4ETMA

Crystal structure of yfkj from bacillus subtilis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
164
structure length
162
Chain Sequence
GQGRGSMISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILRREGISFDGMLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDLADVPDPYYTGNFEEVCQLIKTGCEQLLASIQKEKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase yfkJ
publication title Crystal structure of YfkJ from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 60
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etmA00
2L19A 1DBQA 2DRIA 2YHBA 8ABPA 5TQ2A 1Z17A 2J48A 2L2QA 3M9XA 4YS6A 5IUKC 2IDMA 4RKRA 5PNTA 2E4VA 3KYIB 2B1JA 3H5VA 4ZYLA 3QELB 2PUFA 1CYEA 3JPWA 1DCMA 4RU1A 4KMRA 2FSPA 3QLTA 5E3JA 4Z99A 3CTPA 3LFTA 5JS1A 1PNTA 3KLNA 4OATA 5KI6A 1JX6A 4EYGA 3N75A 3CKMA 4KVFA 6CHYA 1BA2A 5FWYB 1ABEA 1DCFA 4FB4A 2HSGA 4KK3A 3ILHA 3O21A 3I45A 3G85A 3Q7TA 4RZSA 4D74A 4EYQA 3KYJB 3A0UA 3RVLA 4F11A 3OMWA 1JL3A 1JHZA 2RGYA 4JP1A 5IUNC 4P98A 1VLZA 2MSKA 4WWHA 4MQFA 3CFYA 1E6MA 1TM2A 4DQDA 1M2EA 3MQ4A 3UK0A 3LKVA 3EODA 1VPWA 4RDCA 1P6QA 3EDCA 2F8SA 1SRRA 4WT7A 1FFSA 2L18A 4MPTA 3RH0A 3E61A 2VUIB 5TPWB 3SNKA 4L85A 4LDZA 1FFWA 1W25A 2LP4Y 3O1IC 2MSWA 4HNQA 2GX6A 2R48A 4N0PA 3VNAA 7ABPA 1U2PA 2PLNA 1U04A 3JVIA 4RY9A 4G0XA 1EFAA 2FLKA 3FFTA 3K4HA 1M5TA 4W5QA 3RVOA 3OO1A 3BRSA 1YS6A 2WY2D 3GT7A 3CS3A 3GBPA 5BQ3A 1P6UA 2JBAA 1SXGA 3H1EA 4NQRA 4IILA 1BDJA 2QSJA 3H5OA 1NATA 4XXHA 2PE5A 1JLKA 5JNRA 4F06A 3LUJA 2IPMA 1NTRA 4WZZA 2P4UA 1USGA 3CZCA 3QK7A 4LE0A 4TN5A 3RVPA 5FWXB 2CHEA 2R4QA 3GRCA 4RSMA 4EVSA 1M2FA 2ZWMA 1DBWA 4YV7A 1EAYA 1JYFA 4KPYA 2AYZA 1VRVA 4MR8B 4UHKA 5ABPA 3ROFA 4MR7B 1LJLA 1DJMA 1Z15A 5KQMA 4TLLB 3Q7SA 3IP6A 5B3JA 4KQ9A 3BILA 4G0OA 4G86A 4G97A 1IIBA 4HYEA 5HM6A 5KC9A 1BVHA 3N0XA 1VKRA 1F4VA 4RY8A 1TMYA 1GCGA 4QPJC 5BR1A 3RQIA 5JNUA 2JVIA 4S04A 3HEBA 3N8IA 3HO1A 4IRXA 5KQPA 3RVQA 3K9CA 1QPZA 3GL9A 3OO0A 2HQOA 2JCGA 1DG9A 3LUAA 4XAQA 5EWLA 5TQ0A 1JFVA 3KKEA 4N03A 4MS1A 4EYKA 4Z4GA 4B09A 4EYOA 4RWEA 2FTKE 2M98A 3IP5A 3QLUA 5IBQA 1A04A 2FEKA 4WUTA 2HJ9A 5HQJA 5DTEA 1JDNA 1KGSA 1RXIA 1GUDA 2H3HA 4H3HB 3SM9A 3TX6A 3RVMA 1ZH4A 2FW0A 1ABFA 2PMCA 3JY6A 2IPNA 4MLDA 1YS7A 4QYMA 2A9QA 4MLCA 2FMHA 3JVDA 3EJWA 3QELA 4MS3B 3HUTA 5CNJA 4PZ0A 2GKGA 4H60A 2RDMA 2HPHA 3H1GA 4RS3A 3LOPA 1PEYA 1K66A 3N53A 4D6YA 4JOQA 3OQMA 4F8JA 5JNSA 2PUAA 1C0EA 2HQRA 4Z4IA 4Z9AA 1PHRA 3EULA 3KJXA 4LE2A 1CEYA 3TB6A 3HUUA 3IPCA 3OLVA 5FWYA 1A2OA 2JVKA 2MSLA 4O5AA 5B3JC 2FMKA 3CG0A 2CHFA 4IMJB 2PUCA 3OLWA 3H6HA 3OLZA 3GV0A 1UDRA 4OBBA 2E4WA 5IEJA 3I5AA 4JB0A 5FBHA 1U0SY 5T7BA 4QICA 1QKKA 4F3TA 4Q6WA 3L6UA 1JBEA 3T8YA 2MYPA 4RK0A 1U2QA 3QEKA 3N0RA 5TPZA 3QLUC 5TPWA 3Q7RA 4TMYA 3CU5A 1Z12A 2WRZA 1QO0A 1EWVA 1A0OA 4KNYA 1JDPA 1FQWA 1NXTA 1NY5A 4RY0A 3FFXA 4IMIB 5ED4A 3QEMB 1E6LA 3JTEA 3M9WA 4FE4A 1QP4A 1XHFA 1ZHHA 1LK0A 1ZH2A 2PJUA 4M88A 4G0QA 3TMYA 4Z4EA 3KS9A 2R47A 1URPA 4ETMA 4N76A 3O75A 4GNRA 5D2CA 3OQNA 2E4XA 3UUGA 1I3CA 3RVSA 1WETA 3LUFA 5BRJA 1SXIA 5FWXA 1NXOA 3FMVA 1YMUA 3GBVA 3LUHA 3Q9SA 3SG0A 4DN6A 2CD7A 2FLWA 4YO7A 4RXMA 3A3KA 1DCKA 4Q7EA 5KWSA 4CBVA 4N41A 1U8TA 1D2AA 4HNRA 3CG4A 1ZAYA 2FVYA 1F51E 4Z4HA 3TD9A 3F7NA 2VYCA 3FFWA 1QQAA 4MR8A 3HXMA 4MR7A 1D1QA 5DKFA 1FFGA 2PL9A 4JA2A 2TMYA 4XLTA 3CLKA 3MYYA 4RK6A 4ZJPA 4OLAA 3RVNA 5TPZD 3NNSA 2L17A 3P9YA 3HM9A 4MR9B 2FEWB 1YMVA 3ROTA 3B2NA 1USKA 1JF8A 1QO0D 2MYUA 3L49A 1Z2EA 4W5NA 1H9CA 4G0ZA 4LDAA 1LBIA 3BBLA 3SY8A 3C3MA 4YGXB 1ZGZA 2ID9A 4EUKA 1AB6A 2QV0A 1NXSA 2W42A 1D1PA 4RKQA 2PL1A 2FQWA 3G1WA 4KREA 3URMA 2NZUG 3IP9A 3MF4A 4IGAA 1CHNA 3H5WA 1MVOA 3DGEC 3OLXA 5DCLA 4G0MA 1YVUA 3HVRA 3HK2A 2JVJA 1T34A 3D02A 1NXXA 3F6PA 4LRQA 1APBA 1GLGA 3QX8A 3H1FA 4P1ZA 2KYRA 3KCNA 5HKOA 1EHCA 3LTEA 2IKSA 5TE9A 3A0RB 4RK4A 4KQCA 2QVCA 2IPAB 2RJNA 4G0PA 3EQZA 3W9SA 1DC7A 3GWGA 4QYWA 1MB3A 3NNNA 5DLEA 1RZRA 2Q5CA 2CWDA 2HQBA 3Q15C 4MS3A 4Y9TA 2V0NA 4XFKA 1YK1A 4HNSA 4Z4FA 2NZVG 1KRWA 1JFSA 3OMXA 1RXEA 1P2FA 3HDVA 1ZITA 3LKBA 3HZHA 3O1JC 2N9UA 1HEYA 3BRQA 3T6KA 4YRZA 1JFTA 4E7PA 5IEBA 1MB0A 1YK0A 1USIA 1RNLA 2IPLA 3HCWA 5CNKA 3HSYA 4KRFA 3DZDA 2E4UA 4MS4B 1FSPA 4OG2A 1RPJA 2MYTA 3LUDA 1SD5A 1NXWA 5JNTA 4PICA 4MRMB 4OLBA 5KQLA 1AB5A 3R0JA 4JASB 5JNVA 1QMPA 3DLBA 4JAVC 2GBPA 3NHZA 4WXEA 5T3YA 3GYBA 1EWKA 4KV7A 4ZMSA 2NUBA 2FEPA 2IOYA 1XWWA 3RVKA 1JYEA 4EY3A 5FBKA 5EWMB 2O20A 1NXVA 1L5YA 3T95A 4ZPJA 2WWVD 1PUXA 4MQEB 1Z26A 4RK1A 5EWJB 3FDFA 4MGEA 4N0QA 4XASA 3Q41A 4YP9A 5JS2A 1DP4A 3RVJA 1RZRD 4N47A 1GUBA 5I4CA 3O2JA 3QEMA 2MYNA 4WXMA 3RVRA 5C5CA 4Z4CA 3M6MD 3T38A 3JPYA 2P9HA 2ID7A 4W5RA 1Z25A 1L5ZA 2QU7A 2PUGA 3H5IA 2FN8A 2M1ZA 1JH9A 3NNDA 3E3MA 4PYRA 1ISRA 2FMIA 2FKAA 4PEVA 5TQ2B 5KQGA 3KSMA 1YIOA 4NV3A 1W9HA 5GOTA 1S8NA 1TLFA 3MA0A 3EAFA 5HSGA 3I09A 4KFCA 3F6CA 2WJAA 2R25B 4DADA 3QX9A 4S05A 1JWLA 2A9OA 2QR3A 2ZAYA 3F73A 4PE5B 1OXKB 2FN9A 1C4WA 1PEAA 2YHAA 1B00A 2XDYA 1ISSA 4GPAA 2FQYA 3I42A 9ABPA 4G0YA 2JRLA 3NBMA 4W5TA 2QW1A 3NHMA 3A10A 2RJOA 1Z18A 4MR9A 2LUOA 1OXBB 1DRKA 2WJWA 4O1HA 2A9PA 4KK4A 3LUCA 3H75A 3O1HB 