3HFGA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an sulfonyl-piperazine inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hfgA00
1MGOA 1PS9A 3PJGA 1LUAA 3NDRA 3FWZA 3CMMA 3PIIA 4PLVA 1IB6A 4B4UA 3PZRA 4RVHA 1QLHA 3F5QA 3GLQA 3ZWCA 1RYDA 1ORRA 2Y93A 4A7PA 4YR9A 1WDLA 3U0BA 1JA9A 2NTVA 1GYQA 3FWNA 2RHRA 3T4EA 4RGBA 4MVJG 3DHYA 3OIGA 1PX0A 5DOVA 4ALJA 4YRDA 1X7GA 1XDWA 2C07A 3OECA 4G5HA 5COQA 5JW6A 1R0SA 4GMFA 3MCVA 4CMHA 1B0AA 3VAZA 2Q46A 3ZHXA 2WE8A 1B2LA 3COSA 4B7XA 2FMUA 5T57A 5IXSA 2Q49A 4DLAA 2ZTVA 1CDOA 2FZWA 4XQCA 3KEOA 1U3VA 4CV0A 3HFGA 3LVFO 4M89A 2NVWA 4YJDA 1C1DA 4JBGA 1NPTO 1ZVMA 4WCDA 2HK9A 1LRJA 1F8GA 1LSSA 1LSUA 1U3TA 3DZHA 3GUCA 4FJ1A 3UKOA 4BO9A 5COAA 1XWFA 4DBZA 1G0NA 1R16A 4PG5A 5EQDA 1H9BA 4IXTA 4I8XA 1ZBQA 5HWSA 2VHXA 3NKLA 1KY5A 4XIJA 1XCBA 3JCZA 1HWYA 4CM8A 5TJ9A 2O3QA 4CQLB 5BSEA 3A9WA 4GSLA 2CVQA 1SAYA 3SJUA 4B8WA 3S2GA 3Q3CA 2ZB3A 1HYEA 3FNEA 1B3BA 3JYOA 4ZQEA 1FJHA 1KC1A 4IINA 4LCEA 1MFZA 3TN7A 2YQ5A 2BKAA 1HZJA 4QXMA 4NJOA 4I5EA 4WCFA 4MIEA 3ZV5A 3JQ9C 2PH3A 3H8VA 5IXYA 4FSHA 3W4JA 1VL8A 1YOVA 2P4QA 5G4KA 3FF4A 3WNQA 3K5PA 2NVUA 1Q0QA 3E82A 3ICPA 5H83A 5EINA 4QFCA 4GBJA 5JMPA 4BL5A 1EE9A 4RPGA 5GZ3A 3AY6A 4RF4A 1K5HA 4KUEA 2A9FA 4L75A 3W6UA 2RH4A 2AEJA 3RWBA 2AE1A 1C1XA 2YQ4A 1NX6A 2PY6A 3JQAA 1BG6A 2FHSA 1Y5MA 4CM1A 4J1SA 1Z75A 4L73A 4NIMA 2JHGA 2DT5A 4FFMA 3EC7A 3TSCA 4TMFA 4XYBA 2B0JA 3JQAD 3U62A 3WQRA 4JBHA 3ZWOA 3VDRA 3IC5A 3K30A 4WE3A 3HWRA 1ML3A 3GNSA 4L9RA 5KWEA 1IHXA 1ZSNA 3GZNA 3Q9UA 1ISIA 4XR4A 4YT4A 2UUPA 4M8SA 5CDTA 1P77A 4DPLA 3VH3A 3IS3A 4A73A 1U3UA 2EG9A 5GZ1A 3WNVA 3M2TA 5JO0A 2C20A 3DB2A 2C7GA 2B4TO 4YQYA 1Q7BA 1MC4A 3H3JA 4GPD1 1V3UA 3GT0A 3HJAA 3CZMA 5CG1A 1P1KA 3TZHA 4GMGA 1D1TA 1U8FO 1XGKA 2X23A 4ITUA 4N18A 3E5MA 2PGDA 4B7CA 1I5RA 3C7CB 3NDJA 5C7OO 3P19A 4G81A 1I30A 1NPYA 3AM5A 4WK6A 1HF3A 2JCYA 1E1KA 3UVEA 1FDUA 4J2HA 3JV7A 1DO8A 5EESA 3KLMX 1PJQA 3B6ZA 3F5SA 5A03A 4C4OA 2X0RA 1YJQA 3ZGYA 2E49A 4J2OA 3OFSA 4L74A 1QV6A 4PVDA 3QHAA 4CM4A 3E9MA 4W99A 3ZI0A 2IYPA 1UDCA 2BF7A 2VTEA 4XB1A 5KJCA 4Y67A 4P4NA 4KWHA 1G1AA 3LYLA 1VE9A 2VNAA 2ZJ1A 3RUEA 1PGPA 1JDJA 3ANNA 1E3JA 3QVOA 1FDSA 3KYDA 4YA6A 3GUYA 1XU9A 3TZCA 5TS3A 3O9ZA 3TDKA 4I9UA 6LDHA 1D3AA 5G0TA 4BB5A 4XD2A 4J9VA 1ZH8A 2W2KB 4M54A 3KHUA 4B4WA 2EIHA 3BTSA 1MA0A 3FTPA 1LDEA 2AQIA 5A1TA 5C37A 2YHIB 1TT5A 3WBFA 3GZ4A 3P2OA 5JFOA 1D1SA 4XYGA 4MIYA 4UUPA 3H9GA 1LXCA 2VWGA 3V2UA 3GFGA 1HEUA 2OP0A 1W4ZA 3MJCA 1PZFA 4TVBA 5MDHA 3GF4A 2GN6A 2OZPA 1UP4A 2Y1OA 3D5TA 3KETA 2HKIA 1I3MA 3GGPA 2I9PA 5CPBA 5I7SA 1U2GA 1ADBA 5G0SA 4XCVA 3R3JA 3NT4A 1A7AA 1F14A 4JQCA 1B3RA 2XPCA 4N5LA 3F1LA 5TRTA 2H6EA 1UH5A 4HFRA 5IDYA 4QO7A 3JQDA 1J0XO 3F6YA 3VZPA 1AXGA 1SEPA 3BMOA 4JK3A 4CQMB 2X7HA 3NTQA 2FPGA 2NNLD 4O63O 4FN4A 4OO3A 5IZCC 4BO8A 3DMTA 2J5RA 1Q0HA 1UXGA 4JGBA 2OBYA 1P1FA 1IL0A 1KOLA 3I9OA 1R4MA 3G17A 4D79A 1EFLA 1LC3A 3Q1LA 1WMBA 1MG5A 2F1KA 3BTOA 4IZHA 2EF1A 4WNCA 3ROPA 3UOGA 3OJFA 2PFGA 3VPSA 1I01A 2YDYA 2HK7A 3KRTA 1H2HA 2EJWA 2GDZA 3KSDO 4AJEA 3F3SA 2O3UA 4CMEA 1LTHR 3KSUA 3WMWA 1NHWA 2EERA 3AOEA 4YACA 3EK2A 3AUTA 3DC2A 4TZKA 5AVOA 5BQFA 1UJMA 5BSGA 1K3TA 2CF6A 5BT9A 3PGXA 1BW9B 2QHXA 5KVSA 1BXKA 2HLPA 5A5FA 4NFYA 2Q4EA 3CMCO 5JO9A 4RDIA 3IL2A 1IOLA 1SPXA 4R3WA 3SBOA 4DQVA 4B3JA 5IN4A 1CJCA 3HN7A 1CERA 1JQBA 1DEHA 2GRAA 3ZU3A 4BO0A 4NU5A 4HFJA 1JKFA 3INTA 3NAQA 2O2YA 3OHSX 4CL3A 3ZNNA 1G0OA 3FTNA 4I5DA 4L8VA 4PCVA 4ROSA 5A06A 5JS6A 1E0DA 5GMOA 5T6BA 3I9NA 1VM6A 4IJUA 3PZBA 3MJSA 1P1IA 1VL6A 1PGJA 2IZZA 4NR0A 1U8XX 1DRUA 3SJ7A 3PWSA 1AXEA 4OAQA 2RAFA 3CTMA 1ISFA 2WYWA 4CLRB 3AU9A 3AY3A 4R54A 5CP8A 3PYLA 4W7IA 3LDHA 1YBAA 3KO8A 3NUGA 5EPOA 4GGPA 1RJWA 2UVDA 1UP7A 4E0BA 3LZ6A 5EMHA 1ZFNA 2C29D 1DHTA 2HMUA 4JROA 3T7EA 1P45A 1L7EA 3I6QA 2V6MA 4U6QA 1JKJA 3GY0A 1N8KA 4KZPA 5DT9A 5EERA 1ZZEA 2IDZA 3PI7A 2Q1UA 2GSDA 5H82A 5IJZA 5TNXA 5B12A 4J91A 4JP2A 4OMUA 1ISJA 4R69A 2VRCA 2X0IA 4Y9DA 1CETA 1ZCJA 3MWDB 3NEPX 4QT0A 4IDBA 4OQZA 5JY1A 2EKPA 1OZAA 4AJHA 3ASUA 2HQ1A 3OICA 2BHLA 5HBRA 2PR2A 2DFDA 4J4BA 1PU2A 2VRCD 3CE6A 3ROKA 4K28A 2XAAA 4UAGA 1JTVA 2GZ1A 2B5WA 3E1KA 1U3WA 3C1TA 1MXFA 4KMSA 4FR5A 3I5MA 1GZ3A 3DZKA 3HADA 4RPLA 1F0YA 5TLSA 1VPDA 1E7YA 1SBYA 3I4FA 2QRKA 4WLFA 4BKOA 1I33A 3S8MA 2FP4A 2XF8A 3PJDA 4JCOA 1ZK1A 4L76A 2GYYA 4DQXA 7ADHA 4OOFA 2Y0DA 5IDWA 5K0ZA 3OSUA 3ZWNA 4ALKA 3TPCA 4BVAA 3DO5A 2ZTLA 4CM6A 1N5DA 5THQA 2Q1TA 3H3FA 2ZCVA 1BMDA 2BH9A 1EUCA 4XRRA 2EV9A 1O5IA 4DVJA 3QJ5A 1CYDA 5L7TA 2E4AA 2BRUA 1YWGO 4KQXA 4CMIB 5JMWA 4RQTA 2DLDA 5L53A 1NQOA 2BMAA 4O6VA 2B37A 5L95A 1JKIA 4IDFA 3Q2KA 1GUZA 5EQFA 5GY7A 2C54A 2PZMA 2P5UA 3BYZA 5JCJA 2WWRA 3QVTA 4FFLA 3PQDA 1LLCA 2PKQP 3ZWWA 1NYTA 2ZIZA 3VC7A 1O95A 2O3RA 3ENNA 4R16A 5JCJD 2HMSA 5CDSA 3R1IA 2FSSA 3CINA 3Q0EA 4BHTA 3LT0A 2FR0A 1QYWA 3HDQA 1AN9A 3L4BC 3GHHA 4H7PA 3B1JA 3PHGA 3RC2A 3JQGB 3GRPA 2EKLA 3ZWYA 4GKVA 1VKOA 2PGLA 3I23A 1S7CA 4J1QA 4PLZA 5FI5A 2DBRA 3MEQA 3VVBA 1LDGA 2QG4A 2VHYA 1UZMA 2NVBA 3G1TA 2OBNA 4ZQFA 1E6EA 