3KKOA

Crystal structure of m-ras p40d/d41e/l51r in complex with gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
NLPTYKLVVVGDGGVGKSALTIQFFQKIFVDEYDPTIEDSYRKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein M-Ras
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 59
structure length 169
sequence length 169
chains with identical sequence B, P
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkoA00
5EP3A 2HYIC 1X1RA 5TXGA 2IHBA 3ECCA 5B64A 3V00A 3EPHA 4HZUB 1SXJD 2VPPA 1PZNA 1MO4A 3BS4A 1C4OA 1G17A 1AS3A 1XB2A 1GFIA 3KKNA 4D80A 1OV4A 5HZHA 3M4YA 2QNRA 1A7JA 3OIVA 4GZMA 4NBSA 1OXXK 3VR3A 3W5JA 4ZCLA 1NMZA 3EARA 2NOAA 3CH4B 4I1OA 1ZUHA 2JLYA 1KI3A 2ZREA 5SZIA 2GK6A 4KYUA 3HPRA 2ZROA 2PMDA 4TYNA 5JI3E 5AUNB 3K9GA 2XZOA 1AQUA 1W4BA 1IN6A 1Z3IX 3C41J 3PQCA 2AL7A 3QXSA 3QUSA 1VYUA 3UANA 2Q9CA 5UKDA 1D2NA 2JCSA 1FTNA 4NCNA 1VG0B 3QE0A 4B33A 1MRSA 2PJZA 1UKYA 1BIFA 5CM9C 4HAYA 1VCMA 4EUNA 4C7OA 4MUBA 2VRWA 2QM7A 5C4GB 2O8FA 3K9HA 1KY3A 1LS6A 4HLCA 1P3JA 1OSNA 1ZC3A 2F9MA 4F4JA 2V1UA 2QE7A 2DFTA 2ORWA 1Z07A 4PC3A 4QNRA 3ZVNA 4TL8A 3TE6A 2GK7A 1II8A 3PFIA 3W3AA 4TZ0A 2REOA 1KI4A 1N5LA 1U8YA 2GJSA 4F4CA 5J4HA 3UKDA 1HEIA 5HCIA 1CU1A 1SXJA 4JVSB 4HB3A 1QVRA 4OHWA 3TLXA 4AK9A 2REBA 2D2EA 3W5IA 4RFSA 4PANA 4YMVA 1Z22A 1GRRA 2RGXA 1SHZA 1G5RA 2QMUA 2YKGA 1XTQA 1MO6A 3U2QA 1KO1A 1XXHA 4HAWA 2F3TA 1OH5A 1J90A 1E1RD 4EFMA 1PLKA 1KJZA 2FFQA 4LYJA 3FFBA 2G83A 1CULC 4HDCA 4NYJR 3MMPA 1S1MA 1XF9A 4V0OA 3ZZ0A 5J4KA 4E03A 5BXQC 3LLMA 4LV5B 4CEIA 4FMDF 2AD1A 1N5KA 4BFSA 5KNCA 1KSFX 3BRWD 3F8TA 1I4LD 3CB4A 4LSGA 1CRQA 3RS2A 1GL6A 1UDWA 2NG1A 4OI2A 4M21A 2QN6A 1XU4A 3Q72A 2ZANA 1U90A 4Y0VA 3W6OA 3ZDQA 4ZKDA 3A1SA 1G4AE 4HB4A 2F9LA 2FFHA 1WA5A 4M1KA 4XOIA 5AJXA 4FI3C 4OJKA 1R5BA 4DLWA 3CF0A 1U98A 2FG5A 4LJ8A 3TUIC 5IRCD 1N6PA 5SZJA 5A4JA 1QHIA 1ZM2A 3EZ9A 2J7PD 4HB0A 2J5XA 2IYYA 1UADA 1N25A 2QEQA 4PQFA 4C0HA 3NBXX 2GRJA 3ONWA 1E4YA 4A2PA 3AF0A 1E79A 2QTVB 2UKDA 4IDOA 5C46F 1DAGA 1VKJA 3TMKA 1KMHA 4MGZR 1PJRA 3QEOA 3QVVA 5D3MB 3CRW1 3U3OA 1RIFA 4QFMA 1S4QA 1NLZA 3DPUA 5KDOA 1Z8FA 4M0LA 1FP6A 3UPUA 3THXA 5KPJA 4PAQA 4KITB 2AFHE 4MGIR 2ZEJA 2ZRBA 3TAHA 3HJNA 1R10A 3RRZA 3ZD7A 3RS0A 3ZD6A 2RHMA 1Q22A 3K0AA 4II7A 2VP5A 3IQWA 1VG9B 3MD0A 1O87A 1IONA 2QTFA 4MUAA 2V1XA 4Q7JB 1QG2A 3KJIA 4GI7A 1KJWA 1CEEA 1XEXB 1A4RA 4U02A 2X8AA 2IS6A 2IUSA 3DOEA 1XCMA 4B34A 4MRVA 4OI1A 5HPYB 5EJEA 4AYTA 1YU9A 2ODNA 1KI7A 4KVGA 5EP4A 1KI6A 4G5QA 1S9DA 4DDVA 3K1JA 5LB4A 4UXIA 2X19A 4BGDA 4UJ3A 1WB9A 4K81B 2JDID 5JS8A 1OXSC 3AVOA 3EIEA 3QI2A 4BE7B 1DAMA 3GLHE 2IYRA 4MRRA 4HAXA 4F7WA 2A30A 1Z6YA 2N1BA 3PUVA 4BFYA 5K8IA 3WBJA 1DTSA 3EZ7A 4YMTA 2QAJA 1M6NA 1KNQA 4EPRA 1N6IA 1QHHA 5EE3A 4NDZA 2FV8A 4UQOA 2FSGA 2DYKA 1AZSC 1FNMA 3THWB 3VHLB 1WE2A 5JJIA 121PA 4P32A 1TUEA 1XRJA 3OIYA 3BH7A 3AH8A 3QBTA 2NPIA 4KBGA 1NVXQ 2WJJA 4RSGA 5EE1A 3TR5A 4US2R 3GLHB 4WIAA 4DCUA 1W2HA 1CR1A 4LCBA 3CW2A 5L3SB 1JJVA 3K9LA 3LO5A 4Q7LA 1HT2E 2D2FA 2QA5A 4Q7KA 3WHLA 4ABYA 3KQHA 3U4QA 4Q1AA 2NO7A 4LC1A 2AX4A 1DG3A 2V8OA 1BOFA 5DI3A 2HYDA 3PENA 4QHTA 5EXTA 4E5UA 2IF2A 2XOKA 4FMDB 3T5DA 1JBKA 2G77B 3CR8A 4ACBA 5H1YA 3EWAA 2R6AA 1ZUNB 2UVQA 4B75A 4B3XA 1JPJA 4M9SA 3DZDA 1I2DA 5HKKD 4DCSA 1W44A 1UEJA 1MV5A 3NH6A 3OFNA 2FFBA 3O8CA 4R9UC 3QF4A 1Q1ZA 3EZFA 1AKEA 3HYRA 4BASA 3KJHA 3AGPA 3PIRA 3W6PA 2ZXUA 4OI4A 5FBQB 3C4JA 3OEHA 3PITA 4S2EA 4C0BA 2AXNA 3BORA 1N0UA 3E1SA 1W4AA 4G01B 2OFOA 5FFMA 3LQRA 1ZNZA 2F1IA 4ZCIA 1E2QA 2P5SA 3U3KA 3PEUA 1OIWA 1TEXA 2C9CA 2P3SA 4IXNA 2JA1A 3Q5DA 2WICA 3AP1A 3MWYW 4IFEA 4QJ3A 4BZPA 1TQ2A 3SHWA 1GG2A 4MDFA 1XD9A 1QHYA 1Q0UA 4JLPA 4NKRA 1NSTA 2X1VA 2GCOA 3KTAB 4M9XA 3AUXA 1NIPA 4GMDA 5DN6D 2BMDA 1VPLA 3ZH9B 1JR3A 1T8UA 2VTKA 3NBZC 1EFTA 3VR4A 4A0GA 3LXXA 4RD3A 4FCWA 4C0KA 5HKKA 1II0A 2LKDA 4HLDA 3IILA 3OESA 2ZI3A 1CXZA 5CB8A 3KQNA 2GXUA 3U7EB 1GUAA 4TMVA 1IQPA 2CHVA 2ZR7A 5FOXA 2NO9A 1EX6A 2GBLC 2R6FA 4ESHA 4F38A 3RABA 4AYWA 2QORA 3QKUA 1R0XA 2GCPA 1UBFA 2Q3FA 2GJ9A 2MMCA 4I99A 3RC8A 4V0KA 4KJZA 3GP8A 4XWAA 5KHOC 1L2TA 1VG8A 5FOSA 2C98A 1PV4A 1X8KA 1XPUA 2ONKA 1N6LA 3L0SA 3MLEA 3GLGA 1IXSB 2CLDX 1P62B 4QL3A 2WWYA 2EYQA 1W0KD 4A15A 2FN4A 3U6KA 1Z0DA 2ZTSA 5CYPA 1XMJA 2HCJB 3MRSA 3NEJA 1SGWA 2ZE8A 2GF9A 2R2AA 2QENA 2WSSA 4TMTA 4BPBA 1E9RA 4KAXA 1XWIA 4YMUA 5JCZA 2OFWA 3IIJA 4RZ3A 3ASZA 4E09A 2ZJAA 3SHFA 4ZIRA 1LS1A 2JLQA 4DLVA 3I73A 4M9QA 1SXJE 1YR8A 4P4SB 2IK8A 4HATA 5BWMA 1CJMA 4WA7A 1IJEA 1E99A 3WYAA 3QBVA 2O8FB 2DWPA 2YOGA 2WVJA 2YYZA 2BJWA 2FH5B 2HLDD 4L9SA 2ONJA 2QBYA 1F48A 4BLRA 4AKGA 3HPQA 2IXEA 4RY2A 2G1KA 1II8B 1YZKA 2YWHA 1Q20A 2P6UA 4PPQA 3X1XA 3QJYA 3CBQA 4BLOA 2O8EA 2OZEA 2ZSEA 1KDOA 4DLXA 1SXJB 3AQ4A 5J4VA 2E9SA 3SN6A 3OF5A 1E9AA 2AFIE 2QMHA 3F5FA 2H7VA 4FMCF 3ZVRA 4AWXA 3RS4A 5IHPA 3GLIE 1E94E 1NKTA 5KO2A 3GQBA 4NYIR 2DFNA 3WNCA 4HI0E 1XXHB 4DDUA 4DDWA 3A37A 4Q9HA 1DE0A 3KFXA 3L8ZA 4R2IA 3C15C 2CHGA 2QPTA 2ZJZA 3GMTA 4Q1BA 4Q1FA 2BDTA 2ZRKA 3ZZUA 4B74A 1M34E 2VL7A 4P0TA 2A5JA 2VEDA 3ZIAA 4PO1A 3R9WA 5JWOA 1NP6A 2B7CA 4N3NA 4PC7A 3KKOA 1YQTA 