3KKOA

Crystal structure of m-ras p40d/d41e/l51r in complex with gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
NLPTYKLVVVGDGGVGKSALTIQFFQKIFVDEYDPTIEDSYRKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein M-Ras
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 169
sequence length 169
chains with identical sequence B, P
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkoA00
1E69A 2GZDA 1KSJA 2GZHA 4L9WA 4B32A 2GXQA 4QNRA 4IDPA 1E9BA 1W4BA 4HAWA 4EPYA 4MRNA 1C1YA 3SHWA 1CR4A 2LWIA 1XMIA 1ZNYA 3ONWA 4RD4A 4DB4A 1MH1A 1W2HA 1AZSC 1Z2CA 3AKYA 4W5WA 5JECA 1RIFA 4AD8A 2EYUA 2WSSD 2N46A 1L2TA 1YVDA 1FZQA 1KIMA 1S1CA 3LQQA 4OK3A 2V1UA 3LDAA 2ZE7A 2O8FB 1E1RA 2HCJB 2AN9A 5IT5A 4DWJA 2ZRKA 4NDZA 1VG0B 2CCJA 1W44A 1G291 1OE0A 4YDSA 3B1WA 5FBVB 1J99A 2P67A 4M21A 3WNCA 1WB9A 2IC5A 4NYIQ 5JMTA 4ZI2A 1NJFA 4UNPA 5EXTA 1A2BA 3SEAA 3EAQA 4LBYA 3PITA 1Q3TA 2RHDA 1S96A 2EVWX 5CB8A 4GZMA 4MGKR 1W0KD 2RGBA 1E2EA 3N5CA 1EXMA 1M6NA 3QG5A 4BUJA 2EU8A 3VTKA 1SVWA 2N1BA 3DZDA 1MKYA 2NQ2C 4PC7A 4Q9LA 4QJ3A 2QE7A 3PVSA 3RABA 4ASUD 4D0GA 3BORA 3A4LA 4U02A 2DFNA 4MKGA 3U3KA 1VYTA 3T61A 2B21A 4BWYA 3LXXA 4B3GA 1ZD8A 4LHYA 3THOA 3W5JA 2VP6A 4XD7D 1XEXB 1BO6A 2R62A 4IJMA 1E9RA 4TMTA 2WPDD 2AD1A 3MFYA 3EIHA 1OIVA 1GL7A 2IXGA 3I1FA 4FMDF 4LBVA 3R8CA 4LYHA 3GLFB 2OSBA 1JJVA 3QSYA 4MYCA 4MYTA 1KMQA 2UZ3A 2VEDA 3A36A 3NG1A 3K70B 1E2JA 3CM0A 1T4GA 2V9PA 3ZZTA 3RRYA 1NJGA 1QHHB 4P4UA 4TWZA 3P20A 4O0MA 3NIBA 4ZDWA 4EJSC 3VR1A 1NMYA 1RRGA 3A1SA 3OIVA 4UKDA 4DKXA 1DAGA 4A0FA 1RYHA 4O3MA 4R98A 3DL0A 4P32A 4TMZA 4ZCMA 1GM5A 3N2IA 2C95A 3GJ4A 2KB0A 1F2TA 1T3LA 2KBFA 2FFQA 1R4AA 1E0SA 1OIXA 3P27A 3B7GA 4DC9A 2VIIA 2RB4A 5FL7D 1ZVQA 3RS5A 1J7KA 4KVGA 4KVAA 2OAP1 4B74A 1DAKA 2EWWA 3JZAA 4BLPA 2QL6A 1N6IA 1BYUA 2Q21A 1EFCA 1XEWY 1G7SA 3X1XA 4B71A 5JS7A 1TPZA 3I92A 3SFZA 3ZQ6A 1OFUX 5C1BA 2NZ8A 1G1MA 1W4RA 2BBWA 1YR8A 3CWZA 1Z0KA 2J5XA 5CIQA 1FP7A 1E9CA 5ELXA 1PLKA 2WV9A 3FHTA 3WY9A 3GEEA 1NVWQ 1ESNA 1X8JA 2PZFA 1Z28A 3T12A 3ASYA 4Q1DA 4NYMR 1SXJC 2ONKA 5JS8A 4KLNA 5GJBA 5JWRA 2ZSFA 1G3MA 2K5UA 2QGNA 3IPYA 4HZUA 1NG9A 4II7A 821PA 4DHEA 4RKFA 5DGXA 1CRQA 1NMXA 1L7VC 2QSYA 4LHVA 3L0PA 1ZCBA 2XITA 1JR3A 2P5SA 5FTKA 3X1DA 5JI2E 1TEVA 2YKGA 4CF7A 1N5JA 4I99A 4MRVA 5EE5B 1KSGA 3QF7A 1L8QA 1YZLA 3HYTA 4GOKA 3B5JA 3GJ7A 5FBLB 4LJ6A 4GNKA 4B6FA 4CT4B 1UBGA 2ZRPA 2XTZA 3DO6A 4PX9A 2FU5C 1T8UA 1DARA 1S9DA 4KYIB 1E4VA 3ZQJA 1G3UA 1XU4A 1Z22A 1RJ9B 1QHSA 4HUQA 1NVXQ 3SQWA 2IS4A 3VNUA 2LCFA 1QHXA 2H5EA 2GA8A 3QG1A 2WJJA 1Y63A 1U0JA 2QE7D 3IBYA 4AYXA 4DCVA 1ZYUA 2CVHA 1E0JA 2JLXA 1KMHB 2OE2A 3W6NA 1IN8A 1P72A 3V4RA 1CEEA 2W2XA 3LQRA 5SZHB 1KI1A 1Z0AA 2Q9BA 4I1SA 3TMKA 2AWNA 2IF0A 2JCSA 2C99A 2XSZA 4DCNA 3KTAB 2C03A 4P4SB 4NE2A 1FUKA 1ELOA 2IYRA 3CRQA 1XTKA 1GNQA 2ZU6A 4D81A 3PUWA 3QI2A 1KO4A 1FX0A 4A8JC 1N6RA 4D0LB 5DI3A 1E9AA 4BGDA 2FDCA 3I72A 3U44A 4NCIA 2OEPA 4PZYA 4Y0VA 3RYTC 4DJTA 5DN6D 4ESHA 4MGIR 2C96A 3EZ9A 3PUZA 3OESA 2ONJA 1K6MA 4M53A 1X6VA 3MGCA 1KDOA 3GJXC 5KTYA 1G3IA 4H1VA 3TRFA 4GSYA 4LWZA 5D3MA 4CT5A 1T0JB 2RGGA 1HH4A 1Z47A 3FPAA 4G5RA 2GEDA 2XZOA 1RKBA 2EFCB 3FFBA 1E98A 2AK3A 2QMHA 1Z6GA 3PEYA 2VBCA 1YZGA 4TLAA 2ZRCA 4DRZA 2ZI7A 2QMEA 1XD2B 1ZD9A 3EPLA 5CB6A 1UBFA 3K0CC 4BFTA 4LBWA 1E6CA 5L3QA 2GCOA 3KJHA 2PMDA 1DE0A 4A2QA 2V55B 4BLRA 2CDNA 2GJ8A 4QL3A 4Q4AB 5HPYB 3BIFA 3SZRA 2FGKA 2HLDA 2QAJA 4DXAA 2XJ9A 2F7SA 3GP8A 5A5GA 1ZUNB 1GKIA 2C8VA 3HDTA 4HEJA 3V4FA 3KJEA 4IKEA 3QKSB 4KU4A 3T06B 1I2MA 4DLYA 1IXSB 1GP2A 5J4YA 1R10A 4B47A 2IXEA 3O8BA 5DN6A 1HUQA 1XBTA 1S2MA 3CRMA 4G01B 4ARZA 2QBYA 2IWRA 3O8RA 1P2TA 2JJ1A 1WE2A 1E2LA 2ZQ5A 3T1OA 3K9LA 4Q1BA 2NO1A 3BE4A 1N6KA 3CPJB 2EW1A 4JKYA 4CGZA 1NSFA 2QTVB 3AF3A 5FBQB 1XCMA 1S1MA 3JVUA 2YZ2A 1CU1A 4PO8A 1CR2A 3H2YA 3LBHA 4TLCA 1CBUA 4CEIB 5FOSA 1COWD 1OW3B 1X86B 1R2QA 2BMDA 3GMTA 4R9UC 4JBXA 5KSZA 4DLUA 5CK5A 2X19A 2B7BA 1TF7A 3IIKA 3ECCA 2WAXA 4LRWA 2Q6TA 5TB5A 1R7RA 3ASZA 1E9EA 5AUQA 4IRUB 4B3CA 2NZJA 3BFXA 3F3YA 4B75A 2ANBA 2OFOA 2W58A 1TNDA 3NEYA 2BKEA 3VR5A 3WNBA 3L2OB 4JL5A 4ILEA 5FTJA 5KSPA 1LF5A 2EQBA 2XJ4A 3BS4A 4Q1AA 3WYFA 1KY3A 2FGJA 2GEVA 2W0MA 2NO0A 2NG1A 4AWXA 1GL9B 5FI1B 3DHWC 1G9XA 5FPKA 1SVOA 2H8KA 2ZRGA 2G1JA 2IHBA 1XJ0A 3X1WA 1II8A 1IONA 4DZZA 3OFND 1RFLA 3Q3JB 4JJZA 1NBMA 1U9IA 3K0FA 2GK7A 3RWMB 4GOXA 4DLSA 4FMBB 2W6JD 1EX6A 2A30A 3BWDD 2R44A 4JIMA 2WMOB 5JJIA 2O8DA 4TQ9A 2O52A 4OHZA 2OZEA 3WHKA 5B30A 3VNVA 3IIMA 2O8BA 1BIFA 2RGXA 4GZLA 1GUAA 2ZS7A 1COWA 1QHGA 1NLFA 3AH8A 3WMFA 3RNLA 4BFVA 1S4QA 5FUWA 4EFLA 4LY6A 2FG5A 3QF4A 4TTQA 2QUZA 3KJIA 4Q1CA 1M34E 5GVRA 4G3XA 1P7CA 3SJZA 1HQYE 3ADDA 1DO0A 3K0AB 3KKNA 4ERNA 2W0SA 3EW9A 3QXSA 4LYAA 2IW3A 1NI3A 1Q1ZA 2W00A 2WWWA 1KI6A 3ZD7A 3KKQA 2WJVA 4K8OA 1C4OA 4TMVA 5K8TA 2MSCB 4JT2A 3QIAA 4KHZA 3L8ZA 2EYQA 3W34A 4TTPA 1AQUA 1G6HA 2YWGA 2F1JA 3FVQA 2O8FA 3LAWA 4B3DA 4QFMA 4M9QA 2JLSA 2DHRA 2VF8A 1N6NA 2W6JA 1P4SA 2FZ4A 3K70D 3VU9A 4A0GA 3T34A 4KI0A 3WBKA 3OIWA 1CULC 4MKIA 1JR3E 1XD8A 1YZQA 4ON9A 2BOVA 3H4MA 2OCYC 2A2ZA 4PC6A 5F2EA 