3DE7X

Proteinase k by classical hanging drop method after the fourth step of high x-ray dose on esrf id23-1 beamline
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de7X00
1WSDA 5AVKA 4C3VA 2PMWB 1GA1A 5B1DA 2XRMA 1TM7E 3VSBA 1GNVA 1SCBA 2Z57A 1C3LA 1PFGA 1R6VA 2ZWOA 3WIVA 2TECE 2V8BA 1SUEA 5FBZA 1T1IA 3CO0S 3F7MA 4CFZA 1C9NA 1Y3FE 5JXIA 5B1EA 2ST1A 1SCNE 2WV7A 1S2NA 1GTG1 3F7OA 5I9SA 4DJ5X 1NDUA 1THMA 1Y3DE 1PJ8A 3QFHA 3DVQX 4KPGA 2SICE 1SUDA 3DYBA 2Z2ZA 1DUIA 4RYDA 3GCWA 4H6WA 1AQNA 1ST2A 1BE8A 1SUAA 2SBTA 2Z58A 4DWWA 4NMXB 4C3UA 4OV6B 2ZWPA 3DE6X 3DE4X 4WOCA 1MEEA 1P7WA 3ZXYA 1SBCA 2WWTA 1SIOA 2Z2YA 1IAVA 3DE2X 1V5IA 2PWAA 3A3NA 3VYVA 3F49S 1SBNE 1CSEE 3T41A 3EDYA 1Y3CE 1TO1E 5K7SA 3ZXXA 1JEAA 1GA6A 1SUPA 3DVSX 3LXUX 2X8JB 4AKTA 2P4EA 1BFUA 1SCJA 1AK9A 3PTLA 3LPAA 2WUVA 1KE1A 1AU9A 2QTWB 3I34X 2W2MA 2X8JA 3CNQS 1SH7A 3I30X 1YU6A 2WUWE 1TK2A 4H6VA 1SBIA 1AVTA 1TM5E 2HPZA 3A3OA 2SNIE 4OMCA 5JXGA 2DQKA 4DZTA 1Y48E 4MZDA 1Y1KE 4OMDA 1SIUA 3QTLA 1C9JA 1KDVA 2IY9A 1A2QA 3WQBA 3DW3X 1KDYA 3DE7X 1IC6A 2W2NA 1BJRE 1WMEA 1DBIA 3I2YX 3GT4A 4CG0A 1LW6E 1WMDA 1Y34E 1EGQA 1WMFA 3BX1A 1GA4A 3QMPA 3P5BA 3EE6A 3WIUA 5AQEA 5ARBA 1HT3A 1Y3BE 3AJ8A 3L1KA 3D9QX 4ZARA 1TM4E 2ID8A 3OSZA 1SBHA 1VSBA 1YJAA 2PRKA 3VV2A 1TMGE 3GCXA 3UNXA 1AH2A 5JXHA 4H6XA 2W2QA 3TI7A 1YJCA 2XTJA 1Q5PA 3DVRX 1TM3E 5JMOA 5JXJA 4Z2AA 1GTL1 3D43A 1BFKA 2B6NA 4NE9A 3AFGA 4J94A 3WHIA 2PKCA 3GT3A 1NLUA 3HJRA 4AKSA 1PEKE 1GNSA 1GT91 3BPSA 4GI3A 1MPTA 1GTJ1 3LPCA 2DP4E 1P7VA 3DE0X 1SCDA 2GKOA 3VV3A 3VTAA 1Y33E 2SECE 1R0RE 3EIFA 1S02A 4NE7A 1AV7A 1ST3A 1TO2E 3Q40A 3Q5GA 3DW1X 4B5LA 4KB5A 1OYOA 1T1GA 3I37X 4BWGA 2G4VA 4K8RB 4JP8A 1SELA 4M1ZA 1AF4A 1SCAA 1PTKA 2DUJA 3DE3X 1UBNA 5FAXA 1BE6A 4HX2A 4YN3A 2Z56A 3SQOA 4LVOA 1OT5A 3DDZX 1YJBA 3TI9A 3TECE 3AJ9A 1KDZA 1OYVA 3DWEX 4HVLA 1TECE 1CNMA 5AVJA 1SUCA 1BH6A 4WOBA 1WVMA 5AMXA 1GCIA 1C9MA 3H42B 2Z30A 2Z2XA 3PRKE 2W2OA 4LVNA 4FONA 1EA7A 1S01A 2IXTA 1SUBA 2W2PA 1TM1E 1SBTA 1P8JA 1Y4DE 1KE2A 2PWBA 1Y9ZA 1SN7A 1SVNA 1ZVKA 2ZRQA 2PYZA 3A3PA 1XF1A 3DE1X 3SICE 1SIBE 2ID4A 1NDQA 1T1EA 3DE5X 3LPDA 1V6CA 3BGOS 2HD4A 1R64A 5FFNA 1ZVJA 4ZOQI 1Y4AE 4CFYA 5ARCA 5CW1A 5SICE 3VHQA 1SPBS 2E1PA 4I0WB 2PQ2A 4KG7A 5ARDA
chains in the Genus database with same CATH superfamily
1OGJA 4Y9UA 4C07A 2HW8A 1I7LA 1ULSA 2L17A 3H19A 3K16A 2OAGA 1VMDA 3ENZA 3IBFA 3A70A 3KWMA 3L6RA 5AKGA 4KC0A 1CY6A 4LV5B 5F1PA 3ZPXA 2OVFA 2L18A 3LI2A 1CJUC 3QFTA 4IBOA 4UM5A 1JJIA 5F3WB 2F1RA 4RKWA 2NU6A 4I2VA 4K46A 4FYKA 4KTTE 4Y7DA 5I01A 1ZICA 1ZWLA 2PXAA 3AETB 4IILA 5GONF 1T2AA 8MHTA 2V8BA 4OAOA 2PKRA 3DONA 4UM9D 4O4JB 4QREA 4Y1RA 1F0KA 2QYTA 2SKEA 4KQFA 2ZZMA 1E79D 3B6ZA 4B46A 4Z1MD 2VJCA 2VRWA 2YW9A 1KO8A 5T7BA 4AKGA 2Q2VA 3IP3A 3M4XA 3EK2A 1OBOA 2WU4A 1HZZC 3Q98A 3VJKA 2QYSA 1E79A 2OO5C 3PEVA 3G7SA 3OX2A 5BY2A 4KQ1A 5GM2A 3WX0A 1Z29A 2J7PA 2H54A 1X7DA 2R4TA 3VPHA 2FFRA 2NZ8A 1J39A 1DAIA 2NU8B 1OHHD 3BCSA 2EFCB 1GR0A 2VPTA 3CRMA 3K2QA 1DIRA 1VGVA 1J2TA 1CWUA 2EG9A 1NR1A 4TRNA 3SIPA 3HBFA 1KWKA 1OHHA 1HYQA 3K53A 1SKMA 3F7OA 4IFEA 1EQAA 2DFTA 3NNDA 4I8IA 4KPUA 4QBGB 1N1GA 2I6GA 2R7AA 3UMJA 4ZAGA 1YA6A 4QC2A 3I6MA 4BNDB 4TYWA 1F12A 1Y3DE 3UCXA 2IP1A 4GT1A 2JJ2D 2ODAA 3AI1A 4C4PA 1KF0A 3H8WA 1WB5A 4Q24A 4RMJA 5DLDA 4J0DA 4V03A 3BN3A 4CZ2A 3V7FA 4JJKA 4F5WA 1RHMA 5ICFA 2AR0A 1OYYA 3IHWA 4LNUB 2D59A 5PGMA 2SICE 2YY6A 3JXEA 2HJHA 1TJ5A 1W8IA 3G9UA 3ZCUA 1OMOA 2V7TA 4KNVA 2FVYA 4ZFNA 4N41A 2EGGA 4R1UA 2G9UA 2XB2A 1E2BA 2RHCA 4MVJF 4JX8A 3N07A 3RSLA 2BZ0A 1NVVR 1RQLA 2YIVX 2ENUA 3FMPB 5TC4A 2LCFA 4LF6B 2CUZA 3V3KA 1SRQA 3AJRA 5ECYA 4WCDA 3PJFA 3EG5A 1YR8A 1XC7A 4HV4A 3OQMA 5L4LA 1T8SA 3K31A 3ZV3A 4OH1A 5F7ZA 4QLAA 4TZTA 2C95A 2Q4TA 2B3DA 1JEOA 4ASUA 2RI6A 1TUBB 1JFRA 1XD2A 1DBVO 2H4YA 4C3UA 5JISA 5IVDA 2BKLA 2IPXA 1NL3A 3EIUA 1QRRA 2CVPA 4OLHA 1BXGA 3C2QA 5ICGA 3RIHA 4IXMA 5IJ9A 4I6JA 3IOEA 3ICPA 3KL2A 1I24A 4NYJQ 1GQOA 4YMUA 2PMCA 3FCSB 4PHFA 1H8EA 2R87A 3GH3A 4K1XA 3JPYA 3QV2A 3MAGA 4UUQA 3VPAA 1UZNA 2CXTA 3GG2A 2FEAA 2CB9A 1BGWA 4M8IA 1GCAA 1EWVA 1Z0AA 2DKFA 2AFHA 4FLMA 2X22A 3FR7A 5AW4A 4LJ4A 1P33A 4A1FA 1PDOA 1DO2A 3VJLA 3VYVA 3W78A 1OLUB 2DCUA 2MSDB 4BYGA 2VQ3A 4UNIA 3DQZA 3UQZA 1E5VA 3AVUA 2J3LA 5CCDA 2CLHB 4MW4A 3WL5A 5I47A 3SDZA 5LPNA 1ZR4A 3NBXX 3HB9A 3KSDO 1A97A 1R37A 3A4MA 3C97A 3M83A 4HYQA 2O2JA 5HTKA 3TN7A 1TZJA 1R12A 5KMGB 1PW7A 2VHUA 5HQ3A 2YJ6A 2BUCA 1TQ2A 1WHSA 1TVKA 2DB3A 1WXWA 2A9VA 4A15A 2NSDA 1NYTA 3OQVA 5CD1A 1PYGA 2ZSUA 1XCGB 2JNWA 2P9YA 4JR1A 4LZJA 2C03A 3PNYA 2IYYA 2ACEA 4RENA 4YBRA 5ELMA 5DCLA 5FBLB 1WB4A 4EL0A 4ZEVA 2BM0A 2HRDA 2P78A 1DRVA 1E4YA 1Z17A 2VF7A 3NANA 2GMWA 1YVEI 4BLVA 1NIPA 4EARA 4WPGA 2X7JA 3LV8A 1DC7A 1M54A 1N2ZA 2O0LA 4XCQA 3EOAI 5FKJA 4EO9A 3IAAA 1EU1A 3MMNA 4WNAA 3W6ZA 2C77A 2H17A 3HUTA 4Y6QA 4NCNA 3I83A 4WQMA 1GXSA 5LP6F 1TEZA 3ZJVA 5HQTA 2QN8A 5K03A 2CUTA 1VKOA 5JOQA 3DFMA 3D5TA 3NW9A 1IXKA 1Z5VA 4HQNA 2C97A 1XZQA 4ZVMA 3GIWA 4Q02A 1EE1A 3C8HA 4HSGA 5B4TA 1XDBA 3MT0A 4RQTA 1VPEA 1AKMA 5EIWA 