1D5WA 3D8UA 5F64A 2JB9A 3OM0A 4W5OA 3H5LA 2PUDA 1ZDMA 4MQFB 5CNIA 2F8TA 1KMIY 3H5TA 3EQ2A 3OLYA 4YCSA 2OQRA 2A9RA 3SQNA 1BDIA 1DZ3A 5DGCA 4MAAA 1QP0A 1QP7A 3IPAA 1NXPA 2X7XA 1MAVA 2QVGA 3CRNA 1LJUA 1ZGGA 3KHTA 2OENG 3N6VA 2VK2A 4TLMB 4OTZA 5IC5A 2WMYA 4YWHA 4RXTA 4EVQA 2PUBA 4F12A 2LIVA 1ZN2A 1Z13A 3EGCA 4UHJA 4NCBA 4NCAA 3QLVA 6ABPA 2FMFA 2JBAB 1J56A 4ETIA 4KZKA 3LMKA 2QXYA 1SXHA 3DGFC 3SAJA 3UKJA 1TVMA 2FXIA 3MIZA 2E4ZA 1QNLA 3IDOA 5KC8A 5C5EA 3HJFA 4ETNA 3CZ5A 3C3WA 2LPMA 3HV2A 5IULC 4LZLA 2WB4A 3JS5A 3OQOA 1DC8A 4Z9BA 1DBPA 1MIHA 2NT3A 3H6GA 4MS4A 4Q6BA 2H0AA 3CNBA 3OM1A 3N0WA 4ZMRA 2GI4A 2QZJA 3O74A 4LX8A 1LBHA 4MRMA 2PKXA 3S99A 1ZVVA 4EGSA 2B4AA 1R8JA 1XHEA 3DBIA 4RK7A 1Z2DA 1QQBA 1E2BA 2I6FA 4NICA 4Z0NA 3C6QA 1E6KA 4YR7A 5CHYA 3LUGA 1P8AA 3C97A 4JB2A 1YTUA 5CNMA 5IX8A 3LUKA 3O2QB 4YLEA 3DLHA 3CHYA 4RXUA 4RK5A 5GQSA 5EWMA 1M5UA 3KG2A 3HS3A 4ML3A 4MYRA 5BRAA 1PNRA 3FGZA 1EWTA 1DRJA 2VUHB 2PUEA 4MQEA 2NT4A 5EWJA 3TO5A 4E7OA 3GA5A 2GWRA 3KTOA 1ZY2A 5JNWA 5EWLB 2JK1A 5TQ0B 4XARA 4O1IA 4RV5A 3MMNA 3IP7A 5IUJC 2E4YA 2FQXA 4MS1B 5TQJA 2BGGA 1ZESA 3VNBA 1BAPA 2AYXA 3BREA 2PAFA 4H3KB 4D6XA 1KRXA 3KLOA 4IF4A 4EVRA 3ILYA 3MM4A 3C3KA 4L4UA 1BDHA 1K68A 3QLVC 1TJYA 3HDGA 4LE1A 4FE7A 1Y1LA 2IYNA 1D4ZA 3O2SB 2LBPA 1Z16A 1GCAA
chains in the Genus database with same CATH superfamily
2AN1A 4MIEA 5ALNA 2I7VA 3BRWD 3FMGA 4YY3B 2OVBA 4RL6A 3KFXA 2EF0A 3KZKA 5T8KA 2O8EA 4HDCA 3ZIAA 1LBTA 2WPDD 3QE2A 3KYIB 1OWNA 3M1IA 4FDTA 3PR1A 2ORVA 1ZH0A 2VQSA 4J8PA 2CNWA 1IVNA 4KMRA 5IAKA 4ES6A 5LQAA 1S96A 3PLAE 3GHYA 3JWHA 4UHHA 1PNTA 5EN4A 2GKOA 1JSRA 2X8JB 1H23A 2ZIZA 1DT5A 2R3SA 1AJEA 1YJQA 3LU1A 1U1FA 2QP4A 2VHQA 3IAS6 4UOZA 3WLKX 1V11B 4M9SA 1Q74A 1LPMA 1VLJA 1BC5A 2NTJA 2POCA 2HSGA 3HC7A 4BDTA 4PX9A 4QNNA 1WG8A 2W37A 3G59A 3G85A 1I3LA 3OZVA 3RVLA 4HS4A 4LF7B 3O4HA 2C78A 2VH5R 2ZIEA 4LK2A 2P0EA 2RGYA 4Q4JA 2JLBA 5FQOA 3NDBB 3UGTA 1VLZA 1V1RA 3TNYA 5ITZB 3OD1A 5DX0A 4IEEA 4K9OA 1E2EA 3VH3A 4ZCLA 4RLHA 3MQ4A 4HEHA 4G01B 4JJ7A 3WJ1A 4UTOA 4LYEA 3E35A 1X86B 1I3NA 4XD2A 1U0RA 3QPWA 2F8SA 1WD5A 1R0XA 3QQPA 5CBKA 2EQBA 1JH8A 1PJRA 3GN1A 4HYQA 3KJNA 1CJUC 1MMFB 2JAPA 2VZEA 1CVIA 4MWEA 2MIIA 4QARA 2G9NA 1VZ3A 4LRUA 1SUEA 3G5LA 4N0PA 4Q3BA 3UC5A 5BVHA 2I9KA 1NAIA 2IUTA 2ZUDA 1VG8A 4K05A 2DWPA 1Z4MA 2FLKA 4DNXA 5B4TA 5LQJA 4N7RA 3RVOA 2P7IA 3IKTA 4J3FA 3W7AA 1SUFA 3DVAA 4IRUB 3H4MA 4IX1A 4FSHA 1QFSA 1V16A 3OEEA 4WXHA 5A3RA 5LJLA 1L7AA 3BZUA 3LV8A 4WCFC 3IT3A 5AJYA 4ZREA 3PZBA 4DEYA 5EE9A 2LWIA 1Y6FA 1U7ZA 4IIJB 2B34A 3W8DA 3L07A 3WL7A 5FTWA 1IEQA 1G20B 1LTQA 2PUHA 3FF4A 3CUYA 3HE3A 3K0HA 3G8CA 3DBOB 3WC4A 1GARA 1UXIA 2RHDA 2QRJA 1L5VA 1ZH8A 2QJOA 2QP9X 4EHDA 1W87A 3AEXA 3W9BA 1V4BA 3OP1A 2GN6A 3H7IA 3A37A 1JSXA 3DKPA 3N3BC 4NPCA 4F96A 2J0QA 2V9PA 1YFZA 2GETA 1ZONA 1T8YA 1C7FA 2P6RA 1D04A 3QXCA 4MUIA 2C84A 1G66A 5E95A 1GAWA 2PBRA 3ROFA 3UMCA 4TTIA 2B4YA 7ADHA 2WZBA 1YBMA 1E4OA 1A72A 1OVMA 1NN1A 2V6MA 2XX3A 3EA0A 3FPJA 1PJ3A 4GYYA 3OWHA 1JVNA 1KSFX 4ZVKA 5TC4A 4L4XA 3RJ9A 1SQ5A 3WMXA 4B7UA 3DNMA 1ONNA 1J9GA 2GHIA 5BV2P 2RHLA 1OLUB 3GD5A 2F64A 4DA0A 1GCGA 3QUCA 5H3CA 2IELA 2EHDA 1NNSA 2RGAA 4BWFB 4LRXA 3GGPA 1R0KA 2NQ8A 3PD1A 1TVKB 1C0LA 1CW2B 2OILA 2NVWA 2XNSA 1XTTA 1B1CA 2XITA 3TYXA 4Z54A 1JR3D 3SMQA 3FHCB 4IAOA 1VE1A 1GIAA 2NSYA 5BN3A 1IY1A 5D5HA 3PX7A 4QM6A 2FTKE 1WABA 3HNPA 4A6PA 4YDQA 5SYAA 5CK5A 3CW2A 1UR5A 4WUTA 1VL6A 1GN8A 4AKSA 1WUYA 2CF6A 3L04A 3P94A 4IIUA 4B76A 2YWEA 5FPPA 4Q1BA 5JYEA 2DT5A 4RH3A 3PHCA 1GUDA 4FEGA 3TUJC 4RHEA 1Q1AA 2KQUA 3WO0A 5E3HA 4NH4A 2NWQA 3RU3A 1GR0A 3U13A 5IJ9B 3PUXA 1UOQA 1ZMTA 4UOQA 5G0WA 1TK9A 5ED0A 1SHZA 1FNBA 4JA0A 3IAM6 4V24A 2A9QA 3I3OA 5DT9A 1L3IA 3A9TA 3BIXA 4MYCA 5JJLA 1GG9A 2HMAA 3OT1A 1Q0LA 3OA0A 1EFRA 1HYBA 4YVFA 5JALA 4JFRA 1K66A 3KTFA 2IS4A 1KAGA 1QRDA 1TD9A 3UEOA 2F3TA 2PUAA 3PS9A 1E2UA 3OOEA 3ZBPA 3QOXA 2JGIA 1M8PA 4D8YA 4YRBA 1FSGA 4G9GA 4QXMA 4GOLD 1AQUA 4ONEA 2HZBA 3EIEA 3K1TA 4JL5A 4K87A 4OHWA 4ZJUA 4RPKA 4XJSA 3AESA 4JLKA 4OI4A 1WMDA 1A7KA 4MWDA 2GQ0A 4LBVA 4LRTB 4BP9A 2CKDA 3E1GA 2G6BA 3MT9A 1KAMA 3T1OA 4BKRA 3I64A 1FXWA 1VRCA 4I3GA 4AKEA 2DXIA 1XRPA 5KCZA 1YQUA 4HP8A 3NFYA 5EJ5A 4Q4LA 4TMWA 1U2QA 3DUFA 3QEKA 2IZ5A 1DKNA 1YQWA 2AOVA 2VJYA 1YR9A 3LDHA 3TEMA 3TSZA 2OV8A 2A0UA 4CL2A 2LRHA 3KQPA 5LNK6 1UC9A 3NTXA 5FBVB 5F23A 1MCZA 2WRZA 3JV7A 2CJFA 3V4VB 3A4VA 2XT6A 1UJBA 4LOKA 2IU4A 4FS8A 2A1IA 4RV4A 3M3PA 2IIPA 4FZJA 4K86A 5DCWA 3RU9A 5FLKA 2BR4A 2I2XB 2DU8A 4WBNA 1DXQA 4OL0A 3TFWA 2C8LA 5JWRA 2GJSA 2ZSDA 4N8SA 3EFHA 1GHTA 1J8FA 3I37X 3IA2A 3MXTA 4EEKA 1P7CA 1YXMA 3U62A 3WLQA 1O6GA 3WGGA 2ZUWA 1NZDA 2GHRA 2GN9A 3A25A 2H2DA 2WU0A 1S7CA 1KDTA 3P9KA 4UJ3A 4P22A 5IS2A 4RH1A 5CXXA 4JP5A 4YAIA 5C7LO 5GTDA 3I9FA 4Z4QA 2IXFA 1AK2A 5EPUA 1KPHA 1OXXK 2ZCVA 2WINI 1ULTA 1A5BB 2QY9A 3HADA 4OQLA 4MDFA 3I1YA 3F0TA 3L6RA 5FPTA 3S7TA 1C9KA 4WJZA 1NR5A 8GPBA 1NPDA 1SY7A 1WXXA 4JGBA 1DE0A 4LBZA 1PL7A 5EA2A 3UV7A 5EXXA 3WB1A 2GA8A 3UOGA 1O95C 3EGXB 4HWKA 4GP7A 4NWIA 2J4CA 2JFXA 4L2IB 3MJFA 2H18A 3DBLB 4XLTA 2Q0HA 5F3RA 1MB2A 3K05A 