4ETMA

Crystal structure of yfkj from bacillus subtilis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
164
structure length
162
Chain Sequence
b'GQGRGSMISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILRREGISFDGMLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDLADVPDPYYTGNFEEVCQLIKTGCEQLLASIQKEKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase yfkJ
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Crystal structure of YfkJ from Bacillus subtilis
rcsb
total genus 60
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etmA00
2FMHA 1DRJA 4H3HB 6ABPA 3BRQA 3HCWA 1ZHHA 3JVDA 2OQRA 1ZVVA 4G86A 2WMYA 5TE9A 5DKFA 1P8AA 2JRLA 5E3JA 2QSJA 5GOTA 1LK0A 3GL9A 1K68A 2PMCA 3T95A 3HS3A 3KHTA 1MAVA 3OO1A 3A0UA 2OENG 1USGA 2HQBA 1UDRA 4Z9BA 4XXHA 3BRSA 3LUHA 4LDAA 4Z99A 4Z4FA 1FQWA 4MR7A 3P9YA 3UK0A 1Y1LA 3KCNA 5IEBA 1YK0A 3QLVA 3KLNA 3OLWA 1F51E 5B3JC 1Z13A 4RK1A 3GWGA 5EWLB 4EYGA 1KRXA 4Z4CA 3F7NA 1NTRA 3RVQA 3EJWA 3LFTA 3NNSA 3K4HA 3RVSA 1M2EA 1JYFA 3DBIA 3MA0A 3N53A 5BR1A 1RNLA 2NT4A 3LUCA 3CG4A 4P98A 3MMNA 3MQ4A 2H0AA 3CS3A 3HUUA 3N6VA 3O75A 5JNTA 1QNLA 5DCLA 2NT3A 4RWEA 3QEKA 4TN5A 5IBQA 2FN8A 2R25B 2O20A 1QMPA 1USIA 3H5IA 2VUIB 4UHKA 1MB3A 2QV0A 2L19A 2VUHB 3R0JA 2F8TA 3RVPA 4RY8A 3OMXA 3OLYA 2FLKA 3SY8A 3GRCA 1VLZA 4Z9AA 3ROTA 4D6YA 2IOYA 3OQOA 5EWLA 3H5TA 1QP0A 1NXXA 5T3YA 1JDNA 1PNRA 1B00A 3T8YA 3CZ5A 4YRZA 3KSMA 2QXYA 1L5ZA 1VKRA 1MVOA 4XARA 5KQMA 1JBEA 2RJNA 1JF8A 1D1PA 1CYEA 4NCAA 3JPYA 1ABEA 5CHYA 1YMVA 3EODA 3TD9A 4Z4IA 3T6KA 1DRKA 3D02A 1JHZA 4LE2A 3M9WA 2FW0A 2MSWA 4YCSA 4DQDA 4IILA 3N0WA 2JVKA 3VNAA 4KK3A 4D74A 3E61A 3H5LA 1ZDMA 2E4WA 1RZRD 1M2FA 1KRWA 2RDMA 3NHZA 2IDMA 4EVRA 4KMRA 1EWTA 3D8UA 4FE7A 5JS2A 4W5TA 4G0YA 4GPAA 1SXHA 4RK4A 2GWRA 4G0MA 2FQYA 5JNUA 1W9HA 3HJFA 2JB9A 2WB4A 3LTEA 4XAQA 4XFKA 4CBVA 4W5NA 3L49A 1XHEA 8ABPA 3K9CA 4W5RA 4G0PA 1WETA 3O1IC 2HQRA 2WRZA 4ZMRA 3Q9SA 2PAFA 2WJWA 1R8JA 4OBBA 3IP6A 1OXBB 2J48A 2MYUA 4M88A 2PUGA 4OLAA 3LUAA 4TLLB 3BREA 4ETMA 2QW1A 5TQ2B 3HVRA 1BDJA 3TMYA 5EWMB 3RQIA 1NY5A 3GBPA 1EHCA 1VRVA 3KTOA 3I45A 4KNYA 3LUKA 1JX6A 1Z2DA 2GKGA 3M6MD 3DLHA 1DBPA 2PKXA 4HNQA 3GYBA 4JASB 4TMYA 4W5QA 1KGSA 1D4ZA 3HSYA 4KZKA 5EWJA 4OG2A 4EYOA 4PICA 4MR9A 4WUTA 3LUJA 4YGXB 1JDPA 1P2FA 3I5AA 3H6HA 1TM2A 2NZVG 3GT7A 2GX6A 5B3JA 3CU5A 2PJUA 2FTKE 3KJXA 5TPWA 3RVKA 2VYCA 4S05A 1BVHA 4LRQA 3CTPA 3QEMB 5HSGA 4N41A 1YS6A 5CNMA 1U04A 1BAPA 1ISRA 4Q7EA 4N47A 3G85A 4NV3A 3W9SA 3FDFA 4MR7B 1E6LA 4Z4EA 3HM9A 2F8SA 1NXSA 4QICA 4HNRA 4JB0A 2LUOA 4YWHA 4KPYA 2AYXA 4RXTA 4F11A 5JNSA 4YP9A 1YVUA 3CG0A 3NNDA 1LBHA 4LE0A 2PL9A 5KWSA 2PUEA 4OLBA 1FSPA 4MLDA 4DN6A 1MIHA 4O1IA 5FWYA 1TMYA 3N0RA 3IP5A 1C4WA 4JA2A 2R47A 4WT7A 4XLTA 3DGEC 3VNBA 4MAAA 5FBHA 4Q6WA 3JS5A 4IRXA 4F12A 1J56A 1A0OA 4MQEA 2E4YA 3OQNA 1DJMA 7ABPA 2VK2A 3IP7A 4LX8A 3RH0A 4G0XA 2PUAA 3O2SB 4N03A 4MGEA 3T38A 1BDIA 4E7PA 1Z16A 5TPZD 2X7XA 1JFSA 2PLNA 2FKAA 1SXIA 4YLEA 1JL3A 4Z4GA 3QK7A 4ZYLA 3HK2A 3EGCA 3QLTA 4IMJB 3FFWA 3RVNA 3F6CA 2L2QA 2PL1A 3GBVA 3OO0A 3S99A 1QQAA 4LE1A 4S04A 2H3HA 4MS3B 1T34A 5JNRA 2HPHA 4ETNA 1U8TA 4RS3A 1NXOA 4MR8B 5IX8A 3DZDA 4Z4HA 2A9RA 5TQ0B 1NXPA 1PEYA 1P6UA 3O2JA 1QO0D 4RU1A 4UHJA 3UUGA 1DG9A 1AB5A 1S8NA 1JLKA 2V0NA 1Z25A 4MRMA 1QKKA 3H1GA 3NNNA 1SRRA 4MS1A 4EUKA 2L17A 4H60A 2JBAA 1GCGA 2YHBA 3HUTA 1Z2EA 3M9XA 4HNSA 1JFVA 1FFWA 3Q15C 4EVSA 1L5YA 3NHMA 1K66A 4EYQA 2QVCA 4LDZA 4RK6A 4PEVA 4N76A 1LJLA 1LBIA 5TQ2A 1ZN2A 5IUKC 2FXIA 1ABFA 3QLUA 1EWVA 5IULC 1USKA 2QR3A 4JOQA 1YS7A 2CD7A 3C3KA 2ID9A 1DP4A 1CHNA 1Z15A 4L4UA 3Q41A 3MIZA 2MSLA 3O1JC 3RVJA 2FEKA 1VPWA 1DBWA 4N0QA 3E3MA 2P4UA 3O74A 1GUDA 3QELA 4QPJC 5TPZA 3LUGA 5T7BA 1ZAYA 2PUFA 1NXVA 4RSMA 1XHFA 4RK5A 2LPMA 2E4VA 4IF4A 1U2PA 3CLKA 3TB6A 5CNKA 4JB2A 2B4AA 3IDOA 4E7OA 5FBKA 2MYPA 3B2NA 3ILHA 4MS3A 2RGYA 3LMKA 3HDVA 3JVIA 1NXWA 3UKJA 4MS4A 2ZWMA 1PEAA 4NICA 4NCBA 3RVLA 1NXTA 1PNTA 1P6QA 5KQLA 2E4UA 2A9PA 1D1QA 2MYTA 1PUXA 5CNIA 5DGCA 2B1JA 4ML3A 3QELB 3EQZA 3QX8A 4P1ZA 3CZCA 3F73A 1Z12A 3LUFA 4TLMB 1DBQA 2FMFA 1I3CA 5KC9A 2FLWA 2FEWB 4PZ0A 4O1HA 2Q5CA 2QVGA 2R4QA 5I4CA 2GI4A 5TQJA 5TPWB 3QLUC 1QPZA 3OMWA 4PYRA 3CRNA 5HM6A 1QP7A 1LJUA 2MYNA 1JFTA 3EULA 2QZJA 3OLVA 5EWJB 2MSKA 3LKBA 1E6MA 1SXGA 1GCAA 3C3MA 1QP4A 2PUCA 2CHEA 4W5OA 4IMIB 1RZRA 4MQFB 4RY9A 2W42A 1ZGZA 2CHFA 3CNBA 2FQWA 2PE5A 2GBPA 4QYMA 5F64A 3DLBA 1JYEA 2HSGA 2ZAYA 2RJOA 5TQ0A 2XDYA 3H6GA 3KS9A 3OLXA 4D6XA 5HQJA 3H75A 3O2QB 3EAFA 4KK4A 1RXEA 3HDGA 5IEJA 1ZESA 3H1FA 3MM4A 3OQMA 2NUBA 3IPAA 4Y9TA 3H5VA 4ETIA 1M5TA 1YK1A 2JVJA 3OM1A 3CHYA 4B09A 3A3KA 3HV2A 4KQ9A 4KQCA 1SD5A 5JS1A 5BQ3A 1C0EA 3A10A 3RVMA 5KQPA 3TO5A 2E4ZA 3OLZA 4OTZA 1MB0A 4YS6A 1KMIY 1DCMA 3LUDA 5D2CA 5IUJC 5ABPA 1YTUA 1PHRA 2FSPA 1U0SY 3HO1A 4MQEB 4MS4B 2R48A 1RPJA 4LZLA 3RVRA 3SG0A 9ABPA 5IUNC 1ZH4A 5C5EA 2HQOA 1XWWA 3EQ2A 5EWMA 3GV0A 2FMIA 4RDCA 5BRJA 4O5AA 1Z17A 5JNWA 1ZITA 1QQBA 4WZZA 4HYEA 5DLEA 1TJYA 1ZY2A 2A9OA 3CFYA 4ZJPA 4G0QA 3OM0A 2M1ZA 1TLFA 3N0XA 2M98A 2PUDA 3SNKA 1DZ3A 1E6KA 4KV7A 2FQXA 2PUBA 3HXMA 1BA2A 