3KKOA

Crystal structure of m-ras p40d/d41e/l51r in complex with gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
NLPTYKLVVVGDGGVGKSALTIQFFQKIFVDEYDPTIEDSYRKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein M-Ras
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 59
structure length 169
sequence length 169
chains with identical sequence B, P
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkoA00
1ZCBA 1S3GA 2OM2A 4D2IA 4IOMA 4X8LA 1G3QA 3AF1A 4R7ZA 1G6OA 4HB0A 3TGPA 4OQLA 2YC4C 4IOJA 3R8CA 1U81A 3U7FB 2R6GA 1HTWA 2GNOA 5DNYB 5H8WA 1XNJA 4A0RA 4A8JB 1G7SA 2ZI7A 2C04A 4OHZA 1C1YA 2MMGA 3AUYA 4MGZR 3T61A 4LHYA 1UM8A 4HUQB 4RD2A 3TKLA 3KJGA 1GM5A 4YC7A 3TSOA 1HQYE 1I4TD 2RH5A 2GVZC 3AF2A 3C14C 2ZRFA 3LBHA 4XSGA 4DLUA 1Q0UA 1PZNA 2PMKA 2EYUA 4MYHA 5G53C 2X77A 4OBEA 1R0XA 5LBIA 1W46A 3BFXA 3M0EA 4JKIA 3GEHA 3E1SA 3X2SA 4KCGA 4KODA 3TVDA 3B78A 4OQFA 2BWJA 2BBTA 3BAFA 4A6PA 4OJQA 4EPVA 2J7PA 1E9AA 3GLFB 1S2MA 3GJ4A 4BZQA 1ZVQA 5BXQC 2GCOA 5ANRB 1PVOA 4KJZA 1N0UA 4I1SA 5FFMA 2XNDD 2FFHA 3CRVA 3QBVA 2YOGA 4E03A 1ZJ6A 1M2OB 521PA 1TNDA 1XTQA 3QIAA 1OB2A 2IYLD 2C77A 1UFQA 3IIJA 4BWYA 4ABYA 3VTKA 1W36B 1IN7A 3C15C 1Z0AA 3WY9A 1OFUX 1H8HD 4B43A 3CPEA 4QJ3A 2HF8A 3BERA 1SKYB 3AM1A 2QMEA 5GVRA 2GKSA 2ZE8A 5IHPA 4HAZA 5A5GA 2ZRHA 1GWNA 3D8BA 4V03A 4RFSB 2JLYA 2QL6A 3VR3A 4ACBA 3CRQA 1RRPA 4PAOA 3ZD6A 4GOJA 3L2OB 1KAOA 2FSGA 5HZKA 1U98A 1G3IA 4W5JA 4MDFA 1ZYUA 3KKOA 1FFHA 1HUQA 1N6OA 3K9NA 3U4QA 2QENA 1NI3A 5J4HA 1VG8A 2NPIA 1W4CA 2RGBA 2G6BA 2XJ4A 4JLVA 1MRSA 2JDID 2OG2A 3U7EB 2GAAA 5AR1A 2CL0X 2Q3FA 1NG9A 1A82A 3FGNA 1W48A 4R71A 2KSQA 2CCJA 1YR6A 2DFTA 2RHDA 1JXMA 2ZRCA 4BPBA 2DWPA 4KBGA 2D7CA 2FFQA 5BW8A 4EPRA 2IEYA 2O8BB 1R2QA 1ZUHA 3EXAA 3P27A 4RZ3A 4M1KA 2CVHA 5FBRB 421PA 4BZXA 5JLJA 3QI2A 1DAFA 1RRFA 3KX2A 3Q72A 4QGHA 5IF9A 1W0KA 4MRPA 2H57A 5J4LA 5BQ5A 1UBGA 4UNQA 4WW0A 4EJSC 4WZAE 1ZW6A 1EWQA 1QG4A 3BB1A 3REFA 2WKRA 1TL7C 4TMXA 2NGRA 5JSZB 4NMMA 1ELOA 1W0JD 3BRWD 1N6LA 2B21A 4P4TA 2QI9C 1YE8A 2A5DA 3AP1A 3CZPA 2WSSD 1ZD8A 2X1VA 2AX4A 3OIVA 4DCSA 2GJSA 1KK1A 2W2VA 4G5SA 3B2EA 4K46A 4JLKA 1Z06A 2ZUDA 4QJ5A 5EXTA 2QM7A 5CDFA 3THWA 2ECKA 4GZLA 2XSZA 4H1UA 1OFTA 1OIXA 1OYYA 4PXAA 4B3CA 4AY2A 2BV3A 4ZO4A 2AL7A 3TIFA 1RYFA 2J0SA 2G1JA 1HT2E 1X8KA 2FMXA 1F6BA 2GDJA 3CRRA 4U5XA 3QPVA 4DBLC 2PLFA 4M2LA 2QUZA 2WV9A 1NJGA 2V6IA 2ZU0C 4LRWA 3GFPA 2OXRA 2WMOB 1E2PA 4N0EA 4PZYA 2J87A 1ANKA 2G0NA 1Z3IX 1Q1BA 2XAUA 4UXJA 4NP6A 5JFGA 1SXJB 3BXZA 2NG1A 4LV6A 4YMVA 3LNCA 4JJKA 4Q5IA 3IGFA 1G1MA 4V0KA 5FTJA 1F3OA 1VHLA 4US1R 3EW9A 1GRNA 1W1WA 1XZPA 3SU8A 4PC1A 4NTZA 2CLCX 1J8YF 1YJ5A 3ADDA 3BC1A 2QRZA 3WYFA 4Q00A 2D62A 2Z83A 2WAYA 3HU3A 4WXRA 1DAIA 1NG1A 4BLTA 4OHVA 2FOLA 4IJMA 4DT1A 2OHFA 3DEFA 4WZ6A 4CIDA 4HLCA 1WRBA 4PO8A 4BLQA 1DO0A 1E9FA 2WOOA 4U7DA 1PLJA 4TTQA 4D4KA 3K70D 5FOXA 4NYMR 5JZVA 1SHKA 4JSYA 3TR0A 4B71A 2C96A 5FTKA 1JQJC 4Q7JB 4FN5A 4C0JA 1R6BX 2ZJOA 5AWFC 1BS1A 1GILA 1UJ2A 3UXMA 1QHHB 5FBLB 2RAPA 3WBJA 1XP8A 1OFIA 2J7KA 3X1WA 2XZPA 1VTKA 3VU9A 4G5QA 3AKEA 1P75A 3KB1A 3ZLJA 4PC3A 1E6CA 1DVRA 1YR9A 2XB2A 2FH5B 4B3BA 3B8HA 2ZANA 3K0CC 4HAXA 2ZAOA 5TMPA 4W9MC 1GAJA 2V55B 4NDZA 4Y0AA 4AG5A 3FKSA 2NO1A 3U4QB 2OAP1 3B85A 2EQBA 4Q21A 1JXOA 3OEHA 3U44A 5GVSA 2FPKA 2ZI9A 1NVUQ 4DSNA 4JVSB 1BMFA 1VCNA 2GZDA 4LBZA 1QZXA 4M1SA 1GL7A 2OBLA 3GCGA 2A2ZA 4FMCF 2HJGA 4F38A 3DO6A 5EUMA 4NPHA 4YMSA 3GLIB 2R2AA 2VF7A 1GTVA 4XOIA 2F6RA 1ZM3A 1DEKA 2ZRIA 2WWFA 2FSFA 2ZAMA 3OIYA 4Q18A 5JI3E 1Z6GA 2NOAA 2GK7A 3Q85A 1A1VA 2VSFA 4LYHA 5HKKD 2W6IA 3NIBA 4UKDA 2P5SA 4MRVA 2ANBA 4GP6A 2ZVQX 1NKTA 3AGPA 4B44A 2C03A 4PHHA 5FL7A 4LV8B 2IS6A 4HB3A 4Y0VA 4DXAA 1EG7A 1EFHA 2WJIA 1X1SA 1EK0A 1AM4D 3K9LA 4ZIRA 4CEJA 3QOFA 4BZPA 4XJXA 1EFRD 4QBFA 4TZ0A 1RZ3A 2G88A 3WXMA 1US8A 5F9FA 2CHGA 4IOKA 2XZLA 3FVQA 1GRRA 2XEXA 3CUEF 3GJ0A 1HURA 3CX8A 1S1CA 4RZXA 2CLDX 1XJCA 4Q1EA 1D8TA 1P4SA 2DFNA 4LK2A 1FMLA 4DLZA 2AFIE 2FDCA 4B76A 1VKJA 2J46A 5CK4A 1JAHA 2FZ4A 4WZBE 1MKYA 4RKEA 1UDXA 3THWB 3B5JA 1OKKA 4XH9B 4F7WA 5EZ5A 2VSXA 4OHWA 1T3HA 5KSYA 4LHZA 2FJUA 3M6AA 5IT5A 3PENA 3L0IB 4TYQA 2I1QA 5B57C 4LZZA 2QQEA 2OFOA 4JLPA 1O87A 1I2MA 1KDOA 3QXXA 4OHXA 4HB4A 1VIAA 1Z83A 1FW6A 2WIBA 3LD9A 2J1LA 1R8SA 1XFAA 3GEIA 1EFUA 3IQWA 5J4VA 5FPHA 2ORIA 4EPWA 4Q4JB 4F4CA 3BJIC 1OSNA 5CLLA 2CHQA 2EFHB 3BB4A 4TLCA 3ZZ0A 5K8UA 3IO3A 4OI1A 3KJIA 2F9LA 5JEDA 1Q21A 1S0UA 2ZR0A 3SHFA 3FMPB 1FTNA 3SC3A 2CNWD 5FPYA 2DFLA 4FCTA 1L2TA 5JI2E 4G5GA 4TWZA 1OYWA 3ZH9B 2EWVA 3THYA 3R20A 3TNFA 2GF0A 4GT1A 4HAYA 1HE8B 4BLRA 2OLKA 1P5ZB 2HF9A 4M8NE 2F43A 2UZIR 3ZJYA 3W8RA 1R0ZA 4D0NA 1JR3E 3KFXA 1D2EA 4IXMA 2E9SA 1K5DA 2AK2A 4B3XA 2QA5A 1IJEA 1Q57A 2JLXA 3U7GA 1CIPA 5B64A 2DHRA 1NN5A 3NBZC 1XXHB 4P4SA 1LTQA 4JS0A 4ILEA 4RVCA 3IEVA 2PEYA 4AKIA 4IDPA 4NL4H 1M7BA 3EZFA 5FUVA 1XD8A 3UIEA 1CBUA 1GFIA 1W5SA 2XNDA 1ZM9A 4QNMA 1T5LA 5FTLA 1OXVA 1KI1A 1E1RD 1VDZA 3DM5A 4TLBA 1QHIA 2WIAA 3GMTA 1AS3A 3RC3A 2PCLA 3NBXX 4TMKA 1XTRA 3GJ8A 1FNNA 3KZ1E 1OH5A 2F3RA 3Q5DA 3X1DA 1YRBA 2A5FA 2BBOA 2QU8A 2W83A 