3TZKA 1RMQA 2FOIA 3DD5A 2C77A 4B2IA 3FSJX 2IVFA 2OFOA 2W8BA 1B8PA 3P9YA 5GMOA 4A3SA 3SP1A 4UHDA 4C76A 4RTMA 3E5NA 2VDOB 4YFYA 3HJTA 3D8BA 1LF0A 1P44A 2OYSA 5A4AA 4G0ZA 1HLDA 3EIHA 4KBFA 3H8WA 2BDEA 4XUCA 4YGXB 1O96B 2BIFA 2D8MA 3W3AA 3ZXIA 3OZIA 3B9RA 3QW2A 4CV3A 4DLPA 1JLHA 2A78A 4ND2A 2G9UA 2OWEA 3LZ6A 4GBGA 1KVSA 4YJ2B 3URMA 3AFIA 4P4TA 4CMEC 4KREA 4E4TA 1DHTA 2HY7A 2GYUA 1MVOA 4B75A 3DV9A 1WSBA 4G0MA 4L08A 3CUKA 1UBNA 4EB6B 3D6TB 5AW5A 1QX4A 3FDJA 4H1TA 1N75A 2EFEB 1JIUA 2ZPTX 1MO6A 2XW6A 4GRAA 4YRPA 4CDGA 1G8YA 3ZUPA 1JBKA 3HXPA 4F21A 4D4GA 1EHCA 1Z07A 4B8WA 2Q5IA 2IKSA 3HEMA 3IP8A 2PR7A 3PB3A 1K2VN 1ZM3A 2B9VA 2IUSA 2VF5X 1VHLA 1IG3A 2QD4A 3MHPA 3FHJA 4J0CA 4P7JA 1GZ3A 3V8RA 4TXMA 1L4YA 2FWIA 2QX9A 4Q9KA 4X95A 1SCBA 3GPBA 4CF7A 2FXVA 1GPAA 4OHYA 1XDGA 3MBKA 4FLMA 3HBJA 4J1SA 2PS0A 4YRSA 5LN1A 5LP6F 4LJLA 4M53A 3PEWA 1Y5NA 3PL1A 3RCBA 3EVAA 1PTJA 1JDBC 3UKDA 3LKBA 3IMCA 5A6VA 4BFXA 3PNSA 1NZFA 3KVRA 5DX8A 1JFRA 4FGWA 4LGVA 3ID6C 4QXPA 4XTCS 3T34A 2V7EA 4W4TA 3SJUA 4L9RA 3DZDA 4PU0A 3V4SA 1E3WB 4XE5A 1HLPA 5JASA 2MCFA 4AW9A 3AWIA 5IVDA 1DARA 1LPPA 2DCMA 2GS9A 1EDBA 3OIFA 5FBLB 3ZKWB 1CG6A 3UMBA 4OEHA 1Y5LA 1NBEA 4JASB 2DHDA 2IEIA 2EJBA 1HDEA 1QIFA 3U4HA 1EWKA 3ZQ6A 1DEAA 1ODCA 3KPYA 4KV7A 4YYEA 1JKJA 5HIKA 3FWNA 2JLWA 3RABA 1BXZA 3RVKA 1OJ7A 1R5BA 3IQIX 4IO1A 3RRBA 4YCAA 3SZGA 4XB2A 1QE3A 4C2AA 3ANMA 4EELA 1K6EA 1V9CA 4ESEA 1C30B 4NZPA 5A05A 2ZYGA 2CZQA 1X0VA 5A06A 4HH3C 4L5BA 4HAIA 4N12A 4M9UA 4EG7A 4F2HA 5LU8A 1O8CA 1O97C 2VHUA 2Q6KA 3DZHA 4XH9B 1BGVA 4XUEA 3IE2A 3M1YA 4GGOA 4CODB 4JP8A 3UT0A 3BCHA 1FMCA 2IJGX 3F1KA 1RHMA 4JP3A 4PSDA 1Q16A 4L8GA 5HWSA 3WAGA 2WC1A 1KDOA 5KTNA 1TTPB 1YQDA 1YZUA 1FFYA 1IBRA 2A0YA 3M6MD 4Q47A 4HZIA 2A1UA 1M1YB 3W5UA 2EKDA 3FCEA 4MICA 4DCJA 2WMOB 2CXHA 4EW6A 2DPLA 4RFVA 2W4MA 3B6MA 3N70A 1Y8QB 4WLVA 3TOXA 3OBBA 2BMEA 4NNJA 1N92A 1E63A 5J5VA 4EKEA 2J9ZB 1CQPA 2P6MA 4G09A 4C0HA 4A10A 1UC4B 2B82A 2Q1WA 1XMPA 3IQGX 2C59A 1Q44A 4XR4A 2I1WA 1U2GA 1Q2XA 3OTHA 3TM5A 3UQYS 1Y3AA 3DAGA 2VDWB 2YCBA 1PZEA 1VCNA 3CH4B 3HJRA 5FBRB 2Z5VA 1WSDA 4HVAA 4OHKA 4S2EA 3G0OA 4R2MA 3L3BA 4KQGA 5FQNA 1I6LA 2DYKA 1G7CA 3LDUA 4KGVA 1Z3IX 1XZLA 1DRUA 1I5OA 3ETLA 3GLTA 4QJBA 4R2JA 3ZZMA 1LC3A 4LVUA 2DJ5A 1KEKA 2NAPA 3WGKA 2JCBA 1I94B 1NMZA 2IEAA 5CITA 3KT6A 4DTCA 4CZ2A 3FN4A 3OVMA 1E2MA 2A9FA 2O5RA 1J09A 1CRZA 2AFHA 1JDSA 3BJMA 3C8DA 2VNAA 4ZGWA 2ZROA 4ZVPA 5BN4A 3C24A 4WY2A 3SIXA 2QY6A 4DNOA 2O6HA 2XVXA 4GPZA 3OZUA 2XWSA 4W1SA 3S2UA 1ZJZA 1T43A 2OBBA 5FLEX 3GPLA 2JFHA 4PC3A 3UAWA 4DT1B 5AICA 1DTSA 1LJUA 5KO2A 1A5TA 1ZGGA 3ES9A 2GXAA 2D06A 5DHSA 1IB0A 4CL0A 4RVHA 1FFAA 4NBVA 4ZXPA 1YHNA 3EGEA 4HGZA 5CTJA 2DUJA 3OF5A 5ALGA 4RXTA 5IC5A 4DUGD 1PL6A 2XZTA 1F4LA 1G3MA 4WZBB 4E33A 1V5FA 1DT3A 4IOKA 4C08A 1GDTA 2NU6A 1L5HB 3DDCA 3Q8MA 1OXUA 4UHBA 2JRCA 3ZWAA 5ESXA 1PS0A 2ZQ5A 4Z1MD 1JEAA 4LTNA 2JK0A 2G08A 3CR3C 3DGFC 2JARA 2WP8J 3M7IA 4B80A 2QN6A 2PZMA 4I5DA 5BT8A 1A7AA 1NUPA 4DMHA 3ADOA 2J0EA 3H0EA 1Y1PA 1UMCA 1D2NA 1G2IA 2II6A 2ZRKA 3E7DA 3PWSA 3W3AH 3T4XA 2IYEA 4FFBA 4WKBA 3KWJA 5AXCA 3ND9A 4E5DA 1T35A 2AFIA 2RKBA 3QVSA 1OZAA 5JPCA 4L22A 3GN2A 1Z29A 2P3LA 4IGFA 3ZDBA 1MVNA 1R12A 4MKXA 4OB8A 5EQFA 5HKLA 2ZYSA 3VYRB 2G0NA 2GI4A 4OMUA 1IBLB 1N6PA 4WSOA 1B0AA 4HJXA 1P6XA 1ZVVA 2O3TA 4BJHB 2HCJB 5CFRA 2ZB3A 1EK6A 1VLQA 3C6QA 3A1DA 2Y1OA 3IEVA 4EQ6B 4K3VA 3NBQA 1PWEA 1NM5A 3BGSA 2D1YA 4C4SA 4RXUA 1BQEA 4XVRA 3ZNPA 2ONCA 2ZJ7A 1V7ZA 3KG2A 3OWOA 4QBIA 5J2TB 5HBGA 1AGXA 3FJOA 4M7OA 4P8RA 2HA0A 4C07A 1J9ZA 3HZRA 5FPHA 4G63A 1OPXA 1TYCA 1SVIA 2HUPA 4W9NC 4XVCA 5EEHA 1AQYA 2ZR0A 4CMIB 1R37A 4DREA 4RV5A 3ABRB 5D7BA 1JTVA 4R9RA 1WKCA 5JY6A 3CGWA 3JVVA 2AYXA 2WWHA 1ONPA 2C4KA 4HQNA 1ZG3A 4QJIA 4TSFD 2I7DA 1G7TA 1JZTA 2WKSA 3T9BA 3WGZA 4ER7A 4YI3A 2PLRA 1E96A 4LRWA 3KUXA 2V5AA 3FMPB 1ADYA 3NKVA 4MYSA 4DMCA 1D4ZA 5HCNA 2EWVA 5IM4F 3O2SB 2NP6A 4CJXA 1P31A 1T2UA 3GC6A 5CXSA 1P1JA 4N18A 3W8FA 3K94A 1KQ3A 1GFWA 4LF9B 1L5QA 2DWQA 2WHXA 1C3VA 1GD1O 4JJ4A 4ZYYA 4IIGA 2YJTD 2NW6A 4RAQA 3I3SR 4YRTA 3D0KA 1YB2A 2WV9A 3OCZA 1E7YA 2WUVA 2VTBA 4Q1FA 1QRRA 1YCHA 2DT8A 2E5FA 2GBGA 5BVGB 2YV4A 3CRVA 1MO3A 4EY4A 1M2OB 3OQJA 2XUPA 3V4LA 2Y2VA 2P62A 1CDDA 2ZRFA 1Q1GA 4OATA 4PFKA 4DXHA 3L8GA 1LVGA 1O0SA 1EFTA 3OIGA 3U4IA 5TVGA 1N3BA 3ND8A 4CQLA 4RVDA 3H2SA 3PR2B 2FPPA 1I51A 1GUYA 4GMGA 4PZCA 1K3UB 1L4HA 2AW3A 2WI8A 2A67A 4G9EA 1FXSA 3I45A 4D74A 1VTKA 2JHCA 4EYQA 3ZVKA 5JDIC 3MTDA 4RMHA 1GU0A 4LXYA 1IDN1 3BIFA 1CUHA 4FE3A 1L5WA 5TV2A 2P65A 3PNMA 4NMMA 2BYTA 5FUYA 3STXA 1N5JA 4C04A 3NWOA 3TVTA 4NYJQ 1YZKA 5BV8A 1P60A 5BSRA 3L4EA 3P2EA 4CUKA 2P2GA 5TJHA 3UMFA 1ZRHA 3IJRA 1KERA 2PO7A 4OQNA 4BB6A 4B6SA 1Y33E 5JH7A 4W7SA 3K53A 2O8FB 1EJBA 1XQYA 4JROA 5HK9A 5CJ2A 1WP9A 3C45A 4Y98A 1PR3A 3S81A 1N6NA 1B8NA 1FFWA 4KN6A 1OY1A 1H6DA 3F47A 1NFQA 1Q22A 4K28A 1MHPA 4OBWA 1JQ5A 5C35A 1TC1A 1EJ0A 4ZOLF 3S70A 3A26A 5KX5A 4ZKDA 5AW1A 1NVUQ 3COWA 4JWKA 3OO1A 3U4MA 4D4HA 4HVCA 3C43A 4DIUA 2G0TA 3UAVA 3HP7A 1DTWB 5I7HA 1X7XA 3FKQA 3G0GA 3W5BA 2JIDA 1HA3A 5FO0A 4N48A 3BDIA 2QS9A 4FBLA 