5T41A 4J29A 1ZM9A 3SS8A 1XEXB 1AVTA 1Z4NA 3IHLA 3LJKA 1MAWA 3KUKA 3GGGA 2QTGA 3B60A 1TAUA 2D2XA 2ZIXB 2KWIA 3I64A 2GK3A 4W1RA 1PZEA 1QIJA 2CMDA 2HJGA 1O4VA 2H18A 4YNBA 2CLMB 1LJ8A 3TOSA 5J4LA 5J5VA 4WZBE 2N1MA 4U0KA 4HYEA 2OYCA 2JGJA 1OPRA 3T12A 1BH2A 2BKUA 4FZ5A 1FDIA 3IOBA 4JEHA 3USES 4MQLA 5HW0A 2XNKA 3WIBA 1N1EA 3R2JA 3RASA 2EKBA 4I4TA 1SUSA 1X1BA 5DGIA 2RD2A 2QRGA 1FJ2A 1G9TA 3IP8A 4B6PA 2PKQP 5CLLA 1SHZA 2IY9A 1BO6A 1S1MA 1SR8A 4IEIA 5EIOA 4AYWA 3G7NA 4KSCA 4D42A 1DTWB 4FSXA 1P4RA 4KWCA 3TMYA 1C1DB 4DR4B 3PNBA 2EL9A 1NW7A 3CO5A 1E3TA 2Y1CA 1MXHA 4M89A 2BDEA 2NT4A 1NTOA 2TSYB 3QW2A 3UPDA 2H2WA 3DNFA 2FN4A 3A27A 4XYGA 3M34A 1YVRA 5D3ZA 2OESA 4I8XA 4DEVA 3Q9SA 3UJAA 1N0VC 2R2GA 3GRAA 4MGEA 3TSOA 3D0RA 5ENDA 3K96A 2UZ1A 4DBVO 1X0XA 4I6GA 1ACLA 3MK31 3ZGYA 3CISA 4FMCF 5J47A 4JI5B 2AZXA 3AVYA 3EDCA 1FYVA 4ZKEA 1PJCA 1XU7A 4DSUA 3VKWA 2JI8A 4BOYA 2JAHA 1ZD5A 2XXBA 3KCQA 3PUKA 3EWNA 2ARKA 1WMFA 4H1HA 4EF6A 1OXUA 1ATIA 1CIJA 1KP9A 2QV7A 3BDVA 1QIMA 3FD8A 3R3JA 1UPAA 2DH5A 4HK4A 4RMIA 5FWYB 1CE8A 2YV3A 4A8TA 4YMTA 1WPQA 3H0EA 3DAOA 3PUYA 4B34A 1T4GA 5A3SA 1U3VA 2BP7B 3QMPA 5IW8A 3A32A 1Q0HA 4RK4A 4ZV7A 3P5BA 3LK7A 4XGKA 1CEEA 2ZBFA 2G6TA 2J3JA 2ZZNA 4NCXA 2D8AA 5A2GA 1ZH2A 2GRAA 4DQLA 3TDMA 1XPOA 5JTUA 4AF6A 2XJ9A 2ZK7A 4LNAA 1RQRA 2I7DA 5BRNA 3L7OA 1YC2A 2CVHA 2EIXA 4D6PA 4ZVTA 1DDGA 2H29A 1FNDA 1S5PA 3O0TA 1CNEA 4OJMX 1BN6A 2P6RA 4C7JA 1Y9JA 2ZE6A 4D6XA 3FN4A 3LLUA 4C0JA 5BWLA 3AU8A 4DSAA 1OBFO 1JQEA 2Q0SA 3E70C 1GGNA 4S1VA 4NBTA 1T25A 1Q1EA 2QSZA 5EWLB 3VV2A 5G41A 1TMGE 3CN7A 4NU6A 1SD1A 1JSCA 1DOZA 3RARA 4XB6B 3ZVRA 2CXSA 3X1KA 3T9FA 3FCOA 3C5CA 2I78A 3PFBA 3QX8A 4UPVA 3V4OA 2QQ0A 1Q84A 1Q1NA 3BQNB 5IVIA 3LVFO 5SZHB 4IS3A 2I4LA 2ZWVA 4EAAA 1MX1A 3R3XA 3AKEA 2HK9A 2V7UA 3KALA 4UD2A 2JFNA 5FFMA 2D6FA 1A9TA 4UNPA 3KAQA 1DP4A 3N53A 5ICEA 4PZYA 3RR2A 1TT5A 3T5AA 1GM5A 1W7AA 2YJ4A 4K5QA 4N5MA 4BNIA 3TXAA 3EODA 3KP1A 1YR1A 2ZRCA 3D1VA 2R8RA 5LQAA 1DDOA 1L4HA 3EDOA 4UBLA 1HM5A 1Z0SA 3L9XA 2OYSA 4H3VA 2QTMA 4NDAA 5GV8A 1A04A 2PFGA 3IXMA 2GA9A 3ADOA 3CS3A 4NG5A 4WE3A 1EK6A 2PX3A 5EQJB 1CR0A 3VHRA 2PKQO 2X9GA 2BFAA 1UDAA 3ANLA 3FHLA 3ON5A 3P4XA 4M9SA 4QODA 1BCSA 1W44A 3FHCB 3E8SA 4AUMA 5LZ9A 1KZ6A 3FFAA 3RYIB 2JGIA 2QJRA 1RXIA 4Q1FA 4Z4IA 4OGFA 1X77A 1ZOOA 3WRXA 1CFZA 3G2QA 3V97A 2IKSA 2PVPA 5MGBA 3VR2A 3AFHA 4EF5A 3RBZA 4LHWA 4N39A 1MRZA 1QGOA 1OFIA 1ZISA 1M0SA 2GASA 4MQ6A 1ZUNB 1EGHA 3U4MA 1Y3AA 1QQTA 2Q6VA 2PGNA 3UO8B 4B4WA 1HE2A 1Z7GA 3M8KA 3K2IA 5E7MA 4DRXA 1R0RE 3NNNA 3VVMA 2GBPA 5SV2A 1PJZA 4WJZA 3MMSA 2ZQYA 6REQB 2JFZA 1Q1GA 2B2NA 2H48A 2YYSA 1CV2A 1ID8A 2I71A 4HVAA 4Y2SA 4PYMA 3I6QA 3OHPA 2AYXA 4N6GA 3PUVA 5K3BA 1EINA 1NQAO 4RA9B 1CFJA 1DELA 1GQYA 1YV9A 4B5LA 3BHMA 1H4QA 3OQJA 4EG8A 1VC2A 1JHVA 4Z1OA 3SYNA 3FTFA 3CF6R 1RYEA 5HJ7A 4EG4A 3CF4A 4ZTUB 1SEPA 4X0EA 5A2QA 2F7SA 3T1VA 3WMFA 3DO5A 4BU1A 3KKQA 2N75A 2VAVA 2A0UA 4LK3A 3PC3A 5H16A 3TSYA 5F2NA 5G02A 5TQ2B 1I4LD 3AEYA 4KIWA 3AM3A 2MCFA 2YICA 4BGUA 4LG1A 2GFIA 5HUHA 5I48A 4MUHA 1ZOPA 4RHFA 5B6IA 4R71A 1V1RA 3ZWAA 4AK9A 3ACBA 3SDBA 2FOLA 4XPIB 4BVFA 1CPYA 3JQAD 5IWCA 1YBAA 5FULA 2DAPA 3OIVA 1SB9A 2C4UA 5MGNA 1B0UA 1I7SB 5BOSB 1CR2A 5K9ZA 2FCRA 1TEXA 3PPWA 2Q1WA 2EC5A 2O05A 1JFFA 3SQOA 3GFQA 3VHLB 1EUZA 1PK8A 3K35A 4MPPA 4RY8A 1Y81A 2RAUA 4JX9A 4K9OA 2VPQA 4MIEA 4L4YA 3LTEA 4O4LB 4OL9A 1SXPA 4DMFA 2WG0A 5FWAA 1JG7A 4NJEB 1PGNA 3CH4B 3NKLA 1BC5A 1P5JA 1NIJA 1W0KA 2J7KA 1WQ4A 1UK9A 1NLFA 1LQTA 1R0CA 1ZCJA 5KYYA 3II6X 2Y4NA 4Q7KA 4D74A 1BU8A 1CNMA 1HURA 1O5OA 3K9CA 3O9ZA 4FJ2A 3S8YA 3DT6A 1JKIA 2XE6A 1LRJA 3UEOA 1VPTA 1ZLYA 2P79A 1GZ7A 3PPYA 2IIPA 2Z30A 2YWCA 4G26A 2R1TB 1PK7A 2NU9A 3PRKE 2PSFA 4M7PA 5K6RA 4CIXA 3NP9A 4R1MA 2QGZA 1UMBB 4CVNA 3R3UA 4YRJA 2H31A 1BDHA 1J8MF 2QD3A 2YZ2A 4MQFA 1TW2A 4XLLA 5EXDA 3EXG2 4I5GA 4DQDA 2IS6A 3ZLVA 3SNKA 1PRYA 3C8UA 1GPMA 2SCUA 2I1QA 1M2OB 4L5CA 2W37A 3OZGA 2ZBEA 2Q8NA 1X1QA 3EGOA 1NWHA 3Q8MA 1JA1A 4KXUA 5K05A 2KQUA 4XEHA 1JXMA 2V3WA 4B7AA 4BE7B 5IABA 4WOJA 1ZRHA 3B7WA 4YMVA 3Q1KA 1TMOA 3NTUA 4JLWA 2ZM5A 1Z7BA 1NJSA 2XBLA 3HYTA 4BJ3A 5JANA 4O2AA 3MZ0A 3QXSA 1MC5A 1KMMA 4FYIA 5COQA 3O3MB 1RXCA 1R0YA 5CVUA 1BHQ1 2GCIA 3CTMA 1JIKA 5E6SA 5FTWA 2Q2OA 3WK5A 4M0EA 1HBJA 1SU8A 3A3KA 4UHEA 2CL0X 3N05A 4J90A 1IBSA 4E12A 4EMUA 2GFHA 3QLTA 2Y1EA 2PUBA 1I6MA 2IT1A 3R6GA 4HZGA 4Q48A 5I7HA 4G4JA 3IVRA 1U5AA 2FZEA 4FIDA 6PFKA 5HKLA 5LQJA 1QVZA 1WXQA 3PJRA 1HDOA 1Y4AE 2B92A 4JAVC 1Z33A 1H2YA 1QSGA 4ARUA 4EG6A 2XBMA 4Y2HA 1FU4A 4HRVA 5ARCA 4DDMA 1PIWA 1VCOA 3HY3A 4Q4DA 2IEDA 1W5SA 4EI2A 3DLBA 1RTKA 4EHFA 4EDFA 1YUNA 4GPAA 2BKAA 4I9NA 2J08A 1N7IA 3OZCA 2ZRFA 1NF2A 3DL0A 5AKXA 3I61A 5EXTA 2B8JA 1KKUA 4PTZA 5BRAA 3WQSB 3NASA 3RVKA 5DXJA 5BW6B 3WLMA 4EFMA 2EJCA 2G7MC 3Q9UA 2VSYA 4H17A 4NPCA 4QUDA 3RREA 2QQEA 2Y1KA 4MWDA 3WGNA 5CH8A 3U44A 1M8FA 5KYUA 3KAPA 3QPBA 3BD8A 2BJVA 3A1VA 4Y8VA 4UM9B 1NXTA 3JWIA 4MWEA 3IUMA 1V8FA 3VSBA 5CA0F 5IX8A 3GVHA 3IOMA 2EKZA 2RIRA 2AKAB 4CPDA 5BSGA 1KI7A 4TLCA 5KOHA 2VZ9A 3OPNA 4UOEA 4QICA 