3DE7X

Proteinase k by classical hanging drop method after the fourth step of high x-ray dose on esrf id23-1 beamline
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de7X00
3GCWA 1SCDA 1SUEA 1AVTA 1TMGE 3LPAA 5JMOA 2ST1A 1TM7E 1OYVA 1SIBE 5SICE 3VSBA 1V5IA 2WUVA 4H6XA 1Y34E 2Z2XA 2V8BA 1SCNE 4C3UA 4M1ZA 2WUWE 1T1GA 4H6WA 3A3OA 3I2YX 4ZARA 3SICE 1NLUA 4JP8A 1SBCA 4J94A 2ZWOA 3SQOA 1BJRE 2Z2ZA 3F7OA 5ARDA 1SBIA 3VTAA 3DW1X 4DZTA 5JXHA 3F7MA 4H6VA 1KE1A 1CNMA 1WMFA 1XF1A 1MEEA 3DE6X 5AMXA 5ARBA 1R64A 1Y48E 3LXUX 5CW1A 3DYBA 3TECE 1SVNA 1SIUA 1AV7A 2IY9A 2WWTA 1DBIA 2PQ2A 4WOBA 4KPGA 1NDUA 1GNVA 1WVMA 2XTJA 2PYZA 3BPSA 1SUCA 2W2NA 1SUPA 3CO0S 1THMA 1LW6E 3QTLA 1PEKE 3BGOS 1R6VA 1T1IA 2SICE 3DE7X 1SCBA 2Z2YA 1WMEA 1C9NA 1GTG1 3LPDA 1SCJA 1SPBS 3EDYA 3DE3X 5FBZA 2Z30A 2B6NA 2XRMA 1SBHA 1P7WA 4FONA 3CNQS 2HPZA 5AVJA 4OV6B 1TO1E 1DUIA 1GTL1 1Y4AE 3DW3X 3AJ9A 3EIFA 1BH6A 3PRKE 3QMPA 4NE9A 2Z57A 3D9QX 2Z58A 3Q40A 3I30X 3OSZA 2SNIE 3I37X 3DVQX 1PFGA 1TM3E 1CSEE 1Y33E 3A3NA 3AJ8A 2W2MA 1S02A 3GCXA 2ID4A 1Y1KE 2GKOA 1EA7A 1S2NA 3F49S 2IXTA 1AU9A 3DE4X 2X8JB 3H42B 4HVLA 2DQKA 4DJ5X 4MZDA 3P5BA 5K7SA 4B5LA 1C9JA 3QFHA 1WMDA 3DVSX 1OYOA 1OT5A 3DE1X 1KE2A 4KG7A 3DDZX 1SUBA 2ZWPA 4DWWA 1YU6A 4NMXB 1TECE 4Z2AA 1P8JA 4YN3A 1GA6A 3BX1A 2QTWB 3DE5X 1BFKA 3LPCA 1EGQA 1SUDA 1GTJ1 2W2QA 4NE7A 3VV2A 3DWEX 3ZXYA 2PMWB 3VHQA 4C3VA 1GA4A 4LVNA 2W2OA 3GT3A 3T41A 3WHIA 4WOCA 1PTKA 2E1PA 5ARCA 4AKSA 1SIOA 5JXGA 1Y3BE 1SH7A 2TECE 1YJAA 1ZVJA 3PTLA 4HX2A 4OMCA 2G4VA 1AQNA 1KDVA 2PWAA 1AH2A 3WQBA 1S01A 4LVOA 1A2QA 1Y3DE 4AKTA 5JXJA 1P7VA 1AK9A 3WIUA 1IAVA 2X8JA 1C9MA 1Y3CE 1BE8A 3Q5GA 4CFYA 1BE6A 1C3LA 2P4EA 3HJRA 3TI9A 2DP4E 1KDYA 1TK2A 1VSBA 1TM4E 3AFGA 1T1EA 5AVKA 1ZVKA 2SBTA 1WSDA 1ST3A 1R0RE 1ST2A 5AQEA 2ID8A 1TM1E 3ZXXA 2SECE 1GNSA 1Y4DE 4ZOQI 1YJCA 2Z56A 5JXIA 1AF4A 1TM5E 4I0WB 1Y3FE 1SELA 3D43A 1YJBA 1PJ8A 2DUJA 4KB5A 3DE0X 3L1KA 1IC6A 2PWBA 2PRKA 4CG0A 2PKCA 2W2PA 3A3PA 1NDQA 3DE2X 4BWGA 4GI3A 3WIVA 3VYVA 3GT4A 1MPTA 4OMDA 1KDZA 1HT3A 1V6CA 2HD4A 5FAXA 3UNXA 4RYDA 3DVRX 5I9SA 1SBNE 3EE6A 3VV3A 2ZRQA 4CFZA 3TI7A 1GCIA 1SUAA 1Q5PA 5B1DA 1TO2E 1GA1A 2WV7A 1JEAA 1UBNA 4K8RB 1Y9ZA 1SN7A 1BFUA 1GT91 5B1EA 3I34X 1SCAA 5FFNA 1SBTA
chains in the Genus database with same CATH superfamily