5G3YA 4D80A 4HAXA 1G7CA 1W2GA 2BDTA 3K09A 5AR1A 3PENA 1FMLA 3CRVA 3AVWA 3QBVA 5FBRB 5KUTA 4M4SA 4CYMA 4D26A 2WMNB 4HB0A 1JPNA 1CP2A 1GAJA 4JT4A 2ZJZA 1HT2E 3PR1A 1SHZA 1A7JA 4AIIA 3EXAA 4DLXA 2JLQA 1ZM7A 4IOKA 2I3BA 3DVLA 4IVQA 2I4IA 4V0LA 5FH9A 2RGDA 3BGWA 2JLYA 2YYZA 5HE9A 3I5XA 1U8AA 2F3TA 1W48A 2WJIA 4NYJQ 4UXIA 3RS0A 3DKVA 1ZNWA 4NONA 4YQFA 5LDDC 3ADBA 4PO1A 4TMWA 5BQ5A 4WA7A 3BH0A 2GAAA 4JLMA 2B6HA 2WJGA 2GBLC 3IKJA 4FW9A 4CZ2A 3GLFA 5BYJA 2VYFA 3EG5A 5G40A 3F5FA 1GL6A 1CF4A 4LHXA 1FL9A 1LS6A 1ZIOA 3AVOA 4HZUB 2ATVA 4OK5A 5SZJA 5TY0A 1J70A 4C0KA 1KI4A 4JVNA 3WMEA 1ZAKA 4PC3A 3AUYA 3WXMA 4CW7A 4JLKA 3GLGB 3I5YA 4XSGA 4BZXA 4D25A 1U99A 2JATA 3GLIB 5L8VA 1UM8A 3BH6A 3FB4A 5B57C 4TLBA 3W8NA 4YMSA 3KUCA 3ZD6A 2ZI3A 1EG7A 4XSHA 3RRZA 2GILA 5FPTA 2OLKA 1A5TA 4EAQA 4Z8YA 4A36A 2VP0A 1BMFA 2VF7A 2CLCX 2ZR0A 4HUQB 3T5GA 4QKQA 2ZRLA 4Q7LA 4PQYA 2QNRA 4FMDB 4G5GA 2R6FA 5H70A 2JJ2A 4HLCA 4N3NA 5FFMA 3FMIA 1H8ED 2JIZA 2ZRJA 3TSOA 1Y3AA 4V0OA 4JLNA 2R6GA 3BJIC 2QORA 4ZDIA 1HYQA 1KNXA 1E4YA 3SI7A 4PPFA 3UXMA 2YVUA 3EA5A 4M1SA 3P1JA 2QAGC 3QKRA 1OHHD 2D3WA 4B73A 2QT1A 3H0KA 3ND8A 4NZYA 3U7GA 1DAHA 1E1QD 3VKGA 3QBTA 4HLDA 2D7DA 2IYTA 4Z1MA 3AVXA 1FX0B 5DI3B 1HA3A 5C46F 1NNEA 4GT1A 4A2WA 1JB1A 3B8HA 4IHQA 4OI0A 4R71A 1KKLA 1W47A 2J46A 3KKMA 4M8NE 5LD2B 4ZV4A 3RAPR 4TL8A 2PBRA 3SQXA 4RCYA 1P2SA 3H1TA 5E95A 2RAPA 3FTQA 4QJ4A 1QZXA 2MMGA 1CKEA 3OAAD 4P3YA 1H8EA 3A1UA 1OFIA 3LXRA 5JJKA 3TLXA 2Z4RA 3LBIA 4FCWA 4MRSA 2F43A 2ZI4A 1KMHA 2V6JA 3E2IA 3A1VA 4N0EA 521PA 4CVNA 2F1RA 3CZQA 1ZNZA 3N2EA 4TYNA 4P31A 3SFVA 4B3XA 5KPJA 2ZJ8A 3QUSA 2ZYUX 2V4ZA 1AKYA 2WJHA 1PZNA 3VQTA 4DCSA 2ODNA 2IL1A 3GJ6A 1GG2A 3HJNA 4LBZA 1Z6XA 3PEVA 1YRAA 3IHLA 2QPAA 1P9WA 3OEED 1G7TA 5J47A 4Q01A 2A9KA 4QBFA 1ZM4A 1G8YA 4QJ5A 4QOSA 1LB1B 2BIFA 4WAUA 5TDHA 1JEEA 1NBME 2G9NA 3RSLA 5JFGA 2QBYB 1PLJA 1VHLA 1J8YF 4NCNA 4F4CA 2PT5A 5H68A 5KNCA 1W46A 2GJ9A 1SVIA 1RC8A 1IQPA 2WIAA 2CNWA 3QKUA 4D4MA 3REFA 4C4PA 4DCUA 4BFWA 3PEWA 1OB2A 1G8PA 2ZU0C 4RSGA 2MMCA 5DSZA 1KJYA 2BJVA 1UEIA 2I1QA 2QMOA 1E9SA 3QEJA 3QPUA 5BXQC 5IK2D 2OUKA 2ZE6A 1YKSA 3OEHD 3LNCA 2XGJA 3P32A 3I61A 2NPFA 1LW7A 2CVFA 3U4QA 2WOOA 2HYIC 1XTJA 3QVVA 2IEYA 4FINA 1PUIA 4BLQA 3RS2A 3U60B 2E1RA 2WWGA 4JLBA 4DCTA 1J8MF 1E2PA 2P65A 2V8OA 4QHTA 2IUUA 1D9XA 4M9SA 2CHGA 1U0LA 3Q5DA 4IDOA 1EFRA 3AF0A 2IYUA 3QKSA 2IXFA 4W5HA 3UKDA 1NIPA 3ZVNA 4NU0A 1OH5A 4I1VA 1FPMA 1RRPA 1IN7A 3CNOA 3TJZA 4BZPA 4US0R 1QVRA 3QOFA 1PV4A 1UBEA 4RD1A 1U81A 4QGHA 1II8B 1JXMA 4NBSA 1E1RD 3LVQE 3TW4A 1R0ZA 2PZGA 3K9HA 4NPHA 4D82A 2JLUA 2DWPA 3HU1A 2C9CA 3EARA 5C2JB 2VRWA 1SQ5A 3AVVA 2JJ8A 1F3OA 3CX6A 3FWYA 3TVDA 3UMSA 2OFWA 2GTPA 2O8BB 1M7GA 1WBBA 4CEIA 4G5SA 3DOFA 2W2VA 3NEJA 3LD9A 1VPLA 1G3QA 1MOZA 3LV8A 1VCNA 3NBXX 4EFNA 2ZM5A 4JKIA 2GJSA 2RHMA 1JI0A 5GJWC 4O25A 1ONBA 3ZDQA 4Q47A 3OEHA 3QPVA 5A0FA 1XMJA 4LPKA 2CK3D 4C0AC 4OK6A 4AG6A 2YOHA 5TMPA 3AVPA 5L3RA 2NOAA 1TU4A 4EKDA 3U7HB 2OBLA 1UF9A 4QGGA 2KJQA 2Q3MA 3BB4A 1KI6B 3C5HA 2PEZA 1Z8FA 3PCRB 1VG1A 3GQBA 4DVGA 2Q0HA 1N25A 3HPRA 1VECA 3M0EA 4KFTA 3GLFE 1RPZA 4AKIA 2VSFA 1A82A 2SHKA 4W5JA 5L3VA 1UKVY 2D06A 3GEIA 1S3GA 4DIDA 4U5XA 1HY3A 4GMXA 3VU9B 2FPLA 4MITA 4BPBA 3UPUA 4ABYA 1VKJA 1Q44A 2IYXA 4JSTA 1KO1A 1OPXA 3AKDA 2J7PD 5AJWA 2QQ0A 4EIWA 3AB3A 2H16A 3EA0A 1XTIA 2JLRA 1EFHA 1NVVR 3KDSE 4DEXA 2E9SA 2IS2A 3ZLJA 3C5CA 4AC9A 1XCPA 2FF7A 5G3ZA 3NTUA 3VFDA 1CS4C 1RE0A 5AUNB 5HZHA 2QA5A 3P4XA 4G0NA 2C2HA 3PUYA 2JA1A 2A5DA 1E2DA 1RVDA 3GFTA 4LDJA 2CK3A 4C0QC 3THXB 4D6PA 3GJ8A 3K0AA 2UVQA 4F92B 1KI3A 1ZM2A 4MKFA 5SZKB 4A6XA 1E94E 3ZZ0A 1N0UA 3WMGA 4EDHA 4CRWB 4DLRA 4OHYA 3FMFA 5JZVA 1JEDA 1ZUHA 2FEMA 3EZ2A 2XB4A 4DDUA 2NIPA 3PUVA 4K81B 4D4JA 4TZ0A 3M1IA 4KLZA 3DKPA 3ZIAD 4CEJB 1Q22A 4B76A 4X8HA 2ANCA 2NGRA 1KAOA 4NYMQ 5LBIA 1X1SA 3NH9A 1ZMXA 2LKCA 3BD9A 5CITA 4URUR 2J0QA 1TTTA 1DVRA 2WZQA 5CM9C 3LA6A 4OQFA 1XEWX 2J7PA 2WOJA 1JR3D 1O3YA 5DNYB 1P6XA 5B2ZA 2IYYA 1OH7A 4RD6A 4Q4HA 2GJAA 1IM2A 4F4IA 1JBKA 4A0HA 1SVKA 1NMZA 3I73A 3KXLA 2FOLA 3QENA 4TYYA 1P73A 1XNJA 3EZFA 4TN1A 2GESA 4Q9HA 3AF1A 4M1TA 2J0UB 1HEIA 1U0HC 1U8YA 2IUSA 2UZIR 3TSZA 3ADKA 3TVTA 1Z63A 2EFEB 3REGA 4BRUA 1NKSA 1P9RA 4HDQB 1JJ7A 1Z6AA 2CE2X 2ZYTX 4PQRA 1EGAA 2ZE8A 3PG5A 2VHQA 3SYNA 5JRZA 1L4YA 4URYR 4M1YA 4S35A 3GJ3A 2PCJA 2AR7A 5F9HA 1DAMA 3ZIAA 1MO3A 3L0OA 1EFUA 2PJZA 3C8UA 3ND9A 4BRWA 4MH0R 3QKRB 4IW3B 3UANA 2XSZD 1W36B 1DELA 1UKEA 4HB2A 3L0IB 1H8HA 4M0LA 5DH9A 1K5DA 4Q7MB 2ZSDA 3TSWA 3TUJC 1AGPA 5HCNA 2QRNA 3KZ1E 3GLGA 2EFGA 2XAUA 1NY5A 3GLIA 2H7VA 1G64A 3IQWA 721PA 2O0KA 4LHWA 5BN4A 1QRAA 2FX3A 3KQLA 3X1ZA 2QY9A 1T3SA 2F9MA 3LH5A 4XWKA 2X2EA 3O47A 3KQHA 1QG2A 1WDTA 2AWOA 4TL6A 5GJCA 4Q1EA 3T1TA 1FTNA 2QN6A 2WWIA 1YR9A 4JSYA 3THWB 3EIQA 2XEXA 4Q4JB 3D7MA 2BEJA 2F43B 4KYUA 1XD9A 3RS7A 2IK8A 3B85A 4YONB 4A9AA 4C0BA 4PHHA 3TAUA 2OCBA 1FNMA 1OJLA 4I1UA 1W7AA 3J81k 2VP9A 4A8JA 3KXIA 2HLDD 4OQNA 5AJZA 4DSTA 2YOGA 3QKTA 3SYKA 3W90A 2IEZA 1R5BA 4B2PA 1IHUA 1TUIA 4Q7KA 3CWQA 4JZKA 4F91B 2ZS8A 1FP6A 3GCGA 3MD0A 3SBDA 1T8TA 