1BO6A 3B9QA 1CJUC 1JR3A 4H9GA 3QKSA 2D4HA 3LO5A 1H8HA 1R5NA 1XEWY 1N5IA 3VU9B 4AWXA 1R5OA 2ZEJA 4QL3A 4LGMA 4HZUA 2JATA 1TU4A 2F1IA 4NCNA 3LQRA 5LB4A 1OV4A 3P32A 1CJKC 1WXQA 4KV9A 3W34A 4ESHA 1U0HC 2RKOA 2VQSA 1XCMA 4DLWA 4LSGA 1XBTA 4Z51A 3U3JA 1E2HA 3U2QA 3U5ZB 5FOTA 4ERNA 4EFNA 4DHEA 4UJ3A 5K8TA 4HDOB 2D7DA 4MUAA 2VP5A 3GEEA 1CRQA 3E2IA 5KDOA 2YC2C 4LJYA 4RCZA 4WXPA 3A58B 3U6KA 1CP2A 1N5JA 2A78A 2QPAA 2CK3D 2F1HA 4GZMA 4WVFA 4FWIB 1G4UR 2N1BA 2V4ZA 1ESNA 1Z0KA 3HPRA 4BLOA 1ZIOA 4QG7A 3CR7A 2CLSA 3FHCB 3TW4A 3ND9A 1TEXA 1GRQA 1KJYA 1XRJA 2H5EA 1KI4A 4ZDIA 1M6NA 4JLNA 4ARZB 2GJ9A 2SHKA 1R10A 1E79D 1Z0FA 3FDIA 4B35A 3EPKA 4MYTA 2XTMA 4KSBA 4B74A 4EDHA 4OL0A 4OK6A 4M1MA 2GJKA 2PCJA 4MRRA 2VHUA 4M53A 4TL7A 2ODWA 2G1KA 1W0JA 3VMFA 3AF3A 1N6RA 1OXXK 2IYSA 1E3MA 2RGGA 1BH2A 4V0MA 1P2SA 4RZ2A 1W47A 2XXAA 4C7OA 3ZVNA 3R9XA 4I1OA 4R9UC 4Q4HA 2IUSA 3R9WA 1A2KC 1P73A 3IPYA 3DZ8A 3H84A 3MD0A 2IYVA 5G41A 3EC1A 3IQXA 3ADCA 4MKFA 2Q0HA 3SYNA 2CE2X 3BBPA 4K81B 1G18A 1U0LA 3CF6R 3VKHA 2EFEB 4LX0A 4HSEA 4HAUA 1Z6AA 4A8JA 4LYAA 4U02A 2XB4A 1YZGA 3OIWA 4Q9JA 1VCIA 1IBRA 3WNDA 3GJ5A 4POAA 1VG9B 1DAEA 2WICA 5EE9A 1UF9A 3MLEA 3TAUA 3WMFA 3MG9A 3SOPA 3NWJA 1IM2A 5CIWA 1NMZA 2AWNA 4CT5A 5CM8B 1Z28A 2NQ2C 3AUXA 1KZGB 1EX7A 4PZLA 1S3SA 3BORA 4Z54A 1JEEA 4FMDF 4FXPA 4FWTA 3GLFA 2IYWA 1AA9A 1SKYE 3IDQA 3L0SA 1TQDA 1CRPA 3GFOA 4TL6A 1GL9B 1QVRA 5KNBA 2W00A 2F43B 3ND8A 3OEEA 1Q3HA 4QM6A 4NHOA 2H8KA 1E2FA 2F1JA 1GKIA 1N2CE 3N5CA 4MQBA 4R98A 1XMIA 1ZU4A 3MFYA 4JLBA 4RD3A 1WQ1R 2OXCA 4PQFA 1N6IA 2BKEA 2GXQA 1YU9A 4JL6A 3W6PA 4B3GA 2ZYUX 3AB3A 4MA4A 2RGDA 4TL9A 4WIAA 4EUNA 3BGWA 3MWLA 4A82A 4D82A 3CPHA 3KJEA 3NEYA 4DWJA 1ZBDA 2WOJA 1UPTA 2UZ3A 1CR1A 1TUIA 4C0BA 1GIAA 2G77B 4DJTA 1QRAA 3AVUA 5DH9A 2HEIA 3CBQA 4NCHA 4OQNA 1JPNA 5DYIA 1NN0A 1T4GA 1Z8FA 1AZTA 2KE5A 2ZJ2A 3EASA 1XMJA 3IEUA 2VP6A 4F92B 1P61B 3IIMA 2EYQA 4QM7A 4AG6A 4LDJA 2ZTSA 2JLWA 3K1JA 2ASEA 4G3XA 5KSOA 2NO0A 3QF7A 1ODFA 2BCJQ 1OIVA 4C4PA 2IK8A 2JAQA 1CR2A 1X1RA 1ZC4A 3CNOA 1CR4A 1U90A 5LD2C 3NH6A 2F55A 3CNLA 3I1FA 5HR5A 4NU0A 3W5IA 2PX0A 1AJEA 3O8DA 4JL5A 1KMHB 1H8EA 2IW3A 3A8TA 3PUZA 3P26A 2PX3A 1QVAA 4C2UA 1AS0A 4NYJQ 4Z8XA 1XCGB 3LW8A 5A0FA 4C2TA 1UKYA 2P6RA 5HPYB 5EP4A 4ZDWA 1G291 1AN0A 4Q02A 5CYPA 4TQAA 1FZQA 5AJYA 5JRJA 4P3YA 5BN3A 2C95A 2KBFA 1B23P 2R8RA 1TF7A 1VECA 4KU4A 2PEZA 1IXRC 3AEZA 4F93B 1EFRA 2ZRNA 1R7RA 3LX5A 5JHGB 1KNQA 5DHAA 1G8PA 1SXJE 2QE7D 2X2FA 2IXGA 1RVDA 2FE4A 2OESA 2BMEA 2J0UB 4C7OB 1QHNA 3ICQB 3BFVA 2LKCA 2GTPA 4BFVA 4JBYA 3B6EA 2G9NA 4KFUA 3G0HA 1XTKA 1E0AA 3K53A 1T6NA 4DSTA 4CGZA 1TEVA 1Z6TA 1T8TA 2VPPA 2VSOA 1RE0A 3A1TA 3FYHA 2OILA 1XU4A 1OW3B 3C7KA 1N5KA 2IHBA 4JMPA 2ZPTX 4RD0A 5JECA 4DLVA 2PT7A 3QJYA 1YVDA 2QPOA 4OI4A 4UJ5A 2JASA 3T1QA 4QRHA 3MSXA 2PZGA 1CKEA 1EFCA 1SXJA 3QEJA 1JAIA 1GSIA 1DADA 1O3YA 1MO4A 4OJKA 4BRWA 5L3QB 2YVUA 3K0FA 4D4LA 2BOVA 2ZRDA 3TAHA 2FZLA 1WF3A 4RZUA 2WMNB 2JJ1D 4U00A 4C0QC 1E2IA 1T9HA 1UKVY 2OCPA 3PCRB 4J0QA 4OI2A 5AJZA 4PC2A 4YXWD 1XCPA 3C8UA 1AZSC 3LVRE 3ZS8A 1SVOA 4A0GA 5BYKA 4B3FX 5FOUA 2FPMA 2GILA 2ZJZA 4M1YA 4PZZA 4D80A 1VG0B 1YZUA 3Q5EA 2O0HA 3ZQ6A 5HZHA 3W6OA 4LY6A 3W8NA 5KPJA 3SBEA 2V9PA 1QHSA 2V7QD 1AK2A 4LUCA 2A5JA 2REXB 4JLOA 4E22A 1CTQA 3RS7A 2OLJA 1W49A 2IA5A 4DDVA 3EIQA 5KNCA 5EP3A 1KI3A 2FNAA 3FMFA 4C0SA 1KDTA 4LHWA 2B8TA 1M8PA 3AVYA 1VCMA 1H65A 2OUKA 1QHHA 4IVPA 4KO8A 2WPDD 1DG1G 3W6NA 1OH8A 3K70B 3GLIE 2O8FA 3DL0A 4QJ4A 3NC1C 821PA 4GDFA 3ADBA 1E1RA 2E87A 1KSFX 2GRJA 2BCGY 1LNZA 3TUJC 1E2EA 1W2GA 5CM9C 1KKMA 1E9CA 3LY5A 4QXAA 3AVQA 1LW7A 2W6JA 3SS8A 4NONA 3KTAB 4MYCA 3RWMB 3ZVLA 4ZPXA 1TF2A 3TR5A 2CCGA 1QF9A 1FUUA 2QTVB 3THXB 3TJZA 2ZRLA 2WWYA 2GAOA 2B92A 2KWIA 5C2JB 1N0WA 2D06A 1CU1A 4B73A 4RJLA 3IKJA 2RGXA 2W0SA 1J8MF 2ZRMA 3S1AB 2G0TA 2P0EA 4DCUA 3GLIA 4C0AC 1E69A 2PMDA 3T35A 3EARA 2PBRA 4IKEA 1G7RA 4BEJA 5HE9A 1L8QA 4A0HA 1VG1A 2LWIA 2WM9B 3ICEA 2AD1A 2AK3A 1OPXA 1UEJA 3EIEA 4NCKA 5B58C 5KO2A 5F3WB 4A2PA 5C46F 4IFBA 3VX3A 3HU1A 3KUCA 4TL8A 4FCVA 4I4LA 5CDFE 4HEJA 3PUVA 1F2UB 3BH0A 4X8OA 2L0XA 4A1FA 2IS4A 3KKQA 2WJYA 1HY3A 3LA6A 2PJZA 3A36A 3FMIA 3PR1A 4GOKA 3VR2A 4FI3C 1YZNA 4YDSA 5A4JA 4D81A 3T15A 3EA0A 4PHGA 1XEXB 4IEIA 2W58A 3I92A 5FTMA 3CRW1 1NMXA 4IVRA 3ZYCA 5E4FA 4E09A 5JBQA 3SQWA 1KY2A 3JVUA 3QPWA 2E1RA 1L4UA 1ZAKA 2CVFA 1NY6A 4IOLA 2ZRAA 2J5XA 4HZIA 1WMSA 1ETUA 1Q1QA 2AXPA 4GSYA 1Q22A 5DI3B 3AGQA 4B6FA 1E9EA 3AQ4A 5AUQA 5J5CA 2BC9A 2I4IA 4DLXA 3LVQE 1E9RA 2ZJ8A 3V4RA 5G40A 4DB2A 4OKSA 1TUEA 3ZVRA 1J7KA 2RGNA 1XD2B 4Q48A 3PEWA 2WWGA 1F2TB 2J41A 2MSDB 1G8GA 2BHRA 3LH5A 1D5CA 2CHVA 3LXXA 1COWD 2DFKB 2REBA 1Z07A 1M1YE 1SZPA 3BOSA 4YLGA 3KXLA 3L0PA 1FX0B 5EE1A 2QAGC 2WTUA 2OAQ1 1S96A 2R6FA 4ITRC 2Z43A 3UKDA 3EZ6A 5IRCD 2RB4A 2QT1A 4IRUB 4KYUA 4ASUD 3LBIA 3PIRA 4A15A 4Q4JA 3ZVMA 1XXHE 4ZI2A 1Z0DA 3DZDA 3K09A 1HE1C 1G7CA 3RRYA 1KMQA 3K0FB 3H2YA 4Q9HA 2MSCB 2ZRJA 1CLUA 5EJEA 5DHFA 1UKEA 3VNVA 2ODBA 1KI7A 1MABA 5C18A 2C2HA 2Z4SA 3I8SA 3KKMA 3BD9A 1XZQA 4HLUA 4LWZA 4URVR 4PO1A 4LPKA 2ZRGA 4Q1DA 1GUAA 