA 4DYDA 2QG4A 1PJCA 4RF5A 3PWZA 2NV6A 4CMEC 1YWGO 4NK5A 2E6UX 3DHNA 1DIHA 4TVBA 4XYEA 2OBNA 2Q99A 2O7SA 2YHIA 4Q3EA 4PZEA 1YH3A 4U7WA 2D8AA 1TXGA 3IC5A 1YDWA 3ZU5A 4CM1A 2GRAA 1YB4A 1DAPA 3D5QA 4BO6A 2PD6A 1LLCA 1PS9A 2V6GA 3C3XA 3L6DA 1DSSG 3GN2A 1HYGA 4EUEA 2X0JA 1JAXA 3RAJA 1VSUA 2VOJA 3OQ1A 1GDHA 1EUZA 3BMNA 1XKQA 2V65A 2X5JO 3LT4A 2BGLA 2YQ5A 4FIZA 4R5HA 1BDMA 1E7YA 1EQUA 3G1UA 2XAAA 4NDNE 3O8QB 1VLLA 2FWMX 4AJKA 4P22A 1GAEO 1N1EA 2X58A 1D4FA 2ZTUA 2ZYDA 2JFFA 4MO2A 4IZIA 1NAIA 1P1KA 2ZJ1A 3PYLA 1SCUA 4JJIA 1EFLA 2YV3A 2X5OA 2X86A 4HFRA 1RM5A 3PHIA 3NDRA 4JBIA 4A5OA 4N5MA 3QVSA 1DIBA 1MXHA 1ISJA 4NBVA 3RUCA 4IMPA 2IE0A 2C2YA 2JCXA 5A05A 2GASA 1ENPA 1GQ2A 3DOJA 2BGMA 2W2KA 4B7CA 4PGFA 3RU7A 3WTBA 1BDBA 5I7SA 4FFOA 2VWQA 2CDAA 3DFUA 4NFYA 5LDGA 1NVMB 4AJ2A 3HDQA 3JQ8B 5ENDA 2ZCVA 2E4AA 1I3MA 3E6AA 3UCEA 1VJTA 3VDQA 2AW5A 1NNUA 1ZMOA 4U6SA 1JWBB 5KTKA 1HRDA 2B83A 1ZVMA 3ADPA 1U5CA 1W6UA 4XIJA 5JC8A 1ZSVA 1LDEA 4C4OA 3MJEA 2IZ1A 3GMDA 4L74A 5CPBA 4KDFA 4NQZA 3DMTA 1E6WA 4LMPA 2IRWA 4GL4A 2ZB3A 3EDMA 3H3FA 3NAQA 3AFMA 1AGNA 1LDGA 4PLFA 3F3SA 4OGWA 4CMIB 1KVRA 4CM6A 3WMXA 4Y67A 3GRKA 5F3RA 1XA0A 2FRDA 1PJBA 1P0CA 1H6DA 4Z0TA 4IDBA 2JD0A 3QP9A 4KUEA 3JQFA 2VRBA 5KIAA 1MXFA 5BNFA 4R1NA 4XJSA 4R41A 4E2XA 3E9NA 3OMLA 3UICA 1BHSA 1SC6A 4JX8A 4P4LA 2YY7A 2GN9A 4GSLA 2VHXA 1VJ0A 5AXAA 4JGBA 4M86A 1KEUA 2PKRA 4OOEA 5C3MA 2WEKA 1IB6A 3INRA 3UN1A 3M2TA 2DKNA 3IKTA 2YW9A 1MV8A 4MP8A 1HE5A 1YB1A 4TWRA 2ET6A 2GLXA 4A7PA 2PTGA 4TRNA 4U8GA 1Z75A 1Y8RB 2NVBA 3RFVA 1A9ZA 4BOYA 3ZCXA 5A4DA 1JKFA 1AE1A 1A27A 4GQAA 3GG9A 2CVQA 4BNXA 3PPIA 1ZH8A 2NQTA 3GPDG 3HSKA 5FF9A 4DIFA 4FB5A 2BFPA 1RM0A 3ZV4A 3ZU3A 4M87A 5ENVA 5F21A 3FWZA 2GGSA 4B79A 4OXKA 3F46A 2X7HA 1J4AA 1XQ1A 3RC1A 3OFSA 5IJZA 1ZEMA 1R66A 2NUAA 2ZTVA 5KVQA 4B3JA 4MVJP 3I4FA 5DP1A 3LC1O 5A9SA 1LQTA 3PJGA 3DFZA 1TT7A 2GZ3A 1PZHA 3SJUA 2WYWA 4PN3A 3SLKA 3KEOA 3INTA 1GZ3A 2IXAA 5ITWA 4YR9A 1E3WB 2Y05A 3WB9A 1FDTA 3S2EA 3C24A 4KTTE 4IIUA 2IODA 2Y68A 4BNMA 4DMLA 4RDHA 1B3BA 3H2ZA 3NT5A 3VH2A 2OORA 2O4CA 1Z74A 5CEJA 1N2SA 3QVTA 1U9JA 4MIOA 3JQAB 3ROQA 4QFCA 4KDEA 2ZJ0A 1FMCA 1MP0A 2ZATA 3JYPA 4J1TA 1R4MB 3H5NA 1GTMA 1H2HA 2UAGA 2EXXA 5DULA 4CV3A 4WASA 3OEWA 1DIGA 4BKUA 3HN2A 4IXTA 3ZNOA 8LDHA 3V1UA 4AJLA 4JP2A 1B8PA 2BELA 1A7AA 4XZ3A 3KV3O 4N5NA 4C7KA 2B69A 3E18A 1Q0HA 2W8ZA 1EVJA 4XCVA 3LVFO 1KERA 2NTVA 2CF5A 3K96A 4DUPA 5B37A 5T64A 3O26A 1OOEA 3OP4A 3E1KA 2YFHA 4YT8A 1UXIA 1EBUA 2EG9A 2PZJA 4R16A 3IL2A 4UUOA 4XB1A 2VYVA 3G1TA 5G0WA 1DLIA 2W2LD 4Q3AA 5TGDA 1GYRA 1C1DA 1M75A 3SEFA 2D4AA 1M76A 3U3XA 3ZWOA 5LCXA 4W99A 3U62A 1MX3A 1YVEI 2QHXA 4AJJA 1U3VA 1W8DA 4B7UA 5I9NA 4MP6A 1P77A 4KZPA 4CL8A 1Y6JA 4AJEA 4YRBA 2BMAA 5JDIA 5TSDA 3S2IA 1P1JA 3DBVO 3WICA 1H0KA 2F1KA 2PZKA 3EVNA 3G3EA 3FF4A 1N5DA 1LSUA 5EERA 4YEDA 3LDHA 5EIOA 2GSDA 2CFCA 4XYGA 1NPDA 3L4BC 2NSDA 2QQ5A 4E21A 4UREA 4YRDA 4PVDA 2PH3A 4WNCA 2PZMA 5THKA 3JD0A 3NX4A 2EGGA 5CG2A 1I30A 1DPGA 1T2FA 3N74A 4ZN6A 2JD1A 4J7XA 5CDYA 4PLHA 3F5SA 2Q45A 4B4UA 1J6UA 4R69A 2CZCA 5K9ZA 4RPGA 3EW7A 4IDGA 2Z1NA 3E9QA 5KJ1A 4S1VA 3JQBC 2UUPA 3VTZA 4BO7A 2GCGA 4E4YA 4DRYA 3PRJA 1RYDA 1YO6A 5JO0A 4W7HA 4E6PA 1BW9B 2Q50A 2ZQZA 3AM4A 4QO7A 2Q3EA 1DFHA 1PQWA 3AOEC 2OHXA 3R3SA 4GX0A 3VKVA 2FSVA 4A10A 1PGJA 1ZJYA 4Q3BA 2CUKA 5JAQA 1Z7EA 3KVOA 2UUOA 5JPIA 4Y8VA 4MVJG 1SPXA 4MIEA 5KOIA 4OQZA 3DHYA 3DTTA 3GFGA 4KWHA 4OAQA 3VZQA 4EI2A 1T2CA 3FNHA 4Q39A 3K6JA 3B1FA 4PLGA 3ICCA 1I24A 9LDBA 3GMSA 4CR7A 3WJ7A 5HA5A 4NK4A 3I3OA 2RIRA 2DQ4A 1YJQA 2Y93A 1GU7A 5T6BA 2IXBA 3UW3A 4BNYA 4UAGA 1N92A 3D4OA 5CG1A 3AI2A 4HADA 4O1MA 3W6UA 4HUJA 1QORA 2O3UA 3RIHA 2X0NA 3PJFA 3BTVA 2EHDA 1LDYA 4J1NA 5DCYA 4JN6B 3O38A 3W8EA 4OKIA 4YJHA 1R15A 4W6ZA 4B7XA 2ZKLA 1OMOA 2GN8A 1AHIA 3TZHA 5C7OO 5JAZA 4XGKA 3DZKA 3GGPA 4HFNA 2AE1A 1PJTA 3BMQA 1E1LA 4WCFC 2YDXA 4RZHA 3ZV6A 1YL5A 4EEXA 2J3JA 2HU2A 3Q9UA 4TQGA 5BSFA 4RORA 4UVHA 4XGNA 3K2BA 2HK9A 3WQQA 4CMBA 3PXXA 5JC1A 2OL4A 1Z7BA 4RVGA 1E7SA 4YT4A 2ZYGA 1ZO8A 1NQ5A 5TS3A 1XG5A 1Y1PA 4FFRA 4YAEA 5GZ1A 1GV0A 5CAEA 1P33A 3QWBA 2X8LA 4NJMB 3DMYA 1SNYA 4ALJA 1KVQA 3GEMA 3BAZA 3JD2A 1R12A 3RVDA 1D3AA 1R4MA 1U2GA 1UR5A 2G17A 2JHFA 2H6EA 3KBOA 4AL4A 1GZ6A 1UDAA 3ZWXA 2QX7A 5KKCA 4F6CA 3U4IA 3BMOB 4W4TA 2PNFA 2WWRA 3CMCO 2HQ1A 1PJLA 3TNLA 3NJ4A 3PWKA 1H6CA 2YYYA 3BTOA 5G4KB 3GNTA 3MJSA 1R4NA 4CV2A 3WGQA 3M6IA 3E5MA 1PJ4A 3PDUA 1XDWA 1TA4A 4D43A 4R5MA 4K28A 2UV8A 1DO8A 3WJAA 4CM9D 2OFPA 1DIAA 2P91A 2XXBA 3VZSA 5J23A 