4ETMA

Crystal structure of yfkj from bacillus subtilis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
164
structure length
162
Chain Sequence
GQGRGSMISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILRREGISFDGMLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDLADVPDPYYTGNFEEVCQLIKTGCEQLLASIQKEKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase yfkJ
publication title Crystal structure of YfkJ from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 60
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etmA00
5EWJA 5IEBA 2RDMA 4JB0A 2HQRA 3OQMA 1USIA 5FWXB 4Q6BA 3GRCA 2CD7A 3LUKA 3BRSA 1LK0A 3C3WA 1NXXA 4KK4A 3I09A 4NCBA 2FQYA 2PUDA 4Z9AA 4EYOA 4MR7A 1JDPA 2J48A 3QEMA 2WMYA 3T6KA 3RVLA 4RY0A 1DZ3A 2OENG 3UK0A 3GBVA 4ML3A 1QO0D 3A0RB 4Z4CA 4N47A 1QP4A 2R47A 1D1PA 2WRZA 1YVUA 1NXVA 4CBVA 5IUJC 3H5IA 3BREA 3KG2A 3N0XA 5E3JA 1M2FA 3TB6A 3QELB 3IP6A 4IRXA 1JDNA 1LBIA 4JB2A 5DKFA 5JS2A 5JNTA 3NHZA 5ED4A 1IIBA 3QK7A 3T95A 4XLTA 4EGSA 3LUJA 4MPTA 1NXWA 4DADA 4ZYLA 3CKMA 4DQDA 2MSLA 4IMIB 4RY9A 3KKEA 2QU7A 4N0PA 5C5EA 4MRMA 4OLBA 1C4WA 2CWDA 1OXBB 4Z4IA 6CHYA 3DZDA 2IYNA 4RXTA 3I42A 3VNBA 1JF8A 2X7XA 4YLEA 3RVMA 5KQGA 3NNDA 1B00A 1FQWA 1DCKA 3HXMA 4EY3A 2PJUA 2E4XA 4RK6A 2PUCA 3N53A 4H3HB 2RGYA 3GWGA 1ABFA 3LUDA 1E2BA 3Q9SA 3BBLA 5JNUA 2RJNA 4M88A 4HNQA 3T38A 3JY6A 3OLVA 3BRQA 5BRAA 2B1JA 4JASB 1K66A 4G86A 3SM9A 4Z4HA 4QYWA 4JP1A 3EAFA 2FMHA 1NXOA 3HM9A 1QQAA 3HEBA 3SNKA 1KRXA 3OM0A 4MS4A 1W25A 3HK2A 1EWTA 3FFTA 1YK0A 2QVGA 3DLBA 4TLMB 3N6VA 1YMVA 2GWRA 2Q5CA 4LE2A 5KC8A 3FFWA 4IGAA 1QO0A 3I5AA 7ABPA 1FSPA 2V0NA 3HO1A 4EUKA 3OMXA 2R25B 2LPMA 3QX8A 4RKQA 8ABPA 3QELA 4KQ9A 1JH9A 1GUDA 2A9PA 4H60A 4LE1A 2QW1A 3GBPA 3R0JA 2FTKE 4Y9TA 1DG9A 4XAQA 1DC7A 4Z4EA 2FVYA 5GOTA 1MB0A 4NICA 1JFVA 2QSJA 2E4WA 4RV5A 4YP9A 1DC8A 2AYXA 4RKRA 2MSKA 4EVSA 4MLCA 1RPJA 5CNIA 1XHFA 3CNBA 3IPCA 4OATA 3CTPA 2FMFA 3CHYA 3D8UA 1OXKB 1P6UA 3KSMA 3H5TA 4WXEA 4KFCA 1QNLA 4G0QA 1QMPA 5KI6A 1PEYA 2PUFA 1MAVA 1D5WA 4W5RA 5DLEA 1KGSA 1A04A 5T3YA 2JK1A 4Q6WA 3LOPA 2FEPA 2R4QA 3IP7A 3GL9A 4PICA 5I4CA 2QVCA 3N75A 4RDCA 4PEVA 4F3TA 3CS3A 1PEAA 4YR7A 3ILHA 2LIVA 4LDAA 1T34A 4E7PA 4MR8B 4L4UA 1CHNA 2FEWB 1F4VA 4YGXB 4MLDA 4HNSA 3NNNA 2O20A 5DGCA 3RVRA 2NZUG 4KPYA 4QYMA 1K68A 2FXIA 3Q41A 3QLVA 3SQNA 4KRFA 4L85A 3QLUC 2HSGA 3CU5A 5JNWA 3W9SA 3LMKA 1DCFA 2A9QA 2YHAA 3HDGA 2PAFA 1D1QA 4FE7A 4HYEA 3F73A 1WETA 3EULA 1LJUA 1KMIY 4N03A 1USGA 2VK2A 2WY2D 1EWKA 5TQJA 2CHEA 3JPWA 1VKRA 3UKJA 3URMA 5IX8A 1BDJA 2GBPA 2H3HA 3H6HA 4OTZA 4YV7A 3ROFA 2F8TA 5JS1A 3T8YA 1F51E 2YHBA 3KS9A 4RK0A 1QKKA 1Z15A 4JA2A 1AB6A 2P4UA 3EGCA 1DRJA 2JVJA 1PNRA 2PE5A 3MMNA 4WXMA 1C0EA 1W9HA 2PUBA 5DTEA 1FFWA 1SXGA 3A10A 5EWMB 3RVKA 3OO0A 3E3MA 5IC5A 2MYNA 3DBIA 3H1GA 2WJWA 3KTOA 4H3KB 4MQEB 3CRNA 3O2SB 1D2AA 3OMWA 5FBHA 5HQJA 5T7BA 1R8JA 5TPZD 4YWHA 1YS7A 3F6CA 1QQBA 1SXHA 2LUOA 3HV2A 1PHRA 1DCMA 3LUHA 3LUAA 4MGEA 4MS3B 3HCWA 1ZH4A 1M5UA 5JNRA 4N41A 3KJXA 3RVNA 1A2OA 4TN5A 2QR3A 4Z0NA 3O2JA 3Q15C 3NBMA 3F7NA 3S99A 3HZHA 1ZAYA 3K4HA 1BVHA 3C3KA 2FN8A 2P9HA 2E4YA 3FDFA 1JBEA 5FWYA 1QP7A 1ISRA 3K9CA 1MVOA 5PNTA 1Z16A 4G0YA 5IULC 2L19A 4Z4GA 3OM1A 3EODA 3QLTA 4LX8A 5FWXA 4MYRA 1RZRD 1APBA 1PUXA 1RXEA 1RXIA 1RZRA 1ZESA 4YCSA 4MS1B 1J56A 5HM6A 2IOYA 1L5ZA 4MR9B 4F12A 2QZJA 1SD5A 2FMIA 1CEYA 4G97A 4F06A 4NCAA 2NT4A 3JS5A 4UHKA 4UHJA 2IKSA 4O5AA 2R48A 1PNTA 4E7OA 2WB4A 2L18A 4G0XA 3C3MA 4WZZA 3G85A 2NUBA 3H6GA 4MQEA 1YIOA 4Z99A 1EFAA 3IP9A 1GUBA 2BGGA 1VLZA 3E61A 4Z9BA 3OO1A 2IDMA 1P2FA 3OLZA 3VNAA 1E6KA 3ILYA 4KQCA 1P6QA 1NXTA 4JOQA 5TPZA 3OQOA 1L5YA 5JNSA 4P98A 2HQOA 1EAYA 1Z25A 3KHTA 4MS3A 3SAJA 3OLWA 2N9UA 3IP5A 5GQSA 3MA0A 5CNKA 1JWLA 2IPLA 3Q7RA 5TQ2B 4GPAA 5CNJA 5BQ3A 1FFSA 3CLKA 3CFYA 1SRRA 4RS3A 4N0QA 4G0PA 4PYRA 1DBPA 2B4AA 4WWHA 1RNLA 4GNRA 4W5QA 5IEJA 1TM2A 3TX6A 1ZHHA 3FFXA 5EWLB 3FMVA 1JFSA 1VRVA 4W5TA 4MR7B 3H5WA 1JX6A 4MQFB 3LUGA 5B3JA 5TE9A 3N8IA 2ZAYA 1QP0A 2FW0A 2PL9A 2MYUA 2IPMA 1CYEA 3H5OA 1FFGA 4IMJB 1GCAA 1EHCA 3G1WA 3HJFA 1BDIA 3O1JC 1XHEA 2L2QA 3KYJB 4EYKA 1Z13A 3QLVC 1BDHA 4D6XA 3CZ5A 3O75A 1YMUA 3M9WA 3N0RA 1Z26A 2JVKA 2JB9A 4W5NA 1M2EA 5TPWB 4ZPJA 2IPNA 4Q7EA 3CG0A 1ZGGA 2VUIB 1NY5A 4KREA 3L49A 4KZKA 1KRWA 1NATA 3P9YA 3SY8A 4KMRA 4OLAA 3B2NA 2LBPA 4FE4A 2E4ZA 3RQIA 4KNYA 2QV0A 4RK5A 4PZ0A 9ABPA 2GX6A 3A3KA 1Z18A 2OQRA 2VUHB 3RVOA 3H5LA 1DBQA 2XDYA 3HVRA 5TQ2A 2DRIA 3CG4A 5BRJA 4RXUA 4ZMRA 1JFTA 3HDVA 1USKA 2KYRA 4RY8A 1A0OA 4B09A 2MYPA 4HNRA 4RWEA 3GA5A 1YTUA 1Y1LA 2MSWA 4QPJC 3O74A 1ZVVA 2HJ9A 5EWLA 4MS4B 1VPWA 1ZDMA 1JYFA 4NV3A 3TMYA 2JCGA 4MQFA 4IF4A 4YRZA 1ABEA 1ISSA 1EWVA 4XXHA 1LJLA 1SXIA 2WJAA 5IUNC 4MR8A 4ETIA 5KQPA 1NTRA 4RZSA 2PKXA 4RSMA 3NNSA 3DGFC 5BR1A 2GI4A 3DLHA 3LTEA 3KYIB 4G0OA 5C5CA 1U2PA 3FGZA 2FN9A 3EDCA 3L6UA 4PE5B 1U2QA 4YS6A 2L17A 1BAPA 1ZY2A 3HS3A 4FB4A 2FKAA 2VYCA 3EJWA 2NT3A 1DJMA 2I6FA 3SG0A 5HSGA 3GYBA 4F8JA 1JLKA 3LKVA 1E6MA 2GKGA 3IPAA 1GLGA 1HEYA 2PUEA 1JYEA 3LFTA 4JAVC 2F8SA 3H5VA 5TPWA 3KLNA 3M9XA 5TQ0B 4ETMA 3O1IC 1GCGA 4O1HA 1JL3A 