1P60A 2F7SA 1HQCA 2QBYB 2HV8A 2QORA 4NBSA 4FMDB 3VR6A 1E0SA 1NLYA 3IBGA 4O25A 1KO4A 1ESMA 5CJPA 4I81A 4TT3D 1XXHA 4YDHB 2OBNA 1Z6YA 3JVVA 5E95A 1P7CA 5M04A 1N6PA 2KJQA 4EFMA 3KFVA 1RYHA 4DLRA 3PEUA 3DOEA 4GOXA 4X8HA 4QHSA 2F9MA 2IYZA 1M34E 2JA1A 3VR5A 1BOFA 2DYKA 1VMAA 1S1MA 4Z1MD 1S4QA 3NDBB 3ZD7A 1G21E 1Q44A 2HYDA 2AN9A 3VAAA 2ATXA 2IYRA 2V8OA 2O8FB 1U8ZA 1N0VC 1UBCA 3RS4A 3FKQA 4UNNA 2IT1A 2LKDA 3VR4A 3QENA 1P2TA 1LVGA 3EZ7A 4LJ8A 2QT0A 1RPZA 4M4SA 5AUOB 1G8HA 4ZI3A 1R0YA 4AYXA 1K8RA 4LC1A 1W4RA 2OE2A 2ORVA 1AKEA 4A8JC 3OE7D 3RLFA 3ONWA 2IYTA 2HLDD 2YWGA 3B1XA 4G0NA 4G01B 2JIZD 5C1BA 2O0JA 2WWHA 1Q1EA 1ZP6A 2ZS9A 2ZM5A 4PR0A 2A5YB 4CZ2A 2JLUA 1GL6A 1NMYA 3R7WB 3OF5A 3UWOA 2GWHA 2BJVA 3RRNA 1P3JA 4UQOA 3KB2A 3N2EA 4M0LA 5JJIA 3MWYW 5H1YA 2I3BA 4TLEA 4F4JA 2PT5A 1IN8A 3QG5A 1OH7A 2AHOA 1E2MA 2BVNA 4LHXA 1BYUA 5J4YA 2ZRBA 2VLIA 2FSIA 4ARZA 2IHYA 3U3RA 1Z29A 5E3HA 1G4AE 2BIFA 4PTLA 1IN5A 2A30A 3ASYA 3I3SR 2ZUBA 2ONKA 1P2VA 1VYUA 2CXXA 3G82C 3SYLA 1U94A 1KI2A 2EWWA 4MUBA 4BFWA 1W36C 3HJNA 1GNQA 1X8JA 2XOKD 4BFTA 1DAHA 3AKDA 4TQ9A 1N5LA 5GJBA 3L8ZA 4M9XA 2O0KA 5TDHA 4C3ZA 3NC0C 1ZNWA 3T12A 3O47A 3UMSA 4IFEA 2IXEA 2GBLC 1JECA 3NKVA 3W5JA 3EWSA 1WBBA 1KI6B 2QE7A 4BLPA 1U2RA 4PQRA 2P6NA 4S35A 3T1VA 2QP4A 2B8WA 5SZJA 3ZGXA 4DDUA 1WA5A 2QTFA 2ZI6A 2OFWA 2H16A 3I5XA 3V9PA 3QSYA 4PAMA 4ACAA 1XX6A 121PA 4PHTA 3B1VA 2IXFA 3PUYA 4LBVA 3NHAA 3OAAD 4CEIA 1OFHA 4DB4A 5GJCA 1Z0IA 2CBZA 5EXPA 2GESA 4G1UC 5TY0A 4FW9A 3RYTC 3AKYA 3VX4A 4DIDA 3PUWA 2GXUA 2DWQA 5KDDA 1MABB 1WDTA 4MGYR 2BBWA 3QEOA 3RS3A 2XZOA 1RFLA 3LRPA 4LPSA 1FP7A 1D6JA 1T8UA 2KI5A 3BWDD 5LB2A 1OT3A 2B7CA 4HAVA 4ZDKA 2H18A 5J47A 3GLGB 2VEDA 1A7JA 3C5CA 1EX6A 4TZ6A 1ZNYA 3IPXA 3QXHA 5K8LA 4M1TA 3SDZA 4D25A 2IYXA 3A4LA 2J7PD 1G8FA 5EZ6B 1XD9A 4OK3A 1CJVC 3LX8A 4BFUA 2FF7A 4ZKEA 2QMOA 4XWOA 2EFGA 1NLFA 2QEQA 2DY1A 3RVBA 4US2R 2JCSA 2NIPA 3U61B 2O8EA 1KI8A 4EJSA 3P1JA 1ZNXA 3SJCA 4D26A 3GFTA 2V7QA 4CEHB 1FQJA 1YZQA 3UK6A 1E1QD 1W4AA 2WJVA 5FBVB 3KQNA 3EPHA 2CL6X 5DGXA 4LJ5A 4DEXA 2RCNA 2KB0A 4IDOA 1KK0A 3TE6A 1U0JA 2IEZA 1UEIA 3NG1A 5EQTA 2WPDA 3QXSA 5KU1A 4KFRA 1OLOA 1WP9A 1XPOA 2UVQA 3SBDA 5KNDA 4JLMA 2YHSA 3RRMA 2O8DA 1TAGA 1FMJA 2ZXUA 3T34A 2JLRA 4MITA 2ZUCA 1QG2A 1I2DA 1MOZA 3SNHA 1SXJC 3PVSA 5DN6A 5CK5A 1XPUA 3QKTA 2JDIA 4AYTA 4ZV4A 3LLUA 3DM9B 4US0R 2Z4RA 4RD1A 4TMZA 3LQQA 4KFSA 4OHYA 4AKEA 1GNPA 1KMHA 4EAQA 1RKBA 4IW3B 1YZTA 2DR3A 2C5LA 1TPZA 3ZQJA 4EPTA 4V0ME 3SR0A 1E2GA 2GZHA 2EU8A 2VP9A 3BS4A 3J81k 3F3YA 3GJXC 3HR8A 2HT6A 2JJ8A 3CX6A 5DO9A 4CW7A 3D7MA 1QBKC 3SE0A 2AKAB 1Y63A 4DDWA 2GCPA 1GKUB 3KKNA 2CE7A 1LY1A 3C41J 3WHLA 1ZD9A 3EX7C 2OCAA 1DO2A 1E9SA 2BM0A 5HE8A 3T1TA 4DLYA 1KJWA 1NVVQ 1HYQA 3B1WA 2ZETA 4XD7D 3ASZA 3CR8A 3WBKA 4A92A 2EVWX 1KO8A 2GEVA 4JVNA 5H70A 2IS2A 3IIKA 4BE7B 1GG2A 2ZYVX 2JGNA 2YINC 2A3RA 3MGCA 4AKGA 1KI9A 3EPLA 1XEFA 3DKPA 2J0UA 2GA8A 3I73A 2WSSA 2R9VA 3QVVA 4WBSA 4GI7A 1EXMA 3LAWA 1II8B 2XX3A 3FMOB 3SJAA 3OHMA 4O2RA 1VIYA 2EW1A 4GL2A 3MMPA 3RHFA 1CJTC 3RDPA 3UG7A 4EFLA 1VPLA 2JLQA 3GLFE 4KBFA 1FPMA 5L8VA 1G3MA 3TLXA 3ZZTA 2R44A 3A37A 5EP2A 2XSZD 1G64A 4GBMA 5CB8A 4R2IA 3WP1B 3R9IA 4D4MA 1EGAA 1COWA 1LF0A 3AP2A 5L3QA 4OQMA 4B2PA 3NXSA 4O3MA 1G7TA 3B1ZA 4QGGA 3K0CA 2R6AA 4CEIB 1NP6A 4E07A 4IHQA 3O8CA 4Q9IA 1LF5A 2WJGA 1DG3A 4QHYA 3HWSA 1PLLA 1YKSA 3UPUA 2JLZA 1EESA 2YNMA 1TQ6A 5FI1B 4DVGA 2QP3A 1SGWA 5SZHB 1UBFA 1VYVA 3Q7PA 4HAWA 2GEDA 1G41A 5FOSA 2ZSAA 5JCPA 1W7AA 3QNUA 2VHTA 4NE2A 1G5PA 4QNRA 5AJWA 1PJRA 2IS1A 5FL3A 4JSTA 1IOZA 2IYYA 3PUXA 3CIOA 4RD6A 4Q9LA 2WBLC 1N25A 3DMDA 2QGNA 4LV5B 4C0HA 3IUYA 1KJZA 2RGEA 5FI0B 3E70C 3ZIAD 3KDSE 3MCAA 4KI0A 4F91B 3FHTA 1AS2A 1ZNZA 4HLQB 4PSVA 4Q9KA 5EE0A 1X86B 2VP0A 1ZM2A 3IO5A 4V0NA 4AK9A 4XWKA 3MJHA 3TQCA 2BMDA 2ODNA 2O8EB 3PEYA 3CPJB 4Q19A 4EJSB 4Q4LA 4MH0R 1OIWA 2EFDB 2ZSBA 3SHWA 2YWFA 3THOA 1KYIA 3V4FA 4C0KA 5AUPB 2Q3HA 3PV0A 1W2HA 2IUTA 1XB2A 3H4MA 1IY1A 1M7HA 1XTIA 3W3AA 4GNKA 4D6PA 1P62B 1X3SA 5JMTA 4MDEA 2XTNA 4Z1MA 4HUTA 5LPNA 4W7SA 3KTAA 4IVQA 2ZI3A 4QBIA 3CLVA 3GP8A 1AGPA 4NYJR 4OQXA 4P0TA 2DB3A 3THXA 4UNSA 4B48A 4Q47A 3EC2A 1FL9A 2WWIA 2JLVA 2ORWA 1U9IA 1RIFA 3S1AA 2VP4A 4A36A 2O8DB 3WHKA 3FKSD 4TLDA 3B7GA 4TTRA 4PPQA 3OEHD 5CIQA 2JIZA 3FFAA 1BMFD 1E4YA 1YHNA 2PH1A 1VYTA 2FV8A 3DHWC 2FWRA 4URUR 4URYR 1IQPA 2FFAA 2HXSA 3EG5A 2FGKA 3QKRA 3M1IA 4FMCB 4QGFA 5BYJA 5KYKA 4LJ9A 3K8YA 4JJZA 1E96A 5D3QA 2ZSDA 4L15A 1F2UA 5JWRA 3EA5A 2VO1A 2WJHA 3AV0B 3HU2A 5HKKA 1FUKA 2W6ID 2GF9A 4PAQA 2R65A 3QBTA 2X19A 3FOZA 5UKDA 2C8VA 1XEXA 2P65A 1U8YA 4P4UA 4HB2A 1E2KA 1Z2CA 5FL7D 1QDEA 4BRUA 1GNRA 2AKYA 3PEVA 1U8AA 4K8OA 1CULC 2CJWB 1ZRHA 1NL3A 1NVWQ 4KVAA 4M9ZA 1PLKA 2Z6VA 4B34A 4MGKR 2J0QA 2F3TA 3F5FA 1XMSA 5DI3A 3LW7A 2XJ9A 1RJ9B 3OESA 5BWMA 1OJLA 4S2EA 2IBMA 3SEAA 4IDQA 3VHXA 3VKWA 3RRZA 3ZDQA 3GJ7A 3K0SA 2H92A 2NZJA 1E2NA 1XD2A 3GLHA 2J9RA 2A5GA 1T0JB 2XOKA 1F2TA 1SVWA 2ZREA 3A4NA 2NZ8A 3QVUA 4JT4A 4Q03A 4B3DA 5JRZA 5JJKA 1IXSB 1KSHA 1ZUNB 1P6XA 3NEJA 5L3RA 4E5UA 1FX0A 4DCTA 5AJVB 1YR7A 2QGZA 1NY5A 