2DTDA 1ISMA 4CQMD 4D42A 1N9GA 4ALMA 4J4BA 4XR9A 2HKIA 1OC4A 3RD5A 1DXYA 1V8BA 1DRVA 2LDXA 2WTBA 3OETA 3I1JA 4EJMA 5K6AA 4I9UA 1F06A 3QHAA 4RZIA 1DRUA 1ARZA 1GV1A 3WIEA 1I2CA 1FXSA 4E5KA 3IP3A 1I3NA 4QXMA 1OZAA 2VHWA 1NP3A 1QSGA 4ZHSA 3KOUA 1HZZA 1WMAA 5F1KA 4E2ZA 4FN4A 1V0JA 2UYYA 3E82A 1MB4A 2PGDA 3LLSA 1PL6A 2NTJA 5KJEA 2YFQA 1X7GA 4BNGA 4RDIA 1C0PA 3FTPA 5A5EA 1MC5A 4YQZA 3W4JA 1NQAO 2BI7A 1QYXA 2PK3A 4GI2A 2HJRA 4MPDA 1PZGA 3F1LA 3DDNA 3ZWCA 1JN0A 2GN6A 3QJ5A 4NJOA 5H83A 1AXEA 3LF1A 3K73O 2CNBA 1YS4A 4TSKA 4GPD1 3FTNA 4CL3A 2O3SA 2YDYA 5DCUA 1Y5MA 2IZ0A 1NX6A 3CXRA 3ZV5A 4FSHA 4UVDA 4XQGA 4TZKA 3DOCA 3AUUA 4ONEA 3CE6A 4TRRA 1YQDA 3GZNB 4DQXA 2O4UX 1ZUD1 2BFMA 3WIDA 1SOWA 4FJ1A 4BGIA 4NFHA 1TT5A 5ER9A 4AJIA 3RJ9A 3OIGA 4GKVA 1DC5A 4NIMA 3U49A 2B37A 4RPKA 4OSOA 4TMFA 2DT5A 2X0IA 5L3ZA 2O50A 4K1LA 4L8VA 4II2A 3TZ6A 3ST7A 4ESOA 4QX6A 1HE3A 1UJMA 4NH4A 4XRRA 3UGKA 2C29D 3VPXA 1W0CA 3DAGA 3WNQA 5TT0A 3IAHA 3I9LA 4Z9YA 3DTYA 5AYVA 1ZCJA 5T8KC 5I7FA 5KVCA 3RUIA 5AXBA 1K5HA 1JAYA 3KZVA 4IBOA 4CQMB 2W98A 3ANNA 4L4SA 4W7IA 4ND2A 2W4QA 3OSUA 3WGGA 4BIIA 4D3SA 1DFGA 4FBGA 4AJOA 4YRAA 4DQVA 1EE2A 5JSFA 3UKOA 4HX5A 3VZPA 2OXIA 2P5YA 1EFKA 1JTVA 2NTNA 1IL0A 4IDEA 1ADGA 1NQTA 3DBLB 1GUYA 2I65A 4GVLA 4YJDA 5G0VA 5L45A 1N7GA 3PJEA 2VNAA 3WGZA 4PLPA 4NJMA 1LUAA 3MJ4A 3IKVA 2E49A 3LF2A 1ENOA 1Y8QB 3DBRA 1FJHA 1EZ4A 4G81A 3E48A 4YBZA 1HZJA 4RVFA 1WZEA 3OJOA 3X2EA 4BGUA 4GWGA 3F47A 4B8WA 3PFWO 2PD3A 5JMPA 2Q1WA 1O94A 3QWHA 4MJLA 1EDZA 1EUDA 4QTZA 1TVEA 3TWOA 4EZBA 1ZKMA 3WGYA 3KRTA 3BYZA 3NJ8A 4RVSA 2IZZA 4AJ1A 3UHAA 4RQTA 1UH5A 2X6TA 4JLWA 5COAA 3IIEA 2JHGA 4LCJA 4LN1A 1DFIA 3JQ9A 5DOZA 4YAGA 2B35A 5DBGA 2Y99A 4GKBA 5EN4A 1FDUA 2DU8A 4DBVO 3TOXA 1F12A 3H9EO 2PZLA 5TQVA 3T4XA 2BKAA 2VUTA 4HP8A 4KWIA 2GZ2A 4AICA 5JYEA 2O7QA 3A06A 2EJWA 3OQ6A 1RJWA 3SC4A 3TOZA 5TC4A 2HAEA 4XRGA 3LLVA 5JYDA 5BNTA 5JMWA 2XOXA 4NBTA 5CDGA 4L0QA 2O2SA 4FW8A 3L9WA 4WLFA 1JLLA 1A7KA 1NHWA 1PWZA 2OOSA 3D64A 3V2GA 5A02A 1UAYA 3PZBA 3VC7A 1HSOA 3GVXA 5B4VA 1KC3A 1P1RA 1E7QA 4JJFA 4E0BA 4ZGWA 4BO8A 4E5NA 2GD1O 3WQRA 3ZV3A 4D0RA 2AG8A 3NYWA 3ABIA 4J9VA 3FI9A 3KSDO 1MFPA 2J6IA 3GGOA 1GZ4A 4FFLA 4N7RA 1A5ZA 5JAIA 1LNQA 1V35A 2GPTA 1NVTA 5CFZA 1OFGA 5KVSA 1XR3A 3GDOA 3L6EA 3P7MA 5KJCA 1I0ZA 1YOVB 1ADBA 1YKFA 2VRCD 1YBAA 1HDYA 3AM5A 4FJ0A 3WGOA 4GAEA 2V7PA 2D0IA 3UUWA 3PTZA 4Y6PA 5CDTA 5ILGA 4FPXA 5BT9A 4Z0HO 4BO3A 1X1TA 1ENZA 2EV9A 3N58A 5FI3A 8ADHA 4KMSA 1EQ2A 1PQPA 1ADFA 2HMVA 3OJFA 2OUIA 4L4RA 1SZJG 2NADA 3H4VA 4HKTA 3E9MA 1NTOA 1KY4A 3HDJA 4LSMA 3GGGA 1IE3A 1P44A 4KQXA 3Q2IA 3LT1A 2NVUA 3BMCA 1Q7BA 4R1UA 2XF8A 3RSHA 1BXGB 1HWYA 2O3TA 3GAFA 4GLOA 3T4EA 5IZ4A 3E5RA 1PGNA 1YL6A 3ETGA 3JD4A 2FR1A 1ISFA 1L1FA 4BO4A 4CLDA 4WE3A 5JDCA 1HKUA 1BTOA 3WS7A 2WYVA 4B8ZA 4QUKA 1ISIA 1PS0A 1GEEA 4IS3A 4LW8A 3MJTA 3I23A 2D59A 3HUDA 3D3EA 1LEHA 1PU2A 4PG6A 4JIGA 3L6OO 3KUXA 2W90A 1CQIA 4I1IA 3FRJA 4NPCA 2ZB7A 3OJEA 4RPHA 1E3EA 3GFBA 3GVCA 5BNIA 2GZ1A 5JY6A 4YA6A 3WLEA 4E3ZA 2NLOA 3K2EA 3LC2O 4PRKA 3FNEA 3DMTC 3GZ4A 4BNUA 1G1AA 2D2IA 1I36A 2RAFA 4J6FA 3LYLA 5DP2A 3RUHA 3ZNQA 1KEWA 1KIFA 3WR5A 3JSAA 5B12A 4BHTA 3IP1A 2X22A 5L7WA 4D44A 1JKJA 4IXWA 4ALLA 2CY0A 3RKRA 1N8KA 4DMMA 3JQFC 1I33A 2ZB4A 5HBRA 1NAHA 4EUFA 2BFAA 3C1AA 5IN4A 3EAGA 4LK3A 3UXYA 2C07A 4FGWA 4UUNA 1P45A 3F5QA 4Q3NA 1C0LA 4UUMA 1HSZA 1A9YA 3JQAD 1HL3A 4LVUA 3D3WB 1LRKA 3RKUA 2WYUA 4RPJA 2XXJA 1SEPA 1Y9EA 2QYSA 4BV9A 2VHYA 2A94A 5JW6A 1QYDA 2C82A 4ND1A 4L76A 4B4OA 1HLDA 3I4CA 1PTJA 5DOVA 3GUYA 4YJFB 1DJQA 4XD2A 5I8ZA 1NWHA 4OSPA 2GNAA 2BD0A 1T2DA 2NACA 2Y1GA 1F14A 3GRPA 3LK7A 3QLJA 3HDHA 4WLEA 2PGLA 3ICPA 3NGXA 4YJGB 3ZHXA 5HM8A 4BNIA 1OAAA 2I3GA 1E0DA 4HFJA 3I9OA 3DB2A 5COBA 4ZVVA 3NRCA 4M49A 1S7CA 4JROA 3ANMA 3GQVA 1EK6A 4PCVA 1NWCA 4CMGA 3UAGA 5HS6A 4E5PA 1AUPA 4LVCA 2AQKA 2BI8A 1I2BA 1HTBA 5ITVA 2WSBA 4J16A 2QRJA 1FF9A 4FGSA 1NXQA 3DR3A 5BQFA 4R1TA 3B1JA 3KHUA 2DBQA 3FN4A 3WBFA 1XYGA 5TNXA 3WLFA 1XU9A 4BB6A 4BS9A 5IZCC 2J5QA 2ZTLA 1EVZA 2IEBA 1VSVA 4ND5A 2ILTA 2FZWA 4IGFA 1HDZA 5JLAA 2FOIA 1ZIDA 5KKAA 1KS9A 3L9XA 4Y6SA 3TPCA 3VPSA 5L7YA 4I9HA 3LC7O 3QSGA 4I5FA 1EBFA 1HDXA 4KP7A 4MVJI 4NZ9A 4QO8A 3RUDA 4CV1A 3T7EA 5L4LA 4XJTA 4RGBA 1SO8A 5A9RA 3WGTA 3P2OA 2R2GA 2OO5A 5DT9A 1VI2A 3OH8A 4HXYA 4BVAA 4MKZA 3LSYA 1PZFA 4YAKA 1EEHA 2Y0DA 1O0SA 4EDFA 3QY9A 4RJTA 4LSWA 4UULA 3IUSA 1ADCA 3RWBA 2BFOA 1GUFA 1ONPA 3FBGA 2D1YA 2DM6A 3DAFA 4BMNA 5TJ9A 4O5OA 4DYVA 3PEFA 2WE7A 2VUSA 1DC4A 4I5EA 5T67A 3GH3A 