3I52A 1FDTA 1Y1PA 2AQKA 2JKVA 5DOZA 3I9KA 1SNYA 2HDHA 3C24A 1Q7CA 4BNUA 3IUPA 3AFNA 3Q9NA 1E5QA 1FDWA 4J1TA 1X0VA 4K6FA 4XZ3A 1LA2A 3DZJA 4OXKA 4XWYA 1N9GA 2HUNA 3QWHA 2O3TA 4BKQA 1B26A 1AHIA 4A10A 1I32A 4WEOA 2CVZA 4XGIA 3F9IA 1A71A 2DVMA 4D3SA 2X5KO 1ZK0A 5CHEA 3JQBA 4ZQGA 4Z6KA 2B35A 1QKIA 2VHZA 1H94A 3JTMA 3OA0A 4LISA 2R6JA 5G0VA 1V3TA 2GO1A 1PQPA 3NT2A 2HRZA 6ADHA 1ZW1A 3AY7A 1LRLA 3EAGA 5U1PA 1PGQA 3ICCA 4UUNA 3EVTA 4UEOA 1V35A 4XYMA 4Q3EA 2AHRA 2X5OA 1DFHA 4Z0PA 5ER9A 4TRRA 1VJTA 4E5PA 3MJVA 2D3TA 5CEEA 1LDBA 4CMCA 2UAGA 3KVOA 4Q3NA 4D43A 1G6KA 1DJQA 3EY4A 1ZUD1 1VI2A 4W82A 4Y8VA 5CG2A 4BNFA 1DLJA 3OMLA 3D4OA 2CDAA 2CVOA 2HAEA 1A4IA 3KM0A 3H4VA 4FFRA 4O59O 4WUVA 5TT1A 3UUWA 1ZSYA 2X9GA 3OF2A 4HNGA 4RO0A 3BHMA 4AJ2A 4MVJP 3RUAA 1C0PA 2O4UX 4E3ZA 1YRLA 1KEPA 3R0IA 4AJNA 4H15A 2HJSA 2G82A 2NACA 4BNXA 2AEFA 1F12A 2C0CA 2WD7B 4EJMA 4J9UE 1CQJA 5K6AA 3L6OO 1JW9B 4TRNA 1KS9A 1K89A 3K2BA 4TWRA 1NBOA 1TT7A 1YH3A 4D7AA 4GLOA 1IPEA 1DJNA 2CZCA 2PD6A 2W2KA 4YJHA 1J6UA 3WGQA 3ANMA 3STHA 4KDEA 3B20A 4GGOA 4HUJA 3CPSA 3ITDA 2GCGA 1E3WB 3E9QA 3QLJA 3TJRA 1RYEA 2W8ZA 3D0OA 2FN7A 4URFA 3VKUA 2Q50A 1YB1A 3PLNA 1ONOA 2ZATA 2BD0A 4RVUA 1GYPA 2BI8A 4IMPA 1H5QA 5K9ZA 4UVEA 5GZ6A 3W8DA 1BXGB 1J49A 3EUWA 4Y6RA 2P68A 5KVVA 1ONPA 3LK7A 3AU8A 3C8MA 3DONA 4HXYA 5C7IO 1PJ2A 5COBA 4YBZA 1GUFA 4L4RA 3ONFA 1TEHA 2PH5A 3WSWA 4Z9FA 5L45A 1PGNA 3S55A 4UVIA 5KJ1A 3O03A 3V2GA 4UUMA 4CR6A 1Y9AA 1PJ4A 2BFOA 2OOSA 4FPXA 4NBVA 2R00A 3TRIA 1GPDG 4CLOB 3VPFA 4WLNA 4F45A 3B1FA 4NNJA 4FDAA 4B7UA 1LNQA 3OA2A 5F1PA 3PLRA 4P8RA 5FF9A 5HA5A 2OHXA 1PJSA 4OSOA 1HT0A 3D1LA 1GR0A 3ETDA 4GX0A 1EBUA 1DBVO 3RD5A 1PSDA 3TFOA 2A92A 1DC5A 1Y8RB 2DBQA 4IJWA 2VRBA 2IODA 4NK5A 3E03A 1KYQA 3JQ7A 5TX7A 4CR7A 9LDBA 2V65A 1GFSA 2D5CA 5HTOA 4HY3A 1N1GA 5ADHA 2V6BA 3DHEA 2I67A 3QVWA 5JDIA 5JBIA 3PJFA 2I65A 2O50A 4MP3A 3PYXA 1J4AA 4XDZA 2P4HX 3FHLA 4O1MA 1I2BA 2EGHA 2ZQYA 3PRJA 3K2EA 2J8ZA 3AI3A 4Q3AA 4BNIA 4CM7A 1Q2XA 4RVFA 5IG2A 3PHLA 1PWZA 4J7CA 3D4NA 1DRWA 3DL2A 2WEKA 4EEZA 4YAEA 1KVRA 3INGA 4BO7A 5ITWA 4FOSA 5I9MA 4HFMA 3NTOA 3C7AA 3ZNOA 4AG3A 3BHJA 4XQEA 1ID1A 3LC1O 3WG9A 2H9IA 4JX8A 4P4GA 2QZZA 4BNWA 1QYXA 2JL1A 3O26A 1UDAA 2VYVA 2IXAA 4LVCA 4IQGA 1DOHA 3KYBA 2DU8A 3NT5A 5ILGA 1VJ1A 4GQAA 3BMNB 3JQFC 2PLAA 4ZN6A 2HJRA 2FR1A 4R4JA 5LC1A 3WFIA 3D7LA 3K9QO 4BNHA 3WGZA 4RJTA 2VYVD 4XGKA 4U8GA 5T8KA 1IY8A 3WYCA 4CL8A 1QRRA 1WPQA 3FNGA 1HZZA 3F47A 4Z0HO 5AXDA 2AEMA 2GASA 2BI7A 4XA8A 5T64A 4RCVA 3PWZA 3ST7A 3N7UA 4LSMA 1HDGO 3L9XA 2B69A 1Q7GA 3PP8A 4R41A 2DUWA 3DOOA 1OI7A 1HYGA 3ORFA 4INAA 4KTVE 3DDNA 1OFGA 1ISMA 3K92A 3OM9A 1I2CA 4RQUA 3GNTA 3SC6A 4BGIA 2FPPA 4UUOA 2AQ8A 1JWBB 4AJJA 3G0OA 1AHHA 4KTTE 4LW8A 5F21A 2JAHA 4BB6A 1NWHA 1M6HA 3D3WB 4GLLA 1GCUA 4U7WA 2JFGA 2D0IA 4OJNA 1YJ8A 1EK6A 1ZSVA 4K6CA 1W8DA 3ZZNA 3SLGA 3L6DA 3SC4A 3DAPA 5JNLA 4E5NA 4IXWA 5CDUA 1SCUA 4KUGA 1UDBA 4ZICA 4AJ1A 4R1UA 1CWUA 1QYDA 4MVJH 5BSFA 1XIVA 3H65A 1PL7A 5LDHA 3OJ0A 4E2WA 3PPIA 1VL0A 4YAGA 1Z82A 3ZV6A 4BUCA 3H9UA 4GAEA 1DC6A 1IUKA 3CXRA 4AICA 4OGWA 3DTYA 3WXBA 4G2NA 3EVNA 4JP3A 3WS7A 1QLJA 4Y98A 3C1AA 4LRSB 3IP3A 3WWYA 3RASA 3GGOA 2HSDA 2LDXA 3DZBA 3OP4A 4CJXA 3U5TA 4CM9A 1HDZA 1HYHA 2O23A 3UFXA 4WNIA 3WTCA 1UUFA 1XHLA 1QYCA 4YJFB 3ZU5A 3F4LA 4CM9D 4OIMA 4E2ZA 2YJZA 5DN9A 1T2EA 3U4CA 2EGGA 3D3EA 4J0FA 2NQ8A 3QWBA 1GQYA 1MP0A 1U5CA 1WDMA 4M55A 3TFQA 2O3JA 1Y6JA 3W1VA 1P1HA 2X5JO 4F6LA 1QYVA 2NSDA 3GPIA 4EW6A 2NQTA 4AJPA 2JCXA 3FPLA 3OIDA 2NU8A 1I0ZA 2CSUA 2YV1A 1PS0A 3INRA 1PIWA 5JYDA 1QMGA 1SMKA 1R4NB 2PGJA 3W8EA 3I6IA 1NFFA 4LSWA 5KIAA 3MJ4A 1LRKA 1R15A 3OJOA 1EDZA 3MJTA 3ETEA 3RBXA 2GR9A 1ADGA 1DFIA 3OH8A 3ZWBA 2NM0A 3ONEA 3DXFA 3RU7A 1T26A 4DTIA 1LQUA 1LC0A 3H9QA 4XGNA 4PLYA 1ZXBA 4H3VA 4D44A 1I2ZA 1QORA 3DBRB 2DTDA 4RDHA 1E3LA 1WW8A 2C5AA 3O38A 4IMRA 5FYDA 3KB6A 2WSBA 3CKYA 2A4KA 2B36A 1YDWA 3KYCA 4J7UA 4ALIA 3RKUA 1SOWA 2J3HA 4NH4A 4RLHA 2JAPA 4UULA 2ZTMA 4MP8A 3RUIA 1B8VA 1DC3A 4B3IA 3HDHA 4IM7A 1L1FA 3FSRA 1R37A 2FZEA 3BMQB 3EMKA 4LMRA 4W9NA 4QTZA 1O94A 2PTGA 1GADO 3GA0A 4U0KA 1EQ2A 1LU9A 4N54A 4BKUA 3BMCA 1BSVA 3CSDA 4FFPA 1U1IA 3PJEA 4BIIA 4N7RA 3U4HA 4CLDA 4II3A 2EW2A 5EJ2A 4J4HA 4DQUA 2FY8A 2X9VA 5A05A 4A03A 1YB5A 1E1LA 4IDCA 3KTDA 4CV1A 3DOCA 4FS3A 4YJGB 1XR3A 3FN4A 4BNJA 2PA3A 1JVSA 2PD4A 4TSKA 5JDCC 1E7RA 1PJCA 2I3AA 3O8QA 2FRDA 1UAGA 4R1SA 3GNQA 3I1JA 4NFHA 3GVCA 1IPFA 2P9CA 3IJPA 5IAAA 4TKMA 1WXDA 1YQDA 1GL3A 3WYBA 1BGVA 3ZW9A 4ND1A 2D1YA 4NHEA 3ADOA 3WLFA 2HK8A 2VZ0A 2J5QA 3WJAA 4XEHA 2BGLA 4J90A 1E6WA 3C3XA 5F1OA 5LDGA 1OBFO 4IDDA 1FXSA 4NMHA 4ZU3A 3EZLA 1JLLA 1W73A 1SO8A 1LLUA 2A35A 2WD7A 3KLPX 1GDHA 3GDFA 1MX3A 4E12A 3M6IA 1DIAA 2ZK7A 2FPIA 1MUUA 3AFMA 4NFSA 3UF0A 4D3FA 3FI9A 2GNAA 3WIDA 4BOYA 3TOZA 1NHGA 3O4RA 1P0CA 3RBVA 4RV9A 3SVTA 2QZ9A 3A14A 4YB8A 3RUDA 2W4QA 3MWEB 1Q1NA 1E3WA 1E7MA 3VTFA 4RL6A 2Y1CA 5IFLA 2EEZA 1DHRA 2J5KA 4FC6A 1PJTA 3ZWVA 3P5SA 1I36A 3DBHA 3ZV3A 4S1VA 4D41A 4FJ2A 3GAZA 1R12A 3ZNQA 2AG5A 1EBFA 2SCUA 4U5QA 4NJMB 3OBBA 