2IIVA 5C35A 1BW9A 1D8AA 2C88A 3LQ1A 4N03A 2GZ1A 1XLWA 4D5EA 1C7EA 1D2CA 2FPUA 2NT3A 1YZFA 3AB3A 5J5AA 2Y1WA 3CWCA 1U2QA 3PWKA 3BXHA 2YVAA 4JB3A 3B3QA 1KPGA 3HZRA 2FGKA 2F2TA 3AM5A 3PQEA 4LV6A 3P32A 4KPUB 5B64A 4I5DA 4MS3A 4X44A 2VSNA 5FQOA 5HJ2A 4RUKA 3WAJA 2BFPA 1FU7A 3G6KA 4TWBA 4EGAA 3VH4A 4YYZA 2XF8A 4NICA 4N8EA 3UAZA 1DZ3A 1V4VA 1GNRA 1C3XA 3DKVA 4R83A 4ACBA 1H0KA 5A3QA 4QASA 3VA7A 5I7EA 4DCMA 4AURA 2C5FA 3FWHA 3LBIA 3QLUC 4JJZA 3WLSA 3HHPA 4HFNA 1GV0A 3NAQA 4BMPB 1U0LA 2XYQA 3OQIB 1NW6A 4UUOA 4OPMA 5CEJA 1KZ9A 2ACVA 1U9JA 2OORC 4HRXA 4ENWA 2F1KA 1SPXA 4YCNA 5KNDD 3STUA 3CB4A 1GPWB 3CLVA 4R9VA 4RKQA 4Y30A 2C7BA 1U3FA 2I54A 3T7CA 4AX8A 5DFAA 2O8FA 2QZPA 1A88A 1XQVA 4ARVA 1OOEA 2DY1A 1PWEA 3NEYA 2H4XA 3IIEA 4K1LA 4O2BF 2ZUTA 1RIIA 1SUDA 3ONWA 3GLGE 1DCFA 4HMQA 3CVWA 1YI8A 1BE1A 4EA6A 2R66A 1Q19A 1DUIA 1EUDA 2ZYRA 3OPYB 1XD2B 4X60A 1NJ8A 3F5QA 1BS2A 8OHMA 5C5EA 2EJBA 1Y3HA 3AHDA 4H6WA 1AQNA 4YJ3F 3O5AA 3C6KA 5H7XA 1PHRA 3LIIA 4BTLA 3ZQJA 4N3GA 5TARA 3QPUA 5IJ9B 4C43A 1N0WA 4OLJA 3NIDB 4OQYA 2PMFA 1G55A 1T5OA 2Q28A 1UWKA 4ZGWA 4P4LA 5IKEA 1RZUA 4MHTA 221PA 4C5BA 3SQWA 1CBUA 3AINA 4DWWA 1ZNQO 4RTQA 1WZCA 2IVZA 1YMVA 2DHDA 3ML1A 4X7MA 3T3MB 4F45A 1JHRA 1XMJA 1U5BA 1ZA2A 1B4DA 2B83A 2HK6A 3EF1A 2B4TO 4RDHA 5EGSA 2AFHB 4MUBA 2XYRA 1KYVA 4FQ5A 2PZGA 3QUSA 5C18A 2CCJA 4TZKA 2DE0X 4EG0A 1EM8A 2RGNA 5B53A 1K6XA 5B1SA 1NPDA 1KVSA 2UKDA 2DT5A 2WFAA 1MFZA 1WCV1 1MB2A 1KZ1A 1QCDA 1R6TA 1WXGA 1PZFA 2B4AA 5A05A 3IMKA 2VJPA 1VJ0A 2FTKE 1QJ4A 4LY3A 4L76A 1EE9A 2E5WA 1WHSB 1TVKB 4HQKA 2UXDB 3L8GA 4BFVA 2CLCX 2VP3A 2QRJA 5AKJA 1EX7A 1NVUQ 2VOEA 4DUPA 5IJZA 2OLJA 5JADA 5DWVA 3V1YA 2QP9X 1KY4A 3P7MA 4D9MA 3V4ZA 3VC1A 3D59A 4ITVA 3TGLA 4XEUA 2O1EA 1M1YB 3CQ9A 5DHFA 5FA6A 5L4SA 1PS9A 3BICA 4R1PA 3U0BA 2ZAIA 5E0OA 5AI9A 1MTOA 1ORVA 4L3OA 2PGDA 4PYKA 2WWVD 2ZBDA 1YIAA 3U4IA 4FDTA 4E14A 3EXG1 1QVWA 2P0AA 2WI8A 3ESZA 4BNKA 2C4VA 1HQKA 3NCTA 3LXMA 821PA 1GXSB 2PHZA 1Z88A 3C1UA 1RYYA 3WL3A 3PDHA 1NNLA 2X3FA 2FEKA 2J07A 3BXPA 4F2HA 2W4QA 4AECA 1B0ZA 5DBEX 2Y6VA 4Y1FA 2ONZA 4DG5A 1R5JA 3ET5A 4UXIA 8ABPA 1HSZA 1AO3A 1TA9A 1QLHA 1WJGA 2PLWA 3BREA 3C1AA 4P6VF 2QTWB 4FLEA 5JG7A 3SHFA 1ZUD1 5DN6D 3OKCA 1V8DA 5JTTA 3R5FA 5BNFA 4B6GA 3SEZA 4Y0VA 2AMLA 1SVIA 2CK3D 2GN2A 4XZ3A 5DOVA 4BQEA 3R74A 1OFHA 1E3MA 4M37A 4M6WB 4EPTA 3A9CA 2CK3A 5A71A 3O8QA 4XASA 3N7TA 4F3TA 3NBQA 1ZSVA 1L3IA 1ENPA 2F59A 3INRA 3FVTA 3TUIC 1FSGA 1MAUA 4RCYA 5COBA 3L7AA 4N82A 2O6HA 1NKVA 2YZ7A 3MLBA 4I4TB 1BYIA 3Q5DA 1A5AB 1TB4A 4JP1A 1Q17A 4GSYA 3A06A 2PR2A 4QPCA 4RBNA 2A1UA 3KNZA 1V16A 5BO5A 4F5DA 5JMOA 1GZHB 3ZBUA 2IZ7A 4ED9A 2WIBA 3BH6A 3R77A 5K45A 4DYVA 2A9PA 3GGSA 4PYIA 4LOLA 1SUFA 4IFTA 5JPDA 3ERCA 1EZ4A 3ZQKA 1J0BA 1TIBA 3QU9A 4MYHA 1RYZA 1T5IA 3NRCA 3WKDA 4V02A 1NMSA 3SQNA 2VBIA 4GPZA 4CEJA 4GSKA 2EEZA 5DW3A 4UU7A 1BJTA 1DV1A 1YDHA 1ZXBA 3NHLA 4P82A 4RAOA 2HA5A 2UZ1B 1IBMB 3HADA 3O95A 1YB4A 5KNDH 1MP0A 2X7XA 4BN0A 4TKUB 5K8VA 1M9NA 3HKEA 1I3CA 1XEWX 1Z2OX 4MLCA 1KR2A 2D00A 2XA9A 1SVUA 1VPDA 2CDRA 3K1JA 5EUMA 3PX7A 1SXJD 1BJRE 3GJXC 3EEFA 2YRFA 4Q01A 2ZP1A 1SXJA 2B8EA 1KOFA 1CE8B 3HCCA 3OTGA 4DNPA 1M2GA 3B1VA 1SOAA 4HVTA 2Q5HA 4DCOA 1FDUA 1VIMA 2J48A 2C9ZA 1OXVA 3WDKA 1P7CA 1O95A 1G21A 3IJPA 3SQXA 3ASUA 3D6HA 3H5VA 2EFJA 1FMCA 1KOGA 2I1VB 5AJVB 3MTIA 4TMFA 2AXQA 4XVQA 1T1SA 4R1OA 3ZQ4A 3ASZA 4X8LA 5D87A 4QG3A 5TMEA 1T15A 1INLA 2OZLA 2RH8A 5LBTA 2WAMA 1P31A 3EMBA 3SBEA 1COWA 1USKA 3P9XA 3WYDA 3MJRA 3I4CA 3W5HA 1BVYF 1JAIA 3GVPA 3LF1A 3WGVA 2YWDA 1ZMOA 5GZ6A 2AX3A 3HRIA 5AXAA 3B53X 1PR4A 3A2NA 3MOSA 4BO5A 3EXHA 4EVQA 2YN0A 1HFKA 3L4KA 3FNEA 3IELA 3B85A 2PCLA 4ZCTA 1C7ZA 1C30B 3BWCA 4LJ5A 3WGTA 2ZJZA 3H5LA 3ZE2B 4RSMA 1D4OA 5TJ9A 4BMXA 5CX1B 4DQXA 4WDRA 4WY2A 4D4LA 4YGXB 1UK8A 4EJSC 3QLVA 4HH4A 1PNOA 3DM5A 5CVJA 2F55A 2RH5A 2RHOA 4QOHA 2I22A 1HL3A 1YD7A 4WVFA 5JNVA 4ZU6X 3KXKA 1KOJA 3NM6B 1ZPDA 3IKMB 3KOXA 5GY7A 5C1DA 4V39A 5JDCA 3GRFA 1LU9A 2HMWA 4K9DA 1ZGBA 2PYDA 1KZGB 1M5TA 1GPAA 1N2GA 3B20A 4TV9B 1I7QB 1T2DA 3PLNA 1FB5A 3N0RA 4KH0A 5IT4A 3KG2A 3R4CA 4D57A 2XA2A 5NULA 4UMEA 5BSMA 3UJPA 3KYDA 3DGEC 1JYFA 3RROA 2V6BA 3PFHA 4JGBA 2GNOA 4RJTA 4XVCA 3PP8A 4KZPA 1IBCA 4QGSA 3KV1A 1FFAA 1J42A 1NAHA 1U99A 4HN4B 4HWKA 5BT9A 1LK0A 3RH0A 2JLVA 2BM1A 1CVLA 1YTUA 2JLWA 1BCSB 3Q8KA 1WY7A 1KNXA 4WBSA 1A77A 3COJA 2PSSA 3CLTC 4W9MC 3BMQB 1M67A 1V71A 1EUYA 3L1HA 3BRQA 1L4GA 2EBUA 1W4ZA 2FFJA 5FFFA 1AY0A 3NTVA 4F4HA 1RABA 1YZGA 1WXHA 1XI2A 4G0YA 4KXWA 4U2EA 4ZCIA 1N6PA 3QOWA 2Q8PA 4X1IA 1BIFA 3SJCA 4RULA 4R9NA 1FUIA 3FYUA 3KB2A 2H52A 4AKHA 1T8TA 3F2VA 4OHRA 1D1PA 1RXSA 5GONA 3T5BA 4D46A 1U9YA 3ZWOA 4DRXB 3WLAA 1Z2NX 3DV0A 1JIJA 2DUWA 1GKLA 1OLXA 1PG2A 4G5RA 4DE5A 4ZO7A 1AHIA 4YR7A 5L9AA 2BMVA 1E3JA 2DP4E 1R9JA 1Y6JA 3NNSA 3NX4A 4WZZA 4WXHA 2I7VA 4BE9A 1HV8A 2VHEA 4BZPA 1QUEA 3VV3A 1GL9B 1LBIA 2HNBA 1L7AA 3I23A 4FS8A 5KAMA 3CVYA 5L4NA 5H0IA 3B2NA 2O2HA 3TTWA 2FW9A 4JJ6A 2ASVA 1T1JA 4QELA 2A58A 1T4DA 1D0SA 2LCQA 2VAMA 2OB2A 4XCVA 3ZU6A 4U5QA 4RTPA 4BNVA 3AWDA 1AV7A 