3KKOA

Crystal structure of m-ras p40d/d41e/l51r in complex with gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
b'NLPTYKLVVVGDGGVGKSALTIQFFQKIFVDEYDPTIEDSYRKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein M-Ras
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 59
structure length 169
sequence length 169
chains with identical sequence B, P
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkoA00
1PLKA 2W6JD 2F9MA 4P32A 5AWFC 2W83A 1Q1EA 1P9NA 3EC1A 3QKTA 5L3RA 1G18A 1OE0A 4LYJA 1XXHA 1XEFA 4KVAA 1W4BA 1W1WA 3RYTC 1JQJC 2RAPA 4GOKA 1MO6A 4OJKA 1Z63A 1F48A 1CR1A 1E9RA 1TF2A 2J0UA 3U7EB 2W6IA 2P67A 2XJ9A 3TMKA 3MCAA 3H84A 4YC7A 1E98A 1PUIA 2OFXA 1JB1A 1Y63A 5EXSA 2J87A 2WAYA 4JLKA 4TT3A 1KSHA 4KO8A 4KU4A 5CIWA 1RJ9A 3TSZA 1W47A 1XZPA 6Q21A 4QGGA 1D9XA 4XIGS 2BIFA 5FH9A 3OHMA 3ADBA 1G4UR 1VCOA 1GRQA 4P0TA 1D5CA 2WWIA 2XNSA 3VHLB 4JL6A 5KTYA 5BN4A 3CRMA 1N6KA 2IWRA 1GL6A 2GAOA 3FMIA 3RS0A 1UKEA 3EZ6A 1JEEA 4WZBE 5C1BA 3C8UA 4X8LA 4DJTA 5C4GB 4QJ5A 1AKYA 3WRYC 3GLFE 2GK7A 1E32A 5FUXA 4O2RA 4B76A 1E2EA 2D06A 2O8DA 3DHWC 4LYFA 3FVQA 2WVJA 4QGAA 2ASEA 3AKDA 3NTUA 4JLDA 1RC8A 2BM0A 5KU1A 2JLXA 3FE2A 2BCJQ 3CNLA 2R6AA 4S35A 2IYTA 2KE5A 1ONBA 1OKKA 5BYJA 1SVLA 3ZVRA 2R44A 5D3MB 2EFDB 4C2TA 4EPXA 4P4TA 2WWFA 3M4YA 3TW4A 4DLVA 2HYIC 1KSJA 4XH9B 3CZQA 4GOXA 1NRJB 3LH5A 1ZUHA 4TZ0A 3GLGE 3EXAA 5JSZA 3AVQA 1AK2A 3QPWA 1TAGA 1N2CE 3EZ7A 1S1MA 1NJFA 3BH0A 3P32A 5EUQB 2F3TA 2O0KA 4PSVA 5CK4A 1GIAA 4TYWA 3WNCA 3ZYCA 1XMJA 2CLDX 4BFTA 2WJJA 1G3UA 4RZ3A 2IBMA 4C0KA 2O8DB 2ZJ8A 4BRWA 4M9QA 3RWOA 3ZVNA 1X8LA 3ETLA 2YOHA 4IVRA 1CJUC 2VP0A 2WJYA 2GEDA 4HAYA 1QRAA 2CLSA 1OB5A 3OIYA 3CRQA 3NIBA 3EWAA 2GXUA 1W44A 4B3FX 4Q9KA 1KK1A 2ZYTX 1IAQA 4WOPA 1FTNA 4D0LB 1R10A 3UMRA 1OXUA 3GJ4A 3K0CA 4OHXA 2VHCA 4AG6A 1Q12A 3TJZA 1KJZA 3T06B 1T0JB 2F1JA 3DPUA 4B44A 4XSHA 4LJAA 5LB2A 1IN7A 4ERNA 2BEJA 3Q7QA 3EPJA 2V7QA 2V6IA 1OF1A 2PZGA 2VHUA 4JVNA 3RRMA 4HAXA 5FTNA 2QGNA 2ZIAA 4JL8A 3QF4A 3EA0A 1KAGA 2Q21A 1NY5A 3MSXA 2A3RA 4MKGA 4V0ME 3IIKA 3IDQA 1IY2A 2FOLA 4ZO4A 3U61B 1P7CA 1UFQA 1GP2A 2AK2A 3QXSA 4YXWD 2IYXA 1R4AA 2WJGA 4C0SA 2A30A 5J40A 1JECA 4O3MA 1SXJC 1UJ2A 2CE2X 2CK3D 3GJ0A 4F4IA 5TARA 1NN0A 2I3BA 1N6OA 1IOZA 1WA5A 2OXCA 3QXXA 5FOXA 3GJ5A 4GZLA 1WB9A 2GZAA 1FUUA 1GSIA 3CW2A 4LUCA 1VG9B 2C5LA 2ANBA 3ZVLA 4QHSA 3FPAA 2XTNA 2ZETA 3HPQA 1JPJA 2IC5A 3FWYA 4HB3A 1H8ED 2VIIA 3CZPA 1L4YA 4RCYA 3GLIA 3VKWA 1RRPA 1US8A 4Q02A 4Q1BA 2HJGA 2R2AA 1MV5A 3L0IB 4BEJA 2GJ8A 4DCNA 4BLTA 4D25A 5CLQA 3CWQA 1E9FA 3ZIAA 4DSOA 1Z08A 2QA5A 1UDXA 4M1YA 4Q7LA 1E4VA 1X8KA 4DUGD 1FW6A 3HYTA 1Z6YA 2ZUBA 3IPYA 3K70C 3ZVMA 2GRJA 4U5XA 4YMUA 4GDFA 3T15A 1LW7A 3B13B 4LHWA 3ASZA 4TMWA 3QBVA 4M22A 3LNCA 5FPSA 1CKEA 1G20E 4LJ5A 4TQUS 3MWKA 1NI3A 3KB1A 2ZROA 3O47A 4D4KA 4KI0A 2QL6A 5FTLA 1AZSC 2IYQA 3Q3JB 1KDTA 2P6NA 2ZPTX 4TTQA 1E9EA 4IJMA 1W36D 5BN5A 2BOVA 4NP6A 4NYIQ 1JBKA 2OXRA 3K0AB 3KTAA 1DE0A 4DUGA 3CB4A 2NOAA 1T8TA 2EFGA 3DVLA 2P6UA 2JCSA 5C18A 2IX3A 4MA4A 4I81A 4PX9A 4ZKEA 2HXYA 1OIWA 3QY0A 2GCNA 1JQLB 1Z5ZA 2QAGC 2AHOA 4XWAA 5AK0A 1SKYB 3SJBA 4AK9A 4ZDWA 3QOFA 2CCJA 3T34A 2C04A 4TLAA 5DLQC 4BFWA 3BK7A 1LF0A 5JFGA 1II8A 1K5GA 1YJ5A 4E07A 2UZIR 2V1UA 5BW8A 3VR6A 3WBKA 5FOSA 4NMMA 3A4MA 1ODFA 3QXCA 4MITA 1H8HD 1XU4A 1AS0A 2XEXA 3WP0A 4HZUA 3SE0A 3MUFA 1HTWA 1Z07A 2NO0A 2QN6A 3AF0A 4ZIRB 3Q72A 1NVVQ 1XPOA 3UK6A 3IQWA 3I1FA 4KFRA 4QXAA 2QZ4A 3JZAA 4RY2A 3GLHB 1LV7A 3H86A 4C3ZA 1PLLA 1CXZA 2FGJA 4LJ9A 2ZRBA 1ESNA 3LW7A 2ORWA 4TLDA 2FN4A 1UKVY 5FFMA 1FQJA 3DZ8A 2Q0HA 2OZEA 3RS4A 2QP3A 2H92A 3AVPA 4O25A 4F93B 1OFTA 3RNLA 1NIJA 4ON9A 1E2JA 2CL0X 1WDTA 2IXEA 3AVTA 3VKGA 2QQEA 2IL1A 4QM7A 1HE1C 2FNAA 3I8SA 2CL6X 2AD1A 2A78A 4MKHA 5CLLA 2ZTSA 2OBLA 1N5LA 1N6PA 4JKIA 1ANKA 2B21A 2J45A 5AJXA 2QBYA 2WJHA 2D2EA 4LHXA 4ZCLA 5KSPA 2PLFA 2PL3A 1EFHA 2PX3A 3IIMA 3QE0A 1XNJA 3AVXA 1N6HA 1E94E 1RIFA 2ZJAA 4Q66C 3GLHE 4Z1MA 5L3VA 1ZIOA 2VF7A 1WF3A 2NZ8A 3HP1A 4ZV4A 3EPKA 2OHFA 4L9WA 3A1TA 3U44B 2WTUA 3DOFA 4KBGA 2REBA 4OI4A 4A0FA 1OPXA 2ZJZA 4PHGA 3IILA 3KXLA 3CUEF 2OCBA 3V9PA 3C5HA 2E87A 1KI6B 3RS3A 4ARZA 2G88A 5FPKA 5KPJA 3UPUA 2PEYA 1VDZA 1QZXA 1RFLA 2QGZA 2VEDA 1NN3A 1XMVA 2YWGA 4C2UA 1UPTA 2J0SA 4A8JB 3U7HB 3P4XA 2OESA 1P73A 3TNFA 5GJCA 4UXIA 4URVR 3EWSA 4FMBB 4L5BA 5CDFA 3NEYA 3W6NA 2UVQA 4M9ZA 5HE9A 3VX4A 4XWKA 1XTKA 1XCMA 1NBME 3R9WA 4HATA 4MYCA 5KSZA 3C5CA 4YMVA 4PC1A 2GNOA 2AN9A 2W0MA 4HAVA 3MWLA 1KGDA 4KXFB 1U0JA 1E9SA 3BIFA 3AH8A 4G5OA 2WICA 1QHGA 4RJLA 1QDEA 4NYMR 4DLUA 4IXMA 1OXSC 3CPJB 2IS6A 3RWMB 1E2IA 2XX3A 1KDPA 4Q9LA 4ZI3A 3ONWA 1FP7A 1SVOA 3WMGA 4OQMA 3PEWA 2AXPA 4DVGA 2CNWA 1PJRA 4CZ2A 4LC1A 4C0HA 4TLCA 4MUBA 4JIMA 4KLZA 3CWZA 5EP1A 1EWQA 1YZUA 3A1SA 1OHHA 2IWHA 4PAQA 1NMYA 3GD7A 3OAAD 1NF3A 4IXNA 3A6PC 3F0TA 4A0GA 1HYQA 2PX0A 4HB0A 1BIFA 1EX6A 1G8GA 3FKSD 3RDPA 3T1OA 3K09C 4TMVA 2P3SA 2ZYWX 3PENA 2ZSBA 2HLDA 1SVKA 3WYFA 1W5TA 3C4JA 3V4FA 4E09A 4EJSC 1U81A 2HF8A 2JEOA 5AJYA 1IY1A 2GZHA 4M4SA 2V3CC 1J8MF 1IJEA 5HR5A 2FF7A 4MRPA 1OH8A 3C14C 3NC0C 4JVLA 