3UH1A 1H0KA 3QY9A 4L4XA 4OKNA 4IPTA 1ZK3A 5BR7A 1MB4A 1E1MA 1PL6A 1HDOA 2QYTA 1QP8A 4I9HA 1Z74A 1WZEA 2JJYA 1D4FA 4M1QA 1TXGA 1UXHA 2O48X 2YYYA 2HMVA 3AM4A 4CLHA 3BXXA 2TMGA 3PGJA 1Y8QA 4ZRNA 1OC4A 4KOAA 4K9DA 5JC1A 1IZ0A 4R9SA 2JD2A 3K31A 4I5FA 4N5NA 4RORA 4PLPA 1JWAB 4MDHA 2J3IA 2D4AA 3ZNPA 1LDNA 3Q6IA 1ENZA 1GZ4A 1ZJYA 1EVYA 5C7LO 5BNFA 1B14A 3JYLA 2E6UX 5JY6A 2ILTA 2GPTA 5B4VA 2ZJ0A 3IQDB 5DF1A 4MKZA 3LC7O 4CMJA 2VN8A 3AI1A 1W6UA 4GH5A 2QRLA 2LDBA 4YRBA 2XOXA 1O6ZA 3KSZO 4RPHA 1MC5A 1KIFA 4XKJA 4FIZA 2UUOA 3JQ8A 1VJ0A 4PIVA 8ADHA 1H6DA 4K1LA 4YAIA 2QRJA 1KEWA 1HL3A 1HSOA 2P9EA 2VHWA 1ZO8A 4UVHA 4D46A 1EFKA 2DAPA 1ENOA 4YXFA 1T4DA 2WYUA 3L07A 1C3VA 2B4RO 2EWMA 4WCFC 2C5EA 4BO6A 2ZYDA 3ZH2A 4MKXA 1WNTA 3FCOA 2EXXA 4Q3BA 4CLXA 2X58A 3GEGA 3BHIA 4X54A 3LF2A 4E5YA 3IP1A 2WD8A 2OO5A 1NVGA 2DQ4A 1P9LA 5JXWA 3SXPA 2DKNA 4YRAA 4P4LA 1I24A 5BNIA 4GKBA 3RBZA 3A4VA 1M6WA 4HKTA 4R51A 1EDOA 5I8WA 3IKVA 5ES3A 5DCWA 4BMNA 2BFMA 3JQ6A 2CY0A 1C1DB 2Y1FA 4Q3CA 3VDQA 4AJIA 3HZZA 2J6IA 1Z7BA 1ULSA 3NJ8A 4R1NA 4IY1A 3ONDA 4PLTA 3D4PA 1I3LA 3HB4X 4W7HA 4BGVA 4F6CA 4PLGA 3RC9A 4CM5A 2ZB8A 1JVBA 1E6UA 5DBFA 4ZHSA 2Y1DA 4F46A 3RSHA 3D64A 4CM8B 1DC4A 4QQRA 4IDGA 2CUKA 1BVRA 4D0RA 3IAHA 1B15A 1BDBA 2Q4BA 4AJLA 4EBFA 2UYYA 1R6DA 2Z1NA 1Y7TA 3RROA 5A9SA 1NR1A 4YDRA 5FWNA 1RWBA 1X14A 3PFFA 2H63A 1K6XA 3DEYX 4WCFB 2WMDA 3FRJA 2GN9A 4BV8A 1CIVA 1M76A 1YOVB 1PR3A 4PN3A 5G4KB 3IIEA 5CDYA 2DM6A 2NVUB 4PLCA 4QUKA 4CQLA 4R5MA 1T2FA 3ZWXA 1P1JA 5IN5A 5B4UA 2OMEA 3X2EA 4ND5A 4EI2A 5DZSA 1BVUA 2NUAA 4FGSA 3IKTA 2WDZA 1C1XB 2HU2A 3HB5X 5LCXA 4NU6A 5C5IA 3JQAB 4WGGA 1JAXA 1Y5RA 2O3SA 1LBEA 2NU6A 3VZSA 3CIFA 3RJ9A 3GDOA 3E5RA 1P0FA 2OGUA 3V1YA 5EN4A 1QR6A 3DTTA 2Y05A 1C14A 2R2GA 2WJPA 3JQEA 2ZYAA 1GCOA 4XQ9A 2Q2QA 3VH1A 3GZNB 5TQVA 4BNVA 2JFFA 3I3OA 4UREA 4AJKA 4MINA 1PWXA 4BNZA 1B8PA 5H81A 3VZRA 3G49A 2JD0A 1HDCA 2YY7A 4QX6A 3GK3A 4YPOA 3FR8A 4MIOA 3GH3A 1U7TA 1QV7A 2E37A 3LQFA 4WLVA 2IEBA 2OL4A 3WTBA 3GC6A 1TA4A 5THKA 3U9LA 2VWHA 4E4YA 2AQHA 4ILKA 1BHSA 3K8ZA 2VUTA 3OETA 3KZVA 4YTEA 2G1UA 3D5QA 3OQ1A 2Y66A 4GWKA 1NWCA 4RPJA 3ABIA 2O7SA 3GFBA 2H5LA 5A3VA 1NNUA 3CZRA 3RKRA 2QW8A 4XYEA 2Y1EA 4E21A 4CV3A 1RKXA 1DIRA 4DC1A 2QQ5A 1XYGA 3JQ9A 4WLEA 4L4SA 3ZU4A 1UZNA 4RF3A 4EJ6A 1E7SA 1NQ5A 1B8UA 1X1TA 3EHEA 4NG5A 4OXYA 1YONA 1ZK4A 4GWGA 3V5NA 1P1RA 2ZTUA 3RI3A 2BLLA 5AYVA 1O89A 2JFHA 1YBMA 1K6JA 4H16A 2DBZA 1Z45A 1BWSA 3K73O 4XDYA 3WJ7A 4CM4B 1E5LA 1BTOA 4IGEA 4NBTA 1A9ZA 3QVXA 2FWMX 4GX1A 5DP2A 1PJBA 1IULA 3W8FA 1U7HA 3OQBA 1Q0LA 3DMTC 3OEYA 5G2OA 3KYDB 1Z7EA 3WYEA 2YFHA 3VH4A 4FBGA 4HV4A 3IUSA 1XQ6A 1VKNA 4NBUA 3RU9A 1XQ1A 4JBIA 4LN1A 4E30A 1I8TA 1XEAA 4ZQHA 1TT5B 5BSHA 4PGFA 5ILOA 4GL4A 4CMEC 2IYOA 3PXXA 4NI5A 3AOEC 5ICMA 1CQIA 1PTJA 2QYSA 1LSJA 3IJRA 5DCUA 4EZBA 5HRUA 2HMWA 3I4CA 4A5OA 5AQ1A 3AK4A 3G1UA 4YCAA 4P22A 2AMFA 5L51A 4PG6A 3DR3A 4FQ8A 2YHIA 1LEHA 4GVXA 2Y99A 4JJIA 3F46A 1N92A 4JN6B 2VUUA 1OC2A 4BMSA 3KOUA 5F5NA 4Y6PA 1YXMA 3KBOA 2IE0A 3AWDA 4XRGA 5HM8A 3UXYA 2NTNA 4BQPA 4QO8A 1VLLA 5I9LA 5I9NA 3PHJA 2NV6A 4BO1A 1UAYA 1LLDA 4HP8A 4B79A 4BS9A 2Q3EA 3KXDA 1E1NA 4XJTA 1DAPA 3UHAA 1T24A 1LSOA 1KY4A 1YBVA 1QSGA 2ET6A 1KC3A 1R4MB 3ASVA 3S2FA 3BIOA 3WX0A 2VUSA 3MOIA 5I8ZA 4UVDA 4BQRA 2AA3A 2X4GA 3OEWA 2JD1A 1AGNA 1Z6ZA 2NLOA 5ITVA 1JU9A 1P3DA 4U6SA 3N58A 1DIHA 4ZVVA 2UDPA 2OXIA 3RVDA 4RF5A 4A2CA 4CQMA 3JQCA 1DB3A 2O2SA 3WBBA 1GPJA 3U3XA 4IIVA 4PVCA 5KJ6A 3DZGA 4M86A 1AUPA 3ZWAA 4EGFA 3GMDA 1HE3A 4E5KA 1PL8A 4CQMD 4WASA 2NTJA 3PQFA 4O5OA 2W2LA 2X86A 1T2CA 1NQTA 1PQUA 1FK8A 3GR6A 3I9MA 5F5LA 1EMDA 1F17A 1D7OA 5A02A 4RVSA 5AXCA 4KDFA 1LLQA 1YB4A 2RH8A 4OH1A 4OSPA 1SB9A 3HDYA 2W2LD 3UICA 4EUEA 5KVQA 2IZ1A 2F00A 2Q45A 1BW9A 1PR9A 4PZDA 1A5ZA 1EQUA 2C59A 3QWAA 2Y1GA 2GZ3A 1H2BA 1ZKMA 3NGLA 4TVOA 5B1YA 1I3KA 1R0KA 3NRCA 1T25A 2W98A 1KEVA 2IXBA 3UCEA 3W6ZA 5T5QA 4WPGA 5CPFA 2P2SA 4XR9A 3VKVA 4BO5A 2EHDA 4C7KA 4DMLA 2DFVA 2RIRA 4JJFA 3RC1A 3SEFA 4BNYA 3NX4A 2HMTA 3FPCA 4DGSA 4RZIA 1RM3A 4DMMA 5IZCA 1GEEA 3GN1A 5T67A 4YT5A 1C0KA 1VC2A 3QRWA 4BNNA 4YVFA 1XG5A 5KNLA 4DLLA 3DOJA 3H2SA 3LU1A 5EIOA 3DAGA 3UGKA 1E7WA 4ALMA 4RVDA 1LX6A 2ZKLA 4FFOA 4OYRA 4CLRA 5ER6A 1TB4A 1YL5A 1EEHA 3GHYA 5L40A 3VZQA 2X22A 2WTBA 3H5NA 3Q2IA 3M1AA 1HDRA 5A3JA 3WR5A 3B70A 1F8FA 2GGSA 3JD0A 3BZUA 4DL9A 4MJLA 4E13A 2VZ8A 2GUGA 5JC8A 5L4SA 3RC7A 2CD9A 4YWJA 3V1UA 1PZEA 1YO6A 1ZJZA 4RZHA 5I7FA 2PZKA 1RM5A 2OP1A 5DP1A 1OOEA 3IOYA 1E3IA 4DA9A 3EGOA 3JSAA 3JD3A 1IZ9A 3FBGA 1DRVA 3K96A 4OHUA 2Y68A 1MV8A 4J4TA 4HFNA 4A0SA 5KKAA 3HHPA 3V8BA 1DIBA 4DIFA 2DPHA 4M49A 2X0JA 5A9TA 3AI2A 2I6TA 1NAIA 2B5VA 1A27A 1O0SA 1JAYA 1E7QA 1EVJA 1LJ8A 2BELA 2G17A 2I76A 3AJRA 3PHHA 2DBVO 4M87A 5I7VA 5AXBA 1P74A 3CH6A 1XLTA 2P9GA 1PGOA 3GN2A 1KVTA 3GEMA 4PFJA 1UP6A 4MKRA 3HG7A 4FB5A 4PG4A 1BXZA 1GQQA 4XB2A 4JJGA 1V0JA 3ZWMA 3QE3A 1BRMA 3JQBC 4QEDA 1DDOA 3LT2A 3W4IA 2ZB4A 2O4CA 4ZGWA 3QVSA 1SEVA 3NTRA 5ENDA 3ZCXA 3ITKA 5U9CA 5B4TA 4YQZA 5KTKA 2JCVA 2V6GA 3GG2A 4OL9A 5G0UA 1F06A 