1C41A 5JNUA 1W34A 1Q7TA 3FDFA 1YBVA 1Y1QA 1E0AA 3NONA 5A9RA 1NN3A 2JH3A 1T26A 4LDQA 4P8RA 3EISA 3MK31 2EOAA 3R3WA 4ZU3A 1XD2A 3GGCA 1A96A 3I9KA 3O6VA 1I3NA 5LLTA 5ISMA 3GGJA 3L4BA 1NFFA 2GI4A 2PZLA 3ZPXA 4WBXC 1M76A 2QDKA 4M6WB 4P3KA 4U39A 4X92A 2AT1A 2GPJA 4K9MA 5JMPA 3VXKA 4Q7EA 4HLNA 1EFVA 1T2VA 1UKAA 3ORSA 4PRYA 5BV0A 1DX4A 1B0AA 1OXSC 2I65A 4KXMA 2HKIA 5G02A 4EY8A 4XAQA 3U48A 2UZ1B 2F1OA 2VYQA 3H6HA 3UW3A 4ETWA 1RWXA 4D9EA 3IVXA 3JRWA 3LBAA 1ZSNA 5BWOA 2FUG6 4CL2A 3S1AA 1KEKA 1ND5A 2DPHA 1GCUA 2NYVA 4B74A 1PEYA 1CP2A 2P79A 3AM3A 2A84A 2GM3A 5DHAA 2WE7A 1GSIA 1HT1E 3N2GA 2A9RA 3DZHA 1ZCJA 2ZK7A 3BRSA 2RGNA 2X5NA 4ZCQA 3WMEA 1XTSA 4FFMA 5K9ZA 13PKA 2CE7A 5J63A 2D5BA 3VMFA 1SVUA 3RUDA 1HH4A 2I3DA 1G9XA 4BP1A 1JQBA 1WSAA 3I76A 4G97A 1REQA 1TA4A 4GOLD 1S8NA 1B3BA 3IHKA 4LSZA 1Y6ZA 4O63O 5DV9A 4F04A 2HRQA 5CXUA 3M9XA 5KS2A 4ARCA 1SKBA 3QM1A 4DIFA 1G6OA 3ZLBA 3CR8A 4PYLA 4EPWA 1EEHA 4CKZA 3EASA 2QLMA 1JEQA 1KMIY 3ZZUA 4HV4A 1YU9A 5EJGA 3QFCA 2ZAOA 4RVNA 1UEXC 4U0JA 4EYKA 2WTNA 4DC0A 4DCGA 3DZDA 3HMQA 4QEZA 3DW1X 5LNK6 3DTTA 2JB9A 4JHLA 1E9BA 3ZWQA 1A9XA 4GLLA 3BDIA 4JJFA 1RM3A 4DIDA 3KL2A 2PKQO 3AL0C 3IPAA 4YBRA 1ML4A 3JWHA 5ILGA 1TEXA 1KE1A 4KC0A 4EDFA 4B3MB 1QAQA 3WYCA 3KZOA 1OMOA 4NULA 1X7XB 1MCZA 4HK4A 2VK2A 4RM2A 1PVDA 5I6DA 1ISGA 2B1QA 3DE6X 1N2EA 2E82A 2Q50A 3DOCA 4C4XA 5KWEA 5ABPA 1XMOB 3PC6A 3UTCA 2C00A 1YUNA 1S2OA 3LXUX 3F9CA 4XOIA 4DG8A 4II3A 2F3QA 2CD9A 3LP5A 4BUCA 4XCXA 1L8OA 4OLBA 3KR9A 1D2MA 1WXIA 3WWZA 3V8MA 3SP1A 5EUBA 1M7HA 4OBXA 1LI4A 1QR2A 2BZ0A 4BDTA 2EDAA 2ISSD 3HL4A 3BK2A 2IYNA 4JMPA 5J4VA 4LBZA 2WWYA 3C3EA 2RHDA 1A8PA 4N9QA 3IELA 4DPKA 2XF8A 1LSUA 4DV4B 3QEOA 4XYBA 4IMPA 2ZUTA 1E98A 2ZRMA 1NV9A 4BFWA 1M34B 1Z0SA 4E4TA 2WTAA 1WZEA 3NBQA 1QRSA 2WYWA 1SQ5A 2JFVA 3I3OA 3P8ZA 4G1VA 3AV0B 4ZO6A 3ZWAA 3ZQJA 5AKHA 5JAUA 4K40A 2MHCA 2BMFA 1VPTA 1U7UA 1U11A 1NZDA 1JDUA 1KJ8A 2GCPA 3AIMA 3D6UA 5A9TA 3X1YA 1EFRA 4QFBA 1NLFA 1L7BA 4CQJA 2C7VA 3PFGA 4CUJA 1BXKA 4R71A 4XWOA 9GPBA 1JG2A 5J9FA 4ALMA 1XPRA 2B8TA 3FMFA 1VG8A 3MWJA 4MKIA 3RADC 1SVMA 3AB3A 3B6MA 4ZHQA 4CEHB 1SUFA 4ZODA 3SEZA 3QBJA 4EF6A 2O8CB 1P33A 4ZRNA 5B1SA 2MOKA 3DLHA 5IF9A 4Z1MA 5AM4A 3KE8A 4KDEA 3PQ2A 1IUOA 3SIWA 4EENA 4PEVA 3MPOA 1V4NA 2BFBA 2RMKA 1PQWA 1UBHS 2NNWB 3BMXA 3PD7A 4UATA 1W9HA 3KXDA 4C20A 4UEWA 1E0SA 1RQLA 4MB2A 2ZPUA 3GN1A 4TXJA 1NUPA 3INRA 1QORA 2WR8A 1VJRA 4KWIA 4M55A 4UXHA 2H2DA 2IOHA 2WMOB 4RZ2A 5LMZA 3OPYA 1NSTA 2QNRA 4FGZA 2UUCB 3KKLA 4YUYA 2XRMA 1ITZA 1XFAA 2VDKB 2JJYA 3I0ZA 2MWMA 5CDHA 3IVGA 3OEED 1NI4B 1N7IA 3V8RA 1AO3A 1KOJA 3EXIB 4LJRA 1QHEA 2R6ZA 2Y71A 4Q05A 1QBGA 2Q0HA 1FTWA 4I19A 2VJYA 4JJ7A 1YMVA 1ULUA 1ZU5A 