3NHMA 1ZITA 4TMYA 3CZCA 4XARA 3JVDA 1Z17A 1MB3A 1QPZA 3EQZA 3IDOA 3GT7A 2PUGA 2FQXA 2TMYA 4KV7A 2FQWA 4OG2A 2HPHA 4EYGA 1YS6A 4EVRA 3OQNA 5EWMA 2JRLA 1ZN2A 1TLFA 2E4UA 3RVPA 1D4ZA 2FLKA 3BILA 3JVIA 2CHFA 1U0SY 3O1HB 3MF4A 3OLXA 2LP4Y 3C97A 4LE0A 5D2CA 4NQRA 3MQ4A 2W42A 2WWVD 3TO5A 3JTEA 3MIZA 3UUGA 1DBWA 3LUCA 4KVFA 1MIHA 4YO7A 5FBKA 2IPAB 2FLWA 1UDRA 2ID9A 4D6YA 2PMCA 3KCNA 5F64A 1E6LA 4N76A 4RU1A 4ETNA 5HKOA 4MAAA 2JBAB 4RK4A 3KLOA 1TJYA 1Z12A 3LUFA 4LRQA 3MYYA 5IBQA 3RH0A 1URPA 4ZMSA 5EWJB 1TMYA 2E4VA 4G0MA 2JVIA 3H1EA 3O21A 4RK7A 3I45A 5CNMA 1P8AA 1AB5A 2FMKA 5KQLA 3HUTA 3N0WA 4LZLA 6ABPA 2ZWMA 3MM4A 1U8TA 1JHZA 4O1IA 4TLLB 4XFKA 4RK1A 3QEMB 1U04A 4IILA 2RJOA 5TQ0A 3RVQA 5B3JC 1NXSA 1I3CA 2QXYA 3Q7TA 3GV0A 3Q7SA 3ROTA 2PL1A 4OBBA 4W5OA 3M6MD 3EQ2A 4Z4FA 3RVSA 2M98A 4ZJPA 1NXPA 4MS1A 4F11A 3LKBA 2M1ZA 5KWSA 4MR9A 4WUTA 4RXMA 3TD9A 3HUUA 2ID7A 4LDZA 3RVJA 1XWWA 4S04A 2A9OA 3H1FA 3OLYA 2NZVG 4WT7A 4S05A 1ZH2A 4KK3A 3O2QB 2HQBA 1Z2DA 1ZGZA 1YK1A 4EVQA 4P1ZA 3C6QA 3D02A 5ABPA 5KC9A 1TVMA 4G0ZA 4MRMB 5CHYA 1BA2A 1LBHA 5DCLA 1H9CA 2PLNA 3DGEC 2PUAA 3F6PA 5JNVA 4XASA 4QICA 1DP4A 3A0UA 5KQMA 2AYZA 1DRKA 3HSYA 1M5TA 5IUKC 4EYQA 3QX9A 4D74A 3QEKA 3H75A 3JPYA 2A9RA 2JBAA 4DN6A 2MYTA 2FSPA 2FEKA 3QLUA 5FWYB 2H0AA 1S8NA 1Z2EA
chains in the Genus database with same CATH superfamily
4CIXA 4FGJA 4QXRA 4YDQA 3BXFA 3W2FA 4ZHQA 4G09A 3B53X 3BICA 1Y9EA 4JI7B 1H3EA 1Y8RB 2D7CA 4HN9A 4XCXA 4HHEA 4IO1A 4B3BA 3DV0B 2GEUA 3X1KA 3E82A 3OP1A 5DM2A 3KL4A 4LRTB 3DPUA 4ZDIA 4HBGA 2Q5LA 4AP5A 2R62A 3IHKA 3R09A 1B8UA 4EY5A 1QRDA 2OENG 4YRSA 4DQVA 2YXDA 1E3DA 5I51A 5BSTA 4N47A 1QP4A 3JW8A 3NC1C 3TL2A 1W75A 5HIJA 2VHUA 3EAQA 1ZBDA 3GT0A 4FHDA 5AO9A 3RPEA 1G5HA 1T5LA 5A0VA 2D2IA 1YGYA 3QKRB 2B1GA 3QU4A 4MA5A 3N0XA 3X44A 3P0IA 4A7PA 1QOZA 1RR6A 2P2SA 5JROA 4RTJA 3AL3A 1JEYB 4GXRA 3SQLA 1SC6A 3UFBA 4PQGA 3SS7X 4I1RA 8OHMA 4C0AC 4LYDA 1IMOA 2PA0A 1N7JA 2ZJZA 4TUYA 4GMXA 3HEMA 1OZHA 2AA3A 2IA5A 1ZUNA 2CDRA 2JIMA 3N2YA 4NCXA 5D8DA 3VTZA 2F4NA 2HMWA 4OI0A 3TZEA 4TWBA 1YD7A 4ZANA 3H5NA 2X6RA 1ZSYA 4UMFA 2WJ4A 1IXKA 4K87A 1XA4A 1JDUA 3FKQA 3KEGA 4L75A 2KJQA 3BIXA 4UDOA 3X3HA 3DCIA 3VBCA 2VP4A 1A4UA 1W0JA 2VPZA 1GZSA 2B69A 2UDPA 1VL8A 4D1YA 3NTVA 3KEFA 2BMWA 2DPMA 2E4XA 2QE7A 2YIVX 3VU1A 1Z6QA 2H9AA 3LDFA 1XSEA 5HKKA 3BE8A 3TIGA 5CFRA 4WZBB 2QBYB 3LQFA 1UBGA 1JR6A 1OYOA 121PA 5KSPA 3RREA 4MV8A 5JBIA 2YY7A 1JHMA 2YDYA 4PAGA 3V3TA 5BRAA 4KLNA 5LJIA 3TD6A 2O1EA 3SM9A 2XTJA 4OXQA 4LG1A 2PM8A 4EB3A 4AFNA 4I55B 5JAHA 1ZXLA 4M1SA 1KRXA 2O0LA 4BFUA 2V7UA 1W88B 4AG3A 5AIAA 4LFAB 1ZI8A 4IDDA 2BTOA 2QV7A 4U6QA 1RQXA 3N6VA 6GPBA 1Z29A 4R0VA 5MFZA 1EXDA 3R9WA 2HSWA 2Q1SA 1YB6A 3OECA 1RKBA 3P0EA 4GYYA 2ZT7A 4P58A 1DAPA 4X91A 3I5AA 5DX0A 3ILVA 1XAHA 4G23A 4KRYA 1SA0A 1TPZA 3NYWA 4E22A 1PKEA 1JLHA 3B9BA 4CKXA 5CIQA 3MWDA 1N36B 4E13A 2Q3JA 3FBGA 2FTKE 1LA2A 3GBPA 3IJEB 3OE7D 4HDRB 4JUAA 4Y9TA 4DZRA 2FVYA 3DAOA 1FRZA 4RA9B 4B75A 5DI9A 4IRUB 1JFVA 4W1RA 1RD4A 3C8HA 4F5DA 1QGAA 3HI4A 4EZBA 2OVBA 2WJ3A 1L5GB 2NNLD 2IW3A 4HQNA 1OYWA 4LUCA 2C7QA 1NI4B 1V8DA 3N0VA 3CHYA 3Q88A 1NBIA 4WXEA 1KZ1A 2JC3A 2ZJ5A 1VPDA 2CXPA 3ZYCA 4D8XA 3HFJA 5BXYA 3DKVA 1H9AA 3QNMA 4PBRA 1NF9A 1PTJC 5DBOA 3MW8A 3AI3A 1C29B 4E4RA 1J0XO 1YBHA 4J9UE 4XIGS 1SKQA 5I9MA 2PMDA 4AN1A 1PVOA 2O3TA 2FWAA 4Q6WA 1QVZA 4MRAA 1TVEA 2OHGA 2P62A 2CDCA 3PDUA 3H1TA 4KC0A 1PQYA 2VDPB 4UTOA 1IHOA 1NQTA 2RB4A 4BP9A 5I4CA 2CKDA 9MHTA 2E48A 3OP4A 2XAAA 2COKA 3FSEA 3PNVA 4P2GA 1E61A 1KKUA 3LHSA 3ABSB 4D4MA 2XQKA 5JRDS 4R9UC 4DDKA 2II6A 3WGMA 7MHTA 2Q21A 3DWEX 4GE3A 4MVJD 1RJ9B 2AFVA 5G1NA 5LXTF 1QF6A 2P2LA 2XLBA 5CGZA 1R4MB 4TZ6A 1PSDA 1TT5A 1Y33E 2FSVA 4K6FA 3MBIA 4KLCA 1UQRA 1Y1KE 1WJGA 2PXXA 2JFXA 4PXAA 4ZI7F 1E8DA 4HGYA 2BBTA 1Q17A 3CE9A 3FMFA 3WFZA 4DOMA 4TZTA 1FPQA 2Y9MB 2NQ2C 4ARUA 4FOOA 4C88A 4B17A 3C3EA 3KM0A 4BMXA 4BDSA 1F1JA 2OLJA 4UNSA 3ZGOA 4EITA 3LAWA 3W06A 7ADHA 3L8MA 1E7QA 3OD5A 3MCTA 1E62A 1C9MA 1RIFA 2NOAA 1L7XA 1WUTA 2XMBA 3PRJA 2VCEA 4OL0A 1ISPA 2I7CA 3GK3A 3MCVA 4D97A 1Z8FA 2PGXA 3PDHA 4PHFA 2QQFA 4CHTA 3SIPA 1JZQA 1SZJG 2JGDA 1Q0RA 4BXOA 4MKRA 4TGLA 2JVJA 2Q0HA 4IOLA 5I9NA 2QMOA 1FDWA 3RUDA 4BWVA 5MDHA 1GADO 2C42A 1WCIB 1MIOB 3H1PA 1T5HX 3K1YA 3IKLA 5F5LA 4IHJA 1Z06A 1QBGA 3PA6A 3C15C 4R8VA 2WJWA 3DZHA 2DUNA 3TW8B 2OQVA 1Z0ZA 1OWPA 4IV8A 1SQ0A 5DEOA 1YH3A 5BQFA 4MYUA 1L8XA 1J21A 1ZMOA 4IIVA 3FNBA 5I4KA 1LNQA 4Q1DA 4RAOA 1B74A 1UADA 2GHIA 3RASA 1ODIA 1WPXA 2XYGA 3UK2A 5A04A 2WWFA 3KFVA 2LUOA 4CM9D 2QW0X 1FBNA 3GEGA 3K9LA 4P8RA 2XOXA 4XR4A 3V42A 2C2MA 2CJWA 5EZYA 4KPEC 4O4IB 3UMJA 4MROA 2VUUA 3SXUB 4UUNA 4UNIA 1N0WA 1IRXA 3G7UA 3PHLA 1AMNA 4IICA 3B13B 3BQMB 2H4WA 4RKWA 3WRVA 2AOUB 2ASVA 5K03A 3U19A 4QNMA 4B3FX 3K9HA 2PKQO 4KSCA 1MFPA 1H1LB 4GFDA 4TL8A 1ONOA 4YJDA 5K0FA 2JCBA 5CDYA 1AUVA 2E4YA 2YN2A 3RSSA 4Q01A 3U9SA 4DJEC 5JATA 1T8YA 3LX6A 2VA9A 5F73A 3KNZA 4K6OA 3RC3A 1P2VA 3NWJA 2GASA 2Z1DA 1ZIXA 3HJAA 2VF8A 3QLTA 3O3OB 4LX8A 5DIFA 5A7HA 3K0FA 3GGCA 4IFBA 4C01A 4C4PA 1X1QA 5IDYA 4Y6PA 1ZM3A 5JZVA 4QQKA 1E3LA 3AUSA 2XA9A 