4DWVA 3FD8A 4NDNE 3F4BA 4CMIA 2Y0EA 4DBVO 4TRJA 3AOGA 3GEDA 1NXQA 2VT3A 1HLPA 1EVIA 3LLVA 3VTZA 3WFJA 3GVPA 1EUDA 2BFAA 4Z9XA 2RBEA 4DLBA 4BGEA 3WWZA 1NFQA 2J3KA 1EVZA 4FJ0A 5U4QA 5L4NA 3ROQA 2W90A 4IDEA 3ANLA 1E3SA 3E6AA 3PEFA 2Z1MA 3JD2A 2POQX 1ISGA 1GV1A 3PFWO 4HNHA 1ADFA 3FR7A 4A26A 2VOEA 2VYNA 3CEAA 1NP3A 4CUZA 2FSVA 2V6FA 4BO4A 1XA0A 3L6EA 3L77A 4LVUA 2C2XA 3EYWA 1N9GB 3JQGA 4J1NA 3ZHBA 4C7JA 4I08A 1A72A 3RJ5A 5K6AC 3H2ZA 4EUHA 4IQ8A 2VYND 1KBZA 5JAZA 4JLWA 1T2DA 4QFDA 4YEDA 1DFGA 1HKUA 1U4OA 4IUYA 1WP4A 1DPGA 3ROMA 4DRYA 3P7MA 1HSZA 5BNTA 3GG9A 2VQ3A 4AFNA 3LT1A 4EJ0A 2Q99A 1X13A 1GV0A 1V9LA 3KUXA 4DYDA 3UAGA 3WICA 1HDYA 3QSGA 3NYWA 4MVJI 1ONNA 1WLYA 4NBWA 4CMKA 4MO2A 4IIUA 1ZEMA 1NVMB 1MLDA 1T1RA 4MOWA 4KWIA 2Q1WA 2E48A 3PIDA 5KVCA 4WECA 1YVEI 1NTOA 5HS6A 1P33A 3GGGA 4KP7A 3ZHYA 3MTJA 2GF2A 1V3VA 1HE2A 1X7DA 2C2YA 4WOKA 4DC0A 4NPCA 5C3MA 1LI4A 2B4QA 4KQWA 1HE5A 1RM0A 1GY8A 3AM3A 2VZ9A 1FDVA 4RVGA 5CEFA 4TKLA 4RF2A 3RUHA 2R00C 1YKFA 1MG0A 4RPKA 1KETA 3WGIA 3TZ6A 3V2HA 4PG8A 3L4BA 3PTZA 1HXHA 5ICSA 2B83A 4XJSA 4Y6SA 2CMDA 1IHYA 4ND2A 1HTBA 3AUUA 4L0QA 4AL4A 1NFRA 5JSFA 1SOVA 3ETGA 3I9LA 3QWIA 2I66A 2BGMA 3E9NA 3C1OA 3E8XA 3ADPA 3RUCA 4PZCA 2VWPA 4YJHB 2QIOA 3H9JA 3A28A 3HN2A 2BGKA 3RAJA 4DYVA 5TJHA 5L3ZA 4FOOA 5IF3A 3VH2A 3NDIA 5JDIC 1A4UA 1EE2A 4WOJA 4E5MA 4D42A 5DNAA 1X7HA 1YQXA 1U9JA 2GZ2A 3H9EO 4QSMA 4B4VA 4I9NA 4MVJE 1NPDA 1ZXLA 5CFZA 4PLHA 3DBLB 4IJKA 4EDFA 1H6AA 1EZ4A 3UW3A 1ZIDA 4J3FA 1Z73A 1KVQA 2BFPA 3R3SA 5KKCA 1TLTA 5ENVA 3OIFA 3UCXA 5F1KA 2X6TA 3WQQA 5L7WA 1UZLA 2PV7A 3HQ4O 1BXGA 1WAMA 4GVLA 4YAJA 1T2AA 2VHVA 2AE2A 1AE1A 2GN4A 3LF1A 3VHRA 4PLFA 4J6FA 2FOIA 1UXIA 3QA9A 3GRKA 1GQ2A 4HWKA 2YDXA 3DFUA 4K26A 3SLKA 5I7EA 1X1EA 3ZDFA 3QW2A 4Q9NA 2EJVA 2VWQA 5T8KC 3C85A 1EUZA 2G5CA 9LDTA 4IS2A 1PJLA 4PRLA 2G0TA 3AUSA 3JQ7B 1NQAO 4CLOA 3U4IA 2X9NA 3BA1A 3I83A 4GSKA 4R5HA 4IZIA 1KERA 4R1TA 3DAFA 1O9BA 2VOJA 4CV2A 1GZ6A 1PEDA 2ZB7A 1DAOA 5G4LA 3VOSA 5AOVA 3S2IA 2HO5A 5L4LA 1T1SA 3HDJA 3HFSA 2AG8A 1MFPA 3H6KA 1U28A 4WLOA 3OJLA 1Y8RA 5JAQA 1N2SA 4EUFA 4Z3KA 4R68A 3HSKA 4YYZA 5IDXA 4R01A 3EW7A 2YHUA 3OJEA 4IDAA 2ZYGA 3EDMA 3PHIA 4J43A 3DFZA 4RLSA 4A27A 1E3EA 2XXBA 5B37A 3BTVA 4CMAA 3ON5A 2YZ7A 1WZIA 3T7CA 4P38A 4GI2A 2C7VA 1NR7A 4CR8A 4CLEA 3DZFA 1NAHA 4BNLA 1YL7A 3BTUA 3U49A 1BDMA 1H6BA 3VVCA 4PZEA 4CM3A 2VCYA 2I5PO 4OOEA 1KVSA 1M66A 3DHNA 3MJEA 1S6YA 4MVJA 1DLIA 4FGWA 4TROA 3HUDA 4TZTA 5G0WA 5FEUA 2VTDA 3PWKA 4XX0A 3WGGA 2QX7A 3UCFA 3OQ6A 4IGFA 4CMGA 4IQ0A 3PQEA 1QXSA 3MOGA 3WGTA 1XSEA 4MVJD 1A9YA 1IYZA 2G76A 4U0JA 1U4SA 3WDSA 1PQWA 2DUUA 4CUKA 4NBRA 3IMFA 3LT4A 5TC4A 3BMNA 4MPDA 4BNKA 2Q2WA 4JXKA 4W6ZA 1SB8A 4FD3A 5TGDA 3S1LA 1M67A 5CAEA 2E82A 2O7QA 4O0LA 1ZK2A 2Z95A 2A94A 3I9JA 3JYPA 1XKQA 4ALNA 4ALLA 5F3RA 2VNSA 4EEXA 1H9AA 5JAIA 2J3JA 3QV1A 1HDXA 4NZ9A 3RQSA 4ZJUA 5A5EA 1J5PA 3NGXA 5L9AA 2D2IA 2GLXA 3VPXA 3GVXA 2OFPA 2X1HA 5JAMA 2YFQA 1YS4A 1YDEA 5KJEA 3PDJA 4GX2A 2X0NA 2D8AA 3RFXA 1GEGA 3D3WA 4CMBA 1E92A 1N7GA 2V7PA 3TZQA 3RIHA 1FF9A 4CPDA 2CDBA 2HCTA 2ZQZA 1I3NA 2WYVA 4UEJA 1I10A 2CFCA 3GVHA 2IZ0A 2PKRA 4CUJA 3WB9A 3TF5A 2YW9A 5L7YA 2ZCUA 2VT2A 5IDQA 1GD1O 2UV8A 4MP6A 4MVJF 4S3MA 4OQYA 1U2DA 4WEQA 4GX5A 1PZHA 3JQFA 1B16A 1T4BA 2PD3A 2EKQA 5J23A 3QIVA 3JD1A 1KEUA 2Y0CA 3FBTA 3RUFA 8LDHA 2NU7A 4IJVA 1E77A 2DC1A 1ADCA 1R66A 2IRWA 1N1EA 2Z5LA 2PWZA 4I5GA 1VRWA 4XIYA 2PNFA 1GYRA 3ENKA 3N74A 5KJFA 1HRDA 3JYQA 3GPDG 1CEQA 1GUYA 4ZA2A 5JYEA 4AJ4A 4W9NC 5CEJA 1SZJG 4HX5A 3PK0A 1VSVA 3GMSA 1WDKA 3E18A 3F1KA 3VPHA 2PZLA 3U09A 2DTXA 4BNMA 1UXKA 3WGYA 2P91A 4Z3DA 3ZW8A 5CDGA 1CRWG 2I3GA 4YJFA 3ZU2A 4Z9YA 4IBOA 1D8AA 1KVUA 2DTEA 4D3DA 1P31A 4F3YA 1TVEA 1GU7A 2AXQA 2Y67A 4PLWA 5FI3A 3G79A 4J7XA 1U5AA 3DMYA 4OXNA 4FFNA 4BNGA 3HE3A 1PJ3A 1XU7A 4N5MA 4ND3A 3DZIA 4BKRA 1YGYA 5AXAA 1RM4A 1YQGA 1H6CA 3U4DA 4XYLA 1R4NA 4WLUA 2WE7A 3RFTA 3TL2A 4HADA 5KOIA 1LDYA 4OM8A 3TZKA 4UEKA 4FCCA 1ZMTA 3L9WA 1JN0A 3KYCB 3V1TC 3WLEA 4YAKA 1WVGA 1WMAA 3GDGA 3DBVO 5EL0A 3TQHA 4YT8A 2X8LA 2D59A 3HNPA 3MTGA 1OMOA 5DCYA 1ENYA 2NWQA 4B3HA 2YUTA 3WGOA 1FMCA 1NM5A 1NVTA 1R0LA 3X2FA 1IE3A 7MDHA 2WM3A 3DBRA 4G65A 4WKGA 4JNKA 1W0CA 3CUKA 3BMCB 1ISHA 3LC2O 3H7AA 3FNHA 5A9SB 2CDCA 4OKIA 4Q39A 4ZQBA 1H93A 3TL3A 1ZEJA 4DPMA 4TQGA 4ND4A 4R3NA 1PS8A 2EP7A 2RHCA 3BMQA 4E32A 1OAAA 5JPIA 1ZMOA 2PKQO 2RCYA 3O8QB 5JLAA 1ENPA 4ONEA 2YV3A 4LGVA 3WMXA 1DXYA 3GVIA 4KUHA 4LMPA 2I99A 3NV9A 5A9RA 4B4OA 2XXJA 3WQSB 1ZNQO 1ARZA 1GAEO 4J16A 5A4DA 5DDIP 3PDUA 3UN1A 3KEQA 4HBGA 3TNLA 1NASA 4LRTB 2TMDA 4D0SA 1N7HA 4FC7A 1V8BA 4AVYA 1EK5A 3PVZA 3AUAA 3GOHA 1C0IA 4YJGA 3ZN2A 3L0DA 2P5YA 1DIGA 2EP5A 1X0XA 4Q3DA 1Y81A 5DBIA 4DUPA 2OUIA 5MGBA 2C82A 5JCXA 1YE3A 2DPGA 4NK4A 3ULKA 4E6PA 3EZYA 3Q11A 1V6AA 4ID9A 1M75A 4BO3A 3R6DA 3LSYA 5DULA 4XQGA 3BMOB 4BV9A 2D5AA 4QECA 3K6JA 3IDSA 3WSVA 1K6IA 1PZGA 5TT0A 4IS3A 4WJZA 4EITA 3E48A 4Z0TA 2GD1O 3C7DB 4FW8A 1A7KA 4EYEA 4E33A 4W4TA 3G3EA 3W4KA 4BGUA 4UVGA 2NU9A 5TIIA 3DBHB 1X15A 4J0EA 5IZ4A 2PK3A 