5KC8A 4KRFA 1RXIA 1DCKA 3C3WA 4G0OA 2WY2D 4OATA 2N9UA 1D2AA 4F3TA 1EFAA 4ZPJA 3C6QA 2LIVA 1URPA 3LKVA 1OXKB 3QLVC 4RK7A 4JAVC 1EWKA 3BBLA 3RVOA 4YR7A 2AYZA 4L85A 3EDCA 1BDHA 3FFTA 4IGAA 1YMUA 4KVFA 1NATA 3FGZA 3H5WA 4FE4A 4GNRA 4RZSA 4RXMA 3N8IA 3Q7TA 2KYRA 3QEMA 3Q7RA 2QU7A 1ZH2A 5FWYB 2ID7A 2IPAB 2TMYA 4XASA 3F6PA 4RXUA 1Z18A 4Z0NA 4G0ZA 2L18A 5FWXB 2LBPA 4PE5B 4EVQA 3HEBA 3BILA 3GA5A 4MS1B 5GQSA 3IPCA 4G97A 1APBA 1DC7A 2IKSA 1W25A 2IPMA 2WJAA 1DC8A 4MRMB 1AB6A 2JCGA 1HEYA 1Z26A 3O21A 3JPWA 1QO0A 3C97A 2BGGA 3DGFC 5PNTA 2DRIA 1U2QA 5KQGA 4RKQA 2WWVD 4RY0A 4MR8A 3TX6A 2CWDA 3JTEA 1YIOA 1F4VA 2P9HA 4JP1A 4YV7A 3KKEA 5CNJA 3KYJB 2IPLA 3URMA 5KI6A 3H5OA 5HKOA 4DADA 1M5UA 3NBMA 3SM9A 3G1WA 3JY6A 4N0PA 4RV5A 4MQFA 2A9QA 5IC5A 3O1HB 4MR9B 3LOPA 5DTEA 4EGSA 2IYNA 2JBAB 3H1EA 4FB4A 1H9CA 2HJ9A 1IIBA 2JVIA 2E4XA 3FMVA 3L6UA 1GLGA 1TVMA 1EAYA 3MF4A 5FWXA 2LP4Y 4QYWA 1GUBA 1A2OA 4H3KB 3A0RB 2FN9A 2I6FA 3KLOA 4NQRA 3FFXA 1ISSA 3I09A 4EY3A 4MYRA 3Q7SA 5BRAA 2NZUG 1DCFA 4Q6BA 4WWHA 5JNVA 2YHAA 5C5CA 3CKMA 1E2BA 4WXEA 4ZMSA 1CEYA 4F06A 4EYKA 4KFCA 3SAJA 3IP9A 1A04A 2JK1A 4RK0A 4KREA 4F8JA 3ROFA 4YO7A 1JWLA 1FFGA 3ILYA 2FEPA 3KYIB 4MLCA 1ZGGA 3N75A 2FVYA 6CHYA 4WXMA 3MYYA 4RKRA 1JH9A 3SQNA 3I42A 3KG2A 2IPNA 3HZHA 4MPTA 5ED4A 3QX9A 1FFSA 2FMKA 1D5WA
chains in the Genus database with same CATH superfamily
2AN5A 2FVXA 4NULA 2BGUA 3W3AA 4XIFA 1DIAA 2P3SA 3MGBA 4D5EA 5LU9A 3HKBB 4TN1A 4WZBB 4FBLA 5JW6A 5TVGA 3NO4A 3SE0A 3BT7A 2JRLA 2PRZA 3T5MA 2AMJA 4BP1A 3Q8LA 3ZLUA 2N42A 2BHNA 3G0BA 1GDHA 1F17A 3AMVA 1JFFB 4L6CA 4PPFA 4DREA 2EATA 3UMRA 5LJIA 4AICA 3O26A 1TUBA 1UDRA 4FINA 2CXXA 4KWCA 4AJ9A 4ARBA 4CMKA 3W05A 1XFDA 3VBEA 1ZUNA 1QMGA 2XEDA 4MR7A 4ZCQA 2OGSA 3SEZA 3IHKA 4V1CB 5KNDA 4P32A 1JXMA 2PH1A 2YJ3A 1PD0A 3ONWA 4MIYA 1R7RA 1Z13A 1ZNXA 2AJ8A 3IE2A 2ZDQA 2VHZA 1J8VA 3F7NA 4LYJA 3R6TA 4NH0A 5DX1A 1NQUA 3RVQA 3GLGA 1T4DA 3LFTA 2I2BA 3IBFA 4M76B 5F1PA 4URZR 3F2VA 5LPNA 2IS4A 4D4HA 1AXGA 3CPJB 2FEAA 5CJJA 1KJ9A 2JLQA 4P98A 4IRUB 2BL4A 5F21A 5EHNA 4TQUS 1C9YA 2CKDA 3O75A 5B4TA 2XTZA 2NVUB 4CKWA 2NUTB 1KWGA 1X1TA 1CUCA 4P7BA 5HJ5A 2DU8A 3G0DA 1OBVA 3KAPA 2YJ6A 1NXQA 3RS0A 2WZDA 4OQFA 3CZAA 1V4VA 4R71A 4B32A 2QGFA 2VUHB 3G68A 3IALA 3L8HA 3QE0A 3QI2A 2VDLB 1YTLA 3Q2OA 4GX2A 4HOYA 6YASA 4EX7A 5M2QA 4BXOA 5LBIA 3D5QA 2I1LA 2QLJA 3L04A 3OLYA 4MRVA 4MICA 3NATA 3SJBA 4ALJA 4E3WA 2ZB4A 4HDNA 4J7XA 3NIBA 4RE6A 1E1MA 3A1UA 4IEEA 5JY1A 3BHIA 1A9XB 1Z6GA 2D59A 4RVOA 4KBGA 4G2NA 2QXTA 3L05A 2IV2X 1ZUNB 2FMUA 1LB1B 1BMFD 2RJNA 3B70A 3FX2A 4E12A 2EHJA 2C9CA 1I32A 1ABEA 3JPYA 3GF4A 3LCJA 3TQTA 2LW7A 3QUAA 5BN5A 1JZTA 1ZD5A 4IF6A 3PR2B 4XX1A 2EFGA 2VEDA 5ALDA 2H3EA 1BS9A 1TO6A 1BXRB 1Y1TA 3EA5A 3FRIA 4BL5A 4E07A 3WIBA 3PI6A 2B0JA 3EXIA 4URUR 2HGZA 2Q0HA 2ECPA 1GZ3A 1X2BA 3Q88A 4XYBA 1KRWA 2RDMA 1IG0A 1RPZA 3A2NA 1ZM2A 3THXB 2IEDA 3F4LA 1I7SB 1L5QA 2W2LA 3L5KA 4QQRA 2ZSUA 4YJGB 3MFQA 5HX7A 3KQLA 2VXOA 4RC9A 1HQKA 4FXOA 2EDCA 1MG5A 3N76A 3PA8A 4U5XA 5BNIA 1QGUA 1VOTA 2RK3A 2PY6A 2QW8A 2ZAOA 2FSVC 5DTMA 2O2CA 2AUTA 5JOQA 2BTEA 3K1ZA 4WOPA 1MB4A 4GKVA 4NE7A 3SVLA 1OXTA 1LDMA 4HDRB 3HSSA 4IH9A 3PG5A 2JPDA 3UHAA 2JC3A 4ERXA 1P7ZA 3OPQA 2IYTA 2GCOB 2P4SA 3DL2A 1IY9A 3AGPA 4HZUB 2J48A 2OB1A 2P35A 5E6RB 3IXMA 5CEEA 1SBYA 3OOJA 3CTMA 1Y6GA 1QB8A 4ZVRA 3IKLA 2IDJA 3DXFA 4BRWA 2FPUA 3MTDA 1NY5A 4RD6A 1GPAA 5LQNA 1XVUA 5A06A 3OZDA 3LUKA 2BEKA 4NXNB 3SS7X 2WABA 2HJSA 1NVVQ 3M6MD 2AWOA 2DKOA 2XITA 4N3AA 2ZRJA 1IN7A 4MSUA 2GLUA 3NTOA 2OO5A 1BOFA 3ZE1B 1FU7A 1QYXA 1X15A 1QK5A 2PKXA 2H11A 2ZWPA 1EDDA 3ENZA 3ESRA 3GLTA 1RC8A 1PFGA 2B35A 2QUJA 1C7ZA 1R2QA 4IINA 2IU4A 1V1MA 4WXHA 1QLWA 5FP0A 3TPCA 1Z38A 2X4GA 4DBZA 2Y68A 2QD2A 4ERNA 1JWBB 1O94C 4NZ9A 5FOSA 2XOKA 3H6HA 2QMYA 5E4JA 1KL7A 1E0AA 2OYSA 3B60A 3AR2A 1R6DA 3KZVA 4YAJA 2H9AA 5D85A 5FNVA 1RRPA 4CM9D 3EY9A 4PYNA 3FDXA 4QGFA 2ODEA 3NASA 4UE6A 1W0JD 4LWOA 1M2KA 1ONPA 4DMMA 4G85A 2NMVA 2WB2A 1R9JA 4V38A 3KUCA 4F2HA 1EU1A 3GVXA 2X6RA 2AE1A 4OXRA 2YMPA 4AY4A 3OIUA 1M3SA 5LLSA 2HF8A 1SZJG 1THGA 3OOYA 1HDCA 1YRYE 4GPEA 5ELLA 4Y1EA 4OQEA 1DXOA 1XCMA 2J3MA 1Z8FA 2WE8A 3FNEA 1QVWA 2C4UA 4MVJA 4NFHA 4TTRA 4K26A 1PDWA 3DOIA 4OJNA 3OTOB 4YWHA 2CB0A 5C32A 1QIGA 4B3HA 1Y81A 6REQA 2W6PA 3DLIA 4X44A 2NOAA 2UZ0A 4KFUA 1DPGA 3UOGA 1UDAA 1PG2A 2G9ZA 3RODA 3CG0A 1Q3TA 2RB5A 3NNDA 4IJUA 2QMOA 5KINB 1N92A 1YZVA 3UW3A 3L1UA 3M5CA 3VZDA 3W1VA 1NLYA 2OCBA 2QL6A 1QO9A 4CLHA 4D79A 5BNTA 2G9UA 1ZC3A 3CIFA 4AKGA 5E3IA 5AKGA 1NUAA 3ON5A 5DLPA 4HAWA 1MW8X 1TI7A 4PAWA 3QNWA 3JQ7A 2FN3A 5FUYA 4F1KA 2EJWA 5LL6P 2D1RA 4KR6A 3ZI0A 4EKEA 2VCHA 2OZPA 4AWAA 3U60B 3NHLA 4HEA1 2Q8QA 1AQLA 2HRRA 1MQSA 2H7YA 4PPGA 1JL3A 2EGUA 1VL2A 4TZTA 4A8TA 1OXUA 4PIVA 2D0PB 2AGVA 2UDPA 4OGKA 2IWHA 2NU9B 3TNJA 3BVPA 3UUFA 4DDMA 1L2TA 3JWIA 4J0KA 4L74A 4CDRA 2XRZA 1EUYA 1WTCA 3L2OB 3OO0A 2VN8A 1EFKA 2QZPA 1ODIA 4EY6A 1C41A 4FXPA 1YRWA 4TMWA 2IXAA 2CFCA 3IUSA 3U4AA 1GFZA 1T2FA 1WZIA 3CCCA 3N3AC 3UXMA 2XX3A 3V8NA 3DZDA 5KYUB 3C8MA 4I5DA 1NXPA 1W581 1XYYA 1ZAKA 3RRFA 2WUDA 1L4GA 4R3WA 9ATCA 2KPOA 