1WXEA 3CX4A 4IQFA 1F3LA 3N2GA 3FGOA 3NIGB 1NA5A 1XIVA 2QYSA 4RPLA 2ZOSA 3T5PA 3FKSD 1N1MA 5IARA 3RU2A 4TN5A 2WM9B 4IIFA 2XE6A 3JQ9C 4GXTA 4AJLA 2IL1A 3EWAA 1EVEA 5H0IA 1RQ7A 1TFRA 4ZDWA 2BPOA 3F5QA 3KTAA 4IXTA 4KODA 5TEWA 3C8ZA 2X5JO 2O07A 4KACA 4M9ZA 2GEVA 1M2FA 4FMBB 2YJZA 1SHJA 3G8BA 1IPHA 1QHNA 2O7NA 1T5BA 1WEHA 1JLLA 2O3JA 3DTTA 3N8NA 3DZJA 3OPQA 3TL3A 4CFYA 4G6ZA 1Z2AA 4LF5B 2Q4TA 1TA0A 3IUQA 1NVDA 4IXNA 4G1UC 5DI3A 2FZVA 2V3CC 1JMYA 2YDYA 3M4ZA 4RCZA 1G291 5JMTA 4L5YA 5EVCA 1GGKA 2CV2A 3ZWPA 3RRNA 3D6NB 4FD3A 4I4LA 3IP6A 4W8HA 3QE0A 2QPOA 2HWXA 1JJIA 2Z8YA 3BWVA 4TMKA 5HM6A 1MC4A 1CYDA 2PGDA 3KP1A 1K92A 1VFPA 2C1ZA 3VC7A 1ZA1A 1W4RA 2K87A 1KPIA 1Z62A 3WB9A 2KI5A 5DM0A 4A2QA 4ITUA 4S04A 1CKEA 3L8CA 5L4NA 1IXKA 3HO1A 3N39C 1U0GA 2LXNA 4YV2A 3IYLW 4B0PA 5ENDA 3QMPA 1T5IA 4MQ6A 2DQ4A 2X3YA 4PCUA 1EFKA 4N03A 3RTDA 3B1WA 2A33A 3EUWA 1BN7A 2WVHA 3NC1C 4MVYA 4RHXA 2ZCJA 2BKLA 1RYYA 4EMSA 5BNTA 4URHA 2ZWAA 4LZOA 1QG0A 5TX7A 3RWMB 3PQ6A 1SVWA 4XD7A 4CTMA 1SEPA 5DHUA 3JD4A 4DZTA 1RXIA 1EFPA 5HJ2A 1XMVA 5LM3A 4M4SA 2EZ9A 4MV3A 3ZHVA 4CDMA 1TVCA 1P77A 5EJ7A 5LIRA 1NUHA 5EZYA 3NVDA 4Q1VA 1SH7A 3CR8A 1IRIA 1NRIA 2AH5A 2VF8A 2VZ8A 4H6XA 4MI9A 1MOSA 4MRAA 4O2BF 4Z49A 1EH5A 4HK4A 5EXSA 4I1RA 2R86A 2VDJA 4B4UA 5BN1A 3K0CC 3O8CA 1ID1A 1L4BA 5DNWA 1PFKA 1NZJA 3HP4A 3RYHA 1XTKA 2FWPA 4A9AA 4GVLA 1AKUA 2QNIA 4RZXA 1U4SA 1KE2A 1P9LA 1PEYA 3N53A 2NUPA 1GYRA 3W2HA 4BJ6A 1AQNA 4INZA 3LDGA 4CCYB 2WYWA 1UAAA 1X1DA 1ZVJA 3A2LA 3ORYA 1HPLA 4Z9AA 4E51A 2ZXEA 2I7TA 2VO1A 3DDZX 3IUSA 3LIIA 4KPGA 4DLKA 3IELA 3S1LA 4AD8A 4DQXA 2JVKA 2MSLA 3IUMA 1SKAA 2BEVA 3B53X 1TI7A 2RGRA 4TTVA 1OI3A 2EG5A 3FUCA 1CJCA 4I4TA 4PY2A 4UMFA 4JYCA 2PUCA 1XKXA 3KQNA 4D2IA 3JVUA 2QLNA 2GZSA 1D6JA 3KQOA 4OBBA 5DH9A 4DWWA 4D7AA 1Y4UA 2I7CA 3EPJA 1X77A 2KHZA 2Q07A 2R6GA 4J1TA 2AWNA 4LYHA 4C4XA 5I5EA 1X7WB 3H8JA 4ZU1X 3FY4A 3R24A 2PKCA 2BBSA 2F55A 1PJLA 1SG9A 2GCPA 4NH0A 3RDPA 5EHZA 4C0BA 2VNHA 3MOGA 5TPWA 2PDAA 1NUUA 4HWOA 2JW5A 3VJRA 2J9YB 3VHXA 2GAOA 5DCUA 3FCOA 1G8GA 4LOJA 1VJDA 3U3XA 1D2CA 3V8BA 4RJ2A 1XV5A 1PG0A 4BN0A 4AMYA 2O8BB 4OK5A 2JS7A 1G1AA 3NVAA 4U1RA 2ACEA 2E48A 2FPIB 1Y9JA 2OGWA 5L53A 3U1TA 1GPWB 1TUBB 5KYGA 2Q1TA 1U7TA 3D8HA 3V6LA 2Y1KA 4CM9D 2J9XB 1J20A 2Z5LA 1NSFA 3AL0C 3EG5A 1KRHA 2RHBA 1Q0UA 5CM2Z 2HMVA 2ZJ8A 3UUGA 3H99A 5TF0A 3LECA 2NO6A 3KT0A 3SSOA 2XNKA 3VPFA 1MQ9A 3EXAA 4X84A 1ESCA 4MCHA 2GERA 1LV7A 4JS0A 3IR5A 1GVNB 3ZV7A 4FU0A 2JFUA 5F73A 5IYZA 3MAAC 4A0FA 2CMKA 3EF0A 4FWBA 3NEPX 4PGMA 3ZGZA 3FVTA 1D2AA 4RC9A 2YVUA 3AR9A 3ZHTA 4J7UA 5CRIA 4CU2A 3LGXA 2EARA 3KQMA 1YQQA 4TTTS 4MR7A 5AJHA 1GO2A 3P9SA 1T26A 2AT1A 1KH3A 2X1HA 1D0SA 3FYUA 3R5FA 4QIHA 4QLOA 4YT2A 5DHPA 4RK6A 2HCFA 4EHKA 1P7YA 1AHPA 3H9BA 3ZJTA 1JDUA 3V5NA 2V6JA 2DBZA 5I9NA 1RCFA 2R8ZA 1XU9A 1Z5OA 4DV0B 3EMVA 4IQ4A 3NGLA 1USKA 4ZO4A 3RC8A 3UCEA 1R18A 3WDSA 3L49A 5I7RA 1A9XA 5AM3A 3CNLA 3VNRA 3IMKA 3GDWA 3U7JA 2I4OA 5CXUA 1R6XA 3NC0C 1LTKA 5G02A 1LZLA 1R74A 3QMVA 4AKIA 5CBPB 3DKRA 3QPVA 1UPAA 3MS2A 1T9CA 5JMOA 1H0KA 3FTEA 1NXSA 3BCRA 1ZR2A 3B85A 3D8TA 5KB3A 3VO8A 3ZE2B 3U3JA 5GONA 2QXTA 3QXXA 1ONSA 3ZCPA 1UJ4A 3LSTA 3HVRA 4IJWA 1BWRA 5AOVA 2EFGA 5KX5F 1WTCA 3LVBA 3L7CA 5DHRA 4NESA 1GZDA 1IHPA 3LPNA 3PGLA 1GV1A 4QQNA 1ZN8A 3CZ4A 3MT8A 2BMVA 2OBNA 3RROA 4YBRA 7MDHA 3A9RA 2C42A 1OHHD 3C74A 1NIJA 1NJSA 1BWQA 1G7RA 1POXA 3LUPA 1EE2A 3R6WA 4LQDA 4AZSA 3A32A 3IDSA 3LHFA 1QWOA 3IALA 1FRNA 3H13A 3M2TA 3W9SA 3UMJA 1G8FA 3DMRA 4ZQBA 3ZEIA 4Q3DA 4UDYX 2W2LD 1U2EA 3AL2A 1LBEA 3OQ6A 4ON9A 4GR9A 3LHKA 3X1YA 4S1TA 2AG1A 3IQXA 1IULA 2VF7A 5I4BA 2JGEA 2CZCA 1FRVA 2GRJA 3K8OE 3NHSA 1Y3IA 3T6KA 7REQA 2RHGB 4IFTA 5JZSA 1RRVA 1JIKA 1EUYA 5K4GA 3U3RA 1RAEA 4KRFA 2BE9A 1EKXA 5KYUA 1HL7A 1L1QA 1NVMB 3LFHA 1YZFA 3PDUA 4K2HA 4DJFC 1PSZA 2NZWA 2DEUA 1WJGA 3K5PA 4NBLA 4P7FA 1EX6A 3NP7A 4PICA 5JLJA 4RLFA 1QS0A 2VYVD 1BVUA 4JAVC 1NDQA 1N0HA 4M8NE 5HDQA 2GPYA 4E5YA 4QNMA 1SR8A 4A8JA 4F4UA 4JYPA 5GP1A 2CMDA 2CK3A 1E3LA 1G8AA 2FEPA 4MGYR 4NAVA 1IZ7A 4NBWA 4C7JA 2WHEA 3H5NA 4WESA 1ZBDA 3G2MA 2UYCA 3DM9B 3LPDA 1TPYA 1IBCA 2QLJA 1OGJA 1BOFA 3ZDYB 1JG7A 2W6PA 3CXRA 2AQ8A 4GYWA 3T0GA 1PJ4A 1MLDA 5A71A 2HWYA 1XO1A 3CIFA 3WLNA 3O5AA 3ZXYA 2OZLA 2ZITA 3R3VA 5H1YA 4CTNA 1US8A 3BAZA 1YS2X 1UJCA 3B1VA 4G84A 5I4CA 1E5QA 4YAFA 1XZDA 1J22A 2ODPA 3DS8A 2WFAA 4U9IS 5DN9A 4B83A 3JYNA 4FHZA 3WR5A 5LDDC 1OI2A 1UXGA 2Q4BA 4EM6A 1VSQA 2H5EA 3AP1A 3BDVA 2IYSA 2WBLC 3THXA 4AJNA 1RKBA 4I50A 4XM1A 4JV5B 4YLYA 5K3OA 1JH9A 4PC2A 5J47A 2HRQA 4O4LF 3C0KA 3P0HA 5TQ2B 1N4DA 2YDXA 1NLZA 4INPA 5C4GB 3U2QA 1UPBA 2WVGA 2QUIA 3H2JA 1RQNA 6Q21A 1JEOA 8ATCA 3DMNA 4DGQA 3QBJA 2NXWA 4O0LA 4M9XA 4RD2A 2AHRA 2JGMA 2WUGA 4V0SA 3FBGA 3A1NA 3TRDA 4ZHQB 5IJ0A 1HUQA 1WUTA 3JAKA 1FE8A 1ZNWA 3IVCA 1E0SA 4ND8A 4RKEA 4UAJA 4ZVQA 5H70A 5I9TA 2QR3A 1ISMA 5FDFA 2QR2A 1KYQA 2ICAA 1AXRA 2K7ZA 2KB0A 2ZS8A 1B00A 3MGKA 5F5XA 5GAJA 4DYDA 3O7WA 4QBKA 2FQYA 1IDOA 4GS5A 9ABPA 1SBCA 4G0YA 3TZBA 1C7RA 4REOA 2YRFA 1L8OA 3PIRA 3GMIA 4DRXB 5IDVA 4W5TA 5DBFA 3ZDFA 1N36B 5D6NA 3TZQA 1JAHA 5A02A 3IGFA 