4IDPA 4PO3X 4LCEA 4TSRA 4BLTA 3D8RA 4DMLA 1VLJA 3LOQA 3I04M 3PB3A 4ZC1A 3Q40A 3MF4A 3O8BA 2VXCA 1PFQA 4HWTA 5JMWA 4DLZA 4J4HA 1HPLA 1PKXA 2Q9AA 1C1YA 4H1VA 5IM4A 4Y9DA 3EGIA 4YALA 1OYOA 2P9FA 5DGTA 4WY5A 3NV7A 3PVSA 5TE9A 1X7WA 2YWBA 4CEIA 3M0EA 4K8RB 4ARAA 2QL5A 5CJJA 4CE6A 1TJNA 4MV9A 4BE4A 3A0RB 1W8DA 3KC2A 5I4CA 4GZLA 1JUDA 3R0VA 3L7DA 1G16A 1I2DA 4TX1A 4DDWA 5L3SA 1QDLB 5L95A 1U0EA 2VWQA 2FRXA 3LUHA 5KPDA 1V1JA 4GH5A 4MVJA 3PQ8A 1JFFB 2QIPA 3CNLA 4WACA 2IS4A 1OD6A 4MUMA 2AF3C 1AUQA 1IJKA 1TJPB 2VNAA 4FYXA 4EHKA 5GWXA 4D96A 1YJXA 3MJDA 4GZ6A 3EX7C 3HXQA 4M7OA 4XX0A 1PJLA 1K5HA 4JOQA 6CHYA 3RJ5A 1PZXA 3RC7A 5EIXA 1NONA 2XUHA 4N18A 2WM3A 3EZGA 2ZB2A 3FGOA 4IH1A 3CXUA 3Q15C 4QHSA 3D1JA 3HSYA 3L8FA 4S1OA 1ZN7A 2VPXA 1ZLXA 2YMMA 3F90A 4R1QA 4TTQA 1ZH0A 1F8UA 1PBTA 2WJZB 1ENZA 4U7WA 5KYYB 5I51A 3JATA 4BFXA 2HU7A 5A1TA 1H5QA 3E27A 4YAOA 4L74A 1JKXA 3SHQA 5F2EA 3IALA 1JDVA 4BV3A 5G0SA 2H7XA 1REQA 1GTZA 4HN2A 3KT0A 4K6CA 3SQMA 5BNTA 4YCAA 5D6OA 1DJLA 2NU9B 1UCFA 3T9BA 4HVLA 2EX1A 4GE3A 2HSZA 3EIWA 4UAVA 3CKMA 3R40A 1TD9A 3S2EA 1L1QA 1TA0A 2DRIA 3RS0A 4WOBA 4Y6SA 4EW3A 2YC2C 5EIEA 5AVYA 5BV1A 1Z63A 3EVDA 3AUXA 4OAPA 3A4LA 1ISMA 3JQ9A 3LT2A 4BP3A 2IBTA 4CTNA 3K9HA 2IYAA 5FRDA 2I4NA 1ECGA 1ML4A 1SA0A 3PWZA 4HOYA 4ZQBA 4D92A 1BA3A 1N0UA 3VXKA 1NOIA 4BUZA 2XV1A 2XUQA 3SBOA 1MGOA 1VHDA 2JFUA 3ECCA 4J03A 1QIHA 4LZZA 1DI0A 5C7IO 2X42A 1L5MA 3BCRA 4ZPXA 4IQFA 5H68A 3UXEA 1TM1E 3CONA 4WBNF 5LDHA 3AJAA 3DAGA 3DS8A 1DRKA 2ZOSA 3CJQA 3HUDA 4H2DA 4LBZA 5C2JB 5LIPA 5E6SB 3RTCA 1L5OA 1R3UA 2FPOA 1JFVA 1DUVG 1L7DA 2AZDA 3LHKA 3Q7IA 4HDNB 3T5GA 4EI9A 2V9PA 2VTKA 4OQ4A 4P31A 4DC0A 1QZXA 5D86A 2YASA 1Y8AA 2G40A 3L07A 1VG9B 4S2EA 3BIWA 2YBEA 5BN4A 4QUJA 4XDYA 4O2LA 1CUBA 3F7NA 3HSSA 4LXGA 2BISA 4WZBB 1HORA 3ANYB 3VHXA 3ZQ6A 3EQ6A 2C0CA 3AR6A 1SIBE 2YXLA 5KWEA 1X87A 1U0JA 1DWPA 2AMYA 5ALHA 2MDTA 3DLTA 3E1KA 4TMTA 5CA1B 3ZY5A 4KYVA 2IPLA 2KW5A 4M7RA 2ALJA 1JLSA 1PGPA 5JASA 4JROA 1YULA 5FFNA 3KSMA 4RJLA 1RQ2A 1VE6A 2VDVE 5F4ZA 4GOJA 4Q7QA 2VNIA 1IN4A 4RC9A 4LF9B 4CWAA 1YQEA 5TS2A 3GLFA 4WVLA 5FTJA 3U44B 4I4IA 1RAEA 3S7ZA 4C22A 3RHSA 2H08A 3OSUA 5KYUB 1GNTA 4HGQA 1K3FA 3DO8A 3MJ4A 3HEBA 5DNVA 2VOJA 2CCGA 3U62A 2ATXA 5BVHA 2OY0A 2DYKA 1J33A 3CSDA 2AI1A 1FXWF 3LLVA 3WKCA 1DJMA 3QBEA 5ARDA 1DX9A 3A7DA 4LUCA 5TT1A 2K2QB 3SVZA 3CF4G 1OX4A 2B5WA 3VMMA 5CB4F 4FMPA 5H9VA 4WKNA 5GOTA 3WP0A 1BW9B 1H1LA 3ESYA 2FHSA 3FVWA 1K8XB 2FK7A 2NTYC 1OFUX 2EW2A 3DQPA 4JBWA 5H3CA 4BJHB 3D5QA 2QTBA 3LC0A 3H16A 5IRCD 4CN9A 3IV6A 4PWYA 3RU7A 3A4YA 5AIBA 1T4CB 4MS3B 3G68A 3TZQA 3N2IA 4MTCA 4MVJH 3EGEA 2X76A 4NAVA 3B6EA 1GHTA 3NJ4A 1LPAB 2A8YA 2GBLC 3JZMA 3MWKA 3OHSX 3G5AA 4I3GA 4LGCA 5EVJA 1NXXA 2W0MA 3FIJA 3KXLA 3LCVB 3IERA 4RM2A 3TDKA 4WJKB 3WWEA 3HVHA 2P2DA 1N2CE 1FFHA 2ADFA 3ESCA 3IQIX 5E4TA 1G7RA 1UUFA 3FPAA 3UWKA 4D81A 5FUXA 1DAFA 3AEXA 1DRWA 1P7YA 3G0OA 3QF4A 3QJYA 4OL0A 3ZWMA 4ENVA 4Q19A 1RI1A 1D1SA 4J07A 4MW2A 4EKIA 3B12A 1W87A 1NULA 2BEWA 3UJ9A 1E7MA 2Q9CA 3RHZA 3A04A 4DG8A 1EG7A 1ADBA 1XK7A 1Z12A 3MD9A 4ENUA 4JQSA 5DYYA 1XVUA 2YVLA 3FB1A 4B33A 3Q9LA 3R76A 5BQ5A 2HN9A 4KR2A 1A72A 2I3GA 3HWRA 3R0QA 3ZX4A 1H22A 2QM0A 4BIIA 3OM0A 4V38A 2FFHA 3OHMA 5BPFA 2JLYA 4FGWA 3MJTA 4NOKA 2EQBA 4CM1A 1QV9A 5G3ZA 4DARA 4XDGA 4UQOA 3FPHA 4OUDB 1GGEA 3R3ZA 5BSEA 5JVDB 1I7DA 1GRVA 2NZVG 5TGDA 5DXAA 1UPBA 5HMLA 2ZREA 2CXRA 1RJFA 2G9VA 3FUUA 1Z8NA 4XSGA 4P7KA 2JLXA 5IYZA 4Z0PA 2C5AA 3FSGD 2A84A 2PRZA 3O7MA 2VRCA 4AD8A 3P2EA 2DX7A 2CXPA 3PIIA 5JT1A 3NC0C 1F17A 2C7GA 2WD7A 4XSHA 2X6TA 4F2WA 3OLWA 3OZXA 4ZMRA 5AVTA 3ZJUA 4DLBA 4RMGA 3IBSA 3RRYA 2PUAA 3DFFA 2DERA 1XCMA 4RV4A 1U5BB 4GS5A 1E7SA 1FP6A 5HFJA 3D6JA 3WGMA 5LM3A 2Z1DA 4CMCA 4I1IA 1PGQA 1T4BA 3ZU2A 4HZUB 3W5IA 4KOEC 2WDPA 4TMKA 5CDYA 2YZKA 4I55F 5ITVA 2FPIA 2PSHA 1EM8B 1JDPA 4IHQA 5DX0A 2ZYVX 3T0IA 1NR5A 1SUAA 4JVNA 2AC2A 4L4ZA 4MXDA 5KNCD 5LMUB 4X92A 1Z6PA 2B8NA 2HGSA 3CRNA 3GOHA 3H1EA 1WIWA 3CH5A 3I5MA 1JB1A 1FS4A 4BBAA 4BUJA 4CI9A 5A9SB 3AUSA 1CUJA 1MH1A 2GAIA 3G1TA 2OUIA 1VCIA 1PQYA 4P4GA 1BHO1 2B4YA 3A37A 3ZGLA 4W5WA 4KWHA 2QSJA 3PNKA 4HDRA 5ELLA 3WJ2A 5IHXA 2WTEA 4LV8B 1R0BA 1P77A 2LVBA 3PITA 3UCEA 3CVOA 4GX1A 5HZMA 2CWDA 4Z86A 5HWSA 4CKWA 3L0BA 2XLBA 1YFZA 3WKEA 2JZCA 1Q2XA 4EHJA 3OTOB 1NQWA 3PXUA 5C51B 2FMTA 1QWOA 1AURA 2CE7A 2CZCA 4LQCA 1L8LA 2JGFA 5IZCC 2NGRA 1ZHHA 2YIDA 1UFKA 3N2EA 1ETHA 2FX5A 2PT5A 2Q3MA 3OT1A 3UF0A 3UJ8A 1R8SA 2IYXA 4UAJA 2JRCA 1CSEE 3QVOA 3RABA 1OIXA 3BQMB 3GFFA 3NONA 1JILA 4MROA 3EQ8A 4ZJZA 4F5YA 3CLUC 3RF6A 1PP4A 4D9IA 4R1LA 4HBGA 1CP3A 1YHYA 2HRCA 2P3QA 4EHHA 2QG6A 1VHTA 4ZVSA 3H2BA 4RH3A 3TX6A 1O8BA 2JA1A 4NBVA 3KV3O 1JEAA 1QYDA 2O1WA 1HDCA 2YN4A 2WMNB 1JU9A 1SUPA 5DISB 3ZIDA 2DUMA 4QG7A 2X0FA 1PSZA 1L5GB 1R27A 1Y63A 3VJMA 4B6SA 5BSFA 4YJHB 2HF7A 2GBIA 1U81A 4KFUA 3HLYA 4YAJA 3VZQA 3U7GA 2XYHA 2WD8A 1C4KA 3EBOA 1CZUA 4PSUA 5BSWA 4L75A 2H5EA 4EJ0A 5AVWA 1T0UA 3OC0A 3OY2A 4MEAA 1FX0A 5F4BA 2O06A 2GEUA 1A2KC 3HXKA 3SOPA 4RQUA 4V0MA 4J7AA 2D4HA 4II7A 2A1UB 4MW9A 1V16B 