2I1VB 3FTQA 2FG5A 4JLJA 4LI0A 1P9NA 1NF3A 2P5TB 2YJTD 3CRMA 4PHFA 1NSTA 1W5TA 5KDLA 3IHWA 3M4YA 2UKDA 2YV5A 1Z6XA 3KJHA 2JJ2D 2WSMA 3CKLA 621PA 2IX3A 4W5HA 4JVMA 4FD2A 3HYRA 3I72A 4URWR 1CJMA 1ZM7A 2WWWA 3U3MA 3AP3A 4EIWA 4KLZA 3KQLA 3P4YA 4RSGA 1OH6A 3OAAA 3MAAC 3K0AB 2C9YA 3K0EA 4HI0E 3RAPR 4DCNA 3HDTA 4XSHA 2VH5R 3RWOA 2QBYA 1LS6A 3D31A 3UMRA 3F8TA 1RW4A 1KGDA 4UXIA 2CNWA 3LLMA 3Q8XB 4M1OA 4PQYA 3H86A 1XEWX 4GP7A 5JJLA 4QOSA 2ZS8A 1S9HA 4Q66C 1SKQA 1VCOA 2A7QA 3RS0A 4XTCS 1SVLA 5HCIA 5CITA 1IHUA 4A6XA 1K5GA 2NO7A 2VIIA 3DVLA 5DISB 4AIIA 2QPTA 3D6TB 4HLDA 2IL1A 2C78A 3O8RA 2RHMA 1NBMD 721PA 2Z5FA 3UG6A 1KAGA 5LDDC 4PO9A 5D3MB 3BIFA 4ZKDA 3HP1A 1R0WA 2IF0A 4KYIB 2XTZA 2GXAA 3CM0A 2F1RA 2QTHA 5F9HA 2FEOA 2BKUA 5E7MA 1ZC3A 2ERYA 5FPKA 2DWOA 1TX4B 2OFXA 3MRSA 1G3RA 2ZROA 1GVNB 2WAXA 4TMTA 4DUGD 4EQ6B 4LYJA 2EFCB 1U99A 4PX9A 4DSUA 4JVLA 1E98A 1OHHD 2GVDC 1Z47A 2XNSA 2VBCA 5E7JA 5TV2A 4BUJA 1E1QA 1E4VA 1AGRA 2QAJA 2ZRKA 5FPTA 2ZSFA 3X1XA 4DC9A 1RRGA 1JR3D 1IN6A 1KDPA 2FU5C 3WNCA 3AF4A 1CF4A 3W9YA 4Q4AB 1WE2A 4RKFA 1G3UA 3KUDA 3H1TA 3RNLA 1CXZA 2QRNA 3CNNA 4HDQB 4DCVA 4LCBA 2GEUA 4AC9A 3R7WA 1A5TA 1OXSC 2ERXA 4JBWA 1E32A 3AKCA 5FUWA 4GMXA 3RC8A 1E94E 2QG6A 4JL8A 4TMVA 2REOA 1S9DA 3B82A 1DELA 4IEEA 1G9XA 3SZRA 2PL3A 3DPUA 2A9KA 4B6EA 4C9BA 1L7VC 2CDNA 1ZIPA 2C9OA 2YOFA 3QKRB 4QBHA 3B9PA 1YZKA 2CL7X 3B60A 3GD7A 4NYIR 5KOYA 2HUPA 2P2LA 5J4KA 3PJRA 1LFDB 2CK3A 2ONJA 3L0OA 4Q1FA 1LS1A 2WJJA 1IONA 4MYUA 3REGA 5IK2D 1KDRA 3BH7A 2NO6A 4Q7MB 2ZE6A 4V0LA 1ZU5A 4C30A 1P9WA 1DOAA 1XJQA 3FE2A 4PANA 4URZR 3P20A 1E79A 1Q1ZA 1R4AA 3KQUA 1GZSA 5DLQC 1ZMXA 2YWEA 4XD7A 3LXRA 4CDGA 5G3ZA 2NO9A 2X8AA 1SHZA 3KXIA 2ZJ5A 4NYIQ 1KTVA 1KI6A 1SQ5A 4TMWA 3GLHB 2FN4A 1KSJA 1YZLA 3O8BA 3CW2A 4TSFD 5P21A 5JWOA 5C4MA 2IC5A 1KIMA 4I1VA 1E2DA 2JEOA 2QN6A 1JALA 4MRSA 5FPSA 3GLGE 3RSOA 5JWHA 1P2UA 3QQ5A 4BFSA 2FX3A 4M9SA 3IBYA 3IHLA 5KSPA 2CMKA 3OFND 4EQ6A 5KUTA 3TUIC 4CYMA 4LJ7A 2LCFA 4NKRA 2HXYA 1GDDA 5G3YA 5E7IA 4PPFA 3PXGA 4B2IA 3T06B 1NRJB 2QNRA 2WKQA 2O8CA 5GJVC 1V43A 3ZZUA 3CO5A 2GHIA 4BFXA 2V3CC 5TVKA 2OCBA 4NZYA 4DLSA 2MSEB 2O5VA 3P4XA 1CEEA 1MV5A 3GLGA 5EUQB 1UBEA 4P32A 3FHOA 1T5IA 1GITA 2PZEA 3MUFA 2ZR9A 1IAQA 1DS6A 4GMDA 4LBWA 3AVVA 2OV2A 1Z5ZA 4FINA 2BBSA 2QP9X 3PITA 4L5BA 2IWHA 4B47A 4BQSA 3VFDA 5B30A 3OEED 4RFVA 2FEMA 2Q9BA 2ZQ5A 2ANCA 2GCNA 3EZ2A 1D9XA 5CLQA 1N3BA 1G16A 1R8QA 4LJAA 5FOVA 3A1SA 3C4JA 3EIHA 4I99A 2ZIAA 4CEHA 5J40A 4QC2A 4B75A 5FTNA 4LJ6A 2BEKA 1HEIA 4Q1CA 1W36D 3ZIAA 4YONB 4XIGS 3X1ZA 1E9DA 2GCOB 4JLDA 1ZINA 4CRWB 1GP2A 4N3NA 3UMFA 4D0LB 3NTUA 2QZ4A 2OEPA 1UADA 2J45A 1II0A 5FOWA 2PJRA 4A4DA 4PC7A 4AYWA 4DEYA 1Z22A 1QHYA 2W2TA 3CH4B 3CWZA 2C9CA 2AWOA 1F48A 1EFTA 1AIPA 2FFBA 3QY0A 5JCZA 2Q6TA 3LV8A 4D4JA 4KAXA 4Q1BA 3SYKA 2VYFA 3JZMA 5FBWB 1UAAA 1QHGA 2R6CA 1WBDA 2G83A 4V0OA 2Q3MA 4EPYA 4EPXA 1N6NA 2ATVA 3GQBA 1TADA 2OO7A 1IJFA 4Q7LA 8OHMA 4I1UA 1TTTA 1NN3A 1G17A 1NIJA 2QQ0A 3UATA 4RY2A 2Q21A 4AKHA 3ETLA 3Q3JB 3NHBA 4A9AA 1HV8A 2HJVA 4NYMQ 2ZJAA 4RCYA 2OSBA 3I4LA 4KLNA 4MKIA 5FH9A 1DARA 3TSWA 2ZYWX 3PFIA 4BEBA 3SN6A 5JEEA 1A4RA 1DPFA 1P9RA 1DBSA 2ZI5A 1D2NA 4Q4HB 2ZS7A 4BLSA 1N6HA 1H8ED 1J90A 1DAMA 1N6KA 3UWKA 1DTSA 2YOHA 3N2IA 4XVQA 6Q21A 1OXUA 2Z0MA 1G6HA 2NTYC 3QPUA 3PQCA 4QGAA 1FQKA 2VRWA 2QROA 5EE5B 3EPJA 5CYOA 3BH6A 2KBEA 3W90A 5BN4A 3G5UA 2C98A 2ZVPX 4QKQA 1II8A 1Z2AA 3NBFA 1FOEB 1UDWA 2W2XA 3CONA 3K70C 3A1VA 1I4LD 4L4UA 1S8FA 5EXSA 4ZDJA 4MKGA 3TUZC 4AD8A 1X6VA 2HCJB 3V00A 4BFYA 3TSZA 3WMGA 1XPRA 5GJWC 4V02A 5L3SA 1XJ0A 3QF4A 3FFBA 3U60B 2VHQA 5EE3A 1XWIA 4HATA 4OI0A 1D2MA 1BKDR 5AK0A 2J59A 2QY9A 1XDBA 5IDVA 1NN1A 2DBYA 3OZXA 4BECA 1WCV1 2NPFA 4DDTA 1KOFA 1U9IC 4QBGB 3U6BA 4B32A 3KQHA 1V5WA 2HT1A 4A2WA 2OT3B 1MH1A 3WRXC 2YKGA 1TU3A 2J0VA 3TK1A 2O8CB 1KO1A 2VF8A 1SXJD 2Q9CA 4II7A 2V54A 5SZIA 5FR1A 1E2QA 2JJ2A 3BE4A 4JLAA 3TBKA 1M7GA 3TH5A 4DIEA 2XGJA 1MO5A 2H7VA 2JJ1A 1R5BA 1NBME 2PZFA 4LC0A 1X8LA 1F60A 2VHCA 3CF2A 3AVPA 3TMKA 4DLTA 3TQFA 1T3LA 2P6UA 3WNBA 2WVJA 2CEAA 3EZ9A 5FUYA 3GJ3A 4YXWA 5LD2B 1KK3A 4DSOA 1M74A 2ZE7A 2RGCA 1W4BA 4LBYA 1FTSA 3AVXA 2VL7A 1TQ4A 4C0LA 5JS8A 1KHTA 1JI0A 3U3OA 2RGAA 3B1YA 3C16C 3E5HA 1D9ZA 1L4YA 4ZCMA 3WRYC 2NMVA 2V1XA 1NNEA 2GXSA 4TN1A 1FNMA 3WP0A 2Y8EA 2ZYTX 2AFHE 3VKGA 2BEJA 1NBMA 4AI6A 3NDPA 4GRAA 4B33A 4TTPA 3OIUA 5B2ZA 4FIDA 3DDCA 3DKVA 3DOFA 1CS4C 1MO6A 4DT1B 1BIFA 3FPAA 2FSHA 4NH0A 3RANA 1KO7A 3UANA 5FUXA 4KITB 3HYTA 4PPNA 4ZCIA 4JIMA 2P67A 1MT0A 3NH9A 1NKSA 4PSAA 4DUGA 1CR0A 3K9HA 1OE0A 1NLZA 1OF1A 1G5TA 4YMUA 1DAGA 1OHHA 1ZUIA 3C5HA 1JJ7A 2W6JD 3L8YA 4IDNA 221PA 3LWNA 3BK7A 3VHLB 5DIFA 1NVVR 1PUJA 5KHOC 1TMKA 1T0HB 2D74A 2IYUA 1Y3AA 1AQYA 4X8MA 1OXTA 2ZJBA 5DSZA 1Z08A 1PUIA 1T3SA 2QAGA 1QHXA 5FBQB 3IILA 1E0KA 3SJBA 4IXNA 3KXKA 1AQUA 2H17A 3CWQA 4FMBB 3MWJA 3U44B 3H0KA 3HR7A 1YR8A 2N42A 4M21A 1JBKA 3TVTA 3NBYC 4URXR 3N70A 5H68A 2D2EA 1W0KD 2IF2A 4KHZA 3A1UA 4NCJA 1KKLA 1NJFA 4N1AA 1DAKA 4BFZA 1XMVA 3PG5A 3F0TA 3X1YA 1J2JA 2CJWA 1DE0A 4M22A 5IK2A 4MKHA 1RJ9A 4RD4A 3SFZA 4UNPA 3I5YA 