2JEOA 3QXHA 2ERYA 4ZO4A 3A4MA 1YZTA 4H9GA 3QNUA 5AUOB 2FH5B 5FOVA 2GWHA 2H18A 2OXCA 3QY0A 2V3CC 2XB2A 2HDNB 1QF9A 2X2FA 2FMXA 3OIUA 2VHCA 1II0A 3K9NA 1D6JA 4BASA 3G82C 3AVQA 2JJ1D 4JBYA 1M74A 5DHAA 4C0SA 2REBA 3CRRA 3I8XA 3RC3A 3W3AA 5J5CA 1OLOA 3TUZC 2E87A 2WWXA 3CF2A 5F9FA 3K0CA 3ICQB 2WJYA 1TU3A 3LY5A 2GF0A 4LC1A 4DDVA 2VO1A 4UJ3A 5GVSA 4CEHB 4LOAA 5EXSA 4WVFA 2NTYC 3NBYC 4AKGA 4BEBA 5EZ6B 1P9NA 2RGNC 4A15A 4Q9JA 1BS1A 3QXJA 4PSVA 1G17A 2ZUCA 5JHGB 2PJRA 2A3RA 3UMRA 1XB2A 3SDZA 3U4QB 4UNRA 3IO5A 4MRRA 1OB5A 1HTWA 3CO5A 4M2LA 5FPYA 3ZGXA 1E32A 1I4TD 3RRMA 1B23P 3ICEA 5KSYA 1LFDB 5CK4A 3BFVA 1XXHE 4TT3A 4BLSA 4XTCS 3BB3A 4U7DA 2FE4A 1MT0A 4BLOA 5JSZB 1NN0A 4HLUC 4DDWA 2FPKA 4G5QA 3TH5A 5FOUA 2BMJA 5JCZA 3LRPA 1N0WA 2BBSA 4QGAA 3NVAA 2NO7A 1Z0JA 1QDEA 2QP3A 1Z29A 2GXSA 1NBMD 3OIYA 1IXRC 1MABA 1M2OB 1P3JA 1KAGA 3FKSA 1VCMA 4QBIA 4YMVA 4TQAA 4LJ7A 1JQLB 4HDCA 4XVUA 1U94A 2OM2A 5J4LA 3QXCA 1KY2A 1KGDA 1W4AA 3W3ZB 2AFHE 4D0NA 2GXUA 4CIDA 2G88A 1G8FA 2A5GA 5HR5A 5DIFA 1S3SA 4C30A 1BKDR 4QRHA 1BH2A 2Z5FA 1VHTA 4TYQA 3W9YA 3MG9A 1QHNA 4W9MC 5CJ2A 2Z0MA 2G1KA 3E1SA 1RRFA 2QP9X 4HB4A 1DPFA 4KBGA 3RANA 3K0SA 3LW7A 1N5IA 1KJWA 1UJ2A 4UNNA 4S2EA 4FWTA 3CR8A 1XPRA 4B3BA 2ZJ5A 2PLRA 1YU9A 1FTSA 1OXSC 5E4FA 2FSFA 4N1AA 1XXHB 2F9LA 1KHTA 3IPXA 2WWYA 2D7CA 2R8RA 2J1LA 2HF8A 1R0YA 5HZKA 5G53C 2H1LA 3U2QA 2HYDA 1I4DD 3AP3A 2C78A 2REXB 1DG1G 1XDBA 5HKKD 1X1RA 2VPPA 4E07A 2EFDB 2HV8A 3RS4A 4US2R 1N6PA 3UWKA 2QPOA 3OHMA 3B1VA 421PA 3TR0A 1JAIA 1G3RA 5FPHA 3BBPA 3VAAA 2P0EA 4I1OA 4LJYA 5BW8A 5K8IA 4NTZA 1ZBDA 5FOXA 1KYIA 4JLVA 4BZQA 4DIEA 1OFHA 3EWAA 2ZR7A 1GNPA 1AS2A 3WRXC 1PVOA 2WHXA 4JL6A 1FOEB 2ASEA 2IWHA 2ZYWX 1GWNA 3R7WB 4R2HA 1UKYA 1D2NA 4HAUA 3CW2A 5KNBA 3K1JA 2HT1A 1E0AA 5DLQC 4HI0E 1R8QA 1N5KA 4FCTA 2A78A 4Q21A 1AS3A 1CJUC 1SXJE 3Q8XB 2J9RA 1F2UA 2AKAB 1E2MA 4FMCF 3U3MA 5JEEA 3RHFA 2Q9AA 5FR1A 1ETUA 4JYCA 1OF1A 1U9IC 4EFMA 1PJRA 4IOMA 2HEIA 3U7FB 1QBKC 1ZP6A 4HAVA 2AX4A 2ZAOA 1TX4B 3V00A 4PPNA 3S1AB 3L82B 4EJSB 2OG2A 2B8TA 3W6OA 1EESA 2P2LA 2GNOA 2Z4SA 4TSFA 5EP2A 5HKKA 3K53A 3G0HA 3T1QA 3QPWA 2F1HA 2GCNA 1TMKA 3MMPA 3ZS9A 2A5FA 5DYGA 2D62A 4IDNA 1G19A 3L8YA 3GLGE 1Q0UA 2BCGY 4TL7A 3GLIE 2JLWA 5EQTA 2WM9B 2ECKA 4JVMA 2WVJA 1Z06A 1KO7A 4UJ5A 1DEKA 1ZRHA 3EZ7A 4A82A 2FSIA 2CLDX 3P26A 4Q4HB 2X1VA 2C98A 3V9PA 3KQNA 1GNRA 3L43A 1ZC3A 5CDFA 1BMFD 3THYA 3THXA 1Q57A 2YWHA 2ZPTX 2C77A 5KDLA 4ZIRA 4RZ2A 4XWAA 2JJ2D 1AM4D 5FTLA 3U61B 1IAQA 1QG4A 2ZRNA 5FR2A 1SXJB 2GBLA 3CNNA 1OT3A 5ANRB 1UDWA 1YHNA 5JCPA 4MUAA 4Q02A 2CL0X 2JIZD 2P5TB 4FI3C 1WRBA 5F98A 2YJTD 5J40A 3Q7PA 3TQFA 4MRPA 2BV3A 3DDCA 1HT1E 3CB4A 3FHCB 3SR0A 2PLFA 2F1IA 4CEJA 1TF5A 2CCKA 4MGYR 1FMJA 5SZIA 3MWLA 1W36D 2QZ4A 4UNQA 2ZJ2A 3PV0A 5AWFC 3RRNA 4XIGS 3RSOA 2J45A 1EWRA 2YWEA 3FDIA 3MAAC 2ZSAA 4FXPA 5FTMA 1KI9A 1S9HA 2RGCA 4RKEA 3TR5A 4Z1MD 2ZRHA 4GPTA 3FKQA 2YC2C 1ZC4A 3FMPB 4LHZA 3W6PA 4TLDA 2J0VA 3QEOA 4AYTA 2J0SA 3EZ6A 3CONA 1E2HA 1XEFA 3RLFA 3GLHA 2ZANA 4PHGA 1TAGA 3GFOA 3VR2A 4PO9A 4NHOA 2D4HA 3K8YA 2J0UA 1XMVA 1D2MA 4AK9A 1IOZA 2BM0A 3FOZA 4KBFA 3TNFA 4Q18A 3LLUA 2KSQA 2OCAA 4ZCLA 3VR6A 4C7OB 2AD5A 5J4VA 3HU3A 1CIPA 2GRJA 1MV5A 2QAGA 4Q4LA 3CPEA 3K70C 2J59A 3KJGA 1JXOA 5AK0A 4Q9IA 4G1UC 4PXAA 4A8JB 1HURA 3EX7C 3OE7A 2DFKB 4B35A 5KU1A 2CEAA 3KX2A 4Q66C 1VIYA 1ESMA 3F8TA 2GVZC 1G8GA 4KITB 1N5LA 2FPMA 2O0HA 3BB1A 3U3OA 2ZI5A 2DR3A 2QP4A 2HF9A 3IBGA 5C18A 5JWHA 4BECA 1SKYE 3T5DA 1E2GA 1PUJA 1ZJ6A 2XOKD 2GK6A 4Q19A 4GP7A 1NIJA 2PCLA 4ZCIA 3MCAA 2WWHA 1IJFA 4DT1A 3UATA 1IBRA 2OBNA 1Q1BA 4LJ4A 2CNWD 2GEUA 5D3QA 4HSEA 4JJKA 4DLTA 1S0UA 3O8DA 2ZITA 2CMKA 2F6RA 1F6BA 2RGAA 1G5TA 4JS0A 3THWA 1XRJA 3PUXA 4Q4JA 4TMKA 3NH6A 1GILA 3AQ4A 4E09A 3B9QA 2JGNA 4OYHA 1TEXA 2NPIA 1II9A 3NHAA 4XVRA 4EPRA 1QVAA 1JPJA 1UEJA 5L3SB 1IY1A 2WSMA 1CLUA 1UPTA 4FD2A 4RFVA 4KO8A 4PHFA 1EFRD 1ANKA 2BCJQ 2QI9C 3JVVA 4RZ3A 1OXUA 3TKLA 4A1FA 3NDPA 3U3RA 1WBDA 4LC0A 2QT0A 4DLWA 5KHOC 2PL3A 3RC8A 3HR7A 1Z3IX 4GDFA 2XOKA 3DEFA 4OHWA 1MABB 1SKYB 4GI7A 4O2RA 3IQXA 3QVUA 2AL7A 3B82A 4WBSA 4OI2A 5KSOA 1DTSA 4BE7B 1ODFA 1J90A 1W49A 1ZU4A 2DFTA 2OAQ1 1YR6A 3U5ZB 1D2EA 1FUUA 1AJEA 5FUXA 3RWOA 1OIWA 1D9ZA 1NKTA 3CKLA 3GJ0A 1Z2AA 3E70C 3FE2A 3MUFA 4CEHA 3DZ8A 1XZQA 3B60A 4QC2A 1JQJC 3DMNA 1ZU5A 3NC0C 3D8BA 3GEHA 3EWSA 4KFRA 2J7KA 3A37A 4D2IA 2L0XA 3F0TA 1KI7A 2C9OA 3UIEA 4NCJA 1LF0A 2D2FA 4ACBA 2I1VB 1E3MA 1DO2A 3U6BA 1Z5ZA 2V54A 2AHOA 3PJRA 2FFAA 2QSZA 1J2JA 2VH5R 3CIOA 4UXHA 1IN4A 4FWIB 3SC3A 4U00A 5FTNA 1GOTA 2GCPA 3BFKA 4DLVA 4B6EA 2AFIE 5JSZA 5KOYA 4IVRA 4PSKA 3T35A 1GZSA 4Q00A 1JECA 1GDDA 1Z0DA 4OHXA 2ZI6A 4J0QA 3OF5A 1I2DA 3KUDA 3A8TA 4LV8B 1X8KA 2VHJA 2WKPA 1WXQA 4B33A 2G6BA 4ZDKA 2O8CB 5A4JA 1W0JD 2IHYA 2G0TA 4C3ZA 2MSEB 3ZS8A 1SVLA 1VIAA 2OLJA 3MSXA 4BEJA 4BFUA 3BERA 2QG6A 4OJQA 1HQCA 4BQSA 4DEYA 3IGFA 1S8FA 1V43A 2H92A 2ODWA 4US1R 2YC4C 1DAFA 4MKHA 3O8CA 2Q3HA 1EWQA 5J4KA 1OXVA 1NVVQ 2OXRA 5CDFE 2RMKA 2PEYA 2XZPA 2ZRDA 4GL2A 4EPVA 3K0EA 1FFHA 2X8AA 4Z51A 4TL9A 1F2UB 1KTVA 1MR3F 2HJGA 2W6IA 1GFIA 3CR7A 