3IKJA 1P4SA 3ZVLA 1A1VA 4HUQB 4IRUB 1G8FA 4RKEA 3GLIB 4CEIB 4UNPA 2H1LA 1Z83A 2CK3D 2ZJYA 3BBPA 2ZRMA 1KI1A 2P6NA 4CT5A 3AKYA 5C18A 3K0EA 2IXFA 3PJRA 3W90A 2A9KA 5HE8A 1AA9A 4RD2A 4BLPA 4ASUD 3A1WA 4NPHA 1XTRA 1ZU5A 2TMKA 1XEFA 2ODBA 4UXHA 1LB1B 2EYUA 2G1JA 4FCVA 4HLQB 5FUYA 1F60A 2IUUA 3RNLA 4QGHA 2J7KA 5CDFE 4B76A 3VKHA 3IEVA 2VYFA 4LC0A 1KI2A 2LWIA 4I81A 4KSBA 4FCTA 3D8BA 1H8ED 4K8OA 1ZCAA 4PHFA 4C0JA 2H92A 2DPXA 3FMOB 4IOMA 3T15A 4DIDA 5JHGB 4LV8B 2IS1A 3H84A 3EG5A 4C0QC 2B8WA 1VG1A 1U2RA 2YV5A 3M1IA 2Z6VA 4B73A 3NTUA 1L8QA 2P2LA 3THXB 1C1YA 2GNOA 3TGPA 5FI1B 2FJUA 1KK0A 5GVRA 4KXFB 1KIMA 1H65A 2X77A 2XEXA 2BCJQ 3PG5A 1FFHA 2P65A 4UNRA 2P67A 3LRPA 1M74A 4B2PA 3R7WB 2VP0A 1W48A 2N46A 3B8HA 3JZAA 3PEYA 4HDOB 1IM2A 2ATXA 2OG2A 5BN4A 2R65A 1DAIA 1IN5A 3V9PA 2WJYA 1VHTA 4LHWA 421PA 2GETA 3EZ6A 1UEIA 1ZD1A 4H1VA 3WYFA 4BFUA 4TQAA 2KI5A 1KI6B 4GOXA 2RAPA 1HH4A 1WP9A 4OL0A 4JBXA 1Z6TA 5CB6A 5L3QA 2GZAA 2E1RA 2EU8A 4LPKA 4M1OA 2EQBA 2G9NA 5TMPA 4AKHA 2EFDB 3CX7A 1CJTC 3LV8A 1XMSA 4FW9A 3REFA 3RYTC 4BRUA 3IBYA 3U7FB 4M53A 2VSOA 3GJ0A 4Q1CA 3L0IB 3LVQE 3NBFA 2DHRA 3GFOA 1G21E 4MKGA 3L2OB 5CIWA 5KOYA 1ZM7A 4PAOA 4WXRA 1FUKA 2FU5C 4Z1MD 3UMFA 1CJVC 2XB4A 2RGEA 3IHWA 3K09C 2FZLA 4C2TA 2EFEB 1F6BA 1G7TA 1ZC4A 2ZSBA 3HR8A 2JLUA 5JJKA 3DZ8A 3CIOA 2J3EA 2FF7A 1C9KA 3ZGXA 5E95A 3MGCA 4F4IA 2FGKA 4I4LA 4S35A 3U4QB 1TNDA 5AUPB 4RZUA 3HU2A 3CNLA 4JLNA 5KNBA 1UAAA 4US0R 3CM0A 4BLTA 4MYHA 4DSNA 1QG4A 1GAJA 1R0ZA 2A2ZA 3KB2A 3MWLA 2DWOA 5DI3B 4AURA 2FEMA 3GJXC 2W6ID 5LDDC 4W5WA 1P7CA 2EVWX 1CR4A 2NIPA 1W36C 2B92A 3E2IA 3NHAA 2E87A 4NCHA 3WY9A 1J7KA 2IYQA 5CITA 3GD7A 4TLCA 4DVGA 3K53A 3WMGA 4C2UA 5JWRA 3W3ZB 1UPTA 1XD2A 1GWNA 3C16C 821PA 4CZ2A 5FOVA 2B8TA 1DG1G 5LPNA 5CJPA 1Z06A 1OH6A 4GDFA 2B6HA 4GRAA 5C2JB 1G8PA 2BC9A 2V4ZA 2D74A 1II9A 2VBCA 4DB4A 4G5SA 2AD5A 1Z5ZA 4RVCA 1CF4A 2F7SA 3C14C 1OFHA 2OE2A 3LY5A 3MUFA 2IS4A 2A3RA 2LKCA 2WJVA 3B7GA 3P20A 2NTYC 4MRPA 2KE5A 1JR3E 4BFWA 3FHTA 5KDLA 2OT3B 2PBRA 1N6OA 2QSYA 5L3RA 4W5HA 3SJAA 5A0FA 1KDTA 4RKFA 5FTNA 4A2QA 2PZEA 1FTSA 4ILEA 4XD7D 1G6HA 1J8MF 2O8BB 2DCUA 4QGFA 3DKPA 3FTQA 1XP8A 2EFGA 1IN8A 2IYWA 2GCOB 1NJGA 5FBRB 1KO8A 1SVMA 5JRJA 1SVLA 1FQKA 1LNZA 4GPTA 2V7QA 5JS7A 4P3YA 3RLFA 1MR3F 4URUR 4Q1DA 3FWYA 2ORVA 4XSHA 2QAGC 3U3MA 4QGAA 3W8NA 1O3YA 1KI9A 4DLUA 1UJ2A 4NE2A 2KSQA 2J0UB 4Q4JB 2Q9BA 3C5CA 4RD0A 2HJVA 2OM2A 3IO3A 3X1YA 2WMOB 5B58C 4CIDA 2ZI9A 1NI3A 4PR0A 2XJ4A 1ONBA 4TZ6A 3I92A 1D8TA 2AKYA 2EFHB 2ERXA 3TBKA 3H4MA 2HCBA 4Q4LA 3U5ZB 1A82A 2GCNA 4IDPA 1RKBA 2XSZA 4PZYA 2K5UA 3ZS8A 1COWD 4AG6A 3JZMA 5D3QA 3W34A 1KOFA 1TMKA 2F1HA 2ZRJA 5FBLB 1OE0A 2D4HA 5FUXA 1BYUA 4JVNA 1TAGA 4O2LA 3OIUA 3FOZA 1GOTA 1KZ7B 1AGPA 3VTKA 4JVMA 3L43A 4PZLA 2G0NA 3KXKA 4PPFA 1QHXA 1ZNYA 5FTMA 1IXRC 1OYYA 2IBMA 3F0TA 1Q12A 2J0VA 4AG5A 4HB2A 2BMJA 2FZ4A 5JWHA 5FOUA 4YLGA 4BRWA 5F3WB 4HAZA 2GHIA 4G5RA 2QE7D 2ZAMA 1NN0A 4WZAE 2HXYA 2ZI6A 2W00A 3Q7PA 3RANA 2R8RA 4V0MA 5FI0B 5KSZA 4M1YA 4KSCA 2ZJBA 2YJTD 3SNHA 1MT0A 5DE3A 1R5OA 2JLZA 4DDTA 5M04A 3GLFA 1K5DA 4OK3A 1KNXA 1YE8A 2VHCA 3HYTA 4IJMA 5DSZA 3LAWA 1AKYA 4MYUA 3FKQA 5FUWA 1UFQA 3LWNA 3PVSA 1GTVA 1CIPA 5AUQA 4CVNA 3QG5A 2OBLA 4KLNA 3A1TA 1W4CA 2C03A 1IAQA 1COWA 4LWZA 1M2OB 2GKSA 2O8EB 5L8VA 3LW7A 1AQYA 2BMFA 1XD8A 2PH1A 1JEEA 4K46A 2F1JA 3SBDA 1XDBA 2ZVQX 2IEZA 4OJQA 1Q1EA 3DOFA 3ICEA 3HDTA 1JJ7A 1DVRA 5AJZA 3CNNA 2IWRA 4FXPA 3NEYA 1ESMA 5DI9A 1M7BA 4WW0A 2GDJA 3BJIC 4FN5A 5FPYA 4MGYR 1ZMXA 2JIZA 2YINC 3Q85A 1Q44A 1S1CA 3FHOA 1W49A 5BYJA 1GZSA 3TR0A 2GBLA 1TF5A 4V03A 4X8LA 3B9PA 3AVPA 2ZRPA 3KZ1E 2F43A 3VR6A 5FH9A 3AVUA 2CJWA 4MKFA 4E07A 1HA3A 2ZU6A 3AM1A 1G7RA 2QRNA 3VAAA 4KVAA 3BAFA 1GSIA 2C5LA 1E79D 5EXXA 3UWOA 3LDAA 1ZIPA 3M6AA 4Q19A 4C3ZA 2XZPA 4Y0AA 2DFLA 1P9NA 3K0FA 3MJHA 4NYMR 3AKEA 3T35A 1XZPA 5EZ5A 1YZGA 3FDIA 3TSWA 3R8CA 1NLYA 2QM8A 1XPRA 3A4LA 1N6NA 5K8LA 1JR6A 2AK3A 2BJVA 4QC2A 6Q21A 1KYIA 2HDNB 3LNCA 4Q4AA 1U8AA 8OHMA 1FW6A 4Z8XA 2IYVA 2J46A 2ZRDA 1KSGA 1DO0A 2OESA 2PT5A 1P60A 3K0CC 3ZQJA 3O47A 4OHYA 2BKUA 3WXMA 4O3MA 4PSVA 5DLQC 4Q47A 2DB3A 1SVKA 5K8TA 1E9EA 2C04A 2WKPA 3LVRE 3PEVA 4UNQA 5AK0A 1ANKA 1F2UA 3UG6A 2QRZA 1KAOA 4BQSA 3NH9A 4JIMA 1E32A 2ERYA 1DARA 1W1WA 4OQNA 3RSLA 3U6BA 4NMMA 2YVUA 2BHRA 1WRBA 2PT7A 4A8JC 4M1WA 1ZIOA 2QP9X 3FMIA 2GESA 4EPYA 1U0HC 2DFKB 4GZLA 4B3FX 4US1R 2QU8A 5TDHA 3BH6A 1S2MA 2IUTA 3I5XA 4Q00A 2OO7A 5J5CA 5FPHA 4F91B 1QRAA 3V4FA 4QXAA 3G82C 3TW8B 1KK2A 3U44B 2Z83A 4B3BA 1NVUQ 2JAQA 2ECKA 2BWJA 1EFRA 1TQ6A 1GNQA 1W4RA 3NDPA 1R2QA 4DLSA 4NH0A 3UATA 5L3QB 4DLTA 2BEKA 3PCRB 3MWJA 4ARZB 5EP1A 2MSEB 4YDHB 1BS1A 2B7BA 3AUYA 4M8NE 4WAUA 3LFUA 1MO5A 1X8JA 2OFXA 3K70C 1Z6AA 5CM8B 3H86A 4B2IA 1EFCA 1XTSA 2J1LA 1KO5A 3GEHA 2FNAA 1Q3TA 4TQUS 2ZRIA 1FNNA 4HZIA 1DAFA 2FPKA 2L0XA 4FIDA 4CGZA 2Q6TA 1XBTA 2ZUDA 4PXAA 4DZZA 4G3XA 1F2TB 1N6HA 2XXAA 3OHMA 1HY3A 2XOKD 3SZRA 5HZKA 3KXIA 3JVUA 2V6IA 3B13B 1R0YA 4EPVA 4Q21A 3IGFA 2C96A 2C8VA 2VIIA 2NZJA 4OQFA 4QHYA 3OFND 1T9HA 3B1XA 3FPAA 3SJCA 2WZQA 5SZKB 4PPGA 3RS7A 3ZVMA 3I62A 