1JQLB 2GJ8A 5AUNB 4Z8YA 4DZZA 5K8IA 4G5OA 1G8YA 1MO3A 3QUSA 4PSKA 1IY0A 5DE3A 1GOTA 3TW8B 4A2QA 1JPJA 1IXZA 1ZCAA 1PV4A 3CF0A 4PPGA 4ZIRB 4CEJB 4UXHA 1E2LA 1I4DD 4P31A 3A6PC 4KVGA 2QM8A 2ZU6A 4W5WA 2R6DA 1YQTA 1US8B 1NVXQ 1Z0JA 4YMWA 3W3ZB 5L3SB 5HTKA 1ZD1A 2V6JA 4CT4B 4TYNA 2QSYA 3QF4B 1G20E 4M1WA 3U7HB 3RSLA 1F5NA 1SVKA 2YWHA 2BDTA 1KZ7B 1B0UA 1HH4A 1W44A 2TMKA 4LHVA 4TSFA 4XVRA 5TB5A 3I32A 3I8XA 4TYWA 2VA8A 2XITA 3KKPA 4Q1AA 4O2LA 2B6HA 3L43A 3SFVA 4IDHA 4A0FA 4Q7KA 2ZI4A 2D2FA 1IY2A 2CCKA 1T91A 4P33A 4ASUA 4ZCLA 5BN5A 3OFNA 3K0AA 4M9QA 3BFKA 5KTYA 1FP6A 2AD5A 1K6MA 3LFUA 5L3VA 2BMJA 3DMNA 4HUQA 2IYQA 3Q7QA 1Q12A 2AR7A 3KQKA 2YYZA 1SVSA 3VR1A 5DI9A 3HPQA 1JEDA 2AXNA 1II9A 4BASA 3VQTA 3WYAA 5CB6A 2ZRPA 1KK2A 2BMFA 4XWAA 1C4OA 4N0DA 1XTSA 1TQ2A 1TF5A 2B7BA 2QMUA 3CX7A 4TT3A 1Q3TA 1XTJA 1ONBA 4WAUA 2X2EA 5D3MA 4YMTA 3THYB 3T1OA 2VTKA 1G5RA 3AH8A 5F2EA 1G19A 3BB3A 3MWKA 4UNRA 5C4GB 2YZ2A 1RC8A 3RS5A 4JBXA 3QXJA 1NIPA 1KSGA 1JJVA 1A2BA 4LYFA 5TARA 3EWAA 1EWRA 2W0MA 4Q01A 2WZQA 4L9WA 3AVWA 1NSFA 1AKYA 5EP1A 4D0GA 2GK6A 2BM1A 1IN4A 2DPXA 2BJWA 2RGNC 3CH5A 1GKYA 1LV7A 1MRNA 4P4SB 3U3KA 2G3YA 1SVMA 2WKPA 4NCIA 2IUUA 3I62A 2Q9AA 1HA3A 4HYYA 3T5DA 2MMCA 1UKZA 4CF7A 3K9GA 4Q4AA 4FCWA 1WB9A 4L9SA 3GJ6A 2VP2A 4JT2A 3RS2A 1E2JA 3LDAA 4JZKA 1P72A 2FPLA 2GETA 3FB4A 4B2LA 2ZJYA 3D3QA 5F98A 2GBLA 3A1WA 4RFSA 5AJXA 3RABA 3I61A 4GPTA 2OBMA 5CJ2A 3QKSB 2ZSEA 3OE7A 3K09C 4HDCA 2HLDA 4QHTA 5KSZA 3FWYA 2DCUA 1Z63A 3WMEA 3LBNA 4HZUB 3ZS9A 4TYPA 4YQFA 5GADl 1ZM4A 2QAGB 4HLUC 4TYYA 1VHTA 4QFMA 5KPDA 1E9BA 4JYCA 1HT1E 4L8GA 1BYIA 1Q20A 4TQUS 2FA9A 1J70A 1LB1B 1SVIA 3EAQA 2GZAA 3GLHE 5JHHB 2OZEA 4JKYA 3T5GA 2OCYC 5TXGA 2QMHA 4KSCA 4DKXA 2O8BA 2K5UA 3SQXA 4MRNA 3SJZA 2FGJA 2ZE5A 4F4IA 4KXFB 3GPLA 1MR3F 2J3EA 4O0MA 2WWXA 1RRCA 3TRFA 2RMKA 4R2HA 4XVUA 1KNXA 1JR6A 3QE0A 3A4MA 4DRZA 2WHXA 2VHJA 3JZAA 3QKUA 4PC6A 4AURA 1KO5A 3ECCA 4ESVA 2IWRA 4OYHA 5EXXA 3CB4A 4LOAA 4XTRA 5JSZA 4EKDA 5JS7A 1E0JA 1C9KA 5SZKB 3QG1A 4H1VA 1XF9A 2O52A 1JB1A 3WYGA 3NVAA 4G5RA 5ELXA 2HYIC 1KY3A 4MGIR 4PFSA 4GFDA 1JNYA 5DYGA 2N46A 4CVNA 2V1UA 2ODEA 3AVTA 4ON9A 3MJRA 3SI7A 2D3WA 2C99A 2ZITA 5HCNA 2HCBA 2GJAA 2ZR7A 3KL4A 4JYBA 4KFTA 3R8FA 4TLAA 1OB5A 3L82B 5DN6D 2HDNB 4BGDA 3VNUA 5FR2A 4WA7A 1OKKD 1YRAA 3CZQA 3AF0A 2H1LA 2JLSA 4L16A 4WOPA 2QSZA 1E99A 3AVOA 3QXCA 2XXAB 4LJ4A 2PLRA 3ADKA 4OK5A 2P3SA 2R62A 3Q9LA 1J99A 3B13B 1SULA
chains in the Genus database with same CATH superfamily
4ZCRA 4MW4A 1XQ1A 1V95A 2F62A 2OM2A 2FOIA 5KYNA 2DEUA 1ZJ5A 1G6OA 4HB0A 3VNRA 1BD3A 1JAYA 4UDYX 1K7YA 1UPCA 3TLGB 2PRKA 1VA5A 2GNOA 1KYYA 2PZAA 2R6GA 3GLSA 2XI4A 5DNYB 1MB9A 1BDMA 2A92A 4M0PA 2PZKA 2QLNA 2ZI7A 4KN6A 1TAQA 4FYVA 4TS3A 1NUHA 1IHOA 4MGEA 1JT2A 2DQZA 4OHPA 1X74A 1AE1A 2C3OA 4A7PA 2VSNA 3EVEA 5KTOA 1RQXA 4YJFB 1UM8A 2RHRA 1RI2A 2A67A 3A2MA 4DTCA 3PTAA 3KJGA 3O3CA 3Q3VA 1GM5A 1M67A 4GVXA 5GV8A 2RH5A 3SYTA 3PDIB 2GVZC 4EVIA 3AF2A 4F97A 1DWUA 2ZRFA 3STUA 2Q7XA 3LBHA 4UATA 5JATA 2FK8A 1HFEL 3OQHA 2EYUA 4YIKA 2CT8A 1ZI9A 4IXWA 3FWPA 5LBIA 4DR1B 1QJCA 1QM5A 4JKIA 3W9SA 1CUWA 3E1SA 3IULA 3O2JA 3SX2A 1ZGBA 4ZC8A 4OQFA 5GMOA 2FF5A 3GLFB 1XV5A 1OWLA 1E9AA 1E60A 3R3HA 4MHOA 2EXXA 3T95A 4LZWA 3GBVA 1I3CA 2OGUA 2OA0A 3NNSA 4BZQA 3WYBA 4RNDB 3IAUA 4OUDA 5LMNB 2MYPA 4MHSA 3WDSA 3PFGA 2CLHB 1RSZA 3CRVA 3QBVA 3QU5A 2MTBA 2IBSA 3GA5A 1M2OB 2LP4Y 1VSQA 2CWWA 3CLUC 3WLRA 4EB6A 3QIAA 4F45A 1OB2A 2GAFA 2PV7A 4N48A 3OCWA 2C77A 1B2LA 1UFQA 3GVHA 1KR5A 2P4HX 4QG3A 2QYOA 3OQMA 4MV1A 1XROA 4K05A 4OLBA 1W36B 3LY8A 4Q34A 4FXOA 4INPA 2H1HA 1NVGA 4INZA 1PWYE 2ZB8A 4O02B 1JSXA 3AR7A 3ENNA 1QTNA 3N86A 4W8GA 5B1EA 3CPEA 3FNHA 3RD5A 4QJ3A 5CDHA 2VF4X 5C81A 4U7WA 4KR3A 4RV4A 3GHYA 5K0GA 3M3PA 5BSWA 3FUUA 1L4GA 3K4PA 5CR9A 5GVRA 4HAZA 4BN4A 5IHPA 2ZRHA 4V03A 4HGOA 2JLYA 2ETVA 1RAAA 1RRPA 2YQ5A 1G38A 1I0IA 3GEGA 4BVAA 4CU5A 4GOJA 3L2OB 1KAOA 4P7GA 3M89A 5HZKA 4RVSA 2HTEA 1U98A 1N1EA 4K40A 4W5JA 3USES 3AZOA 4ZPJA 5JY1A 4IJVA 2V7VA 3U4QA 5C9ZA 2OV1A 1MX9A 2O2HA 1FXWF 1XCLA 4HRVA 1M8FA 4IYJA 5DN6D 5K6AA 3ZVNA 4RLSA 4F6RB 3BTOA 2Z1MA 3G5LA 1RYBA 2Q3FA 3WL7A 4Z2YA 3IRUA 5ED4A 4HPXB 4W9RA 1U28C 1YVRA 2DPLA 3IAAA 4XVCA 3KOZA 2BKLA 2EJTA 2IPLA 3QOXA 3WGVA 2Q6VA 4E88A 3PHHA 2DFTA 3SY8A 2VXBA 4BPBA 2W2LD 2OCXA 2WYUA 2HZBA 3W8NA 4NU6A 1V25A 2UXDB 2FUKA 3ITNA 1C3JA 2R8EA 4EPRA 5BW8A 4ARCA 1IXKA 1ZUHA 3EXAA 4L7QA 3DTYA 2K6GA 2HLHA 3QI2A 5A7FA 1JIIA 4QGHA 1FP4B 1A4UA 1F9AA 2CLEB 2QTCA 1W0KA 2A9OA 3FSEA 4OO3A 4R1TA 5LA6B 3WKAA 2J5KA 2VBFA 4MRPA 5J4LA 4LEIA 2AC2A 5BQ5A 4ES6A 2RFLA 1B0AA 4RVUA 3FNIA 4J1TA 1PJ8A 1ZGCA 3CJQA 3GGDA 1JPVA 1FC0A 3KT3A 2XUAA 2WKRA 1TL7C 1WO8A 1QP8A 4HNRA 4JJEA 2BEWA 2XY4A 1H2WA 1ELOA 2G4LA 4P7KA 3ZWOA 1A98A 3BRWD 4EG8A 2I6SA 4AF7A 1H2AS 1JG4A 1UBMS 4P4TA 4QPNA 4R1LA 1YE8A 4O3FA 1SG0A 5AJHA 2C07A 2XT9A 4DCOA 4EGFA 2RGRA 5T8KA 2WSSD 4RY9A 2EF0A 5GAJA 3I6ZA 3IKTA 4NENB 2VQ6A 2AX4A 5JCOA 1NNUA 4EZEA 5I4CA 4DCSA 3B7PA 3QHPA 2BE9A 4O4LA 3B2EA 2MSKA 5LNK1 3ZXXA 4PCUA 4Z4EA 1Z06A 2TS1A 1N32B 2R1TB 2ZUDA 4KX3A 4E7PA 