3EZFA 3S6JA 4HP8A 4YDQA 5CIWA 1Z25A 2A0FA 4HLDA 2H29A 3COSA 4PZDA 1TRHA 1YAJA 3GAAA 1KO8A 2H2GA 3N5KA 3W7VA 5H81A 1YSCA 1IIRA 2EC5A 1BRMA 3CRW1 4LQ4A 4DC9A 5H4GA 3RJMA 5JASA 3IVGA 1SVKA 1YQEA 2YWRA 4TPKA 4Y1RB 5GIPE 3ZVKA 3PQ8A 5H9VA 1O57A 2VH1A 3FZEA 4IOKA 1UPBA 3I9FA 4LV5B 1AN9A 2A5FA 2YBEA 2AL7A 4LDZA 1P7CA 4IEFB 3SF8B 5L7WA 1NNEA 4C29A 3EEBA 3KVRA 3LCUA 5KYUA 2PQ6A 2R1VA 3T5CA 2VF4X 3HXLA 3DLTA 4KN8A 4YPOA 1AKVA 1Z15A 2IE0A 2V7BA 3Q41A 3RVJA 1EESA 5FQNA 2YZMA 1ZIXA 2PN1A 3CGWA 3GLQA 4LBYA 4B40A 4DY4A 2YV1A 1RRKA 1GTVA 1ZJYA 3LI2A 4V0NA 3UAVA 3ESCA 1G59A 1K3FA 1ZAYA 1C7FA 2C7BA 2FZ5A 2X40A 4GX1A 5IAGA 3O5AA 3JCZA 2XB2A 4MIEA 3N8NA 5IAOA 1SY7A 2QTGA 4GW3A 1YHNA 1KK1A 2AH5A 4A82A 2NSJA 3GH1A 4BRUA 1OYWA 3MB8A 2P5UA 2QPOA 4YV1A 3ITNA 2H92A 2JHCA 2R0QC 3DNMA 4F4IA 2ZJZA 1PZFA 5F7ZA 1IOZA 1E2KA 1QB7A 3LMKA 4RUKA 3UWMA 3H83A 3JVIA 4P36A 4ROSA 5T41A 3S2UA 5DNYB 4MS4A 5TQVA 4NICA 5AQEA 4AT1A 1ZOLA 4MQ5A 5DTIA 2EBUA 3FM9A 1WCYA 4F2GA 1ZNWA 4GI7A 3OJCA 1T3ZA 1Z47A 2NNWB 1SHLA 3A2LA 4KXQA 2JAWA 2C0QA 2CNWD 5BN5B 4EX6A 5BN1A 5I01A 3LS2A 3ROGA 4BC0A 1V7QA 4LJ4A 1F2TA 5SYMA 4X24A 4H7FA 5DYGA 4AY2A 1OHHA 1OX4B 4TROA 4J2OA 4D9GA 1MABA 3M2PA 3SZRA 5LMZA 2ECFA 3WXBA 2BBOA 2IYFA 4YRLA 1YD7A 5AI4A 4Y2TA 4Q4JA 4N5MA 3C6YA 2VTBA 4GKAA 3OFVA 3CCFA 3OD5A 1UUFA 4BVBA 1NLMA 3GCZA 2PWZA 1ZVJA 2AQIA 2V6JA 5ERGB 5I7HA 2EKLA 3RIMA 1MGOA 1ORIA 5FBWB 1FY2A 1J39A 3ZS9A 2GEKA 2JRCA 1M66A 4K9QA 1YONA 2JJ1A 4MP8A 5IAKA 3M82A 3BICA 5GPBA 1IL0A 2VNAA 4RDXA 3MJCA 1HDXA 5C81A 3L7OA 4L3OA 4EBBA 3LKBA 3JWJA 1DWQA 4X20A 1PFWA 1LNSA 3A11A 4GQBA 4JLPA 4O5OA 3MINA 4XVHA 5DVZA 1Y5NA 3HHPA 4TL8A 1EZ4A 5AJXA 3FN4A 4F97A 3EXEA 4C04A 4BP9A 3BD8A 1P91A 1I2ZA 1FMJA 3QU9A 1F1BA 3L8MA 4FHGA 3X1KA 4ZTUB 4Q1DA 4QOSA 1ORWA 4D6XA 1NQWA 4WJZA 3OZVA 3Q2IA 4OFWA 2L82A 1WKVA 1PV2A 2ZR0A 4KK4A 2IZ7A 2VH5R 4KH0A 2DFVA 4URYR 4WFQA 3FCCA 2YJZA 3ZJYA 1Z4KA 5JBNA 3UJ8A 4RAOA 3OPMA 2CNDA 1J8MF 1YK1A 2AR9A 3D2CA 4L4ZA 4BFLA 2D2FA 1Z4IA 1CU1A 1Q7EA 2ISSD 2AN1A 2O1EA 1NTOA 4GOXA 3P2IA 1W19A 4KSBA 2ZB7A 1SD5A 4L27A 3EEQA 4BVHA 5JS1A 4ND1A 5ARCA 1CUVA 3NRJA 5AJUA 1ORHA 3EVFA 4LNHA 4CIWA 4EW2A 4HFJA 3WTCA 4R41A 4FYPA 4OK3A 1ZNQO 2IV3A 4B1FA 2J31A 2GYYA 3RYCA 4YJGA 1FFXA 4PYKA 4NZNA 4KWIA 2HCRA 3LO8A 2CL6X 2REXB 3AB7A 2IHNA 5DFAA 3T99A 3RGGA 3MJFA 3A3NA 4MI3A 2WV9A 3I01A 4Z9XA 5AM3A 4W6ZA 1YDFA 3MYRA 1SBCA 1ZMRA 3WL5A 1P9LA 3OM0A 4BNWA 1XNRB 5K3AA 5BNZA 3KFXA 1WMFA 2CL0X 5EIOA 5A0FA 2XAAA 3WWYA 3KEQA 3GPDG 4M98A 1WSWA 3TOZA 3I52A 5DNDA 1HO3A 2L69A 2BZ0A 2GDZA 2LWIA 4GNKA 3PVSA 3DC7A 5HIKA 1IY1A 3K2EA 3FUWA 4M1WA 4ZAGA 4TT3A 1PIWA 2LIVA 3DR3A 3H0CA 4N7RA 1NATA 2HQ1A 3PITA 4V0RA 3QYFA 2W2KA 3AF6A 5DSXA 4M9SA 5BN4A 3R3JA 3REGA 3SIWA 1LF5A 4TXMA 4RXUA 2IQIA 4RELA 1Z18A 3Q1LA 4FMDB 3TMKA 4P81A 4PG4A 4EW1A 1ZK1A 2LBPA 2CCJA 2YWFA 1N2OA 4GS5A 3NJRA 4OH1A 4J49A 4BNYA 2NUTA 4PONA 4MS1B 5K0JA 1VJDA 4U6NA 2NVUA 1DFHA 2WHRA 3QFFA 2O3TA 2X13A 4CKWB 5LP6A 4RQBA 3HPRA 3A05A 3AUAA 3R6WA 2M6KA 2NXNA 2OO7A 2FPKA 2X8BA 1FSZA 2C3PA 3H9BA 5DXJA 5KZMB 2J07A 4RHUA 1QHSA 1UT8A 4JQCA 1Z26A 2R00A 3TIGA 4DLNA 4RX1A 4MMXB 1T1RA 1R0WA 2PFSA 2I5PO 3LCRA 1RCTE 1Z4PX 1HETA 4ZPXA 3SEAA 2IPLA 3QMVA 5KI6A 1XVLA 3A37A 4W1PA 3E03A 4N0PA 3C5CA 4PSKA 4QUHA 3V5NA 3P4XA 5DTEA 4AIRA 3ZK9A 4AO6A 4A0RA 1Z88A 5BYKA 4FB4A 5A6VA 2O8CB 1AZTA 4L0CA 3S44A 3FZYA 1IIBA 1CG6A 4RGYA 3RBAA 2BHSA 3ESAA 3IMKA 1UKBA 3GARA 1EXDA 4OKSA 3ZCPA 5C35A 1E77A 3H1AA 4LWQA 2HL6A 4LXYA 3REQB 2QMZA 3CLRC 2GTIA 5KOIA 1LDGA 3IQEA 1QFYA 3PF8A 3JQEA 4HBZA 1JG2A 2RGGA 3CF4G 1W1IA 3DZHA 3DFUA 1X3LA 2AXNA 1Z08A 2HPZA 1KNQA 1LLUA 1Q0UA 2FFJA 3DULA 3GIWA 3O47A 4IHJF 3NKFA 1DCFA 3E9EA 4JBNA 1A8UA 2R6AA 2WPNA 3F6EX 5GMOA 1RI3A 1J0AA 2NV0A 3U3OA 1WMDA 1XTTA 5F2OA 1E2BA 2H1WA 2QXUA 1FVHA 4Z6KA 3SAJA 1K3UB 1Q1NA 1WS6A 2RKOA 2MJLA 2XKJE 3CE6A 1I1OA 3GJYA 3LP5A 4JS0A 4O4JB 4RHXA 2FEOA 5DYWA 3QHPA 1NMSA 5K05A 4GOJA 3ME5A 3P0RA 4HUJA 3GMTA 5FEMA 1KKLA 4HRVA 1AM4D 1Z35A 2AOTB 5ED4A 1PT7A 1QGOA 2A14A 3QVXA 4GLFA 1U2DA 4RKWA 1L7OA 1PX0A 3IT1A 4F5YA 1VSVA 4N5HX 3OKFA 4RETA 3R41A 4EELA 6ABPA 1AQIA 3CVWA 5C1DA 1G8FA 2OP0A 3JVDA 4Q00A 3C1OA 5FHRA 5E3HA 3ABOB 1OBCA 2HPAA 3OCCA 4OI4A 3ORQA 4FGZA 4JXJA 1SCJA 2XXJA 3JZDA 4ZAFA 3OFKA 5KREA 3A0UA 3BIXA 4EL5A 3WJ7A 3ZWKA 2AUMA 2KBEA 5E95A 3N2EA 1OMOA 4GVLA 3RRBA 1MJGA 4Z8YA 4X91A 2R66A 3NHBA 2BV3A 2TMGA 1ZHFA 3EA0A 3L6CA 4Z4FA 1RP7A 5HKKA 3IS3A 4ZT6A 5M7EA 3TTTA 1Z7EA 1F9EA 4YHBA 1AJEA 2UYOA 1JS1X 3DAHA 3W4KA 1GPUA 5D01A 1FFDA 3R2JA 2HA6A 2PZMA 1GXSA 3WYAA 2WF8A 3OH8A 4B47A 2IX3A 8OHMA 1YQTA 4QBTA 5E7MA 4L3VA 4I14A 5B4UA 4FWTA 2NXCA 3DBIA 4NYMR 1Z28A 1N78A 3R4VA 1YCDA 3GJ3A 1BX1A 2C5EA 5AO9A 1AN0A 3O0TA 3PUHA 5CH5A 3TSAA 1YASA 3ADKA 2HM7A 4TLBA 3FCXA 4KCGA 2IF0A 1IK6A 1JQ3A 3FGOA 4D6PA 2NO0A 5ENDA 5KMGB 4IM7A 1XEXA 5LQKA 2PXXA 3R40A 1G3RA 2ZUVA 3F6BX 4OB7A 3VR3D 4LVOA 1D09A 4Y9DA 3TTXA 1WXEA 2Q5LA 3P8ZA 2QK4A 5EFOA 2CFTA 2PGDA 5BV7A 3EIOA 1FP4A 3D6FA 2VBIA 2C2BA 1UXGA 3FPBA 4EHAA 1XKQA 2LRHA 3PTLA 3T34A 5B12A 3KLBA 3FMFA 4QRDA 4ARIA 4D9NA 5AKXA 2D7CA 1TZBA 