3M1LA 4AJOA 1WWKA 1CF2O 3M2PA 4DPKA 1P44A 3DWFA 1DSSG 4ZD6A 1B7GO 3B1KA 1MXHA 3AW9A 1RPNA 3JD4A 3DBLA 3NJ4A 1K0UA 1Y9EA 3QWFA 4II2A 4CODB 3ZV4A 2EW8A 3QP9A 4D45A 5FFFA 3RFVA 3QQPA 1C0LA 1HLDA 3GAFA 2PZJA 1O8CA 3VPGA 5JDCA 4YT2A 1Y8QB 3A1NA 3ZHZA 1L7DA 4DXHA 2YV2A 4NJMA 2Q1SA 1HETA 4B8ZA 5DBGA 4E31A 3WIEA 3WGHA 5HS4A 3ZWPA 2GERA 4BNTA 1UR5A 4BO2A 4DREA 3H5AA 2HRBA 3JYNA 5TSDA 3TOXA 1HE4A 1GTMA 3TWOA 4DIOA 3RCBA 4TRMA 4DIBA 4ZRMA 4NQZA 3WOHA 3FNFA 4PRKA 2IEDA 3DQPA 4E2YA 4J49A 3KV3O 3L4SO 2CF5A 3BAZA 2NADA 2JHFA 3S2EA 3H5RA 1UXJA 2FR8A 4R9RA 3GQVA 3P2YA 2Q2VA 5TF4A 3SX2A 3T4XA 2H1SA 4ESOA 1ULUA 1LQTA 4PG7A 4LCJA 2OORA 2GN8A 2AW5A 3PYMA 3JQ8B 3MZ0A 4MVJM 1TI7A 1LDMA 2CNBA 3A06A 1QG6A 4E2XA 5KCZA 1K2WA 1SC6A 4BMVA 3LLSA 1VSUA 1YL6A 5A04A 5JE8A 4JIGA 4LK3A 4I1IA 1M2WA 4BKPA 1XELA
chains in the Genus database with same CATH superfamily
5GONB 1LUAA 3CMMA 2V7BA 3PIIA 4HH0A 1PSZA 3CZ9A 1QUEA 4PIMA 2GN1A 5HCUA 4CKYA 2AC2A 3H87A 3HJNA 3MMNA 5TQ0A 5INTA 1RYDA 2Z04A 2Y93A 5KYGA 3ICWA 1Z5ZA 4F2HA 2Z8YA 3T12A 2XUJA 2WINI 1IN5A 1WDLA 3CA8A 3NI2A 3UKDA 1RPZA 2ZYSA 2FW9A 4KGZA 1GYQA 5IAJA 5FOTA 3B9PA 1L8XA 2ESRA 2QTWB 2RB4A 3TE6A 2Z6UA 2PSHA 3TVDA 4GGMX 4RGBA 3ET4A 2ORIA 4B2PA 4D81A 1PX0A 5BURA 1J1IA 3OUTA 4RZQA 1GJRA 3HY4A 2R1VB 1X7GA 1Q3KA 1Z2NX 1ZHFA 2C07A 3C5HA 3HZRA 5COQA 5JW6A 1DBSA 2EBWA 3W6NA 5KX5F 3WLTA 2FFRA 1B0AA 2FPRA 2H7CA 1Z12A 1SHUX 2OK8A 2ZWVA 3CUSA 3GXOA 3VAZA 4I6GA 1EXDA 2GA9A 4GW3A 2J9YB 2FEPA 5DW0A 1A9RA 3V33A 3K16A 2ZTVA 4EEKA 4XQCA 5HKLA 2ZYTX 1YI1A 5F35A 2NV0A 2GCIA 5B7GA 3HFGA 1EWTA 3QZUA 3PC7A 4M89A 4OV6B 2NVWA 2P0YA 3NCTA 1NV9A 4WCDA 4YI3A 1SD2A 2HK9A 3EPRA 1T0JB 1LRJA 1LSSA 1U3TA 2RHMA 3T1YB 3V55A 1C8LA 2X3UA 1GG2A 1XWFA 1G0NA 4LX8A 4IXTA 4I8XA 1ZBQA 5BUZA 1TJ5A 3BBLA 2ORED 3AMVA 2VYCA 2JIPA 4ODIA 1P4RA 2PMWB 1MR3F 3CUYA 4XIJA 3JCZA 1O97D 1NI4A 1HWYA 1Z4KA 1NRJB 4QUHA 2P2ZA 2P7IA 3A9WA 4F71A 1NBME 1CHDA 2C3YA 2OV3A 5BNZA 1HYEA 3F7NA 3FNEA 3IMEA 3UMFA 4K1XA 2VHEA 4QODA 2GFIA 5F7XA 3UAOA 3G2HA 4UTRA 1X3SA 3K1YA 3SSOA 4Y1RB 4LCEA 1H2XA 1ZWKA 3TN7A 2BKAA 2XDAA 3OQJA 4H9GA 3I6BA 4Z86A 2C57A 2HA4A 4AECA 1J21A 2RHTA 2ZWIA 2GVZC 4OHPA 2P8SA 4DUZB 1KJNA 2AJTA 2Z4SA 3HY6A 4FSHA 2WTNA 3DD5A 4N3BA 4AMBA 3FCYA 5IXYA 4RTSA 2JAOA 4O2BA 5G3YA 3FF4A 2UZAA 3K5PA 4S24A 3QMWA 3RAEC 1Z56C 5EZYA 1L4LA 1Q77A 2IYSA 2VEDA 1F1JA 3E82A 1IH8A 3HCEA 3HYLA 3ICPA 3O82A 4OKSA 4WOCA 5EINA 4DMKA 2JAWA 5GIOE 1EE9A 4OLAA 1Z0IA 2GBLC 1CP3A 1SVSA 4KSCA 4RPGA 1YMVA 3VYWA 2A9FA 3ZJUA 4QU5A 4YO7A 1VG1A 2RH4A 2AEJA 4LXHA 1MEEA 1XT6A 3SC2B 1TO1E 4FNGA 3TECE 1JLKA 1ZUIA 2R11A 3OKPA 2A9OA 2HV9A 4BRZA 3IR5A 3OCWA 3RTEA 4J1SA 2YX1A 4LF6B 1KI6B 4W5RA 2Z9BA 2HD4A 4DA8A 1XU4A 4IIBA 1NNLA 1XX6A 2XIJA 2GOYA 2B0JA 4CXMA 2ZR7A 2PX3A 3IT0A 1A9PA 1V6CA 2ZI7A 3FGZA 4KE6A 3HY3A 5EAIA 3VDRA 4WE3A 4H6PA 4P7JA 3QE0A 2FFJA 3HWRA 4UXJA 3A3NA 3VC1A 4GECA 4L9RA 1IQ0A 4KNYA 3GZNA 2VQ6A 1C5KA 1LX7A 1PLLA 2QUKA 5LOVB 3HJHA 1AX9A 4TYYA 1IRIA 4DPLA 1CUEA 3LCRA 3OIWA 1GZVA 2Y76A 3FGOA 4N6OA 4NZNA 3FLAA 1VLMA 2QD1A 2EIXA 3SLRA 3STYA 5DRYA 4CKBA 1U3UA 4UQLA 3PS9A 3RK1A 4X8OA 5IT0A 3NHWA 2HW8A 1DT3A 1YJBA 2OCDA 3M2TA 1L7AA 4O4IA 4A8TA 2H4HA 3HKBB 5JO0A 5EMNA 3I58A 4NU0A 1D6MA 2BM1A 2FG7C 5E38A 2XWPA 3PD1A 3QITA 2GUWA 4GPD1 3BKXA 5B57C 3GT0A 4WK0B 2ZI5A 3UW1A 1P1KA 2Q5JA 3DCYA 2XF2A 1WHSA 4TTJA 5DM0A 4G4GA 1FC0A 2X23A 4G0MA 2ZJ2A 3BDIA 3K35A 5BV0A 1UMBA 4ITUA 4ZVTA 1JDVA 3JATA 4WXYB 4HVAA 1I5RA 3C7CB 3AUFA 3ZKAA 4CGZA 1IBRA 2CXQA 4PW0A 1K08A 1NPYA 3H2BA 5GJCA 4V0KA 1HF3A 1XPJA 1L5MA 3SHQA 3ZJ4A 3KALA 3BSFA 4CN9A 3BB3A 3DE2X 2FSIA 1KO8A 2RJ3A 3LP5A 5FA8A 2O8CA 3KLMX 4HDKA 1PJQA 5HXAA 3OOJA 2GCOA 2QL7A 2AFHB 1KEKA 2H4YA 3OQIB 2X0RA 1YJQA 3LTEA 3RYHA 1BA3A 1TMKA 4XAQA 2KX7A 5KNCH 1NLYA 2AR9A 3C5WP 4L74A 4TS3A 4PVDA 1N8SA 2IYFA 3R3YA 4JI0B 3C3KA 5DASA 3HU3A 1NQVA 4XB1A 5TPWA 5IKOA 4GI1A 2E87A 3AJAA 2FLWA 4JJKA 1DBPA 3BMXA 1KMHB 3A3OA 1P18A 3IBGA 2FQYA 1JDJA 1CQIB 1LTKA 4HAIA 3IBCA 1E3JA 3OOWA 1FDSA 5FQOA 1SG0A 4BVHA 1TEXA 2PLNA 4Q66C 3S2YA 4I9UA 2GT1A 1IJEA 1D3AA 2OBMA 1XVAA 4BB5A 4XD2A 4M54A 2YUIA 1AKNA 4QUGA 3KHUA 5ERXA 3QIAA 4B4WA 1FU7A 2EIHA 3U7RA 4EFDA 5CYGA 1KHTA 5IX8A 2QEQA 4LYEA 1N9ZA 1MABA 1RR6A 1QHGA 5EIXA 4EMTA 1EFCA 5A1TA 5KHLB 3M6LA 1WJGA 2CHEA 5C37A 1ORIA 1V8PA 1X8XA 3WBFA 5JFOA 1W5TA 4L9WA 1R6TA 5ELMA 1W0JA 3FVWA 4A2WA 4PGHA 4RUKA 4UUPA 3H9GA 1WCXA 1U6IA 2OCPA 4UNIA 4ZJPA 5T4HA 5CFPA 2WFMA 2H1CA 2VUIB 3MJCA 2W2TA 1GT91 3K9HA 5B2FA 4O33A 1WF3A 2GM4A 1DCFA 3N53A 1MN6A 4FYPA 1ES9A 5JFTA 2X8AA 4OJTA 2OYSA 1W0JD 4MRPA 1JG6A 1RDFA 3UWMA 4Q4HA 2Y1OA 1OZGA 3LPDA 1VKHA 1C9NA 3GGPA 2C00A 5ALFA 4ZEOA 1XMSA 4D9MA 3V4RA 5CA0F 1ADBA 2G88A 4F3CA 4PXYA 1A8HA 4ZOBA 5D3KA 1OF1A 1ZGAA 4JSTA 2WIJA 4W1PA 4AS2A 4MEJA 1BEEA 1LH0A 4LDZA 2PLRA 1U1GA 2XPCA 2UZ4A 4URWR 1TMYA 1D1PA 3F1LA 1T29A 3OWHA 5TRTA 2ARKA 2H6EA 4WI1A 3TI7A 2B9EA 4HFRA 5LQJA 4HC4A 1IN7A 4QO7A 1JHQA 1WXFA 3BIWA 3VZPA 3H7IA 3T7JA 1P5JA 3A9UA 4O63O 1ZM2A 4OB6A 4OO3A 4BO8A 8ATCA 1CY1A 1Q0HA 