3T12A 3EX7C 1OYWA 3C15C 4NCJA 1XJ0A 4CIDA 4R71A 2GJAA 4XWOA 3RRZA 5FOTA 4BECA 2FSHA 2WHXA 4C7OA 2A2ZA 2WWWA 5BWMA 3TLXA 1ZCBA 1PUJA 3PG5A 4G5GA 1RKBA 4NBSA 4D80A 5LD2B 2J46A 1R0ZA 3CR7A 2XSZD 3KKQA 3KL4A 4I99A 3U4QA 3DEFA 3WYGA 3KZ1E 1YE8A 2BDTA 1VKJA 2ZJBA 3LWNA 3TQFA 4BLQA 3X1XA 2OCPA 5LDDC 4HLUC 3QQ5A 2VLIA 5FL3A 4JS0A 4DDTA 4JSTA 2JLVA 3DMNA 4Q1DA 2R6GA 4DCSA 3U7FB 1SVMA 3HR7A 1T0HB 2YJTD 4R7ZA 1ESMA 2W2VA 3GJ7A 1XFAA 5DI3A 2OE2A 2ZS7A 4NCHA 1W0KD 5TDHA 1Q44A 1W0JD 1CULC 1ZAKA 4LHYA 4B2IA 5KSOA 4JYBA 3NBYC 1S9DA 3B1VA 2BVNA 3P20A 4NDZA 4B2PA 1NMXA 3QBTA 4GT1A 5EP2A 1PV4A 2ERYA 2FSFA 4K8OA 1HT1E 2VHTA 3EC2A 4U02A 1E4YA 1LY1A 2RCNA 3SHFA 1WBDA 5TY0A 4LBZA 2Y8EA 1Z6AA 3MGCA 2X2EA 1W0KA 3MLEA 3IHWA 1M7GA 4BFSA 1XF9A 5FI1B 4DB4A 1E79D 4DLZA 1E2HA 3KKOA 2DWOA 1OIXA 5FOVA 4DDVA 4XVUA 5FBVB 1VMAA 4LY6A 5IRCD 5TXGA 3TH5A 2VPPA 1DAHA 1YZQA 3K0FB 3K1JA 1YQTA 2O8CA 4JBWA 4G0NA 5AR1A 1NMZA 3LVRE 3QF7A 1R0YA 1AZTA 1MRSA 2WV9A 4MGKR 3U6KA 2C98A 1LNZA 2JLZA 4A6XA 5FR2A 4PZLA 4BUJA 3KQHA 3ICEA 4IW3B 4CVNA 1CJTC 4A0RA 4EPWA 4RSGA 2JLRA 3QG5A 2GKSA 5P21A 1IXSB 2AXNA 3PEVA 2ZJOA 1VHLA 4QFMA 3PUZA 1J99A 1VPLA 1RVDA 1NNEA 2YYZA 1KY2A 2O8EB 3AVOA 3TE6A 2A5DA 3U3OA 1F3OA 3B9QA 2ZS9A 3A1WA 5J4LA 1GL9B 4S2EA 4TSFD 2OO7A 4P4SB 3IQXA 1TADA 1EX7A 4TL8A 1JEDA 1AKEA 5ELXA 2DFKB 2J7PA 4E5UA 1UAAA 4F4CA 1AGPA 5EE5B 4Q4LA 5D3QA 1F60A 4O2LA 4JKYA 1SXJD 4F4JA 4M1SA 1LVGA 3R8FA 5CK5A 2Z4RA 1L8QA 3WMEA 3TSWA 4L4UA 4LYHA 4Z51A 1OFIA 2XXAA 4LOAA 4B6FA 2ZRNA 2H7VA 3UWKA 1XD2A 4BLOA 5AUNB 2TMKA 2QTHA 1HUQA 2NPFA 2BHRA 3K8YA 4A2WA 1C9KA 5K8UA 4B2LA 1W5SA 1D2EA 1CJKC 4RKFA 3R7WA 2CCKA 4JMPA 3KQLA 4RD4A 3NH6A 2WM9B 1GNQA 4UQOA 1XDBA 3THOA 4ABYA 1VIYA 3WHLA 3AUYA 3VR5A 4HDCA 3GEEA 2Q3FA 2FDCA 2E9SA 2JJ2A 1VG1A 5AUQA 1OH5A 1W7AA 2OAP1 3BB4A 1ZD1A 2Q9CA 4B3CA 5HTKA 1OT3A 3B1YA 4HZIA 2J5XA 3ZQ6A 2EFCB 5FPTA 3SC3A 2LKDA 1CR4A 3VU9A 2BM1A 4LJ6A 1R5BA 1TPZA 5JS7A 4URZR 4M9XA 3C7KA 1P62B 2R6FA 1DAGA 1FP6A 4LRWA 4WXPA 1QVAA 5G3ZA 4A1FA 621PA 5TMPA 1G5TA 1JJVA 4FW9A 1G8YA 4JLAA 1RPZA 2GXAA 1G7CA 1DOAA 1EK0A 2ORIA 1XPRA 3PXGA 3NG1A 1Z8FA 3HR8A 2A5FA 3DO6A 3UWOA 3U6BA 2QP4A 2VQSA 3LQRA 3A1UA 3ZZTA 1UADA 4C0LA 4BQSA 1G4AE 4EAQA 2W2XA 2FSGA 2P5TB 1NLZA 1XEWX 2Z83A 4XD7A 3X1DA 2ODNA 2AR7A 1TQ6A 2QE7D 1IN6A 1R5OA 2KBFA 1XTSA 2IEZA 4YMSA 1IXZA 4C0BA 3GLFA 3X1YA 3FOZA 2QAGA 3GMTA 1N5IA 2FX3A 4HYYA 3WHKA 1TQDA 1A1VA 4DT1B 2J3EA 1OV4A 2ZI9A 1D8TA 1TQ4A 3CX8A 2XITA 4A0HA 5FBRB 1XJCA 4DSTA 3K53A 4IEIA 5EP4A 4LJYA 4RFSA 1R5NA 1G3MA 3VNVA 2ZJ2A 2QRNA 5JS8A 2JDIA 2QMOA 4KHZA 4PSKA 1G5RA 3AGPA 4AD8A 3WMFA 1N6RA 3ND8A 4Q4AA 1NG9A 5JCZA 3AB3A 2L0XA 4W7SA 4B32A 5TB5A 1NL3A 2GVZC 3GLGA 3CRW1 4G5QA 4UKDA 4AKHA 3W5JA 5KUTA 2FV8A 4NTZA 2W00A 2GHIA 4B74A 2W6JA 2WWHA 5IDVA 4AG5A 1CRPA 3KX2A 4NCNA 4QGFA 3QKRA 4OQLA 2QUZA 1G6HA 1JR3E 2QTFA 4I1SA 3KQUA 1D2MA 1OFUX 5FTJA 3AEZA 2JASA 5C2JB 1T3HA 1KI3A 4YDSA 4N1AA 4RKEA 1U0LA 5DN6D 1XXHB 2N1BA 2X8AA 4WA7A 2EWVA 4RFSB 2MMCA 2YNMA 3GJ3A 4Q4HA 4MH0R 3B82A 3FHCB 4A2QA 3AKEA 3J81k 1E2GA 1KDOA 1NLFA 2J0UB 3TK1A 3OEHD 2QSZA 1TEVA 4CT5A 2IA5A 4V03A 3PIRA 5AUPB 2DFLA 3E1SA 1P2TA 3RAPR 2GEUA 1RJ9B 2WSSD 2EYQA 3R20A 1YZLA 4PANA 3ICQB 2FH5B 5LB4A 3I3SR 2QQ0A 4LYAA 1C4OA 3K0EA 1WRBA 3IPXA 5DN6A 4Q01A 1OYYA 3SJCA 3B2EA 1UF9A 4MRVA 2OFOA 2QORA 5B2ZA 4TYNA 1YRAA 5L3QA 4MGZR 4M1KA 1DAEA 2QP9X 3BRWD 3U5ZB 4HLCA 1SVWA 2RGNA 1MH1A 2F6RA 4URYR 2V54A 2NQ2C 1TU4A 2XZOA 4P4UA 3RS5A 4FWIB 1P9RA 4PFSA 2IW3A 4DRZA 1FMJA 1XXHE 1DAMA 2ZI6A 3IO3A 1S3GA 3HWSA 1T3SA 2WSSA 2O8FA 2GA8A 1BOFA 2P2LA 4M21A 1AIPA 4IHQA 4NU0A 1E2FA 1E2LA 4PAOA 4DEXA 3UATA 2B8WA 3BAFA 4PPFA 3AM1A 5BN3A 4DXAA 1QBKC 2QEQA 4EKDA 1OSNA 2F1RA 4PQYA 5L8VA 1G7TA 4MDEA 2ZSFA 1UEIA 4OI2A 5HZKA 3QENA 4EPTA 1LB1B 3THWA 4NYJQ 5L3QB 3T35A 3QVUA 3SNHA 3NWJA 3RHFA 3Q8XB 1OXVA 3LBIA 2XB2A 3THXA 3OE7D 3B1ZA 1E9AA 4JVMA 4TMZA 1GZSA 4Q03A 3DM9B 2JIZD 5JSZB 5HZHA 4D81A 4TTPA 1M7BA 2JLYA 2NG1A 3CO5A 5FI0B 3I8XA 4EFMA 2XGJA 3I62A 4TYQA 1PLJA 3BD9A 5AJWA 4YQFA 1MOZA 4TTRA 1YZKA 4UNNA 3O8DA 2AFIE 3AUXA 4DSNA 2O0HA 2C78A 4B34A 3KUDA 2ZRKA 4GSYA 3ZS8A 4Q18A 1IN8A 4PPQA 8OHMA 4IDOA 1B0UA 2IT1A 3LXRA 4URUR 1HE8B 2QG6A 3Q5EA 3RVBA 2CDNA 2YZ2A 1KSGA 4AY2A 2V4ZA 4KCGA 5KNCA 4XVRA 5J4KA 3DOEA 4M8NE 4A92A 2QT1A 3DMDA 1G9XA 5EXTA 3CONA 4LPSA 5KHOC 4WZ6A 221PA 1Q57A 4E03A 1SGWA 1EFTA 3K09A 3LW8A 2GWHA 2UZ3A 4ASUD 3NBXX 1N0WA 2RHMA 1DAKA 4EJSA 1GAJA 2ZI7A 3KJHA 3QF4B 4DDUA 3KXKA 4DWJA 1N0UA 3G5UA 4YXWA 1E2MA 1NVWQ 1YVDA 4IDQA 2H1LA 3SI7A 2BWJA 2CK3A 3KKPA 1E99A 1II0A 3W3ZB 1AJEA 1E2KA 3B6EA 3BGWA 2PEZA 1DARA 2JGNA 3H4MA 3RSOA 1N6LA 3QXHA 4BLPA 3E5HA 4Q1FA 4Q4JA 1CEEA 1FPMA 1XWIA 1YHNA 1G64A 1KNQA 1R8QA 1H8EA 1ZUNB 4KJZA 3ZJYA 4PZZA 5F9HA 1NJGA 3T1VA 4OL0A 3PV0A 1NG1A 2RMKA 1P75A 5JRZA 5JEEA 3GLIB 1AS3A 1II9A 3AP1A 3CF2A 4HLUA 1US8B 2ZSDA 4TL7A 3RS7A 3SU8A 2D62A 2QM7A 2XOKD 4TL9A 3PQCA 3LX5A 3QUSA 4QL3A 3NVAA 3GEIA 2GXSA 1W46A 1V43A 3A4NA 4KBFA 4DZZA 4KYIB 3RANA 3HU2A 1D9ZA 4NCIA 1A5TA 1GKUB 2YOFA 3LLUA 2DPXA 2BBTA 2OILA 2ZEJA 721PA 3W5IA 