1OB2A 3KPJA 3RC7A 1B0PA 4UEOA 2QN9A 4GT1A 1I7QB 4BMZA 1ZD1A 4OIFA 1KEWA 2GKSA 5EJEA 3Q7RA 3CWCA 3K9BA 4F3NA 4IIDA 1TT7A 4L08A 4PAOA 3TZ6A 4G5RA 3DMRA 1FYVA 2EX4A 2PBLA 3JRXA 4AMYA 4PSDA 2J5BA 1OD6A 3KB2A 5JAPA 2QUJA 3DGFC 2JIDA 5T57A 3ZDBA 3PZRA 1MQ9A 1YF3A 2JLYA 1I13A 4RUKA 5L3ZA 3I92A 3JZMA 2C3UA 3KU1A 2J3EA 4LG1A 3LKBA 1ODCA 2C77A 2R8PA 3AI7A 4MV9A 4NZ9A 3N6VA 1QB7A 1BHO1 1VE5A 1YB6A 2PZEA 3RGGA 1UPBA 4AN4A 1DO8A 2VTDA 1KL7A 1QQ6A 3OFSA 3BOSA 3PKZA 4G2TA 3HU3A 3RUHA 3GWGA 1V8BA 2DR0A 3IVAA 3NNNA 4MVJG 3BMQB 3FPJA 3LDHA 3AVWA 4DY4A 2G6BA 1S3FA 4ILEA 3PRYA 1AA6A 3I37X 2I80A 3R6GA 4M8NE 3JVUA 4ZVSA 2NNLD 3UG6A 3HK2A 3GMIA 1WCXA 3E3OA 2AZ4A 2CFCA 3B2QA 3L9WA 2EWWA 2H0AA 4YROA 1K5PA 5C80A 3B20A 5ALGA 4Y2QA 2VVTA 1EHCA 4PLTA 3I8SA 4C06A 2A3NA 4G07A 1NURA 2NTYC 3BAFA 2A5JA 3UOAB 1CU1A 4ZZ3A 3GCXA 4M1QA 4XB1A 1KQGA 1YULA 4EL5A 3R5KA 1U0OC 3HJHA 3R44A 1ZCAA 2NUPB 4MVJH 4OM8A 5JO9A 1A4UA 1K8YB 2HSDA 2F43A 4X93A 3T7SA 2AFIE 4RETA 4M22A 1ZD5A 3T61A 4EGJA 4EI2A 1IIRA 2OV4A 3EDCA 4CMIA 4QXPA 3V7WA 4U6NA 3D8NA 4MQUA 1EFPB 2BFDA 4DB4A 1B6TA 1YHNA 4GPEA 2CXSA 5FTWA 4UHHA 4CCYA 5FHQA 1MGPA 1JU9A 5IT0A 2IC5A 2PVSA 4X1KA 1FDUA 2VP6A 5BXYA 3QELB 1XZJA 1KHTA 4QGBA 1HDOA 3T0IA 3PDJA 1JJVA 1NW6A 2WYUA 1A4RA 1BU5A 1PZGA 1Z28A 2X8JB 3RTCA 2A7XA 3W9YA 5BQ3A 5M04A 3GEEA 1X3SA 4TWIA 5LBUA 2HIHA 1RXEA 3IEIA 4P81A 1OWOA 1MUUA 4OQPA 3LM8A 1T6YA 1RMYA 1WMDA 5JI2E 1IY2A 2W42A 2IRWA 4BZQA 1SCKA 4CKXA 3OP1A 2O8FA 2I0FA 4LE1A 1B7GO 3M82A 4IMIB 5TQ0A 1E60A 1U8AA 5H1YA 5JARA 4XGRA 1QIJA 2OM6A 2YYZA 2PX8A 2OFXA 1XRJA 2HPAA 4Q1CA 1YL5A 3LYAA 4QO7A 5B2FA 4BKMA 4UTOA 2ZDGA 4X66B 2YHIB 1ISPA 4INOA 2GZSA 4Z1OA 5FUMA 2W4IA 1FU7A 1FCJA 4MUYA 4E5SA 6YASA 5J2UF 1YU6A 1Z2AA 3IT1A 3CVXA 1OH6A 4R0NA 4LY9A 1F4PA 3CH6A 4TKUA 2OK7A 1UWVA 2PZKA 1DJNA 1Y8RA 5EJ4A 1USVA 3O8CA 4XA8A 1KAOA 1R6UA 4D80A 4NEQA 1TYEB 2CL7X 4M89A 4C3OB 1K75A 2OXRA 4WLUA 3FFWA 4TWAA 4NENA 4GVLA 3OT4A 1DAGA 2D00A 1DTWB 1GDTA 4NG4A 3O4VA 4JA0A 4YCLA 2G9ZA 2ZBDA 1VL0A 2OXTA 3RVJA 5JV5A 1XSEA 1ISIA 4L1KA 4JXJA 4EGSA 3KJGA 9LDTA 3PTAA 4NX2A 1U3DA 3R7WB 4QEKA 3N2YA 4RDIA 4KQFA 5GJBA 1ECFA 2JGEA 4Y0AA 2Z1DA 3BWDD 1Z0IA 3V4OA 2YWRA 2Z9DA 1E2GA 3EGWA 4Q47A 3EQ9A 2F4VB 3F1KA 5LWQA 3MTBA 3T5CA 4IEFB 1A5SB 5JFTA 5DF1A 3S8YA 1J07A 3ZWCA 4JYCA 2FPRA 2DETA 1CLEA 2GX6A 1VI2A 2CJYA 2HXGA 2PYIA 2SHKA 2XDAA 3FETA 4PQYA 1NSFA 4YAEA 4D4HA 9LDBA 2O0MA 3SS9X 3KEOA 3PTLA 4OMCA 1TMKA 3OA2A 1RZRA 5IYZB 4X8HA 1TQHA 3ZYZA 5M7EA 2F8SA 