1UXGA 1L5LA 1P1FA 3MUEA 1T3TA 4RK6A 4G0WA 1K7FB 3H42B 4LZZA 3TLAA 2AXPA 2WJIA 4J0HA 4W1RA 3OTWA 2XDWA 3QH4A 4L4ZA 4W8OA 1EFDN 1EFLA 1LC3A 3GGSA 2UZ1A 4U00A 1WMBA 3EAQA 3EVEA 4KV9A 2BFDA 2F1KA 3BTOA 3LX4A 2EF1A 1FX0B 5CT9A 2D1SA 3VTKA 3WFIA 5EG5A 2MSKA 3U16A 1NVWQ 2OAGA 3EVFA 2ABWA 1RLJA 3TFWA 5DGCA 2EJWA 8OHMA 4AJEA 3KSDO 5KYKA 2I1LA 1AH2A 4UCQA 1XMPA 2PEZA 3F8SA 4TSRA 3KC2A 5ALHA 4CMEA 3CLSC 2Q3JA 4P81A 4MQFA 3TNJA 1YZLA 2WLSA 4YACA 4A1FA 5KWJA 1O96B 3DC2A 2WU8A 2IPOA 4Q34A 4MJ7A 2GARA 5BQFA 2XBMA 1K3TA 1LPNA 1UOQA 2D0PB 1WVMA 1TYCA 3AR8A 3PGXA 1LPPA 4NRDA 4WA8A 1GDDA 1GTG1 2ZUDA 4B6JA 5BSKA 5KSPA 5KVSA 3QFFA 5FKJA 4O3MA 4N3AA 2PFSA 4ML3A 4JJEA 3BCRA 1E79A 1OKKA 3VUFA 1SPXA 3H2YA 4HCJA 1KDTA 1GITA 2XW6A 4DQVA 1BHJA 1MW9X 1NXPA 3R41A 3SIWA 4TWIA 5EJ7A 1T2UA 1JQBA 2GRAA 4HWRA 1W5AA 5E1MA 3ZU3A 4BO0A 2WVHA 1EUQA 1VSTA 1RS0A 3GJ0A 1KZ7B 4JODA 3HR7A 3W06A 4EHLA 2UXBB 2X0EA 1E79D 1OKKD 4RTMA 4CL3A 5C7YA 1FRVA 3RS7A 3ZE7A 1G0OA 2C9ZA 2VPWA 1E2FA 2VCHA 4I5DA 1PJRA 4PCVA 5A06A 3PNKA 3VA7A 4U7PB 4YCJA 4C6SA 1ZX1A 1OV6A 3TX6A 3V7FA 3AR5A 3CEHA 2V9PA 1JJFA 1O58A 1YRWA 3CX4A 5ALXA 3B82A 3SZLA 1P1IA 3DLAA 2O8EB 1PGJA 4MR7A 1U8XX 3R3UA 4B3FX 3B1YA 1ZD3A 3D8BA 1DRUA 4MJ3A 4UNSA 4YUXA 4DNXA 1T4MA 5HOQA 2KHZA 3RK0A 1H1DA 3R8XA 3CTMA 1EIZA 4QOGA 2ZYUX 1GARA 1YVRA 2XITA 4WGFA 4KQHA 1DAIA 4LNHA 4YJKA 2NZ8A 4EGAA 4FCVA 1EP1B 1KSFX 4OP1A 1V1JA 2PIDA 2HWKA 2QU7A 4DZRA 2AKYA 3AR3A 1KU0A 4QLOA 4UD2A 3RSFA 1YBAA 4XSHA 2JANA 3QXGA 3T9CA 2IEAA 1Z7GA 1C81A 1VCIA 1UP7A 3L8MA 3LZ6A 1ZFNA 1NW9B 1QHSA 1SZPA 1E2LA 4R0NA 3PDCA 2VTBA 1F60A 3FPKA 1N5OX 4PGMA 1L7EA 4RTRA 5FHQA 1Q1QA 1Y8CA 2ZRFA 3QEOA 1JKJA 4KZPA 1N8KA 5EP3A 3IEMA 5DT9A 5EERA 4X3CA 2JIRA 4JBYA 3PI7A 3DLHA 2Q1UA 2GSDA 2WFLA 2Y2UA 2XAUA 4N4AA 3N86A 4MWCA 2I7TA 2AKEA 4M53A 2DG2A 4JP2A 4K3UA 4AG5A 3RVBA 2FX2A 4U7DA 4P0TA 3DZ8A 4N0DA 1ISJA 2HY7A 4AYWA 2IXTA 1FPMA 3MXTA 2X0IA 4DMGA 2EU8A 3MB5A 4QYTA 2WG1A 2XMGA 3E5NA 4LHYA 1C9DB 3G13A 2J9RA 1OZAA 3VHXA 4LJSA 2EVWX 1U0JA 2WHYA 3OICA 5JMTA 5HBRA 2PR2A 3A2MA 3EVBA 2DFDA 2DULA 1PU2A 3EVGA 1B74A 3KPVA 2NP6A 2IP4A 2AG1A 3N1UA 4UAGA 4LJ4A 4NS4A 4QG3A 2Z1DA 2P9QA 2QAGB 3KV1A 3B51X 4KMSA 1NLMA 4BXOA 3I5MA 4L9SA 3T1VA 4RPLA 2ZIUB 1D2GA 3F6CA 5AO9A 4DV7B 1E7YA 4LIPD 1SBYA 3L79A 3ICEA 4WLFA 1Z6XA 4OLJA 3S8MA 1WG8A 2FP4A 4IFTA 1C3XA 1XTUA 2OK7A 1N6NA 3C15C 3NW9A 4JCOA 4OVKA 4G5XA 5AUNB 2X4IA 2Y0DA 5CNJA 2QPLA 4C3UA 4BBJA 1XXLA 4KQ1A 4EGSA 5IDWA 5K0ZA 3ZWNA 1SVKA 2NO9A 1Y5NA 3VJLA 4BVAA 1RRKA 4CM6A 4BN5A 5IMSA 1N5DA 3E9EA 4JEMA 2ZCVA 5DXFA 1XPUA 2BH9A 4WXEA 1EUCA 1V71A 4IP0A 1UQTA 2Q5IA 4HRAA 4KYTA 4TL9A 4EG6A 5HZKA 5E2BA 3ZZTA 5L7TA 1C9JA 1YAHA 121PA 1YWGO 1IM8A 4R2XA 4CIBA 1G3MA 2YVUA 2DLDA 3DLCA 3D8NA 2QJWA 3COWA 1VXRA 3EC1A 4LXYA 1M6VB 5IVKA 5B6JA 2P0AA 1AQLA 1H4TA 1A3CA 3WY9A 2PZMA 2P5UA 5JCJA 2OYCA 1V7QA 2HF9A 3T1NA 2P2LA 2XHZA 3Q5EA 3QVTA 5F9FA 1JA0A 3AHIA 3VR6A 2JFUA 5CYOA 3O6VA 4DS3A 2C1EA 5CT6A 2HGZA 1O95A 3BICA 3NCHA 4NE7A 2GWRA 1OT3A 2B4YA 3LC0A 1V2HE 3O0TA 1IY2A 3CH4B 3OBIA 5JCJD 2HMSA 3IESA 5BR8B 2FSSA 4UFOA 3TB4A 1I7LA 4YN3A 3VR6D 3LHKA 3AIOA 4IQFA 2RC5A 3QTBA 5FTNA 4OHBA 3N8KA 3GHHA 1O95D 1V8ZA 4H7PA 3SEZA 4FCWA 4TSFA 3JQGB 3IT2A 1M2HA 3GRPA 4C78A 4PZLA 2CL0X 4E11A 2JHAA 1JALA 1T9HA 1VBNA 2E1PA 1KPHA 3ENWA 3EBPA 3D02A 3IPRA 1DBIA 1S7CA 4J1QA 4G67A 4KPUA 2NOAA 2B92A 3H0EA 3THXA 3H2KA 1NXVA 2ZPTX 4L8GA 4GRIA 4ZQFA 2FUKA 4TSFD 1IY1A 3CBGA 2IQ5A 1MO5A 2JKVA 1KH2A 1PJAA 1T3LA 2X9QA 2PGXA 3IEKA 4OUDB 3I9KA 2HDHA 3PPWA 4G37A 3C24A 1Q7CA 3IUPA 3AFNA 3Q9NA 3AKEA 4D3XA 4ER0A 5E6RB 2VG8A 2X41A 1JQDA 5EWMB 5L3QB 2V9ZA 2IELA 4XWYA 1N9GA 1JHOA 3GFSA 4WBNA 2AUTA 1AHIA 4QPCA 3RTBA 1I32A 4WEOA 4P58A 1EFVB 2IHBA 3D8UA 1Q92A 1Z22A 2H2DA 2NT4A 3F9IA 4G4IA 4G5SA 2IDMA 4XGIA 5A7HA 3O4FA 3RAPR 3VDNB 3WWDA 2NUTB 5E7QA 3VAYA 5IVHA 4MWBA 5GTDA 1OA0A 1BHO1 1C2YA 1A82A 2A1IA 2B35A 2VHZA 3EQ6A 4G63A 4NL4H 4FEAA 3REOA 5AJZA 3WP0A 4PR3A 4WZAE 5FBZA 5G0VA 4EUHA 3MAJA 1V3TA 2W6IA 2W6CX 3GP3A 3TLGA 3ZYZA 4BMYA 2CHQA 3MRSA 3DE1X 2HRZA 3NT2A 3ISTA 4O25A 1LZKA 3MCTA 3WLPA 4DC9A 1IWOA 2WZCA 1PGQA 3ICCA 3TTSA 4UEOA 4G0QA 5J5VA 1V35A 4XYMA 4Q3EA 1OHHA 3LVQE 1G8MA 3OO1A 4H4DA 1KRHA 2G4VA 3NVAA 2W6ID 1SKMA 4WKBA 4UOZA 4DG8A 1WU7A 2D3TA 2H8GA 4HDNB 4YIHA 5KTNA 1WETA 1N5MA 4B33A 3BK1A 3ESAA 1G6KA 1DJQA 1K8RA 1TC2A 3EY4A 3WKCA 1Q0SA 4BNFA 3OMLA 4MGKR 1OHHD 1OXBB 1DNPA 1TLFA 2CB9A 3OCUA 3HVUA 5B2ZA 4YMHA 3F6RA 2HH9A 3KM0A 4O59O 4F9TA 3H0KA 1ZSYA 2X9GA 1VBKA 3LA8A 1ZXXA 3OF2A 4RO0A 2OA0A 3AUYA 3P0EA 3PUYA 2ONJA 3MTAA 1CZUA 3RUAA 5MN6A 4BDTA 1AM4D 2YVLA 3QX8A 2DR0A 4P1ZA 4E3ZA 2FW7A 1GTZA 5EA2A 2X3FA 3QF4A 1IDOA 4AJNA 1HPLA 4Q1DA 4NBLA 4BNXA 1AKTA 1FUIA 3G8CA 4OYYA 1RXEA 3NAMA 4IH9A 5JJLA 2YNMA 4TRNA 5I5GA 1K89A 1T13A 5JY6A 1YH3A 1TT7A 2H5JA 2Q2OA 2ECFA 3G5MA 1U28C 3WL6A 4D80A 4UBNA 1OASA 3GRYA 1JP7A 2J9ZB 1W76A 1J6UA 2W2KA 3P9YA 4MCAA 4NG4A 5M3BA 4L2IB 1Z5NA 4KDEA 2CLKB 3T7KA 2Y9PB 1BEUB 3K9FC 4GGOA 5HDBB 1NI5A 2YNMD 3RK4A 1MQAA 2GCGA 3I2IA 1E3WB 