1PVOA 2MSDB 1KSHA 4M4SA 4LRWA 3OEHD 2R6CA 3NIBA 5JCPA 5G53C 5HR5A 1WBBA 2J87A 2O5VA 3AB3A 1T4GA 2C9OA 2BV3A 3OEED 1IN4A 1ZM3A 4RCYA 3EPLA 1WDTA 4BWYA 2ODEA 2PEYA 3TKLA 2ZYVX 4IW3B 4DJTA 2AR7A 1M8PA 1S0UA 4X8MA 3SR0A 1ZJ6A 4DLZA 1I4TD 1WBDA 4XSGA 3WHKA 5GVSA 2W2TA 2CVFA 3LX5A 2IWHA 4BFXA 2XNSA 2YHSA 1E4VA 4JMPA 3RS5A 2NGRA 1ETUA 2FMXA 1X3SA 2ZETA 4KYIB 4LBYA 3RHFA 4XWOA 2DBYA 1GP2A 3D7MA 4Q18A 1G41A 1QDEA 4DCTA 3IIKA 1JR3D 2WJIA 4X8HA 4DC9A 1G3QA 3VHXA 5JEEA 1F3OA 1LY1A 2IC5A 3A4MA 4TLAA 1VIYA 4PZZA 3OE7A 4L15A 4Q4HA 1YZNA 4JL8A 4NCIA 2YWEA 1FMJA 4IDNA 3SJZA 3SFZA 1E9FA 1SZPA 4JLJA 2JLSA 5GJCA 3OEEA 2IT1A 3BH0A 2QP4A 2EFCB 3WRYC 1E2PA 2ANBA 4L4UA 4EIWA 2WWFA 1N0WA 1WMSA 3QSYA 2GAAA 2ORIA 1ZD9A 5CLLA 4URYR 2NO1A 2QT0A 2WBLC 3PUXA 2RB4A 2ZRCA 3K09A 1YR7A 1W0JD 2HJGA 2WIAA 2GEVA 3GJ8A 3MWKA 1TU3A 3KUDA 5TARA 3EA5A 3KDSE 3CKLA 2QMOA 1UBGA 4JJZA 1DAKA 4QBHA 1E3MA 4WZBE 3AEZA 1KDRA 4PSKA 2FWRA 4R71A 2CL0X 4UNNA 4KBFA 3EPJA 5B30A 5C4MA 4L5BA 1NVVQ 3BFXA 1QBKC 2PX0A 2WSSD 4IKEA 4M9ZA 1XTIA 1E9BA 2QMEA 3KQUA 4DT1B 1OYWA 2QSZA 4H1UA 4A4DA 1GRNA 4NYJQ 4UJ5A 1KGDA 2PZFA 4V02A 3RAPR 4TWZA 1FX0A 3GLFE 1ZUIA 2IHYA 4BLQA 1VCNA 4QM6A 4AI6A 1UF9A 3THYB 1GKYA 1X1SA 4TL6A 4TSFD 2ZAOA 2GJKA 4D0GA 2PCLA 4GOKA 1E2GA 1T0JB 1AS2A 2IYZA 3D31A 3AVVA 1J99A 1ZYUA 4C0AC 1VYTA 4MGKR 2A5DA 1ZCBA 4KU4A 4B3CA 2QGNA 3TH5A 2VQSA 3GLFB 1E9DA 4G0NA 4CT4B 1W0JA 2I3BA 1RRCA 3AKCA 4CEJA 4GSYA 3Q8XB 1HQCA 1Z2AA 4JKYA 1S96A 3G0HA 1XZQA 4IOKA 3NXSA 5FPTA 1HE8B 4D0LB 4W7SA 4AKEA 3ZIAD 2VP9A 5E7JA 5CK5A 3GCGA 1E2MA 2HT1A 2WWIA 5FTLA 3KFVA 1T0HB 1OB5A 4EJSC 2GXSA 1MRNA 4XIGS 4JYBA 5JZVA 2HEIA 5ANRB 4JLAA 4GOJA 1YZQA 1ZD8A 4LJ6A 5JI2E 1R0WA 4C7OB 1NG1A 3GJ3A 1KZGB 2QAGA 4R98A 5EXSA 5K8UA 2WIBA 2C77A 4D6PA 4PO9A 2WWGA 4KO8A 4TSFA 3N70A 5KYKA 2ZRGA 1TL7C 2XTNA 3BIFA 1RW4A 1XXHE 2ZJOA 4Z51A 1AZTA 2VHJA 4BFTA 4JZKA 4TYYA 3D3QA 3I1FA 2O0JA 4Q5IA 3NDBB 2CLCX 2ZJ8A 4PC6A 4R7ZA 1E2LA 3LW8A 1P5ZB 4BLSA 1K8RA 5JHHB 1OH8A 3GJ7A 4RD6A 3J81k 4OK5A 3QKSA 1Z0KA 5DIFA 2YOHA 2F43B 1PUIA 2RGBA 4OQXA 4Q9LA 4ZI2A 3RVBA 4RFSB 2CJWB 3VU9B 1RVDA 2RGAA 4ZCMA 4PHHA 1G4UR 2NQ2C 1FOEB 3EC1A 3T12A 3ZS9A 4EFNA 2QQEA 1E0KA 1ZW6A 4H9GA 2J41A 5CJ2A 2IYXA 4DWJA 4J0QA 1NJFA 4DSOA 4ON9A 1DPFA 3K0FB 3R20A 4LV6A 1ZP6A 3GJ4A 2DY1A 4G5OA 2GF0A 4BFZA 4DHEA 4XH9B 4PTLA 2ZUCA 3WRXC 1H8HA 3BFKA 1VMAA 3SYKA 1G19A 1TUIA 2PCJA 2W6JD 2BMEA 3CR7A 4G5GA 1GNPA 4Q4AB 4HUTA 4LJYA 1JXOA 2F3RA 3B82A 1XMVA 3D6TB 1D2EA 1US8A 4D4KA 1MH1A 2FPMA 3MG9A 4DEYA 3TJZA 2RH5A 4C0LA 5CYOA 1VCIA 2BOVA 1KO4A 4JSTA 3O8DA 2FDCA 5GJVC 2X2EA 2BBOA 2ZRAA 1MOZA 1UBEA 4ACAA 2D7CA 1R5NA 1G16A 3NKVA 2NPFA 2FEOA 4TTRA 1BKDR 1CTQA 1JPNA 1S3SA 2QI9C 2RMKA 2PLRA 2X2FA 4LHZA 5LD2C 5TV2A 2CCKA 3ETLA 1E98A 3B1YA 1OHHD 3LA6A 4QBGB 3SI7A 4RD4A 2GILA 3OAAA 4LJ5A 4JSYA 3RRMA 1P2UA 5KSYA 1Z08A 1ZNWA 4JLDA 2J0QA 1W5SA 3X2SA 3KJEA 5BN3A 1JXMA 1ODFA 1KMHB 2Q21A 5CLQA 1S3GA 3A6PC 1KAGA 4CW7A 1OW3B 3T34A 4JLKA 3IQXA 3UIEA 2JJ8A 2QPOA 4XVRA 1P61B 2GEUA 3AF2A 5SZHB 3RDPA 1EG7A 3P32A 1HV8A 2VLIA 4QJ4A 4M1TA 5KNDA 1FQJA 2W6JA 3DDCA 3Q3JB 4V0LA 3K0AB 2AK2A 5AJYA 4L16A 4XVQA 4OK6A 3B9QA 4JLOA 4AC9A 4BUJA 2G0TA 3SDZA 5KDDA 3VR2A 2ZRHA 4DUGD 2REXB 3VNVA 2YWGA 4AY2A 2PJRA 3NHBA 2BM0A 2I1QA 2YC2C 4LI0A 1ZVQA 2FSFA 2DR3A 4YC7A 4XJXA 2ZRNA 4F93B 2XAUA 2FFAA 4IVQA 2VSXA 1U9IC 2XXAB 5F9HA 4TMWA 4A0HA 5EE5B 3U7HB 3PV0A 2V3CC 1OFTA 4QG7A 1OHHA 1WXQA 4XVUA 3U3RA 2P6RA 5BN5A 2GTPA 1VCOA 3UXMA 721PA 5IT5A 4JLBA 1J70A 1A2KC 2OLJA 4ESVA 2QQ0A 3QOFA 4YXWA 3DVLA 4ZDIA 1Q1BA 5EUQB 2HF9A 1CKEA 1MKYA 3IDQA 1E1QA 1G5PA 4I1UA 5G40A 1QHHB 1TADA 4D26A 1KDPA 1BO6A 2F55A 1K5GA 2LCFA 4HAVA 4LZZA 2VA8A 3EA0A 5KTYA 3K0CA 3K70D 1PUJA 4Q9KA 1V5WA 2ZSAA 4FMCB 3SFVA 3BB1A 5DNYB 3DMDA 5DHAA 1E0JA 2ZYWX 1KKMA 4EQ6A 3GJ5A 5DYIA 2H17A 1EGAA 2YZ2A 1E2JA 3ICQB 2WWXA 2FPLA 2W2XA 1XEWY 4DUGA 4MDEA 1T6NA 2OSBA 1N6KA 2H8KA 4LOAA 4QGGA 5IDVA 3CPHA 1XEXA 2Z4SA 2OUKA 4A8JA 4A92A 5JECA 3VKGA 3W8RA 5FPSA 1G3MA 3EPKA 1NL3A 3BFVA 2V7QD 4OQLA 3REGA 4OHVA 4MQBA 4WVFA 3SEAA 4LJ9A 4NCKA 4A1FA 5JEDA 4L8GA 4N1AA 2JJ1A 3O8BA 3ZYCA 4DEXA 2PL3A 3VU9A 3BB4A 4TMXA 3MFYA 5G41A 3QF4B 1U8ZA 3VNUA 3VX3A 3TUZC 4WOPA 2BCGY 2FOLA 4BZXA 1HUQA 2VHQA 4OQMA 3CH5A 1G8YA 4W5JA 2JGNA 1IOZA 1Y3AA 2SHKA 2ZI4A 3EW9A 3QENA 4OI0A 4NL4H 2YNMA 1WF3A 2CBZA 3L0PA 2XSZD 1WQ1R 1TU4A 1TX4B 3UK6A 4ZKEA 2ZJ5A 3SYNA 1GKUB 2V55B 1DELA 3TK1A 4P31A 1TF7A 2XZLA 3UG7A 1G3IA 2WHXA 3PXGA 4DB2A 3U61B 4JS0A 1G8GA 1HE1C 5EP2A 2ZR0A 3L82B 3QPWA 1GM5A 4TT3A 1IBRA 2BM1A 1NBMA 2WTUA 3A4NA 4B3DA 1RRPA 3FYHA 4UXJA 2O8DB 4A6XA 1N6RA 4KCGA 1JI0A 3B1ZA 3SYLA 3QKRA 4TTQA 4JT4A 1NY6A 2WPDA 4PC2A 2QP3A 1FX0B 4MRNA 3I5YA 2Q3MA 1Z0AA 1W36B 4Q7MB 4FWIB 3N2IA 4ERNA 1YKSA 3GLGE 2CNWA 1OIXA 4FINA 1P72A 4A9AA 2GVDC 1EX7A 1HQYE 2VSFA 1U99A 1KKLA 4JYCA 2CE7A 1G1MA 3L0OA 2KBEA 2OLKA 4RD1A 5EZ6B 1DS6A 1VIAA 5EUMA 4P4TA 2O8CA 1QZXA 1OKKA 3BWDD 2H16A 2ZVPX 3E5HA 2IYLD 3RS3A 2D06A 1N3BA 1OLOA 5IK2A 3GLGB 2WOJA 4IEIA 4F92B 3CF2A 3I3SR 2CDNA 3FMPB 4DIEA 4GP7A 3QIAA 1G7SA 2OCPA 1NMYA 