4BPBA 5DLYA 4M0LA 3MB5A 1E2NA 5ADUS 3T7SA 3W8EA 4BO4A 5AKYA 5JFOA 4BLRA 3H11A 3HZZA 3OQ6A 4KFCA 2ZCJA 1OB2A 1KWGA 2QJOA 3U60B 1W88A 4TT8A 2J33A 2IBSA 4CEJB 4DG9A 1ULZA 1ZC4A 2WG2A 4QHTA 3EA0A 2ES4A 2UZ3A 3ZWKA 5ESRA 3I05A 1VE1A 2RK6A 1JKJA 1KFEB 2WIKA 3E82A 4OUKX 3GUCA 4B5KA 4EVIA 3DDNA 4OU5A 5E6UA 2PEYA 3ZZNA 1S9DA 2JAUA 4REMA 1QU3A 3I0NA 3RRMA 2BV3A 3U4QA 5JAPA 2IHUA 1EFVA 2JGEA 2BMEA 4M98A 4MDHA 4R9RA 1QAMA 5LBUA 3A6GA 1SXJB 3L0PA 4ZEXA 1DT5A 3BL6A 1QP4A 1OU4A 2OFWA 3WQBA 2F4VB 3EVCA 3V7WA 2F9MA 2I1LA 3FNHA 4NOMA 2PT6A 5A4MS 1RXWA 4A6EA 2HWWA 2Q6LA 3C3EA 1W1UA 2A5DA 3DE7X 2AMVA 1Z5GA 3GFVA 2LXNA 4P58A 5HIJA 4JLOA 1IC6A 2JJMA 4OQMA 2RGEA 1IUNA 2OTCA 1MIOA 5CDFA 1M34E 2CXQA 3AZQA 1RU3A 3V80A 3FHOA 3KOZA 3SWWA 1WMEA 1NFRA 2BCJQ 2ON6A 3OBIA 1GGMA 2BN4A 5DYTA 1P0QA 1GZSA 2JAPA 2ZYTX 1YMQA 2DSTA 2OZLB 5KQPA 5FADA 3D4PA 1HI9A 2XXAA 3ANMA 2PIAA 3HG7A 3W77A 3DDWA 2GAAA 3BFPA 5ALFA 1T9DA 1SD5A 3QFFA 3RYFB 5FWNA 2BGWA 3FUWA 1U7DA 4ISBA 4G24A 1IN8A 1L8AA 3EXHB 3PCRB 4MR8A 4PXAA 5KNCH 1GA4A 3MLAA 2C7QA 1V39A 2CLLB 2PSEA 3LW8A 2NXEA 4JWKA 1I0LA 4AFNA 2UXCB 4NEGA 3BXFA 1CJBA 1GGJA 1QIEA 3LCMA 3NV9A 1FPQA 4UE3S 5IBQA 4BNXA 3DT8A 3TR5A 2G70A 1HG1A 2J3KA 1WZEA 1LTHR 1KHTA 2OILA 5ALPA 3V34A 5AM5A 2OOSA 3NUZA 5KTYA 1OB5A 1WETA 1V8OA 5I8PA 1VI5A 3M6MD 4GMHA 2OKCA 4KFTA 2OHXA 4OXKA 5ALJA 2E7ZA 2VNKA 5K99A 2A86A 3TFQA 3QVWA 3OZIA 3EGCA 4RVNA 1PL0A 4EA8A 5JD4A 4CLXA 2O1XA 3L05A 2FEXA 1P29A 5B55A 1H1TA 1FFEA 3UMBA 2ABWA 5JW6A 1TM4E 1IXYA 4PIPA 2IHYA 4OHUA 4MICA 2XVYA 1KBQA 1JDZA 3KYDB 5EE9A 2I1WA 2ID7A 5EPOA 1R6UA 4C4OA 4MVCA 2II6A 3M3HA 4GNRA 3BCUA 4QOFA 1QGUA 1KTIA 1M8GA 2PRSA 4DIBA 3QVUA 1YOVA 1YB2A 3HPQA 5EIBC 1PU2A 2IHKA 1JLMA 3AG6A 4AM8A 4BX3A 4GR4A 4QBTA 5EJIA 4ZDIA 5C7OO 2KYRA 5JNTA 4CKYA 4D8YA 1CZLA 2IODA 3CX8A 3FB4A 1E1RA 5EKXA 2B0CA 4U0JA 5TY0A 2WWFA 2ZDQA 5IF3A 2Z8XA 4PPFA 2C82A 3AL3A 5THXA 2A88A 1QX4A 3LM8A 5EQDA 1KEUA 3ROKA 5BURA 4WV3A 5K6AA 3VDXA 1D1TA 2A67A 4R1NA 4BRZA 2EZUA 1MQ9A 3WNZA 2BM8A 3FYUB 3S27A 1R88A 4E1VA 3CNOA 2G0TA 4GP6A 3H4TA 5GONB 4DRYA 4V0SA 2P2CA 1M6NA 4NE9A 3D6UA 4WINA 4JH0A 3DV0B 5AO9A 1JA9A 4DQ0A 5AKKA 5GPBA 4PZ0A 2XE8A 1OLXB 3ICOA 2VAWA 4L4RA 1IPFA 1ULUA 2W2XA 2PKEA 5GVRA 3K0CC 1HA3A 4NNOA 1XNRB 4WNYA 2ZB7A 4INAA 5CA0A 1N8SA 4PX5A 2JI4A 2G5GX 3KU4A 1OXKB 1E77A 1T8YA 5TPZD 1TQDA 3BRCA 4KQ2A 4DRZA 4NABA 1NN5A 1GNSA 4K86A 3GA5A 5TPZA 2G9ZA 3L84A 2J0UA 4ZQGA 3UATA 1TLLA 3RKSA 3O2SB 5BSHA 3S1AA 5F7JA 5C46F 2P6UA 1L9XA 4QJBA 1W5EA 1ZK3A 2GKOA 1W2HA 4R98A 3LOUA 3EPJA 4RDIA 1TQHA 4FPXA 1QHEA 2QROA 1NRWA 3NWBA 2P40A 2REQA 3RBXA 5A4JA 2Y4OA 2W71A 2Y77A 1P0MA 2XDWA 3D64A 2QVBA 3P9CA 3GLGB 1X7WB 3UHJA 1NZDA 2FMFA 2W6JA 4KGZA 1XHEA 4W8HA 4CEIB 3NWEA 4PHGA 1LS1A 1M2FA 4BGEA 2D7DA 2BFBA 4LZPA 2ATCA 3ZLJA 3DFZA 3G5UA 2V5UA 3NTOA 4WKOA 5L3SB 3KKPA 3N8NA 1CHDA 3GF4A 4BRSA 4ZYZA 1X8JA 1L5LA 4WLVA 4CIAA 1JQAA 3KTFA 4N0EA 3K05A 5FNZA 1JU4A 3C6YA 4KN5A 3ESDA 1ZBDA 4X6UA 1XDDA 3GGOA 4NIMA 4WGFA 4XQGA 4Y0AA 4XX0B 4KPFC 4FW8A 3GLIE 2VLBA 2DWCA 3V33A 3RODA 2EHJA 5JPIA 2I7XA 1BDIA 5TF0A 4Z4EA 1Z62A 4BZQA 3HRHA 1N3IA 1V45E 3CPHA 1GPYA 3L4BA 3VKFA 2DFLA 4LF7B 4YRGA 4J9VA 2R85A 3AWIA 3U3RA 3WZLA 3JATB 3MT7A 4CMKA 4N01A 2IDJA 4YJ3A 2AE1A 2G08A 1EDBA 3H18A 3BBLA 4ZVLA 4YQFA 2ET6A 2R6JA 1E58A 4PAMA 5KNBD 1ZVVA 4BC1A 5C5IA 1REQB 4E4RA 1EBBA 1G6OA 2ASEA 3DB1A 2ZJ3A 2PH3A 2WQZA 4MWZA 3GWGA 3DLHA 3V7NA 2D3WA 1M6YA 4OFZA 3I5YA 2XT0A 1KY5A 1WLYA 3HVKA 1UFQA 3M81A 3SK0A 4IIJF 4CBVA 4DCCA 2ZRBA 2WA2A 1K97A 5CVTA 2JIOA 3NJ8A 4YP9A 3UGQA 2GLUA 1E2GA 1Z36A 3K72B 4PC2A 3ZOZA 1UWLA 1YR2A 3S7TA 3VZPA 4A2PA 1PTJA 4MDEA 4RD4A 5ALSA 3AR9A 2O7NA 5A0VA 3UPUA 3AJ9A 4R41A 2KX7A 3JZDA 1YRWA 2XMSA 3TOZA 1SA0B 4OJYA 1N75A 1OVMA 3ND8A 4RJ2A 2FXIA 3IUNA 5BUSA 4IIBA 5AKEA 4A82A 4CCWA 2YDYA 4MEJA 1XCBA 3G49A 4DANA 4AZ0A 4U2FA 3H2JA 2PDAA 2ODWA 2REXB 2GPTA 1E9BA 1GIAA 2P1RA 3LL4A 1OI4A 4B6OA 1O5TA 5JQGF 2FMIA 3KVVA 1JEDA 4FONA 5D3QA 5AJXA 1EB8A 1C7RA 3KTAA 4A2QA 2ZXEA 2C61A 3JYPA 2IKQA 3OE7D 4M4SA 3ZZTA 3PRYA 2E87A 3LQFA 2OHGA 5FUVA 2J4CA 2VEOA 4OP2A 4YJFA 5BN4B 3AUTA 1GQFA 5LP6B 3VHXB 1ZXXA 3DR3A 3P9SA 5KOYA 3RIEA 4G0XA 2ZR0A 2ZVPX 5GQSA 2PWBA 5CNMA 1C8VB 4LE1A 4WECA 5JC8A 2Q1XA 2VPPA 3TG8A 3H86A 3LSYA 4TQAA 4ZCPA 3ORRA 4OP3A 2JRLA 4J7UA 2V9ZA 1JSRA 1GKYA 4R5MA 1QQ7A 3REFA 1K88A 1XXHE 3AR2A 1AMOA 1UXGA 4OYLA 4YFYA 2PL3A 3SICE 3D4NA 5I9LA 3GLFB 1DX6A 4Y67A 3M6WA 1U0HC 3ZHQA 5BUQA 2ZPAA 4HKTA 1MLDA 3W2GA 1P3JA 4NZNA 2DXIA 3FTEA 4W5TA 1MV8A 3WK8A 2GM5A 4RF3A 3CNBA 2WB2A 5BVHB 1EWKA 2OB1A 4ABYA 4GC5A 2C1EA 1V7ZA 4ADSG 1KP3A 1SM4A 4HZIA 1W6UA 5LUAA 4XQ0A 3EPLA 3FOEC 2V54A 3GEEA 1T6XA 2V1UA 4P0TA 4ZI2A 1H1LB 3EAFA 4S24A 1GRQA 3CNEA 3CX6A 1JQ3A 4BVAA 3H9BA 4M49A 5IN4A 4LYAA 3ETEA 2C4KA 4O1HA 1XMVA 1ORTA 5AH0A 2QTRA 3UMFA 2NIPA 4YRMA 2OO3A 1USIA 1E9SA 1SQ5A 2LV8A 2Y0DA 4TMVA 3L93A 4JP2A 1IRIA 4WAUA 1NT2A 2WKQA 3FKQA 1QIKA 4GXTA 4G2TA 4TYYA 3A8TA 3LG2A 4HMPA 3ZVKA 2EJTA 5IAKA 3J7AC 3IAXA 4PCAA 2VQSA 1TAGA 5CBKA 1V6AA 2BI7A 1Y5IA 1TF2A 4FMCB 