2P5SA 2WKQA 5DISB 4Q21A 5HCNA 4HUTA 2BJWA 2YVUA 4HDQB 1GFIA 1HY3A 3PR1A 3ZLJA 5CJPA 2REXB 2R8RA 1SHKA 3K9GA 1O87A 3F5FA 4HLDA 3KTAB 5HPYB 4Q9IA 1EFCA 1NBMD 2IYYA 2RKOA 3SYKA 5H8WA 4JLMA 2BKUA 1Q3HA 1FX0A 4K81B 2IYWA 3GLIE 4JLBA 2CHQA 5HCIA 3TBKA 4DB2A 3CRRA 2WIBA 4Z8YA 3PUYA 4A9AA 5CYPA 1RRCA 3QIAA 1M74A 2VO1A 3P1JA 1QF9A 1U8YA 5M04A 3LX8A 1E1RD 1KIMA 5FOUA 3CX7A 2QTVB 5FTKA 1H8HA 5EUMA 2DBYA 1II8B 3LBNA 4FWTA 3GFPA 1M2OB 1SKYE 2G6BA 3DKVA 5JLJA 4RD6A 1E2PA 2FZ4A 2GCPA 1IM2A 4HZUB 1KO7A 3EARA 3G0HA 2KI5A 1E0JA 3QVVA 3NDPA 4M9SA 4QBIA 1XTRA 1T9HA 4OKSA 3GP8A 4C0QC 3IBGA 3LBHA 3M1IA 2IS4A 2NO7A 3AF1A 2ORVA 3B7GA 3DM5A 2PCLA 3PITA 5E7JA 4BEBA 1S3SA 4IKEA 2FPKA 4CEJA 5KSYA 1KKLA 1TUIA 1A82A 2VHQA 2J9RA 1S96A 1OIVA 1N6IA 1ZNWA 2BKEA 2EYUA 2QY9A 4PC3A 1SQ5A 4XTCS 3SN6A 4Q19A 5FR1A 2OBMA 3SBDA 4OHYA 2YINC 3KJGA 1OB2A 1X1RA 1ZM4A 4Z54A 2A7QA 3KQNA 1YR8A 2BMEA 1KZ7B 4U00A 3AKYA 1KI7A 2F3RA 4GOJA 5EE3A 4RZ2A 5C46F 3T1TA 5KO2A 1COWD 1G3RA 4OHVA 1XCGB 1E96A 4GBMA 2QBYB 2VP4A 1M34E 4HEJA 1J90A 2J7KA 4PPNA 5EQTA 5DHFA 4M1OA 2XAUA 5SZIA 1G291 1KMQA 2ZU6A 1K5DA 3ASYA 1KMHA 1A7JA 4MQBA 5JHHB 2Q9BA 4IRUB 3LLMA 5KYKA 2VA8A 3L0PA 2O52A 3CPEA 1NSFA 4EUNA 4RFVA 3TR0A 1CP2A 4M1WA 2NZJA 4NPHA 4RD2A 4ARZB 2QI9C 4PO9A 2YKGA 3SFZA 3OEED 1VCIA 1DPFA 4ACAA 1Z0FA 2NO1A 1TMKA 5CM9C 3ZDQA 4G5SA 4LZZA 4J0QA 4F92B 1DO0A 2F9LA 4JBXA 1Q1QA 3HJNA 5F3WB 1X8JA 3VAAA 1DAFA 1FNMA 4PTLA 4AYXA 2Q9AA 3K0CC 1G8HA 3NHAA 1ZM9A 3REGA 821PA 1X86B 2NTYC 2NPIA 4D2IA 3AQ4A 4HDOB 4P31A 3L0OA 4W9MC 5JJIA 1EGAA 3RC3A 2XZLA 1OFHA 1Z47A 1A4RA 5J4YA 2OCYC 1MRNA 5B30A 4HAUA 3LFUA 4LJ8A 1HV8A 4GNKA 3FMFA 2RGDA 2VSOA 2Z6VA 1ZU4A 3IUYA 1Z83A 1XEXA 5GJWC 2AX4A 3BH6A 1ZCAA 2YWHA 3LA6A 2WBLC 4M1TA 3RRYA 4BASA 1GM5A 2GJSA 4JT2A 4RZXA 1P60A 2PMDA 1N0VC 3FKQA 3AF4A 2BMFA 5F2EA 1ZIPA 3BE4A 5BYKA 1N25A 3OAAA 3U3JA 4R98A 2REOA 3MD0A 4JZKA 4IOLA 3THYA 2IS1A 5CDFE 1CS4C 3FKSA 4B35A 3V4RA 3KB2A 3AVUA 2EQBA 2ZAOA 4YLGA 5JECA 1T91A 2VF8A 2ZJ5A 3L0SA 1G1MA 2O8BA 2XTZA 1CJMA 1XCPA 1ZC3A 2B7CA 2IHBA 3I4LA 4LC0A 3WBJA 4RD3A 3W8NA 4YONB 3LD9A 4GRAA 1JJ7A 3EIHA 1E1QD 4E22A 4B71A 4K46A 2V1XA 5FPHA 4D4LA 1NP6A 4XSGA 4Q9JA 1BYIA 5CIQA 1XD8A 1W2GA 4RD0A 3TVTA 1KO8A 1AM4D 3ZQJA 3ZD6A 5AJZA 2PMKA 3M6AA 1JAIA 1KK3A 2OUKA 3IIJA 3A58B 1VHTA 4WZAE 4X8OA 3CH4B 2ZSEA 1Z28A 2I4IA 3LV8A 3IKJA 4DBLC 5L3SA 1P6XA 1AGRA 1ZM2A 2H5EA 2ZI5A 4FMDB 1NKSA 1T6NA 2WOOA 2XSZA 3AP2A 3K0SA 1OH7A 4C7OB 4CEIA 1E9BA 2EW1A 2FU5C 2WJVA 2GILA 4G1UC 4UNPA 1KDRA 1ZUIA 1N5KA 2MSCB 2W58A 5GJBA 4UXJA 1TQ2A 2C95A 5JWHA 3E70C 3GJ8A 2LWIA 3U4QB 3VKHA 5H68A 4A6PA 4FD2A 4NONA 4MDFA 3D3QA 1LS1A 2JJ1D 4V02A 1FFHA 2YV5A 2PBRA 4QJ3A 4DCUA 1R0XA 3MJHA 5E7IA 4FMDF 1GUAA 2KB0A 3AGQA 3MMPA 1W0JA 2FPLA 4PC6A 2RGAA 1JXMA 2G3YA 1UBEA 3N5CA 3BFXA 5DI3B 1XB2A 2A5JA 4JL5A 4D4MA 2GF9A 1I4TD 2FEMA 1Q22A 3GFOA 2BBOA 4BFVA 3OIWA 2QMHA 3CPHA 3MRSA 4ZPXA 3TAHA 1D2NA 2ATXA 4WXRA 4QNRA 1EG7A 1ETUA 3A37A 1GKYA 3K9LA 3SS8A 1YU9A 2JJ1A 3MWJA 1Z6GA 4TMXA 1JPNA 1W48A 3P4YA 1UEJA 2BJVA 4MRSA 2FE4A 4F7WA 4M2LA 3NDBB 1XMSA 3IEVA 2PT7A 1G41A 3GJXC 1W2HA 4EIWA 2VL7A 1RYHA 4KAXA 3TW8B 5H1YA 4X8HA 1E79A 3HU3A 1NIPA 1HURA 2C8VA 4NHOA 4F38A 3W90A 2GBLC 4CT4B 3KFXA 4B3XA 4QRHA 2R62A 3QSYA 3AVYA 2WWGA 2Z0MA 3W8RA 1EFRD 3HDTA 1Z0KA 5LBIA 1E6CA 2Z5FA 2JLUA 1MABA 3S1AA 3VNUA 4ZDJA 2EWWA 2IUSA 4UJ3A 2O8CB 2IYLD 3B78A 5J4HA 4A8JC 4O0MA 4OYHA 5DE3A 5FBQB 3PFIA 2GEVA 3R9XA 2EVWX 1FOEB 2QMUA 1G3QA 4NZYA 1WBBA 1S9HA 2P65A 4OBEA 1RYFA 2IYSA 4DSUA 4F91B 1XRJA 2G9NA 4QBGB 4V0KA 3ZD7A 2J0VA 4Q00A 5IK2D 2YWEA 1E2DA 2JA1A 4FMCB 4TLBA 5J4VA 4Q5IA 2XNDD 3CLVA 1S8FA 5DYIA 2ZU0C 2X1VA 4Q9HA 1P2UA 4IVPA 4JLJA 3X1ZA 1TUEA 4IVQA 2ZRGA 1KYIA 2QT0A 2RB4A 2PT5A 4M53A 2H16A 4QM6A 2J1LA 4MYTA 4TSFA 2HJVA 4TYPA 4N3NA 4PZYA 1Z0DA 1MABB 2ZVPX 4URWR 4HAWA 2FGKA 2BMJA 1DELA 1F2UA 2Q3MA 1XEWY 1KSFX 2B92A 1QG4A 3PUVA 4US1R 4MUAA 4QBHA 4OI1A 1GILA 1L7VC 4PQRA 4DDWA 4DIEA 1G8PA 5B64A 1Z3IX 2YC2C 2IXFA 4WW0A 2A9KA 4EQ6A 1SXJA 1T8UA 1GRRA 2G1KA 2QPAA 3BB3A 3OZXA 4D0NA 3B8HA 4D26A 4C9BA 2UKDA 1AQYA 3K9HA 3MFYA 3T5DA 3PJRA 3UANA 4FN5A 4Q7MB 3GCGA 2F43A 3VR2A 5FL7D 1HQYE 2WKPA 1GL7A 1SKQA 1U9IC 3BS4A 4IEEA 4JSYA 4PO1A 5IT5A 1OXTA 4LV8B 5SZHB 1WQ1R 4RCZA 2XXAB 1KNXA 4QHYA 2FEOA 3AKCA 3B1XA 2HEIA 1I2DA 3CKLA 5DIFA 5SZKB 3VHXA 2OSBA 5HE8A 1XD2B 1NY6A 1QHHA 4Z8XA 5A0FA 2ZR7A 3TGPA 2VP6A 1KI1A 4PC2A 4HUQA 2CLCX 1F2UB 3VQTA 1EXMA 4JYCA 1JR3D 3EA5A 3IBYA 4ZDKA 5KDLA 3ZGXA 1VG8A 1KZGB 2HF9A 2ZE6A 4B6EA 4QHTA 1G6OA 2RGEA 3OIUA 4RZUA 5KPDA 3GFTA 3R7WB 2X77A 2ZRFA 4B3GA 3BERA 1GITA 2Q3HA 3SQXA 4BWYA 4LBYA 4B3BA 1F2TA 1JNYA 1WE2A 1HA3A 2F43B 4UNRA 2DB3A 2ZRIA 4NL4H 3TUJC 3I61A 2CE7A 1U8AA 1LF5A 2YC4C 1OJLA 1XD9A 5LD2C 1SULA 1PZNA 3L8ZA 2ZM5A 2FFHA 3ZH9B 3AVVA 4TMTA 4ZCIA 3NBZC 2ZUCA 1KO4A 1S0UA 1QG2A 1U99A 4W5JA 1CRQA 2JATA 4JT4A 2GCOA 4Q1CA 1XMIA 3TAUA 2LKCA 3EIEA 3VU9B 1Q1BA 1XBTA 3CBQA 1E9DA 2IYZA 3ECCA 2VH5R 2IK8A 1DO2A 3K70B 5SZJA 1EESA 3LRPA 2ZE7A 5FUWA 2NO6A 4A4DA 5JHGB 2C9CA 1J2JA 3IEUA 1JR6A 5AJVB 2FFBA 3ZZ0A 4NH0A 