1DCFA 4MRMA 4CMJA 1DCTA 4LFBB 3EMDA 2YW9A 3OPMA 1V1RA 3FBGA 4RKYA 5DVZA 4MV1A 5A0TA 2FA9A 2AV6A 2AN4A 4DVJA 1UJBA 1OFUA 2PRSA 3IAAA 3KPVA 3EZFA 4PHFA 5JXJA 1YTUA 4FHDA 2A67A 2VR1A 3OTOB 2IW1A 3OH8A 5I7OA 3TLJA 2BF7A 4IUBS 4DGSA 1FSFA 4EP1A 1H93A 1K6MA 1WF6A 2P9GA 4D0SA 1A9RA 4I9GA 3P5SA 3MTDA 1U8UA 3A31A 3AR9A 3CNNA 1MX1A 2VJNA 1YV9A 2H85A 2F6RA 4M1YA 4HP8A 5EIOA 4WUVA 2A0UA 3KKMA 3LNTA 5FA8A 5J5AA 1NJSA 3OD5A 1UWKA 1IU9A 3KUDA 3FPGA 5AW6A 5KVAA 1KKUA 1AKYA 1BX0A 3IB3A 2OAP1 1UBSB 3DZGA 3R0IA 1T8TA 4ER0A 1B0UA 2P3SA 1WM1A 1XCBA 5IP5A 4PG8A 4IUCS 4NAUA 3RHFA 4DKXA 1MNQA 2GXQA 3ELUA 4L72A 5K6AC 1VJDA 1KI6A 3A27A 2WAAA 4M53A 5DH9A 1ZMRA 1E0KA 3OF5A 4B47A 4G8JA 1QZZA 3TQFA 3CIOA 1M2JA 1J0CA 1LWOA 4GX5A 2E37A 4JL6A 4K9PA 3WGHA 1ZMOA 4JP5A 3ZYCA 3EPRA 1V9SA 4AFNA 2BZSA 2QVYX 1Z6PA 2JG3A 4ZMSA 3ETHA 1Y9EA 2ZJ4A 3ODGA 1GPBA 5E1MA 4CF6A 3IP6A 4KXUA 5JXIA 4BNXA 2X6RA 4BUZA 2VZ0A 3DO6A 3OOJA 4NBLA 1IBKB 1C0KA 3WX0A 3EEBA 1G20A 2J6HA 2CNDA 1UJNA 4URFA 4I0WB 2RGYA 2HUPA 5E6RB 2WFLB 5BOVA 1TZ2A 4BX8A 3RS0A 5TNXA 4A8TA 4IGAA 5CPFA 5KMGB 5MF6A 5AKXA 4C7KA 4BHTA 2ZJ0A 4DLSA 1IG3A 2Q21A 2QR2A 2ZRDA 3HKBB 4WEOA 2N47A 2ZTMA 2XRZA 2YV1A 7REQB 5LIPA 4Q1VA 3QFRA 1GGNA 4MH0R 4X8OA 4F38A 1TCUA 3QU4A 1V11A 4PBTA 3I39X 4RC9A 5HIKA 1ATIA 1OAAA 1PIWA 1OREA 3QPUA 2QMOA 4ZQFA 1QRAA 4N12A 2OC9A 1OX4B 2PXCA 4TTIA 4UU7A 4XDHA 4KREA 4RLHA 3E1KA 1H2FA 4GBMA 3DL4A 3JD4A 4K7JA 3BF8A 4UREA 4DHWA 2X22A 2D1FA 5AKYA 1L7RA 5H9VA 3JTEA 4C21A 4CLOB 3QPAA 1K5DA 1YE5A 2IZ7A 2J9RA 5J59A 5FUQA 4H3VA 3N70A 4KX5A 3TLYA 1GU1A 2BGMA 1KARA 2CLOB 2DTEA 5C3MA 2BGRA 2BM8A 1X9HA 2WTMA 3DKIA 5GVSA 4K9RA 2EQ5A 1RCFA 2NZJA 5H7XA 1ZOPA 4X90A 3VHXA 3RC9A 3P71T 4GKJB 4BNFA 2DH5A 1L6RA 4Y2PA 5A1JA 1EVIA 4KR3A 4DEVA 4PYJA 2GAFA 1BWQA 5LMUB 1BSVA 2W6MA 3BTOA 3ORRA 1CQXA 4JJ8A 4N6OA 1QBKC 2ZYUX 3K0CA 3PSAA 2OMEA 3GJYA 3UF0A 1NUUA 1U0SY 4EG3A 5BSTA 1ULZA 3BXXA 3FJOA 3NWEA 3GEGA 1U02A 5H3CA 3ONEA 1AB5A 3UMCA 4ICIA 1LF0A 3QYAA 1TZBA 3V8PA 4BATA 3CFYA 1W2GA 2P67A 4OFZA 5BVGA 3PXEA 3P4YA 5EJMA 5FHRA 3VV3A 4D81A 1EK1A 2JAQA 3IXLA 3CRZA 1KDTA 4PPYA 4ZANA 3UJCA 4GR9A 3LX8A 4YQFA 3LOUA 2I3GA 3T9FA 3T0GA 3W2HA 1P75A 4G84A 5T7BA 1ZU4A 3G6WA 1PJAA 1J00A 2AFHB 3O3CA 4D7AA 4CXMA 3E82A 4IZIA 2AQHA 1A1VA 1MJHA 3AI1A 2CD7A 1QDUA 1RM4A 3G0IA 3QP9A 1GPDG 1UK8A 4IV8A 4L74A 4LHWA 4R54A 3T4EA 1I3MA 3O74A 4K9NA 5BW4A 2R1UA 1Q0UA 1CG6A 3DBRA 4Q4HB 2H54A 4LXYA 4Z0TA 5B1EA 1YVRA 3CT4A 4QG7A 3C6YA 2G0TA 3I2GA 1FUYB 4YJFB 4K0KB 