4YAFA 5AVKA 3UJ7A 2CL5A 2BMWA 1IBRA 4E2WA 1DXYA 3DLIA 3WA6A 1YB1A 2R6GA 3L41A 1XMPA 2VI5A 3QKTA 1GEGA 1ZI8A 3QVJA 5D3KA 5KVQA 1PVDA 3QF4B 4MVJG 3KKMA 5JSFA 1U8FO 3WISA 5LFAA 1RPAA 3UWOA 5HR5A 2MSKA 1XRMA 3G02A 4Q1BA 2BEWB 2RKOA 1JMYA 4IRMA 3TKLA 2JLBA 3FF4A 4XW2A 2BH9A 1TQ6A 3ZBTA 3IBCA 1I4DD 2R1UA 1NMZA 3PEEA 1G8AA 4CDMA 4EUHA 2IYNA 2XB9A 1Y5RA 2XCQA 3GU3A 2IUYA 1G6HA 5A5GA 3CO0S 2VQEB 4K9MA 5DTRA 3GP5A 3F71A 5KNBH 1GLGA 3GA0A 3M6XA 4GKJB 3MS7A 3ZGZA 1ESZA 1T3HA 1QH0A 2Q3JA 3HU2A 3K8ZA 5HS6A 3RFCA 4FOLA 2QVCA 4AJIA 4HDSA 4CMGA 2NV2B 2BEJA 2PQ0A 2R6ZA 4X6XA 2WZBA 3ZI7A 2QM7A 2B5VA 1GAJA 2CVOA 4MPRA 4B40A 1WDLA 2DQYA 1N36B 4LOJA 4O3FA 2CNBA 3H04A 5EYPA 1FBNA 1RP1A 1SEVA 2VSFA 3S2ZA 2ZBGA 4FFRA 2ZW9A 3CE9A 5F5NA 4AN4A 4RU1A 4DCVA 1KEWA 3O3CA 3R5JA 2D2EA 2XY4A 4BFUA 3P2YA 4LBYA 2WD7B 4AY5A 1XL1A 5ERGB 4I1PA 2B4KA 1G6Q1 5F3DA 1I2MA 3FAZA 1SURA 3N5CA 3TDNA 4R40A 2RARA 3VH2A 4AP5A 4CM7A 4E7PA 3GPLA 3U7HB 1Z5ZA 2DULA 3A05A 4LPSA 3L5OA 2QRHA 5F21A 4C0QC 3O1LA 1ZM4A 5CVDA 2FPIB 2QMEA 3C74A 4MSUA 4NULA 3G2LA 4AMBA 3H2IA 3E23A 1E6CA 4CIYA 2O2CA 3AIIA 1JG2A 3DYBA 3OJ0A 1Y6RA 4N5IX 4FXPA 4V0KA 5LNK6 4AO6A 1S0UA 4D9HA 1BWPA 2B6HA 2LGJA 3RAGA 4NYJR 1YQQA 2JHGA 2Q1TA 3DMNA 5EMHA 3OZSA 4F1JA 1U1CA 2Q2NA 1CY4A 2I7CA 2VKTA 2XD4A 3GFRA 4I50F 3KR0A 2BGMA 2Q0HA 2VPZA 4HDRB 1WY5A 2VNSA 3FBGA 4F5ZA 1NZJA 4IH9A 1EX6A 2HAEA 4H7FA 4W5QA 1NBME 2IU6A 4L8VA 4YCSA 5BSVA 4AJHA 1EGVB 4CKWB 4H60A 1D9ZA 2PWYA 5KTOA 1XWIA 1G2IA 2WY2D 1WTAA 4C4YA 4ERNA 2V58A 1IBKB 2HUPA 3D7KA 4PHCA 1NOKA 1QGED 1FEZA 1OBVA 1XLVA 1KVQA 3PG5A 3TLJA 4Q9IA 3ER9A 1RKQA 2FMUA 3MWDB 3ZXYA 3CIFA 4IIEA 1NMXA 4C4TA 4OA8A 2VDLB 3HXMA 3NAZA 3CT6A 3K5IA 4ZN6A 1TCBA 3WXMA 3ULKA 3BZWA 4NYIQ 1TE2A 2PS0A 3W6OA 1C4OA 1W5BA 2O5RA 3OG9A 5HA5A 2Z5VA 5AVZA 4KVZA 5FR1A 2PWAA 3SYMA 2IGBA 3MAJA 1KA9H 1JECA 3U9TA 3RD5A 5FP0A 3F6SA 4ZWNA 1KKLA 1T9GR 1B8NA 1IOLA 1XCLA 4OGLA 4EATA 3TLEA 1KI9A 4AQYB 2ZTSA 1T6YA 1D6NA 4XUEA 2BMJA 1B3RA 2V7QD 3D6AA 4O02B 1C9EA 3DBVO 3I9OA 1X1EA 4LW8A 2AWNA 1QPGA 1FX0B 2PH5A 2Q99A 4L57A 4ZCLA 1Y98A 2PU5A 4YRLA 2X8LA 4LRSB 3UQYS 4HG2A 4EF4A 3SZLA 2OLKA 4TSFD 2BF4A 3GPBA 4I1UA 2D1SA 3SJBA 3QE4A 1XZBA 3ZUPA 4EGFA 1Z0JA 2RHDA 2YWHA 4PGHA 5E7QA 5IKXA 4KNWA 3SIRA 5DM60 3WRXC 2PK3A 4TTIA 4MQUA 4PO1A 1E6UA 1P1KA 2G17A 2AHRA 3H9EO 4KRFA 4CMEA 1M2WA 1C3EA 1D7OA 1T5BA 3M1YA 2ZWMA 3IKTA 3S0JA 1W4BA 4PBSA 3AKZA 1G1AA 2XOXA 1W88B 4K6MA 2F3RA 2PY6A 1EIWA 3JWJA 3FPBA 1KMHB 2C8JA 2J3DA 3CR7A 3PGLA 4ZVUA 4XD2A 1PSWA 1PZGA 2GFQA 1O9BA 1GQQA 2RH4A 2RC6A 1DRUA 1AZWA 1JKJB 2B98A 2GZRA 1GILA 4NBSA 4DWVA 3NS7A 1J1ZA 3L6CA 3MLEA 5E6UB 2ICAA 4TPKA 3I30X 2BT4A 3OOJA 4PLCA 4U2BA 3ZE7A 2IE8A 3MPUA 3MMXA 4NNJA 1QFYA 3TZHA 5CLIA 1EFVB 5LMZA 3ME5A 3COZA 3ZS9A 4AYXA 3WP1B 4Z3KA 3LUKA 1MUUA 5AXDA 4ZKDA 1U1FA 2W9XA 3N8DA 4H3KB 5IM5A 4I4CA 3REQA 2WYHA 2HBYA 4WFJA 4ND8A 4BKUA 4OSEA 2WTAA 2NP7A 3M5CA 2Z1MA 2W2LD 5BQOA 2FF5A 3TB6A 4GYYA 2J9GA 2VP6A 1YK0A 3C15C 4XM2A 4CKZA 3KKLA 1M1NA 2B1IA 1Y1KE 1T43A 2NUTA 2EAUA 1T0PA 1MIOB 1R3DA 2OCIA 4ECEA 3TLBA 4Q3CA 2JHFA 5F2KA 4NZOA 4ZDWA 4DLTA 5KWIA 3EQ9A 1R1DA 2I87A 2I99A 2ZDGA 3GQBB 3IIJA 5FBHA 1M74A 2IUUA 2VF5X 2C54A 1ODIA 4B8WA 4CKBA 4P3NA 1F2TA 2DFDA 2PS3A 1Q15A 4UOQA 2XMDA 1YT5A 1HL7A 2XXAB 4RD1A 1IWBB 1QO7A 3BSYA 4C0KA 3KR9A 1A71A 1DQPA 4AT1A 4BFYA 4EH1A 3KFXA 4S3MA 1AQ6A 2OFFA 4D9KA 1YONA 5G1OA 1Y1QA 1GRCA 1RAFA 4FHDA 4QUKA 3G6WA 1SVKA 2Q7XA 3OD1A 2VXBA 4YRSA 1JGTA 4MR8B 4EBBA 3RG2A 3EXIB 3B52X 1HOXA 4LN1A 3V2HA 1XZGA 2YJZA 2FDCA 4FFBA 2J5QA 3NBKA 3C87A 3P4YA 4RLHA 1Z28A 2VJNA 2XEDA 3QYAA 2VYVA 2C94A 3IAS6 4CG0A 2PH7A 1AC5A 2WKSA 2ZKLA 1E1KA 1XZKA 2X5OA 1DKLA 3H5RA 1NJ5A 4HEJA 2PUDA 4KITB 2XDAA 2HJRA 4QTZA 3CUSA 3VNRA 1KYXA 4B7UA 4UARA 4QWMA 1L5ZA 3GARA 3OUZA 1EGMB 4PQFA 3IVMA 3BFXA 4HDKA 3UJ6A 4D6YA 4G41A 5LA6F 1YRQA 4A03A 1MOPA 2BGUA 4HFMA 1T5LA 3IDQA 3KE9A 4WZAE 4WBNA 1JBKA 5BSTA 1R74A 2EGHA 1KDRA 4JZYA 1YZ3A 1NXOA 4KQCA 2V5AA 1ZK0A 5J1SB 3A2KA 2W6OA 2W6PA 4WN9A 4AU1A 3VO1A 1MHTA 4KQMA 4NU0A 1SWWA 3S2SA 4XIGS 1V6SA 3A9WA 1CUDA 1TZCA 2LKCA 1U7HA 1YOVB 2ORED 3QG1A 4PLGA 4RPJA 2CDNA 5D6NA 3W2HA 1WDMA 1AKWA 1N57A 3ZHZA 1ODTC 1M73E 1C41A 1UT5A 4KQHA 3TS1A 4D3ZA 1JJ7A 4M86A 3QX3A 3U3JA 4KR6A 4YMIA 4JJAA 1R6DA 4A3SA 3KQMA 3KUCA 2Q5QA 5D1HA 3UC5A 4F7WA 3MUOA 1ABEA 5TMBA 1CUHA 2XRZA 4RK0A 3UBTA 1G38A 1KGDA 5ANRB 4ER3A 2Y05A 3DR5A 3GCXA 3JQGA 3UNXA 3IUSA 4B1FA 1AH2A 3LHDA 4I9FA 1GRNA 2M9MA 1PFYA 3CGGA 4B45A 4NZYA 3L0ZA 3M7IA 1JI3A 1FMTA 3NCHA 2FZ4A 3OZAA 2PUFA 4TVSA 1RBMA 3CV3A 4OX9B 1BKSB 2Y6UA 3TQSA 2TMYA 5CT9A 1NFFA 2FU5C 3E5HA 3HJAA 4L27A 2K7ZA 5F1OA 5BWBA 4KVGA 3C4QA 3DVRX 5CFLA 1R0SA 1TM3E 1C7JA 2ZUCA 1HMYA 3BIFA 4GI1A 4DIEA 5CA0B 3LFTA 2XE4A 1FXWA 4JOSA 1L5RA 3IAM6 1GTL1 4DDTA 4HT3B 1N2CB 2WP0A 3ANTA 4WASA 5HF5A 2PD4A 4BX9A 1DBPA 4S1TA 2RHBA 3HUEA 5REQA 1GQSA 4G9BA 5IAJA 2GS9A 3VZSA 1U0BB 1F0PA 2J0UB 2P5UA 2WE8A 1G4UR 4TQ9A 3GEDA 3S1AB 7GPBA 1E99A 3W5CA 1UODA 3VU8A 5CB0A 4FIZA 2F8TA 1CUUA 3COWA 2NSHA 3EIQA 2QMZA 4QM7A 4CM5A 