3JQ7A 1FVFA 1LI5A 5AI6A 3IOBA 3FTFA 3BAFA 3ZV4A 4AG6A 1JKMA 1TO2E 3CKLA 3HU1A 3L9XA 5DSTA 1S2OA 1XJWA 1ZDMA 3HCAA 1U8CB 4WEOA 5DXAA 5ADHA 4EYSA 4LQ4A 3JW8A 1FTQA 3DOJA 3V2GA 3EYWA 3VYWA 3CF4G 2GCOB 2HBYA 6PFKA 3AHFA 1OTYA 3TW8A 1DZ3A 1H0RA 3JASB 3UJ7A 5FKJA 3WQBA 2AWOA 1UK9A 2QYOA 1MAVA 1Y48E 2X7XA 1BU5A 4ZT5A 1P29A 3IQWA 3BUSA 3GX1A 4H6VA 1ADJA 2W6ZA 2ZIAA 1VJCA 4KW7A 1Y6GA 3H0KA 1O9GA 1MJGA 5LLDA 2BN4A 1HZZC 3KDAA 2GLUA 4EVQA 1I4LD 5HQ3A 2RB4A 5CIWA 4B8YA 2E55A 4NHOA 3EGDB 5KUTA 1ETHA 1UK8A 4DIOA 2J3HA 2OD2A 2QG4A 2JBAB 2X42A 1FX1A 3AM4A 1FMTA 2BJHA 3MJEA 4OXXA 4EJMA 4ETIA 3G17A 3LBNA 2F43B 4IDCA 2FRDA 1QRUA 2LDXA 4UM8B 2GF9A 4B3TB 2EJTA 4G1VA 4OAPA 5KC8A 3LZCA 2FPXA 2KSQA 3UCXA 3U80A 4C89A 1EZ4A 4GYKA 1MUUA 4AU1A 4BKPA 4HH4A 3V7YA 1IZ8A 2CMGA 2O05A 4DM7A 4NXMB 2CKMA 3TRIA 2FW1A 3EVDA 2VHEA 2WAYA 4EG4A 1R66A 1XTUA 3KRTA 3QBDA 4YPFA 4R8LA 4ZAZA 1RQRA 4JNKA 3OQOA 2YYZA 2GKSA 3VNQA 1EWRA 2V7QD 3Q9NA 3ZHRA 1QDEA 3PC8A 2FCRA 4ZZIA 4XRRA 4F6RB 5DBOA 4ZCTA 1PE0A 4G0UA 4GMHA 1CS0B 1R8JA 2F6RA 2GZRA 3VI3B 5HXAA 1QQBA 2EJVA 1B3RA 3JQCA 4QEKA 3T52A 2ZYIA 4R8MA 3RADC 4I9NA 1J21A 2E85A 1U11A 4M76B 4JBIA 4E5VA 3D54D 5CFOA 1JWBB 2DE0X 1RM0A 2PM8A 2P91A 1GT6A 2PZBA 2X86A 3E2MA 4Q24A 4BRSA 5JDCA 3GELA 4GW3A 3LW7A 4JUBA 5IP5A 1E7RA 4GT1A 4PG7A 3RAPR 3H8SA 2C20A 2QD5A 2B8JA 3AVTA 3K1YA 4RPGA 1KJIA 1Q14A 3MD0A 4DV4B 1QZTA 1M7GA 3KTOA 1ZY2A 2FW8A 4KQIA 4QG3A 4ZZ0A 3ZNOA 4GX2A 4E21A 5CLJA 3HO8A 1ZXXA 1M2KA 3RS9A 1BAPA 4MVJE 1R6DA 1C7EA 1PGOA 2BEUA 1J42A 1DAPA 2R5NA 3F7TA 1ISPA 1DV1A 3T1QA 2DFLA 2JHGA 5HP4A 4V0KA 2CBZA 1FEZA 3EUAA 1FP2A 1OXVA 1PT9A 2CVFA 1NQXA 2Q0SA 4XGQA 4X7MA 1CJBA 1BEUB 2EV9A 3BIOA 2DRIA 4JJ6A 2ZWPA 4DCNA 5JD5A 1LS6A 1Y8AA 1DEHA 2PX6A 1N2HA 1JR2A 1SHTX 3INGA 4FD2A 3R76A 3M6FA 3QFSA 2ECKA 3G9QA 3B12A 1E9DA 3X44A 4NOJA 4QDTA 2BZGA 2QJWA 1ZOLA 2WF8A 4HXEB 4QD3A 1DCMA 2CB0A 5GOZA 4WOCA 2EF1A 4O4IF 5ES3A 3IS3A 3DBRB 1IJBA 4P33A 3AJAA 4X3OA 5JBIA 3LFTA 3RBAA 4YUZA 3JAMA 1QRAA 1YCFA 1IQPA 2HIGA 2QTGA 3L0IB 3MWDA 2Y93A 4H1HA 2FOXA 4MKRA 2FSHA 4ZO6A 1X8XA 5EC8A 2R8YA 2WKQA 4P4GA 2GAJA 3ZD8A 3A31A 4DR6B 3B1JA 1S8AA 3LP8A 3O0TA 1TD1A 1TM4E 1EEXB 3GEDA 1P5ZB 4KB5A 3GLUA 4QHYA 4WNAA 4ZO8A 1WU7A 4DR2B 3LK6A 1N1DA 4KAJA 1V95A 5DASA 4JP1A 3DE2X 5I5GA 1EDOA 5IUNC 1NV9A 1A9YA 4JYAB 3R5TA 4WWHA 4K9NA 5KINB 4MVJD 4UNPA 5I47A 4NCIA 3TDMA 4F4HA 1H3EA 1JKXA 3HB4X 3EHEA 3CN9A 4HNGA 4NFYA 2I3ZA 2ZUUA 4HCJA 3WGOA 1KDPA 1G4UR 4Z0HO 1E1RD 3K9FC 4GQIA 4N01A 4MW1A 3ZHUA 4P5PA 3KLMX 3GLFA 4H27A 1NQ5A 1RAGA 3O82A 4C2UA 3A28A 3ER8A 3SIPA 1U8FO 3OIDA 4OK3A 5AK5A 2NV0A 3MQ2A 4A92A 4Z6KA 5HNKA 4R8SA 1F48A 1GTRA 1JHMA 1OAAA 1TEXA 3ACDA 4NCNA 4L57A 3KUDA 4CKEA 5IT5A 3H83A 4NY1A 2RGWA 1D4FA 1P1CA 5T4BA 4RE5A 5JXWA 3STYA 1FNDA 3VR2A 1K5DA 3FA2A 3JZIA 1RWPA 3IA7A 4EUHA 1GQRA 2F1JA 3WL6A 5IZCC 3SJAA 1ZSYA 4DIBA 3FGNA 5GM2A 4QFDA 3VKVA 2Z09A 5A2QA 3SN6A 4B3SB 4XXHA 1DDGA 1K6XA 2BTQB 3RFTA 2E2WA 2FZ4A 5L7WA 1IAQA 2WABA 2I33A 5DYTA 1UEIA 4QDXA 3RWBA 3TQCA 4B3JA 1C9MA 1R7RA 1RAAA 3LHIA 4PHFA 5HRAA 4NK5A 5AUQA 5FEMA 3HV0A 2PR2A 1FDVA 3BWDD 1TT5B 3QQ5A 4RD0A 1XMSA 1KZYC 1ONOA 3D0OA 4TL7A 1SB9A 4ND4A 4C9BA 1Z4IA 2Q3LA 3D1JA 4FDLA 3H7AA 3HBAA 3ET4A 4DLAA 5ABPA 2VIIA 3CZRA 1FFXB 4Y0AA 4D9NA 3NEAA 5J2UF 5KOJA 2GN2A 1OZFA 2NYAA 3WO1A 3ER9A 1PEDA 3BA6A 3ZXSA 3QU2A 3LY5A 4CEHA 1MA3A 4G97A 3QEOA 1A5SB 1LLCA 4Q9DA 4BMOB 3R7LA 3QPDA 4FCVA 4H0FA 5SZHB 5DZSA 1Y42X 5L6LB 4QPJC 3V4RA 2ATXA 3JAWB 2XRMA 4I7EA 3WLJA 5JW6A 2NU7B 1T4CA 4A6DA 2CLSA 3T5GA 1Z3CA 2R85A 3K0FA 3KYCB 5L3RA 4V0ME 3T9CA 2PX8A 4RNDB 4RTJA 2NZYA 1ZS9A 2XLCA 3PL5A 3GLHB 2C96A 3OOHA 5CD1A 3MRVA 3N2KB 2UDPA 3LQ1A 3UICA 4EABA 1II8A 2R8EA 4EARA 4ZI7A 1N77A 2QL7A 3L43A 3VFDA 1T15A 3AEKA 1SK9A 1VKNA 5IBQA 3ENKA 3PTAA 2CE7A 2IBTA 5D3MB 3ABOB 3SEQA 1TEZA 1TO6A 4NE2A 2R6CA 5AVZA 3ZCXA 2AGVA 1IOWA 2I6GA 3E3OA 1FBTA 1B42A 1CY6A 2JGRA 5IAJA 1NPYA 1D0VA 3EVZA 1L5SA 3KB1A 2FZLA 2VI5A 3D3NA 3SM9A 1J8QA 1DOZA 2VQ3A 2VNSA 1K6JA 3QFTA 2ZSBA 2ECQA 3KEGA 4QYIB 4DXDA 3I58A 2D8AA 2FRXA 4AMUA 1M1UA 4QYMA 2GPTA 3PKIA 1Y6ZA 2XMCA 4QYSA 3TG8A 4REQB 4MS3B 4UEJA 5T5QA 1ZNQO 3HUTA 1ZWLA 2XI4A 2GKGA 3T7SA 5JG7A 4CIDA 1MABA 1YULA 3TBKA 4BZZA 4LGYA 5LZ8A 4WGGA 1UINA 4OGWA 3GRZA 3EQ8A 5ADVA 1X1AA 4Q1EA 1XT6A 2DBYA 4D3SA 1S2DA 3AHCA 4QUDA 5D3ZA 5BUCA 1WZEA 3ZDXB 2GM3A 1U9IA 3LL7A 2VPQA 4G1CA 4NDNE 1PS8A 4WN3A 1GTMA 1A2OA 1K7FB 3IR7A 1KFEB 3CC8A 4O5AA 3LFUA 4GKJB 3STTA 5AVXA 4JX8A 1RS0A 4FC6A 4IMJB 4RNCA 1SU7A 1ZC3A 2HDNB 1T13A 1TIKA 2QTTA 4RIHA 4DLNA 4ED9A 3QMMA 1SHKA 1ZEJA 3H6HA 2P6UA 1HXHA 1UDRA 2E4WA 3WTBA 3AHGA 4DDKA 5IEJA 5KNLA 1RWKA 1YRLA 4EW1A 2J6IA 2V58A 1QB8A 4IF6A 5I01A 1NBOA 1KSGA 1RT9A 3I8XA 2ORYA 4JSTA 2GM4A 2JFBA 1WXDA 2X5XA 4KUEA 1YL7A 4MDHA 4MXDA 4DM4A 1QYXA 2JDID 1E79D 3KJQA 1QQ7A 2FR0A 3C39A 1RFGE 5IDYA 2I62A 3IP3A 4CT5A 4OI1A 3DZFA 4D9IA 1J2JA 4UTRA 2JG3A 2H4ZA 1HSOA 2IYPA 2OP1A 2F7SA 5FTNA 1NXTA 4JFAA 1YQTA 3IJEB 1OCEA 1X7YB 4Z0TA 2VA8A 2DPYA 2BOVA 2DG2A 3QLJA 2EFHB 2ZJFA 4O3FA 3SX4A 1E9AA 2MMCA 4J0IA 1DU4A 1GGHA 3M82A 4RBNA 4MUFA 4AF6A 