3IUQA 4EKNB 3LCUA 2GWHA 4AAYA 4IO1A 1ZR2A 2LZ0A 3KAQA 2R3SA 1VI5A 5CLHA 1SUEA 4GL4A 3VAYA 2XYVA 4NZOA 4B46A 1YR6A 1DAKA 4IFEA 1YHZA 3IJRA 1S8AA 4RADA 1QRTA 1KNXA 3A0RB 1PBNA 2FFBA 5LB2A 5I9IA 1I7LA 4HN4B 2J5RA 4R5MA 4A2QA 1RVDA 1VYUA 4GUAA 5EJ5A 3FCYA 2ZM5A 5A0FA 1V5IA 5DDIP 4F3RA 1WW3A 3DM9B 4H7HA 4HPWA 4M1SA 3K92A 2BI4A 1SHZA 3P96A 4J29A 3OECA 4PSAA 4QASA 1WZIA 1UM8A 1PYGA 4DNXA 4HDSA 4BS9A 3O03A 1XU7A 2ZATA 2ZAGA 3JQ7A 1W4LA 4LVUA 4OQ4A 3BQNB 2M6SA 4MQFB 2R8XA 1N9ZA 3RK1A 1GOTA 3GFBA 1IBRA 2HYDA 3KKZA 3MJTA 5CNMA 1EWRA 4NI5A 3TB6A 1VRVA 4A6DA 4TMKA 1RLIA 1E9RA 3UXHA 1KJ9A 1PW7A 1Q11A 2XT0A 3G68A 1AKEA 1NXQA 3JALB 4BECA 2O6LA 3FLAA 3GHYA 4UVGA 1MP0A 1O2DA 4ZAWA 2FP4B 3DVAB 4MRVA 4TMXA 1HX7A 3NCHA 1ZJZA 4HB3A 1E5XA 2GBLA 3L0OA 4HF7A 4XGIA 2JGFA 5BVHA 1FRZA 2EARA 3N7AA 3O4IA 4GBGA 1P5FA 2HPHA 4CF3A 4LXHA 4P6VF 3TGLA 1G8GA 1VKZA 1PZMA 2BDUA 4RLQA 3S81A 4IWYA 3IEMA 1SA0A 2R7AA 1KO4A 2CVPA 4JENA 5BMVB 1JNXX 2J3DA 3WBFA 2CHVA 3WNZA 3GR6A 5DRYA 4X3CA 1WV1A 1URPA 4BQOA 3O2QB 1QVRA 4K9DA 4NP6A 2P2GA 4UCWA 5HUQA 3KK0A 1LW7A 1OROA 3BMCA 4R8RA 2H4FA 5FNZA 3SQLA 2PS9A 2ZI6A 4A23A 3WA7A 3TTWA 1PQ4A 3Q2KA 2B99A 4OY3A 5LZ8A 1AD2A 1WMFA 1I1HA 1MB4A 1T9BA 4ZYUA 2V3CC 5EMHA 3DBHA 2WT4A 3FAZA 1N6OA 4IW3B 4L4XA 3RB8A 2IY7A 4GHWA 4C2TA 1N5OX 2B4RO 2CMFA 4RVCA 4DG5A 1DMRA 2JK0A 1MH1A 1EDEA 1EA5A 4V03A 4B4KA 3AI3A 3IUJA 3B7GA 1SVNA 1AKVA 1H1LB 2QQGA 3H8JA 2RGGA 4FI3F 3KM0A 2WIJA 1GILA 2RK4A 4E6PA 1FE8A 2ZRHA 1NGSA 2ZI7A 3DEKA 5FQOA 3VZDA 5JSUA 4KE6A 2O9JA 4PYMA 3KX2A 4R3UC 1L4HA 4U2CA 4FZJA 5BXQC 4F8JA 1SC4A 1I1NA 4FFNA 2JNWA 1T3HA 4LZZA 1F14A 4BN4A 2ABWA 4BQPA 5JBQA 5ECYA 4FE7A 1M1XB 1ONBA 1T36B 4FE4A 3EMKA 3BGSA 3L8DA 4CIDA 3DEAA 4D4JA 3S29A 1V5WA 1W4RA 1YRLA 1ZKMA 1RKBA 2HQOA 2P78A 4CUKA 3AVUA 3TNYA 1TF5A 2ARKA 3ECCA 3EFBA 5JFGA 4Q48A 4F91B 4FUQA 4JYBA 5FD8A 4EL0A 1TADA 4D4MA 1J22A 4LZJA 3EC2A 4TMFA 4OXXA 2YZ2A 4J2HA 1JH8A 1L5SA 1W1WA 1NRIA 1WQ3A 3QBVA 2ECKA 4G6ZA 2WSSA 1QYRA 3KOUA 5CCXA 4G0NA 3WL7A 2AOUA 1N78A 3LZ6A 2J9FB 2JIRA 2NZYA 2W70A 3WIOA 2QVZX 5K1ZA 3AP3A 1XJCA 2BCEA 4MAMA 3UYLA 1J42A 2I7CA 4BY9E 1IY1A 3H5IA 4M9ZA 4J7UA 4C2UA 2ZS7A 1BGVA 3L7IA 1KY2A 1RVV1 2QK4A 3ASUA 5E38A 2EWMA 3H04A 3BICA 3D0QA 5BP7A 1XZGA 3NPMA 1OGJA 2X4DA 3AEKA 2WI8A 4MKZA 5TY0A 4UMVA 1FPMA 2ZBVA 5HG0A 1RYMA 3DQQA 4ZV7A 4B6GA 1PYOA 3NBMA 2BRUA 1R00A 3ER6A 3R5TA 3KPUA 4TV8B 4ZOLB 2PQ0A 2AQIA 3B89A 4Y6GB 3LO8A 5ER6A 3TRIA 6LDHA 5IDXA 4IUYA 2FMXA 5DM60 2YZGA 4JQOA 1RC8A 2FF7A 