1FUKA 5AWFC 3A2LA 1FYEA 1ZMBA 3VKGA 1Z4OA 3IE2A 1KYZA 4NZMA 3EIOA 1NQXA 2VA8A 4U63A 1YGPA 2GILA 2REQB 4DCSA 2EVWX 1NUPA 1YI1A 2OZVA 4G5SA 1F2VA 1XFDA 3ZJYA 2AC7A 3LXRA 4E5DA 3K1TA 3LPCA 2CLEB 3OFNA 1FTGA 4ALNA 4F93B 1GLNA 2XNDD 3DSRA 3RVBA 4HNVA 1AKNA 5EHZA 2A9KA 3KK0A 3LW7A 1GPDG 2XNDA 4EITA 4TS4A 4R31A 5G2OA 2VJAA 2VTEA 1PWHA 1D0IA 1RHUA 5A03A 3UUFA 4H59A 1DFIA 2CSUA 3VFDA 2DR2A 2ZTLA 5H59A 4P83A 2PMBA 2D5CA 3MGCA 3OQBA 1E2QA 2DBRA 4CV2A 2ZSEA 3FCXA 1TCCA 3NPAA 1JU3A 4QSHA 2J09A 4PSCA 4DT1A 1GZDA 3AUYA 4DR3B 3VX3A 5JBNA 3JW8A 4PBTA 1HE5A 2E4ZA 1WLSA 5L6LB 3P9KA 1K98A 5BNIA 5LNK1 4YJ3B 2IH2A 4OX9Y 4C2AA 3AMVA 1N5JA 4PG4A 2ZJ2A 4HDAA 4B85A 4B31A 1JIXA 4ARIA 5CLHA 2W48A 3LUBA 4X66B 4IJUA 2PT7A 5E4JA 5AHKA 4P7BA 1A9OA 3T38A 3W9SA 2UYCA 1NBMD 1LTKA 3PVCA 3V4RA 1JH9A 4IDOA 1NUHA 1P60A 1U7TA 2AJBA 2WD9A 1KZ7B 1TUIA 3HM2A 3O4RA 3EFEA 2ZRGA 1H3FA 1XTPA 4PRZA 1YDWA 3V6LA 4OB7A 2YVQA 4X62B 2INGX 1XROA 3M6UA 4Q00A 3EEQA 2ISCA 2A3RA 4B3XA 2GR9A 2XRYA 2Z95A 2WLSA 4OQDA 4R6XA 3ZLBA 3T9EA 2CKMA 4GEKA 2Z5GA 4X64B 2FWNA 4Y1GA 2XMZA 2QU7A 1MNAA 2F9FA 3QUAA 2YXBA 1DINA 2R60A 4KK3A 5K0EA 1B1AA 4HXEB 5ECWA 3JQFC 4LVOA 5FAKA 3RCBA 1QBKC 4EG1A 1D2RA 2HEIA 1GTSA 1OA0A 1FQOA 2G63A 5CD9A 4MP8A 1Z37A 3GJ7A 4AZ0B 1YUMA 1CQJA 3BFKA 3JTEA 2WSIA 1M5RA 3LKVA 4IUCS 2QUHA 3N2NA 3VTKA 3BK1A 1MOZA 2YZGA 1QMGA 3A11A 4M1TA 1XJCA 3QA9A 3WGKA 2A1TS 2RC5A 1V7PC 2B20A 3KQSA 2IXDA 3KTAB 3NGXA 4NZPA 4Z0HO 5DBFA 3T15A 4DYDA 1BXKA 1KVTA 2X1MA 3G2PA 4IJQA 5KKCA 4J4BA 4ZMBA 4OBBA 1J09A 5IH7A 3C6MA 4YJFB 4UC0A 1AM4D 1QQ5A 3TG2A 1WBBA 4YMLA 4JI4B 5AUPB 2UUBB 3MILA 1NVDA 4Q9DA 4MCAA 1NBHA 2DY0A 1TUGA 3VSDA 3PHIA 2W2OA 4DABA 5EHGA 4U3JA 2Z3ZA 1CU1A 2HC9A 3RS7A 1QS0A 1JLHA 4AY3A 4AN1A 4I66A 2GDZA 1IHUA 2OZEA 4ND2A 3STTA 5MF6A 2YXPX 3P27A 3AONB 4IKEA 2NO7A 2WTUA 3AL0C 2C9CA 1SBQA 3FZNA 3EXFA 1R4AA 5A5VA 2AEJA 3F6BX 1FJXA 1XVAA 1NVVQ 1TAHA 2WAOA 1Z7YA 2VJMB 3I1JA 1EUCA 4QYIA 3W7BA 2R8PA 1XX6A 2P9CA 3LU1A 4NOLA 5M29A 5TPWA 1X3SA 2BGRA 3K0FA 4ZAYA 3WE7A 1H05A 2QORA 2VUSA 1QHGA 3SLKA 1VJGA 3WIOA 5EINA 3AR3A 5J3JA 5CEEA 3GHHA 4Q3OA 2EKLA 3CRW1 4HF7A 3UAGA 3STWA 5LJIA 1J5EB 5MFZA 3S4YA 1TFUA 1GOTA 3WAKA 3RSGA 1RD4A 1KFCB 3JYHA 1RI5A 3NVAA 4DYHA 1OH5A 3R9WA 1C0EA 3AILA 2V7VA 3SZGA 1ZK1A 1CG6A 3OCWA 2PMKA 1R64A 3JARA 1DJNA 1RWPA 1RYFA 2R6DA 3LUAA 2DC1A 2WF6A 4HQOA 4ZZ0A 4CLRA 1X7HA 1XZIA 4H0NA 3GJ5A 4G4IA 4DVJA 1QK5A 3N0XA 5LXTF 6AT1A 4EAQA 3HUFA 4WLFA 5FORA 3BE4A 1HT2E 3IMFA 4W5RA 2E1RA 2GERA 3ROFA 5EXSA 4R2JA 1E61A 5C80A 4PCVA 2AFRA 5FOSA 2FPPA 5KO2A 2R8ZA 1IQUA 2H57A 4DSZA 4I0WB 4LJ8A 3VR4D 3WA7A 1NPYA 4RD6A 1PL7A 5AW2A 4URVR 3TF5A 3AHIA 3B6MA 3OIFA 3VR3D 4KQJA 2RGWA 3VR4A 5LUBA 5K8LA 1DIOB 2IY8A 5TDHA 3TD2A 4HGOA 3VR3A 4MIKA 4B73A 1ESCA 3QEJA 1N6KA 4EQZA 1KY2A 1DXQA 3IXLA 3TQOA 4ATNA 2BWJA 4AF8A 1UKEA 2WM9B 4FGLA 4AAYA 5JAIA 2HIAA 1HKUA 3PPIA 1QFXA 1UJMA 3IAS1 4IMJB 4N8SA 1LX7A 4PXYA 3WRVA 4EUKA 3J7TA 1D6MA 3WRWA 4HDSB 3UA4A 1E3WA 4C7OB 2VSXA 3SN6A 1ZH6A 1RRMA 1CETA 5DXFA 3RQSA 1NQOA 2H6EA 4FINA 1NVBA 2IZ6A 3A1EA 4AY2A 3FSRA 4Q66C 5AVQA 4HLUA 1X7ZA 4OI1A 4AICA 1JR3A 2FB9A 5BYJA 3T1HB 1PX2A 3IUQA 3MOGA 1NURA 5ED4A 1PV4A 3VR6D 1E1YA 1E3IA 4MUYA 3ZZUA 1KKMA 4HHEA 2O8EA 1SXJC 3OY7A 1GD1O 4RZQA 3VR6A 5BV0A 4HB0A 5AHXA 1BCRA 3U3MA 3LQRA 3A4NA 2ZJ7A 1A9SA 3FFXA 3I5AA 4KVFA 5FHQA 3R23A 2CLSA 2QENA 1OQAA 1AGRA 1V11A 1U80A 4R3NA 3LZDA 1O95C 3I04A 3KJFA 3SSNA 4AJKA 4QAQA 1E1QA 4S12A 5CFOA 1F4PA 1MRNA 2LWIA 3Q0TA 2EDCA 1XELA 2FSFA 1E4EA 4KQ9A 4GWLA 3D0KA 4XPZA 1NMQA 3ES9A 1Y37A 3PNVA 3QQPA 5EQFA 4YV2A 2QTZA 4LYFA 3V3TA 1E6KA 4TS1A 4FGSA 4EHIA 3HFJA 1O2DA 3T7JA 1YAHA 1AB6A 1LFDB 1JQLB 3N59A 4B3SB 2CKDA 1CJCA 5PNTA 1GAWA 2QW1A 4MRAA 5BWNA 5IEJA 5I9NA 5LQNA 1I7PA 3TNYA 3IE0A 3RB8A 1OI3A 3OEWA 3SVTA 1LS6A 1JSZA 2Q5CA 3L4EA 3EXHC 1P17A 1Q74A 3IVXA 3L7YA 5C8YF 1WOMA 1XTRA 2WUEA 5IK2D 1JS1X 3A1DA 2Q62A 3V1KA 1P3Y1 4JVMA 2BFDA 2WM2A 3OOHA 3GBVA 1YCDA 4UVDA 4XGQA 3E9NA 3LX4A 4G0QA 5KYVA 1K06A 1XCJA 2FWMX 3A6FA 4JR0A 4OD0A 1VE9A 1PFVA 3IAM1 3KEMA 3U49A 4M22A 1L4KA 3DTYA 2QB5A 521PA 4HEA6 4GBMA 5EI5A 1M2KA 3TCKA 3ZDZB 4U6SA 5JDCC 3OE5A 3D4OA 4KO2S 1ZC3A 4L22A 3WHPA 3QNWA 1WCXA 2GEBA 5FLYA 4J7XA 4BQFA 1XU9A 3DE4X 3ABIA 4RORA 3V8MA 3WGUA 1MN6A 5ECGC 4D8VA 1ZAYA 2GAJA 4NXMB 1L7QA 4A23A 3U3OA 1I9CA 2EF0A 1XRQA 4HNQA 1QH9A 5ALXA 4C6RA 1F2DA 1PR9A 1SQFA 4DV1B 4F96A 1FDOA 2P3LA 2YFKA 2V97A 3KUXA 5CXUA 4I14A 2QUKA 3CUTA 4NH4A 2NUPB 3VVBA 4ZCMA 2Z8YA 1Y5LA 3C5WP 1MB4A 5D5QA 5CFZA 5M04A 1NUAA 5ERYA 1OGYA 4W1SA 4DL9A 4PLYA 4AJ4A 4TQUS 1Z47A 3G0IA 1GQRA 3B8HA 3TD6A 1QHYA 4UUPA 4JELA 4DAEA 1NDHA 4P7FA 1TJYA 4RXUA 5DSXA 3U4DA 2GPWA 4YV0A 1H2ZA 5DBIA 4PNHA 3LP5A 4GG1A 3G0HA 3FYUC 3PFKA 2ZJAA 2C4HA 3T99A 3TMKA 3VR4H 6Q21A 5LMNB 3DAYA 3EWAA 1D7AA 4JCCA 4MUEA 1KJIA 5EJMA 1JEQB 3M6AA 2NUAA 1QE3A 2XZDA 3ZV7A 3PFCA 4E0BA 4EMBA 2E4AA 3RGWS 3VU3A 1J8DA 3E9QA 1L5WA 3NGMA 3U7JA 3B3FA 4W1QA 4QYXA 3WV5A 1AQJA 2V4MA 1P1HA 3E9RA 3ZNPA 3CG0A 4D4GA 4KE8A 4QBFA 3W79A 4JODA 4URFA 2PA3A 3ZI0A 2GXUA 