3ME5A 2UKDA 2GQ0A 4BP3A 1M2WA 3ER9A 3BTUA 5HM6A 1WCXA 3RNOA 1IOLA 1H0RA 3H9QA 4M2LA 2ID4A 1FUEA 2FMIA 4K6GA 4DDTA 3V8QA 4ZZ2A 1ZW6A 1U9CA 5AW7A 2VTKA 5G1OA 4O5AA 1TIPA 2Z6VA 2IP4A 1PNTA 4BO1A 1SUPA 2Z1NA 2I55A 2R6R1 2JFVA 3LDAA 4NYJQ 3U7HB 3CF6R 3F49S 5E6UA 2O7NA 3HPRA 4L4XA 2DPYA 3EVFA 1LV7A 1YIOA 1IH8A 4FFPA 4RPJA 2PFSA 2AFIB 1TB4A 3E61A 5FUWA 3MCAA 3KCQA 3JASA 1NVAA 4JEUA 4R01A 4OQPA 4UARA 4YWJA 3TI9A 3U3KA 5LA6B 3D3NA 1MJ5A 4PG5A 1TK9A 2WM3A 1SVIA 2YY6A 4RVUA 4XYLA 4JOQA 5TPZA 2GILA 3VUEA 4DR4B 4LK2A 4P98A 2HHLA 1JZTA 1QAQA 5BOVA 5JT1A 2WABA 4UHHA 5LLTA 1P91A 4H9GA 3T7AA 2QD5A 3LQ4A 3WHLA 4ZVNA 3P52A 5B12A 2BBOA 4I50F 1GGEA 1RQRA 4IV5A 2F55A 4C6TA 1JWLA 5AVJA 3WLPA 4GPD1 3HXOA 4WOBA 2RH8A 2B5WA 3FVWA 3HR8A 4PC2A 1DIRA 2VRNA 2HIHA 4XM2A 4ZHQB 1HL3A 2XLCA 4YP6A 4TYWA 4CV2A 3O92A 3BT7A 2DCMA 4E31A 4W5QA 1C9EA 2AEJA 4DT1B 1VRVA 4BEWA 3FPHA 4S1WA 1BOFA 3CRVA 2H00A 2JCSA 2FRXA 4Q93A 2PL9A 4YX9A 3PTAA 3CEPB 3LXMA 4LJKA 1MX3A 2WC1A 4Q34A 1WZNA 5FFFA 3REFA 1INLA 3RG2A 5K3FB 3RW9A 3SC3A 4D4GA 3DZJA 4KYTA 2VHYA 4LBZA 4CF7A 2DMRA 1U0OC 2FSVC 2QRGA 4NCKA 4EARA 1E79D 4IIUA 1N1DA 1ZIDA 3KYJB 4GMHA 2V7TA 4PXSA 4KQKA 4TV9B 4CG1A 4JGBA 3G1TA 4LWQA 3AM1A 4D6XA 1ZKDA 1SVOA 3IMCA 3KEQA 2BZ1A 4TUYB 5IMSA 3L8DA 2EERA 2J3HA 3EWIA 3N0RA 4W9NA 2KX7A 5DN6A 4J6EA 2JVKA 5D3MA 4FFOA 1HDRA 4UVGA 1N6KA 4C07A 1CJTC 3ZQ6A 4RVCA 3NKLA 2P4HX 1I4LD 1IWPB 2HU8A 3NAMA 4PO8A 2JEOA 2QRQA 1QGOA 4ASUA 3GVCA 4YT8A 4F86A 6NULA 1YUNA 1QVRA 4DIEA 721PA 1V8ZA 1L5KA 3CB4A 4UFNA 4J0HA 3H4VA 3VC2A 4RK5A 1JR4A 1PK9A 2DT8A 1KJ9A 4K9MA 1UFVA 2PV7A 3L4BA 4GI3A 1UWLA 1V1MB 3NOVA 4PLHA 3VR0A 2WUVA 3IAUA 4EHKA 2NXJA 4RDXA 3V55A 4V0ME 2ONCA 2P78A 3ZHRA 4UXIA 2JH9A 4OP3A 2MSWA 4FBGA 2OSVA 3O74A 3NYRA 3QV2A 5EWLA 4FGWA 4D44A 3UM9A 4ARZA 5E4TA 4L6IA 5F7OA 1KFBB 2X3YA 1V1JA 1O0CA 1R64A 4GKKB 4DW8A 3E9MA 3G59A 1QFMA 3BFJA 2O50A 3H1AA 5CFZA 4MR8A 1JDBC 1ZQ1A 1IZ8A 1NTRA 2G72A 2BEJA 3DTVB 3QXJA 3ENZA 3RC9A 2ZM6B 2VHQA 3MAJA 3IUQA 4S2UA 1SA0B 3DEYX 3NWEA 4NC9A 3TBFA 4E5KA 2WTBA 1VMIA 3FDIA 1E9SA 2CHUA 3PJFA 4J75A 2OAP1 1ISFA 1YIAA 2JFNA 3BSFA 3O7WA 4MW5A 2HH9A 1A5ZA 1PX2A 2MTBA 3SFTA 3TPCA 1MZVA 1G0NA 4L76A 5F2NA 5JO0A 2ZSJA 3PQ7A 4MNTA 4AX8A 4ZK6A 1AO3A 4HPWA 3G2JA 5HOQA 3OURA 1F20A 1GY8A 2E6UX 4PGGA 4BKOA 3KYCB 5H5JA 5KIAA 3QA9A 2P0YA 2EX1A 2I8LA 4LQCA 4POAA 5K20A 3ZVMA 1ZR2A 1M7HA 5BR8B 1QPZA 5L6MB 2GSWA 2WM9B 4GM0A 2CNNA 3OCVA 1JG1A 2F6RA 2PS0A 3Q2KA 4MVJG 4YROA 4F3NA 1RWNA 4KR9A 3PL1A 1P0IA 4URYR 2IP2A 5IARA 4E3ZA 2AOVA 3V4OA 1VL6A 1BE8A 3Q5EA 4IKOA 2MCFA 3QUAA 2EEPA 3ZIDA 5BPHA 1QLHA 1VYTA 4PZYA 2PX4A 5FA6A 5EXPA 1SD2A 4IDPA 2JLWA 2IHBA 3KJHA 3ADPA 3B1WA 5BYBA 3P94A 3TW0A 3PPXA 2WHRA 3EW9A 4CLRA 1HFEL 1C7RA 2OAGA 2V45A 3DMDA 5M29A 2ZLBA 3Q3EA 5B6PA 1VA4A 2NTEA 1ZJJA 2DC1A 3GJZA 1OGYA 2X1LA 1YV9A 2FLWA 4UNNA 5F4ZA 3K73O 3NDJA 4D6YA 1AKNA 1ISHA 4C0QC 3Q3IA 4HRYA 1NFFA 1TT5B 3N7AA 4CFZA 1NVTA 4BECA 3UJNA 1T13A 1PQUA 1FDIA 2WYVA 5EQFA 1MC8A 3CZAA 3EFOA 3CW2A 2BE9A 3A8TA 1YQGA 2JCYA 2HUPA 2OP1A 3V6MA 4QUGA 1ZUHA 3RT9A 5I7HA 4EJ0A 3OIYA 2YW9A 4U2CA 3S7ZA 1M5RA 4ABTA 5HJ7A 4YR9A 1PS9A 4M8LA 3I9LA 1LQ2A 1QH1B 2QAGB 2N42A 3QH4A 3SE7A 4ZGGA 2IUYA 3W6ZA 3PCTA 4DJFC 2XBUA 3DO6A 1WV0A 4EVIA 3JR3A 2FZKA 1ENPA 1KY3A 4N18A 3F97A 3Q7TA 3ND6A 3W8FA 4EF5A 2Q6VA 4MSUA 1HV8A 1AOXA 2O0MA 2E55A 2Q9AA 4KTVE 1MPTA 3RGWS 3H2SA 5EIAA 1VJTA 4PM4A 5ESXA 4ZGWA 1IJFA 4ENSA 1E4EB 3QPAA 3AFNA 5J9FA 3J81A 4RXMA 3GXBA 1JG2A 4P08A 3PGJA 4JT4A 2CJYA 3LGAA 3G8YA 1JR3A 2QRJA 5AXDA 3Q5DA 5AUNB 5ICEA 4B73A 3O2QB 4W9RA 4BQIA 2WSMA 3FW1A 2OLEA 4NCJA 3PGLA 4W9NC 4FBMA 3WKEA 1OGJA 1N6NA 3FYCA 2R79A 1GN9A 2ZYSA 1QHSA 2CFSA 5CFQA 1J4AA 1UJ6A 2XW6A 2NNWB 1HEUA 1WZEA 2ECKA 2IELA 1G8MA 3MQFA 2YQZA 5JXHA 1OVGA 2OAQ1 2R2GA 5EZYB 1CUUA 5BQPA 1ODKA 1SWVA 1X92A 4MULA 5IVDA 1KJIA 4NAUA 2OTCA 1JSZA 4UQOA 4BVLA 2OR3A 3DO8A 3GDHA 3H0EA 4DMGA 4QZVA 5AW4A 5U9CA 1PT8A 2NVBA 1DIOB 1PFQA 2PUTA 5IVKA 3D9QX 3BPSA 3II6X 3L4BC 1ILWA 1DEXA 1XZFA 4JC8A 1CCWA 1R50A 4LS3A 3LPDA 5KWEA 3P9RA 3GVIA 1NF2A 3ZK9A 4LTNA 1KS2A 5IEBA 3GN1A 2JFUA 3I6ZA 4LJ7A 4MMXB 3AUAA 4GKAA 1E0DA 5CJJA 3K0FB 4DLZA 3N87A 2VOEA 2IS4A 3CYFA 1JB9A 1ULUA 4FZRA 4D9CA 1G16A 2VSOA 1CQWA 1XVIA 5CVEA 2Z5FA 4EX6A 4EYOA 2EL9A 5IF9A 3IEVA 5AKLA 2PH1A 2WNIA 2Q9CA 4ML3A 3H9GA 2BI7A 4NBLA 5H3LA 1XCMA 2BI4A 2VYQA 2ZU0C 3KV3O 5FOQA 1D6NA 1H6AA 2XMCA 1XD8A 1ZINA 2RBEA 3KUCA 4GAEA 2R6DA 5BUSA 3HCAA 4QG7A 5IUJC 1QBKC 3BREA 4QLAA 5E6UB 4A0SA 3L8GA 3TYXA 1XDZA 2GCIA 1D7AA 1KARA 1XX6A 3GPIA 2A1TS 3DE7X 1PHPA 1RYFA 5DKFA 3T35A 1M6NA 1VRCA 4GYJA 2AN4A 3ASZA 4KR3A 1IK6A 2ZSEA 3M1IA 1XZNA 1SKMA 3VA7A 4B6JA 3I37X 3AY7A 3IGFA 5CG2A 2IFTA 4F21A 4N65A 3DNFA 4OXRA 3I9JA 4RY9A 4MGIR 4C0BA 3DT8A 4MW9A 2B9EA 2W48A 3T3HA 2OHOA 5KUTA 3S8MA 2ZVDA 3NPAA 2AMLA 1Q6ZA 4JJFA 1XWIA 4RXTA 3TFWA 3G8CA 1GQFA 4M7WA 2HA5A 5BV7A 3F90A 3KJGA 1RAAA 3OD1A 1ZW1A 3DBRA 4TYNA 4C6TB 4D99A 5BN5B 4Z8YA 1J2UA 4FJ1A 3J81k 1WMBA 2NZYA 1A9QA 1P75A 2A4KA 2PJZA 4OBEA 3TQOA 2BKLA 2WKSA 5IBPA 1GZ7A 3GY0A 5JJLA 1M1YA 1O96A 3T3NA 2Z4TA 5AVSA 2G5PA 