1W5TA 3N2EA 4M1SA 4LYFA 5BW8A 2JIZD 5TVKA 3SC3A 4IOJA 1NKSA 3ZQ6A 4QBIA 5LBIA 5FBVB 3LQQA 4IOLA 2CL6X 4PQRA 2IF0A 3C8UA 4EPXA 2Q9AA 4ZIRB 2BKEA 2BEJA 1KK1A 1TPZA 1LF0A 3QEJA 1CS4C 3TQCA 3GEIA 4QRHA 1E69A 1E2FA 2PLFA 3BD9A 3CUEF 1BH2A 1QHSA 3B1VA 4U00A 2QAGB 3PUYA 2CVHA 2OBNA 2J45A 5LB2A 3UMSA 1OH7A 2CCGA 3IO5A 4XTRA 4DBLC 2QBYB 2AHOA 3FMFA 1G64A 1DAEA 2QT1A 5JJLA 3QXJA 3QQ5A 1NY5A 4NCJA 3U60B 2IA5A 3TSOA 3R9XA 1Q3HA 2GWHA 1U0JA 1W47A 3QKSB 2CHQA 2ZJ2A 2P5TB 2BBSA 3I32A 3I72A 1KTVA 3IBGA 3L8YA 1BMFA 3WP1B 5AJWA 2D62A 5FPKA 1P2SA 5JFGA 2XX3A 3CRVA 2C95A 2GXAA 1E0AA 2YC4C 4DSUA 4PHTA 2QROA 3P27A 3T1QA 1X86B 4ZI3A 1N0VC 4TYQA 3O8RA 5DISB 1X8LA 2N42A 5KU1A 3QPVA 3VKWA 4CEHA 4B43A 1LF5A 3FKSA 4D4MA 1W46A 2VHUA 5FOWA 1E9CA 4DCVA 4DXAA 3AVWA 3U7GA 2GZHA 4P4SA 2ZS8A 1US8B 3Q5EA 1RRFA 3CX8A 1DAHA 3VR5A 4TMKA 3AGQA 1VYVA 2CE2X 2WSMA 3DM9B 4GP6A 4ZDWA 3LD9A 2CEAA 2WOOA 4OYHA 5HTKA 4ZO4A 5FL7A 5C1BA 1XX6A 1K6MA 3WNBA 3ADBA 1SVOA 4A6PA 4JL6A 3B85A 2XJ9A 1EFRD 2AN9A 1Q21A 4RZ2A 1AM4D 4MYTA 1I4DD 4KFTA 3U3JA 1NN3A 3X1ZA 4TYPA 2C99A 1YHNA 1I2MA 4NZYA 3AF1A 1DOAA 4Q02A 3G5UA 5KPDA 4DLRA 1E2EA 1GL7A 2XGJA 1NVVR 1CP2A 4R2HA 5FOTA 4EJSA 2W0MA 1JQJC 2XNDD 4QKQA 1Z0JA 4YONB 4Q01A 3F3YA 3OZXA 2WKRA 3RC3A 4A0RA 2UZIR 4TMZA 1L4UA 4HUQA 2J9RA 2ATVA 3GLIA 1G8HA 1TEVA 4O2RA 1ZU4A 2VHTA 1FZQA 1PLLA 2PX3A 3WNDA 4XWKA 4JLMA 4Q9JA 5GJWC 3FVQA 4B3GA 1LFDB 5DGXA 1F5NA 3M0EA 4FMBB 3ND8A 3A58B 1B23P 4D4JA 2Q0HA 4JKIA 1Q1QA 4LHVA 4OBEA 3BXZA 3VMFA 2FGJA 2G88A 3BOSA 3CRMA 3S1AA 1LTQA 1QHNA 2ZS7A 3EWSA 1FPMA 3ZJYA 3DEFA 1XMIA 2D3WA 1N5IA 3CZQA 1AK2A 3TAUA 2ZSDA 2OCAA 4TN1A 3W9YA 4DKXA 3FE2A 3ADKA 3B60A 3BC1A 4JBYA 1R6BX 4V0NA 4EFLA 4QOSA 3UMRA 4NP6A 4PQYA 5FR1A 5BQ5A 1E1RA 1XPOA 5IF9A 3ADDA 1E2NA 1UKEA 1E96A 2V54A 3I4LA 1GL9B 1W2GA 2QZ4A 2XNDA 5H68A 3SE0A 1ZNXA 3TIFA 2OEPA 1NSFA 3Q9LA 3MCAA 4FWTA 5CDFA 4BZQA 1JAIA 2J59A 5GADl 2VP6A 4Q03A 1CJUC 5FBWB 3T5GA 4A2WA 2QTHA 4EQ6B 1BYIA 1YR9A 4HYYA 5FUVA 2C78A 3TQFA 3AP3A 3R7WA 1GRQA 4RCZA 5H70A 4L9WA 2VF8A 3WBKA 5F2EA 3CX6A 3KUCA 2JASA 4KI0A 4Z54A 2ZIAA 2OCYC 2QY9A 3OE7D 4LPSA 2QPAA 4A8JB 3N5CA 2R6GA 3B5JA 4GT1A 3CLVA 3EC2A 3I61A 5JSZA 3NWJA 4LHXA 2WV9A 1YVDA 2J7PA 1ESNA 2CXXA 3C5HA 2A78A 4D2IA 2ZSFA 2RGNC 4TL9A 4TTPA 3BE4A 5EE0A 3T61A 2AWNA 1UDXA 3K8YA 521PA 3IIMA 2WAYA 1Z2CA 1XD2B 3CPEA 1VECA 1WCV1 5B2ZA 4FD2A 2A5YB 2H5EA 2IEYA 1EXMA 2MSCB 3AVTA 3BB3A 1UM8A 2F1RA 4U7DA 3RWMB 3K70B 2DWQA 2RCNA 2WJHA 1CLUA 1GITA 1NBME 2ZU0C 5L3VA 1KSJA 4Q9IA 4YMSA 3K9NA 3CRQA 4DSTA 4LGMA 1RE0A 1Z47A 3LLUA 3SBEA 3DO6A 4D25A 4IXMA 1HURA 1U9IA 3QVUA 2BIFA 4LYAA 3GJ6A 2ZITA 3AF3A 2JLRA 4HLUC 4QJ5A 2HF8A 4ZV4A 1X6VA 4JT2A 1W36D 1P75A 4GL2A 4ZDJA 2JLVA 3HR7A 3KJGA 3NC0C 3ND9A 1R8QA 1T3LA 2Z43A 4URXR 1YZUA 5TB5A 2W58A 1XCGB 4QM7A 2JATA 5FTJA 2R62A 1IJFA 3CO5A 2JDIA 1L7VC 1V43A 1D6JA 5KSPA 3QKRB 4ITRC 1IXZA 1CR2A 1RPZA 4I1VA 4YDSA 1M1YE 4WBSA 2FA9A 4HDQB 1TQDA 3PUWA 3TVDA 5HCNA 2ZM5A 4GMXA 2NZ8A 3QXCA 4P4UA 4BECA 2W2VA 4LBVA 1N5JA 1S8FA 1Z6XA 4DRZA 3KKPA 2ZYUX 1KHTA 2WWHA 3A8TA 1RRGA 4KFUA 1KI8A 2VO1A 4BEJA 3WYGA 4X8OA 5EXPA 5GJBA 2C9YA 1W7AA 2O8CB 221PA 3NVAA 4MRSA 4NYMQ 1ZBDA 3P1JA 621PA 2PEZA 4V0ME 1G3UA 2CCJA 1IN7A 1GIAA 4GBMA 3AP2A 2VH5R 3A1VA 3CZPA 4LJ7A 3KQLA 2OBMA 2A5FA 1T5LA 4PX9A 1LVGA 2VP4A 2O8BA 2EW1A 3SQWA 3ASYA 4OHXA 4PO8A 1OXVA 2Z5FA 1P2TA 4URVR 2P0EA 1CR0A 3CF6R 1UKZA 2R6DA 4IDQA 1KMQA 4YQFA 4AD8A 5J47A 5F98A 1OXTA 5P21A 3A1UA 1OIVA 3VX4A 3QG1A 5E7IA 2WM9B 1NN1A 2YWFA 2PZGA 1DADA 2A5GA 3SOPA 5BYKA 3QPUA 4TLEA 2FX3A 4KODA 2J0UA 4Q4JA 1RJ9A 4IFBA 2FE4A 3DMNA 3KKQA 4I1SA 4MH0R 4D81A 1SXJC 3A36A 1E2KA 4JVLA 3KXLA 5B57C 4EKDA 1IY0A 5EQTA 1HYQA 5H8WA 3VR1A 4XTCS 3EZ2A 4MYCA 3SU8A 3GPLA 4TYWA 3HWSA 4HAUA 3CONA 3LX8A 4WXPA 1VDZA 1M7HA 1MABA 1H8HD 1ZM9A 2WMNB 4PAMA 4RZXA 5E7MA 3QF7A 3KKMA 3P4XA 3T1TA 3DKVA 4PC1A 4M22A 4O0MA 2KWIA 4EPTA 4IEEA 4PHGA 1XEWX 2FSHA 3CPJB 4URWR 5JMTA 4UKDA 2Q3HA 1T3SA 2QGZA 2OCBA 4OKSA 3HU1A 5DN6A 5G3ZA 5CK4A 4P33A 2XB2A 2V9PA 2WJGA 4DLYA 1GILA 4MITA 1JAHA 2G3YA 4CEHB 3THOA 1ZAKA 2NMVA 3SQXA 1YRAA 4D4LA 2ZUBA 3IPXA 4HZUA 1UBCA 1D9ZA 4G1UC 1JNYA 3T1VA 2PMKA 2RGDA 3OAAD 1E9SA 2QL6A 1KO7A 1ZM4A 4C0SA 2GJAA 5HE9A 3CWQA 2IYTA 1NF3A 1B0UA 2QUZA 1XFAA 3TSZA 3LBHA 1YRBA 1NN5A 3HU3A 1OB2A 2IYSA 2VP2A 3BERA 5AUOB 3QNUA 1OXUA 2I1VB 1E2IA 4LHYA 5A5GA 1DBSA 1CRPA 2ZS9A 1G7CA 1LV7A 1G6OA 1P2VA 1FP7A 5FTKA 4URZR 1CBUA 1SULA 2F6RA 3MJRA 1Z63A 1W0KA 4TQ9A 2ZE6A 1P9RA 4MKHA 2GEDA 3IPYA 4EJSB 5JRZA 1R8SA 2HV8A 1SKQA 2WKQA 3TNFA 1M7GA 3EX7C 1E6CA 3EASA 1F2UB 1SVWA 2CL7X 3RWOA 4IHQA 2WAXA 1EFHA 3X1DA 4M1MA 2NO6A 1T91A 1AIPA 3BGWA 4U5XA 1DEKA 3RRNA 2ZR9A 2UZ3A 5J40A 2IW3A 4TL7A 5AWFC 4EDHA 2Z4RA 2AKAB 3RRYA 3PEWA 5EE9A 4WZ6A 1D2MA 2HLDA 4IDHA 3TUJC 1ZRHA 3ZZTA 3NG1A 4YXWD 4M2LA 1OFUX 4PPNA 3TRFA 4LK2A 1XTKA 3EAQA 1E1QD 3LBNA 1UKVY 2WWWA 3HP1A 4LJ4A 1FMLA 3S1AB 4B32A 3K0SA 1IY2A 4NONA 4AKIA 4LBWA 4JLVA 2B21A 3Q7QA 4PSAA 1NLFA 1G18A 2J0SA 1P6XA 5TY0A 3H1TA 4UNSA 1OPXA 3GFPA 4Q1EA 3VQTA 1KK3A 2IYUA 3ZLJA 1EWRA 2O52A 2ODWA 2ZQ5A 