1VHJA 5E2AA 1M75A 1QCYA 3H1TA 3SIWA 2X1LA 1OY1A 4UMDA 4ND8B 1KZHA 1CY0A 2CZGA 4Y6PA 2GYVA 3Q6IA 3ZCTA 4EFNA 1ZL2A 3OF5A 4R8VA 5TQVA 5HZHA 4P4SA 4UM7A 1P1RA 3PD0A 3L7JA 1CR4A 1M1NB 4DCUA 1UPUA 3BGVA 1E98A 2NUTB 1TK2A 2V0CA 2E5FA 1TCUA 3ZWBA 3T3GA 1RYBA 2H3HA 3NTXA 1P2BA 2QW0X 2G1JA 3MCAA 2GVNA 1EFLA 3D3QA 3VR6H 4BNTA 2C4NA 2A0FA 3MPOA 3TQCA 4CKBB 3HA2A 2SNIE 3QEMA 4PFKA 3RG8A 3U09A 4L9SA 4TL8A 3IQDB 1N9GA 1GG5A 2GLXA 2PPVA 2NO6A 5B3AA 5BN1A 4G25A 3KWFA 1C8LA 4GZ3A 3AF1A 4NV1A 1S1CA 1J9ZA 1K5PA 2ZBVA 2OFPA 2Z08A 4IIJA 4RK1A 4WXRA 4AB1A 4FFBB 4KK4A 4JU8A 3UMMA 5EKDA 2R7LA 2J67A 3HBAA 1R4MB 3AKYA 2C2XA 2F3SA 4AIRA 1E63A 1THTA 3KKZA 1GVNB 3E3OA 3ASVA 3C6QA 4UBMA 1PR0A 1CUZA 1I30A 2P67A 2W2NA 3I6ZA 3JWGA 5JYEA 3GJSA 4WX2B 3MMPA 5HBRA 1RLMA 1VJRA 1UWCA 1TO6A 2DLDA 2FUG1 2PX2A 2RAPA 5E9QA 1B26A 4L9RA 4XYBA 2G5PA 2RGXA 1J56A 3HUUA 4QIHA 3R5TA 4HDKB 4CDNA 3FHJA 4GD3Q 1MOQA 1FTNA 3R7WA 5I8ZA 4ENPA 5DNUA 5HIAA 1K7SN 3P26A 3TNDA 4WBNB 3UFBA 1E8MA 3WLIA 4E3WA 1JPVA 2CXNA 1ZGZA 2ZTMA 4FOOA 3TIFA 5HCUA 2BGIA 2NX2A 2W2VA 2P2YA 3X1DA 2QQFA 5JHHB 3QU7A 4WN9B 2WPDA 2RJOA 1EGQA 1SIWA 1SKAA 1W4LA 3OICA 3TW0A 3ZE8A 5JQGA 1Q0RA 1NNUA 2GK7A 1EJ0A 1Q1QA 4UBJA 2ZEJA 4BAZA 3LUGA 1BQ4A 4OJTA 4BNFA 1ZJYA 3IIIA 2GB4A 4KI7A 3RVSA 4KAFA 4KRYA 3D0QA 4JLPA 5KTRA 4NQZA 3ZW9A 3AIKA 5IEBA 2I65A 1EZZA 1KI4A 2Y71A 3WL4A 3JQ9C 4BLQA 2IZ0A 2RJNA 4YROA 2WR8A 5AQEA 3WK4A 4KKVA 4XJXA 2VT3A 4K0RA 2DBZA 5KVSA 6ADHA 1FFBA 4L02A 5FBRB 4YMGA 1NQVA 2H2IA 2V4ZA 4I8DA 4NI5A 4PG7A 4DIDA 2X2EA 4Q34A 1PLJA 3EMDA 3NP7A 4ZARA 3UT5A 3F0TA 4W63A 3DZHA 3MC1A 4GOXA 4GSLA 3BWVA 3W8NA 5FEUA 4XGRA 2YINC 3UJCA 1TOAA 1SBHA 2VAPA 5A4FS 3DBLA 3V2UA 4CQJA 1GU7A 1OVGA 5I9MA 2ZT5A 3K1YA 4MKFA 4ZYWA 2W2QA 4NC9A 3EC1A 5ADWA 1L7EA 1B23P 4UAUA 1G20A 2QE7D 5ALZA 4MYRA 2J45A 3HB1A 1OAKA 2P62A 4UOZA 4YXWD 5ADHA 1H2FA 3RUPA 4AVYA 2GZAA 1W34A 1OSNA 1E3QA 2UZAA 5LP6C 5CB4B 2QE7A 3FDZB 2WZCA 3AR7A 4H7PA 3W9UA 4XDHA 5IFKA 2QNBA 2DFPA 2CVZA 4M87A 2FSGA 4GOND 1RWOA 2O8NA 3CX3A 5DCWA 4ZVVA 1MCZA 4INJA 4XA8A 2H85A 1GN8A 2AK2A 2NQTA 1KK3A 1FW8A 1W4AA 3D2AA 1M0EA 1LXCA 1BD4A 3AM1A 4F86A 5B30A 3CT4A 4L5YA 2AOWA 4LS3A 3TRJA 3EUAA 3HP1A 4KV9A 4MA5A 1VJ1A 4U9IS 3D43A 2ZIZA 2JBWA 4DMUB 2P4UA 4URZR 5KWVA 4PHTA 3QFRA 3HEMA 2NVBA 4FSDA 5DF1A 4E5NA 1ZH4A 5AM4A 2CBZA 4DGQA 4Q3BA 4Q4HA 4BQRA 4AXBA 3BB1A 1O57A 1RXYA 1T9AA 1ZOIA 3SFZA 3IT1A 2JIRA 2XWQA 5FOUA 1QHNA 3B3GA 1HYEA 4I2NA 4O59O 1T0HB 1TGYA 1Z0DA 3BJEA 1XZEA 2NTNA 3S55A 1LPPA 3MERA 4FGZA 2BFMA 2GSDA 5LWQA 3JV7A 5CCXA 1Z6QA 1EJ2A 4PAQA 5CB8A 4WXPA 3PYMA 1TFRA 4XIIA 3AFMA 3SD7A 3RK0A 2XKAA 5CAEA 2YH2A 1CUXA 3LGSA 5JJBA 1WDKA 1Z74A 5JUWA 4UZEA 3RAEC 1OZFA 3D0OA 4LQLA 3C16C 5DW0A 1P7VA 3O31A 2XXJA 4MUNA 2M1XA 1T8UA 4NDZA 4QU8A 4UM8B 3ECSA 5LBIA 4V0RA 4RAQA 3OECA 4ZQIA 4DT1B 2KHZA 4R2IA 4IOMA 1PEAA 3A31A 4ZI7A 1DWQA 2G28A 4JLAA 4U4AA 2IVFA 1KMIY 2HCJB 4DQUA 2DPHA 1ZP6A 1F8XA 2HA3A 4TL7A 3T3DA 4EYEA 3M9XA 1WBJB 4EFKA 3PDIA 1QKJA 4MV1A 2PUEA 2R5NA 3MNFA 1ST3A 4UUBA 3TLYA 1XYGA 2EATA 3VU1A 4Z4FA 2H5LA 3NTRA 2WTNA 2QLTA 3F47A 3KUDA 2GJSA 3JD0A 4I7EA 1G3UA 4D4JA 1T24A 4ENQA 1E9AA 1M10A 4RDCA 5C8ZA 3GWZA 1CX9B 4LGVA 3EUEA 3B1WA 4KYIB 4O08A 1W1IA 3RWMB 3AV3A 4JYCA 2GHQA 3N28A 1X8LA 5ICMA 2JJYA 2OCGA 4YA6A 3S29A 1DEOA 4I55B 2J6CA 3H0KA 1Y7IA 3M82A 2G4VA 2DFNA 4UEJA 5DO9A 2X58A 3GGPA 4S35A 4WESA 3VMFA 3WBJA 4DWOA 4RHYA 5JSZA 3RUDA 3I12A 4DLKA 2VCHA 1PSDA 1GN9A 1KIAA 3PT9A 2QD1A 1IZ0A 4OI4A 5DBGA 5EZSA 2FQXA 1AXRA 4M1ZA 1U3TA 1U7WA 3U7IA 4JGIA 4YT2A 1QRTA 4E09A 5D3MA 1RM4A 4FM9A 4DCPA 3FRJA 3BIXA 3L8CA 3G5TA 2I2FA 2V7EA 1I7NA 4BNYA 2ZYGA 5AW0A 2D5LA 1Q0QA 1PTKA 2R9VA 2WWGA 3MCVA 4G1CA 4L28A 2HU5A 4LXIA 4JI8B 5DNAA 4AQDA 3KTDA 3NAGA 4TYNA 1SBYA 1MA3A 5BQ3A 5KIAA 1KO7A 1E60A 4FEGA 4MVYA 2Z6UA 1I32A 3LFUA 2IEBA 2P1DA 4G4GA 3RT9A 3KQUA 4RMNA 4YMHA 4TGLA 2VUIB 3ETGA 4OHCA 5IJWA 1GTVA 5I7FA 5JRDS 3JQCA 3C14C 4US1R 2QDKA 2RK4A 4K28A 1U8XX 4UCFA 3IP6A 5KX5F 4WW0A 4WA8A 2FN8A 1WBDA 4KP7A 1MZVA 2H4ZA 4OSPA 4U3JB 3FI9A 3S1LA 1F7VA 4OHMA 1XAJA 1QS0B 3C7DB 4MUKA 4MW6A 5H1YA 3LX6A 2OXTA 3ILVA 3KB6A 4KYUA 2Q1SA 3NIBA 1S9HA 2YHIA 3PXEA 4JT8A 4HBZA 1C2YA 3R1IA 2ZB3A 4EENA 3EXFB 3T7IA 1RAHA 3SHWA 4AZ3A 1G3IA 5KYWA 4TLBA 1EDZA 3WFIA 1IYZA 5KHOC 1EUCB 5A7HA 1Z5UA 3ZV5A 3E2PA 2GN9A 5TPWB 3K0FB 1UBFA 4Y2VA 3SR3A 3UHAA 2I4TA 4H08A 2W2PA 5FLEX 1XOIA 3VNVA 4ESEA 4LOKA 3ZXIA 4C30A 5EFZA 2WKWA 4BB0A 2ACKA 2IYLD 1JAXA 2QLBA 3IDOA 5E2BA 5C37A 3T95A 2ONCA 3Q8WA 2BVNA 4RS3A 3V55A 4GM0A 3GJYA 2I6XA 4Y6GB 2C5EA 1IFXA 1BEUB 4YASA 5GIOE 1NE2A 2R1VA 3JARB 4JEMA 2GJ9A 3R5XA 3RU2A 1WCIA 4CLRB 2NMVA 1Z7EA 1OFGA 4Y2GA 1RRGA 5IVHA 4YQEA 4DEYA 2VBCA 1PWYE 2GPAA 1U0FA 3GAMA 2YWXA 5NLLA 4LJYA 5CTJA 4YQZA 2A5FA 1YVPA 4IMIB 3N39C 1B00A 1CUWA 4J91A 5ILQA 4ZYXA 2CCKA 2AXPA 4HQLA 2FPPB 2NO1A 3NETA 4F72A 5IASA 3ENVA 3K5HA 3LCJA 1L7NA 3FPFA 2NVUB 3ZHOA 1O0BA 2CDBA 3JWEA 5JARA 1ZVJA 4X1YA 1K7YA 2A7XA 4C6TA 5K6TA 5JYCA 2HIHA 3RVMA 5EJ8A 2FUKA 1KJ9A 3G2JA 3T1NA 5HXAA 3VNSA 4JDUA 3R6WA 1J23A 3GL9A