4RF3A 4AFNA 5LDHA 3LU1A 1GUZA 3RROA 2J5RA 5CDUA 2POQX 4LISA 4UEOA 3C7CB 3QQPA 1XSEA 3AI3A 1HLPA 3K92A 4YTEA 2ZYAA 3O8QA 1JQBA 3MJVA 3WWYA 4UEKA 4IJKA 3KYCB 3ZU4A 2EEZA 2HMWA 4YAIA 2EIHA 3DQPA 2YZ7A 4HWKA 2AQHA 1P1IA 5JDIC 4CR8A 4E33A 5EESA 4YT2A 4BO5A 1VKOA 1EMDA 5I8WA 4GX1A 5HWSA 1WAMA 1LU9A 3KLMX 3V1YA 1WDKA 4B3IA 4WCFB 1QXSA 3KM0A 3COSA 1LQUA 1CETA 1T4BA 4L75A 5AQ1A 3RFXA 4MDHA 1E77A 2VYNA 1PJSA 1X13A 2HUNA 2NVWA 1LBEA 4EEZA 1VJ1A 1P74A 4DWVA 1SAYA 4RL6A 2B4RO 4IPTA 4XYBA 3JQ8A 4BMSA 2R6JA 4J1QA 5KWEA 3U4HA 4OQYA 4RO0A 3EMKA 2DTEA 4R3WA 2VOEA 3ZW9A 4A26A 1NQOA 4R54A 3RUFA 3ZDFA 4EGFA 1WZIA 4FR5A 1NR7A 1JVSA 4IJWA 4PVCA 5DBIA 1G6KA 2C0CA 4DL9A 2Y1EA 2EF1A 3QIVA 1UP4A 4J9UE 4PG4A 3JQ7B 3H9JA 1SB9A 1VRWA 2TMGA 4JCOA 1U2DA 2V6BA 4CMIA 2Q2QA 3HB5X 2UDPA 2AEJA 1ENYA 2VWPA 3ONEA 3VPGA 3I52A 1AN9A 2VRCA 2BF7A 3CMMA 4KUGA 1U1IA 2WD8A 1WP4A 3AUSA 1ISGA 1PL8A 4BNNA 4PG8A 4A03A 5T5QA 4ALIA 4P4NA 4XDYA 3BZUA 4CUJA 3F1KA 4AG3A 4CQLB 4CV0A 4JJGA 1VM6A 5U9CA 1LSJA 4BNTA 4J2HA 4PG5A 4RV9A 3F4BA 4XQEA 3TSCA 1PQUA 2DTXA 1VL8A 5G0UA 1HYHA 1R16A 1ULUA 3Q2KA 3NKLA 4FJ2A 2JAHA 1DJNA 1U5AA 3H9GA 4PLZA 1QRRA 3KYDB 4PRLA 4YACA 1NASA 5JO9A 3CKYA 5BSGA 3V1TC 1B3RA 1Y8RA 1ZK1A 3PVZA 4TRJA 2X1HA 1R6DA 4E30A 1LLQA 2OZPA 1BGVA 4CM4B 4Z6KA 5FFFA 1PZEA 1IZ9A 3HHPA 1I8TA 3EY4A 5JXWA 4HFMA 1DLJA 3ENNA 4JK3A 4OO3A 2VT3A 4BNHA 1PR9A 3ZWVA 1ZFNA 1HYEA 3AWDA 4R68A 1TLTA 2Q1UA 2ZK7A 3ZWBA 3GLQA 2NU7A 1NPTO 5GZ6A 1AHHA 1KEVA 2EW8A 3D5TA 3M2PA 2YV1A 4OM8A 2OGUA 1YQGA 2RHRA 1C1XB 3JQCA 3KO8A 4I08A 4XGIA 5TT1A 5CEEA 3DEYX 3OM9A 4WGGA 4CLHA 4IQGA 3TFOA 1W73A 1K89A 3WXBA 2FPIA 3ZWMA 1IOLA 3OECA 5ICSA 3H8VA 4ALNA 5ADHA 2VUUA 1E3WA 2RH4A 2ZTMA 4EITA 1QP8A 2Q4BA 3FNFA 1U8FO 3RQSA 5F1OA 4D3DA 1K2WA 2P9EA 4J0FA 4E31A 1IHXA 1ORRA 1KYQA 2VZ0A 1R0SA 3JQAA 1PGPA 1DOHA 4MIYA 3NDJA 3ANLA 3I9NA 1X14A 3X2FA 1NHGA 3QVXA 3VHRA 4CM5A 3V5NA 3TDKA 2O2YA 5IN5A 2HO5A 3FNGA 5MDHA 4N54A 2WD7B 4DA9A 3NT4A 4CMAA 3DZJA 4HBGA 2HRBA 4BGVA 1MUUA 4HY3A 3U9LA 5K6AC 4Q3DA 1YONA 2DUUA 4B4VA 1K6JA 3DL2A 3D0OA 3PK0A 1RM3A 3U4CA 2O3QA 3KSUA 2X5KO 4L73A 4QQRA 4K9DA 2FY8A 2JAPA 4CODB 4FFMA 3HG7A 3AY7A 1LX6A 5DBFA 1U4OA 4DLBA 3U09A 1ZZEA 1CRWG 4J4HA 4MKRA 1O5IA 1LI4A 1B7GO 3AUTA 4QEDA 1ZSNA 1YXMA 3B70A 2J3IA 3IJPA 3EC7A 4ROSA 3W1VA 1GPDG 1QR6A 3HN7A 2WDZA 3CTMA 4ALKA 1DBVO 4WEQA 1GQYA 1GR0A 5TLSA 1U3UA 1ZNQO 1UZMA 1H5QA 1F17A 2Z1MA 3GEGA 4GWKA 4W9NA 3WQSB 5FEUA 1UXKA 3DWFA 4CUZA 4ZICA 2FR0A 1BXKA 1CWUA 4YDRA 1YGYA 4M54A 2D5AA 4CR6A 4EUHA 5DZSA 3GOHA 1LXCA 4M8SA 2QRLA 3CIFA 3ZNNA 2FP4A 3OA0A 3E03A 2O48X 2AMFA 3TRIA 3B6ZA 3VOSA 3WG9A 2BH9A 2PWZA 4X54A 5JE8A 3AY6A 6ADHA 1NBOA 4XQCA 1IULA 1N1GA 4MINA 2GF2A 9LDTA 5A04A 2X9NA 3ZWAA 7MDHA 5I7EA 1LC0A 2A4KA 1BW9A 2I6TA 1HT0A 4EJ0A 4CQLA 1RYEA 5HS4A 5G4LA 3H5RA 5L4NA 1GD1O 5DDIP 4G5HA 1A4UA 3H2SA 1OBFO 1ZBQA 2F00A 3R6DA 4NU5A 3I5MA 4ZRNA 2VTDA 3OQBA 1PGOA 1O9BA 2WMDA 4J49A 3PIIA 2BLLA 2FZEA 2C2XA 5EQDA 5A03A 1YB5A 4DBZA 1J0XO 1KVSA 2Z5LA 3EZYA 1NVGA 4D79A 1Q0LA 2YV2A 3D7LA 4P38A 1E7RA 3HQ4O 3K5PA 3OEYA 3RC2A 4BV8A 1N7HA 4ID9A 2PV7A 4QFDA 3GG2A 3IQDB 4XIYA 1SEVA 3S8MA 1EVYA 1U3WA 5EJ2A 3Q9NA 3UOGA 3DZHA 3DO5A 4Q3CA 4CLXA 3PJDA 5IF3A 2Y1OA 1ULSA 1PJ2A 4BGEA 2WM3A 1BWSA 1E3JA 4LGVA 3BMNB 3WOHA 1B8VA 2Q2WA 1JKIA 3OF2A 1A71A 1F8GA 5JS6A 3OBBA 2EW2A 3Q0EA 3ZN2A 4NBWA 4R9RA 4FOOA 1K0UA 1ONNA 2VHZA 3JYLA 1C1XA 2W2LA 1LDBA 1PR3A 2DBVO 3QVOA 2A92A 4OXNA 1U3TA 1H6BA 1ZJZA 4GVXA 4JQCA 5I9LA 3BHMA 1BVRA 3NV9A 2DLDA 2Y0EA 3QE3A 4D46A 2GERA 3PQEA 4J91A 4OHUA 3MOGA 1WWKA 1EDOA 3QW2A 1I01A 3WYCA 1E6UA 2GDZA 4E5YA 2CSUA 4XX0A 1RWBA 3O4RA 4FQ8A 2I66A 1NPYA 5A3JA 3ZWWA 4PLCA 1WXDA 5TF4A 4CJXA 2HDHA 1E7MA 2W2KB 3H65A 1VKNA 2Q49A 3CZRA 3ETEA 3RASA 1P1FA 3ZWPA 4R51A 1JWAB 3A4VA 1ZW1A 5F5LA 1ZMTA 2IEDA 3GEDA 1UAGA 2VWGA 1X1EA 5CEFA 1XU7A 4NNJA 4JP3A 2Q4EA 3VPFA 4FC7A 5B4UA 3GHHA 1EE9A 4NHEA 3ZU2A 1C14A 3BMOA 4OMUA 3ZWNA 1K3TA 1YE3A 5JCJD 2DBRA 1V6AA 3W8DA 3DZFA 4DPKA 3PZRA 1JA9A 1U7TA 5G4KA 2I3AA 1XWFA 4RVHA 4GMFA 2O3RA 3S2GA 1SB8A 1JU9A 1E3LA 3F6YA 4YQYA 1HDRA 3WWZA 4A2CA 2ZIZA 3DOOA 2ZB8A 2Y1DA 3R0IA 1QV6A 1V3TA 4JBGA 1UUFA 4KOAA 3JQDA 2PH5A 3M1AA 3DBHB 4NG5A 3FHLA 1LJ8A 4DLAA 1EUCA 1DAOA 3GT0A 4IMRA 4ZD6A 2P4QA 3DAPA 2TMDA 4FOSA 1KC1A 1GEGA 3AW9A 4HV4A 5BR7A 3A1NA 4OYRA 3DHEA 1WVGA 4WNIA 1V9LA 4BNLA 3A28A 1NFFA 2YHUA 1R37A 3BHJA 1O95A 5U1PA 4CLOB 3VVBA 4LRTB 3QV1A 4TVOA 1GQQA 3GVIA 5I9MA 2P5UA 4Y9DA 4ZQHA 1UP6A 3CINA 4WLVA 2H1SA 4IINA 4BO9A 4F46A 