3NBZC 4FCVA 3AKCA 1C9KA 4XOIA 2FSGA 3NBFA 1XXHA 1N0VC 2GZAA 2DB3A 4UXJA 2FEOA 2P6UA 4PAMA 1M1YE 1XWIA 4KODA 2D74A 1GRRA 4X8LA 3UG6A 2C04A 3ZYCA 621PA 3HWSA 2ZIAA 1ZD1A 5H1YA 1W0JA 5HCIA 2WICA 1LS1A 4QGFA 5EXPA 2OHFA 3ZH9B 3GFPA 5KDOA 4L16A 3NHBA 2FA9A 3KFXA 4YXWD 4ZI3A 2IYSA 4NMMA 3HU2A 4DB2A 5IF9A 4C0LA 1ZW6A 3GLHE 2KE5A 4IXNA 2ORIA 4MA4A 2FN4A 5HE8A 2Z83A 2WAYA 3R7WA 1KI2A 2VP2A 5CIWA 2LKDA 3THYB 3D31A 2NO6A 1V5WA 3AVYA 4Z8XA 4HZIA 1P2UA 4JLPA 1OKKA 4KV9A 2A7QA 4BLTA 4ZIRB 2XNDA 2VSOA 2F55A 4DUGA 4YMUA 2UKDA 2ATXA 1KSFX 3BAFA 3MLEA 4E5UA 1SXJD 2ZS9A 3AEZA 5LPNA 4LSGA 3TK1A 1G5RA 2R6CA 4WZBE 1T91A 4HAYA 3TW8B 3PIRA 1KOFA 2A5YB 1VTKA 5FUYA 2CHVA 2XXAB 2JLZA 1XJCA 3KKPA 5DO9A 3S1AA 3CF0A 2RH5A 4EJSA 1IXZA 4Z54A 3IUYA 3A58B 4A0RA 1GKYA 3WRYC 5AJVB 1XP8A 2FZLA 4RCZA 4Q5IA 3U3JA 4YMTA 1FQKA 5TXGA 4FIDA 1H8HD 1Z0IA 5E3HA 1GRQA 3Q5EA 3KKOA 3UG7A 3TBKA 5BN3A 3OZXA 4RZXA 3IO3A 4YXWA 1NLZA 1XCGB 2MSDB 1KDTA 1VCOA 2VP5A 5DYIA 4PFSA 3UK6A 3I32A 4FN5A 2G77B 2WSSA 1E2QA 4FMCB 3C4JA 1JAHA 1MRNA 3GLHB 4E22A 2KWIA 3T15A 1NN5A 4LJ8A 4A2PA 1RRCA 121PA 4L9SA 4NYIR 3UMFA 3GD7A 5JLJA 2O5VA 5G41A 5JEDA 1GRNA 2P3SA 1SVMA 1GTVA 5BYKA 4OL0A 1U2RA 3SN6A 5LB2A 1SXJA 1XZPA 1M8PA 1UFQA 3DPUA 4MYHA 5C4GB 1Q12A 2QAGB 3QXXA 3QQ5A 1W0KA 1TQ4A 3KB2A 4PPGA 5KYKA 1NSTA 5DE3A 3MWJA 1HE1C 3ZVRA 1JALA 2JASA 3SHFA 4ASUA 1CTQA 1TQ2A 5GJVC 2HXSA 2R6DA 3BK7A 1YR7A 1R5NA 1E9FA 4NCHA 2FSHA 2ZEJA 2Z43A 4IXMA 4P4TA 4TTRA 4NCKA 1OXTA 4XWOA 4PTLA 4I81A 5CJPA 4XD7A 4KFSA 4JYBA 1YZUA 1GVNB 4ZKDA 2WPDA 1US8A 3ADCA 1MO6A 1VMAA 1EK0A 2ZVQX 1G41A 1P61B 4ACAA 1WF3A 4PC2A 1LTQA 3EPKA 2YINC 4H1UA 4RFSB 3X1YA 2W83A 5IHPA 4LGMA 2PH1A 4DT1B 3QE0A 4JBWA 2QTHA 1MRSA 1SKQA 4DSOA 2WWFA 2ZRMA 2FFHA 1G8HA 2X77A 4QNMA 4EQ6A 3CNLA 1NLYA 4C7OA 4JL8A 4V0MA 2ZE5A 4QBGB 4A92A 4X8OA 4LPSA 2O8EA 1PLLA 5J4HA 2BM1A 4ZKEA 5EZ5A 4DLZA 2B8WA 3EIEA 2RCNA 5FL7A 2QM7A 2P6NA 4QHYA 4D4KA 2GKSA 1DAEA 2BJWA 2WKQA 1Q1EA 2F3RA 3DM9B 4TYPA 4DBLC 3SJBA 1DG3A 1KO8A 4TT3D 4ZPXA 3VX4A 5JRJA 1KKMA 3U7EB 1E99A 1KDRA 4IEEA 4V0NA 4LYJA 4RD0A 4OBEA 4OQXA 1NN1A 3UWOA 1T6NA 3MRSA 4C9BA 1ZUIA 4JVLA 1AA9A 3AP1A 1AS0A 1CJKC 5GADl 1N3BA 2BHRA 2IA5A 1HE8B 1P2VA 3CH5A 1U8ZA 4Q03A 2V1XA 4B43A 3FKSD 3B78A 2DFLA 2QM8A 2YWFA 2GVDC 3A1TA 3CX7A 3WNDA 1KK0A 2RGNA 1XPOA 3R9WA 5EP3A 1T5LA 3IEUA 1NVUQ 3R8FA 3SBEA 1F5NA 1E2FA 4GOJA 3ZJYA 2XTNA 2GHIA 2ZSBA 3EPJA 3NWJA 3AV0B 3IDQA 2J41A 2VL7A 5DISB 3Q85A 1KI8A 1P62B 3IILA 3KFVA 2DCUA 2ZJAA 4LI0A 4MUBA 4WXRA 4B2LA 3CZPA 4HLUA 2BBOA 2HJVA 1JNYA 1OH8A 4TLEA 3SNHA 1DADA 5L3SA 2VHTA 2BC9A 5LD2C 1CJVC 3C14C 3I8SA 4I4LA 5FL3A 2P6RA 4IOJA 3MWKA 3LX8A 3Q9LA 2QU8A 4MYUA 4UQOA 4OQMA 3C41J 2ZREA 5EE1A 3VHLB 3VHXA 4RVCA 1E9DA 2IYWA 5EXXA 4PHTA 3C15C 2N42A 2ZXUA 5LB4A 4C2UA 2V6IA 2KI5A 4GP6A 5FI0B 4AY2A 1GKUB 1G20E 1G7RA 3A1WA 4V03A 2R9VA 4EPXA 4Q7JB 4MQBA 1ZM3A 3DOEA 1BYIA 2ORWA 1JR6A 4DDTA 3AGPA 4QG7A 4URXR 4WIAA 2OESA 1I4LD 4JMPA 1RYFA 4HLQB 3MJHA 1LNZA 1TL7C 2IYQA 1YJ5A 4L15A 3AGQA 2Z6VA 5CYOA 3BH7A 3TQCA 4LK2A 2GDJA 2C5LA 2IX3A 4M1KA 1CR1A 2CJWB 1ZNXA 4EUNA 4POAA 4EPWA 4LJ5A 4KXFB 1TADA 5TARA 5EP4A 1FQJA 1ZCAA 4QHSA 3ZVMA 3ZVLA 2ZRAA 4IVPA 5B64A 3EC2A 2XNSA 1M7HA 1Q21A 2ERXA 3PQCA 2OT3B 4F38A 4W7SA 2VHUA 1YZKA 4KFUA 2IS1A 4PAQA 4RD2A 4MDFA 3CUEF 4TSFD 1F48A 2J87A 2QROA 3A6PC 2JLVA 1DAIA 2CLSA 5B58C 2O8CA 2ODEA 2R2AA 1TQDA 4X8MA 4UNSA 3KB1A 3BRWD 4BFSA 2ZTSA 1VYUA 1XMSA 3PFIA 3AF2A 3IHWA 2G3YA 4PAOA 5AUPB 2WTUA 3CPHA 4RZUA 1MO4A 1YZNA 2GETA 1WQ1R 1W5SA 4QBHA 3AP2A 5HTKA 5M04A 3PEUA 1MO5A 1A2KC 2ZR9A 2ZYVX 4IOLA 2ZRBA 5DI9A 2ZROA 2IS6A 1Z0FA 4PANA 2ZJYA 2ZAMA 3C16C 4Q48A 2RKOA 3BOSA 1KK3A 2VP4A 1G4AE 1VCIA 2HXYA 3WHLA 4L5BA 2RGEA 2VQSA 1A4RA 1N2CE 3SJCA 2BVNA 4M1WA 1R8SA 4BFXA 4BFZA 2JAQA 4GMDA 2AKYA 3EASA 4LYFA 3G5UA 3JZMA 2QGZA 2B7CA 3SJAA 3VR4A 4LV6A 5E7MA 3KXKA 2VSXA 3GPLA 2ODBA 3CX8A 3QJYA 5FBWB 3Q72A 2PX3A 4HUTA 2IYVA 5EP1A 1QHYA 2ZUDA 3K9GA 3TUIC 2AXPA 4OHVA 5CLLA 3FFAA 1M7BA 3KL4A 3BC1A 2NMVA 1OH6A 1KZGB 1CR0A 1NG1A 2WIBA 1X3SA 1SULA 4MDEA 3FHOA 5JI3E 2XX3A 3LO5A 3TIFA 4XTRA 4YMWA 4AYWA 2DY1A 3M6AA 2YHSA 1AK2A 2PX0A 1K5GA 1HV8A 1SHKA 2AXNA 3R9IA 4XVQA 4EPTA 2CBZA 1R0WA 4L4UA 4M9XA 4DSUA 3D3QA 1OSNA 4M1OA 1Z08A 2CL7X 3N70A 2ZJOA 5K8LA 1XF9A 3AKEA 1D5CA 3DM5A 4F7WA 4OKSA 3OFNA 2H17A 3SYLA 5EUMA 4MGZR 4AKEA 5BN5A 4C0JA 1UAAA 1AIPA 1R0XA 2R65A 1GIAA 4ITRC 1ZM9A 5K8UA 4XH9B 4V0ME 4AG5A 1N6HA 1L4UA 2BBTA 4K46A 1E2IA 4HAZA 2BEKA 2OCPA 5TV2A 1OXXK 4YDHB 1NN3A 4CDGA 1F2TB 2QMUA 2FJUA 4YLGA 1A1VA 4OQLA 2XXAA 1P75A 2HT6A 4LZZA 1AN0A 2FWRA 2IBMA 3WP0A 3AM1A 4PPQA 3OE7D 2W2TA 1E79D 3K09C 2QQEA 1TF2A 5JBQA 2V7QD 3WYAA 4M1MA 4KSCA 4F93B 3ZZUA 3VX3A 1G4UR 3CLVA 4KJZA 1G21E 1W4CA 4HYYA 4YC7A 5IRCD 1OFTA 2YOFA 3I62A 3E5HA 1Q3HA 4NP6A 4TMXA 1XEXA 2G0NA 2HCBA 2J3EA 1KSHA 2BMFA 1US8B 1DBSA 2QPTA 1KNQA 3W8RA 1FW6A 2ZI9A 2HUPA 4B2IA 3C7KA 3VKHA 2Y8EA 1D8TA 1YE8A 4PC1A 1OYWA 5E7JA 1UBCA 1CJMA 2D2EA 1OV4A 1G18A 4RJLA 3SS8A 4QXAA 2G83A 1IN6A 1G6OA 3CH4B 3LFUA 2EWVA 1QHHA 3VR3A 2GXAA 2CHQA 2WBLC 1SGWA 1KJZA 