1JALA 3LXRA 5F9FA 4POAA 1DO2A 4CF7A 4RJLA 3LBIA 2G6BA 4LUCA 4QHSA 1FUUA 1Y63A 4JL5A 3AVXA 2GJ8A 4JJKA 1GVNB 1SKYE 3EIHA 4KV9A 2KJQA 2XTZA 4PFSA 2IX3A 1HTWA 1T5IA 4OHZA 4HSEA 4O25A 4B47A 2W0SA 2OXRA 2XTMA 2CK3A 3DL0A 4BEBA 2O0HA 1NG9A 2GAOA 3KL4A 3SS8A 3EXAA 2JJ1D 2OAQ1 2OXCA 2OV2A 3BK7A 2V6JA 5LD2B 3DHWC 4LJAA 4ASUA 3P4YA 3LH5A 1SKYB 3B2EA 2ZYTX 3FGNA 3QY0A 2BBWA 2I4IA 2KBFA 4JBWA 5D3MA 3WMFA 2JJ2D 3U44A 3FFAA 3FB4A 4B48A 1KY2A 5JSZB 3MAAC 4QBFA 1NVWQ 4Q66C 4E22A 1RYFA 4CYMA 2GA8A 4DCNA 2R9VA 3AF4A 4NHOA 1H8EA 4ARZA 4A36A 1RYHA 3QXHA 2YOFA 1G20E 3R8FA 1J2JA 2ANCA 1S9HA 2RKOA 2RGGA 2Z0MA 3OIWA 4TLDA 3E70C 1QHGA 3B78A 2A7QA 1T8TA 3CNOA 5J4YA 3PR1A 3WMEA 2O0KA 2AXPA 1U81A 5E4FA 2HT6A 2HXSA 5JLJA 1L4YA 3GEEA 4B2LA 3DM5A 1GKIA 1XJ0A 1P9WA 3X1WA 2GXQA 4TLBA 2XITA 1Z0IA 2CMKA 4TT3D 3GFTA 3UWKA 4C4PA 1E2DA 1AN0A 1F2TA 1NBMD 3AKDA 2JEOA 1Q57A 5FL3A 4QNMA 4RFVA 2CLSA 1D9XA 2H18A 3AVQA 3KB1A 3JVVA 4C9BA 2H57A 2WPDD 3FHCB 3NC1C 2ZE7A 1OJLA 4LYHA 3CWZA 1NIJA 1Z28A 4KHZA 4Q4HB 1RFLA 1GNRA 5JBQA 5J4LA 1G291 1U0LA 4W9MC 1ELOA 2JJ2A 5KUTA 4D0NA 1Z6GA 1JECA 5DH9A 1OT3A 1A5TA 2CNWD 2HUPA 1E0SA 2ZI7A 4D82A 4IVRA 4YMWA 1QVAA 4B6FA 4GFDA 3THWA 3AV0B 2ZE5A 3I8SA 4KFSA 4LX0A 1IHUA 4EPWA 2O8DA 4LY6A 2AWOA 3GLHA 4IVPA 4A82A 4B35A 1OKKD 2GVZC 1XJCA 4N0EA 2R44A 5DHFA 5L3SA 5FR2A 2IXGA 2BVNA 2BBTA 2EWWA 3I8XA 1CJKC 1SVSA 4KLZA 2D7DA 1NRJB 5DYGA 3AVYA 1U94A 3WP0A 1OFIA 3KQKA 1GDDA 5IK2D 1ZINA 3B6EA 4HEJA 3VFDA 2RGCA 5AR1A 1P73A 4Z1MA 3QXXA 2GZDA 2ZRFA 3V4RA 3KX2A 2VF7A 4MA4A 4NYIQ 3PUZA 1YZLA 2OHFA 4BFVA 1EK0A 2IS2A 1G5TA 1HT1E 1TF2A 3SJBA 2ZRLA 1JB1A 4MKIA 4B71A 2MMGA 3ADCA 5CIQA 4NU0A 1NNEA 1R4AA 2RHDA 1TQ4A 2QG6A 3IUYA 1XNJA 4LBZA 4A0FA 4N0DA 1XJQA 1YZTA 3QKTA 1NMXA 2W6IA 2RGNA 1A2BA 5DO9A 1VHLA 1QF9A 1MO3A 3TW4A 1XTJA 3CRRA 2C2HA 1OF1A 4Z8YA 2Y8EA 1J8YF 1E2HA 3TVTA 1SVIA 1Z0FA 4AIIA 1BMFD 3H2YA 2EWVA 1SQ5A 1RJ9B 1YJ5A 4NTZA 1TTTA 2OAP1 1PLJA 1AJEA 4CEJB 1IY1A 3W6NA 4ZPXA 2KB0A 1N2CE 4GNKA 5AJVB 3RSOA 1EESA 2OILA 1FL9A 2ZPTX 3T1OA 2W83A 3H0KA 1EFUA 5G3YA 3KTAA 2JLWA 1LW7A 2FSIA 1Z29A 4KFRA 2NO0A 2JLXA 3R9IA 1T3HA 1R7RA 1JEDA 3NBYC 4AYXA 5E3HA 1G9XA 2IL1A 3C7KA 4HLUA 4ZDKA 5ELXA 1RC8A 1JQLB 1RZ3A 1XCPA 3MSXA 1MABB 4DT1A 3FKSD 3T06B 1EWQA 4B44A 4XD7A 1D5CA 4LDJA 4CDGA 4CRWB 4Q48A 1YR6A 2ASEA 3IHLA 3EIQA 1KJYA 4EAQA 1AS0A 3THYA 2ZI5A 1AGRA 3P26A 3IEUA 5FL7D 1G3RA 1VTKA 1SHKA 3B1WA 4C30A 5KSOA 4B6EA
chains in the Genus database with same CATH superfamily
3W3AD 4IMRA 2O2YA 2OGTA 3LY8A 4AQYB 3ECCA 3GT4A 3K6RA 1QRRA 4GIBA 4HP8A 3V00A 3WNQA 3Q3EA 4FYVA 1WZCA 1B6TA 2BF4A 2VPPA 1X7ZA 3E9RA 4ZXPA 5A9SA 3HC7A 3DAOA 5KYNA 3BS4A 2UUAB 4P5PA 2BP7A 4EGJA 1C4OA 1G17A 4NOJA 1GFIA 1QR2A 3KKNA 1KVRA 3TL3A 3K4PA 1NXTA 4FFVA 1OXXK 1RP1A 3VR3A 3W5JA 1SCIA 4W7HA 3VBCA 3GY0A 1NX9A 2XYHA 2ZOSA 4ZOLF 1P6UA 1BCSA 1SU7A 1KI3A 2W2LD 2QUAA 2QJWA 2GK6A 4KYUA 1EP3B 3D54D 5SZIA 3OX4A 5AW2A 5JI3E 3K9GA 4F9EA 3WLRA 2Y1OA 4BVLA 1Z3IX 2ACWA 2AL7A 1RPNA 2E89A 4Q93A 1MTZA 1YB1A 3JQCA 3R0QA 3TQSA 4ZYXA 1NX6A 1FTNA 1SBZA 5AW6A 5M34A 5LXTB 4M9UA 1MRSA 4A6EA 1UKYA 4COKA 5CM9C 5K0FA 1BE1A 4MUBA 3O3OB 4CU5A 3DO8A 5C4GB 1QQAA 5G1PA 4DSAA 4LIPD 5IBCA 1OWOA 2F8TA 4F4JA 1Y9ZA 2EZ8A 2Q2QA 2QE7A 4QNRA 3HCNA 4L95C 3T5PA 3Q7IA 2JAUA 3H4VA 3FWKA 3O31A 2REOA 2DC1A 4NX2A 4WY2A 2M32A 4ETIA 2V7XA 2VJNA 3AUJB 3HVUA 2QN9A 5EIXA 1ISPA 3H2GA 2ZT5A 3LKDA 1HEIA 1KY5A 1CU1A 1SXJA 1BC5A 4NC9A 1QVRA 3IV7A 3V7FA 4YMVA 2GAFA 4RFSA 4YROA 1FDOA 3DFUA 4RY8A 3TB4A 4GZ6A 4KLRA 4IGIA 3G59A 2YRXA 4IIHA 2X9GA 4EB6A 5BN3B 2XXJA 2AMJA 2F3TA 3CMMA 5AK4A 3NWOA 3C5WP 4EFMA 2FEWB 3PFBA 1PRYA 1KAMA 3DBHA 2WHQA 3KBBA 3T7AA 2GBCA 5FAKA 4MQ5A 4MWTA 1IY8A 3CLRD 3H7IA 5M2QA 4LN1A 1K89A 3ICVA 3JS5A 2B94A 1C0LA 3F78A 4YAWA 4YNBA 5BXQC 4BGUA 2AD1A 4ZGWA 4BFSA 3NATA 3OF2A 3BRWD 4F97A 4JBIA 4ZVUA 1DCMA 5IF3A 3UOWA 4N6GA 1E3TA 13PKA 4LSGA 1CRQA 1UWVA 3RS2A 3OMWA 4P2GA 1KEZA 1R9NA 1SCNE 1Y4DE 1NQ5A 4HB4A 2XODA 4XM0A 2F9LA 2FFHA 4M1KA 4XFDA 2YJ4A 4C76A 4I5FA 3USCS 5CNKA 4HQ0A 4RDHA 3WIVA 4DLWA 1WMBA 1YQQA 5ARBA 1JKXA 5CXUA 4CIBA 2HJSA 1JZSA 4MP6A 5IJ9A 1UODA 5BN5B 4HB0A 5A6SA 4X24A 2J5XA 4JHLA 3ZE1B 1ZJYA 2X14A 1H85A 1U65A 1EXNA 2D5BA 1SK9A 1N25A 2QEQA 3IMCA 3PNYA 4PQFA 4C0HA 2PLWA 1TM3E 4JEMA 2HA5A 1EVQA 2QTVB 2ZJ7A 5ALTA 4A10A 3TMKA 1KMHA 2GN2A 3V1MA 4MGZR 1FS6A 3L9XA 4IS3A 4PLVA 5L7WA 1RIFA 1S4QA 1HGXA 1NLZA 2D2VA 1Z2PX 5K8JB 3ZHYA 5A05A 5FT9A 2H07A 1FP6A 4RVHA 3ZR4B 5KPJA 2XKBA 3V1LA 4PYMA 4KITB 4ZI7A 1TTHA 2GQ0A 3SJ7A 1KPHA 1DDIA 3P96A 5DBOA 4BDTA 3ZJ5A 4UOZA 5L6MB 4HS9A 2D2XA 4X71A 3AHGA 3ZKAA 3NASA 3K0AA 3PLRA 4I3HA 2VP5A 2X23A 4TMFA 1JXAA 4IIUA 5HILA 3KKKA 3MERA 5GIOE 1H05A 2D0IA 2FKNA 2Q2VA 5HK9A 1CUDA 4BXOB 4Q7JB 3A0RB 3KJIA 1KJWA 4GM4A 1A4RA 3MLBA 1O9BA 3WK6A 5KQGA 3UGKA 1WNTA 3DOEA 1VSVA 1X77A 1DFIA 3B12A 2ZAYA 3PNSA 4MRVA 4RHTA 3ZCTA 4OLBA 3SLKA 2QX7A 1FC0A 1N2ZA 4KVGA 1KI6A 5EP4A 3UCEA 3TCKA 1EQUA 1QFJA 1ISIA 1S9DA 2GBIA 2XRZA 4BCDA 3K1JA 4JP2A 1BU8A 4XZ3A 3VVCA 2VHEA 4BGDA 1OYVA 2VPXA 1X94A 3JYOA 2JDID 4RCVA 2LPMA 2YXLA 