2PGAA 1EP2B 1W0JD 3IOMA 3VMMA 4ETMA 2W70A 5BNIA 4NAHA 2IF0A 5T64A 1SPBS 5PGMA 2B3TA 2LV8A 2XDWA 3O9MA 4WOPA 3A1TA 1U2RA 5TS2A 2WTAA 3X1ZA 5LOVF 3X43A 2GH1A 3K73O 2Y99A 4KOEC 4MWBA 4KITB 2GDJA 4XVQA 3WMWA 1CD5A 1O95D 2ZTSA 3IRVA 1QK5A 2QD3A 4WN9B 5B7PA 2FVYA 2H7XA 3PQDA 1BE8A 3QJYA 4RVGA 4YCMA 5JV5A 1DFGA 2W2LA 3RI3A 4UXJA 3HXMA 4FZ3A 4DZRA 5EIFA 2QBYB 1S9HA 1FFGA 2IYXA 2OAGA 2PL9A 2CXTA 2XECA 4NZYA 1VJTA 5DK6A 2L42A 4CG0A 1EK2A 5JT1A 2QRZA 3B5JA 1JFFB 4PFSA 2IYWA 3U40A 5JBQA 3SC2A 3DXYA 1GUFA 3KOUA 1PV1A 2HI0A 4D9HA 3PJDA 4FMCF 1WNTA 5BW8A 3LCMA 1QO0D 4YALA 5KYXA 2GBLC 1EX7A 3OKFA 3OPYA 2Y66A 3ORHA 1YDHA 2VXYA 1SQ6A 1NT4A 3H1TA 3QA3E 3BBLA 3UAYA 3HVUA 3N0TA 4O2RA 4DY6A 1UBEA 1KVTA 4QDOA 1XZPA 2CLIB 1X74A 1C3JA 1QFJA 4QE3A 2VYVA 1D4OA 4IIHA 2W7TA 3BFPA 4PV7A 1TYBE 1X80A 4IUDS 3WBFA 5JCXA 1SU8A 5DCLA 1TMGE 2NUTB 3EZGA 4H0NA 4B2LA 4AYWA 1FTGA 1C3OB 1G2PA 3CNEA 1R8XA 3F6PA 4Q7MB 5TMBA 3TTTA 3MHTA 1NG9A 3N7UA 2XXAB 4XFDA 4G4JA 4K6OA 4X71A 2J9FA 3PC6A 3FOZA 3RPEA 2QUHA 4KXYA 4XDYA 1JIIA 5F33A 2A0FA 4MQUA 2DCUA 4QRIA 1SKMA 1SUSA 4G0PA 4GC9A 5ARDA 3EQZA 1EIZA 1U5BB 1CY0A 1DC7A 2RCYA 2YQ4A 1NI5A 1UDXA 1W93A 1ZJYA 3HNOA 2ZP1A 1UF9A 3H9GA 3TRJA 2EP5A 3DMYA 3VNUA 2NZVG 4DAOA 4B9EA 3ZXXA 4TTRA 4R4JA 1N2OA 1VFNA 1NVEA 3LQQA 4R8KA 5C5IA 4RSHA 2DWCA 3NHPA 2IYRA 4Y9RA 1YAJA 4ZV9A 2GPWA 3NFRA 4G8JA 1YVEI 2C3YA 2FMTA 2I6XA 3GJ5A 3CE9A 4BLWA 1HC7A 1COZA 2YWJA 4A0GA 2DWUA 2GD1O 4P81A 4DOMA 3L05A 2C31A 4DQUA 2LTAA 4HDMA 1MZPA 5EJAA 4DV6B 1TFUA 1QFZA 3O4FA 1RRKA 1F1JA 3F8SA 5JNTA 3S1SA 4MRMB 1DXYA 3JQBA 3EAQA 3IJ5A 5KYWB 2PZAA 4NAUA 4ADSG 5C2JB 1G8PA 3A7DA 2MR5A 2Z2XA 5D1NA 4ZMSA 1RYNA 1T3ZA 1X8KA 3C7TA 1PRYA 1FFDA 2BFPA 2ODWA 3B3AA 4EY3A 1NQAO 3MCAA 4ZAFA 1YDWA 5J58A 3T94A 2HQSA 2HWKA 1FK8A 1F4PA 1U4OA 2QN8A 4FYJA 2OECA 5E4YA 1GNQA 5ALVA 1Z7WA 2D0DA 2OV3A 2ZI5A 1N8NA 2O8DA 5EWJB 3PGMA 1E3QA 2ZTHA 3EZ9A 4GF5A 2PMFA 4A2PA 1ZRSA 1HZJA 1A88A 4EPXA 5A0TA 2OAQ1 3O2JA 4C7KA 2AUMA 4LOAA 2ZZNA 3OZFA 2RHHA 1LPBB 4B6EA 2YTZA 3UO8B 1UANA 2QRGA 5LBIA 3WSTA 4DIFA 4Z4CA 2PCJA 5FA5A 3HJHA 4JYZA 1WBJB 2C4TA 3R7NA 1VYVA 5JRDS 2O3SA 4MULA 4HX2A 4OCZA 4GMKA 3KSUA 4GI2A 3F71A 1A50B 1N2CE 2WZQA 1YVPA 2VXBA 3CN7A 4OFWA 3A3NA 2FN8A 5REQB 1JJBA 3E3MA 4OY3A 4PG5A 3BMOA 5AI9A 1A9RA 3VZRA 1AS2A 1R4NB 4XSVA 2HQ1A 3AF0A 2B8TA 3Q72A 4YMIA 4B7AA 3JQDA 2P79A 3HYNA 4AMBA 3K6SA 2ETXA 1S8NA 3MA0A 2EFYA 3EW7A 2C7OA 1THTA 3BMCB 2Q50A 3REQB 4ND3A 1RIIA 5GGXA 5K3DA 1E60A 2FZGA 3CJRA 4XYMA 2HF8A 3OKCA 3DMTA 4Z7JA 5JROA 2PZEA 2A7QA 1F8YA 2GK7A 4JKIA 1F9AA 3D4IA 2AX4A 2A5YB 5U4XA 5DIZA 1VHJA 3PFNA 4TV8B 1FX0A 1XEWX 1S3IA 3VKHA 3NOVA 3STUA 2X4LA 1Z6YA 2J0SA 3TJMA 3LUBA 4TV9B 2RJOA 4MR9A 3N05A 1QO9A 3EARA 4KLZA 1OX4B 1PT8A 5DTMA 1IU9A 3E9YA 2O3UA 3ECCA 4QDKA 1JDTA 5JMPA 4C4YA 5LQCA 1X1RA 1WW2A 2V7QA 4HZUB 2PX2A 4YXFA 4Q5IA 2RSLA 4DR7B 3L7KA 4WLFA 2QQFA 2A57A 4Q05A 3MINA 2HEIA 1CUIA 4UCWA 4FI3C 4EZIA 3BK2A 1X13A 4PZZA 1IHDA 3EPPA 1M2HA 4AS1A 2AZ4A 2WJYA 3W6ZA 2MTBA 2O3RA 4JVNA 2UVPA 3VH1A 1MNAA 4FOTA 4DR1B 1XJ5A 2QTNA 3UK6A 4PRLA 2D0OB 3FLBA 1W96A 3ONNA 1G21B 4BVJA 2BD0A 4DY4A 3FCAA 2Z04A 4FXOA 5B58T 4CQMD 4YWJA 5AW9A 2CFCA 1UT5A 5AW3A 5IF9A 4OP2A 5AVWA 4F3NA 2GJKA 1TJPB 2BR5A 4QJ3A 2C2XA 4BVFA 3KHUA 4E46A 1EQ2A 5DM1A 1QAMA 5FFNA 1U7OA 1GT91 3U44A 3V00A 4TS1A 1RHRA 2Y3IA 1PDWA 2W6CX 3A14A 3D6HA 3OCWA 4U6SA 4YO8A 2O8CA 2C4VA 2RMKA 1XZEA 3C1TA 2KX7A 3L6OO 1K8XB 4H35A 5BQ5A 1TVMA 4JJKA 3WNDA 2CLCX 1H1LB 4YRRA 1ZQ9A 5EIHA 2XADA 5L3ZA 3ZHSA 3UK7A 1XX6A 2CSXA 1U1IA 4MA0A 4EDFA 3B89A 3MTQA 1KFJB 1J2TA 3H4TA 4ASUA 3JQEA 2WB4A 2HSJA 1DC8A 5JS8A 2LCIA 4BRUA 2NT3A 1TTHA 2XVAA 3HKEA 4TUYB 4O2AB 1FNSA 1B6RA 2P5SA 4UD2A 3RS4A 1V43A 3UH1A 2V6IA 1N2XA 5D01A 4AF8A 3D9QX 4EZBA 1SKYB 1VPLA 1G8JA 1WHTB 1ZK3A 1RAFA 1VYTA 3N2IA 4YRAA 4IMRA 1GLNA 3DBIA 4HAZA 2WUDA 1SVLA 2HJVA 4OQDA 4I1OA 4C03A 1T0BA 1KYZA 1PYDA 1ODSA 1HQCA 1RBQA 4OP3A 2I29A 4OA8A 4HUQA 2GZ3A 4JSRA 2Z8YM 1GPDG 1L5KA 4FK8A 3UA4A 3V1NA 2H65A 4C3UA 5KZMB 3SHOA 1G41A 2D2EA 1DXHA 2J41A 2QM3A 1DIGA 4LY0A 3FW1A 4BVHA 9MHTA 3KQHA 5DDIP 1EWTA 721PA 3WQHA 2CCKA 1OV6A 5DRTA 3GA7A 2ZULA 3RTEA 4BMCA 4E11A 4MQEA 3A6FA 3LVQE 1OH8A 4W5JA 4PPYA 5JYCA 1KQOA 3NDIA 2JK1A 3Q3VA 3JQ8A 4JY7A 3U3ZA 5ER6A 4TYWA 2PO5A 2V7WA 2YIJA 3OHSX 1GTZA 2Q6LA 3BREA 4U7GA 2FZWA 2QQEA 4MVJA 2EATA 1LDEA 1UXOA 3EIOA 5CM9C 4R8RA 1CZNA 3AXSA 4JITA 1J90A 3DLPX 2Z9BA 3I5UA 2IYNA 4YEDA 1E1RA 1ORWA 4MLPA 4G2TA 4H4CA 4ZEMA 1GGEA 4LHZA 4JVLA 4CKWB 1J24A 2RFLA 2PSSA 2IUYA 3OBIA 4NYMQ 3TH5A 3WLMA 2YHBA 4O4HA 3DCNA 3NIFB 4FHFA 4PO9A 1I4EB 1T8SA 3ITDA 5E1DA 4L02A 3KD2A 3FNQA 4ZV4A 4N8EA 4WBXC 4WCFA 5HHTA 2WFLB 1KI1A 2VTVA 3KKZA 3G0BA 4MDEA 3GJ4A 4E13A 2WUWE 3ZLBA 3WB2A 1SRQA 4UPEA 4HGOA 1LQ2A 2X5KO 1P7WA 5EQDA 3U4QB 1SZJG 2DGDA 1KDYA 2Q5HA 1NW3A 2BLLA 4CF6A 2ACVA 1MJFA 3BB4A 3KLNA 4RPCA 5B1EA 1L9KA 1AOXA 2OTCA 4Q4CA 1NKTA 2DFDA 4BTVA 5JSUA 3L7AA 3TD2A 5DTQA 4V0NA 5SY4A 1AMOA 4J76A 4NSNA 5BW4A 1GZ7A 2ADOA 1ATZA 3AG5A 3L1JA 1ORIA 4HAWA 5CVJA 5I7OA 4E5SA 2NOAA 2ZJ4A 3AB7A 3EXIB 3PD7A 4PR3A 3OMWA 1BD4A 3PFIA 