1NL3A 2QENA 1XX6A 2REOA 5EE3A 4EQ6B 4LUCA 2XZLA 1RW4A 4DSNA 4P0TA 2O8EB 5AJYA 2Q9CA 3DMDA 1OYYA 3TE6A 5BWMA 4URWR 4ZDJA 1YQTA 3B2EA 1AKEA 4PSAA 1LV7A 4LCBA 1W5TA 3EPHA 1AZTA 2YV5A 3SU8A 3LBNA 1IY0A 4N0DA 1VYVA 6Q21A 2QEQA 4WW0A 1O87A 3LWNA 2IF2A 1E79A 4HB3A 5AJXA 2H57A 2V7QA 8OHMA 4G5OA 4NKRA 3AVUA 1KK1A 4NH0A 1XTRA 4Y0AA 5EE0A 4NYJR 2IYZA 5JHHB 1E96A 1AGRA 2ZRFA 2VLIA 3LLMA 4JVSB 4IDHA 4QM6A 5FUVA 4QM7A 3GJ5A 5JJLA 4B3FX 3LW8A 3P4YA 4PQFA 4A4DA 2IUTA 1VG9B 4URVR 2PZEA 1EX7A 4WOPA 1VG8A 1YRBA 3IIJA 2A5JA 2BKUA 4RFSA 2VTKA 4R7ZA 4GBMA 3W5IA 2GF9A 1P60A 2KBEA 3M4YA 4R2IA 3B13B 4M22A 3CF6R 4V02A 4IDQA 4OI1A 1T9HA 2OV2A 2OILA 2BWJA 2OBMA 3SE0A 2DYKA 4V0KA 3T1VA 2DWOA 1EFTA 4JLJA 3MJRA 4L8GA 3U44B 2BMEA 3HYRA 5KO2A 1W36C 1T0HB 2FV8A 4GFDA 1R5OA 4TZ6A 5CM8B 1Z6TA 3WP1B 3X2SA 4URZR 4D4LA 2DBYA 2XTMA 3CRW1 3NC1C 4P33A 1Q20A 5D3MB 4HDOB 1RJ9A 4LJAA 4WZ6A 1F60A 3FGNA 3Q7QA 1UDXA 1IJEA 2PT7A 2FNAA 3FMOB 4RY2A 5KNDA 1LVGA 1WA5A 3SOPA 1UKZA 1KO5A 4ESVA 1AQYA 1ZIPA 4PZLA 1Z6YA 2YNMA 4NL4H 1WCV1 4PR0A 1T3HA 2ORVA 5L3QB 3B1ZA 2GCOB 2IT1A 3B6EA 1XFAA 3U6KA 5F3WB 1SZPA 1DOAA 1GSIA 3HPQA 5FPSA 1QHIA 1G5PA 1OHHA 4AURA 1WP9A 5FOWA 5KDDA 1RZ3A 3KTAA 2CE7A 4GRAA 4P4SA 5E7IA 5JWOA 1CJTC 2Q3FA 4RD3A 2QTFA 1E1QA 1FNNA 4OI4A 4M9ZA 1W1WA 1XJQA 1G16A 1E0KA 2VA8A 3I4LA 1NY6A 5P21A 3D6TB 2DWQA 1CRPA 3B1XA 4LJ9A 1P5ZB 2C9YA 3AF4A 3LVRE 3HR8A 2EFHB 2PMKA 4C2TA 2QRZA 3L0SA 5EUQB 4ARZB 3AUXA 1E2KA 1X8LA 2CXXA 1BOFA 3H86A 221PA 4LV5B 4O2LA 3CBQA 3WYGA 1KZ7B 2JDID 3B1YA 2OFXA 3EC1A 4A6PA 1LY1A 4PZZA 5EE9A 3HP1A 1Z83A 2CCGA 3FYHA 3A4NA 4WXPA 5CLQA 1B0UA 2W6ID 1TUEA 2DPXA 3B9PA 1U98A 4TQUS 5KPDA 1XTQA 3OAAA 3RS3A 5CYPA 5UKDA 4OJKA 3AVTA 4JLDA 5C4MA 4AKHA 3NXSA 4Q1FA 2TMKA 2ZJBA 4Q9KA 2R6AA 4XJXA 1XD2A 1NRJB 2OO7A 2ZUBA 1XTSA 4IEIA 3KQKA 2ZSEA 4Q4AA 3KQUA 1E2NA 2GJKA 4F4JA 4BFYA 1ZINA 2AK2A 3WBJA 1N6OA 3NKVA 2O0JA 4HATA 1VDZA 2ZVPX 5TVKA 4JLOA 1KK2A 5IDVA 3VMFA 4TYWA 2ZETA 1IY2A 4JLAA 3PXGA 3NDBB 3OEEA 4C0HA 2GAOA 3RVBA 1U90A 4AI6A 2ZRIA 3RDPA 4IFBA 1DS6A 4E03A 1XPUA 5H8WA 3H84A 1N6LA 3TAHA 1Z07A 1IN5A 5EJEA 4KCGA 4B44A 3K0FB 3MWYW 4KAXA 2B92A 4B48A 2IYLD 1WMSA 2JDIA 1Q1QA 2CJWA 2NO9A 1OKKD 2O8DB 2FFBA 4IFEA 1SVSA 2XNDD 1T5IA 3VKWA 4DUGD 4LX0A 1K8RA 1CXZA 3BXZA 5FOTA 1R6BX 3LX5A 4WZAE 2CL6X 5DHFA 1H65A 3R9XA 1NP6A 3TGPA 3ETLA 1TQ6A 4B34A 3R20A 3QF4B 1KDPA 4KSBA 5IK2A 3I3SR 2WKRA 3IEVA 1NF3A 1UADA 1GITA
chains in the Genus database with same CATH superfamily
3FJ1A 2EC5A 2GXQA 4KW7A 4IDPA 4QNRA 3NYQA 1C1YA 1PJQA 1DKLA 2VDOB 3KEGA 3PLAE 1I01A 1DUVG 5JR3A 1BQEA 2E5WA 4ZK2A 4E7OA 2H65A 4AZ0A 4K9QA 2CLKB 2OYCA 1MH1A 1W2HA 2RG1A 3AKYA 2FFJA 3C43A 3F3SA 1VE7A 2VLBA 2XECA 3H75A 3EIFA 3JZIA 4GRDA 4H1HA 3S5JA 4CIWA 4RMHA 4XYEA 3MEQA 1HR0B 3L92A 3VAZA 3ZW8A 1L2TA 3KVVA 1FFEA 1YVDA 1FZQA 2DQSA 3G3EA 3A4TA 1JSXA 4BV8A 4Y3UA 2AOTA 2PRJA 2ZE7A 2BFBB 3A4IA 2HCJB 2BKVA 2YW2A 4X3CA 4DJFC 2O8FB 5EG5A 4NDZA 5KYYA 3V46A 3OQNA 1TJNA 1W44A 3A7DA 1OE0A 3KAKA 5JPCA 3B1WA 4MUYA 3ZU3A 1VMIA 1J99A 2P67A 3L6CA 4H35A 4M21A 1FU7A 3WNCA 4C6TA 3IR6A 1XVVA 2BDEA 2FR8A 3DUFA 2CVZA 2NVOA 3UWDA 3W2EA 5JMTA 5JNRA 4ALIA 5HIMA 4N01A 2Y05A 4YPVA 3OP4A 1FDOA 1JYSA 2AE2A 1KORA 1M1NB 2PA3A 3OZRA 4G1MB 2CV0A 3WB1A 5H82A 2EVWX 5CB8A 4GZMA 4JBHA 1R4MA 5EJGA 1X94A 3NT5A 2JCXA 3N5CA 3DTNA 3DZDA 1NFQA 3IOYA 3EFBA 3RIMA 3OFKA 5DOVA 2P79A 4ASUD 1PEKE 5CDTA 3K4HA 4C14A 2D1RA 3F5DA 3GZJA 4JQOA 2EGUA 1USGA 3H8VA 2W2LD 3OLYA 4K6HA 4MKGA 3U3KA 4L8FA 1P5JA 3FOWA 2B21A 4BWFB 2DM6A 4UMVA 3IR7A 1ZD8A 2Z09A 2GEKA 1IHPA 4D3ZA 1S2DA 4Q7EA 2I4RA 2R62A 1BO6A 4IJMA 4BPRA 4EA8A 3UPDA 4Z4HA 5KTSA 2WPDD 4EHIA 1NW9B 1XL1A 4ZO9A 3OM1A 1GL7A 3HUDA 3QZUA 2I65A 4FT4A 3CXRA 4FMDF 2YHAA 4UATA 1OLUA 3R8CA 3RYCB 3RBAA 3F49S 4MWDA 2WYHA 1C9YA 1PP4A 4IO0A 3OIFA 4CFSA 4MTCA 2GZ2A 2C7OA 3N2LA 3CU5A 3NXKA 3EC7A 3L6BA 1J2YA 3FVRA 3ZZTA 4DV2B 3ED1A 1YQWA 4P4UA 3RRYA 5ALQA 1MEJA 4G23A 1I7QB 2FVYA 4GWKA 3WK9A 3RAFC 4EHFA 1PT5A 1RT9A 1E63A 3OT1A 4BLUA 5C5EA 4KPFC 4TMZA 2HMWA 3JQ7B 4YFVA 4UD6A 3EVBA 2C95A 4ML3A 2KB0A 3NTQA 4OXRA 3ZJTA 4XGRA 4FHCA 5KNDH 2KBFA 2VCHA 1E1CA 1TM2A 2VIIA 3T3DA 2IBTA 4KVGA 1RQ2A 3V8QA 5H3LA 1W5EA 3C6MA 1R8JA 1K7XB 1WCXA 3N0TA 3MS2A 1QAOA 4GLLA 4BXOA 2QL6A 5GM2A 2QRMA 3PX3A 1BYUA 4N5IX 1EFCA 4B3MB 2W2LA 1F2VA 1G7SA 1XEWY 2Y0CA 1U0EA 4NABA 4P7JA 4ZAGA 3RTGA 5GONB 1OFUX 4QYIA 5C1BA 2ONZA 4M1ZA 1RTKA 3BDAA 5EJ6A 2GM5A 1Z4OA 3B1JA 3MLAA 1NVWQ 1HNWB 1ESNA 1SQ0A 1VSTA 1Z28A 1TYAE 4BIIA 1MQ8B 2V6BA 1R6VA 4HRYA 5CDSA 5JFTA 4NYMR 1SXJC 2HZ7A 2ONKA 3PXBA 4KLNA 1SBQA 2IOQA 4DV3B 2H4YA 5KHLB 1T3ZA 2AX3A 5JWRA 2ZSFA 1G3MA 2PS1A 3JQGB 4LF4B 4IH9A 1DLJA 4KIFA 2YW9A 4D8VA 5IKPA 3OJOA 4ZOAA 3LQYA 4L4ZA 3STHA 3L0PA 1Z2EA 1ZCBA 1JR3A 2XYVA 3CQ9A 5FTKA 5A3SA 1TEVA 3R5FA 5JI2E 2X5NA 2YWCA 3LWBA 1ACMA 5CEEA 2VWQA 3Q1KA 3SR3A 1YH3A 1Y5LA 1Z5GA 4EHKA 2B99A 3UAOA 2YR0A 3GLUA 3N76A 5IF3A 5M5BA 4WFQA 2P11A 2O1XA 1J33A 2OV6A 3DAGA 3GJ7A 4MMXB 3DOUA 4GNKA 4CT4B 1PVVA 3BKXA 2VHVA 2XTZA 2G06A 1ZIDA 1KRWA 3EUWA 3FNFA 1G3UA 3OO1A 1RJ9B 1QHSA 4PTYA 