1NFQA 1XLUA 1R3UA 1XZAA 3SY8A 2CXUA 5C80A 3DZJA 4LFCB 2WG1A 2OYRA 2UUBB 4DFDA 2A30A 1Z6YA 3L41A 3OSZA 2NUTB 3PJGA 5HIAA 3EZ7A 1PN3A 3COPA 2EIHA 3R3WA 2PRIA 1VLLA 4Q7EA 1C14A 4ZFNA 3ILYA 2FV8A 5CPBA 3KEMA 2WG2A 4FQ8A 1AZSC 1ZGGA 4HADA 4AUNA 1E66A 4O1IA 3MBOA 3NEPX 2UUCB 1L4MA 1WE2A 4P32A 1XRJA 2R47A 3OIYA 3QBTA 3AH8A 1A69A 1TGYA 4KBGA 2EJVA 2DETA 1PTKA 3GB9A 5AHKA 2DB3A 3B6ZA 2FB9A 3GUVA 3OU6A 4FHDA 1GPYA 1MNAA 3ZE6A 1T6YA 2I5PO 4LCBA 3HSYA 5L3SB 1GU7A 1CG6A 1JJVA 3K9LA 1W1IA 1ZVKA 1HT2E 4Q7KA 3KYDA 4L8LA 3U4QA 1L4KA 2ZUSA 3GHHA 2RH4A 1T36A 3NIWA 1C4KA 4JD5A 1Z7GA 3TNDA 1EDEA 2JG3A 2AQ8A 4XUCA 3SHTA 1QMPA 3B38A 2ZTVA 1YQWA 1DG3A 2HMVA 4QZVA 4DUZB 3LECA 3HFSA 4KKVA 5DI3A 3LOPA 4MGEA 3M6LA 3CEHA 1JBKA 2NXEA 4UHKA 3KJQA 3ESBA 2FSVC 4UM9B 1ZUNB 4U39A 4B3XA 4KFCA 2YHIA 1JDVA 1VPDA 3FWHA 2RHTA 5FPQA 5HKKD 1UJNA 4I50B 4DCSA 1W44A 3JAKA 3NH6A 1MV5A 2C00A 3OI7A 3QNMA 4MQ6A 1FDSA 4TWRA 3M3DA 3O8CA 4JSRA 2WVHA 1Q1ZA 2E55A 4OV6B 3EZFA 5H80A 4BASA 2EG9A 1FUEA 4HFNA 3AGPA 3OJFA 3EXFB 3G23A 4TUYB 1OR8A 3C4JA 3KVNA 5E2IA 1KMMA 4I6JA 2I3DA 1CK4A 4C0BA 1C8VB 2XBUA 1W4AA 3ETJA 2DJIA 3BMNA 4N3CA 1JT9A 4JFRA 4Q3NA 1JIIA 5GZ3A 1YOVB 1NTRA 3DMTA 2P5SA 3U3KA 4KO4S 1OIWA 4X6UA 3N76A 4IDEA 3WGLA 1EGVB 3GP5A 1XLTA 1RC1A 1I4EB 3AO0B 4EW2A 2AOTB 3AP1A 1EGMB 1GG5A 2PANA 4QXOA 1YJXA 3A9CA 3KQWA 2C8LA 2EBFX 1AKNA 2XCUA 1DTEA 1TQ2A 2HA7A 3BF7A 1GG2A 3ZNOA 2C2WA 4J0KA 4MDFA 1CUUA 5JISA 4NKRA 2E2WA 3EHEA 4BNLA 2XMDA 3DUFA 4M9XA 5IC6A 3K1AA 3KTAB 2WYHA 4WMLA 3L7CA 4RYLA 1NIPA 3NHPA 4ENPA 1UANA 4LQCA 2FRDC 1JWBB 3HK2A 1JR3A 2ZPAA 2VTKA 1JU9A 5D85A 2J3KA 4R8LA 3DE0X 4QECA 1MJGM 3T3HA 4A0GA 3LXXA 4FCWA 2PZBA 2TS1A 3HXQA 3OESA 4NK5A 2OXTA 3GEMA 4EECA 2C7QA 4FZVA 3LQYA 3M49A 4TMVA 4H3KB 1LRJA 4L78A 1ZOPA 2PJUA 4U9IS 5FOXA 2GBLC 1L8AA 1OYOA 1LSUA 3BWMA 1ZRSA 4O1MA 4UULA 5BQPA 3RABA 4AYWA 3Q7SA 1WZIA 1R6DA 4KK3A 5DP1A 5FWXA 4FFPA 4UAVA 2C2GA 5J3JA 3ZDFA 3V6MA 1F6WA 3JRNA 4I99A 4RY0A 3SMQA 4MROA 5E1BA 3RC8A 3SKYA 5KC9A 4KJZA 1VFPA 1T3GA 4RADA 3R41A 1MJFA 3NBUA 1J2EA 1I6MA 1ORWA 2N47A 4FYWA 3MMXA 1C4XA 2F8SA 3M8KA 3PC8A 1XPUA 5AESA 1WNFA 2P9TA 4AP5A 1BDHA 1SCQA 2HIMA 3DHVA 3L0SA 3ORSA 3TFWA 3DTTA 4EKYA 4CFYA 1PFWA 1IXSB 4CKEA 1P62B 2WWYA 3D59A 2EYQA 1EM8A 4BAUA 4JXJA 4OA8A 4F45A 1W0KD 2FVXA 4UE3S 1IVSA 1TGVA 2ZW9A 1MJNA 4F5DA 3DAPA 3NB0A 4RTSA 3FDZA 1N0HA 3AI7A 1YDWA 3RKUA 5AT1A 3A3YA 3V3TA 4RAOA 4N0PA 4DXHA 4HVCA 1PJCA 5J2UB 4QULA 4TMTA 1O03A 4CN8A 1G55A 1V5EA 1W35A 3CJRA 3TI7A 4EG1A 2CJFA 5JCZA 4XJSA 2OFWA 4DG5A 3IIJA 4XJTA 4E09A 2ZJAA 4U2GA 5D3KA 3I9MA 3AG6A 3Q9NA 2JLQA 2R6HA 3I73A 4DLVA 4BN4A 1QBGA 1YR8A 1ZR2A 1O08A 1PP4A 1PYOA 3E22A 4O4LB 1OLXB 4WA7A 1IB6A 4ZD6A 3WYAA 5H83A 3QBVA 4PZAA 3KB8A 2YOGA 2WVJA 2F62A 5B1SA 5BWBA 4L9SA 5HJ5A 4OHUA 4J0HA 2VQ6A 1F48A 5CH8A 2JKYA 4YP5A 2ZDHA 5AXCA 2RJ3A 3VH1A 5AVWA 5LYJF 5CA0F 4N39A 3FTPA 2COUA 3NFYA 2E18A 4PPQA 3X1XA 4BLOA 3CBQA 5CFQA 1A9OA 4OQ4A 4EFKA 2OZEA 3PNOA 3AQ4A 4HGNA 3AI3A 4MMZB 2B37A 5DWVA 1R6UA 3VISA 5I9BA 4AX4A 2FSUA 2F9FA 1DCKA 1SZDA 2HIAA 4AMZA 2E37A 2BM9A 2OORC 1YF3A 3JVIA 3FWPA 3TQHA 3D4OA 4HI0E 2QWXA 4JA0A 2MOKA 1F8GA 1W29A 3DXZA 1OASA 3L8ZA 4R2IA 4BQRA 2CHGA 2TMYA 4Q1BA 2AUTA 2PX8A 2YZNA 2JKZA 1GNLA 1H1DA 2EGUA 3EGEA 3FYCA 2VS1A 2VL7A 5IW8A 3G0GA 3EVTA 2YASA 3QMWA 3F90A 4DLNA 2WR8A 1QLJA 2VNSA 1ZH6A 2ZJ3A 4N18A 5J59A 4EKIA 1YQTA 5ERGB 3N2KB 2A1TS 4HUQB 1YV9A 2GPTA 3SHVA 4RKEA 4OHKA 3V8EA 1GLNA 2P62A 3MBKA 4L0CA 4CEIB 1M6VA 2J9XB 2ZRMA 3PIIA 5K5EA 2QDXA 2XT6A 2P6NA 4CT5A 5C18A 3RTEA 2CBGA 1AGNA 1PEKE 2I7XA 2YRFA 3PDWA 3DS8A 4WEQA 4CQLA 3W90A 1Z16A 5IKXA 1WXGA 5HE8A 4BLPA 4ZOBA 2XVZA 1BHQ1 4TS4A 3BA1A 5F2KA 3U1TA 4ASUD 1T2AA 3A1WA 1GHTA 3O8QA 3DCYA 4RXUA 1WABA 1LB1B 1M2KA 3O9VA 4IV0A 2EHDA 1JAXA 2G1JA 2HA4A 3N0XA 3L77A 4HLQB 4WN9B 5FUYA 1LPPA 4ZZ2A 4N3BA 1BHO1 1NPDA 1OLSB 3DEIA 1GZDA 4M36A 5FYQA 3WL8A 2ZVJA 4B76A 5CDFE 5K6AC 2VYFA 3MJEA 2LWIA 4PAGA 2BGRA 5ALEA 3WXBA 4BBZA 4LCEA 1RQPA 4KSBA 4K6OA 1X2BA 3A6ZA 1H8ED 1WMEA 1L3BA 1ZCAA 4LE1A 4BJHB 4PHFA 4BIMA 1RC0A 1T1EA 1W6UA 3C6ZA 3PUIA 2ZZNA 3MTJA 3QVGB 4IOMA 1TC2A 1WD7A 3QVJA 3DC7A 3OPNA 3QELB 4C6TA 4BP9A 2VNKA 2YV5A 3H6GA 3OTGA 3F98A 3RO7A 3ZUPA 5DCYA 3FSRA 5JNLA 2XB8A 4B73A 3NTUA 1AQJA 3WB2A 1L8QA 3LTNC 3UQYS 2OM6A 5MN4A 4K6GA 1WSAA 1IUPA 1C1YA 3ZD8A 2GNOA 3RYFA 3Q12A 3H3XA 2FJUA 2O05A 7AT1A 4KXFB 1P0QA 1H65A 2X77A 2XEXA 2BLLA 4P7JA 4FE7A 3HCAA 3NOVA 1C1XA 4TV8F 4XGIA 1PGPA 5CGZA 2AUMA 4BV9A 3GI1A 4EGCB 1KVQA 2FWBA 3A31A 3TQQA 1OGIA 3B8HA 1T2CA 3QFFA 4HDOB 2OG2A 1RCFA 2RI6A 3NTQA 3VNSA 3G8AA 4HDSB 4O4IF 3SC2A 2R79A 4OFBA 4QOHA 421PA 1QYDA 1VCHA 1L5NA 3EZ6A 1SQFA 3CZ5A 3OQ6A 2QTLA 1KA9H 1PFVA 4H1VA 5BOSB 3HEAA 4Z7OB 4BFUA 3FGPA 4TQAA 4C6SA 2RAPA 1P7ZA 4N82A 3SGLA 4BB0A 5BQFA 1Y7TA 4QLBA 1I1NA 2XRMA 3AF5A 4RH3A 3P9NA 4BLWA 5BV8A 5CB6A 1CQIA 1ULZA 2QR3A 4OSPA 2YIJA 3CX7A 1CJTC 3N8IA 3WWDA 1GYQA 3TW0A 1CETA 1XPJA 1FFSA 1VI6A 3TTVA 2CY0A 3EGXB 3VUFA 4BRUA 1DMRA 3BTOA 4M53A 3ZU3A 4B4UA 1T6BY 1NUQA 4Q1CA 3LVQE 3WFZA 1KIFA 4EEZA 5AI9A 4IS2A 3GFOA 2J5RA 