4WN3A 2P9ZA 3CVOA 5EC8A 2NU6A 2WIDA 1E7QA 1MMFB 2ECKA 4MVJD 2W70A 4GZLA 1CQXA 1NV9A 3BICA 4XE5A 1PZEA 1OFTA 3ZOZA 1OYYA 4B3CA 4BKMA 5KYXB 4C7JA 1RYFA 4Y6GB 3W0LB 2G1JA 4CMCA 3P0JA 3W06A 1QV7A 2FMXA 2IYNA 2JBHA 2A4MA 2GKOA 3BWMA 3CCBA 3CRRA 4QIHA 2F00A 3RE1A 3RVDA 4DBLC 1BMDA 2PVCA 4NBUA 3D3JA 2FP3A 2I8LA 4EYGA 5CFQA 4CTNA 1NJGA 3ESQA 3JQAD 2BZ0A 2R6ZA 3GFPA 1DQZA 2BGIA 1YA4A 1GZUA 1Z17A 1GR0A 1ANKA 2I4OA 4AL4A 1C2YA 3NAZA 3OKPA 3DL4A 2CYCA 2XAUA 3GOHA 3NBAA 4OP2A 2XDAA 2WNSA 2JGDA 2ZSJA 4JYMA 2IBTA 4YMVA 1DKUA 1SVNA 3LQYA 1G1MA 4CM5A 3EXHA 1QQ5A 3GGGA 4E2WA 4U2GA 3MTJA 3W2EA 1J0AA 4UQLA 4KK3A 3SU8A 1E64A 5JH7A 4PC1A 4FFBA 3IL2A 4GE3A 4UBLA 3PHIA 4G1VA 4FWBA 4YT5A 4EOGA 2MINB 1TM1E 5F52A 4IGFA 2Z83A 4EW1A 1KETA 2LW7A 1Z5VA 4GXQA 1V9SA 4K1LA 4WXRA 1DAIA 1JJFA 4D6YA 5AHOA 4YUVA 3PHLA 3MWFA 3OJ0A 1R4NA 4DT1A 2IPNA 2OHFA 4WZ6A 1RRKA 2IH5A 2WUFA 2ZTMA 2X0DA 1ACLA 2RI0A 3RGWS 4BLQA 2WOOA 4BP9A 1IQ0A 1RXEA 4X3OA 3IJRA 4D4KA 3DP9A 4ZVKA 1CUIA 4NYMR 4YJGA 5JZVA 4KTVE 3ILSA 4DQVA 5E1MA 1A8UA 1U7TA 3L7AA 4Q7JB 2I65A 4FN5A 4RZHA 1E3DA 4WE3A 4NCBA 4ZQHA 4E1AA 1VKHA 5GZ1A 3CZ4A 4ND7A 3OQOA 4O2BA 5CHYA 1GCGA 1Z5WA 1GILA 1YVUA 3N7UA 3T0IA 1UKBA 5M2QA 2VAWA 4H35A 3JYNA 3NOOA 1QH9A 2DXIA 3D6MA 2H4XA 4NBWA 3VU9A 5BYAA 1P75A 3E84A 3ZLJA 3TBFA 4NEQA 2FH5B 1CY1A 3NATA 4B3BA 5JAMA 2TECE 3DHYA 3DSRA 1EVQA 3LPCA 4UDNA 1GAJA 2HF2A 2V55B 4AG5A 4F11A 4EGSA 3FKSA 1RLOA 1JF8A 2V7WA 2NO1A 4QJBA 5JSUA 3P2JA 4O5OA 4L51A 3DKKA 3VHRA 3DE2X 1UPAA 1T0PA 4TUYB 1YFLA 3UAXA 4Q21A 3U44A 3P2IA 1BE0A 5U4XA 1QRTA 1P39A 1WW3A 1CUFA 2ZI9A 2Q8PA 4LBZA 1ZVVA 3DS8A 3R3ZA 1GL7A 4KRGA 1MX1A 5D5PA 4HQ0A 1GGJA 3G2KA 4NPHA 2VF7A 2WU8A 3CY6A 1C5KA 3IB3A 3KV3O 5J23A 1E0DA 1PT8A 2WWFA 2ZAMA 5TQ2A 1Z6GA 2IZ7A 2NOAA 3Q85A 4IP0A 4MMXB 5AICA 4H7PA 5HKKD 4R1QA 3H18A 2HA0A 3R0XA 4OQQA 2AEEA 2AFVA 4UKDA 1AKMA 5AVSA 1BFUA 1SZCA 3NHWA 1U7HA 4CJXA 3NTOA 5FL7A 4LV8B 1QF6A 3R9KA 4X62B 4Y0VA 3TW8A 1M8JA 3O95A 4AAYA 2WJIA 2VJPA 2XQGA 4AMGA 1AM4D 1JQEA 3E3LA 2X8JB 5EWLA 5FNVB 3ECAA 1JA9A 4HLNA 1JG6A 1AQLA 3MUOA 3N3AC 4TZ0A 1QQAA 1QANA 2FB9A 2CF6A 4E11A 2H51A 5T6BA 4J0IA 4J0GA 3WFJA 2R8ZA 3ORSA 1XF1A 4G26A 2CNBA 1O9BA 3GLTA 1V71A 5CH8A 4Q1EA 2VC2B 1WPRA 2JFGA 3OQJA 2DJ5A 2QD3A 5L53A 2AZTA 1KC1A 3EFEA 2FDCA 4LECA 4P38A 3UB2A 5HQ3A 2J46A 2CMHA 3NHMA 4FGLA 4WZBE 2R7KA 4F6LA 3D64A 4RDCA 2PE5A 1UDXA 4J16C 3A0UA 1NTRA 1C50A 1V5EA 2JGJA 4GL4A 2IGTA 4Y0NA 1IK6A 1XTBA 2GEKA 4S2UA 2VSXA 4K9NA 4XH9B 4OHWA 4YECA 4FHDA 4IDCA 5DYTA 3L0IB 3MK31 2A8YA 3ACBA 3GLUA 5K45A 5A6VA 2PGNA 1EQAA 3GRFA 3PNBA 3ZDAA 1NF2A 2OFOA 1O87A 4H15A 3EXEB 1N5RA 2GD2A 1XWFA 5JD4A 1Z83A 2WIBA 1ENZA 3O83A 1R8SA 1YULA 2HDWA 3PKJA 4W7IA 5TMBA 2AFIA 2NXCA 4JUIA 1P0QA 3MIIA 4FE4A 1BDHA 2ORIA 4WTOA 4CTKA 3PQ4A 3O73A 2FW0A 4Q4JB 3LT5A 1FFXB 1Y9DA 2ZZMA 1CPYA 1OSNA 1GV1A 1KEKA 2EFHB 3D0KA 3DCYA 4CR8A 1WY7A 1MJNA 2WZDA 3EJ6A 1C3OA 1SOWA 1Q21A 2QXUA 3EWIA 3M6VA 3I6MA 3NTVA 4BXOA 3FMPB 3AJ9A 3H1GA 1ID8A 3U4DA 2PFGA 2CNWD 3JRWA 1I1HA 4FCTA 1GTJ1 4TWZA 1JIVA 4J90A 1YJCA 2GF0A 1M1YB 5BV2P 3TQIA 1H4TA 2HHLA 2PFSA 3HJAA 1IY8A 2OLKA 4Q15A 1P5ZB 2HF9A 4OQYA 4YJHA 4BNDA 2CLIB 2DG2A 2F43A 2UZIR 2VOEA 1UP6A 3P9CA 5HGXA 4EHHA 1A7KA 5JZBA 2ZUFA 1WHSA 2D59A 2V5AA 5JBNA 1S8NA 1XSEA 3BZWA 2XRFA 3LP5A 5AVOA 2DHRA 3RQSA 4EKGA 1NN5A 2C84A 1I36A 3HJHA 4WCFB 4P4SA 3ZE8A 2WNIA 3NS7A 4RVCA 4AKIA 2QLFA 3OY7A 4IDPA 3N0XA 1UJ5A 5FUVA 2HM7A 2QRLA 2WIKA 5JMOA 2XNDA 4CLXA 4MVJH 1XJWA 3O4VA 4WLOA 2WU1A 2UU9B 3KB6A 1K4YA 3DMGA 2O7VA 3ROEA 3DM5A 2OZVA 3DFUA 4IWXA 4TLBA 2WIAA 2B35A 4DG5A 2PH5A 2A4KA 1LWNA 1AC5A 2I7XA 4TMKA 4BMCA 1I80A 3GJ8A 2WI8A 1GNTA 1OFUA 4LXYA 4OATA 3Q5DA 4BQPA 1YRBA 1BWQA 2QU8A 1QB7A 3B9QA 3H13A 4GZ5A 4X1KB 1XLTC 2GARA 2JFBA 3I9JA 3QKSA 4O6VA 5FA5A 3E4CA 1H8HA 1NNI1 3L8GA 1N5IA 5AOCA 4GMGA 3ZE2B 3KLBA 5B6JA 2A1UB 1R5OA 1AHNA 1V7QA 1T1IA 2AMLA 2PFKA 2ZEJA 1AKVA 2JATA 1TU4A 2C0PA 1GPMA 2PUVA 3E9ZA 2V6GA 2QMYA 4NCNA 4F12A 4EZBA 4Q9NA 3P32A 2W22A 1TZJA 1NYQA 4ZEXA 1I4WA 3DBIA 2QRJA 3IVCA 1SVUA 3N8NA 3ZKWB 3U2QA 3U5ZB 3CEJA 3LUDA 4CCYB 4DHEA 3QFTA 5B3JA 2DBQA 4PINA 3CH7A 4QLAA 5K8TA 4ZARA 4TS4A 4D99A 1PR4A 5LXTA 1JAXA 3HDQA 2QOEA 3GEEA 1CRQA 3E2IA 3E5RA 2OGTA 1FF9A 4LJYA 3RTCA 4Q12A 4DWVA 4E51A 1RPTA 2VCHA 2A78A 2QPAA 1R9NA 4RJKA 2CK3D 5G4KA 2ZCUA 3DZGA 4FC7A 4GZMA 4J7AA 1R9GA 1G4UR 5D85A 2N1BA 1W5EA 3O4GA 3NANA 4XX0B 4G65A 4KKXB 4CFSA 2FLKA 4P22A 3BX1A 2OBYA 3ICOA 1CC1S 1IWOA 1XRJA 2H5EA 3NEAA 5AOAA 4YRAA 4XLLA 4F60A 2C5EA 4TM7A 4S3MA 4X95A 4JLNA 4MI9A 4WJLA 3DNPA 4I46A 3A9WA 1T34A 1Z0FA 5LSAA 2HSJA 1PIWA 3B6IA 4KSBA 1TU0A 2EGGA 2HA3A 4LCJA 4B74A 3OCCA 1R6TA 3QWFA 3GB9A 3H2KA 3PUHA 5KC9A 3CUUA 2ISQA 4MVJI 3AERA 2VHUA 3K5HA 4HN9A 4W5RA 1FRQA 1W0JA 3ZWDA 4C5BA 2YX1A 4ZICA 1LUAA 3D3KA 3HV2A 3DB1A 1BH2A 4V0MA 1X0VA 1XYGA 2RH8A 3C6MA 2IIQA 3C3YA 3MMSA 4RZ2A 1GPJA 3GRUA 3GT3A 4I1OA 1FJ2A 3KE8A 2JI9A 2Z95A 3BJEA 2BTOA 2C2BA 1P73A 3IPYA 4X63A 4G4SO 3F73A 2H1OA 3WGMA 4QECA 1EYZA 2PVSA 1QFJA 2D5IA 1A9OA 1A9ZA 2RKBA 2JHGA 3CVWA 2CE2X 3OM0A 4K81B 1G18A 1U0LA 