4HRVA 1UBJS 2ACVA 3E9QA 3DVLA 3QLJA 4IYJA 3TJRA 3DWEX 1JDPA 1NBHA 3D0OA 4MQUA 4NYMQ 3KCNA 5ALLA 4C06A 1QRDA 2Q50A 3VNRA 3E8SA 3QEMA 4RVUA 4YK7A 1GYPA 2JLQA 5K9ZA 2PKXA 3AB7A 4EI9A 3WK5A 1BXGB 3EUWA 3M6MD 4P86A 4TX1A 4KXVA 4ZK2A 2SBTA 1A97A 1FU4A 5FBKA 3UT6A 5ABPA 5KVVA 2Q4TA 3EG9A 5C7IO 2JG3A 4OI1A 1NOJA 4JUCA 5COBA 5BRNA 1MRNA 1UC4B 3ONFA 3Q7IA 3U1VA 1PO7A 3FCAA 4N5HX 2J45A 2ZS9A 1X9IA 2YYSA 1TVMA 2J5XA 1PGNA 3S55A 5EP2A 5E7IA 1T5IA 2K5UA 3JXEA 3O03A 3V2GA 1SQSA 1Z0UA 4NCNA 3IV7A 5JXGA 1QZUA 2BMEA 2QW1A 4MQ6A 3OUZA 4OJKA 4CLOB 5CLFA 1TZBA 3VPFA 1NTRA 3FYUB 2F9MA 3LKVA 2I3DA 4IWNA 4NNJA 1NVDA 1P39A 4E5DA 3VU3A 3OA2A 3PGKA 4QJBA 5DK4A 4H27A 1KTVA 3SYNA 3PLRA 4P8RA 1DJLA 1QIKA 2OHXA 5HA5A 1QZTA 2WOOA 1MC1A 3EVZA 5LD2B 1C9YA 3CJRA 1HT0A 3CH7A 1GR0A 2AFIE 2WR8A 1I4LD 3TOVA 3U4MA 3K9CA 5KHOC 2X2OA 5JJ5A 1P3JA 1Y8RB 3KAKA 1AUQA 2J85A 4IJWA 5JQGA 3R20A 2B9VA 3CWZA 5ETJA 3HYTA 3ZHSA 2G4LA 3IUMA 4B48A 5A3RA 3R7WB 5IPFA 2O6HA 2BMWA 3EGXB 4YJ2F 4MDYA 3R5FA 3FIJA 5EHGA 1MO6A 3JQ7A 9LDBA 1VPTA 3RVMA 4O02B 4JJ4A 2QGZA 4MV1A 2OHIA 2NIPA 4HY3A 1MPXA 5ADHA 1FXWF 1PW5A 3NBFA 4ZDKA 3WRYC 3KQLA 4DCGA 2I65A 2F8TA 2RGXA 3TQQA 1A95A 4XDZA 2OV8A 3LW8A 1M3SA 4PZ0A 3PL1A 3CNHA 5SZKB 1KRXA 3A1WA 2ZQYA 1O9GA 3LAWA 3PRJA 4JLNA 3AI3A 4CG3A 2I7XA 2BWJA 4F5WA 2CHGA 1W6RA 1CZLA 1ZNYA 2P6MA 4HNTA 1YA4A 3LUKA 3FCEA 3GFPA 1V16B 4P98A 1KZ6A 2QTNA 4NARA 4EEZA 4JI4B 1KYVA 2GXSA 4RXTA 5LBTA 1T8PA 3ZJVA 5ITWA 2XE4A 5U4XA 2PUAA 3CVYA 3NTOA 1ZONA 3C7AA 2MDTA 1XROA 1TU3A 3A3KA 4RZ3A 3RV3A 1TEVA 2Z2ZA 4DHEA 4YH1A 3VNUA 5J1SB 4TWJA 2A0FA 1LW7A 4G4SP 4RKQA 4MV8A 4E6EA 3E1SA 1DQRA 1XE3A 4D92A 4E1AA 3O26A 4JI3B 2JGAA 5BVGA 4JD5A 3KB1A 2H06A 2BFCB 3L2OB 3NOVA 3HYRA 2OHOA 5JS2A 2C0PA 3BMNB 1THGA 2FQ1A 2E4ZA 2C42A 4DJEC 2RI1A 1NJ2A 2HWUA 2P7HA 4FN5A 3D7LA 2WJ6A 4Y2QA 1D9ZA 3VXKA 1OBVA 4ES6A 3SS9X 2D4HA 4WH0A 4U8GA 5K8IA 3JWEA 4KGXA 5REQB 5ADWA 2VAWA 4ZI7A 5IJ9A 5KQSA 1NG9A 2KWIA 1CBUA 3O1IC 2KS6A 4A8JC 4M99A 3PWZA 2WFZA 1AK2A 2X8JB 3L9XA 2E5WA 2XB4A 1EXWA 2B69A 1WBDA 3C3EA 1PFKA 2DUWA 3LUPA 2J0SA 2Q8QA 3DOOA 1OI7A 4FZRA 4KTVE 2O0LA 5FNVB 3DDNA 4UMEA 1PT9A 1IJKA 3EFOB 3HCRA 4MUNA 3KDPA 2H00A 1E5XA 1RC1A 1GWNA 1OFGA 5EIEA 1X7XB 1UINA 1DG3A 3EGVA 5CVTA 1IN1A 1T8TA 3GNTA 1N6IA 3HBNA 3K4PA 1T6NA 3OKCA 2AQ8A 4JASB 2BFNA 2ZLBA 3FUXA 3G0OA 4YBRA 5A0FA 1JSRA 4CQJA 5AIBA 7AT1A 2G70A 4GLLA 1M6HA 1NL3A 2FA9A 1VCOA 2D0IA 2JFGA 4OJNA 5JH7B 3T8YA 4U9UA 3ZZNA 1UWLA 2QN2A 3K6RA 4LBWA 5DPMA 3ZDQA 4MW2A 3ZXYA 5JNLA 3I5YA 2OLEA 1ZYUA 3GFVA 4ZCSA 2PUGA 1MZPA 1XVTA 3H8JA 1SCUA 4AZWA 1O0CA 3PC8A 1DT5A 2W6NA 1DC7A 1Z34A 4LDPA 3FNRA 4ETIA 2EJUA 3PQ5A 2NO0A 5C52B 3C7TA 1CWUA 2E4XA 3TCNA 2B6NA 3HV0A 4OJYA 1OY1A 4GVPA 1MORA 3O21A 4EGQA 4K46A 2Y3IA 3ORYA 3PPIA 2CJYA 3C48A 1ZRNA 4NZPA 2JGRA 1M9NA 4QLBA 1Q3TA 3HWX1 4GAEA 3ZK7A 3USES 4P0QB 4AICA 1E2PA 1B76A 2QTFA 3DFMA 4H08A 2F2TA 2XNCA 3WXBA 4CFZA 4HTFA 2QMHA 1Q2UA 2YWFA 3L0CA 5DX1A 2PJUA 2BSAA 4D8VA 1AA6A 1OB5A 1SIUA 3C1AA 4LRSB 2CYAA 3S5UA 3OF3A 4RIFA 4ANFA 3A1FA 1NM5C 1N1MA 4ZCMA 1T9BA 2OCAA 3D6JA 2FFBA 3DZBA 2Z98A 4HLNA 4JJAA 4J03A 4KLZA 3TAXA 3WXMA 4BEVA 4INPA 4E07A 3U5TA 2IHZA 3UFXA 5JLJA 4HEJA 1AK1A 3WTCA 4C7XA 1RWKA 2HHJA 3RVNA 2I55A 3VDXA 3E7WA 6CHYA 1B0UA 1VP3A 4KYIB 3ZU5A 4PPYA 1AKVA 1IN4A 1E0KA 1RACA 2FI1A 4E2ZA 4CTMA 4MS4A 1KDYA 2CVPA 1SQ5A 3LXUX 4G1CA 3U61B 1JFRA 3C16C 3R0QA 4J0FA 1DWQA 1Z5WA 4EO4A 2R7NA 2REXB 3QWBA 1BCRA 4GMDA 5ERYA 3O9VA 2GRJA 2VT6A 1U5CA 1XD9A 2GTPA 2E6KA 4M55A 3TFQA 1SUAA 5FTLA 1R9GA 1RJDA 1VG0B 2FUG6 2QZSA 4RVNA 3Q7TA 3NXKA 1O6CA 4X1YB 3OIDA 2NU8A 4J16C 2BFBB 3NZEA 5JTTA 1KMQA 1P2TA 1PS0A 4PZPA 5I45A 3I62A 5AK5A 1MT3A 4BE9A 5JYDA 4N41A 2ZM6B 2H5EA 2QVZX 4PAQA 3CZ5A 3KHSA 1QX4A 1U0TA 5CNMA 2GZRA 1XJWA 2P3QA 4OJQA 4UNNA 2C7OA 1ZD5A 3BA6A 3OT1B 3SQWA 1YHYA 4ZCIA 3MJTA 4KR3A 4JJ6A 3RBXA 4GM0A 2GR9A 4FMCB 5AJYA 2V8BA 3DPSA 1TO2E 2IP1A 3OI7A 2GTHA 1ADGA 2DPXA 3KOYA 1UIMA 4U2GA 3PUJA 3U3KA 1H23A 4BV3A 1I1HA 4W5OA 1S2NA 4BJ1A 2POCA 1P1CA 3ONEA 2BFEA 4QICA 1WZUA 4ECAA 3H1PA 4ZOQI 3KVNA 4DWWA 4MPPA 4YUWA 1YZNA 3H9QA 1TQ4A 4XGNA 2JZNA 4U7JA 1ZGCA 3G89A 4W5QA 1LY1A 1DAMA 3R40A 3QUAA 4CI9A 4E7PA 1W19A 3DBRB 3TKYA 1E3LA 2FGKA 1WW8A 2TECE 3T3HA 3TW6A 3TRHA 2FWAA 3CW9A 2WSBA 1P80A 2R8PA 3EY9A 1XBTA 2CZGA 4A1OA 3U39A 2W4MA 3RKUA 4NH4A 4RLHA 4UULA 3M34A 3RUIA 1JIIA 2NXCA 4MP8A 4B3IA 1DGQA 3CLTD 3T9EA 1L1FA 3FSRA 3WK4A 2O5EA 1OR8A 2PMCA 4NFLA 2WKWA 4YRQA 3OC6A 4U2KA 4LXQA 2IV2X 4S05A 4RLQA 3RAGA 2GF0A 1O94A 1UPAA 1ZBDA 3DMHA 4KW7A 1CZKA 1X7ZA 4C0HA 5E6UA 4ZOLF 3ET5A 2DT8A 1I7PA 2PL9A 1ZJJA 5A9SA 3GBVA 4QYIA 4CLDA 1U1IA 2P5SA 1D2MA 2H1RA 5EJ2A 7GPBA 4W9MC 1ZJ6A 2X9VA 4KOEC 5ADVA 1O94D 3R5SA 4HT3B 2GYWA 1YB5A 4UU1A 4ZWNA 1AZLA 2G09A 5BMOA 1Y6GA 4IDCA 4G0YA 1UBUS 1E1CA 4F56A 4JQZA 2EKBA 4A6EA 4RIGA 2SICE 1NR5A 2VFAA 2Z3ZA 4LECA 4CEJB 1N8TA 2PA3A 1JVSA 4TSKA 4D9HA 1E7RA 1MX9A 1RWNA 3NWEA 5F51A 2JLVA 3DR5A 3QY0A 5EJFA 2FRDA 4GHWA 1UAGA 1BJRE 2QMOA 2YVKA 5KTPA 3GNQA 3MJRA 3Q85A 1G8FA 4NFHA 1GG5A 4EYGA 