2NWQA 3K31A 4RF4A 4A0SA 1T1RA 4RF2A 4XR4A 4O6VA 2JFHA 4IS2A 4IDDA 1VC2A 1MG0A 1C0KA 5AOVA 3I9JA 1PEDA 3WYEA 3TZCA 3F4LA 1WMBA 2FR8A 4DTIA 3QWIA 3A9WA 3FWNA 4GGOA 4YT5A 1T2EA 1KEPA 3BTUA 2J3HA 1NR1A 2BGKA 2H9IA 1B8UA 4JBHA 2JL1A 3GR6A 1AXGA 1UXHA 3GVHA 3FPLA 4KQWA 3S55A 4DQUA 3MEQA 4TZTA 5JDCC 3IUPA 1E5LA 2G1UA 3GUCA 3CEAA 4DC0A 2FHSA 4ND4A 2CVZA 2HK7A 5JFOA 2G82A 1E92A 1HE4A 2I67A 3K8ZA 3GDGA 4F45A 2H5LA 2Q2VA 2B5VA 2EERA 3ZHYA 1QYVA 1WDLA 1LRLA 4TKLA 3L07A 4BB5A 4CM7A 2R00A 4PIVA 3RUEA 4BNKA 3WYBA 2YQ4A 3ONDA 3PYMA 5A9SB 4J43A 2P9GA 4OL9A 2LDBA 3U0BA 2AQIA 3ITKA 3GZNA 4EJ6A 4O59O 1YBVA 4A73A 5KNLA 4FCCA 5G2OA 4DLLA 4XKJA 4CM8B 1Z73A 5G0TA 1QMGA 3M1LA 5F5NA 4NBUA 3E8XA 2EP7A 2Q46A 1I5RA 4PZCA 3GNSA 1FDWA 1H9AA 1ZK2A 2HLPA 1LTHR 1PIWA 5T57A 2B36A 3HE3A 5L9AA 3JYOA 3RC7A 1E3IA 2Q1TA 1T25A 4L4XA 4IGEA 4LCEA 4Y98A 4DPLA 2NM0A 1T26A 4YPOA 3EZLA 4RLHA 3A14A 1B26A 2HJSA 2UVDA 3VH1A 2FPGA 4EBFA 4CM3A 2Y1FA 1DEHA 4MKXA 2Y67A 3GPIA 4BNFA 4CMEA 4CM9A 4DC1A 1NM5A 3OIDA 1IY8A 2O23A 1B14A 2X9GA 4H3VA 3PGJA 3PIDA 4CQMA 4YXFA 1TB4A 4IM7A 1VL6A 1K6IA 5ES3A 3UH1A 1MC4A 1UXJA 2X23A 2JCVA 3RU9A 3B1KA 3GC6A 1LLDA 2HMSA 4OXYA 2X4GA 5C5IA 3INGA 1Q1NA 3ZHBA 2HRZA 5JAMA 2CVOA 2D3TA 1U7HA 1X7HA 2V6FA 3KYBA 4MVJH 3BHIA 3L77A 5THQA 4AJ4A 3ZGYA 3JQGB 3DBLA 4DVJA 1F8FA 1CYDA 1C1DB 4I8XA 1LDNA 4KTVE 5EQFA 1DRWA 1Y8QA 3PLNA 3UFXA 3O03A 3KLPX 3VKUA 4UVIA 4UVGA 4D0SA 2VN8A 3WMWA 4DPMA 1GPJA 2VNSA 3F9IA 5TX7A 1L7EA 1QG6A 5IXYA 3GK3A 3C85A 3AU9A 4IY1A 3PHHA 3OICA 2JD2A 3RUAA 3IS3A 1HEUA 1U8XX 4K6CA 1PX0A 4FFNA 4M1QA 1CF2O 3EVTA 3V8BA 3W4IA 4LRSB 2CF6A 3NTOA 3TJRA 3UVEA 4S3MA 3UF0A 5BSHA 1LLUA 4H7PA 5FWNA 1UDCA 1HF3A 1Z45A 1XCBA 4XEHA 3DBHA 1JDJA 3VH3A 2DUWA 3TL3A 1GCUA 4RQUA 3ETDA 3ONFA 1E1KA 2VCYA 1DHTA 3H9UA 5ER6A 3DZGA 5KVVA 3EYWA 4OJNA 5L40A 1P9LA 2CD9A 1RM4A 1JVBA 1GY8A 3DXFA 4HNHA 3G49A 3PFFA 4U5QA 5CP8A 2PA3A 1A4IA 4J7UA 4CLOA 1U28A 2I9PA 3JCZA 4E12A 2C7GA 4AJHA 1YL7A 2XPCA 5A1TA 1KOLA 2HSDA 4ND3A 4WCDA 4PG7A 4NR0A 3SXPA 2DVMA 4L9RA 3H5AA 3FCOA 3U5TA 2QZZA 4E5MA 2B5WA 3L4SO 4LMRA 1WW8A 4EW6A 3ASVA 3V2UA 1Q7GA 2J8ZA 1RKXA 5IDWA 4WEOA 3IMFA 3IDSA 4IUYA 1IPFA 1ISHA 2YUTA 1B2LA 1YOVA 1LDMA 4G65A 5IDQA 1XEAA 2GN4A 5IDYA 2C5EA 3OJLA 3ORFA 3O9ZA 4O63O 1MG5A 2AQ8A 2PFGA 1XIVA 4YJHB 5EL0A 4NFSA 2QYTA 3OJ0A 4UVEA 1Z6ZA 1HDOA 4RCVA 1Q7CA 3W6ZA 2DPHA 4ZRMA 2PKQP 2YJZA 3LT0A 2J3KA 1DC3A 5L51A 4C7JA 3BMQB 3KEQA 2X9VA 4QSMA 5C7LO 5K0ZA 3GHYA 4Y6RA 1EK5A 3KXDA 2RCYA 4U0KA 4R3NA 5L4SA 1BXGA 2PD4A 4URFA 5IZCA 2C54A 4XQ9A 5LC1A 1X7DA 4BO2A 1PSDA 4CM8A 1J49A 3G79A 1XGKA 2NNLD 3HNPA 2AXQA 1VE9A 4I5GA 4GGPA 3ZH2A 2BRUA 2I5PO 3KTDA 5JCJA 2AE2A 3ADOA 2QW8A 1BXZA 2ZCUA 4M89A 2EGHA 1D1SA 2FMUA 1OI7A 3VPHA 4IJVA 1T24A 1Y5RA 4F3YA 2IYPA 3UCFA 2D5CA 3HFSA 6LDHA 1ZK0A 3Q11A 2B0JA 4J3FA 4J4TA 3D4PA 3QWAA 1PJQA 4Z3DA 2QIOA 3TQHA 4CMHA 1WDMA 3WBBA 3QRWA 3FD8A 3OIFA 5G0SA 2QRKA 2FN7A 4MOWA 4WOKA 1DDOA 2DBZA 3LQFA 4UUPA 3UCXA 1E1NA 1X15A 4BUCA 1J5PA 3BXXA 1IYZA 3DONA 5B4TA 1R4NB 4D41A 3PP8A 2C5AA 1M6WA 3ASUA 3AM3A 1LSSA 3TF5A 3B20A 2HK8A 2NU6A 3RCBA 1P31A 3IOYA 3JQGA 4YWJA 1BMDA 3HWRA 3GA0A 3AI1A 1N9GB 1QYCA 1TEHA 3D3WA 3GVPA 4BKQA 1B16A 1QLJA 4DIOA 2OMEA 2EKQA 2PGJA 1FK8A
chains in the Genus database with same CATH superfamily
3W90A 3PHJA 1UP7A 4LHEA 5JXGA 1CUIA 3N7UA 3NWJA 3DP9A 4ZJZA 2EBHX 2WTAA 2GLTA 3K9QO 3I9V1 5J3JA 3STXA 3ZGLA 4CGZA 2Y1KA 2FLKA 1YE8A 4JP1A 4XWYA 1VA5A 2IKQA 4UCXA 1AHPA 3U4QA 1LA2A 5IC5A 2Q5EA 2R7LA 4PANA 3KQUA 1IBSA 2BHSA 4JQYA 5FYQA 1F7UA 1X74A 3AI7A 4YFVA 4YJGA 3VC1A 4BFUA 2GJAA 5KQMA 2ZPAA 1PFKA 3NTRA 4O2AF 5CDSA 4E46A 2WJVA 1ZJ5A 5L53A 5AXDA 5F76A 4RZQA 1LJLA 4JVSB 2WZQA 4RVDA 2MSCB 5A5GA 3TGPA 2D1RA 3BTSA 5TMBA 5AUNB 2Q1SA 3JQQA 5AM0A 4EENA 1R0KA 1JJFA 5IFLA 1WW3A 4BECA 2IU4A 1OHHA 1MR3F 2ONYA 2NZ8A 3RVLA 2EKPA 1TKBA 1L7RA 2PLFA 2VHVA 4OQFA 2O8BA 2ORWA 3A3NA 3CZ4A 3HB9A 3L4BA 3X0DA 1C30B 2XIQA 1W5FA 4FC6A 1SD5A 4ND8A 1SBYA 4X20A 4MNTA 3WK4A 1VCNA 2DPMA 3Q3CA 3OQMA 2QJOA 2Q5IA 3NUGA 4MWOA 3TLKA 5JCXA 2FUG6 2QVYX 3SU8A 5D3MA 4YRIA 4AXBA 2UYQA 2H17A 1Z4PX 2ZQYA 4JI2B 4LDZA 4M0UA 5B57C 4HGOA 4PLTA 4BRUA 4L22A 3KSZO 3FPCA 4X7RA 4B1FA 3N28A 3OHPA 1RKBA 1AG9A 3IUEA 3MT0A 3ZBTA 1YZ3A 2WJ6A 5HF5A 2B21A 2GF0A 3WX0A 1POWA 3BM5A 5DTIA 3BDVA 4U6QA 1UKVY 2MIIA 3BUSA 3ZCUA 5MN4A 4BMXA 1KBZA 3FTCA 2NTEA 1EVLA 2E18A 3CB4A 4F38A 3GY0A 4EGCB 3GNQA 4UQLA 2AEEA 3FBTA 1IMJA 1U0FA 3A58B 4MP3A 3UWSA 3IPRA 1W4ZA 1GL6A 2IUSA 1NMXA 2YC2C 4HDKA 4OUDB 