2ZULA 3G2IA 4W63A 2IS4A 2LCFA 1ZONA 2WKWA 1C50A 4UULA 5DRYA 2RI0A 2H5EA 2ZVJA 3K35A 4NDAA 1HLFA 1L7BA 1QGDA 3M3PA 3UUEA 2Q62A 3BL6A 4TVOA 1Y48E 3KPWA 3OJFA 4AYXA 2K7ZA 4Y7DA 3AR7A 3DP9A 4FKZA 5FLKA 1RR6A 3R7NA 6GPBA 1P77A 2CVHA 2ZB2A 4DR5B 1AKTA 1B93A 1P72A 1O7JA 1CEEA 1WZIA 2JEYA 4KTTE 5AW9A 3GDGA 3GLQA 1RQ7A 5SZHB 1F0NA 4LRTB 5BSGA 2Q9BA 3LYHA 3VSDA 3TMKA 3AT1A 2AWNA 2IF0A 3DP7A 1QWOA 2BDUA 2C99A 3TPZA 3NHPA 1ZK3A 3FX2A 4DJDC 1FDTA 1FUKA 1QZZA 4KN5A 4S1TA 3HTXA 4DPMA 4D81A 2PBLA 4MROA 1P0CA 3PUWA 5G1OA 3Q8MA 1KO4A 4YBRA 2XGOA 1H6DA 2JI8A 4UU7A 4HH1A 5B7PA 2C9DA 1XK7A 4EO7A 1S02A 3NHMA 3X0DA 4DJTA 3KOWA 1QFXA 4JITA 4DJEC 1KMCA 1PGPA 3K32A 3UCFA 3GLKA 4DYVA 2QL5A 1XXLA 4TLMB 3MRXA 4M53A 1LSOA 2JW5A 1KDOA 1FTYA 1PJTA 3C97A 3GJXC 3MGCA 4HGYA 4ME6A 2G4CA 4GSYA 4BBAA 5K0EA 4LWZA 1GPBA 3VVMA 2BFCA 1WUYA 3IAM6 3UO8B 1IUKA 1NFFA 3SJ7A 5E6SB 3SVZA 2P1DA 2RGGA 3DWFA 3VA7A 4JBIA 3FPAA 4ILKA 3IURA 1J6UA 2H29A 1ZD3A 3FFBA 1LV8A 5B5SA 2AK3A 1CUBA 5JNWA 4FHDA 1XZNA 4XB1A 5LMZA 4EY7A 4E11A 3MA0A 2PX4A 5L3ZA 3JXEA 2OP1A 2OWEA 4A2QA 3HYLA 4DNQA 1T35A 4L57A 2GJ8A 4QL3A 2ALJA 3BIFA 3SZRA 4KTVE 1DJOA 2HLDA 3TZBA 3WTBA 1PX0A 4ZYYA 5FIUA 2F7SA 4R1UA 2VJBA 2OAEA 3SVLA 1QDLB 2EHDA 2QAIA 1RSZA 4EGCB 4J9VA 4HEJA 2NUTA 1GZ4A 4QFBA 3OJLA 5F1OA 3QKSB 4KU4A 2Z04A 1HZJA 2IKSA 3RV3A 1XTBA 3HB4X 3RC7A 2IBSA 2GI4A 4AJ9A 3IKLA 3HCBA 4IMIB 4EA9A 3RADC 1T24A 1NJ6A 2G7ZA 2MSLA 5JCOA 1R10A 4AIRA 3KOMA 1X15A 1XBTA 4OAQA 4TV8B 5KQMA 4ARZA 2PYZA 2QBYA 3B2QA 1HFKA 3OCXA 2YVKA 5C7YA 1ODSA 3WK4A 4WV3A 1W29A 1WE2A 1XTPA 3ENZA 5KQGA 2GM3A 2XRZA 2D00A 4Q1BA 5CD1A 4XR4A 2BR5A 3ZK7A 4Y1RB 1KBOA 2WQ6A 5F7XA 2YZ2A 3PXDA 5HMMA 2PAFA 3IUJA 3T9DA 3ZU5A 2O07A 3H2YA 3LBHA 1CBUA 1RCTE 3ONFA 4RNDB 1COWD 1OW3B 3VISA 1QMGA 5ADWA 5KQLA 3UJDA 1QJ4A 5HOQA 4DLUA 2DU8A 2M32A 3ONEA 4BNJA 3QLUA 2B7BA 4L7VA 1Z6QA 3U7IA 1O4VA 2W2MA 1L5OA 5CNKA 4LRWA 3EGEA 5IWAB 1VL2A 1Y5RA 3PF9A 5AUQA 4IRUB 4B3CA 3AU8A 4H7DA 1RACA 3BFXA 2IEIA 4O6VA 4AY4A 4B75A 2OFOA 4FC7A 4Q7QA 1TNDA 3THRA 2BKEA 3VR5A 2BF7A 3PYMA 4P08A 5FCDA 4RTSA 1CF9A 4KQFA 1U2DA 5ALTA 1T10A 4JL5A 1ICIA 1W581 2GGSA 5KSPA 1LF5A 4RA6B 2QD2A 2E5FA 3NTRA 5EZYF 1ONSA 3BS4A 3GJTA 3TLAA 2C3YA 2WFAA 1I7PA 3GQBB 3CTPA 2VPIA 1UOEA 4J6FA 4HSGA 1K9SA 5D01A 2FMIA 1SVOA 1SK9A 2GN4A 2VK2A 4RQTA 4EMBA 2JK1A 4YO7A 1Z36A 3G88A 2EZUA 2D7JA 4Z0HO 4OA8A 4RKQA 3VPCA 4Z4GA 4XUDA 4CMIB 4GOXA 4LXXA 5LYJB 1N78A 2W6JD 1NDUA 4F9TA 4JIMA 1X70A 1UXGA 5IVKA 3L05A 3N8KA 2O52A 4YNBA 4KR7A 2OZEA 3WHKA 7ADHA 4HG2A 4F6RA 4OP2A 4DL9A 1YQDA 5IXJA 4B09A 4GZLA 1GUAA 1QJCA 3JZFA 2WB2A 1COWA 4KC0A 1WXFA 3DLHA 2G9RA 2QJTA 3AY0A 2JFQA 2XUZA 5FQOA 4BFVA 4X3PA 3T3OA 4O2AF 1KJ8A 3ZVKA 1ICEA 2VNIA 3P0HA 3QE2A 5E4YA 5JIBA 1EE2A 2PWAA 4TTQA 5HFJA 2ZB3A 2Q4OA 2UYGA 3KJIA 4FFLA 3SJZA 3ZPXA 4KLAA 1P7CA 1HQYE 1OI2A 2UXCB 2O7SA 4HWOA 3K72B 1R6DA 2CHUA 2DHCA 1RJEA 3K0KA 3PL1A 5EIHA 3U4HA 3SKVA 3WOHA 1P0FA 3QXSA 4I1IA 1DQRA 2Q1YA 1LDEA 4WDQA 1WCWA 3IT0A 2IW3A 1NI3A 2PNFA 4K6GA 3MPUA 4FLMA 4REMA 2Z9BA 1KI6A 4I4IA 4IIVA 1QIGA 3OM0A 4KHZA 1U3FA 4B4UA 4E13A 3EHDA 3VAYA 1Q1AA 2EYQA 1NBHA 4F96A 3ABOB 3HHEA 3K0HA 2WD7A 5DBIA 3WICA 1X1CA 2F1JA 3BUSA 1Q5PA 5ALKA 1GZVA 3FVQA 7ABPA 3CVVA 3N0VA 4B3DA 1EAMA 1XZEA 1DBIA 2D2IA 3FDFA 4EVQA 4RV4A 2W6JA 3KU1A 2FZ4A 3K70D 1A7KA 1C7JA 1GDHA 3QBDA 1SELA 4XD2A 3CLSC 4L08A 5CLFA 1GTRA 3COSA 2IPXA 1NR7A 1G66A 1NVFA 2VF2A 2EXXA 4N8EA 2OA0A 1UQRA 3V1NA 4ON9A 1TPYA 4ZK6A 2OCYC 1NM5A 2A2ZA 2J3MA 4PZDA 3UXEA 4P9NA 5G3YA 5KWIA 1KXJA 2VDRB 5INTA 3K09A 3OC0A 4H7FA 1QOZA 2NZVG 2Q2VA 2DP4E 3PENA 1LQTA 3EIXA 2AUMA 4IYRA 3U7QA 2WMNB 1BD3A 1P8JA 3A10A 4BNZA 4BNTA 4H1WA 1GAJA 4JT4A 5HA5A 2MOKA 3IC5A 5JMWA 4AIIA 1GQFA 2Y27A 3Q7SA 2JLQA 2P7HA 1BJTA 2I67A 1UOPA 1ZM7A 1M34B 3TVYA 4BNKA 3UC9A 1JFFB 3DVLA 4FGUA 4F6LA 1U7HA 4D8WA 5FH9A 3BGWA 2JLYA 5HE9A 2DBRA 1UCFA 1A8IA 1MXHA 1SO8A 1F8YA 2DHEA 2VF5X 3JAKA 3PXEA 5DBGA 3I5XA 1E8DA 1XQ6A 4V38A 4E1AA 1BGVA 2OHHA 3ZWNA 4CWAA 5B7NA 3RS0A 1MJNA 2Z5VA 1XNGA 3MINB 2VK4A 2YXNA 3DKVA 2C5HA 2YV3A 4NONA 2V0GA 4PO1A 4TMWA 4WA7A 1LPBB 1U3VA 3EF1A 4UEOA 2GAAA 2WJGA 4FW9A 3DE3X 4V1CI 3OCCA 4CZ2A 2HRQA 3QE4A 2VYFA 3EG5A 3OPNA 3X2EA 1NBOA 3NM6B 3NOOA 1J09A 1N77A 1T0UA 5DB4A 4GGPA 1JDUA 1HQKA 2ATVA 3NALA 4OHRA 4QEDA 1J70A 5SZJA 4OV6B 3RRXA 1KI4A 1UKAA 1ZAKA 3HBMA 1P2DA 2DQZA 3I6QA 3W3AH 5MF6A 1X9HA 1D4AA 2H52A 2ZT7A 1S2OA 2PO5A 2Q45A 5L8VA 2C5AA 2R8OA 1YV9A 4XX1A 5B57C 4MYSA 4LHSA 2YFYA 2ZZKA 3QW4B 1UMCA 4X1OA 4DM7A 4HS9A 3ZD6A 2EL9A 4XSHA 5KTRA 1XCBA 2GILA 5TQ0B 4PNEA 3Q2OA 2LCQA 3VZCA 4EAQA 1A5TA 4TXMA 2R4QA 3IP1A 2Q1SA 1XT6A 3JAWA 2CLCX 2ZR0A 4HUQB 4HQKA 1MC8A 4JR2A 5C1PA 2ZRLA 2NSLA 4JYMA 3EEFA 3CNQS 4Q93A 4RS4A 5H70A 3ZN2A 4AZTA 2JJ2A 4Q4CA 4N3NA 5KNDD 2RFLA 2BHLA 3KLBA 3QPDA 4KXWA 2GCEA 1HRDA 4OJNA 1R88A 5AI6A 5K1ZA 2Q6OA 2ZRJA 4YJ3B 2WB4A 1QGZA 3ZGNA 1QQBA 4ZEOA 1JHYA 1YCHA 4V0OA 4BQPA 1OZ0A 4C78A 5LC1A 2YMLA 3RBVA 4UBOA 1PQ4A 3LPLA 1HQDA 4PPFA 4LE2A 4BP1A 4M1SA 4UTNA 5I9IA 1B8PA 2AI2A 4Q9DA 5AT1A 3EVDA 1GTJ1 1OHHD 4JMLA 4AULA 4NEQA 4EEZA 