4HDMA 5IKOA 4ZTBA 1KA9H 3ANMA 1CZHA 4RTSA 1KHHA 1IM2A 1PZNA 1X7WB 3WZLA 1SUSA 1C7RA 3HNRA 4LVCA 3UA3A 3DBLB 4BPRA 1L1EA 4N6GA 3VQTA 2GLTA 2C99A 5CT6A 5AKIA 3WDLA 1SVUA 4Z4IA 1RMQA 1CXZA 1BQ4A 1VYHA 3AF5A 3D02A 3GT0A 4WXYB 3UGTA 1X74A 1IZ9A 2FRVA 1X94A 2O0KA 3KQWA 3W2FA 2DT8A 4H1TA 1XVTA 4M0MA 3JQRA 5FNZA 2JFXA 3NBZC 3ER6A 3RTDA 2XT0A 3HJGA 1DQSA 1QJCA 1YBHA 3EX7C 2GM4A 4RSHA 5E4YA 2H4ZA 2E4WA 4KAFA 4B75A 1WD7A 5EJ4A 4YCMA 4HAZA 2P3LA 3ZHBA 3PLAE 3EQ9A 2ZYWX 3PU6A 3CURA 2HFKA 2DR3A 3JQAA 1H2WA 2H4WA 4HSEA 4OQMA 4V0QA 5DN6A 1JYSA 2ONZA 2X76A 1IN1A 1UP4A 3SX4A 3V6LA 1ZLXA 3L77A 2JLYA 5FBLB 1E60A 1O03A 1RWPA 2NZWA 2XE6A 4XW2A 4YJFB 4CQLB 5LMUB 2YMQA 2ATEA 4WKPA 3ZLVA 1YQGA 5FUXA 2DPXA 1OJ7A 3L49A 2NU8B 2RIPA 4TS4A 4D2IA 1YKSA 2OHGA 4NS1A 1U1GA 4TTSA 3ZCVA 1RM5A 2GJ9A 1D2RA 1QTIA 2B2NA 4MUEA 5EAIA 2HHAA 1E9DA 4M83A 2JAOA 3JD3A 1UODA 3ZXIA 4A1OA 2L42A 3FDZA 3IP6A 5C4IA 1KFCB 1OXBB 3V9PA 4Y6RA 3RYTC 3TVTA 1XZHA 1Z5VA 3NGXA 3OG9A 4GYJA 4NDNE 4W8GA 3ZLTA 1FW6A 4KR0A 4YBZA 3N2IA 3HVRA 1R8YA 1T9GS 1XR3A 3TMYA 3ZNPA 4AZ0B 5KVAA 1TEXA 1KEEA 4REMA 4KNYA 2QTVA 3GZNB 4OF4A 4RJLA 4AUEA 5LZ9A 2Z5LA 1L6IA 4IKOA 5KYNA 3X1ZA 3AHIA 1FNMA 1ISIA 4QQNA 4J16A 1NQXA 2IY8A 4Q9NA 4YXWD 4DPKA 1D4ZA 1U5BA 1YZNA 3LX6A 3OEEA 4OFZA 5EWJA 3QEBZ 5JQGF 3SKXA 1KBQA 4YYZA 2BM9A 2A35A 2WJYA 1ZX1A 2B7BA 1NR7A 2IUYA 3KWLA 1WQ1R 4PRZA 2G0TA 4AF6A 2DBQA 1BH6A 5J5VA 3RVKA 3WAJA 4LCEA 1FZTA 1SPXA 2CLIB 4M2LA 4LDPA 4W8OA 3QEMB 2GT1A 2HLHA 1GM5A 2IU3A 1JDVA 4FW8A 1OB2A 1GO2A 2CVQA 2I6GA 5J4YA 1XO1A 2RHLA 3C5HA 1RXYA 4J7AA 1F14A 1BZYA 2H4HA 4EKYA 2A0UA 2DHEA 3FUCA 4II2A 1BHJA 3A4MA 4RPLA 2R751 5CM9C 10MHA 5IKXA 2G5PA 1XYVA 4MW7A 1H6CA 1QGDA 3ZX5A 4JB0A 1TADA 1U63A 2LUOA 5FYQA 2VQEB 2X7HA 3MAJA 2M6LA 4MVJH 1GGJA 4Y9SA 3AVYA 1PL0A 3F9RA 1XAIA 4NYJR 4F11A 3RFTA 5I9LA 2G4CA 1YRQA 3HCPA 1G60A 2ONJA 5HNKA 1L7EA 2CNBA 1QIFA 5KYYB 2B1RA 2GZMA 2X77A 2PQ2A 1YHYA 3IVCA 4BLUA 5IF3A 1YVEI 1MQAA 5EIBC 2PKQP 4YCNA 1R74A 1NVWQ 3AR9A 2VP2A 1MAWA 2EU8A 4RLSA 7AT1A 3AIKA 4CE6A 4IDPA 1XQYA 1VJ0A 2I7CA 1UF9A 2YFQA 3P9PA 3Q7EA 3UCEA 4DDVA 5FI0B 1RBYA 4B17A 1Z16A 3K5IA 1GITA 1SZCA 3ZYCA 3USZA 2QV7A 3OE5A 4B7XA 3N2KB 2VDMB 3KR0A 3ETCA 3H2YA 3UT6A 1E0SA 1TD9A 4U0JA 3PNQA 5CU7A 2Y93A 1KJWA 2GYWA 3PFIA 4R0VA 4RIGA 4B6PA 2XZOA 2IH4A 1X7WA 1ECBA 3KBBA 3VPBA 2R8XA 4EG7A 3OQPA 1C7JA 1SKQA 3E2IA 2H3HA 1ZD9A 3H7AA 1FQJA 3KR9A 2PT7A 2Y2VA 4M87A 1YO6A 5FPTA 2PNJA 5HQ3B 1C8KA 1SGWA 3OP1A 5IX8A 3ZD8A 4Q1AA 3EGIA 5SZKB 1P4GA 3FA2A 3EA4A 3NKVA 4RHCA 4WLNA 4YP7A 2OORA 4J94A 4MRPA 5FA5A 3WIDA 4CIBA 2XZPA 2WQ6A 3WRXC 3ZCTA 2R62A 4JLWA 3SC2B 3W6ZA 4HRAA 1PR2A 1UEIA 1TK3A 2Y0EA 4ACBA 2QY9A 4XUEA 3X2FA 2FQQA 2PGJA 3H86A 3G88A 1Z5OA 2RGWA 1JXAA 1SRRA 2WFAA 4D82A 4OJTA 3U3XA 3OM9A 3CX3A 5DTQA 1B3RA 3QKTA 3QUCA 4EGAA 3WC4A 3TLXA 1AV7A 1HKHA 4B3JA 1KZYC 1SQ5A 4I6EA 3HUTA 2EZ9A 2VATA 1SKAA 2QVZX 1OFHA 5AK4A 5HRCA 1UR5A 2UU9B 4D4GA 4M1MA 1T5LA 2G1UA 5A9TA 1HE8B 5ADWA 2AI3A 1K66A 2DQSA 3KZNA 4J3JA 1TPYA 3LA8A 4PEVA 5CA1A 1UKEA 1WBJB 2O0MA 1R6XA 1YDWA 1E5LA 4YMWA 2FP4A 3WA6A 3C3KA 4TKVB 2OECA 3K73O 2UUCB 3MT0A 4PHGA 2Z4TA 3FDZB 3IIIA 3HG7A 3FR8A 4P3KA 3A4TA 3EXHA 4TM8A 4Z0TA 4DEVA 2FEKA 5IJZA 1UADA 2OBYA 2W43A 5H5JA 5K8IA 5MF6A 3HXOA 1V3QE 5C1BA 4OUDB 4JK3A 1PSZA 3LUGA 1DAPA 2GZAA 4L16A 3VSDA 1K7YA 1L8AA 3PL5A 4FYVA 2Z58A 3IULA 3SIXA 4F45A 5CW2A 1FYFA 1F5SA 3ZWWA 1EFRD 1V96A 2QTAA 3B82A 2A0YA 4OQYA 4YJ3F 5FFNA 2WSSA 3WFIA 5CJ2A 3K20A 3P32A 1S1MA 2A59A 3FIUA 1RYNA 2O52A 3DPIA 4G0NA 2YH2A 1P74A 2WIGA 3L07A 4BNUA 3GCDA 4JENA 4YMVA 3TSOA 5BSKA 1LI7A 1O5OA 4Q01A 1J2EA 1IXZA 1QIDA 3AY7A 4FJ0A 2LCQA 1WRBA 3WYDA 1V8PA 3C45A 4IMPA 2Z43A 4MUFA 2QL7A 4QT0A 4POOA 5ALVA 2WJ6A 4M0EA 3G3EA 4NCBA 3IO5A 1U3FA 1U8YA 5KQLA 3B1ZA 3RYFA 4Q7QA 3FOBA 1CHDA 4TTVA 1IH8A 2C59A 1OC4A 4WY2A 3T7TA 3U2QA 4A8PA 1R0SA 4M89A 3VNUA 4BKOA 3CUKA 4QG7A 1OWOA 1OA1A 3JQFA 4I2NA 5EL0A 2D2VA 1T0BA 3C87A 4GR5A 1L5WA 4CUKA 4RZ2A 4JLAA 3REFA 1H6BA 1M2OA 1UWLA 1XD2A 2X41A 1HE2A 3DOHA 2WAMA 3A58B 2FFAA 4AMUA 4DJFC 1SM4A 4ZN6A 4NR0A 3B3JA 1OHHD 1MD9A 2C5AA 2YCBA 4B6OA 5EESA 1A97A 2NLOA 5BV0A 2JFQA 2DWOA 1YL5A 4I9NA 3LBYA 1R27A 3O2NA 4H77A 4WSOA 3KYDB 1BXGA 4FIZA 4BGEA 5FOUA 2XB4A 4F93B 5JJKA 1HOTA 1S9DA 3ZV6A 2DJIA 2RGXA 1AT1A 4UJ3A 4IIGA 1MJGM 4NAHA 3GZJA 4IXDA 4C2TA 3FSJX 5AQ1A 4CQNA 1G8HA 1NMEA 2PLFA 1BVYF 1L3CA 3QJ5A 3CYFA 1QH1B 3E9YA 3L1JA 4MW2A 2QDKA 1GCAA 4ZHSA 2ATXA 2G63A 2YBDA 5J40A 4CZ2A 4JC4A 4WZAE 1BTOA 1QFSA 3VJLA 2Y0DA 3PNOA 3EGXA 4XUGB 1UM9B 2FQWA 2O2SA 4KL8S 3VR4H 3HL4A 3WFJA 5BW4A 4C0LA 1SC1A 5JBIA 5JQWA 5I7OA 3U81A 4R2HA 3KS9A 3ZIAA 1N9ZA 2OV1A 2I7TA 4S24A 4Z9YA 4I1OA 3WHIA 1ZI9A 1B6RA 1H1TA 2GM5A 1OZHA 2JLSA 3H65A 3KALA 1VI6A 4B33A 4DSTA 2V0GA 1Q3HA 3H5VA 4ETIA 1P61B 2ZANA 4DNFA 5LP1A 1D2HA 3PDJA 2D2IA 1QH8B 1F0YA 3OEED 4G4JA 3MUOA 5CVVA 1M74A 2KBFA 1XELA 2P9JA 1M8JA 2NQTA 1ND5A 1OAOA 2D54A 1MXFA 3LLSA 3QUBA 4TSFA 4QKQA 5FI5A 4DILA 5BVHA 3L02A 1NU8A 1E2MA 4BNNA 2C1EA 4CRWB 3S2YA 1RLUA 5JTTA 1FYWA 3G02A 5DBHX 1EUDA 2P2LA 1FTWA 5AK6A 5JZMA 5AHRA 1VP3A 2JLVA 