4MKGA 4G6ZA 4ZO7A 1IE3A 3WGHA 3TRHA 4XYGA 2DECA 2UYGA 3D4NA 3KEGA 3L2OB 2H0AA 1ZM7A 4PAOA 4CF6A 4KEAA 5DGCA 3CNBA 1CJVC 3UMFA 4XB2A 3IXQA 1UZUA 3BREA 1PNRA 1BKYA 4MLCA 5I7HA 3MM4A 5LA6A 5EJ2A 1J5EB 1J8VA 3O83A 4L8VA 3PHJA 1YVPA 3D2AA 3ZGXA 1I2ZA 1ULAA 2PSDA 3ZXIA 3DCJA 2B4KA 3FUTA 2FEXA 2FGKA 4I4LA 2A9QA 3LMKA 3BUSA 3QUTA 4ZARA 5JG7A 4ER0A 3LF2A 5KNBA 3T3PB 3U0VA 4GQBA 2DBRA 3CM0A 3U3XA 2VJCA 2PWAA 3UICA 1O6CA 2B9EA 3BIOA 2VDWA 4ZJZA 3IP1A 1OLUB 2P2DA 5LP6C 5A3RA 4C04A 2FEMA 2V4UA 4YQZA 4W5WA 4B46A 4IXWA 1I2CA 2SCUA 3H4TA 2EVWX 1W36C 3D7NA 4Y1RA 1DIOB 5ECWA 1BU5A 4OJNA 1J7KA 3HVJA 1WF6A 2UUOA 4TLCA 4ZAVA 3K53A 5IVDA 1KYWA 5HKLA 4YJ3F 5SYAA 3W3ZB 3WKBA 1AO0A 1GWNA 5B37A 4CZ2A 2EZUA 1XDGA 4NBKA 3MHTA 2QYOA 3L02A 5F21A 1I0ZA 3ROFA 1GAXA 3GL9A 4GRAA 4U7FA 1ZSNA 2RGYA 3D2CA 3F67A 3F3SA 1CP3A 2BC9A 3QHAA 4Q34A 4EJ0A 1CF4A 2C4HA 2HGZA 5K4AA 3AFIA 4RKQA 3ZDBA 4Y2VA 2HUNA 3UXYA 2WJVA 3P20A 3FSGA 1T4CA 1R0RE 1VI2A 4MLZA 1B74A 2PXHA 3OSUA 5IH3A 4DN6A 3CG4A 2QSYA 1ZL2A 5A3QA 4W5HA 4P3PA 4Z53A 5A0FA 4PIPA 1CF9A 2NYAA 5A9RA 1KDTA 1QX4A 2C2MA 4RKFA 5TIIA 1CEYA 3EUWA 2O7QA 5K0CA 1KAEA 1TCUA 2PZEA 4B3JA 4EY3A 2BTOA 4NARA 3W6UA 5H3CA 3HZZA 4MS1B 1J8MF 1NM5C 3JQGA 4W5TA 3HWWA 2HQ1A 1YRYE 3GFGA 5MFPA 2BZ1A 4HG2A 4IHJB 1IN8A 1KO8A 3PJFA 3IOBA 4PNZA 2FN9A 2V7QA 4DWWA 1T10A 5JS7A 3M6FA 1MR3F 1ODJA 3IEKA 1A9SA 3W1VA 3UHOA 4HQLA 4MW7A 4XSHA 3GN2A 1L7DA 3IHKA 3W8NA 2GN6A 1KI9A 4DLUA 2NYVA 2PGNA 5ECDA 1IBMB 2KSQA 2BI4A 2P8SA 4BKMA 4XSVA 5KWIA 1ACJA 5KWSA 4YHHB 2HU5A 4B3SB 2HJVA 5EPEA 2X0NA 2I4OA 2D0PB 2OBBA 1J2YA 4HPWA 4NV1A 2ZI9A 4LQLA 4PONA 5FLKA 2XJ4A 3HVHA 4WFKA 4CIDA 1EA7A 1E5LA 2BFAA 3KEQA 1MXHA 1JVBA 2A8YA 2EFHB 3EZXA 2FP4B 3G2LA 2HCBA 1M9NA 5DVZA 3V7UA 3VHQA 1A82A 1IWPB 1GPDG 4UCXA 4YV0A 2GCNA 3E9EA 4PZYA 3OPYB 4Y6GB 3WWPA 2PR7A 4TRJA 4UM5A 3DXXA 3ZS8A 2UXBB 1HWYA 2Q4TA 3JZMA 4W6ZA 2GK3A 4QQKA 2IEGA 3W34A 1GSAA 2F1HA 2H4YA 4MTCA 4OVKA 1DLJA 1N7GA 2CSUA 1YK0A 1QANA 3FOZA 5F4BA 4URHA 1HL7A 1KZ7B 1VSBA 2H2HA 1L7BA 4PZLA 3L43A 3T0FA 5LZ2A 4Z4EA 1QHXA 1ZNYA 2J3HA 3QW2A 4HEA6 4MV5A 3JQ7A 3E0XA 4EL0A 5BNIA 1USVA 1OYYA 1Q12A 2V7VA 1RRVA 3WA7A 3KTOA 4HMQA 3K30A 1Q95A 4ZYLA 5LU8A 2BI7A 5JUWA 1G2OA 2DBZA 4G5RA 3M3HA 5LMCA 2IYNA 2WILA 5FP0A 2ZAMA 1YNOA 1NN0A 3WMXA 1BXGB 2E82A 2HXYA 4YXFA 4GMGA 3UNXA 1P8AA 2R8RA 4J75A 4KWIA 4V0MA 1SG6A 3DVQX 5FI0B 2PMEA 4P38A 3ADPA 4ZK2A 2QDKA 1VJCA 1XA0A 2YJTD 2ZJBA 3GU3A 3T3DA 2CFRA 4GLOA 2JLZA 1IBLB 1V8ZA 2MINA 1QU2A 1G5FA 1YRLA 4MWZA 2F3QA 2HOQA 3G9XA 4EJMA 3TFQA 1O8BA 3EAGA 4YR7A 3LWNA 1UC9A 4CVNA 3QG5A 3IP5A 1M8FA 4U0KA 4EHJA 2DPLA 3BIXA 1DSSG 4KLNA 5F7ZA 2RCYA 1A3CA 2P9QA 3G1UA 5A5FA 4QDJA 5TEVA 5L8VA 3H83A 4B6JA 1E7YA 2ID9A 4R2LA 2VF4X 4MB2A 2BMFA 4KGVA 2FZCA 4JLUA 1MC1A 1GCOA 5KOJB 5LSAA 1KZ4A 4OJQA 4V1CB 4J0JA 3DOFA 4MYRA 3ICEA 3HDTA 2FPGB 3SVTA 4B6PA 1GPBA 3NEYA 4LHSA 1GY8A 5DI9A 1CIVA 2BTEA 1M7BA 4OCZA 4QTUB 4WW0A 4YA6A 4YUVA 3VGJA 1YL5A 4OB6A 2C5BA 2R60A 1XDWA 2JIZA 1T8YA 3OZTA 4TMYA 4W82A 5CU7A 3GLVA 4EI8A 4BO7A 3D0KA 4EA6A 4WD3A 4UCQA 1ISHA 1TF5A 2O20A 2IHZA 2J30A 3B9PA 5C1DA 2P8JA 1IPEA 2ZRPA 4PWYA 2F43A 1QG0A 1XTBA 4URFA 3IDAA 1IHDA 3FPHA 1Y8QA 2IJGX 4E07A 1HA3A 2ZU6A 4B09A 1WDLA 4KE7A 1QTNA 1TE2A 3IDZA 2IP1A 2OHOA 1B26A 1E79D 5EXXA 3PGKA 1ZIPA 3F9RA 2Q7DA 4IL5A 2Y1DA 4DR4B 3K0FA 1F0KA 4WKPA 3LBYA 4X1IB 3I9V1 3BSYA 1QIDA 3GA0A 1XZPA 3RVJA 4DQKA 1NLYA 1QKKA 3L8MA 3M70A 1DIGA 4ZOAA 2QRUA 4OM8A 4BN5A 3ONDA 3A05A 3VC3A 4AJ9A 5K8LA 2BJVA 5EWJB 3RHTA 2ISCA 4HQNA 3NIDB 3R6LA 1PX0A 3PVCA 4QLAA 2XNHA 5BMVA 6Q21A 8OHMA 1S3FA 4AMGA 2G9ZA 3BMCB 5CB0A 1U6KA 1ECLA 4WCDA 1FFCA 2ZRDA 1KSGA 3TOXA 3K0CC 4IJUA 3O47A 2BKUA 3OQVA 3LCMA 1B3BA 1RZUA 4Z2YA 1G8KA 4Q47A 5HM6A 3FVVA 4JJGA 3MQFA 5A03A 5K8TA 5KB3A 4G8JA 3CYFA 4JT9A 3ZK9A 5CG1A 5IKEA 3AJAA 1N32B 2DEUA 3ZHTA 4WXEA 5AK0A 3GX1A 5I8WA 3EZGA 3UG6A 1KAOA 2FDXA 4RGBA 1F8FA 2GS9A 2HLPA 3NH9A 1E32A 1NYRA 3WLOA 5K1ZA 2WV7A 3ENZA 3HZOA 1W1WA 5H3HA 4F86A 3OH8A 1DXHA 2D0DA 4FGWA 1UBTS 3FZGA 2VT2A 2XYGA 1ZGCA 4M1WA 3NVKI 6REQA 2FOIA 3BXOA 2GESA 4UHDA 3UAGA 2O4CA 2B6NA 4PY2A 5E7QA 4AMBA 4XYLA 3UTCA 1Y8RB 3BH6A 5TDHA 2IHTA 1GN8A 1U3GA 3ELWA 1W73A 3H1EA 4LXHA 1TQHA 5CA1A 4F2WA 1QRAA 3G82C 3D6NB 3HFJA 3TW8B 3WQHA 2AEJA 2BL4A 1KK2A 3L8CA 5F5NA 3U44B 1TJ4A 2EW2A 2DHCA 2C2XA 2JAQA 2N9UA 3DEHA 2I65A 1PCXA 5EXDA 1TQ6A 4D46A 2E4VA 4M8SA 4MDYA 4DLTA 1OX5A 1GV0A 5CH5A 3UB2A 3KWJA 1VP3A 5TQ2B 1KZHA 4XVHA 3O26A 4U7GA 1CUWA 3AUYA 5KYUA 3LFUA 3FBWA 4BP8A 2QYSA 4LSZA 3P52A 1L4NA 5CCXA 1JI3A 5ALZA 1TLTA 3FNEA 3RIXA 5CM8B 4FT2A 3FRJA 3EISA 5JANA 1XTSA 2J1LA 4KO1S 1UEXC 1IHYA 1XLVA 1L6IA 2IKSA 3DTVB 3DYVA 4TQUS 1J20A 1E8NA 4DBZA 4HZIA 3FNGA 1T3TA 2YHBA 4L8FA 1BZYA 4R83A 4G3XA 2VT3A 2GH1A 4HGZA 2NP7A 2IXTA 2JIMA 1HY3A 2XOKD 5HZKA 3FCYA 4QA9A 3BK1A 1C7JA 5CT4A 2V6IA 3B13B 2J4FA 1RSZA 1IJBA 3O95A 1MPXA 3IGFA 2QUJA 1W2WB 1G98A 2C8VA 2VIIA 4R0VA 4OQFA 3QYJA 1T9HA 1QXSA 1XZGA 1XUOA 1I6LA 2AOUA 1VJ0A 3N28A 4ZTBA 5SZKB 3G9QA 3S2GA 3UPDA 1FFYA 4RFLA 5KX5A 3L6RA 3SQOA 3NIBA 4INJA 4N5IX 4ZVNA 1K6EA 