2AEMA 1PJ3A 4X1YB 3WGUA 2I7XA 3LBHA 1D6SA 1D1TA 4FS3A 5AVKA 3IEVA 1SXIA 2VZ9A 1FTNA 4EUNA 1Z5GA 3CUSA 4JLBA 4RA9B 3N2NA 4WBNB 1HFKA 4GLLA 1FMFA 3IHWA 4C43A 4EA7A 5WRFA 4BL5A 4K26A 3RQIA 2CXRA 4FIDA 4AZTA 5KNBD 4H6VA 2ZBQA 4KXNA 2Z4TA 3I72A 4H18A 4XAQA 3FLMA 4ZC1A 4ZYXA 3WGIA 3WISA 4QIHA 4KQ6A 4PS0A 4RH0A 1QKIA 3Q10A 1I2DA 1LNSA 4NHOA 4R2JA 1KE1A 1SUBA 4WL0A 4DT1B 4EHFA 2FW0A 1TZCA 2VHUA 4INAA 3EG5A 4GXQA 1DBRA 1FFWA 2R6R1 4UXHA 1DAKA 2OM2A 2DFVA 3HACA 4IGAA 4C9BA 5IEJA 2L42A 4RTQA 3ZXYA 3LBAA 3MBKA 3K6SB 2RGDA 4DLYA 3PDCA 2PA0A 1HDGO 1IEXA 3IQEA 1Z56C 3O2JA 4D9CA 1NJGA 4GNRA 4REQB 1JDBC 1WKVA 1E5QA 3H2BA 2DPGA 3TEFA 5GIOE 5EPUA 4ZCIA 3AJRA 5DE3A 4WOJA 5ALZA 4TTQA 2WKRA 1U65A 3WP0A 4DCJA 4ZGGA 3I9MA 1K9VF 2YUIA 2DHCA 1XAIA 3A1VA 2JEYA 3KLBA 3EGOA 5AHKA 3NYIA 1FL9A 4WJZA 1O6FA 2WZBA 4NU8X 1VL0A 1SVMA 1HY3A 4N18A 1Q0RA 1DC6A 3WRWA 2LWIA 4XFJA 3E70C 5CFPA 5U4QA 2C7QA 3NHLA 4CFYA 1W44A 4WFQA 2QM7A 3P71T 5EPOA 2P4HX 1SCQA 4JT4A 4AVYA 2M6LA 3WL3A 4RHTA 4AKTA 4AKHA 3MWFA 3I3SR 1H6AA 2R8PA 1Q15A 3AEQB 3RADC 1J7KA 4AZ3B 3HNRA 3S1LA 2IV2X 4KN6A 2AFRA 4IQ8A 3C7DB 3UJNA 5A7GA 5TJHA 2Y92A 3RI3A 3QNWA 1IZ0A 1P7YA 2PRZA 5I7OA 3GGCA 4OIMA 1BROA 1GFZA 3AUAA 4J0HA 1D1PA 4YDQA 2ZDQA 1N6LA 1XMJA 3AX6A 3NAGA 1GFWA 1DB3A 2DFDA 4KXYA 4DHWA 5LR6A 4DMHA 1G8HA 1W5TA 2BUCA 3I58A 4I81A 3CLUC 1JLLB 1FX0B 1JLKA 3ILXA 4ZHQA 4K8RB 2Q21A 4XDHA 3DVQX 4ZXPA 4KREA 3OCCA 1P0QA 1K0FA 2QSYA 4FQ7A 5BWCA 1KA9H 1CDZA 1QLHA 2JEOA 3OE7D 4P4GA 1V7PC 1QQ6A 4BNVA 1V7ZA 3L8HA 3B8EA 2WJPA 2AB0A 2XBUA 3E61A 4ZDJA 2CLOB 2C4TA 1QIMA 2W6ID 5FWAA 1IPEA 3MTGA 4XSGA 3NVMB 2ZANA 3VH4A 1PWHA 4DIMA 1WETA 1ZWLA 3EUFA 4H7IA 1QV7A 3H7AA 2MSWA 3PI7A 1YJ8A 3R5SA 1Q2XA 1N36B 4IIJF 2Y9MB 1J2JA 3HCOA 5JI2E 1LVHA 1ONOA 2OO3A 2VEOA 4IWXA 4M83A 2VWHA 2FA9A 4YROA 1WULS 2DGDA 2QRQA 3I45A 4N8SA 2X7XA 5EZYB 3SK0A 4ETNA 4R01A 5LOVB 1DXQA 1TVKA 4DV5B 4GC5A 3O5AA 1I4LD 2C4MA 3B1XA 3E3MA 4R9SA 1O5TA 4DDHA 2IYRA 2HDNB 3K0KA 1WOMA 2GUWA 1FDRA 2HBRA 1XO1A 4CM4A 2P90A 3GFFA 4DCMA 3TW0A 3L8EA 3CLRC 2VK1A 3D6MA 4QPPA 3KLNA 5CNIA 2UZ1B 4CKXA 4MR9B 2V3CC 2EWMA 2YMMA 3BRWD 1PX2A 3IMEA 4GZ5A 4H3HB 4KUHA 1OXKB 1FQWA 4W82A 3JYNA 4O1IA 3ZHOA 4L2IB 3QPAA 2OGTA 4MI6A 4M2LA 2A35A 3COPA 4U7PB 5BQ3A 4IX9A 3B9RA 1RLOA 3DE7X 2W2VA 3TLJA 1FY2A 1OSNA 1SJ9A 3CE9A 1HQDA 1Q1AA 1ZNXA 3Q1LA 1IOVA 1TJ3A 2D0PB 2I4OA 4YVFA 1RP1A 1GYPA 2ZOSA 2C8JA 5LFAA 1THGA 2LE0A 3KR9A 4DCOA 5IULC 4L72A 5KNCH 4JXKA 3RC9A 3T7TA 2XNCA 4ASUD 1HTTA 4ZEVA 3T12A 4D4JA 4WECA 2ERCA 3WNCA 4DJFC 4MYRA 1QFJA 3CSUA 5DHFA 2VP6A 2H29A 5C7IO 1TI7A 2Q41A 5H4GA 1KFCB 3JATB 3OQIB 2GUGA 2XA1A 2GCPA 3ZEAA 4A92A 4GKAA 5HZHA 4Z3OA 2AD1A 4NYIR 4QU5A 2RI6A 2ID9A 2R5FA 4EZEA 1DG3A 5FBVB 5K3OA 5I6DA 2IYOA 2B6NA 2G76A 3AEKB 3WL4A 3JQ9C 3NALA 1O8BA 2IE8A 1E1RA 4O0MA 1O87A 4NOMA 4TKMA 1YS2X 2DSNA 1HT3A 4UMEA 3WKBA 5IH3A 1PT5A 4TLDA 3ULKA 1W4CA 1VGRA 2PG3A 2IDZA 2GVNA 3UAXA 4PYIA 4Q9DA 1MABA 3HEMA 1CP2A 1YI1A 2J5XA 2YS7A 2NQ8A 3M5DA 4PLWA 4EYEA 3WGHA 1OB5A 5A4AA 4GDFA 2IJGX 4DA8A 1U98A 2GB4A 3VDMA 3K1AA 4ILKA 4I14A 3GRCA 4B6PA 2C77A 1MZPA 2XZTA 1GUBA 1WTCA 2I9KA 1U99A 2Q3FA 3SEZA 5JZOA 1ES9A 4XM1A 5KCZA 2ZJFA 4FWBA 4JBYA 5MGBA 3AEUB 4MDYA 5H81A 5G02A 4B35A 3RBXA 3HDYA 5CX1B 3TZEA 3M7IA 1PL0A 2E2WA 1PEAA 4WOCA 1N2HA 3PUHA 4C4AA 3SJ7A 1BMFD 2P9CA 4INZA 5HKKD 1K7XB 2KSQA 3LOUA 1QV9A 5JG7A 2NU8A 3TX2A 1RCUA 4EFMA 2G9RA 3UBMA 3KSAC 1L5ZA 3K5HA 5E4JA 4BKPA 4P8RA 3GB9A 3NHJA 4EARA 3L5OA 1ICIA 4QRIA 5ITZA 3ZH9B 1OC2A 1N5IA 4ZPJA 4C1NA 3KKOA 2Q3MA 2FR8C 4RPLA 1PR5A 1DIRA 3ZJ5A 4QECA 2ZT5A 4WLUA 2JBHA 1QLWA 1GKLA 2C42A 4BVLA 4QGSA 2H63A 2OZLA 4A36A 3CG4A 4TTTS 3QTTA 3QU9A 1VYTA 4UEJA 1KZHA 2XMSA 1PWXA 2I76A 2XY4A 2IEAA 2G83A 1UXGA 3DFKA 3KKNA 4LFAB 3RFFA 5CURA 5ECGC 4YY3B 5B1YA 4O4LA 4DR4B 2C59A 4Z3KA 1CW2B 3DDOA 3HTXA 5EE5B 1BKDR 3C43A 1NYRA 4E2YA 4EY7A 1WCXA 1YU9A 2FV8A 1ND6A 2VYND 3CPSA 3KB6A 4IEIA 4JLPA 4LOIA 5BV1A 3HB4X 4LXGA 4BO1A 3CPHA 4U7GA 5JY1A 3P4XA 4HZUB 5K05A 1D7AA 3RJZA 1EX7A 3AR7A 2MINA 1A2OA 1X1AA 2ZLBA 4J2OA 3HA5A 2ECQA 2BZSA 2H51A 3L0DA 4GRAA 4IDPA 2JIPA 3WFIA 3DYIA 4RM2A 3KR2A 5AI8A 3AF3A 1SOUA 4OFBA 2FRVA 3CHYA 5EIEA 1M2OB 4X1KB 4EKDA 4ENUA 1KYZA 1U9IC 2PGOA 3JV7A 4J1SA 4D7AA 5HTOA 3STHA 4JD5A 2AWOA 2CYAA 3IAAA 4IQ0A 3WV5A 4ZKDA 2GEBA 1MF7A 1C9NA 3LW7A 4PYKA 1HV8A 3TB4A 2IYZA 4AY2A 3GJQA 5B58C 2SKCA 1JEQA 3MTIA 4B9AA 2A57A 4KO4S 5KNDH 4NMXB 2H06A 5DIFA 4DQDA 1H94A 1LVGA 4YAFA 1BG6A 3AL0C 2VLBA 2RJ3A 1Q6ZA 3CRQA 2NUAB 4HRAA 2AHRA 2Q6TA 