2BBTA 4EABA 4BNGA 4EMBA 5KNCD 4JI5B 1C1XB 1MUUA 5AW9A 3MW8A 2ZRQA 4OLJA 1OXMA 1TJYA 4UE3S 3G2PA 3LPCA 3Q11A 4YJHA 1U81A 4ZVTA 3O9MA 1L7NA 2O19A 1Z07A 4MWEA 3F47A 4U7FA 4XOUA 4HRYA 1T8RA 1JN0A 3G1TA 3GLHB 1CV2A 1RXIA 4G0OA 2FFRA 4GEKA 2QJFA 4MUGA 3FYDA 2SKEA 1ZD2P 1QGUB 1URPA 3FPLA 3HWX1 1CF4A 4LSGA 4MVJE 2AIRA 3KV1A 4FYXA 4EJ2A 4WZ6A 4H35A 2NYRA 3A6LA 3SWWA 1P9WA 1PK9A 3HO8A 4GECA 4UU7A 4E5NA 1PAUA 1AO3A 1ECPA 3NAZA 5KSWB 1E99A 3P94A 1PJ8A 4QUEA 3A9TA 4R8RA 5G0WA 2YRXA 5AP9A 5FOQA 2DG2A 3EPKA 5AM2A 1RYEA 5A5DA 3GI1A 2IYVA 3BULA 5F2EA 2RGAA 4LA4A 5EP1A 1DPFA 5I51A 5FAKA 4U4AA 4Q39A 2X1MA 3C3BA 1WLSA 1GDTA 3WL6A 4MRMB 4M1ZA 2YJNA 4RH0A 2ZETA 3PXAA 1K6IA 4Y2QA 1DINA 3GX1A 4W1RA 4URVR 3KQHA 2ISQA 3H4IA 3NLLA 1KS9A 1N5MA 2G08A 1EIZA 3OOEA 2ONCA 3DUFB 4M9RA 3C7AA 4OBXA 5PNTA 4CM1A 5BR4A 5BUCA 1SBQA 2AJLI 1A69A 3VPGA 1OKKD 4X1OA 3HA3A 3AC0A 4LHXA 1NBIA 4X3CA 2DZDA 1YZGA 1RRFA 1SXJE 3I92A 2R6FA 3P9ZA 2JI7A 4M55A 5LXTF 1ONNA 4A27A 2P6RA 5L95A 1TAGA 3B3QA 3TTVA 5LQMA 1H66A 4XM0A 4UARA 2E1PA 1T13A 4MV0A 3V1KA 3MINB 4ZVVA 1FXSA 3QFCA 3HVJA 3SYLA 1RJ9A 2E4XA 1ZRNA 2G6TA 1EVYA 3Q8WA 4WESA 1GLGA 1W0JA 4RGVA 3UW1A 1RC0A 2LNDA 4ZV4A 1T15A 2W6MA 3GFSA 2RHWA 1W2HA 1NVEA 3IR5A 5DM1A 3W5BA 1EP1B 1NF9A 4S1TA 4RF5A 1WM1A 3G6KA 4C5BA 2FN9A 4QQKA 3KLOA 5CLFA 5H8WA 3MBKA 5JR3A 4O33A 5KSZA 1JQKA 5D7BA 2Q0QA 2JFNA 2OFWA 4OEHA 3WL8A 4L4YA 1UZNA 4TWBA 3WNVA 1JR2A 1LTQA 4BB5A 2I22A 2CNOA 2Z2IA 1M2VB 3CKMA 1J9GA 1NLUA 1ZNZA 2ODTX 3OPYA 3Q3JB 3KPWA 4WKGA 2E7ZA 4KXFB 5DP1A 4OM8A 2QD4A 3PFKA 1K2VN 3ZJ5A 3H1PA 1KEZA 5AW2A 4HN9A 3IQDB 4JNKA 4YO7A 1MORA 1SJ9A 1JFFA 1JGTA 1FP1D 5EC8A 4LAFA 3KKZA 4QX6A 4BNTA 4NBTA 3TF5A 3L8FA 1NRXA 1EUCB 1UXIA 4EGQA 4GYYA 1SCIA 1HT0A 2MCFA 3A6GA 1VKHA 4IO1A 4PLVA 1PNOA 3BA1A 3TBKA 3UV7A 3LWNA 1G7CA 2OVFA 3M81A 3QXCA 4NZMA 4WY8A 4RY2A 4AD8A 5ITVA 1NGSA 4JKYA 4IGFA 1CQXA 1CERA 1NJSA 2EL9A 3HZRA 3H99A 2HMWA 3NHFA 4BNJA 1XCPA 2QORA 1IJEA 1C9DB 4XLZA 4XIYA 1T9HA 2D8AA 2IZ0A 3GL9A 1Y4AE 4LY3A 3CEHA 3SC3A 1LUAA 4KQKA 4D56A 2BC9A 2OENG 4PHFA 1U6JA 1YUMA 1JLLB 5AVWA 2ADFA 4LDAA 1S2OA 3LYLA 3UFXB 3UJCA 1MQ9A 3EZ6A 1L4MA 2W8BB 2C31A 2A8YA 3OIVA 2Y1EA 4JYCA 3S2GA 3AKCA 3SLKA 3SS8A 2Q5QA 2R3SA 3PXBA 3TD6A 1TAHA 1DIOB 2IRWA 4EY5A 2I2DA 1NJ6A 2J9GA 1LD3A 2PH7A 3AESB 2FB9A 2Q9AA 4LBZA 4MJXA 4HDKA 3HUEA 4XWTA 1Y8RB 1DRUA 3DBVO 3I64A 4WAUA 3P9QA 4II7A 3U4QB 3VSCA 4I81A 1B43A 4YBRA 3TTYA 3JVEA 2ZIXB 1ULBA 3QXJA 5KJ6A 4CKCB 2HMAA 3EGEA 3KE9A 2PWBA 4QJIA 1Y7PA 1TQ4A 3LUPA 1Y63A 1DUVG 4OOFA 5D1NA 4EGFA 3UMCA 2Y1FA 2HA2A 5IVDA 4C4TA 1KBZA 3H16A 1FQOA 1JHMA 1WSBA 1Y9ZA 3DHYA 2YIJA 1ES9A 3UJ9A 1FDRA 3RUCA 4MWSA 3Q9UA 3ELBA 2G76A 1HK7A 2O20A 1B26A 5BWNA 2GUGA 2X1HA 3T5BA 4HJRA 4CQLA 1TA0A 3IOCA 3IQGX 3RS4A 4GXQA 2F8TA 2O3JA 2I76A 1QYCA 2OC9A 4I5GA 2WP8J 1NBAA 1DC6A 4B71A 3GRCA 4CT5A 4CETA 2IOYA 3RG8A 3ROKA 3G5AA 1JR3A 2XE7A 3WLNA 2HFJA 1WBDA 4D92A 1B00A 2X8AA 1EEHA 4KRXA 2WU1A 3T8YA 1MJFA 3SSNA 4C21A 3FE2A 4D0NA 3C7KA 4I50A 4YAGA 4AKTA 4B3MB 4YV2A 3U7QB 3CNEA 4NV1A 3BDVA 1P0PA 3E1GA 2FPRA 4J7UA 2BFCA 2X4LA 3F3KA 1F2TB 2LCFA 4MUIA 3F3MA 1SXJC 3T6KA 3E8XA 4DLLA 4CCSA 1OWPA 3ODPA 2XDAA 3CZ9A 3GGDA 4LE2A 1NF3A 3P2YA 1AHPA 3NWJA 3H05A 1LPPA 2PH3A 4KPEC 2V03A 1KFBB 5TMEA 2R6CA 5AJTA 4RFVA 3HZZA 4PGAA 1U3WA 1V7CA 3K6KA 3QPWA 5DBGA 3ZHSA 1RTKA 4I4TF 4J0DA 5AI9A 3KL2A 2ZIEA 3WLHA 1A9SA 4BLQA 3SX0A 1Z6PA 1IHXA 2VTVA 3IEUA 3PE4A 5ENVA 1F8XA 3AFHA 3C7DB 4G9BA 4QU8A 1RKXA 2HUPA 5FBVB 4PLYA 3JQ8B 2EP5A 3DNPA 3S7ZA 3TW8B 1FYDA 1XHEA 2BI4A 3KD2A 4FLMA 3TI9A 2J7KA 5L45A 3EZ2A 2CUZA 4QNNA 2BFBA 1P0FA 2HQRA 1LW7A 4BN4A 4ZMRA 1JPJA 3BDAA 2WJWA 2Q3EA 3IA2A 3OJLA 4BIIA 1MRNA 3D64A 1RHMA 3AINA 1KOLA 3T7IA 5IT5A 4OMUA 4N0EA 3IHWA 2WV7A 2ST1A 2ZRMA 4TYMA 1J20A 3FETA 2OGWA 3LUAA 4JSYA 5SYAA 2Z8YA 3P9IA 3DV0B 2QW1A 1QE5A 3DEYX 4Z0HO 3KEMA 3I45A 2X6QA 4G23A 1TF5A 1HRDA 4O2RA 1Z2DA 2X4IA 5E9JA 4RJKA 1GSOA 2V65A 3MLEA 1B0AA 2X8JB 1E5XA 5JIBA 1GOTA 2AFIA 3F7TA 1S89A 2J9ZB 4LJAA 4EKDA 4Y0AA 3EOBI 2Z9DA 1RWMA 2VSOA 4TMYA 5LYYA 3IKJA 3P0JA 2ZZNA 4PVDA 3GFRA 3SM3A 5IANA 5KYTA 2DR2A 1TU4A 3OF2A 4HMQA 2JIPA 13PKA 4KFRA 2PJUA 1KI4A 5LZ4A 3E05A 4QEDA 1O6FA 4PR3A 5DLYA 4D3YA 3IR7A 1A4RA 1F4LA 2GEBA 3I5YA 1U04A 1NHWA 1ORRA 1Y8RA 3CISA 3NUQA 2VYVD 3W3ZB 2IBMA 2Z1DA 4PZCA 1WXFA 4JGBA 2EKQA 4QJ5A 3NBXX 1J00A 3IAHA 3G85A 4IX9A 4MJLA 1T8SA 1MJ5A 1L5MA 1M6EX 3L6RA 4XQ0A 2JLBA 1FEZA 2QNIA 4HDQB 4D8UA 2JAUA 5J23A 1P81A 3A6KA 3CE9A 2JHAA 2WIAA 4KPYA 5LUBA 5C4MA 3PJGA 4GO1A 1C30B 1ARZA 3DDNA 3L40A 4KQIA 2J1LA 3DEHA 3KSAC 1V7PC 3LT5A 3ZE0B 1RPAA 4HADA 2Z30A 3T35A 3ZXSA 1H85A 2QROA 4OLBA 1UKVY 4K3VA 3SVZA 2JAHA 1L4FA 1MRSA 5KBYA 3N7TA 4DUZB 1KSJA 2HOQA 2ILTA 2PS1A 1EP2B 2V59A 3VH1A 2EFYA 5HILA 3VU3A 4CR6A 4MI1A 3WJAA 1R0ZA 2ZYVX 4BVFA 3UJNA 3IQXA 5FFMA 4OQXA 4ZEXA 1YQXA 2V7UA 2X6TA 1EEXB 5NULA 1PJ3A 3FCSB 2AC2A 3NGLA 3EBLA 4DKXA 4XYLA 4D57A 2V7VA 4NMHA 3RQSA 2VTDA 3B48A 5DF1A 4X8MA 1RD4A 2C00A 2VKTA 3G0IA 5JCJA 3RO7A 3N8KA 1W29A 3IAAA 4TKZA 3H9QA 3MS7A 5E6SA 5ADHA 5F9MA 1GGKA 1WMEA 4IKEA 1MC8A 1ADBA 1NX9A 3N2NA 4HEHA 