3C4QA 4FNGA 2DY0A 3GG2A 1A8QA 4G86A 1M0TA 2PEYA 1WB4A 4JP1A 2DBQA 1U8UA 3B1ZA 2FVXA 4AULA 3HM9A 4E32A 3KZNA 2D54A 1P9RA 3PUHA 4MINA 2VT3A 4NDAA 2WZBA 3FFTA 3ONDA 2BFWA 3TQTA 3D3QA 3N8KA 1TX4B 2XNKA 4WOCA 2GWRA 3HB4X 4UU1A 3TG2A 10MHA 3M3DA 2W8BA 2QM7A 4OJQA 3T1OA 1YDHA 4G8CA 4CEIA 4LGMA 1C3XA 3FVVA 5EJGA 3WWCA 4RFSA 2QX8A 1QSGA 8ABPA 2P4SA 4RL4A 3X1YA 4AYTA 4DMRA 1DXQA 5CT8A 1PT6A 3RGGA 4LOJA 4L9AA 4Q9LA 3QVJA 3V4VB 2NPFA 4B4OA 1BVYF 1FYXA 3AXSA 2YOGA 4ZAWA 4DKXA 4QECA 4EQ6A 4U39A 4RV9A 4IP0A 3ZCRA 4OJKA 3ICEA 3BA1A 1J07A 5H4GA 4M21A 2I6QA 3M6LA 1QTRA 2OBBA 2AW5A 5DLPA 1XRRA 3ZK7A 4WQMA 1CDZA 3ZWBA 2HCFA 3AKZA 2ET6A 4MLCA 2ZUDA 1K7YA 3IPCA 4QAJA 4QG3A 5BORA 1AKTA 3FAKA 1X8KA 1ECPA 1KI6B 3DD1A 3RSZA 4ZYVA 1QAOA 5I9IA 3HY6A 3GFBA 3FPEA 4HWTA 5DASA 1QMPA 3REOA 3VZQA 2EX0A 3LQKA 4IF6A 5C8YA 4AWBA 1NMSA 2D7JA 3RHZA 2X9LA 1HE3A 2AN5A 4EUEA 4X8LA 1L0BA 1OGIA 4PC3A 3IPXA 3Q3JB 1LPOA 1EB9A 2GAIA 3IP7A 4KR0A 4ARZB 3HNRA 1Z3IX 3GL9A 4JHLA 3VC1A 4ENUA 5JVDA 3N75A 3VPHA 5TLSA 2A0XA 3IHWA 3PD0A 3CS3A 2H9YA 1ZM9A 3TM4A 1CUIA 2JKVA 4MR8B 1DQYA 3LP5A 1PJZA 2I7TA 4RZIA 2IUTA 4FYYA 2FN4A 2GK7A 3IIEA 2OA0A 2JGAA 3TZ6A 2H59A 3WLLA 4AMVA 5EZ6B 1A71A 4O4JA 1X7YB 3OG9A 4PSCA 4TLBA 1VTKA 4REQA 2FHSA 2ZAOA 4Y0VA 3DDZX 1ID1A 5DHAA 1JLLA 1KAOA 5DGHA 3GO4A 4E4YA 2RCNA 2WVGA 3PI6A 2VT7A 3JZFA 4RF4A 5CEFA 2ZBUA 1LJUA 1ZEJA 2WVAA 4D26A 1CR0A 5CA1B 3UJAA 3RU7A 4QDKA 3AESB 4BVJA 2GO7A 3M34A 4MV9A 5ES4B 1IYZA 3LO5A 4R51A 1EX7A 4B4WA 1H4QA 1ZI6A 2XZDA 3QF7A 1Q84A 1RYNA 5CEJA 1LDBA 4E2ZA 1PWHA 1RVDA 3EBLA 3H86A 4HDMA 1AKVA 2YJ3A 2OD7A 3EY4A 4XYEA 1Q74A 4A10A 4ALLA 3EGCA 3P9QA 4V3CA 3MWKA 1E1MA 4ZVRA 3AM3A 1FFWA 1KP9A 1JHVA 2DQKA 1VFNA 1T29A 3GVXA 1JR2A 3L8EA 2CEAA 1NVEA 2ETXA 2QTVB 4IIJF 4P53A 5CHEA 4A2PA 1P6XA 2K2QB 1KZHA 4LKRA 2ZI3A 3VZDA 3QOXA 1T5IA 1SULA 1X42A 2WQZA 3PGVA 3I73A 1G2QA 4JYCA 4BLOA 2V5AA 4B76A 5JFTA 4OFXA 4E2FA 1V71A 2WK1A 1Q1GA 1J25A 1E58A 3AZQA 4QBTA 4E0BA 1GPH1 2ZM5A 1KETA 4A16A 4M8IA 4CKBA 4ZZ3A 1XMIA 3M6UA 1PYDA 5KDLA 4X8MA 3IBTA 2EFJA 1JSXA 2ASEA 1P7VA 2BMFA 4KQXA 2EKDA 2QJTA 4X90A 4BMVA 4RUKA 2NTVA 2ZI7A 3GH1A 3LPCA 3I8XA 1RQNA 1M73E 5I4BA 3M1AA 4MVJA 1YKSA 4GOMD 4QWWA 1QIMA 4U9IS 3W79A 3GGJA 1S89A 1NN3A 4OHRA 5FOXA 1SCJA 1T3ZA 1U5BB 5D3ZA 4ZVUA 4L08A 1XNHA 2GPJA 3HXTA 2AEEA 3CH7A 5D6NA 4G0YA 1FX0B 1U0EA 1C5KA 2EATA 3GG9A 2JLRA 2L19A 1U3CA 3FKJA 5CFNA 3OM1A 1LLDA 5AVVA 1X8LA 4PYOA 5JEDA 1N0IA 2X4LA 3HXKA 4AD8A 4UBJA 4ZOBA 1P74A 1W52X 4DXHA 3B2QA 1O6CA 1V95A 4I14A 3FI9A 4WV3A 5F1KA 2A84A 3ZBUA 1OLOA 5FRDA 1AZSC 2X4GA 3K5PA 3D6VA 1L7MA 1ACJA 3ORQA 1Q2UA 2BI8A 2D2XA 3B89A 4R8SA 3WE7A 4BMYA 3EEOA 4B85A 1HTBA 1N32B 3L40A 1X15A 3WICA 4WZZA 3X0DA 1SZPA 2FUKA 3H6GA 3TZBA 1EFAA 1YDWA 1S8FA 4ZYTA 3GFQA 4QATA 1HEIA 3NALA 3IQGX 1DX9A 2FEOA 1X2BA 1GRRA 3L9WA 3LL4A 1FQKA 1V96A 1EIWA 1EE2A 3FMIA 4N3NA 3ZUPA 4W82A 4ZPXA 3VNAA 4EGAA 1Z6XA 1P6QA 4WCDA 5SYAA 1YRYE 1MJGM 4WLEA 1VSBA 4CM9A 1F48A 3DEAA 1UK6A 1NV9A 5EJAA 1PR9A 1XRPA 1XQVA 2F3UA 4ZRDA 3L1IA 4RD1A 5CNKA 1US8A 2RFLA 3UB4A 4G36A 3D2AA 3HKCB 4YMIA 4BNYA 3AIOA 5EMMA 4IPTA 2R44A 4YCDA 1LW6E 4IEIA 3I9V1 2I6XA 4ZCTA 2VI5A 1WEKA 2PTHA 3ENNA 4MI1A 5A1JA 1MGOA 1CRZA 4CR8A 4XUGB 1DBPA 2B4AA 1PK8A 2YHIA 4PONA 1CZLA 2DHRA 5SICE 5KOHB 1Z5GA 2QNBA 1CQZA 1JHPA 3QFHA 2YZGA 2AF3C 3QVTA 4XUCA 4G0NA 4YUVA 3WY9A 3U60B 3ETEA 4D3FA 2J41A 1JSLA 3NIWA 1QP0A 2IUEA 4BV9A 2HW8A 5HFJA 1ZOPA 1VDZA 2W0MA 3ZE7A 1H69A 3LPLA 4GO1A 3VYRB 3GLIE 2F1JA 2GK6A 2Q5FA 2O3SA 3EF3A 4EFLA 1E99A 1JHRA 5LXTA 1VJDA 5FTMA 2V6GA 1WO8A 1KOFA 3LLMA 4AY5A 4PS1A 1GIAA 4IINA 1JG7A 3C7AA 5DBEX 2AK3A 4BZZA 1GUAA 4ZI7A 2IY7A 2J0SA 3K4PA 3M8KA 2I1QA 3ZQKA 5A4DA 4Y7CA 3NWBA 1DOHA 1CP3A 2RBKA 3KSZO 3NZEA 1E69A 4R1NA 1KOLA 3CH6A 1FYVA 2H4FA 3CG0A 4KGVA 4QUBA 2VS1A 2WQ7A 3BIJA 3L49A 4PGAA 4KOAA 1NC3A 3ELYA 4Q4AB 4AF7A 2E89A 3HCEA 3JALA 1CQIB 4L95C 3ZD8A 2ZGVA 5AKKA 4JU8A 3DBRB 1LKZA 3L07A 3R3XA 1SBCA 2FNAA 4XGIA 1DKQA 2O2EA 1XLUA 2JCXA 3CZ4A 1R6DA 4F91B 5K4AA 1IZZA 4HZGA 4JBNA 1HNXB 1NVDA 1QYXA 1XO1A 1O96B 2LDXA 3M81A 1KR5A 3F5SA 4RXUA 3I92A 3QBEA 4PR3A 5K8TA 3B7PA 1FXSA 3AEKB 2AZXA 4IMRA 4B09A 1FXUA 2XH8A 1FFXA 4YPFA 3CR3C 2GN9A 7YASA 2I2AA 4LJRA 4JSYA 1RKQA 2H4XA 3BVPA 3QNWA 5JQWA 3UBMA 2QNIA 3KKNA 3TSCA 3F8SA 2H1FA 3K70D 1Z33A 3AONB 4TM8A 1VBMA 3WV4A 2AN3A 4QM7A 1RWVA 3BCRA 3C3JA 1MKYA 3BX1A 1EXMA 3IQHX 4WNYA 3QW2A 1N6IA 3LC0A 2ST1A 3FCAA 4WACA 1MG0A 1Y1TA 3B1VA 1R8XA 4RSMA 5EJMA 1DBIA 1VI6A 5FD8A 5FNVB 3M1YA 3ZY6A 2AQIA 2PMFA 2DLCX 4F72A 4MRRA 3PEVA 4GEGA 1BGWA 1HYBA 3TB4A 1VHWA 3R3JA 4M87A 5J5CA 4EBBA 4ZCMA 1V43A 4Q15A 1C8KA 2CV1A 4A82A 4AJ9A 4G01B 1E79A 2GN6A 3Q12A 2H1VA 4WZAB 3RBVA 3CCFA 4EQ6B 4DR3B 1Y9AA 4H7KA 1TFUA 3IESA 1ZL0A 2O1SA 3RWMB 1GZ3A 5EAIA 3ZW7A 3GOQA 1XQXA 5KX5B 1L7NA 2BJVA 1NDHA 2BZSA 2DETA 4D8UA 5EMKA 2J5RA 2C96A 2LZ0A 2Y0BA 3MWLA 1SBZA 1LX6A 4JLWA 3JQRA 5JH7B 3GLSA 2IY8A 3KZXA 4UDXX 4FT4A 4I4TA 4B5KA 1Z6GA 1ZN7A 1G60A 2XUIA 2DQYA 2I2DA 1YA4A 2V96A 1NE2A 3C43A 3CSUA 1C41A 4TYQA 3RUCA 3TNJA 3RYCA 4BN0A 3AOGA 4XH9B 4AKTA 1SU8A 4ZAYA 2I9KA 