4D92A 5B12A 1WF3A 2V65A 1ZGCA 1II0A 3OPYI 4LOIA 4TMFA 1EFVB 1Z5GA 2MSKA 3DMHA 4HATA 3KAJA 1DWQA 4K9RA 4OAOA 3TZHA 4D1YA 1OX5A 3U7RA 1RQGA 5U4QA 1M2EA 3TLXA 3UWDA 1R88A 3MOSA 4YAGA 1DIRA 3C3YA 4DCGA 4V3CA 4LTMA 1KO5A 5CFMA 4CG3A 4CTOA 3EPLA 1QVZA 3MCUA 4E2ZA 1E3MA 1FLVA 2I6TA 4QGGA 1XMJA 2NO0A 5FB3A 3FHLA 5HZKA 3B5IA 3QKSB 5AD1A 4N6NA 3PIDA 2R48A 2OLEA 5F1PA 1MQ8B 2ZSUA 1I10A 5CFLA 3K4HA 2JIZD 1R0SA 1QYIA 4L16A 4UPVA 5DU2A 3MWFA 2WY2D 1E1CA 2AV6A 3OTWA 4YV1A 1E20A 1Y7PA 4IIEA 5ECGC 2H7VA 3FTNA 2GSDA 3LF1A 4XCXA 2E7ZA 3HFJA 4D8TA 4TZKA 1JHRA 1PQ4A 3SPXA 3M81A 4B6QA 4Q3EA 5LD2C 3SS9X 1BCSA 1PFGA 1USVA 4PYJA 2SHKA 3TMKA 1SUWA 5BXQC 1K5PA 2B4QA 3VSAA 1E94E 1O77A 5HFNA 2IV7A 1QV6A 4M49A 2HU2A 1PSDA 1R1DA 1Z33A 4YV7A 1C1XB 1AUOA 5BV1A 2BFMA 5KNBD 1CV2A 2Z9DA 4J0EA 2B83A 1J8MF 3E9RA 4QT0A 2HPVA 2VP3A 5B57C 3E53A 4ZWNA 2QLBA 2WWFA 1DGQA 2P75A 5BRNA 5KQMA 4D41A 1P2SA 4G5GA 5DE3A 2WF7A 4S3MA 1UMKA 1I7LA 3T15A 1FU7A 2I78A 1D2RA 2OBFA 3FPEA 4TQGA 1XKQA 3EZYA 3N0XA 4R7GA 3PSHA 1IOLA 1GNRA 3A1VA 1Y81A 1CPYA 2PUJA 2CBGA 4NNPA 5K4AA 1WOYA 1X92A 2IQIA 2ZT8A 3FOAA 4HDQB 1F0KA 3BM5A 3NTRA 3HDYA 5FWDA 3AHHA 4CRWB 1EWQA 4CNQA 3GL9A 4Z4GA 3OQIB 4RKWA 4V0MA 4YBZA 3ZKAA 1I3OA 5TQ0A 4N7MA 1YHYA 5KNCD 2D7JA 3KKMA 4WDRA 4G65A 3DP9A 2ANCA 1HE1C 5JYDA 1AV7A 3ABQB 3RKSA 2CGEA 3HTXA 1GSIA 1J0CA 2XCIA 4JH0A 3RT9A 3V1LA 3EAGA 3GIDA 1JG1A 1VLHA 2JDIA 2L82A 2R8BA 3PX2A 4KDCA 4M55A 4ZC1A 3COJA 1PUJA 1PWXA 1RBYA 1X9GA 3PYMA 3CZAA 1KO4A 3Q6IA 2ORWA 5BQXA 3L4JA 4JT9A 1KAHA 3MGCA 1WM1A 3BTVA 3K1AB 1Q12A 1CY1A 4OK6A 3RVMA 1QRSA 1WRBA 3SLRA 3VKUA 3G3EA 2DQYA 4PSKA 4A03A 3CURA 4K8RB 4RETA 5ENZA 4Y2XA 1QZZA 2N1MA 1XZNA 1QZXA 4II2A 1Y37A 2W6ID 4Q9NA 4WMLA 5EZ6B 3WGNA 3BF7A 1PX2A 4R8VA 4A23A 1TCUA 2JHFA 4MAMA 4PHGA 4M83A 3WBBA 1QGUB 5C34B 5C8YB 3P9ZA 1EK1A 1QGOA 3I30X 1ZI6A 3WV5A 2FP4A 1IXRC 2C04A 4KQ1A 5H3HA 1GGVA 4D5GA 2WU1A 3OJOA 2N47A 5E7QA 4YP1A 3A7EA 4QGFA 3ZGNA 1YFJA 1W8IA 3BMQB 3C70A 3DUWA 4OQXA 5FWYA 1OTXA 3GDGA 2FEXA 2C9DA 1GZVA 5DYIA 4GVPA 3UTDA 1O95A 1R0YA 2CHFA 4FZVA 3U81A 1VPTA 3NKLA 5K1ZA 2HFKA 5F21A 3QUSA 1Q2UA 1Y3HA 2JI7A 4KIJA 3W4IA 4DWVA 1NI4A 4NV0A 3BCSA 3I5AA 3TI9A 1FA9A 1L8QA 2XDQA 5FORA 2P67A 3SYNA 2GK4A 1K5HA 3P19A 1RD4A 2BGWA 5J23A 3S5JA 6ADHA 2IHTA 3OJLA 3DFIA 3RS3A 2J85A 1T10A 2F9LA 3EEQA 4G26A 1T6ZA 4HTAA 1VIAA 3X1XA 3ZU2A 3ASVA 5C7OO 3HXOA 2O0KA 2GYWA 1FUEA 1ZXBA 5TR9A 4KI7A 4BYGA 5D5PA 1XBTA 1QO0A 4W99A 1X1BA 3AEYA 1QORA 1UBLS 2YHIA 3EZ7A 4GOMD 4TSRA 3SI7A 4LWZA 5A4DA 3TLZA 3ZD7A 1AUVA 1P1BA 5ED4A 2PS3A 5AR1A 1KKUA 2RHWA 3M6XA 4FW8A 1LJ8A 3GEIA 2NU8B 4O4JA 1HLGA 3PC7A 4O0MA 1ZH2A 2FVXA 4TLDA 1P45A 4X66B 2X77A 1QC5B 3BE5A 3PUIA 2I2WA 4TWRA 2C7PA 5EXPA 4EFKA 4YYZA 4U2EA 4CL8A 2RK6A 4BP8A 2AE2A 4M0CA 4Q3LA 2P8SA 4RD3A 2Z43A 1L7PA 2P8JA 3GUCA 3ZDRA 4DRYA 1CUWA 2K7FA 2EZUA 3AHDA 1NXOA 4A15A 1N1EA 2IVZA 1NE2A 3CZPA 4Z86A 2UXBB 4Y2VA 4QXOA 5K3SA 4C6TA 1C7QA 4LAFA 5DBEX 5B1YA 1X7GA 2OCIA 2WHPA 5BSVA 4G56A 3BXXA 4ZZ2A 1E4VA 2I3GA 4N5DA 1GYQA 1Z73A 5B7QA 4NZNA 3UF0A 3TK1A 2D2FA 2YOGA 4MKGA 5CTAA 2IHYA 3DHWC 3LCCA 4HMOA 2PPVA 3FNGA 1V26A 2Y8EA 2C82A 1NVVQ 4JI3B 3AFMA 1PKEA 5AVOA 1E8DA 5MF6A 3RVNA 2VXOA 2VAMA 3RUIA 3V8EA 1L9XA 1OIXA 3EISA 5JADA 1DBIA 2ZUTA 3L7JA 4JK3A 2FEWB 1YMVA 1HI9A 4HAOA 5ALDA 3LPCA 3S1AA 5E0OA 3V2UA 2ZVPX 1QIMA 3AR3A 4IJQA 1G55A 1KMQA 3E9EA 5GADl 4QTUB 1DAOA 3SY8A 2XNHA 2PWZA 4HB2A 4BQSA 4HNHA 1USWA 5JCOC 1U7XA 1RZUA 3RFCA 3JD2A 1EIWA 1QG4A 3G1WA 2NZUG 4ZTZB 2R9VA 3HCDA 3F7OA 3N2EA 3MBOA 4B46A 4P80A 4FM9A 2XNCA 5KYVA 2B7CA 4MVJI 2Y6UA 2EDCA 2PRSA 1SB8A 1APBA 3M6VA 4GYJA 4AO8A 3WRVA 1TRKA 2G1UA 4FKZA 4I1UA 1L5GB 3C1OA 1MJGM 4JU8A 4QUGA 4XEUA 2ZTLA 3F3KA 2FW6A 4QU8A 4ZQFA 1P39A 4DJDC 1UAYA 1AZWA 4UUOA 4CYMA 5HKOA 5E8JA 4KQCA 2OV2A 1E58A 1QLJA 8LDHA 5CA0A 2ZGVA 4G0WA 2V59A 1T9GR 2ZI9A 3E7PA 4BNIA 1AKNA 4FFVA 2QN9A 1ELOA 2PGLA 2WWRA 2EHJA 1AKVA 1NLFA 4R2HA 1JB1A 5E6SA 5LL6P 1V9SA 1ZITA 1E6WA 3R8CA 3CH5A 3C6BA 1KI6A 1NNI1 1U0NA 4MHOA 4MGZR 1M33A 2UYOA 3UAGA 3HDHA 4LJ6A 4IZOA 2YZ2A 4B81A 1RPJA 1QB7A 1R0ZA 2J3EA 3A6JA 1WTAA 1VMIA 1IYZA 4H7EA 1KOLA 5KDLA 1FTYA 2Z4SA 4COKA 5KQLA 4WXEA 1OASA 1ZVMA 10MHA 3JQQA 4LMPA 2JFYA 4ZALA 1G8SA 4DE5A 5CVEA 3BG5A 3BD8A 2KJQA 4P3YA 1CDZA 4OHCA 5FBKA 2E1PA 2XA2A 3O4GA 1VA5A 4ENPA 1SBNE 2XYHA 4ACBA 1MC1A 2A59A 1NQUA 5JQGA 5K20A 1WXWA 2GARA 3FJYA 2J0UA 4TKZA 3P2IA 4ZRDA 4A1FA 3A9SA 3G6WA 1QH1B 3D81A 1QH8B 2VJNA 3MUOA 5E3IA 3W1WA 1LZKA 4Q0MA 4J29A 4PHCA 5ADWA 1BG6A 2ONYA 4Q37A 2BP7B 5FUBA 3HSKA 2E0IA 5IKOA 3T7KA 1IXSB 1WMSA 2HA3A 1X2EA 3KQWA 3JZMA 4GUDA 4QTXA 4ZA2A 5JAQA 4WW0A 5A7HA 4KEAA 1G4AE 2Z1DA 5KVVA 3FMFA 2HU7A 4M0LA 1GPUA 7MHTA 2YY6A 1L3CA 5BW5A 2YCLA 3GFFA 2YXNA 5CYOA 2X3FA 3RGWS 4NU8X 4UUNA 1N2CA 4PHTA 3RLIA 4J0JA 4RAOA 3EG9B 1B4DA 3PUWA 1YIOA 2OHGA 2YR0A 3FMIA 5ESRA 5AVJA 4KMOA 1KDRA 3GFSA 4U4AA 2FSIA 1W8DA 3ZPXA 1I4OA 3JARB 5T4HA 1U7HA 2QYTA 4C7VA 2G4LA 1G16A 3O8QB 2R8PA 4I4CA 2ZRAA 2LE0A 4LMBA 2GJ8A 4D80A 1KK1A 2ABWA 1D7OA 1JWLA 3GEEA 4U7HA 1RU3A 1YL6A 3I2YX 3K70C 2PWAA 3R7WA 4HD8A 2QM8A 4CLXA 2C2OA 