1GPKA 3GBVA 3EGOA 4U7PB 2A92A 3ZJTA 4ID3A 3HYRA 1T9DA 4E2FA 2RD2A 1CDDA 4IJMA 3RB8A 1PN3A 2HIAA 2XVYA 3A1FA 4YP6A 2EGHA 5TQ0B 4ND6A 1YBFA 2FPPB 4TTTS 4B80A 5FTLA 1GFWA 1H42A 4ILEA 1FPQA 1I51A 4B0PA 1Y9EA 3ROZA 4EEZA 4KVGA 1A4UA 1WHTA 2JHFA 5DNVA 2NUPA 2QLLA 3R7DA 3UIEA 1U7XA 4K9NA 1W1UA 2OD7A 4ZYWA 2B8WA 5D84A 4EUKA 2CXRA 1VL5A 3SFZA 3ND9A 3QYAA 1Q83A 4Z51A 1NUTA 1E9VA 1OUMA 3STUA 5A05A 2DWPA 3HQ4O 4GZ6A 1J1ZA 4V24A 3ROPA 5IDYA 2HSDA 5GM2A 4I7EA 4IL5A 3COWA 3QF7A 4L76A 4P4TA 4RK6A 4DWWA 3U5TA 5K8LA 3B20A 1N6LA 2C0CA 3CR8A 1ICIA 3QWAA 4F5ZA 3GPCA 4RVSA 3DMPA 5H3HA 3ZW7A 1RHQA 4FWIB 3PHGA 4RVUA 1SVWA 1Z82A 1DLIA 1USVA 2GN4A 1JQDA 4X71A 1E9FA 4DV4B 1T35A 2AOUB 3NCHA 4JLMA 3VA7A 1TJ3A 1OH6A 3ZJUA 1DBWA 2IU0A 2HMUA 1RWKA 3DMRA 2ZIFA 3O74A 1LPBB 4DWJA 2W2NA 2XPCA 2LGJA 4KIJA 4U02A 3PB3A 4S1VA 1PGPA 3DNFA 4N5DA 2Q2QA 4NH4A 5ESWA 4PCAA 2ZRLA 2FCAA 3K0AB 2QQEA 3VPSA 4NEQA 5EVJA 1V9LA 1AX9A 2LPMA 2PCLA 3DDUA 4KC0A 1DU4A 4FQ8A 2PUWA 4R7GA 4JWTA 4ZREA 3TIFA 4BC1A 3V2GA 4F4JA 3FIJA 2WFZA 3ZK7A 3PWTA 5BP7A 1LKZA 4GWGA 4RFSB 2VP3A 3BMQB 3BFPA 1F48A 1NN3A 1SZDA 1T91A 4JEHA 4MWZA 4UBOA 4F5DA 5A5FA 4MZDA 2WU0A 1QVVA 3VGJA 1OC2A 4CFZA 4KAJA 3UKJA 1ZIDA 1HR0B 1NXTA 4H7JA 3ZDFA 1VLVA 3JYQA 1D1QA 2YOHA 4BQNA 2XIQA 1X92A 4LGMA 4TQGA 4CMBA 2CLHB 3OE7D 1FXWF 2POCA 1ZGBA 3OA0A 1O5IA 1O4WA 1QRDA 3COYA 2PVSA 1PW7A 2ZS7A 3LPNA 4HUQA 4TLMB 3F73A 5E2BA 2PXAA 1DEAA 1PX2A 5T8KC 1JVSA 4BX0A 2BIFA 5A4MS 4DRYA 4OX9B 4RF2A 1TRKA 2Y27A 3TOXA 2A9VA 1MG0A 1E1LA 4GVXA 4MZXA 3VR5D 2RI1A 3I6BA 3VFDA 4MIKA 3DONA 1X8JA 1ST3A 5KYWA 1SVSA 2R97A 1NN0A 2X19A 5H1YA 2UVPB 1CK4A 5TQJA 1U8UA 3I58A 3MD9A 4GQIA 3E5MA 5FHQA 4WH0A 4X1YA 2D74A 2QJTA 2WNHA 2ORWA 1I30A 1G8KA 3FWHA 1YA6A 4FLFA 4ZI7F 4RJ2A 4HQOA 4NE2A 4PQGA 3SZLA 3KKLA 1UWKA 1S2LA 3VX4A 3PC7A 5CCEA 2O07A 3O92A 4F6LA 5JPCA 3FMPB 1GA1A 4IMIB 2QN1A 4RVGA 4LEIA 3MSCA 1PEDA 1ISJA 3CR3C 3DO5A 1E9BA 4Q9DA 2BH9A 1E62A 1OU0A 3FMOB 1GV1A 3PR1A 4EOGA 1R88A 1X86B 2YS6A 3AZPA 3EGDB 3OIDA 4LC0A 2AFRA 3UM9A 3H75A 1MO4A 4A8JB 3WA7A 3CUSA 1Y33E 1I4LD 4F3YA 1QIHA 1AGRA 4JL8A 1ZESA 3RARA 2WI8A 3QVUA 3OURA 5AVTA 2JDID 1SXQA 3HI4A 1V8BA 2BM0A 4P34A 2FPMA 2EX0A 3BEOA 4GPTA 4Y2YA 1T5BA 4M0FA 3WV5A 1QH1A 1WY7A 2YYYA 4IZ6A 5BQ3A 3PICA 3JQPA 4H18A 3N7AA 1WOYA 3PHHA 1YJAA 4A3SA 4KQMA 1QHEA 3NHYA 5K3BA 1IMOA 1MB0A 1RLIA 1ZGAA 4G25A 3TSCA 3I2KA 3K8YA 3QVMA 2IEIA 1ISGA 3UH1A 1G8MA 2ZRPA 1Y98A 2R48A 1M8KA 1I6MA 4JBHA 2ZYIA 4MS4B 4QRIA 5IUNC 4GZLA 1E5VA 4EGJA 2KJQA 4BO3A 3LGXA 4Q1EA 2GNOA 4X63A 5AK3A 5E7JA 4WBNB 2HC9A 4LRUA 3H8JA 3IESA 4IIVA 1IBCA 4P0PB 2H18A 2P0EA 4EP1A 5IK2D 1SPBS 4IS2A 1YRAA 1EJ6A 4X00A 1P2BA 5JWOA 4WASA 2PUBA 4B4UA 3GIDA 3FBGA 2BELA 1J1UA 2TSYB 2N9UA 2JGKA 3B8HA 1EFAA 4L9AA 1E4YA 2GJKA 1J6UA 1X7ZB 4MWOA 4P22A 1CTQA 2AN9A 3RYFB 3KQYA 5DBOA 4YR7A 3AF1A 3F78A 2G67A 4KR7A 4ESVA 1E79A 3EZYA 2Q3BA 2LVBA 1WZEA 221PA 1QZTA 4IGAA 1I0ZA 1RCUA 2VFAA 1UBHS 2GXSA 3PD0A 4QLOA 5D5HA 2WR8A 2VNJA 3T3IA 5BSFA 2IEGA 2E6KA 2EFEB 2C9OA 4NK5A 3ZH9B 2YW2A 4KXVA 3HB4X 4N40A 2OPBA 3Q6NA 2I6UA 3EH2A 1GTZA 2WA2A 1A4IA 1GCOA 3PC6A 5T4EA 3GA5A 3FWYA 1M2GA 3KETA 1KZ4A 3U3DA 4EMTA 1G5QA 2AG8A 4UNNA 5GJBA 4RPGA 1K6XA 4GBED 4KO2S 4UU0A 2Z2KA 4UTRA 1OTHA 2VLIA 1QXSA 2FF7A 2ZE6A 3D6NB 3L6EA 4TSKA 3T4PA 5AXDA 4Q18A 2WWTA 5EPUA 5H3LA 5KX5A 4EI2A 3IAEA 4IEIA 4QBGB 2GO7A 4TKMA 2CFOA 4D4MA 1DLJA 4ISCA 1PS9A 1LVUA 1WDWB 2JEOA 2PEZA 5IC5A 2QX8A 3QPDA 5CFRA 2ZT8A 5BR8B 3AWIA 3BFKA 1EMDA 3LLMA 1O58A 2C4HA 4V1CI 3LK7A 1AGNA 4Q3AA 4XWGA 2P8JA 5EIAA 2FPGA 1V35A 3ETDA 3PFCA 4R8MA 5KWEA 4REQB 3AR5A 2F62A 3DE3X 3VTAA 1TCCA 4Y6OA 1YT5A 3EHDA 3CX6A 1WABA 3I1FA 1QX4A 2C5HA 2O1XA 2PVCA 4AJJA 4DNPA 1EM6A 1DKLA 3TFWA 3ZNOA 2B4QA 3V1NA 3PIRA 2CUKA 4GXRA 5A5GA 2WAYA 4JT8A 4EG0A 1V3TA 5C1OA 1QHHA 1NBMD 2JJ2A 2XWQA 3AEXA 5AVQA 1R4NB 1ZVQA 4W9NA 4IV5A 1A04A 3H13A 4CL3A 1B16A 3B1KA 5FD8A 1XXHB 1K2WA 4A91A 1I36A 1A77A 2IH5A 3MYYA 3KG2A 4DCGA 4AQ7A 2FR0A 2VAPA 3QX9A 4HL6A 1HNZB 1D5WA 3DYBA 4GHWA 3QPCA 4BDTA 5LIPA 4FDUA 1HZZA 1JE1A 2ZWVA 2IU6A 1NOKA 5IAEA 3G2NA 3LQ4A 2WMYA 4TT8A 3AYZB 4H4DA 4KYTA 4M38A 1C3OB 3LF2A 5GOTA 3NC0C 3I9KA 5AM0A 3SXPA 1N9KA 2Z8ZA 3C39A 3FNBA 4EPVA 3E9QA 5MHTA 4BMYA 2Z6QA 1SCKA 4YP1A 3TGPA 2Y1DA 1JT9A 2GRUA 3C8UA 1E3QA 1ZGHA 4FCVA 1ZJJA 3WGMA 4OL0A 2GARA 3BPSA 3NWEA 3D31A 4EJSB 2HKIA 7ADHA 1Y1LA 4RE5A 5MN5A 1OWMA 4KOAA 4W7IA 4D9IA 2RGNA 4DZRA 3RUDA 1UWCA 2VRCA 5HA5A 4FNMA 1UFOA 3IDZA 1FBNA 4IIHA 4C4RA 4F3NA 1GQSA 5K2MA 4UTNA 4ZT5A 2E5FA 4PGMA 3C3YA 3T4XA 1P0QA 3NEAA 3K30A 1PFKA 2DWCA 4HDKB 3O8OB 1ZA2A 4Q9HA 5BWLA 1M8FA 1D6NA 2A57A 5JYDA 1LBQA 2SKCA 4MVJP 1REQA 1POXA 4HWOA 1EDOA 4MHOA 4RIHA 1A50B 1CS4C 1OIVA 1I5OA 2D5IA 2Q0XA 3WDMA 2OXIA 2NQ2C 5K51A 3T4UA 4WFIA 2EOAA 2OESA 2W22A 4Y1GA 5IBQA 3PC4A 1EVIA 3WNZA 4D3FA 2YC2C 1EI9A 4NYMQ 1V9SA 3A1SA 4UHKA 4YMGA 4EFDA 3THWA 1CCWA 1VCNA 1QRUA 1GGNA 3IILA 3V97A 3D6HA 1TGVA 5AKYA 4F5WA 1HTWA 3SY8A 4BVJA 2HIMA 3UTDA 1E5DA 5TGDA 2F90A 2ZWIA 2JAQA 1HYQA 5T3YA 2CCKA 4KX3A 2QSYA 4NY1A 1KQNA 4XDHA 3RFFA 4D43A 1J0CA 4JKIA 3E3LA 1Q7RA 1O87A 