3G0GA 3WL8A 3JVIA 3GGSA 5JVDB 2NYRA 4GU5A 3DW3X 3W3AH 5LVAA 4DM7A 2AG6A 2GZSA 1RJGA 3DZFA 2ZJ3A 3LC7O 1E1YA 1VHQA 1N8NA 4RZ2A 3N28A 2I1LA 5D84A 1MHPA 5CLFA 3U17A 2H2IA 4CEHB 4U2KA 3SVZA 4O4LA 3QNUA 1P1IA 3IUBA 3LIPA 4HQ6A 4REQB 3SMQA 5LDHA 4HQ0A 2M9MA 2BSXA 3MS4A 2WZQA 2A5DA 1NLFA 5EP2A 1RLTA 1H6DA 4I50A 5REQA 1X2EA 5H9WA 1GPDG 2GF0A 2XJ9A 4EPRA 1TUBA 3GPCA 4DDWA 2ERCA 4BHTA 3T99A 1Z8HA 1EWRA 2IEYA 4BJHB 2X8LA 1TO2E 3PFNA 4M22A 3KVRA 1NY6A 4PCVA 1CBUA 4M1MA 4YRTA 4ZRMA 3U4CA 1CFJA 3ZK8A 2H7VA 4K9LA 3SZUA 2GEJA 4ZEVA 1I3CA 3RRBA 1VZ3A 2FPOA 3PDWA 3A4MA 4CTJA 1LBSA 1PZXA 1QK5A 1NP3A 4ZT6A 1ULZA 1KBOA 4RACA 1SM4A 3F7TA 1LPSA 1NXPA 4QXPA 3TG8A 1ZCZA 2WG1A 4NCNA 1PT9A 1NULA 2XUKA 5AVXA 4LXYA 2DFNA 1G7SA 2ID7A 3ESDA 3W6OA 3RVJA 1BQ3A 1GITA 3EDYA 4HDSB 3KSDO 5B4VA 1ZGZA 3EDRA 2XGJA 3GRYA 5K6TA 2I66A 1Z4IA 4CKBB 5CJPA 5C8ZA 3ROGA 2ZS8A 3QYFA 1XF9A 2ZTUA 2IBTA 4W7IA 2JGFA 1GZDA 1ZVQA 2GEKA 4UAGA 4BBPA 5IYZF 3LHDA 3LPNA 4Y3UA 5K09A 2OE2A 4LMPA 4MKIA 3U3ZA 2P40A 4XASA 1JJ7A 3WFJA 2JFPA 4UQLA 1UT5A 1VE9A 1KGDA 2ZWOA 1XXHE 1AKUA 3L6RA 3NBFA 4HP8A 4GMKA 4EYQA 1N4AA 2I6TA 4EUHA 1M6WA 4OHZA 4TTQA 4JVMA 1F8GA 1Y37A 4JI8B 5KNBD 1G55A 2W37A 5EHNA 4EAAA 1G66A 1A96A 5AQEA 1FNBA 2IU6A 3WYBA 2OKCA 5ALXA 1XMOB 3B5EA 1KK0A 3JSXA 1JVNA 2WV7A 2I71A 3I34X 3TKAA 1Z4PX 4J3JA 4C5AA 4I1YA 3LWZA 3OOJA 3PG5A 3LRPA 5BO5A 5KOYA 5K3AA 4L9SA 4X1IA 5DNCA 3L43A 1IWBB 1I0LA 3DHEA 5DYGA 5K0JA 2BM9A 3MSXA 4QULA 3SJAA 2WMYA 1GOTA 4DEVA 1MEOA 1U7DA 2YMLA 4PXYA 3T7TA 1EUDA 2WF9A 1WF3A 4NH4A 5JCOC 1D1PA 2DGDA 2GS9A 3G2QA 1K88A 3OZFA 4P7GA 5G02A 4B3CA 5J2UF 4IQ4A 2XOKD 1NXVA 3BXOA 4MHTA 1E0AA 4PSKA 2Y1GA 3DF7A 1FDUA 3KQYA 4R3UC 1CEQA 3CF0A 4OKIA 4RLHA 4YAOA 2IEGA 4HAWA 1PLJA 1U0NA 1OFHA 4RHEA 4XB1A 4BQSA 4R1OA 4WDQA 2DX7A 1JDJA 1MNAA 3AIKA 2OHFA 4UUAA 4DADA 5K0BA 4LY9A 2D62A 4IMIB 5KVCA 4N0PA 1L7QA 5AK6A 1YRWA 2JGRA 2NWQA 2JH8A 3ITDA 4TM7A 4M8KA 3UMMA 3SWWA 1YZ3A 3KZMA 5IT9A 2BFNA 5GWXA 4GEKA 1RTKA 4URHA 4ZP1A 5TY0A 1US8B 4W99A 2ODNA 1FQWA 4H1TA 4G37A 1R9GA 4ANFA 1B0ZA 3M83A 1KI1A 3KAKA 2WM2A 2PUCA 1S2OA 1A76A 1VJGA 1N2SA 3KB1A 1ZG3A 5IKPA 3Q9SA 4TX1A 3DT6A 3HV0A 5DCYA 4NAVA 5HDBB 3A6GA 1DQSA 2H1OA 5IAAA 4DSAA 4R2JA 2YWGA 1ZUD1 1RABA 5JWHA 2GEDA 2BF4A 2VHEA 1UMCA 1MXHA 2QDKA 1BYIA 4FEYA 3GDOA 5CG1A 3HGMA 3EZ7A 1E2HA 2C54A 3BTVA 3OM0A 1W25A 1IBMB 3HK2A 5AJXA 3F8WA 1SH7A 2UYGA 2B9VA 3QXSA 3KWLA 3WL6A 2MSNA 3WB1A 3OU6A 1ZGHA 4WERA 5KC8A 3IH5A 1U0GA 1KIMA 3JWGA 5YASA 2J46A 4NOMA 3TM5A 1RACA 4ZI7B 2FWNA 2ZZMA 3BDAA 3EZ9A 4K5QA 3GLFA 5I8ZA 4CU2A 2QTLA 2P11A 1SOVA 2MU1A 2A9PA 4DMFA 1K5HA 4EIWA 1VCMA 1JWAB 4DUYB 4G6ZA 2B21A 3RC1A 4MCJA 5GJVC 4XX0A 4CTKA 4DIFA 4ENPA 2DKOA 4Y2UA 3R6TA 1SB9A 4WRRA 1MX5A 4L8GA 1R9JA 5BUCA 2ZS9A 4GC9A 4NOLA 5ANRB 1IBLB 4S1NA 3I01A 4FD3A 5EYPB 1EESA 3DZGA 1A97A 5HF9A 1WSWA 1SOMA 2Z3ZA 4UPVA 3TN7A 3F98A 1TF2A 1FBTA 1JEQA 4Q03A 5AI8A 5KJ6A 1KAEA 1Y7TA 5CIYA 3TL6A 2GGSA 3OPYB 1FFXB 3ID6C 1UL1X 2GPYA 2AE2A 5DLEA 1UFRA 3GLVA 4NBSA 4X85A 4YJHA 2R6HA 2VCHA 5T4HA 3U3OA 1I1HA 3BS4A 2QPOA 4M7PA 5FWNA 5M5BA 3WIDA 1N2XA 1L5WA 2BFFA 5I7AA 2G83A 3VH2A 4BNHA 3K1AB 4CM4B 2YWBA 4KNVA 1QHNA 1J1UA 4YR7A 5FYQA 4YT2A 3Q87B 4WESB 4P2BA 3ROEA 4YGXB 2ZBEA 3UNXA 4YGYA 4XD7A 6REQB 2BFEB 3IXQA 4S0ZA 4HNSA 2IKQA 2VDWA 1UC5B 4E09A 4NMMA 2IEBA 3BJMA 3IDFA 2V5UA 2WZDA 4MPJA 5C7LO 2IZ5A 3CLUD 4QU5A 4AKEA 5IXJA 4LOLA 1D0SA 4EMTA 1B0PA 2BFDA 4FYKA 1U8XX 3DV2A 2LW7A 1DKUA 2FFRA 4BNZA 5LB2A 2CCJA 1JWBB 2P1RA 3EZNA 3KZOA 3ROMA 1ZNZA 3PQ3A 4IJVA 4MYTA 4CE6A 1RU3A 3RBXA 3NP9A 3VOBA 4GDFA 3L8CA 3N8GA 4G3XA 3OETA 4MVWA 2GHTA 4U7DA 1T15A 4R84A 2FUCA 5BN4A 1RAFA 2W2TA 1XK6A 3VU0A 2GBPA 1V11B 2WSSD 1Z6PA 4IIXA 4TRMA 5AESA 2NMVA 4HX5A 2B4QA 5JS6A 3VO9A 2QPTA 3DOIA 1DFHA 3EAGA 3ZWAA 5KTTA 2NP6A 5JC1A 1AB6A 2X2PA 3QOFA 3DFUA 4RYDA 1HF3A 2ZRAA 3NJ4A 3KAQA 1SXGA 1B6RA 3BMQA 3PQ2A 4WN3A 1W5SA 3FWZA 1PWYE 2VAVA 3DVLA 3HLKA 3QVOA 5IVIA 3T3GA 5IC5A 4K1XA 2CZQA 1W46A 3VR2D 2X14A 3QF4B 3I9V6 3R9KA 4MV0A 3ZE8A 1KYQA 2V3WA 5CXUA 2OFFA 5GZ3A 1XDBA 4QPDA 5KVAA 2C29D 1PR6A 2ZP1A 2OXFA 1QRUA 1FP4A 3HNPA 5T4FA 4URXR 3VZRA 4N49A 3HQ4O 4ALJA 5GV8A 1QDEA 1UMBB 2GPBA 3H2KA 3MVEA 4QPZA 1GSIA 4R7GA 5K9ZA 4ABYA 5A6SB 4D46A 1TGYA 2Z2XA 4AN4A 5JJ5A 4LFBB 2QXTA 1C7EA 4U2FA 2UV8A 5B2EA 2L69A 1W5AA 1BCRA 5FA5A 3RANA 4B6FA 5DYTA 7MDHA 1OH7A 3G0HA 4B0PA 3AHGA 3NP7A 4QC2A 4N7BA 4R6WA 3HLYA 2DPGA 4XSVA 3RKRA 4BKMA 3O2JA 3HYSA 4GZ5A 3BXHA 5REQB 2BR3A 2OCPA 2R1TA 5C1DA 1PJSA 3LCRA 1QP7A 1P1BA 2I3GA 5DYNA 4HH1A 4U2EA 4AJ1A 1XTKA 4KWCA 4YXFA 4N7JA 2FWPA 2JAOA 2NM0A 5TIIA 1YZLA 3HVKA 4LIPD 3DCNA 1Q50A 2AUTA 2B0CA 3E2IA 3MMXA 2NUAA 3OHMA 3ZGNA 1QUFA 4UUMA 5AXBA 4YCSA 1J56A 4EHIA 3QKIA 1QZTA 2VHWA 3OVMA 4WCFB 4CCYA 4F06A 3TTWA 1RE0A 1L5MA 2HD4A 3A2MA 3C85A 2ZUBA 2C94A 4P31A 3VTAA 4E7OA 4AMUA 1OFUX 3C8UA 1QQ7A 2L18A 3C1UA 3WNVA 2D4HA 5CTJA 1L9XA 1T2UA 4A0RA 4PRZA 4RMJA 5EXDA 4M89A 4Y6RA 2SICE 1H3NA 2R5WA 2BGGA 2RH4A 2XCOA 3KPYA 1T2AA 1T3GA 1XCBA 1T8TA 1QF7A 2FDXA 2V7VA 3RFFA 5IM4F 2HNKA 3HR7A 4OREX 4A0HA 5IJWA 2ZRMA 2FMXA 1Z6AA 3HU2A 3LWBA 