5K2OA 4PFJA 1JEEA 1ZZGA 1P3Y1 2ZUBA 4JDPA 2EEZA 4DJ5X 3RSOA 2XOXA 2Z30A 2WF5A 2LUOA 4DLUA 3B51X 1DRKA 2WJWA 2ZRJA 3GPDG 2BCEA 3D3WB 3K6KA 1UM9B 1K5GA 1KR2A 2BMWA 2VSQA 3R9XB 3TGPA 3TNJA 1L6IA 3C3EA 2TECE 4MQFB 4OHOA 2BDTA 1U0LA 4Q7JB 4MGHA 4F5DA 5C81A 2QZ9A 3U4CA 3B20A 3OT4A 5CNIA 4KVGA 4RADA 3I61A 3DHYA 4YRDA 5LA6A 2FYTA 4EP1A 1VMKA 3NAGA 5CJPA 2E6UX 3BE4A 1PTKA 1NXPA 4AP9A 2FPSA 4Y1EA 5A3JA 4L1KA 1F7UA 2QVGA 2ZYTX 4W9NA 2HLHA 4V02A 1Q83A 1VG1A 4M2LA 3AL3A 4PZ9A 4CM8A 3VPSA 1IBMB 1QRTA 1GKIA 4V0QA 2FJUA 3TAXA 2HHHB 3ESZA 4QSHA 4XPIB 1YU9A 3H2HA 3IBTA 3IR6A 1AKTA 4GPTA 3SSNA 4AZ3B 4F12A 1EAMA 2HA6A 4ARBA 2C7BA 2XTJA 4AFNA 2QHXA 6ABPA 1GLVA 3M4NA 1Z34A 3FNBA 1J56A 2ZM6B 1S02A 2GCGA 1TYAE 3UA3A 3RAJA 2HPZA 4LNUA 3HBLA 3RYIA 1E2IA 1BD3A 1SXHA 1DBRA 3H1BA 2J32A 3H3XA 1M76A 3BXHA 5ERXA 2JGNA 4AIIA 2PHZA 4LDPA 5A9RA 2O5CA 3WQQA 3ZZ0A 1Y5RA 1KU6A 4JJFA 3TGLA 1UBFA 2QX8A 2J3JA 5EJ2A 1HEUA 1BZYA 3ZIDA 1QANA 3G2LA 3LPAA 3MLAA 3R3UA 4NCKA 3RT7A 3I04A 4LZLA 2PH1A 4HKTA 4D56A 3JS5A 5IAOA 3TQIA 2Z6QA 1MIHA 3HWWA 3GXOA 4ZVRA 3ZI4A 2RBGA 4ZVOA 1J4AA 3WLOA 1IN5A 2W2XA 1Q21A 3C87A 1S2NA 4CVNA 2WEKA 1EYZA 5CVTA 3S7ZA 1OFIA 1OQAA 1T2NA 1V1MA 4BN5A 5CDYA 2UUCB 3QEBZ 1EFCA 3CVYA 3C97A 3O3NB 4FNOA 4D8VA 4FN5A 3JX9A 1CUSA 4X9XA 1R5JA 4RK5A 4BCDA 5JDIA 4ABYA 4PG8A 3UPDA 4BMPB 3PQ5A 3TE7A 2EG9A 4MWGA 3ILVA 3DD1A 2PMEA 3JYOA 2I2AA 2JFPA 2WV7A 3V7NA 2OR3A 1TMOA 1MC5A 1Z0SA 3WQSB 2O0JA 2OQVA 4FXPA 4NZZA 5CP8A 4O1IA 5HR5A 4JI4B 2WQZA 1KZHA 4EWLA 1ZESA 4BNZA 4H3KB 3G5UA 2F17A 1ZX1A 3C5CA 1FDOA 2XQIA 3O4VA 4J0FA 4IR7A 2GPSA 2BGJA 4J91A 1DKUA 1K68A 1R9NA 4G1EB 5LP6C 3G8AA 1T6NA 4LZZA 3QTTA 2MSEB 3UT6A 2XY4A 4RTLA 1TZ2A 5TQVA 4PHHA 1QHXA 3O1IC 3W2TA 1VI5A 2RHRA 2IY9A 4BMVA 5C8ZA 2UZ4A 5BPFA 1FRFS 1NV8A 4CKYA 5HM8A 4F38A 4LN1A 3S3TA 3E58A 3WLAA 3UG7A 2BMJA 1T1IA 4F5YA 4S2UA 1AKMA 3H5VA 4MUHA 3O8OB 4BV9A 1HFEL 3H16A 1ECCA 4MP3A 5BORA 1J0EA 4MEAA 3JQ9A 3I62A 1DJOA 1Z7BA 1NSTA 2FSPA 2W2QA 2HMTA 3UFXA 3BFVA 4GOJA 3U1BA 3B9BA 4WKOA 1NOKA 2OXTA 4B4OA 4TS3A 2CJYA 1AKYA 3ICOA 4AC9A 1BIFA 2BEWA 4LWPA 4YH1A 3SM3A 2HD4A 4K8OA 2P9JA 1NLMA 3AT1A 1UBTS 2WAAA 5ALRA 3WGMA 3KYDA 1BMFD 3O21A 5A6SB 2ORED 1G19A 3ZY4A 5FUMA 3KYJB 9LDBA 2FSUA 3ZXUB 2PEZA 1CEQA 2A94A 1OBHA 2CXQA 4H31A 3SQOA 5KNBA 2HUNA 1FDIA 1CZRA 1SURA 3OQVA 4ID9A 5EGNA 4AZWA 3QUQA 2VQ6A 3NT4A 3AUSA 3W5IA 2CYAA 1ECBA 4ZAXA 1Z35A 4AP6A 1VPWA 4M38A 3PXEA 1NWCA 3ITNA 3IDAA 2BCGY 3OOJA 4J0HA 5GGYA 2ZR8A 4B4WA 5B7GA 1P17A 1KWKA 1FFSA 1FSSA 1I8TA 1LQTA 1T0HB 2BMFA 3P9PA 3MUFA 4MPTA 4BLTA 3ZN2A 3AH8A 2H85A 3AETB 3QVVA 4BO9A 2ODTX 3KU1A 2C5HA 2W00A 2BH9A 5B30A 1ST2A 2R87A 3VAAA 1HT2E 3W7VA 2PFGA 4MKHA 5JSZB 2YWRA 3UH0A 3NM6B 4K5QA 2G80A 4BO4A 3V7UA 1OFGA 3BRSA 5GIOE 5LB2A 3E0XA 5KNCA 3PUVA 1DDIA 1NU6A 4FYMA 4D4IA 1OREA 2EKZA 1WWKA 4MIKA 5E2IA 1GZ5A 1U0TA 2FX2A 3D59A 3QW4B 3R5JA 4UREA 1GFSA 1NATA 4H7JA 4C4OA 5BV0A 4ERNA 1YQXA 1T9HA 2P2ZA 4JLUA 4F06A 1SAYA 1M5RA 1SA0B 2R44A 1MXHA 1AKRA 3CGGA 3VU9A 4D4LA 1TK3A 1YZQA 3T54A 1LSUA 4NHEA 2QJTA 1JS1X 2G67A 3T4PA 4TTJA 3SBDA 3K0CA 5FYQA 1BMTA 1IXYA 2XIJA 3KE9A 1TIBA 3HYRA 1ESZA 3NXSA 4JLDA 5AOBA 1PFYA 1J49A 4BFLA 5ES4B 2JCSA 3MTIA 4IIVA 4PZDA 3PVCA 1LFDB 3SS7X 1FLAA 2PL3A 1EP9A 1H85A 2CNLA 2W6IA 2B2XA 2ZIGA 2Z6AA 4HH0A 1GXSB 1LJLA 4WNCA 2B6NA 3WMFA 4OM7A 4NJMA 4O29A 1QIKA 1YZVA 4XWKA 2EKBA 3FM9A 3IO3A 1VM6A 5FNVA 3EW9A 4HTFB 4HYEA 4BRZA 1UXJA 4I81A 1WV1A 3IE0A 3ER6A 4FX2A 4JR0A 1RWXA 1LX6A 2VNJA 1ZJ4A 4G3XA 4TMXA 4YP7A 1LVUA 2ZIVB 5CB4A 5JATA 3QVOA 1EZ1A 5CLHA 1SZCA 3Q8KA 1HR0B 1FRQA 2RGNC 4LMAA 3FI0A 4NNOA 1DG9A 4J0QA 1P1IA 4L74A 4ZQCB 3W2GA 3VZQA 3ZS8A 3SJ7A 4DR5B 1FVXA 1OV4A 4GZ5A 1AQLA 5CHEA 2M98A 3ASZA 3TR6A 4NF2A 1CF2O 5TDHA 3AFHA 1CJMA 4G1MB 3K1JA 1UJ6A 3PD0A 4UM9D 5AW7A 2XMSA 1Q7CA 4L9AA 4RQUA 5SY6A 1ZI9A 1LU9A 2ZJ2A 4UUAA 2P27A 1NYLA 3ANTA 3TQQA 2HCTA 4EY7A 2QAGC 1MC8A 1A4XA 4MLDA 1N6HA 4X00A 4ZRNA 1I33A 1XXHE 2Z5FA 4LXGA 1O3YA 3Q3EA 2GDZA 3AERB 4HAVA 1AS3A 3HI4A 3LD9A 4H9GA 1BWPA 2DVMA 2IU6A 1JN0A 4PZ0A 2G83A 2VQDA 2BT4A 2EBUA 3EGOA 4KTTE 1ZD9A 3QVXA 3AEUA 4P3OA 1UMBB 1S0UA 3WMEA 2XUDA 4RZQA 4GKVA 1XXLA 3SEAA 1M2JA 5HIAA 1L7DA 3FTPA 3T5TA 4NU6A 4EGFA 2FWNA 4RGYA 3G0DA 4JZYA 2VJMA 3G8YA 3NVKI 2AVDA 4EOGA 4KO1S 4HYYA 4YP0A 1TOAA 4U2FA 4UHEA 4PLWA 4QDZA 2HHLA 3KJZA 4DG5A 4BGDA 1G2OA 4MINA 1CNMA 2IITA 2X15A 1S6YA 3Q87B 4D82A 3KXIA 3IUBA 1I13A 1VI6A 5FBHA 4ZT7A 2R1UA 5JVDF 2BHRA 2ZB7A 3C7CB 2HMSA 4L72A 3A9UA 1STOA 3K32A 1HYGA 4XGRA 3ZQ4A 5CA1F 4IHQA 4U3JB 1RM5A 3N0RA 2DTDA 2H4FA 2P3QA 3D2LA 3W3ZB 1C50A 1O5TA 1NJ8A 3MWEA 2WSYB 4FFNA 5FHRA 4AWXA 1C81A 4EL5A 3DVRX 1RI5A 2DQZA 4TL6A 3CA8A 5LYJF 4RX1A 3GJ8A 2G77B 1U8YA 3IV6A 3R9IA 3HZZA 3NBXX 3LCVB 3S2ZA 5IN4A 1O87A 5J4VA 3M6IA 4IUYA 4KYIB 2D7DA 5IKPA 2HHCA 1XHFA 2IA5A 5U1PA 1BNCA 3OECA 3OPXA 3QVTA 1SGWA 4X60A 3A2KA 3EVCA 4PWYA 1II9A 2Q0QA 2XRZA 1URPA 4PC7A 5AKKA 3ANXA 5I7AA 4AZ0B 1U9YA 2VF4X 4QFCA 3GLIA 2VJPA 3GFGA 3PDWA 4H17A 4HPXB 5KOHB 3U7QA 1WETA 2QAJA 4XB1A 3GBVA 3SG0A 4DN6A 2FLWA 1M8FA 2JA2A 2VYND 3WGUA 1XUOA 2NYRA 1CUBA 3I28A