4LX0A 4HSEA 1PK8A 4BCBA 3D4IA 3GELA 3KJZA 4U02A 2VTBB 3TN7A 2HJRA 3OIWA 1WZIA 3LC7O 5F5XA 1QX4A 3O4FA 3GJ5A 4EY4A 3IAS6 4LSZA 4ZK6A 1DAEA 3LLCA 1UF9A 3MLEA 5EE9A 5CEEA 3UJAA 3MG9A 1NPTO 3NWJA 1C7QA 5TPWA 3K94A 3OBBA 2YV4A 1WDMA 3W1EA 3N8KA 3I04A 4PG4A 5TGTA 2IHJA 1RLUA 1EX7A 2QX6A 3U80A 2QY6A 4R9NA 2JKVA 3GROA 3QOYA 4Z54A 1JEEA 1IIRA 1YRLA 5DJ5A 2W2KB 5FI3A 3AY7A 5EGNA 2IYWA 2PXCA 4OREX 4PYJA 2I7VA 2PMCA 3QEKA 2GN0A 4RY0A 1AA9A 3F1LA 2QTRA 3ICPA 3JQ7A 4IIEA 3IDQA 1H1TA 1OVGA 5CUQA 4DIBA 4U39A 5ALMA 2QSUA 3GRAA 3O84A 3DTTA 5JYCA 1RPNA 2W00A 1XZBA 3DV2A 3IBFA 4MIYA 4EITA 4QM6A 2AEJA 1E2FA 2SBTA 1GKIA 1TXGA 5FYDA 3N5CA 1J9GA 2NV2B 4DRXA 2FRXA 4ZK2A 4JY7A 1WQ1R 4EG3A 4O8ZA 2MSNA 1N6IA 5JJ5A 1R18A 1YU9A 2FR0A 4JL6A 3VBCA 3W6PA 4DCPA 2ZYUX 2XQFA 1KFKB 3FYSA 5JYBA 2IZOA 4RQAA 4UDOA 3UT5A 3BGWA 1T43A 5EIXA 1QU2A 3OTOB 3MWLA 1ULSA 1KJIA 4WLNA 2DUUA 4Q39A 4HVLA 4O4JA 1W0CA 3K1ZA 2LR0A 2PBLA 1PT5A 4DDHA 4V1CI 1NT4A 1SY7A 4I1YA 1YRWA 1INLA 1FDUA 3QLVA 3HA7A 4E33A 1A9TA 1B8OA 4EG0A 4AO7A 1SKAA 4GPEA 4UPEA 2HEIA 2OHXA 3GFQA 3KVRA 1PFVA 2R751 1JFFB 2LE0A 3OECA 1ZXBA 1Z4OA 4WXYB 5DYIA 1XNGA 1AZTA 2A0YA 2JGAA 3SMQA 1QC5B 3TTYA 2B2NA 4YJKA 7ABPA 4U7HA 2VP6A 3LGAA 4F92B 3IIMA 4QM7A 1FNBA 1S4MA 1PNVA 1D09A 2VXOA 4AG6A 4GYKA 2D7JA 3HY3A 2OBBA 4G56A 2P0YA 3K1JA 3CUKA 3FPEA 5ENDA 1OIVA 3VRHA 5HILA 4LRUA 5CH3A 4J2HA 4JP3A 4J9UE 1ZC4A 1S2DA 2V97A 1IZ0A 1YASA 3CNOA 5AXCA 2O8VA 2AZ4A 3HSSA 4JUAA 2P8JA 4U2FA 4YRLA 4QBTA 1MC1A 2H4JA 1GQFA 3VOTA 2H6EA 1ZJWA 1C7IA 1AJEA 5C5DA 4BUCA 4X94A 5IANA 2F64A 1GD1O 1TO2E 3G2HA 4TXJA 2J31A 2X22A 3NYWA 5IDQA 5K6RA 1VL6A 4C2UA 3BD7A 1B14A 1J1IA 1KTIA 4YLYA 3DLIA 3K31A 4FHZA 4RSRA 2QD5A 5A0FA 1UJMA 3F49S 3OZWA 3KAKA 4M1QA 1P80A 5AXBA 1NJ6A 1UKYA 4AJNA 1U2ZA 4RYDA 5JFTA 5LR6A 1RHUA 1AN0A 1FVFA 1BXRB 2QV7A 1Q14A 1W9HA 1S6YA 4B83A 1FZQA 3U62A 1UMKA 3D6FA 1QLWA 1OAOC 2KBFA 3PGVA 4F3TA 1B23P 1TF7A 2YXBA 2PEZA 5K3BA 1EFRA 3HJFA 3H75A 5JHGB 3UOAB 1ADGA 1ONPA 3V55A 1P1RA 4NNPA 5DGTA 3EXFB 3QEMB 2UYOA 2V5VA 3NNNA 1EAMA 3RJ5A 5KYYA 1X1DA 2LKCA 2OPBA 4D8YA 3B6EA 3WOHA 3R5HA 1IMOA 4R8RA 4AG3A 4BATA 3G0HA 3OZSA 4Y2HA 4TV9F 1PQ4A 3ZZNA 6ADHA 3RC2A 1E6KA 4OXXA 4XYBA 3I37X 5J1TB 4EHDA 5P8WA 1GGVA 3ELDA 2Y1XA 1ORHA 1T2EA 1XU4A 3VJLA 1OW3B 2DETA 2IHBA 3PPIA 1YNSA 3PGXA 3NUGA 5AM5A 5K3CA 2G07A 1YVDA 2QPOA 4OI4A 5CW1A 3VSEA 2B3TA 4QRHA 3MSXA 1MZPA 1TIKA 3QEJA 4OJKA 1DADA 1LSUA 1MO4A 4BRWA 1AMOA 1VGRA 2YVUA 3K0FA 1K3FA 4ARSA 2Q5QA 4W1RA 1OZGA 3ILHA 3C70A 3JQAB 2WJZB 4JUBA 1EUYA 4F46A 2X0RA 3AR2A 3OA2A 3SZUA 1PNOA 2P62A 2DLDA 2QK4A 1E4EB 3PLNA 4RWZA 1QWOA 3PCRB 4J0QA 4OI2A 1CIVA 2YHUA 3CZ9A 3KCNA 1NPDA 3IQZA 3OPQA 2G36A 1AZSC 3ZS8A 4RAOA 2GYUA 4ZVRA 3RKUA 1U3UA 4GX5A 3VH4A 5JD6A 5L51A 2PKCA 5BYKA 2ZOSA 4QQRA 2PN1A 5FOUA 2ZCJA 1Y7HA 1T1EA 3FNFA 4J9VA 2FY8A 4P34A 1JUDA 3A6EA 3E8SA 3OOYA 4G0QA 1YZUA 5J43A 3Q5EA 2RHLA 3DLHA 3LYUA 3WMWA 2C7PA 3O4HA 2WAMA 4GX1A 4LY6A 4DWOA 4A23A 1V26A 3FW1A 3IJPA 2P90A 3NUQA 4GEGA 2VI5A 4GPAA 4LZNA 4OQZA 1IEQA 1NDQA 1NQ5A 3AZPA 5EINA 1UZAA 3RHZA 1XAGA 3FDFA 5HRUA 2H00A 3RYFA 2ZWAA 4HH1A 1E5VA 1W49A 2X13A 1RP1A 2FKAA 3KG2A 5BY2A 3EIQA 2W6NA 4KQGA 1LI4A 4BMVA 5F7OA 4H3HB 2G9QA 4OHUA 5AKXA 3AVYA 1H65A 5AP9A 1DXYA 1GAWA 1QHHA 2RBKA 1NQWA 3E15A 4IVPA 2WPDD 1DG1G 4KO8A 5EQDA 3BWXA 1SQSA 3HKBA 3QXGA 4D8VA 4GDFA 2O07A 4UTRA 2UYCA 4X7BA 1ZITA 1XE3A 2FFJA 3TI7A 5CM9C 3IEMA 3BF7A 1XDDA 1PW5A 1GTL1 1KKMA 1VL0A 4H7HA 1J0CA 3G1UA 3H2HA 1FJXA 4RA9A 3VOAA 5EHXA 5F35A 2HU8A 4NJMB 2CCGA 4Y2TA 3DAGA 5LBTA 2UUCB 3O92A 2QTVB 3UXHA 4E14A 1DBIA 4IHJA 4IQFA 5KHAA 2WJ6A 4DXHA 3CZQA 5DK4A 5C2JB 1DUIA 1N0WA 1BEZA 4LK3A 1P9OA 1CU1A 3R6LA 4RJLA 3S1AB 2W0SA 2WG0A 4DCUA 2G0TA 1TZCA 2P0EA 3H9CA 3L4BC 3L7OA 1Y89A 4JEMA 2QNIA 2COUA 1G7RA 4RM2A 1ADJA 4X91A 1E6EA 1R8YA 3DLPX 4RK6A 2LWIA 2Q1WA 4JX8A 3T7IA 3TM4A 3W7VA 1J20A 1ZOOA 2BSXA 4FOTA 2HX1A 4BOYA 4W7HA 4M8SA 3EIEA 3O9VA 4NDNE 5LCXA 3VPDA 1P0IA 3DV0A 4NCKA 5KS2A 3WLOA 5KO2A 3NP9A 2VF2A 4FJ2A 2ZJ1A 4YV0A 4XUGB 1QS0A 1LZKA 1T1JA 2OB1A 3F5QA 4ABTA 2XWSA 4I9HA 1TM5E 3VR5H 2A86A 5TQJA 5CDFE 3FCCA 3IP8A 3O5AA 1HLFA 4OAOA 4OSEA 4X8OA 2O3SA 1M6VA 2WJYA 1Q0LA 3U81A 2PJZA 3FMIA 3HYCA 4BRSA 5AW7A 3ZCXA 1YZNA 3QUBA 2YUTA 3ONEA 3BRSA 2QUIA 4ZVMA 1CUCA 5DHSA 2Y66A 1L4LA 1DJLA 4WOKA 2W58A 5FTMA 5JBQA 3SQWA 1KY2A 1QH8A 1L4UA 1V8FA 3IALA 1THZA 3H2GA 2ZRAA 1Q0QA 5GZ6A 1P18A 1USUA 2VLBA 2WAOA 4G23A 3RUEA 1LKZA 2R6R1 1ETUA 3NRJA 4GOOD 1I6LA 1Y7IA 2AXPA 4X3CA 4NZZA 4YRTA 4FNMA 1L3BA 3B12A 2HI0A 2QYTA 3PQEA 3PQFA 1LPPA 5AUQA 1E9RA 3LUPA 3OC0A 2RC6A 5EHNA 2V0NA 4ZGGA 1O2DA 3HB9A 5KYWA 3CLTD 3X44A 2OD2A 3JQCA 5JAQA 2REQB 4JA2A 1F2TB 2J41A 4KN9S 3JALA 3GL9A 3LH5A 4BBZA 2BCEA 1MJHA 2REBA 3DZHA 3VOBA 1M1YE 1NYLA 3NO4A 4YLGA 1KBOA 4IGKA 5EE1A 4J2OA 2J6CA 2QN7A 4U3JB 2QAGC 2WHQA 1ZZEA 2WUEA 4U6SA 3U4GA 4BNJA 5ICCA 2Z6UA 3UKDA 3EZ6A 1O8CA 5FORA 4YJDA 3KVOA 2C31A 4IRUB 3KB8A 2WFLB 4ASUD 4HN2A 1ZG3A 3G2IA 3RYHA 4KPEC 1BW9B 2DPHA 1C7ZA 3RRYA 4EKNB 4Q9HA 1HL3A 2MSCB 5EJEA 3J7AC 5DHFA 1UKEA 2C3YA 3S28A 3VNVA 2V4UA 