1ZU5A 4YQEA 1NFRA 3MHTA 2X8JA 3TRKA 1T4CA 3H3FA 4Q47A 4MS3A 1C8BA 4ES6A 5CVUA 4D0SA 5JADA 3EIWA 4JL6A 4JI0B 4DBZA 3NLLA 3Q1LA 3DUFA 4X41A 1CP2A 1KYIA 1LB1B 2HHJA 2VJMB 1RRPA 3RT7A 3OFSA 2IZ0A 1Z62A 4PAMA 4ZTUB 4N39A 1TU0A 3ENQA 2ORIA 4IIYA 3D4OA 1OYYA 2P79A 2FWRA 2RGCA 1AGRA 3RS0A 4X1IB 1IL0A 1UODA 5I3CA 1AO0A 3ZJUA 1MH1A 1FXWF 4WBNF 3AVTA 4JT9A 1GYRA 2ZAYA 3IVAA 2DKNA 1GTVA 2ZSUA 1ZFNA 2HFJA 2P0EA 4Z7NB 1FFGA 4V0MA 2QMZA 3H8WA 1SGWA 3HVHA 3GJ8A 3VR4D 4EHFA 4DV0B 1B41A 1EHYA 1XTPA 5IFLA 3B2EA 3NFRA 2ZB8A 3RC8A 5EEHA 3NFYA 2V6BA 3TLAA 5E7QA 1Z88A 2HRZA 2JGEA 4XB2A 1M6VA 1NKSA 3P0HA 4H59A 3TQIA 1TTQB 5JCZA 4HGRA 1Z13A 2BEWA 2LD4A 1XMQB 1GXSA 1BDHA 1ISIA 3ND7A 5I9LA 2FDCA 3EZXA 1PKXA 2WF8A 3VPSA 4EDHA 2A7XA 4YUZA 2VNHA 1PG0A 1H0HA 1O0SA 1DIAA 1P2BA 1AHIA 1Z75A 2KBEA 3LQQA 4Q4HB 4XIJA 5HFAA 3F5DA 1ZNQO 3DEHA 4IQ8A 5EC8A 3BG5A 5EHIA 4CFSA 3LBNA 3DMYA 3ZX4A 1T1EA 1V4NA 1ZQ9A 2V7BA 2OM2A 1A77A 5E0OA 5DB4A 1U2ZA 2OGUA 4J91A 4KMRA 4LQLA 3VR6H 2AEMA 3JATA 4FGUA 4HN4B 5FNZA 3B7GA 1FPMA 5HQ3B 2GX6A 4OK5A 1JQAA 1K6IA 3HB7A 1L7AA 5E2BA 3Q6NA 1FW8A 2WHXA 1U6JA 1G9XA 2F1HA 3WL4A 3SN6A 2V6MA 5AVTA 2QX9A 3K7EA 3VYTB 1Z2AA 4DWJA 5FBWB 4BIIA 4BUJA 1SUSA 1A0OA 5JV5A 2FPRA 1DZIA 1UMCB 4Q3LA 4NZYA 3HA5A 4IIJA 2HWWA 3VMMA 2XMGA 3C48A 4BBAA 1TOAA 1AURA 1JPUA 4RPKA 4N82A 1VPWA 4LXHA 2O8EA 2XB4A 5B55A 1E1QA 1IB0A 1TJNA 3D8HA 3J80A 1U1IA 1VC2A 2OCYC 5JJKA 1EFVA 4B48A 4MPRA 1H93A 3DGFC 3DSRA 4AKGA 1BC5A 3QKTA 3R77A 3D8BA 3WLHA 4FMCF 3ZD9A 4Z1MD 4Z51A 5IH3A 3CX6A 3GLFB 4LF8B 5JSHA 4UZFA 2X19A 2YNMD 4GICA 4RGQA 4MPDA 4P3KA 1P33A 3ZIUA 4R68A 2DB3A 2G7ZA 2RHBA 4D4KA 3NHPA 3PWKA 4D79A 1UPUA 2JI8A 3IA7A 4GL4A 2JAQA 1NMXA 4C2TA 1T2DA 1EFTA 4DPMA 3AWIA 3DWFA 3L1HA 1ZGAA 1QZ3A 2ZUWA 3IQEA 3LM8A 5F76A 4AY3A 5C1PA 2V03A 1E5VA 2F8SA 4LYEA 2BFMA 5TQ0B 3RVDA 4L72A 4A2QA 2VXCA 1GCGA 4O1HA 1RQ2A 2K5UA 3CZCA 4II2A 3VPAA 3FPCA 3MLBA 2SBTA 1RKXA 4A3SA 3GP3A 5KU1A 1CKEA 1FVOA 2V59A 1JEQB 2ALJA 3EXHA 1UOOA 3L7AA 3MJCA 2CW5A 2SKCA 1H05A 3A4VA 3R0QA 1TYZA 1I5OA 2HN9A 2ZI9A 3EWAA 1OI4A 5KYGA 5LP6F 1DAMA 2RHHA 5HYVA 1Z3CA 1T6YA 3FLMA 1M2VB 2AJCA 2BFFB 3MC1A 1A9PA 3CX3A 2ZSFA 3KKLA 4URFA 2W42A 3A9SA 1YTUA 4GECA 5JAQA 3AI7A 1AK2A 2CVZA 2VYFA 3DDHA 4ALMA 2Y9PB 2RD2A 2O8BB 4OOEA 1ODLA 4HVTA 3AV3A 4NCIA 1FU8A 2M32A 4OL9A 4Y9SA 5EJFA 5ITWA 1GPAA 3PFWO 2FW7A 4HDNA 3E3OA 1NR5A 4FBLA 5HE9A 2E4AA 4F3KA 4Y30A 3PR2B 4RK4A 2HGSA 3IUYA 1JKXA 5C0OE 2HEIA 3EGVA 4YFVA 1MG5A 1ADFA 3Q8WA 4KAJA 4XWGA 4MB0A 3QOWA 4UDYX 4QU8A 1OLUA 1RRVA 2CVQA 1UP6A 1Y1PA 2I76A 2E4VA 3B6EA 1WXIA 2JVIA 1ZJWA 4J0GA 2D1YA 3MYRA 2PX6A 1V37A 4TQ9A 3FF1A 1M54A 4LZLA 3N0WA 1ZRMA 2X1MA 4K6KA 3NUQA 1G7TA 1M2OB 4FSXA 3GGOA 2HY7A 1UPAA 1W8DA 4Z0HO 3AF1A 4RK1A 3VR3A 3WR5A 4CTMA 2QP3A 1MJHA 1Q57A 3FNIA 3MWYW 4F3YA 4LRWA 2GN8A 5CW2A 1LQUA 1YB5A 3ABOB 4W5OA 1AZWA 2F9FA 4OXYA 4WLUA 1NUSA 3BMQB 3TQSA 1YB4A 5A5GA 1PW5A 4AO8A 1WW2A 3HSKA 3TZKA 4LVOA 4C89A 3TLBA 2IYOA 4KFTA 2Q3CA 4FEEA 4KXVA 4HS4A 4F4DA 3VKFA 2DWOA 5IFKA 2HMSA 1M6YA 1OFGA 2QK4A 1BKYA 4KACA 1LDMA 1E2GA 1FP4B 3AR5A 4KXYA 3GDGA 4LYAA 3EWNA 2WA2A 3DMNA 3GLUA 4PO9A 5FP0A 4YRRA 2Z6AA 1LDGA 3R0XA 2HIAA 1OE0A 1JXOA 4LNUA 5DCLA 3UJ3X 4AN0A 1XAGA 1XMJA 3LA8A 4E30A 1MC4A 1CW2B 4KPFC 5MHTA 4NOKA 3UMVA 4QICA 5CM2Z 3GFPA 2ID8A 2HPAA 3F3YA 2P4QA 3WDLA 5KU7A 4YRPA 5HGXA 4DCNA 3ZNOA 3N2LA 3QBJA 5C5DA 5DM0A 3UAWA 4XQ9A 3FHOA 1YFJA 3TF5A 3ZWNA 4EMBA 3SIXA 3AJRA 3EPJA 3BRWD 4IIFA 4EB0A 3H8SA 1Q92A 3IP3A 4J0FA 4JBYA 1JVBA 1ODJA 1STOA 1TKAA 1ZNXA 3M2PA 4OUDA 4Q1EA 3ZVLA 2WJ6A 5J58A 2QUAA 1R5NA 2QD2A 3GIWA 4NENB 4O59O 5AVQA 4CKZA 3WXMA 1DARA 3DE6X 1MH9A 1U3DA 3BK1A 3FNGA 4U00A 2NUAB 2AOTA 1V9LA 2C3PA 2R8ZA 2A92A 2R1VA 3IJRA 3PC2A 4RY0A 4D5GA 1Z08A 4K7JA 2AV6A 2FEXA 4UU0A 4CCYB 1VBKA 1L5NA 2PKCA 1OHHA 3A9CA 3CRZA 4EHBA 3OZXA 3FNRA 4Y6LA 5AHOA 5DRYA 3DXXA 2XUOA 4JJZA 3R3YA 5DGIA 1Q77A 1ULAA 4RA6A 3BB4A 3KG2A 3GFRA 3P5SA 2D00A 4IUYA 4MO2A 4Q16A 5L3QA 1ND6A 3N74A 2FI1A 1D09A 3LYUA 3BGVA 3CF4G 3UKOA 1Y1SA 1KU6A 3ZQ4A 1JJVA 1BXRA 4EGSA 2ZETA 4B7AA 5ENVA 2XXAA 2ZZKA 2C4TA 5CXQA 5KHAA 4RGVA 2X8JB 3SMVA 2ISSD 1B76A 2G04A 4Z4QA 1GAEO 3VNBA 2GJ4A 1V5EA 1AS0A 4QO8A 5EP4A 1N5OX 3ANNA 4I9FA 1WABA 3DUFB 3LUBA 2UVDA 3NM4A 1U2SA 2HA3A 1F0KA 2CE7A 2HI0A 4L2IA 4XM0A 3O83A 4BEBA 3EXHC 2PJUA 1KBQA 4RFSB 2VP5A 1OPXA 3UHOA 2PX0A 4LWOA 1LVHA 3L5KA 4OGKA 4ITVA 5KYVA 4WXPA 2E9SA 5JZMA 2R7MA 3SR0A 4QHYA 1BNCA 1RRKA 2OGSA 5IAEA 4BV2A 3BWCA 4ENQA 4GI7A 1K66A 2DY1A 2ECPA 2VJAA 3D1VA 2B2NA 4TTSA 2OPHA 1C30A 3WIOA 4Z4HA 3JQ9A 2E85A 4Q1VA 3KQPA 1RLMA 2H7CA 1LZKA 3E7FA 4GX2A 4YJ2F 1W94A 3HTXA 2KMLA 5JMPA 3T9BA 3UFXA 4IJMA 2JZNA 3V7FA 3BWEA 4U0JA 2EAUA 3WMRA 5K8JB 5CYOA 2XZLA 5CA0B 2KLHA 3N2EA 3K70C 4BYMA 1I4TD 2WI8A 2YWDA 1J00A 2ZIZA 5TDHA 2DPLA 1MVLA 4GLBA 2NO9A 5ALQA 1QIHA 3NTXA 2JFOA 5J1TB 1TC2A 5CFOA 2A2ZA 2BEWB 2V55B 4G1CA 5CGQB 3NDRA 4QJ3A 2FCAA 3HFSA 5EEGA 1T1SA 1FLVA 2HIGA 3CE6A 4FZJA 3OZBA 2XOKA 3Q9LA 4IEEA 3VSAA 3D7SA 4PZZA 4E33A 4R1SA 4YMUA 3UWPA 3T7EA 4LZJA 2UXCB 3SNHA 1Y82A 4I2VA 5FF9A 3VTKA 3OCYA 3L3BA 3THWB 2H4HA 