1TTPB 1ZXLA 2BFPA 2DWCA 1KOJA 5IASA 4CMKA 1ECBA 1GGVA 3MJ4A 1DAHA 2XWBF 3K9QO 4L07A 4ZXPA 4X7PA 4AM8A 1RQXA 2E4WA 4MXDA 2I55A 2XGMA 3MTGA 3QVWA 3QBTA 2HDHA 2CYAA 2QUBA 4XRGA 1I7SB 1GQ2A 3AVXA 1ZN7A 3O73A 2G4LA 3RYHB 1HA3A 4Y9RA 5F12A 3RBZA 3GV0A 5FLYA 4R8RA 4YJFB 1Z16A 5KC8A 2CLFB 4DR1B 2Q4TA 2J46A 2Q07A 5A9TA 2QRHA 3HC7A 4R8LA 3RAPR 5A4AA 3DVAB 2PBRA 4LE1A 1CDOA 1RTTA 4IKOA 3E9CA 1P2SA 3H1TA 3D8UA 3PDIB 1EAYA 2ZSUA 2D8MA 3F8WA 2RAPA 4WD3A 4YAWA 1HBJA 3FGPA 5E95A 2XNHA 3T7AA 3P45A 2PKWA 5IXYA 4CN8A 4QELA 3FTQA 3HN7A 3L8CA 4UHCA 4C22A 3VU0A 1QZXA 3KEFA 3ZW7A 3OAAD 3KUKA 4D9CA 3QWFA 2FPUA 4BB5A 3K2BA 4PGFA 3MQ2A 2Z2IA 3CX3A 3U37A 1W5FA 2B9EA 3JSXA 2I7XA 5BRAA 3TLXA 4MRSA 2FEKA 3NBAA 5A6SA 2ZIWB 4X1YB 2QD4A 2V6JA 3E2IA 4HWRA 521PA 1XN1A 4S1OA 2F1RA 3FCCA 2VDKB 1UWCA 3FUCA 4UHBA 3CZQA 3RTEA 2HMVA 3LCUA 4MV8A 3O82A 1AD2A 1QPGA 1ZN8A 5I47A 1XZLA 4B3XA 3C8HA 2ZJ7A 1N2BA 1PJZA 2SICE 4IHJA 4WZZA 5GWXA 4DG5A 1PZNA 4QPCA 1GTL1 4DA0A 2ODNA 2IL1A 3D5EA 3PJGA 3FNBA 4DCSA 1XE3A 3BD6A 3GJ6A 3AL2A 3HJNA 3K20A 3PEVA 5JRDS 2JGRA 3IHLA 3E3AA 3OQVA 4J7CA 5CFOA 2XUPA 2H4XA 4C88A 4LF6B 2H3HA 5J47A 1SR8A 1O5IA 1WD7A 2A9KA 4Q01A 1G8YA 4AZ3B 4C2BA 1PQWA 2C31A 1RBZA 4K7JA 5G4KB 1PK9A 3II6X 1D2HA 1JEEA 1NBME 3HDGA 2G9NA 3RSLA 5CVDA 1OFGA 3CKYA 2VJOA 3ACBA 3O38A 2LGJA 1PDOA 2D5IA 5KNLA 5JECA 1U80A 4HBZA 2W2KA 5LWHA 3CLHA 2GJ9A 1YACA 1SVIA 4QWMA 2CFOA 1JG2A 1VGVA 1G8KA 1IBCA 5JATA 2HK8A 3EYAA 4YFYA 3STUA 1LD3A 3R3XA 5KNBH 3WLMA 1ESCA 4TOIA 4NX2A 3EGCA 3JWPA 3ONNA 3TMYA 1ZVJA 2QTCA 3TOZA 4QZVA 3WKEA 1GQYA 4DCUA 4P2BA 1QF7A 2D0OB 4RSGA 3ZHXA 1ZVVA 2DLCX 1VSQA 2YHIB 3E9QA 1P1HA 3QPUA 2BJVA 1UEIA 1G1AA 2I1QA 5AW1A 1AX9A 1JG3A 3WIUA 2ZE6A 3AM5A 3IJEB 4JHLA 2NP6A 4KQEA 2A57A 3P32A 1EK2A 3U4QA 2GPBA 2WOOA 4K2AA 2HYIC 2NSYA 1XU9A 3DKIA 1Z5PA 3I0MA 3QVVA 4P3NA 3B38A 4DCTA 2CMHA 3V3TA 1J8MF 1GQSA 1X7GA 2P65A 2PMBA 2V8OA 3JQ9C 1GUBA 4KO1S 3KZXA 4IDOA 3M1LA 3P9KA 2IYUA 4YQEA 4BGVA 2Q5QA 4LTMA 5FHRA 3RKUA 4P0QB 2VTVA 4JOQA 2FLKA 2C2KA 2E37A 3N6VA 2GBCA 1II8B 2X41A 2NZWA 2DCMA 1SY7A 2BGJA 3CC8A 1NONA 3K9HA 4DZTA 2C9CA 1W88A 3I2YX 1SQ5A 3QPCA 2XZDA 1KARA 1XFDA 3CUVA 2IP4A 4PW0A 5ALFA 4DZRA 5JSHA 2WFMA 3FWYA 3PFKA 4ZQHA 4EQZA 4JB8A 4FLFA 3EMDA 3HFSA 4XDZA 3ZCRA 2W48A 2VNJA 1RHKA 2PWPA 3PC4A 4G5SA 4GEKA 2CXUA 2W2VA 3CN7A 3NBMA 4U7GA 4CLOA 1MW9X 3T0GA 2B8JA 5T57A 3ASUA 3DO5A 2WABA 3UK1A 1JZSA 3ZKAA 3ZLVA 3DZGA 1GU7A 3ZQKA 2YYAA 1JI0A 3NM4A 2HEGA 3DSRA 3QM1A 4Q47A 3PGJA 1PJ8A 2IOFA 4C0AC 1YAJA 3GDHA 5TS2A 1NVDA 2QZPA 3FYCA 4KXNA 3OZBA 1OVGA 2YFKA 1F38A 2BCEA 4QGGA 1NXVA 3H18A 1SA0B 2KJQA 2B5OA 3LUAA 2Q3MA 4QXMA 2V7XA 5EIOA 4I9GA 5LA6A 4L4RA 4UASA 5LZ7A 3SX4A 1JTEA 3KT8A 3PCRB 4GYKA 2O2CA 3V8VA 4AX4A 1HO3A 1V3UA 1E7MA 3AJ8A 3WIBA 3U9SA 2I7DA 4I46A 1VECA 3ER6A 4Q3NA 3WQSB 1LSSA 1FVFA 2Y1KA 3GRVA 5AVRA 3N2GA 2SHKA 3EXHA 4HS4A 1V47A 4WOJA 1LTKA 2HLPA 2JIRA 4UUOA 1K4KA 3FBWA 4AN1A 1YBVA 1S8AA 4DIDA 5ALHA 3FKJA 3VU9B 3NMUF 4ND4A 4LMAA 2P2NA 2Y1XA 4CF3A 5JDIC 4UHKA 1YRYE 4E94A 3VSBA 3QFSA 5IVHA 1NPTO 2IYXA 2GFIA 5EKUA 2FP4B 2GKGA 4BNYA 3QU4A 4RTLA 1K7FB 5A5EA 4U6NA 3AB3A 4WKPA 3RU3A 2WAMA 2H16A 4ONEA 2R8EA 3ZK8A 1GFZA 4WH0A 2JLRA 4X91A 3M9XA 1NDQA 2IS2A 5DTJA 3ZLJA 1JHQA 1LBSA 1XCPA 1K1EA 5G3ZA 1XZ8A 2R7LA 5HZHA 1T29A 2VQFB 4G0NA 4CCSA 3RHZA 1P1JA 3GUZA 3OCYA 3PUYA 1E2DA 1RVDA 1U9CA 1YS6A 3CH6A 3THXB 3T38A 3K0AA 1PK7A 2XRMA 1ZM2A 4JXJA 4ZI7B 3ZNQA 1PHPA 3ZZ0A 1ZCJA 1OI4A 3A9UA 1U7UA 1S4MA 4CRWB 3P71T 3FMFA 1ISGA 2L18A 1UMBA 1D1SA 3IVRA 2FEMA 3MJFA 1ZH8A 3EZ2A 3SZLA 4DDUA 2QL9A 1Y9AA 1Y4DE 1HWYA 2NUAA 3DKPA 4HAOA 1C8BA 2TRSB 4D3XA 2EEZA 5FI5A 4B76A 4X8HA 3ZHCA 4ZVTA 1JT2A 3HUUA 3CVUA 2E4AA 1XZMA 4NYMQ 5BVGA 1MO2A 4EHJA 4MJXA 3JQ8A 1ZMXA 2LKCA 4J0IA 1T5TA 4HVTA 3IP9A 3PC6A 5IH7A 2ZAYA 5FWXA 2A88A 2AG8A 4DREA 5FBHA 1O6ZA 3HVHA 4OQFA 1Z25A 1O3YA 5DNYB 4NFHA 3NR2A 2XY4A 3DBRB 1P6XA 5F1PA 5B2ZA 4K2HA 3VPSA 1ZH4A 4A73A 1JHZA 1CC1S 4Q4HA 2GJAA 1IM2A 1RHJA 2IHJA 5FWAA 3ZWQA 2H4ZA 5C8YF 3HDVA 3IODA 3OUZA 4H59A 5FFFA 1XNJA 3EZFA 5GOZA 3CVJA 4C3UA 2PUJA 4M1TA 1XZAA 5DGHA 3RGGA 3T9AA 4Z2AA 5IXSA 3R24A 1U0HC 1U8YA 3EOBI 2UZIR 4G26A 2QD1A 3JD0A 3ZU6A 1YQXA 3FNIA 3G1WA 5ADVA 3DLTA 1NKSA 1P9RA 4KZPA 3NPMA 1JJ7A 1Z6AA 1H23A 2CE2X 4QDOA 4MVJH 5FYDA 4PQRA 2A14A 1KERA 1MUUA 1PWYE 3OIGA 1H1TA 5I9BA 4N3GA 4URYR 2HR1A 1WEKA 5J59A 1A98A 2I9KA 3I37X 2B36A 1GYRA 4LNUB 3W9UA 2PCJA 3QMVA 4CR8A 5AQ1A 3I34X 5ECDA 1JW9B 1EFLA 4J0HA 1Z26A 2ILTA 4OFWA 2VT2A 1EIZA 1PZFA 3L0OA 1MJFA 2PJZA 4YHHB 4MH0R 4GM1A 2PQ6A 4Y0NA 1DJPA 1J4AA 4DGQA 2ABWA 1DELA 1EXNA 1VC2A 1RU3A 1F9EA 2VPQA 2R66A 2ZJ1A 3GZTB 1FEZA 3JQEA 2Q41A 3L0IB 3PK0A 4HB2A 2AYYA 4WN9A 4L4YA 1U3DA 5DH9A 2VXYA 3QA3E 4E2YA 4Q7MB 5J1TB 3CLRD 2HZBA 3GFGA 3GGJA 3TUJC 1AGPA 5HCNA 2QRNA 3GLGA 2G63A 3F67A 3FOBA 3G6KA 1Z4KA 4J1SA 4ZC8A 5LJLA 3IMKA 4JASB 2H7VA 3DEJA 3OPYB 1UM9B 1IZ7A 3IAHA 4TSRA 2FX3A 3KQLA 3X1ZA 4QX6A 4KAAA 1WTAA 3GCZA 2DSTA 2VJMA 1UWLA 2Z08A 3LH5A 5BYBA 3UW1A 1ZIXA 2X2EA 2AEJA 1OWPA 3JTEA 4YJ2B 5A1JA 4ROSA 1WDTA 4IIJB 2VT7A 1H4VB 4OMFG 