4WVFA 4LCBA 5FPYA 3EASA 1NVXQ 1JXOA 1FZQA 4I1VA 2RHDA 4D6PA 1YR6A 4V0OA 3Q7PA 2WOJA 3SEAA 4ZKDA 3TUIC 1Z0IA 2W6ID 4NE2A 2QE7A 1E0KA 4FCVA 1NSTA 2FSIA 3NH9A 4NYJR 4LX0A 2C9OA 4IOMA 4TT3D 3GEHA 1E2NA 2OBNA 3TSOA 4KSBA 4AWXA 2NGRA 3GLFB 4A2PA 1VYTA 2QAGB 1R0WA 4OK5A 4AI6A 2PLRA 2WSMA 4IOKA 3VFDA 2ZRPA 3W6OA 4C0JA 2PJRA 1MO4A 4W5WA 4XVQA 4AIIA 1XP8A 1T4GA 2MMGA 1G16A 4TWZA 4BFZA 3CF0A 1NLYA 1VECA 2NIPA 3AF3A 4EDHA 2VSFA 2IXGA 1NN5A 1ZRHA 2WZQA 4A36A 2VP5A 2N46A 2OT3B 4Q4AB 5EE0A 1QHSA 1ZJ6A 3NXSA 3EIQA 3OF5A 5D3MA 5CB8A 3GLGB 1DTSA 3BWDD 3KJIA 3BJIC 2G1JA 2OFWA 3WY9A 1OKKD 2QRZA 2GTPA 2BBWA 3SZRA 1YZNA 4BZPA 2QPTA 3KXIA 1U8ZA 3QXJA 5B57C 1IY0A 4OHWA 4OQXA 1QVRA 3LXXA 4R2IA 5CB6A 1LS6A 1MT0A 1Y3AA 3QKRB 3FHOA 2CHVA 4OI0A 2DFNA 4V0MA 2HXSA 3H2YA 4TMKA 2J0QA 3KDSE 4AC9A 3OEHA 2DCUA 1S2MA 3N70A 1P9WA 4Q4HB 4HB2A 4R2HA 2FPMA 1EWRA 4DLYA 4JLPA 4ZDIA 5CM8B 1Z6XA 3B9PA 5K8LA 1GTVA 4GZMA 5ANRB 2WWXA 5BQ5A 2IF0A 4KV9A 2ZI3A 3OESA 3RABA 3IHLA 2DHRA 4FIDA 2J59A 2V6JA 1IQPA 2CMKA 1R2QA 2DWPA 2F55A 4BFYA 3VX3A 2WJIA 4NYIR 1ZU5A 1G7SA 3KFVA 4BFUA 3LQQA 4Q7JB 1W49A 2HT6A 1XZQA 5CYOA 1P3JA 2AD5A 4JLVA 2HYDA 2ZRDA 2A5YB 2IYUA 3WXMA 1VCMA 4C30A 1TEXA 2RGCA 3RC8A 2C03A 4LBVA 1AA9A 1S1CA 1XTQA 2V7QD 2ZSAA 5JCPA 5F9FA 3WP1B 2IS2A 1A2KC 2O8FB 5JWOA 2FFQA 1CTQA 1IN4A 2IUUA 3WYAA 2WMNB 4JVSB 4CRWB 2ZR9A 2CEAA 3SBEA 2GJ9A 3QI2A 4H1UA 4EPVA 3ADDA 3FHTA 4BFXA 3Q85A 3REFA 5EXXA 2X19A 4GP7A 1UDWA 1U94A 3OE7A 4TYYA 1M1YE 1U2RA 3ADKA 5A5GA 1NVVR 3THWB 1BKDR 1ZVQA 4US2R 2JIZA 1BMFD 3R9IA 2DYKA 4BRUA 4DIDA 2QPOA 4PR0A 3THXB 4GL2A 1IHUA 2WIAA 3W9YA 3X1WA 4BLRA 1SVSA 3NBFA 1K6MA 1MKYA 2OM2A 3WNDA 4L9SA 1TTTA 3I5XA 4UJ5A 3PEUA 4OQNA 4GI7A 1W4RA 2D74A 2B7BA 4TLEA 2FJUA 4AYWA 2CVFA 4H9GA 2IUTA 1PVOA 2ZI4A 4PPGA 1AS2A 2R6DA 4RD1A 1UBCA 521PA 3ZIAD 3TUZC 2A5GA 3KUCA 1BMFA 4HSEA 3T5GA 5JI3E 3JVUA 4BLSA 3QG1A 2DR3A 3KKMA 1Z2CA 2XTMA 1LFDB 2DY1A 2ODEA 4IOJA 2J41A 5E95A 3CR8A 4ASUA 2B6HA 5F98A 5K8TA 2CCGA 3B5JA 4C0AC 3O8CA 4XTRA 1TU3A 2W0SA 3K0AA 1F6BA 3ZZUA 3MJRA 4QNMA 3KKNA 4BPBA 1QHNA 4A82A 5G53C 5LPNA 2ZXUA 3RRNA 2AK3A 1BH2A 1P5ZB 4KFTA 3A8TA 1SHZA 1WP9A 3EAQA 3UMSA 4FI3C 4EJSB 4CGZA 3SFVA 1GOTA 2JJ8A 2EU8A 2KWIA 4B43A 2CXXA 5EE9A 1ZW6A 2ZRMA 4HLQB 1FUKA 2CVHA 3M0EA 3BORA 1A2BA 1IJFA 2GXQA 2YHSA 4LI0A 5J47A 3HU1A 2CJWA 5G40A 1KI8A 4PHFA 1WXQA 3QEOA 3V00A 3SYNA 1Z2AA 2YOGA 1P4SA 4Q4JB 4MKFA 1ELOA 3EZ2A 4KSCA 4TZ6A 1R8SA 1KAOA 4I1UA 1GNRA 3W3AA 3KJEA 4DHEA 5B58C 1JAHA 4ZIRA 2K5UA 3NHBA 1KK2A 1YR9A 4XOIA 2XOKA 3DKPA 3T61A 2WKRA 3GLHA 5KNDA 4DLTA 5FOWA 5DO9A 3I5YA 1YZTA 5E4FA 2ODWA 1GRNA 2RGGA 5J5CA 3W34A 4CDGA 3N2EA 1G19A 4CYMA 1SZPA 2GVDC 1E3MA 2GK6A 2CJWB 1RE0A 3T1QA 4C4PA 1NN1A 1DVRA 3BFVA 1FNNA 1O3YA 4Q7KA 1CF4A 1EFUA 4IFEA 1XX6A 1ZNZA 4W5HA 3U3KA 1L4UA 2QAJA 2OEPA 3FFBA 4EFLA 4D82A 3EZ9A 2EFEB 4TQAA 4ZCMA 2RH5A 3RS2A 1W36B 4PAMA 2IEYA 1T5IA 3FDIA 1KJYA 4KVGA 4Y0AA 1TF7A 4B3DA 2IF2A 3AF2A 3LO5A 1NBMA 2ZRAA 3QJYA 1KI2A 4JLOA 2D2FA 3FMOB 4WIAA 1R6BX 4RVCA 1NKTA 3RSLA 3TKLA 4BZQA 1Q20A 3TIFA 2JLWA 3WNBA 3W6PA 1MO3A 4GPTA 4HI0E 5E3HA 5EP3A 3BFKA 1WMSA 3ADCA 4LJ4A 1FX0B 5KDDA 1HT2E 5JWRA 1E1RA 3B85A 5GJVC 3U44A 4IFBA 1KO1A 1JI0A 2QNRA 1BYUA 2GBLA 4JBYA 3FB4A 1DS6A 2WWYA 4Z1MD 2BC9A 4B48A 1Z0AA 3VR4A 1IN5A 1KI6A 3L2OB 3I92A 4LPKA 5EE1A 4KYUA 5AUOB 2E1RA 1QHIA 3CH5A 1M8PA 4A8JA 1VTKA 2N42A 3FMPB 421PA 2QENA 2PZFA 1FTSA 2ZRLA 2ZYVX 1IONA 1DADA 2ZREA 4MKIA 1DG3A 4IDNA 4WAUA 1G21E 1X6VA 4HAZA 5FTMA 5JJKA 5JRJA 3U3RA 4BGDA 1FL9A 3P26A 1CU1A 4KLNA 4CEJB 5JJLA 1U0HC 2PJZA 1P2VA 4JJZA 3B1WA 4N0EA 2RGNC 4DEYA 2ZJYA 1DAIA 1Q3TA 5JBQA 1K8RA 1KK0A 4V0LA 5G3YA 4I4LA 4LK2A 3MG9A 2CBZA 2VHJA 4YMTA 3UG6A 4ESVA 1COWA 2DWQA 3TVDA 4KITB 3PEYA 1D6JA 3B60A 3SR0A 1KO5A 4FCTA 4BE7B 2QMEA 3BBPA 3R8CA 2OLJA 2ZRJA 1U90A 4MGYR 3VTKA 1N6NA 2VP9A 3D8BA 1MO5A 4UXHA 1G8FA 1Q1ZA 1CR0A 2D7CA 4DLRA 4LV6A 4PO8A 121PA 1XJQA 4NCKA 4B47A 1LTQA 1ZM3A 3RLFA 1GDDA 4TQ9A 2D3WA 3ZS9A 1XTIA 2ZVQX 2CNWD 1AQUA 1VYVA 2VP2A 3A1VA 2W2TA 1U9IA 4A15A 1UM8A 3EZFA 3GJ6A 1KMHB 5DNYB 1OHHD 5KOYA 2ONKA 3BC1A 4OHZA 2RGBA 3H1TA 4LWZA 2QROA 3OEEA 2C2HA 4L15A 1SVIA 3CM0A 3UG7A 2AL7A 1ZINA 2AWOA 1N5JA 2HLDD 1GVNB 2BMDA 2GJKA 2HUPA 2C99A 2GF0A 4CW7A 3C41J 1Z22A 3L82B 3FTQA 4M0LA 3SJZA 2RGXA 1XTJA 3I72A 4TN1A 3KQKA 4KFSA 3GPLA 4DKXA 3VR3A 1G5PA 3AVWA 2ERXA 2KJQA 4II7A 5IHPA 2EFHB 3DL0A 2MSDB 5IF9A 1OW3B 2ZAMA 1GG2A 2VSXA 5KNBA 1I4DD 3PCRB 1RZ3A 3N2IA 4Q48A 3MAAC 2VYFA 2C9YA 5FUYA 1CBUA 2HDNB 2ZITA 4ESHA 3U3MA 3O8RA 1ZNXA 4GMDA 2BV3A 1M6NA 1Q0UA 2ECKA 4LHZA 1DBSA 4P3YA 2H17A 2ZANA 5DHAA 1KKMA 3U60B 3PVSA 2GESA 1XEXB 1IBRA 2VBCA 3SYLA 4DCTA 5JMTA 2FFAA 3QKSA 1AN0A 1HH4A 2AWNA 5EZ6B 3NC1C 1ZBDA 2AKAB 4ILEA 4Y0VA 1R7RA 5EJEA 2JLQA 4LBWA 4G3XA 1P72A 5JEDA 3THYB 2AFHE 2ZR0A 1KJWA 2H18A 1HEIA 2ATVA 1I2MA 2G77B 4H1VA 3SDZA 1I4LD 2QSYA 5FUVA 1W4CA 2O8BB 1E1QA 2XB4A 2VTKA 3CF6R 4L8GA 1JALA 4M1MA 2R65A 2G0TA 4LJ7A 2QU8A 4QKQA 4YMWA 1VCNA 1YZGA 4OK6A 2F7SA 1VYUA 2NO9A 3QEJA 3QKSB 2IYVA 4NYMQ 1J7KA 1T3LA 1X3SA 2O5VA 2ZRCA 4LSGA 4CEHA 