4KEAA 5SV2A 3QENA 5JROA 2PSHA 2P11A 3VU9A 2A0WA 1B0PA 2G9VA 3GHHA 3PX2A 1QHXA 4EPTA 1WU8A 3HFSA 1I80A 1ZONA 4Q3NA 3UKOA 1T3TA 2XAUA 1AZLA 4CEIB 1E3JA 1ZIOA 3D7NA 4JELA 4OB6A 2DETA 1H6AA 5JWRA 2HIHA 1M2VA 3ETGA 3JZMA 3E35A 5ALQA 4MW1A 2G71A 3FMGA 1GP2A 2GYVA 1Z45A 4U8HA 3H5LA 1EVQA 5EN4A 3OU7A 4LF5B 1VGQA 1ZU5A 5B58T 2HIGA 3RVDA 1ADYA 4GXNA 1DKMA 4UD6A 2DVMA 3IYLW 3RC2A 3UK2A 2IH2A 1OI2A 2O8DB 2ZR7A 5EE0A 1DEXA 4ER7A 2WB4A 2AJTA 3Q3EA 4HGRA 1Q5PA 2CL5A 2ZJ5A 2I80A 1Q7BA 2D3WA 3CH7A 4KACA 3RYIA 4EDFA 1TFRA 2JFBA 3C4VA 5DO9A 3PXCX 4Y3UA 4EZBA 5LKAA 4FDMA 3JATB 2YMLA 5KCMA 3R7WA 5C7IO 1GQFA 3Q9SA 1RQNA 1RW4A 9LDBA 1DOHA 4E1VA 2MWMA 2QTBA 1FS5A 4X5OA 1G16A 2BBSA 5ES3A 3U16A 4Q03A 4MKGA 1EJ0A 3U61B 2Z95A 4X93A 3HJHA 2AZDA 4MDHA 1Q1AA 4TS3A 1KVTA 4MV9A 5H59A 3BBPA 3EVBA 4DQXA 3GLFB 3EXFA 3GLIB 3E4CA 5AVUA 2WKSA 4R8VA 5JJIA 2HMSA 1Q3KA 1EHCA 3AR8A 3EIXA 4ARSA 2VRCD 2V97A 3E9RA 4HAIA 1MHPA 3KEFA 2C5BA 2A3RA 4BBZA 1L8XA 3RJ9A 1POWA 4CMAA 4EMSA 4P6VF 2WTMA 2JKYA 1V5IA 3OZBA 3WSTA 1XU9A 4UNPA 3TRKA 4A10A 1TUBB 3HSYA 5DEOA 2IHTA 4WEQA 4ZCTA 4PICA 2UYHA 1IJKA 1XA0A 3C0KA 3H04A 4HFNA 4FGJA 4B7AA 2C1ZA 3GLIE 4NF2A 1ZOIA 1XXLA 2UUBB 1CZUA 1GG2A 1TYAE 2GX6A 2EX1A 3OA2A 3VAZA 1T6BY 4UFOA 1P9OA 4GP9A 4FEEA 1A1SA 1XPOA 5KNBA 2GVDC 4UAGA 2PZKA 5IM4A 4K87A 4PO9A 5K0CA 1UJ2A 1HNXB 1E1CA 1YUBA 1ULSA 1M0TA 3E81A 5G1PA 1E2EA 4H7IA 1TKRA 3MCUA 2EW2A 3R7NA 1GPNA 2XUGA 1A71A 4DM7A 1VRCA 2XYQA 3C6BA 4W4TA 4GOMD 5K4GA 1FVFA 2H5IA 3S1SA 4NBLA 2F3RA 3PGVA 5K20A 1A7JA 2F8SA 4F86A 4CXMA 4OAPA 4U5QA 2RBKA 3JQBC 3KQMA 1E3IA 2V7EA 4QWWA 4WNYA 3F3SA 4BX8A 4GQAA 2GEDA 1C9KA 2G8LA 4AZVA 4DA6A 1IQRA 3UEOA 4P2GA 3A06A 3FVVA 2PUEA 2LKCA 5C52B 5L6LB 3PXDA 1N6HA 1BCRA 3JRXA 5BSTA 2I65A 1QYVA 3CLUC 1M6VA 2NPIA 4AJOA 3UOAB 2K2WA 2AN4A 4H9GA 2GN2A 3HKDA 5FBHA 3JV7A 5LWQA 3MJSA 4IR7A 1HTTA 1TZMA 2HLNA 1CJBA 4WNCA 4DGSA 4US2R 4YRTA 5K0GA 5IT9A 1YF3A 1D2MA 3MJRA 5IG2A 2P79A 4M1OA 1PT9A 1N3IA 2EFDB 5LZ5A 3HCBA 2Y3IA 3GJ7A 3T7CA 4EIWA 1MAAA 1MDFA 4LMAA 4M9CA 4TLEA 1Q1EA 2QVBA 2DPHA 2UZIR 2YVAA 3W6UA 2DJ5A 5CVUA 4EJ0A 5EPEA 3LBAA 4UHEA 1ZBDA 4KXYA 5CGZA 3I3OA 1X7YA 1X6VA 2GFQA 2JGNA 3BQMB 4M46A 2XODA 2XECA 5BR7A 4AI6A 4ETNA 2Q2VA 4OHUA 4Q1BA 1COWD 1KYZA 4GL4A 2QI9C 5GZ1A 1E92A 1N3LA 2BM1A 3T3DA 1Q0QA 5JI2E 2VJAA 2IVFA 5CLQA 3UUGA 4MPRA 1OLXB 4MRMA 2I3ZA 5GZ6A 5KU1A 1QTRA 3FPSA 5KYKA 4D42A 1UFVA 1Q0ZA 2QGZA 1VLJA 1P45A 1WO8A 2BMWA 2A1UA 4XX0A 4JFRA 4JN6B 1E96A 3LBFA 5ETJA 2I4RA 2GXUA 3AOEA 1NZJA 3I53A 4QYSA 3S1LA 4DR2B 2GN8A 3O0DA 2H57A 5BPHA 1F3LA 1LH0A 3BZBA 4HGPA 5C4GB 4FSDA 3QPBA 1JFVA 2FE1A 3Q15C 3ZZ1A 5KX5B 1L5YA 1W1WA 3EK2A 4M1QA 1J8DA 4MV6A 2XB8A 3T61A 2RC5A 2DHRA 4UCQA 1NJGA 5DGIA 2UAGA 5M5BA 1LBIA 1U2SA 3NONA 2COUA 4GKJB 3HCCA 4AJEA 4R0NA 4Q3OA 1NMZA 2J6HA 1GZ5A 1E79D 1V8ZA 2HDNB 2RHDA 2W2QA 3FYSA 4GAEA 4LHWA 5EY5B 3OMLA 2Q1UA 2J3HA 1FA9A 3I04A 4KDFA 2PNFA 4Y8VA 3VDXA 3QNMA 4RKEA 4BV9A 1KTIA 1KOFA 3GRRA 3GJXC 1Q16A 3LKDA 5J43A 2H0QA 3TS1A 3T7RA 4BU0A 3BMOA 3NBAA 2ZRCA 4UUOA 5EJGA 1NYRA 2HEIA 3R8XA 2DYKA 3LDAA 2BGTA 3V2IA 4AMGA 4EO7A 2W2PA 1S7CA 1SU4A 5JO9A 3AX6A 4NV0A 2UVPA 2WHXA 1KJYA 5FV7A 3L84A 3TL3A 3TOSA 2CZGA 2F59A 4LOHA 1FUUA 1QPGA 2MYPA 4O2AA 4A0FA 3OOWA 5B3LA 4R5HA 4WDQA 2HSJA 4K88A 3SDZA 4EUEA 2ODWA 1WB9A 4MH0R 5IZ4A 3SQXA 2VNSA 3Q85A 2A1TS 3R0XA 1GRCA 2QG9A 3T12A 3NTXA 3OCVA 2Q41A 1R00A 5C7YA 2VXYA 5CB8A 2AOVA 4YIKA 4IG4A 3G2IA 1VBNA 3M89A 4F04A 3K71B 4RA9A 5EQTA 3E3OA 5EOVA 1QC5A 1BC5A 1WP9A 4WOCA 1VSQA 3SBOA 5SZIA 3ZY6A 2ERYA 4JX8A 4MUBA 4TQ9A 3W8NA 4H59A 4MDYA 3NHRA 2EFCB 2A86A 3E9MA 2AVDA 3Q8MA 4M0DA 5LD2C 4DR7B 4TKVA 2P9CA 5DHRA 2AFVA 3CW8X 4MXDA 2NU6A 3BFJA 3GUCA 1Q92A 4NJMA 4ZJYA 1QAOA 2PRJA 3JRWA 1MN6A 1O95D 2XH8A 2QT0A 2ROQA 5LQRA 3TTWA 1SC4A 4JLSA 1QWOA 3ZQJA 3FMIA 2B78A 5HCIA 1CZLA 3T5PA 5JJBA 3S3TA 5K8CA 5JAOA 4PBRA 3NVMB 1QPZA 5HM6A 1P0MA 4R16A 2BEVB 2P9BA 3DMFA 1ETUA 5JVDF 3FJ1A 1RXUA 2OGTA 1HF3A 1ML3A 3ROEA 5J47A 3N6RA 4YCDA 1Y3IA 5BOSA 3OLVA 3IJRA 1QU2A 1LPSA 3HPQA 2G77B 3G5MA 2ZAMA 1SXGA 2OP1A 4TS1A 5J2UA 4MVJD 5BMOA 2MT9A 4R3NA 5KOHA 4U7JA 4NQZA 2IS1A 1QE3A 2O8CA 5LZ2A 3UK6A 1OI3A 2AOUA 3GGGA 3IMGA 1HNWB 5BRJA 1ISPA 5BW8A 2WHYA 3AVWA 1RJWA 2GNPA 1ZQ1A 2GEVA 4JBLA 4BRZA 3FLEA 3PHJA 3COVA 1YRLA 1QCDA 1NOIA 2GM3A 1JYEA 2HSGA 1OIXA 5F1OA 5DIZA 1PQWA 3OHMA 5HQJA 4AYWA 3I9V1 3VM6A 1RXEA 4H1UA 1WX1A 4UNQA 5K0NA 2V7GA 1I7LA 2V4MA 3FPEA 2QBYA 2J32A 3ROMA 3VZCA 2Z6UA 3OCJA 4Q4HB 3IPAA 1P19A 1Y1SA 3HB1A 1IZ7A 1P7VA 5MN4A 3HEMA 4ICIA 1SVOA 3BJEA 5A71A 2XQGA 3TH5A 1RRGA 1U7TA 1YIDA 2BKUA 4ITRC 4BEJA 4I1VA 3D0RA 5GY7A 4D4JA 1Z7YA 1FFBA 1DT5A 5EQFA 1FNNA 3HRIA 4OYRA 1VE1A 2WQZA 1RJFA 2DUJA 2VHVA 3LUDA 3B3FA 4RNCA 2H17A 2OCDA 3KZOA 4EBFA 3NETA 1KAMA 4KR9A 4L8LA 3PCRB 3QVWA 3QMWA 1VQ1A 1A8QA 2ZTMA 1TMKA 1LZKA 3I2JA 4QHTA 3SNHA 4BPBA 1KOJA 4GM0A 5EZ6B 4B73A 1QQBA 3ERCA 3BWDD 3B2QA 3SQOA 4JH0A 3F0TA 2ZYTX 1WCV1 1X9GA 3Q72A 4NU0A 5JSZB 4H7PA 1U1DA 3O8LA 1JNXX 4M99A 1IQ0A 1NNSA 4GX5A 4FHCA 4DS3A 1A1VA 2IYRA 4I55F 3SNKA 4E2ZA 2C29D 4KQ2A 5FOVA 1LRLA 2IW1A 1RKVA 5FLKA 