2QUKA 4GD3Q 3GFBA 1NU8A 3HE3A 2QJFA 4EJ0A 5KYWA 1DDIA 1JIJA 4M8IA 4REOA 3ETJA 3ROKA 3F6EX 2QMYA 3UAWA 4DNFA 3JALB 5L9AA 4H3KB 3UJ3X 1Q83A 4H08A 1NW5A 3SXUB 3ZBPA 1K06A 3D7MA 4XWWA 3CH7A 3LL7A 4MV1A 1JDBC 5AM0A 4C0BA 2ZIGA 4OH1A 4A9AA 1MGPA 2QT9A 2XYGA 3TAUA 2BSQA 3SQMA 2VP9A 3WO0A 3KXIA 2B4RO 2BFEB 5EJFA 5AJZA 1IEVA 2EV9A 1UPFA 3TS1A 4J43A 3KR0A 5LP6B 3DCJA 3W90A 1J07A 4NG5A 3ET4A 5L7TA 1Q7TA 1X8XA 2AGVA 4MPDA 2PIAA 4O5OA 3QU7A 2IQIA 1EG2A 3MD0A 3L8FA 2UUBB 3A4MA 3IT1A 5B4UA 3QNUA 4RJIA 5AUOB 3ZJUA 1I94B 4IM7A 3BWXA 3FBTA 4MPJA 4FB4A 3TIVA 2X2FA 1QR2A 4H6VA 2J9XB 1ABFA 3HNOA 3K9NA 4KWCA 4L9RA 1A4UA 3AVQA 2A3NA 2AUTA 3R6WA 1XKXA 2JJ1D 2NZUG 2W5UA 2XE7A 2NADA 4AMBA 3TBHA 4XVCA 4ZVOA 4C0SA 4H6XA 1YGPA 2REBA 3ZI0A 4XIYA 3W3AA 2GYUA 2UXBB 4QGBA 3F5QA 4WHMA 2JK0A 3CF2A 1HSZA 4GU5A 1O6FA 4F3NA 4KR6A 3EBPA 1DRVA 2ISCA 1TU3A 2GF0A 1TFUA 2P75A 1W87A 2J31A 2HGZA 3FPLA 4UJ3A 3RS9A 3WGOA 5EIEA 1KYQA 4TS4A 4KR2A 4CEHB 1F8GA 2NTYC 3NBYC 4BEBA 4A15A 1P9NA 3QMWA 4OMUA 3ZU2A 1BS1A 5BWCA 3PGA1 1G17A 2GJ4A 2VAPA 3COYA 2ZSJA 3MJDA 2F3SA 2ZUCA 4M99A 4PINA 3FH0A 2OC9A 5JHGB 2A3RA 3E9EA 4ZHQF 3C1TA 5LBTA 1OB5A 1E6WA 3DOCA 4M2LA 4A0SA 3GRZA 2ERCA 3OWHA 1H0KA 4UPDA 3B8EA 3UKOA 3SC2B 4F2PA 2HNBA 3OCWA 4DIBA 5JJCA 1XXHE 1PGNA 5LLSA 1CRWG 2RJNA 3OX1A 1MT0A 2HI0A 3UTCA 5K4GA 3KJQA 4U2BA 1T36B 1V8FA 4CHTA 4HLUC 3ZTYA 5FOUA 5SY4A 4UUAA 3DEIA 1P7YA 3M70A 1TCCA 3K5HA 4LGCA 3K8ZA 4RH0A 3UCXA 1Z0JA 4E32A 3ONVA 2GBGA 4J91A 1WLSA 4F21A 1FNSA 2BZ0A 1TM3E 1JLMA 1CR6A 5JH7F 1M2OB 3HBFA 2BI8A 4JIGA 3LUBA 1JQLB 4HDCA 5AK3A 3TOSA 2OM2A 4XVUA 4TVKA 3OLVA 1KGDA 4QPPA 3AJ9A 5B1HA 1U4NA 2AEEA 3W3ZB 4DV4B 3OETA 1IHYA 3L7OA 2VJKA 4D0NA 1DGQA 2GXUA 1DDOA 1TJ5A 2G88A 3FROA 1JQAA 3Q88A 4W7HA 5HR5A 3FNHA 4FIZA 1R1DA 1BH2A 4TN5A 4Y9TA 1LPOA 3CUKA 3U4DA 4P3PA 2LXNA 3W9YA 4BBZA 2EATA 4Q34A 4W9MC 5LL6P 3RVQA 2ZYAA 4F71A 2XW6A 4M9CA 3HVRA 5KNBD 4TKVB 2G1KA 3E1SA 1RRFA 4KBGA 3K0SA 3S8YA 5IAEA 3ZDCA 1KJWA 1VBFA 3FPBA 3Q9UA 5LCXA 4ETWA 3IUQA 5AHXA 2PLRA 1F6WA 1YU9A 3H9CA 2J6BA 5B4VA 5JAOA 1VLMA 4I55F 5SYNA 5E4FA 3GF4A 2OR3A 1ZSVA 2B82A 1MW8X 3QXGA 3V42A 2RONA 1H6BA 2F9LA 1SU4A 5ER6A 1YMUA 4B6QA 3QFCA 1SEVA 1Y7PA 4FI3F 4PM4A 1DOZA 4LXHA 2J1LA 4DMGA 4PZCA 2QTBA 1R0YA 1I9CA 2LDBA 2I7VA 1BQ3A 1GZHB 3FSRA 3MTEA 5COBA 2JIBA 1X1RA 2QQFA 1FUIA 4JI6B 3WLJA 3KWMA 5AW6A 1RRCA 1EQUA 4CM3A 5CB4B 4QUBA 2HV8A 4IQFA 5IPFA 4R68A 3VV3A 4N41A 1JDZA 1QMPA 3B1VA 3WS7A 3GJQA 4O3FA 2EBWA 3Q9SA 5A06A 3GDOA 4B8WA 4LJYA 3F6CA 4Q3CA 1ZBDA 2W98A 5FA5A 2VJCA 4JLVA 5DMHA 4FMPA 3EMKA 1J56A 3WRXC 4P34A 4WINA 4HFRA 2BP7B 2PLAA 4E21A 1FOEB 2ZYWX 3FN4A 1XYYA 4Y8VA 4GBGA 1Z0ZA 5CNMA 1KZYC 2CDAA 3BIWA 1LPNA 3KAPA 2I71A 3RRBA 5KNBA 4F91B 5FF9A 1QTNA 4HI0E 1R8QA 1L5RA 3MWDA 1C0IA 4PHCA 1VKNA 2A78A 3JU3A 3QTBA 3BIJA 2GAIA 3I01A 3G02A 5FAKA 1E2MA 1UAGA 4MHOA 5EHIA 5FR1A 1V37A 1T9AA 3DEHA 3OVMA 3BFPA 3KT0A 1ZD4A 1U9IC 5A3QA 2FG7C 4Z7QB 3PCXA 2H1HA 3TCKA 1WCYA 3BMCB 1QBKC 4PV7A 3U7FB 1ZQ9A 1I6KA 2AX4A 1C2YA 2ZB7A 3D3JA 3M6FA 4WGGA 3EMBA 3RTAA 3WJ7A 2AFIA 3S1AB 2CJXA 1ZHHA 3JYPA 3L82B 2B8TA 2V97A 5CLJA 3LOQA 1EGQA 3VU1A 2WR8A 1QIDA 4TSFA 2VR1A 2FPPA 3T1QA 3QPWA 2F1HA 5C7OO 1I13A 3ZWKA 2AQIA 2GFHA 1FP1D 3OHPA 3ZS9A 2A5FA 4DBVO 1HFJA 2JGAA 1GPAA 2CJYA 2H08A 4IDNA 5LMNB 4JFRA 2A86A 4RA6A 4TL7A 1HLDA 4B17A 2WM9B 1DFIA 5HTOA 4X41A 3H2ZA 5LR6A 2HXGA 1ZRHA 1W5BA 2GD0A 2PBZA 1S2LA 3AB8A 4A82A 3DMFA 3P26A 3PF8A 2KS6A 3HKBB 4TS9A 1NVEA 4Z9XA 3MGKA 4ES6A 1GNRA 2AR9A 3ZV5A 5IU6A 4IZHA 1E6UA 4NJMA 1NNSA 2XRFA 3RFTA 5JNLA 1ZOIA 4YGXB 5GM1A 1WCIA 3GRCA 1PWEA 3KQSA 5CDFA 4R0MA 2GN2A 4IBOA 3THYA 1PNVA 1XWFA 4JJIA 1Q57A 2YWHA 3CLUC 4IWXA 2XDAA 4LZJA 2OC4A 1QH1A 1V96A 5EERA 4ZIRA 4XWAA 5FTLA 3U61B 4OUKX 1QG4A 4F45A 5ANRB 1UDWA 1Z33A 3GEBA 3MOGA 1QOPB 3X1JA 1TZ2A 3EF3A 5DLDA 1WRBA 2HIGA 3ZD9A 4HX5A 1UJMA 3TQFA 1ISIA 4D45A 4L4SA 4MO2A 4AFNA 3FHCB 2I6UA 3FDXA 4PX3A 4TS3A 1CE8A 4QUHA 1EXDA 1TF5A 2V5AA 3PFNA 4CEJA 3O8LA 2CCKA 3LX6A 5SZIA 1ECLA 4PO3X 5CH8A 1KR2A 1W36D 5LM3A 1U8CB 5EYPA 2AZ4A 3RRNA 3WK8A 4MJLA 2I8LA 2J45A 3MAAC 3HM9A 2DUJA 1BA2A 1QK3A 4MWTA 1OBFO 3KAJA 5FTMA 1KI9A 1Z2OX 2VHZA 4IX1A 4II3A 2GPNA 3R3HA 2OK8A 4RKEA 2ZRHA 5FLEX 1Y9DA 1A3CA 3JTMA 5HF8A 3RB8A 4EARA 1QYWA 3S40A 2RAVA 1C3EA 1TZCA 1IHDA 3UB3A 4AYTA 1DRWA 4WXYB 5I7OA 3DBVO 5C7LO 2J0SA 3B1FA 1CQWA 3DGFC 1M3SA 1E2BA 1XEFA 1UBTS 5KZMB 3ND7A 2WE7A 1TAGA 2AXQA 1J5PA 3VR2A 2IIQA 3GH3A 4E4TA 3V8MA 1KH2A 1RS0A 2B0CA 3I64A 4AK9A 4R1NA 4CM4A 3WOVA 1Y6GA 1E3SA 3WLTA 1P5HA 4BWVA 2Y71A 3WDSA 3O8NA 4MJ7A 4H0FA 3J80A 2OCAA 1L1RA 4ZCLA 4RKWA 2GR9A 5DX0A 2OY0A 5H3CA 5K8JB 1GA6A 2AD5A 2OFFA 1L4FA 3HU3A 3AUAA 1SBCA 3OIDA 1DXOA 1OBVA 3HSKA 4JUBA 1IATA 3CG4A 4TTAA 5AK0A 1ZGJA 4RIEA 3OX4A 2XEDA 3M4NA 4UHJA 3TCNA 5LN1A 3KDAA 4G1UC 4PXAA 3B12A 2BY4A 3AKZA 1F0YA 4GOMD 2QXYA 3KRTA 1DKMA 4UREA 4B35A 5EIWA 2CEAA 3KX2A 5KU1A 2A67A 3O9ZA 4X93A 1HPLA 3HL0A 4RZQA 4LEIA 4PEVA 4YT5A 2G9QA 2FPMA 4KGDA 3GW8A 3SC4A 1TZBA 5SY6A 2OCGA 2I78A 3RG8A 2BTEA 1VL8A 4FEAA 4UVEA 2IRWA 4IDBA 4KQ2A 1JHVA 2ZB8A 2DPHA