2ZUDA 3EG5A 3I73A 1F5NA 1W36C 1UBGA 1TNDA 2PZEA 3C16C 3D7MA 1KOFA 3K0FA 1KY3A 2WMOB 1V5WA 4ITRC 4I1OA 4LDJA 5E7MA 3TRFA 5L3SB 2XZPA 3E2IA 3HYRA 5DH9A 2PCJA 1J70A 3AP3A 4CEIB 2H8KA 3MWYW 5TV2A 4URXR 4WBSA 1MR3F 1VG0B 2R6CA 3NKVA 4OJQA 2OCAA 4FCWA 4QOSA 1FQKA 2KSQA 4PSAA 3IGFA 2AKYA 1HQCA 1T5LA 1KI9A 1G3IA 1E0SA 2WPDD 2OV2A 2BCGY 3ND9A 4DLXA 3D6TB 1ZD8A 4DC9A 3LAWA 3BOSA 4QJ4A 3U7GA 4YDHB 4IDHA 5BXQC 3EPLA 2O8EA 4JLNA 4CEHB 1ZP6A 4AKGA 2C77A 1ZC4A 3BB1A 1Z06A 4AKIA 5UKDA 1P61B 2ZQ5A 3VR1A 4G01B 2D7DA 2JAQA 4P4SA 3Q5DA 1L2TA 3NEJA 2ZRHA 4D0GA 4U7DA 4LGMA 1NVUQ 4DLSA 2VRWA 4G5RA 4PHTA 4PC7A 4L16A 1YRBA 5FBWB 1ZM7A 2ODBA 2WPDA 4MGIR 3FGNA 5TVKA 4KODA 3SOPA 1XPUA 2R9VA 4UNQA 2ZS8A 5G41A 2ONJA 5K8IA 4GP6A 2J7PD 4QG7A 1H65A 1DG1G 2BBSA 2Z4SA 1CLUA 2ZE5A 1G17A 1W4AA 1FMLA 1YR7A 1G7RA 2G83A 3D31A 2IHYA 3I32A 3HPRA 5HKKD 1EFRA 3H0KA 1CIPA 3UKDA 3F8TA 1KTVA 4QBFA 4CF7A 2I1QA 2FZLA 5EZ5A 3QKUA 3A36A 2HCBA 2Z43A 1TL7C 2D4HA 3UIEA 2WAXA 4PXAA 3S1AB 1IXRC 1WCV1 3G82C 1ZMXA 1CJVC 3X2SA 4OQFA 1B23P 3Q9LA 1E0AA 1RRFA 4FMCF 1ZYUA 2HV8A 1UKYA 4GMXA 4HB4A 1Z0JA 4LHVA 4Q47A 5IK2A 3EPHA 2GDJA 2XNDA 3UXMA 5DI9A 1TX4B 3JVVA 5CITA 5HKKA 1ZD9A 3SHWA 1KHTA 3O8BA 1GNPA 3BXZA 5DGXA 2HT1A 3EW9A 1E9CA 2BEKA 1M7HA 2F1IA 2FWRA 4N0DA 1OXXK 1QHXA 4B75A 2X2FA 1BS1A 1E2QA 2XJ4A 4PQFA 2JJ2D 4AURA 1GWNA 4IDPA 3CNNA 4OK3A 4NKRA 4PHHA 3OIVA 4XJXA 3OFND 2C96A 5EXPA 3QPVA 4B73A 5C4MA 2PH1A 1UKZA 4DCVA 4DLWA 1X1SA 1OLOA 2ZYUX 3PUXA 2ZE8A 3F3YA 1N3BA 2FG5A 2JLSA 2CL7X 5GVRA 3CRVA 5GADl 2GAAA 4Q1AA 4MYHA 2GZDA 4R9UC 3FFAA 1C1YA 2SHKA 3K70D 4P33A 4GFDA 4EQ6B 1SXJB 5FBLB 2P6RA 4KFUA 4ZI2A 3K9NA 3SQWA 1Z6TA 5FL7A 3VMFA 2FA9A 2G0NA 4EFNA 2V9PA 3JZMA 5JZVA 4EPYA 4QC2A 4LV5B 3CNOA 2GETA 2V8OA 4POAA 5KDOA 1Z29A 2NMVA 1OH6A 3OFNA 3QPUA 4AKEA 3AV0B 2LCFA 2YWFA 1UBFA 1S4QA 2HCJB 3P27A 3QNUA 4D4JA 1U98A 1JR3A 5CJ2A 2CHGA 5DSZA 4XD7D 5A4JA 2OLKA 1QHHB 2H57A 3LDAA 1QHYA 4HUQB 4MRNA 4US0R 1DEKA 3LVQE 4UNSA 2FMXA 1KI4A 4DT1A 3L8YA 2QM8A 3DZDA 2I1VB 1P2SA 2IYRA 4FXPA 5JI2E 3DDCA 4X8MA 5GVSA 1TF5A 2Q6TA 2DFTA 4ACBA 3TQCA 1F2TB 1SXJE 1J8YF 3GQBA 2ANCA 3BH7A 3U2QA 1RRGA 3SJAA 3CX6A 1VIAA 2O0JA 4B33A 1GKIA 2P0EA 2OAQ1 3IO5A 4FINA 5H70A 3L43A 1YKSA 2JDID 4TL6A 3A4LA 1BO6A 3LY5A 4EPRA 3TR5A 3CIOA 2F1HA 1CR2A 3FYHA 5DYGA 4MRRA 3PUWA 2MSEB 2OG2A 3UMFA 4BZXA 1E69A 2V55B 2B8TA 4JJKA 2KBEA 4MYUA 4Q1EA 4AYTA 4QGHA 4V0NA 1RW4A 2GCOB 3WRXC 1ZNYA 1Q21A
chains in the Genus database with same CATH superfamily
4MVWA 2ZT6A 2QG9A 3I53A 3MTIA 4DDKA 3JQEA 2W83A 3V5NA 4LYJA 2H08A 1ZKMA 2GPYA 4MUKA 1E63A 2CMHA 3BHNA 2B4AA 2BFDA 1TM3E 3FZQA 4UBJA 4DLBA 1RNLA 2BYTA 1REQB 2C3YA 2OK7A 2RAPA 3CV3A 2BRUC 3H5TA 3TMAA 4ME6A 5AK3A 1MXFA 3U7EB 2CZQA 4LAFA 3NATA 2YNMD 2R97A 3FNIA 3V2HA 1Q1GA 1Y3DE 3R8XA 1MTZA 3SX0A 1SZJG 3H9EO 2J87A 2QRJA 1Y7LA 4JLKA 2J30A 2W2MA 1JV2B 3DT9A 5M2QA 4N39A 4RY0A 5CIWA 1W47A 3OPQA 4X65B 3TCXB 4QGGA 2QTGA 8OHMA 3MTGA 1WLYA 3ADBA 3BBLA 3PRJA 1K5PA 5CFQA 3OBIA 2WWIA 3OTHA 5D51S 5IJXA 4TV9A 2Q7OE 1P29A 3HCCA 1IWOA 1N2CB 1GL6A 3DNFA 3ZK9A 2FYTA 4ZT3A 1JSZA 1M0SA 1UKEA 1ZVKA 3E23A 3OZSA 3RHZA 4WZBE 5C1BA 3NX4A 4KGDA 3TFWA 3WHPA 4H59A 4YRQA 4X8LA 1DBVO 5C4GB 2OYRA 4U4AA 5JISA 3WRYC 3GLFE 1AKQA 2Q3CA 3PBKA 3FPHA 2GK7A 3Q3HA 5AOBA 1E32A 5FUXA 4O2RA 2XMZA 2CHEA 3E2MA 2JHPA 2WVJA 4AY5A 1CIVA 4F2HA 2N47A 1Z5UA 4DABA 2BM0A 2Q0SA 2UYQA 2BCJQ 1MPTA 4IDCA 4PVDA 4R16A 4P5PA 4S35A 4NV3A 2KQUA 1BHO1 2QLNA 1RWOA 4QAQA 5BYJA 3ZVRA 2XMRA 3OWHA 3L93A 4HJXA 2O3RA 4UAJA 4HVAA 2EFDB 5FPPA 2C7QA 2QPLA 1T3TA 3M4YA 1AB5A 2VPWA 2IE8A 2Y9PB 1YMUA 4XX0A 4DQVA 4KUEA 3PE6A 5HUQA 1BJKA 1UBRS 2O3TA 3LH5A 5L95A 4D8XA 1QZ3A 5JH7A 1KYXA 3KZCA 2KHZA 1XN1A 4A5OA 3AVQA 3JX9A 2JEYA 4AKTA 4BMVA 2FDXA 3H5LA 1I14A 1CY1A 2A88A 1WZCA 4WK6A 1K8XB 2FJPA 3FNQA 3I1YA 5CK4A 3OX4A 1L7DA 1YJBA 3RU3A 3O03A 1V26A 2WJJA 1DKUA 3P9QA 4JNCA 5EWMA 3MS7A 4C0KA 3BMNB 4H3HB 1X8LA 3ETLA 1L4KA 2QSUA 5LZ7A 3ZWCA 4CM8A 4HAYA 5FUMA 2CLSA 4HY3A 4HLNA 2OPHA 2DUJA 1A9OA 1OVGA 3CRQA 3NIBA 1OB5A 1T8RA 3G5MA 4P3PA 1SO8A 3HQ4O 2WFAA 3LQ1A 1KK1A 3LRXA 3WQHA 1FTNA 3P4UA 4D0LB 3OVMA 1YBHA 3C85A 4EGAA 5IM4F 2NP6A 2W2LA 1T6ZA 2V74B 4X7MA 5CVTA 4B5KA 3MCWA 2ZB2A 1XPJA 2OXFA 3L0CA 2ILVA 3IT2A 4JJ7A 5AJTA 4ZYLA 4RGBA 4B3JA 3H8WA 4R1UA 4ERNA 5KNCD 4CLHA 4R1OA 5EFZA 4QRIA 2I1WA 2P9JA 4UUNA 5JCOC 1ARZA 4DADA 2VWHA 3DP7A 2JD0A 2V6IA 2PZGA 3H97A 1ZH0A 4JVNA 5E3JA 4HAXA 1ZLYA 2FQQA 3EMBA 5FTNA 4JXZA 4N01A 2CD7A 4QT4A 1YQUA 3B1JA 4UARA 4ZMRA 3Q8KA 1NY5A 1I30A 1E1YA 2AMVA 3MSXA 4YO7A 4YCCA 5KTTA 2WUGA 3PPXA 1U5BA 2FOLA 3L40A 3EXHC 1QFXA 4FBGA 4ZO4A 2YS7A 3FSJX 1WMFA 1P7CA 2X0JA 2AK2A 4JX8A 1JZSA 2J31A 1YL5A 3FPKA 5KC9A 1KL7A 4OMDA 3O2QB 4O3MA 1SXJC 3DG9A 1UJ2A 4ALMA 3B6IA 4HNUA 1P1HA 3UMBA 1NN0A 1G5IA 1ZD5A 1Z8HA 4Y30A 1IOZA 3AUFA 5FOXA 4IPTA 2VHEA 3RROA 2PRSA 3DEKA 5E8RA 4F8EA 1FNBA 1QMPA 1VG9B 1XZIA 2AV6A 1C9EA 3Q9SA 1EQ2A 2ATEA 4KN9S 3D2CA 1JJAA 4QHSA 2AJBA 2XTNA 3LGSA 1GPMA 2DR2A 3TRDA 4E5NA 4M49A 3FWYA 2Y2UA 3RUAA 3FTFA 4IKOA 1T1SA 3QLVC 4L2IB 1RRPA 3JARA 1CY0A 1SVNA 1ODLA 