5FQOA 3COJA 2ZXFA 3KQTA 2FFBA 1P1FA 4J4TA 3U13A 5I7FA 4RTOA 3LGSA 4ME6A 5BY2A 4J07A 3T61A 2XZOA 4ZARA 3IPLA 1IQUA 4RH1A 1PBTA 3JATB 5AH0A 3TKLA 2V58A 3QKSA 3ZY4A 1GQRA 3R74A 4DCTA 4EL0A 1LS6A 2AG0A 1H8ED 3ICQB 5LZ2A 4CR7A 3HGTA 2JI7A 3AUXA 4DIBA 5BR4A 4NU5A 1LPNA 1NUPA 2ZRLA 2BKAA 4EWLA 5AM0A 3A28A 2P5YA 5ELXA 1NG1A 2H2AA 1I4EB 4P4UA 4P7FA 3I9NA 3A1SA 3K9WA 5IHPA 1O6GA 2EKPA 4AKSA 3FAZA 2X13A 3E27A 2BEVB 1HZZC 3QUTA 4DPKA 1KKLA 1N6LA 1U0JA 4RDCA 4MP8A 4UOQA 1OXMA 3VAYA 4A03A 4AP9A 4F3TA 5LLSA 3WYEA 4KPGA 2OWDA 4DLTA 5H70A 3DFIA 1KQ3A 1P77A 3ZGYA 1S8AA 2W93A 2F9MA 2ATVA 3R3SA 1ZUWA 4MW0A 2H1CA 1ADJA 4G4SO 3V2IA 1Y48E 2MINA 2EZTA 5CIWA 2O2HA 1XKQA 5GJWC 4DPLA 5CDUA 1K6MA 4O25A 4KPYA 1SUWA 1GTL1 1YBMA 5G4KA 3WK9A 4C76A 3UICA 1IXSB 3L41A 3CX4A 1T2CA 2IXGA 2PSFA 4O1MA 5L3ZA 4W6ZA 2WB2A 1QPBA 1U7UA 1L7PA 2ZR7A 2IH2A 5ECGC 1HPLA 2J0UB 2UUPA 3A31A 3NONA 4P86A 5BYJA 4X84A 3RIHA 4P6VF 3RU2A 5EOVA 4IHKA 4CN8A 3BWYA 3OIVA 3OZ7A 3WLAA 1XKTA 3DTTA 2F3TA 3T34A 4PNEA 3AY0A 4A23A 3I6IA 4WFIA 1IZ9A 3WHPA 4DSNA 1XF1A 4J29A 3ZCSA 1VKRA 1BYUA 2EDCA 2VZLA 3UKJA 4V0OA 2H3HA 3H6HA 1U4OA 1I33A 2ZAGA 1VLHA 3T94A 1PV2A 3EVTA 3EXHB 2JIBA 2NZWA 2JIRA 4ZYXA 4Q1AA 5DTQA 1PFWA 4Z54A 4B35A 1JG3A 4MWTA 1A4RA 1NJFA 3W5DA 1VZ2A 3DPSA 2H85A 3E9DA 1HYGA 5JYEA 1D2GA 4RPLA 2H9IA 1T8WA 1Y3FE 4JZKA 1IOZA 2AC7A 4D82A 3F47A 1D2MA 2IW1A 5D7NA 4R9VA 4RTRA 1XFDA 2A35A 3G89A 4OP1A 5DVZA 3KKKA 2OXTA 3DEIA 4QGAA 2WMNB 2C83A 5BVHB 3HEAA 1YS1X 3BF7A 4HDNB 4JL8A 4IDFA 1Z38A 3VM6A 4EW6A 2YJ4A 1FFEA 5ED0A 1GZHB 4JYZA 4YLGA 5DM4A 3U56A 1ZH4A 2I87A 2Q8PA 1QVVA 4QREA 3R7AA 2ZCUA 4HAVA 1NHWA 1FRVA 1ODSA 1UIRA 1DKNA 2GNAA 1S2NA 3FVRA 3GT4A 3IO5A 1XTIA 3K1JA 4IAOA 5AICA 4JVNA 4F46A 5I6DA 3H0CA 2Y1KA 4OAPA 5LDDC 2QGNA 2XX3A 5KOIA 1SVUA 4Z9YA 1ZAYA 2RI6A 1YL7A 4PZEA 4S3MA 3P97A 4Z5XA 1W30A 2Z83A 5T8KC 1W48A 3KJZA 4K2AA 4S1OA 3N39C 4XTCS 3RS2A 5DGTA 2HDOA 2HU2A 3WJ2A 3RTCA 4RWZA 1A5SB 1I4DD 1LC3A 5I7RA 2AD1A 1WE2A 4JOCA 1MABA 3ADBA 4DNPA 5D3KA 5K4HA 4K05A 3JQ9C 2C5EA 4IW3B 2WAAA 4X94A 4EQZA 1ZRSA 2PT6A 1M1XB 4NS1A 3AR6A 4KMMA 2EV9A 2ZYDA 4K6MA 2XIJA 4L8FA 1U1EA 2OCLA 5J5VA 3UAOA 1N1GA 2WTXA 5JAPA 3UATA 4YALA 3JS5A 1K97A 3UOWA 3ER6A 5DF1A 3CRW1 4P3XA 1K2WA 3V7YA 3ETLA 4KHPB 1S2GA 3MOGA 5C5IA 2RH5A 1GARA 2XPCA 1T1GA 4V38A 3MELA 3HB1A 4TMTA 4YQZA 1ATIA 2A8YA 2BKUA 4X92A 4L8VA 4ZO7A 3VR2A 4PZCA 1K98A 1XXLA 4LNUB 1P2FA 3NDIA 4CUJA 6ADHA 4TXJA 1W44A 2PFKA 1NIJA 3LBFA 5CX1A 2VQSA 4GWGA 3BDVA 2NO1A 3KXIA 3TSAA 1MQAA 4L4ZA 1DO8A 4JR1A 4CKEB 1EAYA 3D6AA 1SVMA 3P2JA 1N6OA 4WUVA 2J87A 3V4FA 1VJ1A 3NBUA 3LXUX 3EY9A 3PXGA 4EI2A 2J7KA 4CLOA 1FYDA 5BQ3A 1FJ2A 4HH4A 3D59A 4R8LA 2V7XA 4YBZA 4EUFA 2Y2VA 3EVGA 1D4OA 1VLMA 4GUDA 1YZFA 1E3IA 3OOYA 1RZVA 1HY3A 4PN7A 3KWFA 4QOSA 3G2KA 4N54A 5BV2P 1EFHA 4W5TA 2IY9A 2XWBF 3H4IA 2DUUA 2Q46A 1K8XB 3Q2OA 4YUAA 4MUHA 4Q21A 1CVRA 4GD3Q 4OMUA 1ZGCA 3AG6A 3EMKA 3GP8A 5KO2A 1UBCA 2HWKA 1P9LA 3I6MA 3TPFA 3OC0A 3NBKA 3KWJA 3K9GA 4HZUA 4QYXA 2VKQA 4Z2AA 2IYAA 5L3QB 4DMCA 1K63A 4EYKA 2OZVA 2W2OA 2XTZA 1DUIA 3R5XA 1AXRA 1E96A 2I9PA 4QO7A 4Z3KA 2IODA 5G2OA 2BW0A 3VOSA 1BXRB 3B8HA 1KP2A 3CKKA 5G0TA 2QRMA 5DRTA 5K0ZA 2Y1LA 5FJIA 4UE3S 1KMHB 2WICA 3W8NA 2QM8A 4OXIA 5E6RA 1UJBA 3FWNA 3DT9A 1O5OA 2BIFA 2HBZA 3BKXA 1JILA 3BD6A 2PKEA 1GPJA 2ZPAA 1WVIA 2OZLA 3AVWA 4ZYZA 3OLQA 2W6JD 1JMYA 4HPXB 2FN7A 4X8OA 1TC1A 5FLEX 4RM2A 4KYVA 5E8RA 1L5HB 3P9YA 3SFZA 5DSTA 3C24A 2LBPA 2X58A 3H04A 3R5HA 3A6KA 4L2IB 2E1PA 2Q0SA 4MI6A 1USWA 1QGED 2F64A 3M6XA 4QVGA 4ZEMA 1UBNA 2HF7A 3ITNA 4I81A 1WKCA 3U26A 3QIVA 1DBQA 1NR1A 2HL6A 2POQX 5E8JA 1QVAA 3HKBA 3MCWA 2G0AA 3EH1A 4FP9A 4RY8A 2VH1A 2ZANA 3I05A 4F6CA 3F5MA 3THXA 1Y1LA 4E5UA 1FMTA 5K45A 1LRJA 3B78A 3LBAA 3NVDA 3W5IA 3CF4A 1XJWA 2EF0A 2R84A 3IKVA 4FU0A 5ILQA 3PEYA 1AHPA 3IDSA 1G9SA 3V1YA 3MFYA 5EJ9A 4HGPA 3IBGA 4UVHA 4YRQA 1P1CA 1PWXA 1E5DA 4RF5A 5A5FA 2WM8A 1C4XA 2QRVA 2CF5A 3IBYA 3KO8A 3NHYA 1UZNA 4MV7A 4UBOA 5CLHA 3NC0C 5KQPA 1GNSA 5LQKA 2Q49A 4KR2A 3DLHA 1RI5A 2HXGA 3C98A 1DKPA 3FGZA 4DA7A 2A14A 3JQPA 4JEIA 1D2RA 4QTUB 3VR4A 3ZZTA 4F56A 5K0GA 1DTEA 2P7IA 3ZVRA 5C4GB 2K7FA 5AXCA 1E60A 1MO6A 4EAQA 4WECA 3CLUC 2QUJA 3DBLB 3OCUA 2ZYIA 1YNOA 2WP0A 3OZCA 3BORA 4ZQGA 2UYCA 2GKGA 1REQB 5FTWA 3PDCA 4PBSA 2ZSBA 4L0CA 5HK8A 5BVGB 2YS7A 5JQGF 3LFTA 4LDPA 1CZOA 1NRWA 1PL8A 2WHEA 3H5VA 4CCSA 4DE5A 1GGFA 1YQWA 3GLQA 3PQ8A 2VR1A 3HG7A 2NADA 1RLOA 3OA0A 4U7PB 3P9CA 4XGNA 1PL0A 3IHLA 1I3MA 2TYSB 3IIJA 3K4QA 4GWKA 4OY3A 1F8XA 1I3OA 4ZGBA 1RMYA 1U65A 2VP6A 4A0GA 3LP6A 3TDMA 3N6RA 3WK8A 1JG4A 2DEUA 4TKUA 1PVVA 2AIRA 3EVCA 3RTAA 3WKCA 1Q15A 2DUMA 1DEKA 2IYLD 2JRLA 2PUVA 3M33A 4EO4A 4ZKEA 1QV6A 5FFMA 4IGEA 3ZWXA 3NHUA 3SSMA 5CVTA 3PUWA 3T1NA 1YA8A 2Q5HA 2NX2A 1JIXA 4U7HA 1N9GB 1UZLA 3MRSA 4I1VA 2BGMA 5CDSA 1XCPA 2BUAA 1WLSA 3LUCA 4BTLA 3SSNA 4PWZA 3KJQA 4IZHA 5IZCA 3SE0A 4LJSA 2V7GA 3C3BA 3AB7A 3S68A 1H2WA 9LDBA 2RH9B 4IJ6A 2O2ZA 1RYBA 1B6TA 2OB1A 4YV0A 5BOSA 2VKTA 4BVGA 5IYZB 1IPHA 4U0KA 1SBHA 2GERA 4PHTA 5EKTA 1XCOA 3U1BA 1T0PA 5EHZA 3NAGA 1SQ6A 5KSZA 2BEUB 2DOKA 5EQJB 