4TKUB 5HR5A 1ECFA 5L7YA 1AX9A 1NA5A 1XQ9A 4R9RA 2BV3A 2DH5A 3ESAA 1AVTA 3I04A 1H2ZA 1HYGA 1ZM3A 2CYBA 5F76A 1W6RA 4DMHA 1UBHS 4RCYA 5JSUA 3EEOA 1FSGA 4X3CA 1BKSB 4BQNA 2B2NA 4BWYA 2PNFA 2ODEA 2PEYA 2HNKA 4IW3B 1JKMA 3GRYA 3LOQA 1DQRA 4X8MA 4XW2A 2QTWB 4JI2B 1HFWA 1I4TD 4BLUA 4N40A 3H6HA 1JHPA 1FE8A 1LJUA 3WHKA 2CVFA 2WJ6A 3LX5A 4BFXA 4ZRMA 4L28A 3IQEA 4KE6A 3LRXA 5DLPA 5AVYA 1W5BA 3BHIA 2FLKA 1R15A 1N2GA 2QUKA 4KYIB 4LBYA 1EP2B 4XWOA 3EDRA 4A23A 3SEZA 1S8NA 4C0XA 4TWAA 1V11A 5CB4A 1JKJA 2AEEA 4YGYA 1RXUA 5DOZA 4DC9A 3W2TA 1NWHA 3WLFA 1SWVA 4UUPA 1LY1A 1ZRNA 3PWZA 4TLAA 1VIYA 4MWEA 4TV9B 1KYVA 1CIJA 3ZDYB 1P7VA 4HQOA 4NCIA 3ZLVA 3N3BC 5JVDA 1FMJA 1Q0TA 3WQRA 2YY6A 4V38A 3F7TA 2A84A 4IIDA 4DA7A 4JLJA 1V6SA 2R25B 1J4AA 3RT9A 2EZ4A 2NVUA 3OEEA 1T43A 3T3EA 1XNRB 1JW9B 2WYOA 4TKVB 3SNKA 2EFCB 4YP0A 3LKBA 1Q83A 4XPZA 2G63A 1WMSA 3GGJA 3NO4A 2M9MA 4KQJA 1JYSA 1SEPA 2GAAA 1J1IA 3D1VA 1ZD9A 2HF7A 3EVDA 1QQBA 4UEJA 2NO1A 2XDAA 5AMXA 2WBLC 1XQ6A 1M2FA 2WMYA 5DYYA 1NRXA 4YREA 3VDXA 1YQUA 3KR9A 5JC1A 3PNMA 4MZDA 3CJTA 3FM9A 4DMUB 3MWKA 1TU3A 1JHQA 1MOPA 3KUDA 3TIXB 5DB4A 5CVVA 3U4GA 3QBJA 4Z0TA 1V0JA 1E3MA 3U16A 2IEBA 3QKIA 2BELA 4WZBE 1E0DA 1PIWA 2VZEA 4KBFA 3EPJA 2OQIA 3ASUA 5JDCA 4L5BA 5EJGA 2A5LA 1A9YA 3HA2A 2OGSA 4ZVTA 5BUSA 1Z38A 2E48A 1QBKC 4UU7A 4BB9A 4FVTA 1JPVA 1ISSA 2AQIA 1A4XA 1K2WA 1UP6A 1JAZA 1GPH1 2Q6OA 3Q15C 1NOIA 3KQUA 1NMQA 3M6IA 4A4DA 3E82A 2ZR8A 1GRNA 2HHCA 1N7IA 4NYJQ 1YQ9A 1FX0A 1EGHA 2NU6B 3GRUA 1PR3A 3OPMA 1U1EA 2GNAA 2O8NA 4B4DA 4L02A 5I9SA 1P4AA 1VCNA 3DMHA 2VYNA 4WZBB 3TPCA 3AM5A 4GR9A 1CDEA 4TL6A 1X1SA 3ZGLA 1GJRA 1MB9A 2ZAOA 4N8SA 3GXOA 3VYRB 3COWA 2XDYA 1AS2A 4GLJA 3DLAA 4QBKA 1JF8A 2G7ZA 2IYZA 5ELLA 3PQ2A 4Y9DA 4I2NA 5T6BA 4DV4B 1D8AA 4UDXX 2HMSA 3LUAA 4L6AA 4MO2A 2BAGA 4UCFA 4D0RA 4F5EA 3T52A 4ZU1X 5ADWA 2A5DA 1UR5A 3DDUA 1JLRA 1MHTA 2AMYA 1JMYA 2EKBA 2QGNA 3JD3A 4WESB 1VA5A 4ZWNA 1MQ8B 4BJ6A 1X7ZB 2VYCA 1T6XA 4P5DA 2BP7B 2HB6A 3CZ9A 4Q4CA 2JF0A 3I6IA 3N8DA 5FWXB 2VI5A 1RRCA 1XZCA 2GAIA 3AEXA 4NNPA 4DQDA 3TW6A 3KALA 2VNJA 4HH0A 3NWEA 1VJRA 1NUUA 3NW9A 3TNLA 3NXSA 1FDUA 1IOWA 2I1LA 2ZIGA 4R7GA 3S8YA 4L7QA 1EFPB 1UBJS 2ZBDA 1WDWB 4W7SA 4EJFA 4GVXA 4AKEA 4DWOA 1JZQA 2VP9A 5E7JA 3R09A 1M67A 4AIRA 1AGXA 1UDCA 3IXMA 2HT1A 1E58A 2OK7A 3DDWA 3T9FA 1MVNA 2JGLA 3E3NA 2PBZA 2G4CA 4LXXA 4BNGA 2GTIA 4XIGS 3UT6A 5A4FS 3UJNA 1SR8A 5ANRB 5G4KB 1R0WA 5JBIA 1NG1A 3GLQA 2E21A 4R98A 5K8UA 1T8SA 1PJ8A 4ZVQA 3I23A 1M5TA 4EHDA 4MB6A 5CLGA 1EX9A 2AF3C 5IZCA 4OU4A 4KDRA 3MIZA 3D3QA 3IR6A 4Q5IA 3SC4A 2CLCX 2MDTA 2PHZA 5JHHB 4KREA 3ZK8A 1KPIA 1MA0A 3B7PA 1QYWA 3HVRA 3IS3A 5B53A 2YOHA 4M0PA 3HB7A 4DTCA 4ZMRA 2ZLBA 3MZ0A 4OQXA 3F5SA 3V5NA 3TLYA 2XAAA 4Q9LA 3EJWA 4RFSB 2X5OA 1V6AA 3IAAA 5IJAA 1XO1A 2PGDA 3EMDA 1RM3A 1IK6A 4C89A 4EFNA 1AKUA 2QVZX 4ZYTA 3VO2A 1ZW6A 4EB6B 1LLQA 2XUFA 3OT1A 2JFOA 2NT4A 2H4JA 3F1LA 4TN5A 4TTTS 1S3IA 2QRHA 4BOYA 2Z30A 4HBGA 3F9CA 3WQBA 5BYBA 4E5MA 5J2TA 1WUYA 3O1IC 1TZKA 3ZHVA 4DHEA 7REQA 4NCAA 1SC9A 5K0LA 4KO2S 2D1FA 2TRSB 5AW5A 1VMAA 2HPVA 1NXWA 2W6JD 1TUIA 4YS6A 2BMEA 2G06A 4G5GA 5EJ6A 3V8QA 2IELA 2R751 5JAMA 3QJ5A 2Z5LA 5F51A 3HCPA 3B82A 1XMVA 1D7OA 4D4KA 1U5BB 4L0DA 3A27A 1HI9A 4C0LA 3PI6A 2Q62A 1VCIA 3UA3A 1N3YA 1B2RA 2WDZA 4Y30A 3LA8A 5GJVC 2VYVD 5JH7A 3T7TA 1MOZA 4ACAA 5CT6A 2D7CA 1NDUA 2IHUA 1G16A 3IOMA 3KG2A 4DIFA 4YAIA 1P44A 1BKDR 5EMJA 4GW3A 1PI3A 1JPNA 2JLAA 1HG1A 2RMKA 2PLRA 4JJFA 4RHYA 3ETLA 4CKCA 1ZH2A 1VPWA 2FR8C 2VJYA 3LI2A 1EFVA 3BJEA 5DP2A 2GILA 1ZG3A 3OAAA 5FWDA 1EZ4A 3RRMA 3PHCA 2I91A 4DIKA 1A5BB 3BPSA 1VE1A 1UC8A 2X3UA 3PCXA 2WJAA 4JLDA 4ARVA 1W5SA 3ABRB 4BMDA 3X2SA 4EB3A 3KJEA 1JXMA 5CLQA 1KMHB 1S3GA 1WSDA 1VIDA 2QM0A 3T34A 2YJNA 2VDJA 3ZTTA 3IQXA 2JIPA 4CLRA 3M6UA 4F5WA 4G2TA 1OH8A 2GI4A 3PT9A 3RSHA 3S68A 5HJEA 4L4YA 1FMCA 5SZHB 1TFRA 3QFCA 3LQKA 3P32A 3SVZA 1O5IA 1Z2EA 4Q12A 4Z4IA 5LQMA 4Y2JA 1B6RA 4P36A 3H9QA 3Q3JB 1OD6A 2B4RO 3TJMA 5ALUA 2QE6A 3K0AB 5AJYA 1PL0A 2RHWA 4ZREA 3TS1A 5I7SA 5F1YA 1YS7A 2FPPB 3T3MB 3B9QA 4JLOA 4RQUA 3VPCA 3N8KA 4AC9A 3NP9A 2JLYA 3S5JA 1HOTA 5AW1A 5ES4B 3FROA 4MAMA 5LP6F 2PJRA 1VDMA 4EHKA 1DTWB 3IT3A 3IJRA 1EIWA 3IH5A 2CXSA 1Q11A 4JUCA 4LI0A 1TJNA 4G0ZA 2YDXA 2HCTA 2VPYA 4RKRA 1TCBA 5MN6A 3NETA 1W4ZA 3PR2B 2DMRA 2XAUA 1X9IA 1T24A 2VSXA 1LKZA 3VA7A 3CEMA 2COEA 3RBXA 3E3OA 2C4VA 5K0JA 2YV2A 4M54A 2GTPA 3K9CA 1R4MB 3KKZA 1AK1A 2IDZA 4C2BA 5IT5A 1J70A 3DDHA 3GDFA 1YDEA 2AG8A 2JFUA 1VL0A 3Q8WA 2ACEA 4HGYA 2ZJ1A 4KDEA 2BONA 1UUFA 3DVLA 1I3KA 1Q1BA 3E03A 5I7OA 4HNRA 2I6XA 4HKTA 1I1HA 1TADA 4MMXB 3GR6A 1KDPA 3LTEA 4RU1A 4AJKA 4DR1B 4D26A 1PSZA 2PS9A 3A3KA 3DVAA 4MIEA 2VA8A 3FY4A 5C8ZA 4ID3A 3EPPA 1SG9A 1HDIA 1HNXB 1RJFA 2GEKA 1PDWA 4FMCB 3SFVA 4CLXA 2VDNB 3BGSA 3B48A 5JSQA 2JH3A 3BFPA 4NJMB 3NHJA 4PZEA 2ZYWX 3S3TA 4D4HA 1IQ0A 5DYIA 1BVUA 2H17A 1EGAA 4MQ4A 1FLVA 1YZYA 5HW0A 2NU7A 2WWXA 4NK4A 2PGXA 1RHUA 2ZUWA 4MDEA 1UXGA 1N6KA 3KYDB 4C07A 2H8KA 1T36B 2IKQA 1RHQA 2JVJA 4L85A 1C8BA 1QIFA 3USES 2YMQA 4AO6A 2AW5A 5C7IO 3FTEA 1T0PA 5THXA 3KOMA 2OUKA 1W59A 3LC7O