2HPVA 5CT4A 2HJGA 1UXJA 2ZLBA 3R3VA 4HWOA 5K0NA 5IPFA 1QZUA 1MV5A 1WULS 1Y8CA 2AW5A 3A9RA 3E0XA 3W5VA 2W98A 3L0IB 2EERA 2GJ8A 1D04A 2VSQA 3COYA 3L4BC 4FFLA 4ZD6A 4L3OA 1XLTC 4R8LA 3SX4A 2JAPA 5CG1A 1ZZEA 4J3NA 4D25A 5CLQA 3ZDFA 1NR1A 1Z08A 2HUNA 3RO7A 3UXHA 1E4VA 1LK7A 4H31A 4X45A 1FW6A 3IPYA 3OT1B 2WFZA 5DHSA 2GRJA 5LOVA 2YRWA 3WSTA 4PEVA 3EVFA 3IJ5A 2GUWA 2M6KA 2V7XA 3B13B 2JKYA 3QBVA 4M22A 1EVLA 1YI0A 3ZGYA 1V48A 3FVTA 3MWKA 4C4YA 2VZLA 3O47A 3PI7A 2QL6A 3EY9A 4KI0A 2VDRB 4EAAA 1PWHA 2CKDA 2IYQA 2X4IA 5IKEA 3JYLA 2BTQB 2P6NA 2CDRA 1F12A 2G1UA 4J7UA 2OXRA 3OM9A 3VNSA 1N1DA 3ES9A 3KTAA 3O8OA 1DE0A 5I7HA 5JD6A 1VE6A 4KXXA 4QATA 3CB4A 5TF4A 1FTYA 3P7MA 4LZWA 1RHKA 3BDAA 4G56A 1LNSA 2IV2X 3IEMA 1QPZA 2MIIA 3DVLA 4CMEC 4PYJA 4QYIA 2PSEA 4FKMA 2JAXA 4MA4A 4PX9A 2C5SA 5DGTA 1XMQB 1XKXA 3MERA 1GR0A 2YY7A 1YUNA 3OCWA 2QAGC 5AK0A 4N9WA 4NE9A 1O77A 2CCJA 1X38A 3OPYI 1UJCA 5FF9A 2C04A 1NI5A 2P40A 5DLQC 4BFWA 5CBKA 5T6MA 1M1NA 3BIOA 4BVJA 5A9SA 2I76A 1K5GA 1QH1A 2X0DA 2EG9A 4E07A 1XA3A 2UZIR 4GL4A 5BW8A 2DECA 3IPAA 1HE4A 5FOSA 5FUQA 2X6QA 3G59A 3P0EA 1XU4A 3TZLA 5GGYA 3KXDA 4M7OA 3HCPA 3AHCA 1TAQA 3SC6A 2QN6A 4FR2A 1TQ8A 3AR2A 3STXA 4JP1A 3CLUD 1XPOA 3LVFO 3I1FA 2FK7A 1EH5A 3OUTA 4QUBA 4QXAA 1YXMA 2RDMA 3JZAA 4RY2A 3RUDA 1LV7A 2VYVD 1OV6A 2EL7A 1UQUA 2OMKA 1PRYA 3RVPA 3F78A 2FGJA 3D2AA 4YQZA 2QG4A 4YJ2A 2WWTA 3LW7A 2ORWA 4KQXA 2FN4A 4J2TA 4PAGA 1PZFA 3RS4A 4WK0B 2QP3A 6LDHA 3AVPA 3II6X 4OCZA 3ZI7A 5K2OA 1LBQA 2GZMA 4YV2A 1L5QA 3WIUA 1IIRA 3DL7A 1E2JA 3EC7A 3ET4A 1WDTA 3AVTA 3OQ6A 3K30A 1WMBA 3VKGA 3M1YA 3TF5A 4HWKA 5EOVA 2WM3A 1HE1C 4PCVA 3ACBA 1M34B 1N0IA 2YXPX 1DG9A 3I8SA 2VYVA 2PMWB 4UHHA 2FMKA 4IIHA 1SHJA 3WB1A 2H29A 1KYQA 3IESA 5AJXA 3WLHA 2QBYA 1IN1A 1EUCA 4RA9A 3QGMA 5IHXA 3PFNA 4IUBS 3HGMA 4LHXA 1FK8A 4OO3A 2H1SA 5I7OA 2PLFA 1JFSA 3IIMA 1YVRA 3QE0A 2P91A 4TXMA 5YASA 4EY3A 3OTOB 4D9IA 1EFKA 4NJEB 4TKLA 4YJ3B 1N6HA 3HNPA 4BV3A 5BRAA 1C3EA 2SCUB 3VKVA 1BSVA 4Q66C 1QH9A 1PG2A 5CTAA 1EMDA 2PNJA 4CR8A 1KVUA 3HP1A 2XMQA 4ZV4A 4XCXA 5KEIA 3BWEA 3ZWDA 2VPIA 4OI4A 4A0FA 4BO1A 2WE8A 3E9DA 4PHGA 4J0GA 3JALA 2WU0A 1UC8A 4OMCA 2RHJA 2C42A 1LBIA 2B3TA 3LI2A 2Z2YA 4NOKA 5ENZA 3G1UA 2OCBA 3NS7A 3V9PA 4B40A 4C22A 1Q92A 3UPUA 3GNTA 3S6JA 2FY8A 1XZMA 1QZXA 2ZYGA 4YJ3F 2QGZA 5ILGA 2Y0BA 4C2UA 2J0SA 3FCEA 4JITA 5KMGA 4A8JB 3HZZA 2DXIA 1IG0A 5G2OA 1EFLA 2R85A 4UASA 1IBKB 1RMTA 4U2DA 5GMOA 2OESA 1DOZA 3HTXA 2QIOA 3ROQA 4YDQA 4URVR 3AL0C 3DBOB 3IB3A 4FMBB 5CDFA 2IUEA 3DFIA 2XGSA 3UENA 4XWKA 1XCMA 3RBXA 1KQOA 3SS7X 5KU7A 3D7KA 1UM9A 1AF7A 1UKBA 4YREA 2WSBA 3EGIA 1TTPB 4R8KA 1BD3A 1D4OA 1K27A 3UUEA 3HXKA 3CO0S 2AN9A 2BUBA 2H2DA 2YJGA 3C24A 2DQZA 3HDHA 3TO5A 3VNRA 2WQZA 2PU5A 3ZHVA 4DM4A 5KYWB 1UOEA 1KGDA 3K0KA 3WICA 1U0JA 4PNZA 3L49A 4G5OA 5CG2A 1KYYA 1QHGA 3BMOA 5EJ4A 1YOBA 1G66A 1NAHA 4X95A 2ZUUA 5D5PA 2HU8A 3P2IA 4OHRA 5BT9A 3PQEA 4D8VA 1ICIA 3A32A 5B3LA 5ESRA 3KLPX 4ZOQI 2Y1OA 2R8BA 4FLMA 4KV7A 1SVOA 1FC0A 2X8BA 3U3ZA 3WMGA 4XIJA 1JDZA 1DZIA 4DVGA 3TQRA 1PJRA 4CZ2A 5HGXA 3EDMA 2WC1A 1HMPA 3INNA 4NBTA 3U1BA 1FFWA 2Q4RA 2X3YA 3ASVA 3CWZA 4OP1A 4Z9XA 4X84A 4IO0A 1N7IA 1C1DB 1L7BA 1OHHA 1ST2A 5CT5A 2I6XA 1NMYA 2BN4A 2JGIA 2A0WA 2WF8A 3HZHA 3GD7A 1X9GA 2RK4A 2AJCA 2G40A 3GCZA 4UUMA 3DCNA 2TMYA 5KQSA 1L4EA 5KKNB 4ERXA 5ADUS 2PX0A 3FLAA 3KHUA 3RDPA 5K03A 3L4EA 1OBOA 5KWJA 4JGBA 1V8DA 2VKQA 2ZYWX 2FZEA 1B0AA 4U7WA 3U17A 2HLDA 3NDJA 1GAEO 4Y2HA 2HRZA 5JAMA 5EESA 1U81A 2L18A 3EZYA 3GGDA 2HF8A 2VNSA 3TL6A 3DPSA 3OI7A 2Z5LA 1EWYA 1G0NA 3EQ8A 3IOCA 1WCIB 2PUJA 1IJEA 1H2RS 1OH8A 4ALKA 2O6LA 1SELA 2HLPA 3CLRC 1LEHA 2X14A 3N59A 4O4LB 1OYWA 2VTBA 3ZD9A 3VH3A 3C15C 3GHYA 3UTDA 3ZTTA 4DQDA 4CIDA 5EZYA 3VA7A 5C3UA 4FB5A 2DOKA 5C7IO 5HX7A 1Q1AA 2FSHA 4ZQEA 4C7OA 1G0OA 2A2ZA 3DV9A 4QOJA 2WWWA 3GUZA 1QKKA 5ESXA 1Y48E 1RJFA 4JJGA 1JTEA 3A6DA 3BK1A 2AOWA 1U80A 3FETA 4NBRA 3U4GA 1SXQA 1WEHA 3ETDA 3GIDA 3CR7A 1HSZA 4CM9D 3KL4A 4DV4B 4P2BA 1IOWA 3MWEA 3DEFA 2HSEA 3O84A 1C1HA 4CHTA 2IP4A 5INTA 5H83A 3OY7A 3TQFA 1U0SY 2C4MA 4AS2A 3K5WA 4HDNA 4UVDA 2GPJA 4O4LF 4Z49A 3O93A 2VLIA 1YL6A 3BD6A 1DX9A 1VHDA 2PU7A 2FPGB 3EBOA 3GDHA 4DDTA 2B1RA 4O4HB 5EWJA 3TI9A 3GG2A 4QYMA 4F2WA 4RQTA 4XARA 4Q1DA 1Y4DE 3WJ1A 3BTOA 3UFXA 4DCSA 3Q1KA 1A96A 4QUGA 1W1IA 4KRGA 1ESMA 3GJ7A 4GMFA 4PGMA 1G59A 3G6KA 1Q44A 1W0JD 3SXUA 5BWOA 3JRXA 5E1BA 2X6RA 2O7QA 3NBYC 1P17A 3ST7A 3TRKA 3KJZA 4KWTA 1PV4A 2ERYA 2FSFA 4K8OA 5FO0A 2VHTA 3HA3A 3I2IA 5LQUA 3LK7A 2I2XB 1TM2A 1LY1A 1B8NA 1P5JA 3KL2A 2R1VB 1AF4A 2K6GA 3ONFA 4LBZA 1TTQB 5BYBA 7ADHA 2HMVA 5F7XA 3VPAA 3QLUA 4JYZA 1Z7BA 1E66A 1N2SA 3S70A 2JGDB 4RTKA 1TZJA 3UJPA 3F8WA 3I5MA 4MR9B 2R751 4XUDA 3P0IA 5CLGA 1E3QA 3T3IA 2IZOA 3GNLA 3SDSA 3JS5A 4LQLA 5FOVA 1VRWA 1B74A 1WTCA 3B9BA 4TGLA 1OD6A 2EIXA 3GAFA 4HAOA 2XBLA 4IF4A 2VPPA 1YZQA 1A4XA 2D0IA 3K0FB 3K1JA 1SB8A 1WZIA 1WZEA 4R2WA 4UEQA 4C3OB 3EHDA 4X20A 4M55A 3ELWA 1EZ1A 3LKVA 4Y9DA 2IGTA 2PGAA 3NHZA 4RADA 4LJLA 1UFKA 3U6KA 2QTLA 2JLZA 2DTEA 5FR2A 1Z5GA 2QL7A 3OPYB 3EEBA 5LZ2A 2H11A 3KQHA 4BY9E 5B2EA 