3O90A 3GVCA 1HORA 3OAAA 5EWJA 1IPFA 4GP9A 3IJPA 4G4JA 1HL7A 1KBOA 4FGZA 4S1NA 4JI5B 5IAAA 2QUAA 2HRDA 1KI9A 4NHEA 2BTEA 4RCZA 1EJBA 1GPWB 4XVHA 3KYJB 2J5QA 3WJAA 2X14A 3KT8A 3LUBA 1W4AA 4DN6A 2D6FA 3OAAD 1U9ZA 2BGLA 3C3XA 2ECPA 2QQEA 5F23A 2I54A 2FR8C 3IQHX 3QUQA 4ZU3A 5CCXA 3JPWA 3LY9A 1SO8A 2OORC 3LUDA 4DBLC 3LBHA 5C0OE 3ER6A 1MX3A 3GDFA 1AMOA 2XBLA 4IMJB 5BW8A 2FPMA 2SECE 4RHEA 3V4FA 2FZ5A 1I6MA 3I64A 4HGQA 2IH5A 2XMZA 1RJ9B 2VATA 4WERA 4D3FA 4JB8A 2I6FA 4L3WA 2OXFA 1US8B 3R24A 2MSLA 1Z83A 2BDEA 3HCWA 3N2GB 2ODAA 3RBVA 5IASA 3SVTA 2WV9A 3A14A 4QVGA 1P2UA 3QUCA 3RUDA 4F12A 1POXA 3ZD8A 5CFMA 5HSGA 3TINA 4ZKDA 1XAIA 2Y1CA 4A16A 1DRJA 3EXG1 4UTZA 5IFLA 2XZOA 2EEZA 3ZV3A 4P9NA 2B2CA 2UU9B 4QG7A 3WYAA 1Y3CE 2WAMA 4KJZA 2RC6A 2GEDA 1R12A 4PU0A 1NUQA 1XZBA 2REBA 2Z9CA 2AMLA 3D81A 3IP5A 3SSAA 4G56A 2ZJOA 4N8DA 4OB8A 3BXGA 3TEFA 4ZMSA 5JD4A 1SCBA 2H7VA 4L4XA 1UIRA 4UU7A 2P6RA 1NBWB 1F2TB 5EWLB 3A6FA 1ETHA 1ZK3A 3QG1A 1SQ0A 2H92A 4QOHA 2L69A 1LPBB 1HDOA 4GXRA 2AZTA 2A1UB 2Z83A 4Q0MA 1TJNA 1R27A 1UJBA 1K75A 1WZEA 3GZTB 3O9MA 1W36D 4A8HA 3BZBA 1TXGA 5LA6F 4ZREA 3AM4A 1WUHS 4ZYXA 3GJQA 2TMGA 3LXXA 4XUGB 2D7CA 3QVJA 3T3PB 1U3GA 4D8WA 3E8MA 4GLBA 5JC1A 1RTTA 2AOVA 3KUDA 4L72A 4P80A 3K31A 4L28A 1D0VA 3SYTA 2KSQA 1NW7A 1F20A 1EGHA 2ZSDA 3T5TA 2J3IA 1R6XA 2D4AA 2NW6A 3ZNPA 2C9MA 3PNVA 4OXIA 3HR8A 3EEIA 2Q6VA 3N2LA 3ORSA 2QRVB 3OUUA 3U2QA 1WRBA 1N34B 4DSTA 5BNFA 1B14A 1XNJA 2E6UX 4I81A 5A2GA 2ILTA 5B4VA 4YQFA 4N7JA 3LC7O 1H1TA 4CMJA 3FTCA 1J06A 1M0WA 1P73A 1ZOLA 3AF1A 4HSGA 2LDBA 4MIKA 3QPAA 3CNNA 2W6ZA 4HATA 1CQWA 1J0BA 1FYEA 4V0LA 1YI0A 3BWVA 3VU8A 4EY5A 4Q7QA 5F2EA 1QZXA 2BSXA 5TQ0B 1BH2A 4RA6A 1CY6A 2NO4A 3RRXA 4YAIA 4B7ZA 2B20A 1HL3A 1WXIA 4N8SA 1OXVA 2AN9A 1DKPA 1U0OC 2JEZA 1MOPA 1C3VA 1N2GA 2B4RO 2CLDX 1WDTA 2GXUA 2XMQA 4HDRA 3NANA 3TQFA 3ZH2A 2AGVA 1WNTA 1DKUA 3K0CA 4EABA 3LUHA 3ADCA 2VTVA 3PUIA 3PQ7A 3BHIA 3NQ41 3IP1A 3A36A 3GRVA 4KXFB 1QOPB 1UK9A 2ODPA 5JXWA 3ZV7A 4YRAA 2IGTA 4Q4LA 1UK6A 3CVXA 4PPGA 1YMUA 5CLJA 3EGIA 5I8WA 1VJGA 2GWHA 3Q3GE 2PCJA 4MZXA 4O1HA 1BS2A 1I2AA 1T9GS 1TZ2A 3DS8A 3JQ6A 2VHCA 1G2OA 3WSTA 4FI3F 2GYUA 5FUWA 2I8LA 2ONZA 3BAFA 2J6IA 4RETA 4DA4A 3NJ8A 2XUOA 4R1NA 3FRIA 2PYDA 3DMNA 3ONDA 1I3LA 4BGVA 1FFYA 5HUQA 3D3JA 4UTXA 1TQ2A 4F6CA 4IHJF 1G8KA 3RC9A 2ZB8A 3ACBA 1IN8A 1XXHE 4ZHSA 3N0TA 2Y1DA 3O3CA 2R5WA 4I7EA 4F46A 2QSUA 4MW5A 2RKOA 4A23A 4AY2A 1NI4B 3N9IA 3NNDA 3UMMA 2BAGA 2EX4A 4QQRA 5L6MB 1E32A 1GGEA 3L0IB 4IHQA 3R5HA 1SCQA 2QPAA 1NP6A 3IAHA 1B15A 5CH5A 2RGRA 4AJLA 5JVDB 4Y6LA 2UYYA 2XUDA 5JRDS 4ITVA 2IF2A 4ROTA 1A8PA 3LLUA 5FWNA 2O54A 1RWBA 4D4GA 5GVSA 3DL7A 2WMDA 4BV8A 2C4UA 2Q7DA 3EZ9A 2GD2A 4COKA 4YMWA 1N0VC 4L51A 4GI5A 1PR3A 3PXCX 1DUVG 5CJPA 3IIEA 1Z6QA 4O2BB 5ALGA 5F7JA 1PD1A 3T7AA 5IKEA 4FW9A 4Q1CA 5EZYB 2W0SA 3JQPA 4R5MA 5AW1A 1QAOA 1H4SA 2BJVA 1GKYA 2I8CA 2OMEA 3N8DA 4X45A 3X2EA 4ZDJA 5A6VA 2PZGA 4UBKA 3SC3A 1BVUA 2NUAA 1PRYA 3AV0B 3T0IA 1Q16A 2FKAA 3TR0A 4C6RA 3HXPA 3KJIA 1XF1A 3QTTA 4NU6A 4HHEA 2UXDB 1KKUA 1KFKB 2D7JA 2EAUA 4OMFG 3BWDD 4AX8A 2O8NA 1NF9A 3R6WA 4LV8B 4M0EA 4MR8A 4IGKA 2OZLA 3I2YX 3NM4A 4HD8A 4JEHA 1EM6A 1HR0B 2NU6A 4U2EA 5FUVA 3BCSA 4OK3A 4C4AA 5JAUA 3HR4A 3PEUA 2FSGA 1G18A 3EF3A 5EN4A 3DTTA 1KO5A 2Y05A 4JU8A 4ZEMA 3GEIA 4D9EA 2R2GA 3DHVA 3TPFA 2Z08A 1IJFA 3ZGVA 1O54A 1CIPA 1TCAA 4KXYA 4XQ9A 1GGNA 2C03A 2GJAA 2H2WA 3VH1A 3GZNB 4B75A 2CXOA 2EX1A 4BNVA 6YASA 2AD1A 3I3OA 1KOFA 4BQFA 1XZEA 4GOOD 2C97A 4KGVA 4MINA 3ASYA 5EZ5A 2JD0A 2QQFA 2YY7A 4S2EA 1KIMA 2G77B 4YPOA 4MIOA 5K0FA 1QQ6A 1NU8A 4EDHA 4YC7A 5HKOA 1MOQA 2E37A 3NALA 2N1MA 1OXKB 4AW9A 4BAZA 1T6BY 2OL4A 1MNAA 4Q4JA 4O4IB 1TA4A 2GPYA 2DWPA 2GK6A 2EWWA 3OTHA 2GBGA 5THKA 2JGDA 2HPAA 2I7DA 5JXHA 2NO6A 2VUTA 1TKAA 2G1UA 2N3ZA 2QRPA 2C4WA 3OQ1A 2MOKA 4GWKA 4HJXA 1Q6YA 4QNNA 3ABIA 2O7SA 3DL0A 1WHSB 1I14A 1TUEA 1J99A 2ZE7A 5A3VA 1LF5A 2C77A 3KNZA 1CY7A 4W5HA 5IM4F 3O83A 1L5NA 3JATB 1W4LA 3RKRA 2YMPA 1B8NA 2PVPA 1E8DA 2Q7OE 1OWOA 1DIRA 2WFAA 4DC1A 2QVGA 2QTAA 2ZRQA 2OO3A 4QTYA 4P84A 1EI9A 3VSBA 1KYTA 4D4KA 1K4MA 1Z4IA 1LBSA 2O8CB 3UTDA 4QPDA 3L0PA 4DCSA 1YONA 3GIDA 1J56A 2GCOB 4P3OA 4CGYA 4L6IA 3CTPA 3RRMA 4GKKB 1P1RA 3RYHB 4QEZA 3EA5A 2RG7A 3AG5A 1BWSA 1IHUA 4DIEA 3WIVA 3FOEC 1LVHA 4IGEA 2GEJA 5TPWB 4H60A 1J0EA 1NF8A 2FWMX 3C1UA 2FPLA 3WGKA 4C89A 2VVTA 3OQBA 4HAVA 1MEOA 3AESA 3B3QA 3OEYA 1QU3A 2F9LA 4KGDA 1I6WA 3WYEA 2Q6TA 1KP3A 1X80B 4KDCA 3VH4A 2LKDA 1R8XA 1MC8A 1ZGGA 3LD9A 1VKRA 5AMXA 3AHEA 3EIWA 2RARA 4AF7A 5B6IA 1XQ6A 1DXHA 1E9SA 4S1OA 3OLWA 3TSOA 4EGJA 5DFAA 4Z4EA 4BFXA 3C45A 4L8YA 1J2JA 5H68A 3ZOKA 1A77A 1MABB 3M83A 4H1WA 2IXEA 3NG1A 3KT3A 3A6PC 2A0XA 4ATNA 5AM3A 3LX6A 3MT7A 3RFFA 1Q6ZA 3PXAA 5ILOA 4FLMA 2EHJA 2O52A 1WMFA 1WBJB 2IYOA 3I92A 1L7PA 4HB4A 3AOEC 5DM60 3KHKA 1OAKA 3CF4G 1KYIA 4V3BA 2O5VA 2QYSA 5DCUA 4L27A 3FOAA 3UJBA 1EX1A 2HMWA 4EPWA 3IPAA 5HQJA 3GDWA 3VPAA 4Q4HB 1TK3A 5ALQA 3WLRA 1PNQA 1KQOA 5L51A 4WOBA 3OKAA 1K68A 2F8LA 2QVCA 1JDSA 1YA8A 3ODPA 4ADSG 4XUCA 4Y2PA 4CKXA