5T6BA 3CPEA 1Q7GA 4RV9A 1NG1A 4W9MC 2EBWA 3I73A 3RK1A 3OTQA 4AUMA 2OAQ1 3BC1A 3IAUA 3Q6IA 1IBLB 1YZLA 1OBHA 5IARA 2WICA 2HQSA 2FUNB 2LZ0A 1FUIA 1CW2B 3A26A 4OVKA 1NNI1 2G9QA 1IAQA 1GKYA 2A2ZA 1KGDA 1I14A 3DW3X 4OQDA 4AJHA 2JFGA 5JZVA 3OE1A 4MTCA 2ZT7A 1QK3A 1WKCA 3FPHA 3G5TA 4PWYA 5AUOB 2GA9A 3CKLA 3OPNA 3NHUA 4O4LB 3BM5A 2ID7A 2GPSA 2X0NA 1R64A 4LXQA 4ZQBA 4L2IB 3L7MA 3V55A 3VHLB 4DVGA 1NG9A 4FFDA 4LHEA 3I6ZA 2VK4A 3K0AA 4PE5B 2EFJA 1E2FA 1BE6A 2QN2A 2Y0PA 5DBEX 5CX4A 4XSVA 3W5CA 3QVGB 2AD1A 2QRGA 1VL0A 4G97A 2OBFA 1EA7A 5HG0A 4BNVA 1W25A 4BN5A 2HCJB 2JGDA 5EKUA 1CJCA 5C1PA 4KPUB 2JCGA 2CXHA 1J49A 2P41A 2DLDA 3FPGA 3JR7A 3QUQA 4JOCA 4OQNA 2J30A 1C81A 3PSAA 4GICA 1IOLA 4HB0A 3AV3A 3DGFC 1JA1A 2DRIA 1A5AB 2GVNA 3QEJA 4KXXA 4UEKA 4E5MA 3J7AC 4Q4DA 1F4VA 3CKYA 1Z0UA 1YZUA 3DQQA 4JP1A 4WCFA 4LIPD 3ICWA 5D86A 1SOAA 2XLBA 3AKYA 3DCJA 3NJ8A 4FT4A 1Y42X 2FSIA 2P5YA 2PU7A 3NBMA 3PNYA 4IDHA 3VOTA 7GPBA 3KTDA 1B23P 3DR5A 4C7XA 4TYPA 4NU6A 3U3RA 3HY6A 4EGSA 5JAPA 2J08A 1LSJA 4C0BA 3O3CA 1KDPA 4C07A 1JG6A 4Q12A 3QF4B 4OI1A 1BGXT 1NVVR 1TVMA 3ZOZA 4GDFA 3WGJA 3RS5A 1PGNA 1J2RA 1TF7A 2FUG1 4XGIA 1DTEA 1N8NA 2XMQA 3Q7IA 5DYYA 1ENPA 1GPDG 2IUTA 2Y6UA 5E6UB 5IBRA 4BLVA 2PJDA 5KVVA 4F6RB 3KXIA 1I6KA 3GDHA 1NR1A 2VQ6A 2PTGA 2PZLA 2I03A 4CU2A 4RTPA 1ZUHA 1WE2A 4CCYB 4WIAA 3OFNA 4URXR 3Q0EA 4FNAA 4TUYA 4Q6BA 2FETA 1KJ8A 3MTGA 5F9HA 4E46A 5KNDD 3G59A 3UJAA 2XNKA 1DJPA 1ODTC 2OM6A 3VR2A 1JFLA 1E69A 1UZAA 1VJ5A 1Z6TA 3MT7A 4H0FA 4CEIA 4ITVA 2PGLA 1V1JA 4FUTA 4L07A 1QGAA 2ORYA 3IQWA 2MOKA 1GNVA 3UA4A 1WNFA 1G7SA 2I33A 3P4YA 5JE8A 3TW8A 4G4SP 1CBUA 1PJZA 4Q4LA 3F7MA 5HK8A 2AF4C 2C3UA 3R20A 2J0UA 3DV9A 1FTSA 3I42A 1G5IA 1FFSA 2JH8A 2NYUA 3PQ2A 4RMJA 4ZEMA 2QX7A 2JLCA 2FP3A 2FMHA 2KSQA 2YHUA 4IBOA 3IC5A 1GG9A 2O7RA 2X9LA 3E53A 2ODBA 2W90A 3GVIA 5J5CA 3VJKA 1UPXA 4BFTA 1II0A 5GJVC 2R60A 3WGUA 1LBTA 5DKFA 2XQIA 3RTCA 3VOSA 5KIAA 4AN0A 5EMHA 1YNSA 1H2YA 2WJ3A 1QTNA 2JI8A 2X2PA 4YB8A 4BVAA 3ZH2A 4IIFA 3TEMA 4MI6A 2JKZA 4FK8A 1RRMA 1KQ3A 3PYXA 5IM5A 2Y1KA 1U11A 3KVNA 3TUIC 4DQ0A 5AOAA 1L4BA 2ZS9A 1MGPA 3U7QA 4D44A 5HDBB 1C14A 4NU8X 2IZ1A 3QLVA 3AG6A 1SU6A 1Y6RA 3H9CA 1UMCA 2EVWX 3PIDA 1MH1A 5F35A 2IODA 3HCRA 3PWKA 2GBLA 1Z4MA 5CRIA 1FU4A 1FF9A 2YXEA 4OI2A 2O2ZA 5EHQA 1K5DA 3CUEF 4F7DA 1USWA 2BW0A 1G3QA 1CRQA 4REOA 3N53A 3O90A 1PK8A 3ZYZA 4QIHA 2O4UX 4J0GA 5CK5A 2P2NA 4Y1RA 5SYNA 1DJNA 3A2KA 1OASA 1V48A 3G8YA 3MQ4A 4R69A 2PBZA 3PPYA 3QYPA 5LM3A 4R8LA 1G2PA 2GF0A 4UUNA 5LXTB 4ZFNA 3C7CB 1CC1S 3T94A 3MN1A 4Y2HA 1R5OA 1R10A 3KTAB 4ITUA 5AW5A 4E1BA 1TQ6A 2GR9A 5C9ZA 1C9NA 3F8TA 3A3YA 1IU9A 2HNBA 3MS2A 2IHYA 4JQSA 3IVAA 4ZYVA 3RVPA 4BNZA 5D3ZA 2XEXA 3OQOA 3K1JA 4G0WA 3KC2A 3RS9A 3S8YA 2CDRA 1BWQA 1Z2CA 4AJKA 1SHUX 1WPXA 4G89A 4YRRA 2IYUA 3I9V6 1PNRA 4DYVA 2I7XA 4B83A 1K7CA 2HREA 1L5ZA 3QKRB 1HLPA 1LLCA 1A7KA 1VKRA 1ZZGA 1XDDA 2GCOA 2OCGA 4TVOA 5AUPB 1NJ1A 2PRIA 2Z5VA 1CE8B 4X66B 1HG1A 1BW9A 2FK7A 4OHWA 4F4DA 3GFPA 3N2GB 5D1HA 3RHTA 4ZTZB 5D6NA 1HL7A 3CEAA 4BNFA 3GDFA 1HX7A 2AR7A 4YCSA 4H6PA 2HUNA 1K7SN 4QM7A 2QUBA 3UAWA 5J3JA 4LOLA 4JC0A 3HYSA 1YQDA 1XDZA 3FBWA 4AZSA 4KMRA 3PCXA 3VZBA 4W5TA 1TC2A 1YA8A 4CLDA 3NDBB 4WK0B 4F21A 2AFHA 5HBRA 5TEVA 4MEJA 4CJXA 4EF5A 5ANRB 1ECJA 2ZDGA 1M2JA 4V0LA 4I46A 1NMQA 3LDFA 5DE3A 6REQB 1XN4A 3RRYA 2BSAA 1JQ5A 1JMVA 4CKEB 3I01M 1QUEA 2NPOA 1WWKA 2XUHA 3DT6A 4BO9A 5HJEA 1E2IA 2E89A 1WF3A 3C3EA 2YCLA 4XJTA 1RWWA 3AZQA 4JYPA 1IC6A 2FXVA 2R4TA 4TVSA 1WXXA 2B1IA 2PT5A 3ANYB 1GZVA 3G0GA 2HXSA 4KN6A 5F3DA 2MYUA 5K7SA 4MQBA 3O6VA 1JEYA 4DANA 2PLWA 1TCBA 3EBOA 4Q9AA 4BFSA 1KY5A 2GD0A 2I67A 3BE4A 1M73E 4PAOA 2IZ5A 3BWCA 1GAJA 1XRPA 2GHTA 5ALJA 4RANA 1OX5A 1AZSC 5DM60 3ZUGA 2QT9A 1WY5A 4BVGA 4QO7A 3UGJA 1UFQA 1XRRA 4IHJB 3DLCA 3WRWA 2GZRA 5DTJA 5KYGA 2GKGA 2OR3A 2G1AA 3CX7A 4JBIA 4YT8A 1JILA 1E98A 2JASA 3K5PA 2H1FA 1UJ6A 3LHSA 2CVZA 1FMCA 1DBPA 1XCBA 1KYTA 2QOEA 3FNRA 4IWNA 1KPHA 1UT5A 1YULA 1ZJZA 4IIBA 4YJKA 4UOEA 1P62B 4MGYR 3O4RA 2GBFA 1XL0A 1IYZA 2NYAA 4IXNA 4EYOA 3FTEA 3CVJA 3F90A 3GG2A 1W48A 4HQNA 3W34A 3D7MA 3WYEA 4RO0A 2AHRA 2MDTA 2X5NA 3JAWA 3LUBA 4NG4A 1F60A 4PLGA 4C5AA 5CLLA 4DVJA 3L0ZA 1YE3A 2QBYB 2OGUA 1AKRA 3FLAA 1Y7HA 3WBFA 5JS7A 5JCOC 1Z4JA 4QYIA 1N2SA 2ETXA 2VF2A 3GUZA 3OEHA 4P82A 4E5PA 5CNMA 4RTQA 3DLPX 3ZDAA 2X2EA 5I7EA 3DUFA 1ENZA 1Z56C 1P1HA 2OBNA 4NMLA 3QP9A 4HG2A 1X87A 2ZTUA 1RT9A 3LHKA 4P35A 4EW3A 4YLYA 5CDUA 7MDHA 3DTTA 1F20A 4HUQB 1JW9B 4ZQEA 2A5JA 2RGDA 3PQ7A 4HAXA 4CLRA 4P0QB 4ZVMA 2HGSA 2CY0A 1YRHA 3QQ5A 3I1IA 4ECAA 1JLLA 4CV3A 2GPBA 3DEZA 3ZTWA 4PSVA 3HNOA 3HVKA 4DDHA 5HFJA 1YWGO 5JNSA 1W0KA 2QSUA 2N3ZA 1E89A 1VSBA 3BAFA 4IIDA 4RMIA 4TL9A 1P7YA 2WUGA 1FSPA 3JZAA 5HQTA 4IVPA 3I28A 3L82B 5FA8A 1KC3A 4ZYYA 2XCLA 4I1SA 1ZEMA 4KGVA 4EUFA 1W4AA 3SJCA 3K31A 3KAKA 2GNAA 4G56A 4ESHA 5CH3A 4D7AA 5HHTA 4RMGA 4V0SA 5CURA 2X42A 2F1RA 1WB4A 2XDWA 4FNOA 2O8BB 3DG9A 3SOPA 4LZOA 3VU8A 3RKRA 3MRTA 2FKAA 1WTAA 4UPVA 4B2PA 4Z7JA 4O63O 3QLTA 3R5JA 2JKVA 3ETNA 3H7IA 4FC6A 4JJ4A 1DV2A 2NGRA 2BKLA 2PX3A 3TG8A 3S99A 3UHFA 4QBKA 3DEFA 4C3ZA 1MXHA