2AW3A 1SGWA 3M81A 3RRBA 3VZRA 5BUZA 5JNUA 3DZBA 3IURA 3HADA 3MJCA 3C5VA 1JDPA 2QG4A 5KNBA 2CUZA 3HBLA 2VT6A 4NYMQ 1NM5C 3AY0A 3QEOA 1DIHA 2UVPB 4RQAA 3ELBA 3L8ZA 2OBNA 3G2QA 2YHIA 3DL4A 4Q3EA 5K5EA 1JYSA 1FLAA 3B1YA 1Z0IA 1IZZA 2GD6A 3L5KA 3M6LA 1TXGA 4PHFA 4CI0B 2QN3A 2ZI7A 7YASA 3UTDA 4Z86A 3BD8A 3OZVA 1I51A 1Q5PA 3EDRA 4ZAWA 3ZU5A 4CM1A 2ZZMA 4F3TA 2WMNB 1BMQA 3D5QA 3KFLA 3QKUA 1PS9A 2PRJA 3GFPA 4QBGB 2OK7A 3GN2A 1HYGA 1JFTA 2QPAA 3K8OE 2D1SA 1M1UA 1RLIA 4GIBA 4A16A 1EUZA 3BMNA 3VPCA 5BP7A 2BCJQ 3LT4A 1UBUS 3QQ5A 4ZCQA 1UOPA 4KSYA 3IESA 5AM1A 1CS4C 1BDMA 1P73A 3N7AA 3VHLB 3DM9B 3F97A 3G1UA 1DADA 3TVTA 3L7KA 4PYLA 5HQ3A 2FWMX 4ZI7B 3A6FA 1KIMA 2UZAA 3K0CA 4QM7A 5EC8A 1GAEO 3BT7A 3CWQA 1N1EA 1PRYA 1GL9B 1QZXA 1QQTA 2ZTSA 2XR1A 2ZTUA 3LUBA 1CJBA 4M9CA 1N4DA 3WMRA 5KQGA 4RJJA 2DX7A 1LY1A 4IZIA 1P1KA 3PYLA 4EJSC 5JAHA 3AP1A 4BPBA 3ZTTA 4HDSB 2YV3A 1MAAA 2JAQA 4TXJA 5JVDB 1Z07A 3NP9A 3PHIA 4HFRA 4JBIA 2DCMA 4A5OA 1Z4NA 1HO3A 1MXHA 2BDUA 3HBMA 3UMSA 1MRSA 3AJ9A 2G4LA 3R7NA 4IL5A 3DOJA 1GQ2A 3AHHA 1V95A 4I2VA 3SIPA 2GM3A 2F3TA 1JFFB 2YRFA 2CFRA 1BDBA 3R44A 1QGOA 3IT3A 4GU5A 4FFOA 5DT2A 3IOBA 2A1TS 3L0OA 1NVMB 2HHCA 4AJ2A 2B3DA 2IOQA 4HXGA 1TZJA 2VJMB 5AW6A 2E4AA 3GLRA 4HB2A 3DOIA 5LZ7A 2OGWA 5ALXA 1PV2A 4DADA 4LRXA 1JWBB 2OFFA 3DUWA 2XUPA 2HSZA 4QOIA 5DNWA 1ADJA 3N8KA 1COWD 3VISA 2XT9A 4F1WA 1G98A 1P75A 1P81A 1QH0A 1W0KD 2V4MA 3E7DA 1EX1A 3IBYA 4B71A 3OE7A 1SOMA 4ZT6A 3K70C 2PS3A 1N5JA 1G42A 3REQA 3BN3A 2SKDA 5G1NA 5CB4F 4L9SA 4KPUB 5K4HA 5CPBA 3P0EA 3UBTA 3C2QA 1KJJA 3L8DA 4KDFA 3DMTA 2CZQA 2W6IA 4LMPA 3HEBA 2VTVA 4NQZA 1UMDB 4WRRA 3EDMA 3W1EA 1G9TA 4Z99A 3NAQA 5FOWA 2EF0A 3IP7A 4RU1A 4CMIB 3V4VB 1KVRA 1ULAA 4CM6A 3LQ1A 3WMXA 3ICQB 5MF6A 2JGJA 2OCIA 1XA0A 5FUVA 3RT1A 3DVLA 1TX4B 4AM8A 2XLCA 4B3FX 3R8FA 1CJVC 4JELA 3VJLA 4A23A 3HO1A 4O4IA 5SY4A 5LP1A 3UUEA 4YP7A 2WG0A 2XODA 2X4DA 1RWPA 2X6QA 5BNFA 3BH0A 1NW6A 4G37A 4E2XA 2XJ9A 1FUYB 4OGGA 1NLMA 2WUFA 3OHMA 4OPMA 1SC6A 4D97A 2EZ8A 4P4LA 4GSLA 2VHXA 1VJ0A 1W4LA 2XDAA 2E89A 1XEWY 1B93A 2ZIXA 3VKFA 1KEUA 1OLUA 2HEIA 1NBWB 2IUEA 5D84A 5ALOA 3OTGA 2Q5OA 1JFLA 1IB6A 3BRWA 3UMBA 3UN1A 2XHEA 4R71A 1TW3A 3T3PB 3IKTA 2C3YA 1BE0A 3KG2A 2YW9A 4MP8A 2JFBA 1HE5A 4WESA 4V0NA 4HQNA 3Q9SA 2GLXA 2QG9A 4OX9B 3PC3A 5ICEA 1DRJA 1A76A 4P7GA 2ANBA 5A4DA 2N42A 3VSDA 2Q5FA 2EW1A 2WSLA 1TDJA 1YQ9A 2DUNA 1H1DA 1G2IA 1WXQA 5J43A 3TUZC 2CFTA 4P9NA 4ASUA 3MWKA 5HRAA 4GQAA 5HNKA 2G07A 1EGAA 3RYCA 2K7ZA 3WL6A 3H0KA 3PPIA 3R6LA 5IARA 1TADA 3HSKA 2L82A 4R8RA 5FF9A 3EE6A 4U1RA 1F5SA 1IJKA 3Q7EA 1RM0A 4Y1EA 4LDPA 3ZV4A 2PWAA 4DG5A 3ETHA 3OX2A 2J3QA 2R68A 1OFHA 4BZZA 2GGSA 2QUZA 5FT9A 3VPDA 2WQ6A 2IYXA 2HH9A 2XB4A 2YZ2A 2ZVDA 3F46A 4RK6A 4UBNA 5H59A 1N6KA 3OFSA 4JOCA 3UHJA 1P2DA 1R66A 1RBQA 4OP2A 4Q7KA 2VTBB 2OQ2A 2ZULA 3BICA 3JZDA 3JWIA 5DEOA 5DP1A 3LC1O 1O2DA 3MPOA 3OZAA 1P7ZA 3DFZA 3ZY5A 5A9SA 5F9HA 1PZHA 3SJUA 4F93B 2G9QA 1TAHA 3NIGB 1RTTA 5DVZA 1JTFA 4PN3A 1T9DA 2CNOA 3OMXA 3ORQA 4C89A 1OTYA 4C7OA 1YQEA 2IXAA 5ITWA 4YR9A 1ZN9A 1WB4A 4LBZA 1PE0A 3S2EA 3C24A 4EGSA 3JALA 1A50B 2OQIA 4IRMA 4IV8A 4KXLA 3T9FA 4B3MB 5F77A 2ZS8A 1T2UA 3DV9A 2OORA 3ZE7A 2O4CA 4JJAA 2V8OA 5EHNA 2O59A 3N2YA 4ZYYA 1N6OA 5AVUA 2QBYB 1TRHA 4DTCA 3JQAB 4CIYA 4NOJA 1ODLA 3UYKA 5CK4A 2XGMA 1MP0A 2GEKA 2ZATA 4J1TA 3ZKAA 2R44A 3GQBA 3O3OB 2UAGA 1BMFA 1JU4A 3BX1A 5GGYA 4CV3A 5JSHA 5IAKA 1WIWA 1VLQA 2J30A 3V1UA 4URXR 4JP2A 5PNTA 2BELA 4X6LA 3Q8MA 3BFPA 2I0FA 1R5BA 4PC7A 2E4ZA 4TTRA 5FKJA 5C7YA 4QM6A 4LV8B 1J39A 2VAXA 3O0DA 3RIMA 3H4IA 1RAEA 2BM1A 3VJRA 4XCVA 1GM5A 5IS2A 2NTVA 1BDIA 1L5RA 1KP3A 3U61B 3I4LA 4JZKA 3FOWA 1RWOA 2ID8A 3AR8A 3WWPA 2H07A 3O26A 4CXMA 1ZUNA 3KKEA 1WZUA 1RHQA 2BMJA 2EG9A 1NR5A 2PX6A 2XMDA 1FXUA 1RXEA 4Q1BA 4R16A 3TW4A 4V1CI 3C3BA 1PHPA 1DLIA 1G8AA 4JHLA 1SQ0A 4Z4HA 1CJTC 1I6MA 4JBXA 2J41A 5TGDA 4K9SA 4HL6A 2YJ3A 1C1DA 4AWBA 1E63A 1SQ6A 2XSZD 3SKYA 1UMBA 2FTKE 4MCJA 1F4PA 2J33A 4RWZA 5LCXA 3U62A 3HCAA 3UJ7A 3A05A 5DHSA 1U3VA 3H83A 3FLEA 2NYAA 3GDHA 3OQHA 1Q17A 4NMLA 5CHYA 1BKSB 5LUBA 4F85A 2MDTA 1Z7YA 4R7ZA 1QE3A 1Y6JA 1SK8A 5IYZF 4AJEA 4G5XA 4BKMA 5EIBD 4AURA 1J00A 3IO5A 1YK1A 1DEOA 5H7XA 5B36A 2HQBA 4EYKA 3G3EA 1M7HA 1A8SA 2X9LA 4HAXA 2DFPA 3T7RA 1LSUA 4OYLA 4YEDA 3H04A 3O21A 3LDHA 4G23A 1EGMB 1XF1A 1UJ6A 3LPNA 4H4DA 1CE8B 4PFSA 3RTCA 1FVHA 2GSDA 4M7RA 1FZTA 4QUBA 4XYGA 4E21A 5BVHB 2NSDA 4BGDA 3FE2A 3T99A 1NQWA 3TG8A 4PVDA 2VRNA 2Z9CA 3RC8A 4C78A 1ODSA 1VBNA 2O2IA 4H6PA 1D03A 3JD0A 3NX4A 