4CVNA 4TKUB 2QN7A 5BV8A 3GGOA 5KNBH 2HA6A 1TVMA 2L2QA 2XYHA 2XA9A 3A28A 3OCZA 2GKSA 3QX7A 4O4JA 5P21A 3RTCA 2AXNA 1EVIA 1FYFA 1UWLA 1XDZA 1DQNA 4HR7A 3DDHA 4U2KA 4YRZA 5F3RA 4BJ5A 1NUHA 4QFMA 4FW8A 2PLWA 3DKIA 4P36A 1VPLA 5G0SA 3U56A 5T64A 2WAMA 1R0RE 1NNEA 2Q2WA 1CQJA 4ZODA 1YF3A 3EFOA 3R09A 2A5DA 4G97A 3C6QA 3ZDBA 2NU6A 1D4AA 4ADSG 3RGWS 3T8YA 4KGZA 5E9AA 1YQXA 5IMBA 1EX7A 4TL8A 2XUHA 1JEDA 3QHPA 5GONA 3JTEA 2E1PA 1TYBE 3LY7A 4L5CA 3WGNA 1F4PA 1T2AA 2UZ4A 2P1RA 1JN0A 3BSWA 3FOCA 4C43A 4KO1S 1E7SA 2D0DA 3TW0A 1UAAA 3ILHA 1GQRA 3ZHUA 3GEDA 1W0CA 3FYTA 1Z6QA 4U7GA 4X1IB 5D3QA 4UCWA 5K51A 4F86A 5CB0A 1K66A 1JMVA 5ILOA 2B0JA 2W7TA 3PLAE 1J7JA 1EP3B 2PL1A 4H7FA 1PNVA 3TSWA 4L4UA 3QYJA 2AXQA 1K8QA 3WLRA 3HUUA 4KMSA 1PJZA 3PWZA 4NBNA 4MPTA 3IMGA 4LOAA 2YWDA 2ZRNA 3CUVA 3DLAA 3TD2A 3UWKA 2BFPA 4GOMD 1DIRA 3KO8A 5AUNB 1PEKE 1GPBA 4IQ4A 4LXYA 3QU2A 4QTYA 3E9RA 2JIPA 1HWYA 4A2WA 2QRLA 1AV6A 3EW7A 5DBOA 3T99A 5CH3A 1FU8A 3WAKA 1W5SA 1XDWA 4URFA 4WT7A 5IYZB 3PNLA 3FYUC 1JR2A 1Y8RA 2VDWA 3R44A 4WY2A 3D7RA 4HXYA 3DXXA 3BXHA 1JTFA 3SIWA 4D4IA 3KRTA 4ENVA 2CCKA 4WBNA 2I6QA 2R7NA 3HMQA 1NP7A 4FPXA 4OD0A 5HQTA 4OVKA 3NH6A 5E6RB 2WM9B 1GNQA 3A06A 1VZ2A 2QUJA 5LFAA 3GB9A 5D8DA 1W8DA 1VG1A 4HGQA 1OH5A 3BB4A 1XP5A 4BP1A 2FUCA 1ZD1A 1QAQA 3AHJA 1UOOA 2G70A 3B1YA 4GX5A 4CQMB 4JI4B 3W6UA 1T15A 1YB1A 2WTEA 4WKGA 5JSUA 3SC3A 1XTUA 2LKDA 4LSWA 1CR4A 3WJ2A 1U3UA 4LYYA 2P9CA 5H16A 5K3DA 3U7RA 5C9ZA 3BFPA 5JJ5A 2OFFA 2Q4OA 1P62B 2QD4A 2CHUA 3F6EX 1DAGA 4LRWA 1N57A 1A88A 4K86A 4Y6SA 4YNBA 5DCUA 5TMPA 4OQQA 3TQSA 1JJVA 5CM2Z 4FW9A 2ZJ4A 1DOAA 5F52A 3RQSA 2O9JA 3D1LA 4ZT4A 1QAOA 3PXGA 5ALHA 1XPRA 3ZDRA 3U6BA 4KN8A 3UBTA 2R96A 2QP4A 4N5DA 3ZLBA 4KR7A 4U3JB 3G9QA 4WECA 4TUYA 4OGLA 3DULA 4ARIA 3D0OA 5T7BA 2XVZA 2UVPB 1PFYA 4FR5A 2VQEB 4C0LA 1FP1D 4D97A 4ZJZA 1SQGA 1X7GA 4BN4A 3X1DA 4MWOA 5G1PA 1RXVA 1JUDA 3DSRA 1YA8A 2J6HA 4MS1B 4UEJA 3RK0A 3V46A 5A9RA 2QE7D 3H75A 1CERA 1E7MA 1FDTA 1B76A 1MX3A 4ZOAA 2FI1A 1XTSA 1I5RA 1YVEI 3NHYA 3ICVA 4OAOA 4PXYA 5MN6A 1IXZA 1H9AA 2AI2A 2OB1A 5JCJD 4LF9B 1I6LA 2M6LA 3GMTA 3FOZA 1Y8QA 2CL5A 3ZDXB 4ND7A 1PWEA 2P27A 1VJCA 3NDIA 1JDSA 5EKUA 4B6OA 2G09A 4PYIA 2FQWA 1AZLA 3DKRA 4QU8A 2QVZX 3EH2A 4H16A 3ZLTA 4PQEA 3PDIA 3GCWA 4HMOA 3K53A 1XZLA 4IEIA 4KZKA 5EP4A 4JLSA 1YASA 3U81A 2Z6UA 4NABA 2ZJ2A 2HI0A 2VWPA 4KHZA 2VC2B 4WY8A 3AGPA 1N5MA 2WT9A 3IFSA 5B7PA 2Z9DA 3LKDA 1N6RA 5AVQA 4AN1A 1NG9A 3FNGA 4R8SA 2GM3A 2JBWA 2IEDA 2L0XA 4MR7B 2FW8A 5JCZA 4C3VA 1EFPA 1Q6YA 2GN6A 3GLGA 3CRW1 4G5QA 4UKDA 3BXXA 1GN9A 1SEPA 5KUTA 4NTZA 1L5SA 1SOUA 4GWGA 3ZOKA 4B74A 5CXSA 1JDBC 1BMQA 2BM9A 3BAZA 3ZVKA 2PX4A 1CRPA 2CLIB 5ED4A 4BVLA 2IHVA 3DT6A 1CUJA 2J6IA 2XY4A 4I1SA 2JKVA 1E4OA 1IVSA 3AEZA 4X61A 3VC2A 5AM2A 1QBGA 1XZJA 1XN4A 4N1AA 4HQFA 1UEXC 4HDMB 3IEXA 4I1IA 5TPZA 1WQ3A 2PWPA 2WHPA 2MMCA 1JMYA 4HFNA 3GJ3A 4N82A 5ALPA 4Q4HA 3JWGA 3B82A 3FHCB 1H9CA 1LLCA 4K2AA 3AKEA 5CA0F 1E2GA 3TNDA 3S8YA 3HV2A 3K1YA 3TK1A 3T41A 2Z1MA 1UWKA 3ZHRA 4QLAA 3GYBA 2FP4B 1HGXA 1OT5A 3KV3O 2XKAA 4XGKA 3G2IA 2RCYA 3S2EA 5AUPB 3LUFA 5JMWA 2B5OA 1XO1A 2GEUA 1XRRA 2WSSD 4KLCA 4YP7A 4RKWA 4C04A 1E1NA 2O48X 2HCTA 2COKA 4PBRA 3WHIA 3WK5A 1WRBA 2V7BA 3IPXA 1Z4OA 4Q01A 3DMYA 3B5EA 4MRVA 3PXBA 2OFOA 2QORA 5B2ZA 1T5TA 1WUIS 2VXCA 1H4VB 5BN4B 2PXCA 1OX4B 2K4MA 2P35A 3A6FA 1DAEA 3BRWD 2C00A 3PNPA 3QWAA 4MGZR 4RXTA 4YO8A 5FI3A 1MH1A 4C01A 4BYGA 1L4LA 1DBQA 3PXCX 5COAA 4DG5A 3V7UA 3G0CA 4X91A 1AVTA 1JAYA 1NVEA 1SC3A 2GN0A 2H3HA 2V5VA 1P9RA 3N7UA 4Q3EA 4WNAB 4FFPA 3I64A 4DRZA 5IZCC 1FMJA 3R7DA 3FF1A 3EZXA 3RYHA 4ZKDA 4AMBA 3I28A 3GUCA 2ZI6A 3IO3A 3HWSA 5HDBB 3U7IA 2WSSA 1RQGA 1QVVA 3D9QX 4K6CA 2WA1A 1G5HA 4NU0A 1E2LA 3ILYA 4CKBA 2ZT5A 2A5LA 1JE0A 1R4ZA 4BMDA 3U13A 1VPDA 5DGDA 1QBKC 4EKDA 2VT6A 2P9FA 5L8VA 4MX8A 4CLRB 4X24A 3D8UA 5TQ2A 1RWVA 2QD3A 4OI2A 5KO2A 3ZZNA 2HADA 1JHQA 1T13A 3SQOA 5JFTA 4DDHA 1BXGA 3THWA 2R6JA 3HLTA 3KYDA 4NYJQ 3BWVA 1KE2A 3SNHA 2UZ1B 1DBWA 3KQTA 2FEPA 2QAIA 4QQFA 3THXA 1LV8A 3B1ZA 5F4ZA 4A27A 4IHJA 4MV0A 1GZSA 2GUGA 3DM9B 3QE3A 3OHSX 3RPEA 3SVZA 5LYJB 4TTPA 3ZPXA 2IU0A 5K0ZA 4AJOA 2BGRA 3WMRA 5JD3A 4RTOA 1K08A 1HE3A 2PYZA 3SEFA 1SUBA 3I62A 4HNHA 1NM5A 2JI4A 4QOGA 5CD1A 1S8OA 4F2DA 3BD9A 4QVIA 2N9UA 4HMQA 3JVDA 5AJWA 2HY7A 4TS4A 4NDAA 4YQFA 4OUDB 3PC7A 4BCBA 2AFIE 2GBGA 1J0XO 2O0HA 2PT9A 4GR9A 2DPGA 4QIHA 4W5OA 1W5EA 3KK0A 5DVZA 2YYAA 1IN8A 4RTQA 1RKXA 1Y7PA 1LU9A 4KN6A 1HLFA 4P5DA 1ZG3A 4PPQA 1U9YA 4ETIA 1B0UA 5IVIA 2FJ0A 3H9JA 2UV8A 1HE8B 3ZXXA 4DW8A 1SUIA 2IZ7A 2YZ2A 5LYJF 1XCJA 2DKFA 4CMAA 5LA6A 1GZ4A 1XVIA 3QE4A 3VAYA 3DOEA 3IDOA 5LM3A 4B84A 3DMDA 5EXTA 5A4KA 1HDEA 4DQ0A 2AQ8A 3CONA 3O82A 3PRKE 4LPSA 1ORDA 1Q57A 3FR7A 4WZ6A 4AO8A 1QYIA 1EFTA 4QPPA 5K4GA 1IAVA 2LCIA 4MVCA 3V4SA 4XQ0A 3LBYA 1N0WA 3QRWA 2RHMA 3DDNA 1ZDMA 1GAJA 3ELYA 3SF8A 3ZDDA 2H7CA 5DXAA 2HQBA 4JC5A 1K6EA 4AQYB 3KXKA 4JYAB 2CUNA 4PX2A 1N0UA 3LQ2A 1K3TA 1YVDA 2XHEA 4PQGA 1TQHA 2Z8YA 3CKYA 3DV0B 3JSXA 1SKAA 4ZARA 1CVLA 1A8IA 1NJ8A 2CK3A 2G5GX 1PU2A 4B8ZA 2L42A 3H11B 4R2JA 1U2DC 2FQ1A 