3TNLA 4G24A 2LIPA 4DCTA 1MA0A 2W2KB 4WNIA 4XDGA 2I2BA 5ALTA 2HV9A 2WM3A 4LOAA 1NUHA 4FIDA 2C88A 4BNJA 3FFAA 4CF5A 1P91A 2HPZA 1YR8A 2JD0A 5DN9A 3L8MA 2OGWA 2Q2WA 2I7TA 1VKHA 1H2AS 1PVVA 2VYVD 2WOOA 2WM8A 2WT8A 1BH6A 3K1ZA 3KALA 4H2DA 2GYVA 3BVPA 4KI0A 4W9NA 1RWNA 2BDTA 2C9CA 2GN8A 2IU4A 3K0FA 3K31A 3N86A 1IWBB 4G5OA 2I1QA 2H3EA 2M98A 2FK8A 3EXHA 2P2SA 3G5TA 3ROTA 3DH0A 1ANKA 1ENPA 3O0DA 1SXJE 2RHRA 3H1BA 2Z09A 4DSTA 4QXMA 1RZ3A 4YMHA 2XUDA 1GSOA 4K88A 1X1RA 2GHRA 4XUEA 2AYZA 3Q9SA 3L7NA 4XYEA 2CDNA 2EAUA 3WNBA 4QA9A 2ALJA 4WLFA 4RTNA 1Q17A 2PRJA 3TIGA 5CX4A 5JI3E 3T52A 4LMRA 2ZR7A 4Y1GA 2O7QA 1A69A 2TYSB 2FHPA 3HSYA 4OJYA 4UW9A 3UB3A 4XQEA 2GK3A 3C45A 3D3JA 4JJ6A 4RIEA 4LF5B 4G89A 4DL9A 1RXIA 5CT5A 1O9HA 5E7JA 5FPKA 1CB0A 3MWYW 4LGCA 5KNLA 1P19A 3PP8A 2Q7XA 3KWJA 4JVOA 3VPXA 1M8KA 3ICEA 3L02A 2C3PA 3PQ6A 2B9EA 5F4BA 3QYFA 3LYHA 4ENRA 4FLFA 4LRYA 3MWEA 4WXYB 1J21A 1F5SA 3C70A 3VR4A 1MO5A 3D8HA 1OIVA 3GYBA 2QVXX 3X2SA 1NBMD 2OCBA 3MUFA 2WTXA 4HCJA 3VHLB 4D8WA 3SZOA 1X7HA 3MT9A 2X7HA 2Y0PA 3F6RA 4MMZB 3F8TA 1UFOA 2JFHA 1YB2A 1CRPA 4TS4A 4KSYA 5K8CA 4RZQA 4KRGA 4TN1A 2PV0A 4RWEA 3A1FA 4KH0A 4W8OA 3MAAC 4EQ6B 3OG9A 1KO8A 4ITRC 2XVYA 4ZT2A 3CT6A 4KPFC 4DA7A 5B7PA 2CN1A 1WMBA 2ORVA 2PNJA 1I0ZA 1C14A 1O77A 5AOBA 4DJ5X 4AD8A 4Q1DA 3CZ9A 3U4CA 3W06A 1G5FA 4I4IA 4A2WA 2VXCA 1LPAB 4QPZA 4ECAA 1OJLA 3I9FA 5CXXA 3SJAA 5KTOA 2FDCA 2C8JA 1AGPA 4KG7A 5H70A 4BB0A 5C5DA 3TKLA 2IF2A 4JLJA 3OM1A 5DE3A 5FOWA 1XA3A 1SUBA 3LVBA 3RYTC 1CUHA 1JSCA 2ZETA 2XB2A 4YRBA 1JU3A 2PANA 5IN5A 4NVRA 1EQUA 5JH7A 2JZCA 3WLEA 4JL5A 4M6WA 5EXEA 1VMIA 3LP6A 4YUAA 2HK6A 4FTWA 1UXIA 2W22A 4KU4A 2ZI4A 4W8GA 5IYZF 1NYLA 4TX1A 2WSIA 2Q9CA 3UOGA 5AWFC 4EW3A 2V7EA 3C15C 2VAVA 1QFMA 3DXXA 3RAFC 2PMCA 4AS2A 4ZVLA 2V4MA 2Y8EA 3MMXA 2HSWA 2I2CA 3GUUA 1PX2A 3DHYA 4OFBA 4UAJA 1WDKA 2HLDA 3KO8A 2R1TB 3H84A 4I14A 5HA5A 4FMBB 5C9ZA 4ZYVA 3J81A 2P35A 3GP8A 5ALVA 3DAPA 5D00A 4R1NA 1XNJA 2OYCA 2AZMA 3U7EB 4KO3S 4MKXA 3V55A 2ET6A 4H7FA 3ORQA 1LBQA 4UM7A 4AJ4A 1Z26A 2ILVA 3KT6A 1I7NA 1FP7A 3NLLA 3H0CA 4I8DA 4D0GA 5TGZA 5JCZA 4BCBA 1NHWA 3UJHA 4MUXA 4FDTA 5H81A 4AJJA 4D1YA 1VIMA 5NULA 3QWAA 1XTTA 5D85A 1C0LA 4MCIA 4R1LA 2O5VA 2ZSAA 1GAJA 3V4PB 3FVVA 1PCXA 1DDIA 2O2GA 3AWDA 3BXGA 3CG4A 3CXRA 1D2EA 2QSZA 4ZAVA 3BIJA 2WLSA 3V3TA 3A6FA 5CFNA 4NBRA 4DV6B 2ZSFA 1HQKA 1LRKA 4TV9A 1WY5A 1PT8A 1XN4A 2IVFA 1Z33A 5HJ7A 2YTZA 3IEUA 3JYNA 2NM0A 2YV2A 5FYDA 2OCKA 1UBUS 1W8IA 3FTCA 4NBWA 4X64B 4FYIA 1D5CA 3L84A 