4R8LA 1ONSA 1I30A 3H13A 4QGFA 4YO7A 2COKA 3TQFA 1KEEA 1OVGA 5J2TF 4DJEC 5CDYA 1SD1A 3TW6A 3LV8A 4Q16A 1J6UA 4KRGA 3O8DA 4DUGD 2EYUA 5CW2A 4YRKA 2V54A 3E9QA 3OOHA 4ZANA 3I61A 2VK4A 3PGA1 4MA5A 1GPBA 4B2IA 1U2RA 2JI8A 2UUPA 2EQAA 1VXOA 2XTJA 3LL7A 4I4TA 1W85A 3H42B 4E51A 1YO6A 2IOHA 4F4HA 4E6PA 5KSWB 2AJCA 1BW9B 4UHJA 5LWHA 2WHYA 2C95A 3VKVA 4L3WA 3AOEC 3E9DA 2F8LA 1DIOB 2FSVA 2NPFA 1PGJA 4Q3BA 2Z2IA 2CUKA 1K98A 3GUVA 4EX6A 4QGBA 2YINC 5EUCA 5JPIA 1VHTA 2E3JA 1Q0UA 3UUFA 3PFKA 4FYHA 4CQJA 1XEXB 1DDIA 4IUCS 1IHDA 3FVRA 3KSRA 3Q3EA 2SKEA 1J21A 4OU5A 4RIEA 3GFGA 3IAXA 4OAQA 4IH4A 1CRPA 3UGJA 1ESZA 2SBTA 3B1FA 1W87A 1CS0A 1NF3A 5AM4A 3DT9A 9LDBA 4PY2A 1XQXA 3BGSA 3QU2A 2C8LA 4I66A 4ODIA 5HA5A 3I3OA 3JAWB 3WJ7A 4HYYA 4HAYA 3ZDDA 2Y93A 3A9VA 4HQFA 3UW3A 1WOYA 2ZBDA 3GMIA 3D4OA 1EUYA 1YK0A 4P93A 2GXUA 1G2PA 1EP2B 5CG1A 1Z18A 4WKOA 4UD2A 4BBAA 5LXTA 5L6LB 3A2LA 4O1MA 4FMDF 1XHEA 2MYNA 4FR2A 3D4LA 4HMOA 2O20A 2RC5A 5AJHA 3B6EA 1LDYA 2QXTA 4J1NA 4Q7JB 5DCYA 3P96A 4JN6B 8ATCA 4FOPA 1P39A 1SBNE 2OBXA 1ZM3A 2ZKLA 1G2QA 3EIHA 4OXIA 3X1DA 4RA6A 4RAOA 4EG1A 2HQRA 2QZJA 1F8YA 4BLVA 4MJ7A 1N6RA 5B58T 1RFGE 2E1RA 4BWGA 1HL7A 1TAQA 3AKCA 4JXXA 4OLHA 4FEAA 3BMQA 1E1LA 4Q37A 4WCFC 4RZHA 2E4WA 4NCNA 3TSAA 3GUZA 3TSWA 1YL5A 1OA0A 3OIYA 3DZ8A 2Q3JA 5DHPA 4NLLA 3VKWA 5J2UA 1RI5A 1L9KA 2IDMA 3DL7A 2WU4A 4RORA 1R6BX 5JT1A 1GUAA 4B3BA 2JH8A 4QDZA 4BMZA 2O8EB 3PCXA 4J6EA 4B40A 2KWIA 3AUFA 2FEXA 2ZYGA 3RF7A 1NQ5A 4GPZA 1Y1PA 1N2JA 1XNJA 1B8OA 1JHQA 1WD7A 1RHRA 5EHQA 1W0KA 4NICA 3FJ1A 4F7DA 5BWNA 2HGZA 4QGHA 2X8LA 4MPRA 1SNYA 3VHXA 1QVVA 4R83A 5ELXA 1ELOA 5LYJB 2GXSA 1ECGA 4TXLA 2OAQ1 1YVRA 3BA6A 3MFYA 3CRRA 3N0TA 1D2MA 1XLTC 3FDFA 2BV3A 4BFCA 3T1TA 4RK5A 3P0IA 1SCDA 1UR5A 2G17A 1R5NA 4HGYA 5CYGA 2H6EA 4JLOA 1U8EA 3M5WA 1S02A 1QIKA 3UMYA 1P5HA 4MWGA 4NC9A 3CEMA 1TYEB 1WBJB 3BMOB 3P4YA 2DWCA 3U4IA 4W7IA 1YI8A 5NULA 2J32A 3VO1A 4KXFB 1A3CA 2BGIA 4YPFA 5KQSA 1P5RA 1PJLA 3IEKA 1AQLA 3NJ4A 1BRTA 3P5BA 1F2DA 3KJHA 2BFFA 1H69A 4S1WA 2NO5A 4BJ1A 4KLRA 2RGNC 3BTOA 4LHVA 3O7MA 4C6RA 2P5TB 4RJIA 3KQQA 3WGKA 3A6DA 3DPIA 3VX4A 2OKGA 1P62B 1INLA 1E96A 4EB6A 3B7WA 3HB1A 1JB1A 4D43A 2Y4OA 2CHQA 2D7CA 2H7XA 3L06A 2P77A 1O6GA 3LYAA 4K28A 5IBRA 1LPSA 1R6AA 2NV0A 1M2KA 2CB0A 2XXBA 2OHOA 3FGPA 1DRKA 2OECA 1ISMA 2YXEA 4JUAA 4D42A 4HGRA 4MPPA 5E2AA 4JI6B 3W78A 1USKA 1HI9A 3MGCA 5CDHA 1OJLA 1TTTA 4O5AA 3I6BA 4J4BA 4XR9A 1QCZA 2W6OA 5AQEA 4MQ6A 1RLUA 1M6YA 2B7BA 1V8BA 2JASA 2BC9A 2D5IA 4HQ0A 4RKYA 4EG3A 3LS2A 3IHTA 2XDQA 1KSHA 3KKLA 5TEWA 1VLVA 1ZGZA 1M74A 2XNHA 4BC0A 4RZIA 1YGPA 3ER6A 4E5KA 3BXOA 1I3NA 4JLDA 4WOPA 4B73A 1NP3A 4ZEMA 1RE1A 2WJIA 1FS4A 3OLQA 5EE0A 2XUQA 5ENZA 2PWBA 1HZZA 3KZKA 4N8DA 1D1QA 2Q8NA 5TDHA 3UG6A 1M1YB 4FN4A 1FMLA 2FZVA 2F3UA 2AWNA 3AHJA 1RJFA 4CEIA 2PGDA 3SYRA 3VBCA 3KQPA 1PL6A 3U3ZA 4RD3A 2FEPA 3DVAA 4EK9A 3AKZA 1S2NA 2GM5A 5HF8A 2SICE 3RV3A 5T7BA 4M1YA 3WWCA 4YQZA 4AY5A 9MHTA 3BK1A 4MJ3A 2XJ4A 3DV0B 3Q6MA 2ERYA 1B1CA 3IPYA 4MPDA 3N2KB 3CLKA 3P9ZA 2AF4C 1W2WB 1BA3A 3HJHA 4EPVA 3LGSA 4NJOA 3WNZA 4W7SA 5H83A 1JIJA 1WUKS 1E5XA 5I4KA 1XPOA 3RRMA 2P1RA 3OPVA 4RLFA 5IM4F 3AVPA 4IYJA 3VV3A 3FTNA 4CL3A 2XUIA 1I1OA 4OI2A 2VAWA 2RHHA 5DCUA 2GAAA 3AIIA 3QPCA 3RKSA 1WS6A 3QF4A 3CXRA 3K3PA 5KYKA 4LF9B 4WFIA 3ZV5A 2ZAOA 4L6AA 4PE5B 2ZBGA 4XQGA 4LSZA 4RGYA 3AUUA 3B2EA 4MTCA 2JHCA 4PIPA 3C4JA 3PSAA 2RG7A 3CE6A 3BIWA 1U2QA 2OK8A 3G2PA 3N2ZB 4TRRA 4DW8A 2AFIB 3FYUC 2O4UX 1TPZA 2QTGA 3NH6A 1SOWA 2Z04A 1Y6RA 3KWLA 3R5XA 3P20A 3TFWA 4CNBA 1PJRA 2VP5A 1OT5A 1RAIA 3I2YX 4AJIA 4B31A 3RJ9A 4GKVA 1W88B 4LS3A 4TKUB 1AGXA 3VO2A 3NH9A 4EY4A 4C03A 3B36A 4GMHA 2EEPA 4M88A 2FAXA 1O4VA 2P78A 5EYPB 1K7FB 4TMFA 3LI2A 4AIIA 2X0IA 3DVSX 4O33A 5L3ZA 1ZIXA 4L8VA 4II2A 3TZ6A 2AI3A 3LNCA 2WWTA 4QX6A 3FCAA 4ZEWA 5ES4B 4RD2A 4DSOA 3IUYA 2V5AA 3OLXA 2REOA 2C29D 2FPGB 3QVLA 4BQNA 2HRDA 2OWDA 1LPOA 1ZN8A 2ZI6A 3IAHA 3I9LA 2M6SA 3R7LA 4B83A 5C1OA 1HLGA 5I7FA 1QG2A 3QEAZ 2BTQB 3TRHA 2FPWA 1VJGA 4ZT5A 2PKYX 2XSZA 3VR2D 4C01A 4QEZA 1QH8B 5EKXA 3OSUA 1G21B 2RHJA 4Z2YA 3WGGA 2WWGA 5EXDA 2Z2XA 1RBMA 1DAIA 2ONJA 1FLVA 5I48A 1Z15A 3L79A 1OH7A 3G23A 4XWAA 3Q1KA 4FBGA 1GTVA 3KTAB 1TA9A 3N39C 3R7BA 2I6GA 4HGZA 4KQIA 3UMJA 4C6TA 1OE0A 1F2UB 1SRRA 1N8NA 1WM1A 3FOCA 3G02A 1AK2A 3S8EA 3T1YB 1IL0A 5F7XA 4NJEB 1NQTA 1R6TA 2I65A 4YJDA 1TU4A 3UJDA 4YJ3F 3PJEA 3G9QA 2CB9A 3B13B 3IVRA 3WGZA 3BGVA 4XTCS 4L08A 5BMOA 3IKVA 1Q2UA 4HUQA 2C0PA 2VHJA 4ON9A 3RVKA 3QKRA 3OJOA 4RVFA 3T7AA 3KELA 