3ZZ1A 5BOSB 3E27A 1ZXLA 3B6EA 3OKFA 3RW9A 1ZSYA 3BWMA 1N6LA 1UMDA 3E5HA 4Q1FA 4HKTA 1G9TA 5K0SA 1PR4A 1CEEA 2I3DA 3IP7A 5MFPA 1FRFS 3A6ZA 1AQLA 1R8QA 4QASA 1ZUNB 4W9NA 1V1MB 4G0OA 3A11A 4UUPA 1P7WA 5AVKA 4DLLA 4BGEA 3LT5A 3N07A 3W3AD 2O05A 3GF4A 3PV0A 1MOQA 1NG1A 3PNOA 3QUQA 4MYDA 5JEEA 1DJMA 4K87A 3GLIB 1A7AA 1WWKA 3HDGA 4ESEA 3AIKA 4EY7A 3UGKA 3AP1A 1V0JA 1M8KA 2HO4A 5IWCA 3KJNA 3FUCA 4TL7A 2GEFA 4LE1A 3VNAA 3OKPA 5TQVA 3QUSA 4B3TB 3GEIA 5EMMA 5LR6A 2VAPA 3FZEA 3O1LA 3V1MA 1BFUA 2NSLA 1D9ZA 2JW5A 1Y9EA 3VNQA 1CJSA 1VJ1A 1E5TA 4FS8A 3ZHYA 1K7YA 2C07A 3IULA 4FEEA 2I1LA 5BVGA 4QQKA 4M0CA 5CDTA 4LXHA 4K6HA 5DM1A 4RHEA 1IL0A 3L01A 1JAZA 5KOIA 4Q21A 2NUPA 4DJEC 2CV2A 4QWWA 1L5WA 2BJWA 5JNUA 2X22A 2PH3A 3IBFA 1NI4A 3KU1A 1GFIA 5LDGA 3M33A 4R2KA 2CNLA 4K6KA 5ARDA 1J00A 4LYEA 5IASA 2FRDC 2V6MA 2IVZA 4CMBA 1RRVA 1NBMD 1JYFA 5H8WA 1FFCA 2VAXA 3A7DA 1FX0A 2X5JO 1U0GA 3FAKA 4BQOA 3J7AC 4EGFA 3CRRA 4RM2A 4Z8YA 4RF2A 3U7HB 4YVFA 1I7PA 4UU1A 2IIPA 2HK7A 4N6OA 1M74A 2VO1A 3P1JA 4RHYA 1EA7A 1GGKA 1QXSA 1RAHA 3KLMX 1QTIA 2Q07A 4EHLA 3D6UA 2PZLA 1NUQA 4Y0NA 3EXFA 4L8VA 2Y4NA 3CX7A 2QTVB 2B99A 3HUTA 4IIUA 4QUHA 2WVAA 3AY6A 3DHNA 2BW0A 3F4KA 4IIJA 4K9KA 4C4XA 3CG4A 3GFPA 3NTLA 1M2OB 3WBFA 4X6YA 1E5LA 3Q10A 3L6BA 4FT2A 4J1QA 5JLJA 5K3FA 3L7BA 2FZ4A 2GCPA 1U11A 4ZC8A 1IM2A 4Y2SA 1KO7A 1Y37A 4QBIA 1MN6A 1K75A 1XTRA 5HIKA 2D5AA 2IELA 1T9HA 2VT7A 2JI9A 4NQRA 4OKSA 4YBRA 1ZGBA 2ZYDA 3UCXA 1RMQA 4D99A 1B2RA 3LBHA 4DLPA 2HMUA 2R5WA 1N2BA 2NO7A 2WD7B 1MC8A 3AF1A 2AN3A 1B4DA 2ISSD 1FQWA 3B7GA 4TTTS 2C2GA 1V2GA 4J94A 1S3SA 2QLBA 2RJOA 1B8VA 3VU1A 5IDYA 3VOBA 2A0KA 4PZ9A 2A0XA 1TUIA 5DM4A 3I9LA 3WQQA 2VHQA 4EMBA 4EW3A 2W42A 4Y2TA 1OIVA 1N6IA 1Y9DA 2BKEA 2A0FA 3K31A 1J8QA 5B1HA 4UNRA 4GW3A 2JAUA 5FR1A 4DFDA 1KP2A 2YINC 1BS2A 1X1RA 3E7DA 3H9GA 4EQZA 3AXTA 1NVMB 1NW5A 1GPH1 1VHJA 1UZUA 3QVLA 4G23A 5EXEA 1TKRA 2PKQO 2VZEA 4C87A 2Y1EA 5CDYA 1UMCA 3ASUA 1IQUA 1YR8A 4BTLA 3VPFA 1KJ9A 1J97A 3CLTD 4WNCA 4GOJA 2XWQA 3GEBA 3TCKA 1GQSA 1P1CA 2HX1A 5KTNA 3NQ41 4WWHA 2FLVA 2FDRA 2HQOA 4GBMA 4ZCSA 4Y2XA 3ZK7A 1FDWA 3IEPA 5K3CA 4M1OA 4JB2A 1I0IA 2N0SA 3DR5A 3FCYA 4ND2A 2NUBA 4EUEA 1SXPA 4G0UA 3C1TA 5HILA 1SBHA 2Z5VA 1K5DA 5B53A 1KFBB 1A7JA 1IDOA 1AURA 4MQBA 4AJ9A 2Q9BA 1CUIA 2W11A 3LLMA 4KUGA 4QXMA 4UBLA 3GI1A 4XYEA 2B78A 2O52A 3CPEA 1NSFA 4LRUA 4CDNA 2EJTA 1RAEA 4GECA 5JT1A 3H2HA 5KNDH 3BRSA 2TSYB 4YI5A 3RYFA 2RHHA 5C8XA 2PUCA 3QKWA 1Y9ZA 2ZTLA 1AE1A 2O1EA 1W88B 4RD2A 4ARZB 2QI9C 1C1XB 1GLVA 5IVHA 4KDEA 3OEED 5BPFA 1VCIA 2O50A 3BT7A 4AUNA 1UJBA 3ENWA 4CIXA 4OJYA 4G5SA 4NJMB 4J0QA 2PO5A 2F9LA 3D8HA 1Q1QA 3FCOA 3HJNA 1G42A 4B2YA 3NGLA 5KAPA 3VAAA 1QORA 3AW9A 1E6MA 1FNMA 3VR6H 5TS2A 2Q9AA 3EYAA 4QEDA 3NHAA 1G8HA 4FOLA 3REGA 821PA 1YULA 1CDOA 2X5OA 1PZEA 2QIPA 2E4UA 3AQ4A 2PKWA 3P9IA 3PUHA 1M73E 4P31A 4WKPA 2BKAA 3VR3D 1EGAA 1H2BA 3DAHA 4FLFA 4JI3B 5C81A 1LJUA 2WLTA 1A4RA 5G4LA 1YCHA 4TM7A 2BSQA 5B30A 4LJ8A 2W2OA 4QYWA 4AMGA 4Q93A 2ZCVA 4MVJG 3UMMA 4X1YB 2Y1XA 5EQDA 3TEMA 4RPCA 1P1BA 4N5HX 3HKEA 2HJWA 3LQ4A 4NOJA 1ZZGA 3GP3A 4H2DA 2Z30A 5DHPA 4L4SA 5C1DA 4IWXA 4BASA 1GAQA 1GG9A 1QG6A 2ZWMA 4KXLA 3FUWA 5K3OA 1X1QA 3PCXA 4UATA 2XUPA 2HSGA 1TO2E 4EEXA 1P39A 3AF4A 4BCDA 5CDUA 3NANA 1ZIPA 3CIFA 2AF4C 4AJ2A 1N25A 3OAAA 1T1RA 3MD0A 3CW9A 3C3WA 1JE1A 4DE5A 2HA4A 3C1AA 2IS1A 1K7CA 3AUJB 4B35A 1AUQA 4XEUA 4TS9A 5CRIA 4Y2PA 2Q62A 1X3LA 1TK9A 1T91A 2VF8A 2ZJ5A 3AZQA 3GUVA 1G1MA 3L0SA 1RXYA 2XTZA 2L82A 3ZI0A 2HA0A 1ZC3A 3T4PA 1JT2A 2B7CA 1ZGHA 1U1IA 2NM0A 2OSVA 3NRCA 4G0YA 4LC0A 3WBJA 3AOEC 5LBTA 4XQ9A 3W8NA 1E58A 2Q6VA 2HO5A 3LD9A 1RZUA 4GRAA 3EIHA 4J1NA 2HRRA 1IPEA 1E1QD 4KDRA 1USVA 4E22A 4B71A 3GFQA 4K46A 1PUXA 3GT7A 2V1XA 3AOGA 3C45A 3LXUX 3I9KA 4XSGA 3UWPA 4D4LA 1ND6A 4IGKA 4DA6A 4E7OA 3RT7A 1JSCA 5D3ZA 2Z09A 3DQPA 1BYIA 2BEUA 2CXSA 3HEAA 3L8CA 4FX5A 1TUGA 4J0HA 4R40A 3TVTA 1KO8A 3ZQJA 2FKAA 1GGJA 1T8PA 4HBZA 2C5HA 3IIJA 3ZHBA 2ICAA 3RJTA 3CH4B 2ZSEA 1DRKA 3KPUA 1Z28A 3LV8A 1YJ8A 5LQCA 3NYRA 3K73O 4BKMA 1AO3A 1WNFA 4FMDB 4L4YA 1MEEA 1T6NA 3LC2O 1WY7A 4N3GA 3I1IA 4WGFA 3RC1A 5FDFA 4CEIA 4YJHB 1E9BA 5I9TA 2WJVA 1R0CA 2NQ8A 2D8MA 4XIYA 4EKGA 1N5KA 5JWHA 3GLUA 3GJ8A 3U4QB 2LXNA 2HWXA 1HG1A 1DCMA 3WIBA 3PHGA 3AIMA 3I9JA 4FD2A 3GARA 2FQXA 2EZTA 2WT4A 2YXLA 3O1JC 2FMFA 2UZAA 4Z3DA 2YV5A 4BVKA 2JIQA 2P0YA 2XCIA 4C4SA 4AT1A 5AM0A 1LRLA 2I4LA 5JNSA 4FMDF 3B36A 2J4DA 1N8KA 1NVDA 2OGZA 3AGQA 4R0MA 1F0PA 1R64A 4IXDA 4PC6A 3ZJTA 1I2BA 2WAOA 4JROA 3BFXA 4U7PB 5DI3B 3B2NA 3O2SB 5HTOA 1X7YA 3V32A 3L6UA 2XCOA 2FUG1 3M70A 3EPPA 4JL5A 2JIBA 1ORWA 3NVMB 5F64A 3V7YA 4BFVA 1XHEA 2QMHA 3W3ZB 3OTGA 3MRSA 4DIFA 5FWYB 3V8QA 1JHVA 1K68A 2MINB 3ISJA 1UPBA 3W1VA 4EKYA 1R4NA 4FWBA 1EG7A 1IZ9A 3K9LA 3SS8A 2PQ0A 4WLVA 3MWJA 1XAIA 5E0OA 3ABSB 2I2FA 1NQOA 3CJTA 4RPGA 1RPTA 5TMBA 2NQTA 2J3HA 1BXZA 3KG2A 1C81A 5HG0A 3UW1A 3C3PA 2IDJA 1G41A 1QZTA 4M86A 1ODSA 1OXMA 1WUJS 2BCEA 1RYHA 2VL7A 3KZOA 4NF2A 4FHFA 1DWOA 1M2JA 3PT5A 5H1YA 4U6NA 1C8KA 1OGYA 1Q0PA 2H1FA 3HU3A 5LCXA 1TEHA 3ETHA 3L9XA 1B3BA 1HURA 1CS0B 4FHEA