3DDUA 3UOGA 4CW7A 3W6PA 1V0JA 1NW8A 2GR9A 1RE1A 1RYDA 2GKOA 4OQXA 5F3DA 1P5HA 2NP7A 3K9FC 3AGQA 1L2TA 3SLKA 5EUCA 1J23A 4W8HA 2FPSA 3KT0A 3SOPA 3HDHA 2KB0A 2UZ1A 3PITA 3QEMB 3OFJA 5BQXA 3S8YA 1XALA 1NXSA 4LTDA 4MQ4A 2JGLA 3WWZA 5B7NA 1CUYA 4LYJA 3FHTA 1DOZA 2BMVA 4R0NA 1QLJA 4E08A 4BZXA 5J2UB 2H06A 2OHVA 3M5CA 2BL4A 4TTJA 4YAFA 3KZCA 3RLFA 1G1MA 1O8CA 2W6QA 3E4DA 5I9SA 4AF8A 2G9VA 4NWIA 5M3BA 4C0HA 1GV1A 3KT3A 3W05A 3JD0A 3WP0A 2QLLA 2VNAA 6YASA 3LKZA 1KTVA 5KJEA 2JIPA 3OX2A 2I6UA 2JARA 3R6DA 4I6JA 4ALKA 1ZONA 3E03A 1C0LA 1KDVA 1T4MA 1RMQA 3D02A 2PBRA 3DF9A 3EUFA 3UWSA 2VAMA 1YR2A 1KH2A 3E5HA 2ZJ0A 4WXYB 5A9TA 4NNPA 4TQGA 2DH6A 3WYNA 1XRLA 4HNUA 1HDYA 3CTMA 3CLVA 4QBFA 5TRTA 2GTIA 5EXTA 4TWRA 1YIDA 1F9EA 3VHRA 1OBOA 2WWIA 3L1JA 3I58A 4HQKA 4IH9A 3T3MB 1SU7A 3U3RA 3LZDA 1JKFA 2OC4A 3B82A 2VSXA 4NZMA 1BN6A 3REQB 2I8CA 2AXQA 2FPGB 4KKVA 1HDEA 3IAXA 2QYOA 2H0AA 3O9VA 3PHIA 2J9FA 4O63O 4AZWA 4F2GA 2WVJA 5BW8A 1RYZA 1GGNA 2W2XA 2X8AA 2RDMA 1LBTA 1TM5E 2QE6A 3EJ6A 4JLOA 4B2LA 1GZ4A 2K2WA 3RIEA 3MTAA 2REBA 2XQJA 1RYYA 4CLDA 3EPPA 1KYWA 5CB0A 1ORHA 1TA9A 2JIQA 4CIAA 4H15A 1V39A 5H1YA 4GP9A 4OHFA 2Q9UA 1GPWB 3W1WA 3HRHA 2EGUA 3OZUA 4QYTA 4FC7A 3UK0A 5GM1A 4B3XA 2QTCA 4DAEA 4Z4CA 1JB1A 3Q9NA 5KINB 4BQNA 2H08A 2JS7A 4A2WA 1TTHA 2GNPA 5DP2A 4OBXA 1Z5UA 1KMNA 4F2WA 1FUUA 2HHCA 4GRAA 3WK6A 1NOKA 1XZ8A 2HF9A 3F74A 3H5IA 1YI1A 2CCGA 2W4IA 4HMOA 4X1OA 4B84A 1LBIA 1CIJA 3LW7A 4WOPA 2IUUA 5JNTA 1R15A 2QL7A 5ED4A 5ILGA 5FPYA 5HGJA 5E0KB 3V32A 1XLWA 1XJCA 4F8YA 1RMTA 3KETA 4K8RB 2AL7A 3HCNA 1IY2A 4MUFA 3OCXA 4WEQA 4PX3A 1Z4QA 2R0QC 1N34B 1L7DA 1JJFA 2AQKA 4B47A 4DA6A 4ZICA 3D2LA 2OXIA 3E7DA 3S2SA 2FX2A 4XSGA 1KERA 1QV7A 2IYNA 3IXLA 4FFMA 1C0KA 1EDEA 1G8AA 2R8XA 4JCOA 2JA2A 3C5WP 2PQ2A 4M0FA 3D6MA 2ZSAA 4JBGA 1JDSA 1NMZA 4ZVVA 3I8OA 4IDQA 4X7PA 1V26A 1ZH6A 3FETA 3A32A 1KJWA 3D4PA 3MJ4A 4NZZA 3W5VA 4FYJA 4LMBA 4K88A 2DHEA 4ARSA 2O6HA 2RGYA 3A9TA 5KBYA 3AFIA 1L5LA 5MN4A 4QDOA 5JNUA 3PD7A 4D0GA 2R96A 4QWMA 1RDFA 2G4CA 5LP6A 3BM5A 1QHEA 5B7GA 2UVPA 3HFGA 2D5IA 4QYWA 4D56A 2ZR8A 3EAFA 1Q0TA 2VDQB 3K71B 5IZCC 2HTFA 1JJBA 3RE1A 1EM6A 3U1VA 1W2HA 3D5EA 1IFXA 1WWKA 2G8LA 2H1SA 1QC5A 3DLBA 2IOFA 3IDQA 5TGDA 2WE7A 4OSOA 1ICEA 5A6VA 3TECE 3CKLA 4IGAA 5AKGA 5JZOA 1HDOA 5LU9A 2I4LA 3UV3A 4OU5A 1U8EA 4EUKA 4ZT5A 4N0EA 1Y7IA 2HYDA 3BMCA 4ZOCA 2FX5A 3RC7A 2VTBA 2J9ZB 1E1DA 4KQ9A 5GIPE 1JH9A 3O8OA 2RGXA 3NEYA 4O2BB 1TKRA 2CK3A 3IRUA 2PX8A 4H60A 2WILA 5E6RB 2O2SA 4GBJA 3R0JA 1Y3DE 5K1ZA 3PJGA 2JHAA 4Z4EA 3ZKAA 1ESDA 1BQ4A 2BONA 5DNAA 2J6CA 2UZAA 5BPFA 3JAKB 1VGQA 3DOUA 4BPBA 4CV3A 4II7A 1K4KA 2AX4A 2FQQA 4HAYA 1XHFA 1NOIA 1EB8A 4HO1X 4REMA 3X2EA 5J40A 1OI3A 2FOLA 4G0QA 2OORA 4Y2YA 3ROKA 3GELA 1AHNA 3VR1A 4CUZA 5GVSA 3A1TA 2EJWA 3THXB 4JGGA 3EXEB 2ZUCA 5IANA 5AVZA 1A04A 1GQSA 3WLSA 4IEFB 1O1YA 4HPJB 3HP4A 2H1HA 3JARB 2P3QA 1H9BA 4FMPA 4UMVA 4YNBA 1R2QA 1OTHA 2DUJA 4KIWA 2WUDA 1Y8CA 2GYUA 4RVSA 1DHRA 1E9DA 1DC4A 2QRVB 4WADA 3FXAA 3PCXA 5EI5A 3ZDAA 3O4RA 3PPVA 4O4HF 4LJ9A 5B7PA 2PSEA 3HWRA 4HXYA 1NQOA 4QTZA 1ORIA 4KLRA 4XPZA 2R6AA 3ELWA 3G5UA 4R71A 2B7BA 2X0IA 5C52B 4Z7OB 2O06A 3WTBA 4NPHA 1QGUB 2P9TA 3AINA 3P4UA 1SEVA 4L02A 5KYKA 2ATXA 3AF3A 3F5QA 2WU1A 2W2VA 4M0EA 3LDGA 1E4OA 1T5DX 1WKBA 3M3PA 2GTPA 5ITZB 2YHAA 3SJ7A 3OJ0A 1KZ6A 3PUKA 3ZDRA 1XZDA 2J3DA 2OV2A 4OYRA 1W5FA 1D03A 4N03A 1FMCA 3CLHA 4ROTA 3LRTA 3WNCA 3FGOA 3S2UA 2BRUA 1JQ5A 1SIWA 1GDTA 1I1NA 4NE7A 4R16A 2PCJA 1FJXA 3Q7IA 3UJ6A 3RUFA 4ALIA 5DX1A 3T8YA 3ZDDA 4WZBE 1DADA 2QNRA 1Y89A 1X7XB 4AZTA 5ELLA 3ORFA 3DQPA 2MOKA 4LSMA 3I2JA 4TKUB 5TV2A 3MPOA 4ZD6A 2CLSA 1GR1A 1POWA 3NT5A 1M72A 2NW6A 3OO0A 3V1UA 4BVEA 2MYNA 4KGXA 1AV6A 2IZ6A 2PSDA 3H1GA 3WK7A 4C29A 2AKYA 2HK6A 4JJ4A 3C5HA 5JSKA 1BG6A 4AI6A 5CBKA 2ATCA 4AMBA 1E3MA 4JLPA 1CXZA 2HBQA 3JAWB 2FYTA 1J9EA 3C1OA 3GIDA 3I9MA 4QA9A 3TZCA 5IH7A 4JVLA 4Q3DA 3FSGD 1DO2A 1ZIOA 4M9XA 3B3AA 4BBJA 5BOSB 1ISMA 2GVNA 3AJAA 2ZRNA 4N41A 1DC3A 3DG9A 1TZ2A 1A2OA 2COEA 3K96A 3KQQA 1E20A 2EZ9A 4TN5A 4A6DA 1J24A 3IKTA 3ZD7A 5DM70 1C2YA 4JB3A 5C1OA 5FBRB 4JVOA 4WK4B 4Q39A 1WQ3A 1A9XB 5J1SB 1Q7CA 3IR7A 4LV5B 1E3WB 4QUKA 2BPOA 5FWYA 2XBMA 1JBEA 5L4LA 2GA8A 5AUQA 4JJ6A 1H6CA 4J7XA 1NMYA 4CN9A 5IKMA 4E6PA 3MT0A 2F1RA 4HNVA 4BVAA 1NRXA 3AUJB 2Z0MA 3SF0A 3I04M 1E0JA 3JQQA 3LX4A 3WS7A 1UDBA 1O5IA 3MK31 2JKZA 2X77A 3NBXX 1C7IA 1XZLA 2DR0A 1QCDA 5L7YA 2IHTA 4IS2A 4WBNB 4NV1A 4L50A 5J4LA 4E21A 2YJ5A 3ZU6A 1NN0A 5EUMA 3R0IA 3R5KA 6LDHA 2G25A 3EX7C 2EYUA 2OXRA 2PWAA 2NV6A 3L7JA 521PA 1N3LA 3T1VA 4BIMA 5BXQC 1O9BA 4YJ2A 3LTNC 1FTGA 2QZJA 4TT3D 2YUTA 2D2EA 1CJUC 4R2IA 3W7BA 5IXSA 2GCOA 2J9GA 3OUZA 2R48A 3RD5A 2VJKA 4OGFA 4Q4DA 3WQHA 4COKA 1YRHA 2B1QA 3FFBA 5AK5A 5GZ6A 1C9JA 4W5HA 3N9IA 4DM3A 5CDGA 4MW1A 1RHMA 13PKA 1OIXA 4MVYA 2PKWA 4FGLA 4Z9BA 2J4DA 3NGMA 5HZKA 3THYB 2G1AA 2SHKA 3MNFA 2WOJA 1GHTA 4HQFA 1TU4A 3LK6A 1QH0A 1YZKA 3EPRA 4RMIA 4A5SA 4BNTA 4I66A 2GBGA 1UJ2A 3U44B 2RGBA 2QN7A 4P7BA 1X3LA 4M1ZA 2ZJ6A 5EIXA 4OQMA 1GAWA 4XFDA 3KAJA 1Q1AA 2H1WA 1T9GS 1YJXA 2IYWA 3AY3A 2OXCA 3R5JA 5GM2A 1Y9JA