1K66A 3BGOS 5JUWA 3KHSA 2PMDA 4FWIB 1DBIA 5E6UB 1NN0A 2R6CA 3DCYA 4B8WA 5I4CA 4IIBA 4EMTA 3PFWO 2PD3A 3ILSA 1VTKA 2JH9A 4Y2RA 2HI0A 4G26A 4BQFA 3CBGA 1O94A 3PGLA 4DUGA 3LA6A 2C7BA 3GCDA 3MMXA 4DA7A 3O4VA 3UPTA 4WXEA 1QX3A 4EZBA 1Z28A 3VNQA 2WG2A 3KRTA 3NJ8A 4KNYA 1AH2A 5J4YA 4TVSA 1Q1ZA 2X6TA 4PNPA 5COAA 4LCJA 2I6FA 1S3SA 3HSYA 2VJNA 2OT3B 3THRA 3V32A 2OXRA 4KBYA 2P2NA 4H1HA 2ZBVA 2ZYSA 3OTOB 2V7XA 2Y99A 3NATA 4YJ2B 5EN4A 3ORHA 1QHHB 5DM1A 1NVEA 2DU8A 3I9V6 3SR0A 4DBVO 2B7LA 1FFCA 4FEEA 2JW5A 1F12A 4RTJA 1M1XB 4X6UA 1Z35A 3T8YA 3VPBA 3W3AH 3CLSD 2EBWA 2BKAA 2QXYA 4EHBA 2VUTA 2GHRA 4GPIB 3A06A 3TOZA 3ESCA 1RJWA 3DSRA 2I1WA 4AKEA 5JYDA 1XKLA 3AHIA 4W6QA 5H1YA 1ORDA 2BFWA 5BNTA 4ZREA 4LNAA 3QXGA 5IJ0B 1GN8A 2O2SA 4FW8A 3L9WA 2QEQA 3QE0A 2C58A 1CY1A 1DBQA 4WLFA 5JYCA 4P3OA 3ZY6A 4Q9AA 2Q27A 4NATA 3IQFA 4YRGA 3IHLA 5B4VA 1QS0B 4JUBA 1WG8A 1Z5WA 5FL3A 1AF4A 1DJLA 1NVXQ 1KFEB 4BO8A 3ECCA 1SULA 1SHJA 3O8OA 2ZSAA 3FOBA 4LDJA 4UXJA 2JGRA 2NIPA 3NYWA 3C1UA 2F8MA 1MFPA 1UMCA 3UAZA 1GZ4A 2IUUA 4N7RA 4QC2A 2A9VA 1GPMA 3ABSB 2EX4A 1FVXA 4RFLA 3CR7A 5CFZA 4LQCA 2ECPA 3DNPA 4G84A 1FYFA 1XR3A 3GDOA 2ETVA 5EOVA 1VP3A 5JWHA 4ZT4A 4UBMA 5LLTA 2G9ZA 4C4ZA 5I7WA 1B1AA 1YBAA 4IH9A 1HDYA 2FUNB 2QUHA 4LZWA 1XEFA 3GEEA 2P8SA 4FFDA 2V7PA 2D0IA 2WUWE 5YASA 3PTZA 2DQYA 1C50A 2V3WA 4BFXA 5B6IA 3OTWA 5CDTA 1FFYA 3F6PA 3BPSA 3M9LA 3O1HB 4ZVSA 1X1TA 1BE6A 4BO3A 5HSGA 1E64A 2EV9A 3E2PA 4KMSA 1E0JA 4KNVA 1EQ2A 3CX7A 4QJ5A 4TV9F 2HMVA 3OJFA 2OUIA 5FLKA 3A6PC 4N0DA 2R5NA 1NTOA 4JBNA 1CNFA 1NW9B 1O96A 1UJCA 2VL7A 5DMHA 5FCDA 4ZXFA 5HIKA 3OT4A 2EU8A 1LTKA 4IIFA 3P52A 1P44A 1UDWA 3FPEA 2GWRA 1J7JA 4KQXA 2IPOA 3LT1A 1COZA 2NVUA 3R8XA 2VQSA 3HWWA 1I13A 4IVQA 2QAGA 2O3TA 3S99A 3CS3A 4M37A 2BGRA 3C6ZA 3ZW7A 1PSZA 4LC1A 3RSLA 4OSEA 5EE9A 5JDCA 1CZNA 4IOJA 3WS7A 4JKIA 4B8ZA 3CRW1 2IBTA 4W8OA 5T4FA 4YUZA 2O0HA 3QVGB 3SEQA 4IS3A 5FWXB 4LW8A 1Z6AA 3MJTA 4GR4A 3HV2A 3HUDA 3D3EA 1RACA 4PG6A 1IBKB 3L6OO 3KL2A 4HWGA 3M4JA 2OCAA 2Z6VA 1QP7A 721PA 4B4DA 5JQGA 1V7CA 1FW8A 4I5IA 1NZJA 1E94E 1FNCA 5SV2A 2JCGA 3GFBA 4FFVA 1BHJA 4HVLA 2YJ5A 4N9WA 3VRHA 5BURA 4G0ZA 4UM9D 3KEGA 3K2QA 6REQB 1WRBA 3JPYA 1U63A 1KJWA 5BXYA 2R65A 1Z3CA 2CLIB 4RE5A 3TXXA 4XE5A 4CTJA 4CKEA 1CUXA 5AOBA 4E3ZA 2GCOB 4BNUA 1G1AA 1OA1A 1I36A 1VGQA 2HWXA 2I7TA 1Y1LA 3M6XA 4FT4A 4NABA 4J6FA 5LBTA 1NW3A 5DP2A 1L7XA 5JS2A 3ZNQA 4PNHA 2YTZA 1KEWA 1KIFA 2DFNA 2GAOA 1ZISA 2WM9B 2XGOA 5K03A 2D5BA 1C9YA 3BWVA 5EJAA 4DKJA 2ZVQX 2X22A 5L7WA 2HJVA 2FG6C 5JRZA 4X84A 2GTPA 1YD7A 3RKRA 1N8KA 3HB0A 4EO4A 4D8WA 3JQFC 5HBRA 1OASA 2BBWA 1NAHA 1RXYA 2WV7A 4EUFA 3TBHA 3C1AA 1V96A 1ZRHA 4AY4A 1T35A 1ZJ4A 4LAFA 1ULZA 3EIOA 2NQ2C 2HSJA 1C0LA 1X77A 1P6XA 2FQYA 4BE4A 1HSZA 1A9YA 2YFYA 1DL5A 3MM4A 4IUBS 2UZ4A 3D3WB 1NJ2A 1T9AA 1QCYA 4EB8A 2WYUA 3TRFA 3KOMA 3G2HA 3ONNA 1MNAA 3THXA 2VHYA 4XM2A 3N05A 3VR6D 5FEMA 3NBAA 1G9XA 1QYDA 4MQ4A 4JR1A 4L76A 2P3OA 1HLDA 3I4CA 1AV6A 1E3DA 1VJ5A 1VG9B 2J6HA 4YRCA 4X9XA 1DBSA 4HAWA 2L69A 4EJFA 4FBLA 1ZAKA 2CMFA 3MMZA 1JA0A 3QTLA 3ZZ0A 4BAUA 4OGKA 1DBWA 2BD0A 2GJSA 1DO0A 3OPXA 2VPWA 3HDHA 1X7WB 2Q6LA 3HCEA 4KAJA 4ZOBA 4OXQA 1JEAA 3W9YA 3SVLA 1JWLA 3QMVA 5A6SA 1TYCA 3GGJA 4MEJA 1H4TA 3DB2A 1NG1A 3NRCA 2ZU0C 4M49A 4BFTA 2G1KA 1PBTA 2P27A 3UGQA 3ANMA 3MA0A 5E9AA 1M2VB 2VQ6A 1NWCA 3CX6A 4S1NA 5CVVA 4CMGA 1G38A 3NANA 1I4DD 2WKQA 4LVCA 2AQKA 1J8YF 4EHHA 1I2BA 3M6VA 4COKA 2WSBA 4CCYB 5ITVA 3PC8C 1V8ZA 1FJXA 5AVWA 4D74A 2FEKA 2F1JA 5EQJB 1X86B 3DTVB 5DTJA 4EHAA 5JZSA 3O8CA 1QRUA 4ER0A 2OZKA 3WBFA 3KQKA 1XYGA 5TNXA 3VKHA 2O2HA 4I50F 4LBWA 4FILA 4EA6A 3LYUA 4WA7A 2AV6A 3KXIA 2ZTLA 1FNMA 2IEBA 4QUHA 4ND5A 4G0OA 1HDZA 1DCMA 2OC4A 3NV7A 1IOWA 2A9OA 1GL7A 3M34A 1KXZA 2MMCA 3BWEA 4V3BA 3N8DA 1NUSA 2HMYB 1P72A 2BEWB 4PZUA 4WVLA 5KKAA 4Y6SA 1T43A 3TPCA 4DV3B 3AB8A 1MO6A 4CHTA 1AZLA 1TUBA 5LMCA 3VPSA 3OO1A 5HM6A 2HUPA 1GN9A 2OHFA 3E3OA 1UBJS 1W46A 3OPYB 3EPJA 4PU0A 3QSGA 1QFMA 1EBFA 1X8LA 4MVJI 3ITEA 5DGIA 4QO8A 2MCFA 3BWBA 3BSFA 1D07A 1P7CA 4IWYA 4MWZA 4F4JA 3ZD7A 1R8QA 3T7EA 1A1VA 5KB3A 5A4MS 5L4LA 4XJTA 3W34A 2M98A 3L8YA 3VR2A 1E6MA 1FX1A 1KKUA 1CC1S 3FTFA 2AK3A 1YZGA 3HYSA 1GA6A 1GRNA 1JJBA 3TM4A 5ADVA 1DEXA 1JU3A 1Q6YA 2PRYA 2XWJI 4MKHA 4CCAA 2PKCA 3LPMA 3NHMA 4GZLA 4LY3A 4EDFA 4RJTA 4NQRA 4I55F 5FB3A 2F4VB 3LPDA 2BFOA 1ONPA 5FPPA 1Q20A 3FBGA 2DM6A 4Y2VA 5SY9A 4BMNA 4G0MA 1XE3A 3F2VA 4O5OA 1AK9A 2WE7A 4ZAZA 2PCLA 4Z2AA 1ISRA 1E58A 1DC4A 5LDHA 4RF3A 4EKEA 2NUPB 4X61A 2AYXA 5IJXA 2J5RA 1X8JA