1DC5A 3B3JA 2V5AA 2XYPA 3NTOA 4S24A 1Z4NA 3DFUA 4JIMA 1G7RA 3PI6A 1CQPA 3EXG1 4JBNA 4KR2A 1DXYA 4Q5IA 4P2BA 1EWQA 3I9V1 2AD5A 1BN7A 2XMBA 3MOIA 3UHAA 4BO6A 3FPSA 3P2EA 3R3YA 5DOZA 1GTRA 1T0JB 4GMKA 1J1UA 4BASA 4F4HA 4Y2XA 5EEGA 2XNDA 2Y1LA 4BUJA 4TLDA 2H1FA 2O5RA 3SYLA 3MIIA 4RK1A 1Z82A 4EECA 1C9MA 3DFMA 3NOXA 3IGFA 5TGTA 4C0AC 1VPLA 4GSKA 4KAXA 1Z2NX 3OEYA 2Q2OA 2WUEA 1IOZA 3T0FA 4M49A 3V4FA 3RWMB 4X1IA 1Z5UA 5HIMA 1PKXA 4YR7A 3FMVA 1NBMA 4TTTS 5MN4A 4M8KA 4YCJA 1Q2UA 3E18A 1L4MA 3U37A 4GKAA 4IEIA 4KVFA 1V47A 2QA5A 2CV1A 4IH9A 3IEVA 4D8VA 5JO0A 1CZRA 2R8OA 2PRIA 3GPIA 4QUEA 5KYUB 2FZVA 1IN7A 4C2AA 3FPBA 4KNWA 4CTOA 1XZAA 2WJVA 3A58B 1B2LA 2PJRA 1HQYE 2P9HA 4NECA 2N9UA 2CDCA 5CB0A 1H1TA 4UEKA 2WG0A 3QI2A 3IB6A 3VKUA 5K0NA 1XZIA 4EPRA 1FRVA 1N8SA 1QUFA 2Z04A 3ZWVA 3FKSA 3K30A 4JLKA 2TSYB 1Y1SA 4X20A 4RO0A 4X5OA 4S3MA 3WP1B 5IJ0A 3I9V6 3Q3HA 3QXCA 3TQIA 3FYUB 3I4FA 4YWJA 2O8CA 1CF9A 3O2NA 2Y2UA 1JTVA 3OLYA 4GOOD 1O94C 4LE2A 5G4KB 3D7KA 1VYHA 4BLTA 3HDHA 3LQ4A 2QI9C 4A0FA 2GF2A 5ALDA 1R6AA 2C2OA 2FJPA 2YIDA 4MS1B 3KBOA 5CVUA 3GJ4A 4YV0A 4G8DA 1QGAA 2FP3A 4AURA 5EP2A 3IDAA 1GQOA 1Q3TA 2H31A 1JPNA 5P21A 2QTNA 3GF4A 2CCKA 1OOEA 3AJAA 4HDKB 1KEVA 2IY8A 1KSFX 2XUPA 1YE8A 3GHHA 4QUIA 4ENWA 5FTLA 1NT4A 4CM4B 4GWGA 1D8AA 2PWBA 4QYTA 2YMLA 3QNWA 1QH9A 1YKGA 4K1XA 1NI4A 1XNHA 4JVNA 3RVBA 2RGEA 4REMA 4KQ2A 5KNBH 2X2PA 4WVFA 3UICA 1H8EA 1LSOA 1JG4A 4LTNA 3G5UA 4LN1A 4ENSA 3HP1A 1U2TA 4GM4A 4Y2YA 1PD1A 3HBAA 3AHGA 4J1SA 4FCTA 4F85A 5HZMA 4WFJA 1PNOA 5A7GA 1I9CA 1QC5B 2OAEA 3KSBC 4XSGA 3U80A 4HXGA 3UYKA 3NHZA 2WF7A 1RAEA 1NPTO 2YS7A 1DFIA 3OZVA 3KZVA 1W0KD 3ZIUA 3MWDB 3CF4G 1U2SA 3LK7A 4XWYA 3IXQA 2IDMA 4YWHA 2WFMA 4R2LA 5TE9A 2AA3A 2F8LA 2QX6A 1AX9A 3CJQA 3PNKA 5FOTA 4OFWA 1X8KA 4LFCB 3GAMA 2JI6A 2ZE7A 3Q6MA 1I5OA 2HD4A 1BMTA 5T4EA 3BMQA 5BSFA 2ENWA 2WQ7A 2A1UA 4NYJQ 3O75A 3SSMA 3TOVA 1J6UA 2QV7A 3SXJA 3DR3A 4X63A 1IXYA 4F6LA 2EJTA 2FOXA 3DAHA 1MVLA 3GPLA 1NKVA 1QWSA 2QMHA 2Y6VA 1HC7A 3EH2A 3LO5A 4I36A 4MYRA 1NVUQ 4BQEA 2I66A 3FWZA 2P7IA 3FI0A 4RZXA 4CEJB 1PJSA 2PX0A 1BG6A 2JGIA 3NO4A 3KFLA 3BTSA 1M9NA 1P3JA 2BJHA 4HYEA 2OPHA 4AO7A 3B60A 1ZD9A 3QHPA 5DWVA 4YACA 2QVGA 2YMPA 1TB4A 1W6RA 1T2CA 3GDWA 2DBQA 2QS9A 1VJGA 1K08A 1EFPA 1QGOA 1Z7BA 1E9EA 1SN7A 2GN0A 2P30A 3LUAA 4HNRA 2J4CA 5IXJA 1K8QA 1AC5A 4ECEA 4EGAA 5I9NA 5FXMA 1OH7A 2GCEA 4PCVA 1XQYA 4K6GA 4JAVC 4I1UA 4MVCA 3QELA 2IYYA 1ZXBA 1OLXB 3R7BA 4DA9A 5BSWA 2IH5A 1XNRB 1THGA 4L4YA 2JLUA 1EFLA 2WPDD 