5T4BA 3O3NB 4FYIA 1KXZA 4E4RA 3I8SA 3DHVA 3EVNA 3BD9A 3JYHA 3R5FA 4PO1A 1IEXA 4B4OA 4LPKA 4CKBA 2ZRGA 4FKMA 2JZOA 1FTWA 4BVEA 2F7SA 1E3IA 3QGMA 2ZT6A 3LUGA 4CUJA 3WGIA 1HQCA 2H1FA 2QBYB 2HWKA 2QORA 5EIAA 4EHFA 5LKAA 1IPHA 3EXG1 4O25A 4YA6A 5LLSA 3VNQA 4ZOQI 1QRSA 5A5DA 3DFMA 4I81A 4OQPA 5CJPA 3WGGA 2H54A 2ZR8A 3PHGA 4U8HA 4C6TB 1SC4A 1E61A 2DX7A 4YDHB 2OBNA 5TF0A 4FSDA 4REOA 4U2KA 4F96A 3JVVA 5E95A 1BG6A 3CZ5A 5BVGA 4GUAA 3DXZA 3TINA 1N6PA 3WV4A 3KFVA 2AOTA 3N6XA 3PRYA 3VDXA 4ZZ3A 4DY4A 1S3IA 2C97A 2GI4A 4ZT4A 3DOEA 1SXQA 1SNYA 2OVBA 4QHSA 2X1LA 2F9MA 4PEVA 4KREA 1UK9A 3HNPA 1RBZA 2AC7A 1BOFA 1KHHA 2JA1A 1S5PA 1Z5NA 3DXYA 3MWEA 1S4QA 4R01A 5IC6A 2JG3A 3NDBB 5IHXA 3ZD7A 1W85B 1WG8A 4Z4GA 1Q44A 2I7TA 2HYDA 2AN9A 2AUTA 1EE2A 1Z13A 3ZDXB 1SJ9A 2IYRA 2FEWB 2OSVA 2O8FB 3FSRA 1YS1X 4ALKA 5H83A 1U8TA 2ZJFA 3HVHA 3AT1A 4HMOA 1I9CA 1LVGA 3AFGA 4TOIA 1OLXB 2J3IA 4LJ8A 2P0AA 1SXIA 1SUCA 5AUOB 1G8HA 4U7PB 3ZDDA 1RS0A 4LA4A 1NRWA 1YK1A 4G84A 5ESRA 4CM7A 2PO7A 4A8JC 3LHIA 2P27A 1XQYA 2B25A 2QD1A 3OE7D 3PEFA 2HLDD 3B1XA 3NFYA 4OHRA 3MTQA 2QR5A 1Q5PA 1RABA 1LBSA 2GBGA 2JIZD 5C1BA 1BHO1 1TK2A 2WWHA 1L4HA 2R1UA 2ZS9A 4PR0A 1EFVA 3RW9A 3RTGA 2JLUA 3DE3X 1NMYA 1AG9A 1UP7A 1F14A 2Y4OA 3OF5A 5HF9A 3O94A 1EXVA 3AILA 2C5FA 3I9V6 4B4KA 4ZI7F 4EHBA 5A9SA 3NIWA 3HCOA 2BJVA 1O4VA 4UQOA 3B5EA 2XBUA 5BT9A 4TXNA 16PKA 2PIAA 4M0LA 1WB5A 4PCVA 4RENA 2XA2A 3DD1A 3MWYW 3QX9A 4P53A 3P9XA 3OZBA 2Q5CA 5C8ZA 3SM3A 3S27A 4BP1A 1C7EA 1LVHA 1TMYA 3I2GA 2BTQA 1OV6A 3GAAA 1E2MA 1BYUA 2ZRBA 2Y05A 5IAOA 3U3RA 3L6EA 3UQYS 2CMDA 2BIFA 4Z7JA 4PTLA 3EVGA 2UYHA 1EDZA 2ONKA 2Q7OE 1AD2A 2UZAA 5AW0A 2BDEA 3AESB 1SUFA 2EWWA 4MYSA 1PTJC 1OFVA 1PZFA 3HKCA 4KXYA 3V1NA 4ENTA 4HDNA 4QEKA 4RE5A 3N7AA 1K7FB 3EDRA 1JA0A 1V4VA 1DJNA 3JZIA 4RMHA 3U1VA 1QZ3A 5IUNC 4DCMA 2VEOA 1N5LA 4BO8A 1Q15A 5GJBA 3ABRB 4D43A 4G37A 2Q2QA 4ND3A 1I10A 4JFRA 2X0KA 2O0KA 2EKBA 3NC0C 4C20A 3UMSA 1UZMA 4IFEA 3RAJA 2GBLC 3GO4A 5IFLA 3HVJA 3R7LA 3UMGA 2Y1LA 4H18A 5FWXB 3X2EA 1E1MA 2H8GA 1WQ3A 2PX2A 3INRA 4KPUB 2P6NA 2W90A 4WNAB 1X77A 3T1VA 1OZHA 4M0CA 2JI7A 3FYCA 3N0WA 3F98A 2YDXA 4TWJA 4UNIA 3UWSA 4BKQA 3D1JA 5C46F 1B15A 3VYWA 2WKWA 1ZLXA 2R8PA 1L5HA 5KVVA 3QSYA 3LP8A 3VR0A 3T3HA 1IZYA 1OLSA 4GE0A 2DR2A 5CDUA 4XLTA 1O0SA 2IXFA 2L19A 2ONCA 1OYVA 2FUG6 2O3UA 2Y4NA 3PC3A 1IVNA 5GONF 4W4TA 3ZWCA 2CBZA 1D2AA 5EXPA 3AINA 2QTLA 4IZHA 5TY0A 2Q7DA 1NULA 3CVUA 3RYTC 2F1KA 4DC1A 3VX4A 1P4GA 4DIDA 3EDQA 1C80A 2EIXA 2I78A 4I55B 4LMRA 3FLEA 1WDTA 4BN5A 1NT2A 1Y5IA 3DYBA 3QEOA 4XRRA 4DEVA 5CG2A 3W6UA 5L4LA 1HT0A 1YAHA 1FP7A 2R47A 3BKXA 2ZWMA 1D6JA 1OT3A 2C4TA 1P19A 2OFPA 3RARA 1KA9H 3C5CA 5IJ9B 2HD4A 1C30A 1ZNYA 5GOZA 1JYSA 3SDZA 2Z6QA 5IM4A 1U9YA 1IE3A 3A4LA 3EEOA 3BXGA 1E66A 1MG0A 1RJDA 2DPMA 1CJVC 3G88A 4RK5A 3IUSA 2O9JA 3OCZA 2FF7A 4RHXA 2HRCA 5BV0A 5HQTA 2EFGA 3DBRB 1ECBA 4MVJP 3C3PA 2R8YA 3IAFA 1U80A 3PIIA 4LDAA 3ZQKA 3VYSB 2NIPA 5D2CA 5A5FA 4ZCSA 1Z8NA 3U61B 1D5WA 4AU1A 4EJSA 1DXHA 1ZNXA 4FN4A 5EI5A 1G8SA 2PAAA 3JY6A 1FQJA 4YAEA 4BNHA 5HIAA 2Q8NA 3M5DA 4TXMA 3EPHA 4YEDA 1IZZA 3NT2A 4ZHQA 3THRA 4LHSA 2PGXA 1KYVA 4HFRA 2KQUA 3ZPXA 4U7TB 2KB0A 1V16B 1YTLA 1DPGA 3I52A 3V1LA 3TE6A 2W8BA 2D1TA 5JQGA 1PSDA 1UEIA 2NT4A 2QGFA 3DVSX 3I45A 1CUVA 3CTPA 2Y1EA 5K8VA 1UFRA 3Q87B 1OLOA 4FE3A 2FQYA 3ZHTA 2HHJA 3PD1A 5A06A 4GVPA 2P3QA 3KAPA 3BSWA 2H1VA 2YHSA 4E3ZA 4HC4A 4F4JA 2O8DA 3BD6A 2DKFA 1OBCA 1FMJA 5D7BA 2D5BA 2JLRA 1GPWB 2IHVA 1X80B 1JMYA 2VCEA 3D0RA 1MOZA 3LUKA 2Q2WA 3B20A 1SXJC 3KRTA 5H9VA 3N05A 5IYZF 2X8BA 1RQ2A 5TMEA 1XPUA 1P5HA 3IEKA 5JJBA 2ZJ0A 1JKXA 3DLTA 3GAFA 4V24A 5F7XA 5J2TB 1EFPA 2HA4A 4Y6PA 3GDHA 3I58A 1ADFA 1Z4KA 1WXIA 2QR2A 4KXWA 4WERA 4EAQA 1DIRA 1GPKA 1YZTA 4R2WA 3BZBA 2VYQA 2OGZA 3BK1A 1XC7A 3VU0A 3F96A 2HW8A 4WN9B 4JJ8A 3TIXB 2O3QA 1R0KA 5DM0A 1HDCA 2H1CA 5EZYA 1JZQA 1Y1SA 2EKQA 3CX6A 3HR8A 1UIRA 4X1IB 4D4GA 3D7MA 4FBMA 4HNTA 1XHEA 4O4HA 4ZVSA 2G8NA 3KKNA 1T5BA 2CE7A 4V2IA 2ICAA 1ZD9A 4JI3B 1LC3A 2OCAA 3EZLA 1DO2A 4FYXA 3T1TA 3P71T 2NVUB 4ZOLB 2D1QA 2ZYDA 3F3KA 5KKAA 1L7NA 2EEPA 4A92A 2I4NA 1CK4A 1JHAA 1QKJA 1WZEA 1ZN9A 2EVWX 1W73A 2AQIA 2ZYAA 3OKFA 4IIFA 4BLUA 2QRPA 2JGNA 1DWQA 2ALJA 5FBZA 2A3RA 3MGCA 4I4TF 4C04A 5ALWA 1I7QB 1KI9A 3DKPA 4J0DA 2J0UA 1TYAE 3WQBA 4C01A 4I2VA 4P5DA 5BN4B 1A71A 1WXGA 4MWZA 1EXMA 2CV1A 3HABA 1FTGA 3FMOB 3OHMA 2JLAA 3GZNA 4JGBA 4PWYA 3MMPA 2CFCA 4G1MB 3UG7A 4DR4B 3F2IA 1Y8RA 1VIDA 1VPLA 2O8NA 4YT4A 5CFZA 4RE6A 3QRWA 4N7MA 2PLWA 4PFKA 4P3NA 1UBRS 5EJMA 1AF4A 3CMCO 2YHIA 4KQHA 4TV8B 3N9IA 5GWXA 5KX5A 1DKLA 2UXCB 2XXJA 1JFVA 1WLYA 3MPOA 1AMNA 4G1FA 5CB8A 4JUDX 5C51B 1JZTA 4W99A 4BFLA 2PRJA 1COWA 3AP2A 5I4BA 1AU9A 3AEUB 4R0MA 4ISCA 1QAQA 3BEDA 2XAAA 3Q15C 4AXBA 4E4YA 5CEFA 5K09A 4HK4A 5JTUA 1OMOA 3DHEA 2CVOA 2O23A 2V96A 4IS3A 4OD0A 4IHQA 2JVJA 1K1EA 2J9YB 1GGKA 1Y9ZA 5HUJA 2HQSA 2QTAA 1G98A 3PSAA 2H2GA 2XTAA 4WHMA 1WSWA 5M7EA 4ZQEA 1UOEA 1CHNA 2O7QA 1PLLA 1YKSA 3Q2KA 3UPUA 3FHLA 1Z25A 1RWWA 4DVGA 1R0CA 1TQ6A 1P3Y1 1TZMA 3CNHA 4WI1A 4XPZA 2I22A 2CXTA 3W8DA 4QDOA 3DVAB 4U7FA 4TRNA