4JJ4A 2FK7A 1FVFA 2OPBA 3WBJA 2WNSA 3ZHCA 2WA1A 2AJCA 1KJYA 1PDOA 2XVXA 3FROA 3O4GA 2X8WA 1IK4A 2ANCA 2NZ8A 5BMVF 4IDAA 3RKRA 1RFGE 3HWX1 3NTVA 4D99A 3BWBA 4RCVA 5L45A 2WUVA 1G19A 4WASA 1WXEA 1SQGA 2VWQA 4UDXX 4LC9A 4JK3A 2IFTA 1N5RA 4MYTA 5FF9A 3WKDA 2YQ4A 4TMYA 4RQAA 2HRBA 4QPDA 4LCJA 4L9SA 3PT5A 4J3NA 2ZVPX 1SCNE 4B09A 2CMHA 5CFQA 1W19A 5K0ZA 1KI7A 3UGJA 4RPHA 3SC2B 2ANBA 2F7SA 3C48A 1O54A 2YHIA 5J3JA 1JFVA 2ZJ3A 3VPAA 3A6LA 3WB2A 1Z5NA 2FEXA 4LHVA 4YHBA 1EDDA 1R0LA 1PJRA 2OZPA 3H83A 3I6ZA 3QUQA 3SYTA 3BCUA 3V32A 4JYAB 2G71A 4I1RA 5EWJA 1C8KA 2BISA 4OSEA 1RMTA 1CZHA 4BFTA 4E5YA 5DGTA 1PR9A 4G26A 2YWEA 1XQ6A 3NBFA 2B37A 2AI2A 2Q5JA 3EWAA 3NBYC 4JP8A 3LWDA 4XJXA 1T91A 3SQOA 2HCTA 4N8DA 4E5UA 4HDRB 5B3KA 5I4KA 3LY8A 3CX8A 1NY5A 2XW6A 4EUHA 2WMNB 3DP9A 1DTWA 1T5LA 2EFYA 3P7MA 1PNRA 4PLWA 3GV0A 2RGCA 3F7OA 4ZO4A 3WOVA 2CBGA 1E92A 1V0JA 1AKMA 1VKOA 3INYA 4L0MA 2B7CA 3KQMA 3TW4A 4MB6A 3U26A 4YCAA 1WZCA 2I78A 3JQ9A 3SNHA 1CZUA 4W7SA 3M9LA 4JOBA 1IM5A 2RHLA 2FVYA 4KWTA 5H82A 4BC0A 1S2DA 3AR2A 2B82A 2Q0SA 4PCAA 2YOFA 1T6NA 1C1DB 2A9PA 2GAJA 3D5QA 2GPTA 3RC1A 3ZKAA 1X9GA 4ZTZB 1Q7GA 4HLUA 4H0NA 3KETA 4IY1A 4IKEA 3FMGA 3WFZA 3B1JA 4Q34A 3CY6A 1P6QA 4KN5A 1M67A 1U3FA 1W0KA 3KEGA 4L73A 4RBNA 5F2KA 3IOYA 4N18A 4AJNA 5ITWA 2Z8ZA 2RHHA 3QE3A 1XVAA 4DM4A 5DBOA 2FV8A 3TINA 5IYZA 3UPTA 1RPTA 3ZY5A 4DUPA 1U9ZA 1Y9AA 3ZGXA 4E08A 4UOEA 3NIBA 4O4LA 4M1KA 3MAGA 1ZK4A 1WR8A 1PK9A 2E89A 1AV7A 2ADOA 5CLGA 5C5EA 4B0OA 4LF9B 4N3AA 4YFVA 4BYGA 1SJ9A 1UC4B 1CRWG 4JJEA 3KWFA 2X15A 1PFYA 2PS1A 3ABOB 3LBHA 4LRUA 4MQEB 3WGQA 3IQIX 3E9YA 4XGKA 1O0SA 1ZWKA 1XIVA 2QW0X 3ON5A 3KYDA 1K4YA 4HDAA 4CMBA 4ERNA 2FSSA 1JDZA 4Y2VA 4ZVPA 3OY7A 1STOA 4ZOLF 4TV8F 2EZ9A 4BFSA 1NU8A 3H2BA 4KPGA 4Q7LA 2ZITA 3GJ8A 4UUMA 3WRYC 2WKSA 1Q3HA 1WHSB 1GNVA 4MCHA 1ZFNA 4KO1S 2JBAA 2BRUC 2GILA 1PHRA 3BWEA 3IQHX 2G1AA 1KNQA 2ZPAA 1MO6A 4NH4A 2FPKA 3Q7EA 1ONPA 2BGTA 2QZ9A 3LYUA 3GLHE 3LQRA 3U7QB 4Y2TA 2A4MA 2R7MA 2PGNA 4P36A 4DZRA 4JFRA 1LKZA 1UF9A 2VDJA 4TLCA 1I3KA 3PNPA 1VLQA 5SY9A 4BZXA 5FX2A 5HKKA 1QX4A 4BLQA 3GLIB 2VXBA 1R6BX 3IMCA 4LOHA 2WPDA 4IAOA 2BMDA 3UJDA 1SVIA 1O6CA 4I9FA 4DILA 5JSZB 1JEEA 2A2ZA 2YW2A 3OOWA 1JEYB 1QVZA 2BKAA 3BEOA 1IPFA 3PD0A 3DE7X 4IVPA 1UFVA 4TMWA 5E4TA 5KJ1A 4OHYA 3LLSA 4W9NC 1RBYA 3B5EA 3L43A 4GRIA 2V0NA 4AS1A 1SCJA 2W8ZA 2CWWA 2P3OA 4RKFA 3Q9UA 5IT9A 2MSCB 3VR2A 1OFHA 4DV2B 2BFWA 2ECOA 2B6NA 1GWNA 2R751 1XHLA 4JN6B 4TMVA 1JS1X 4R2JA 3TR0A 4C7JA 4H1VA 4BLOA 2GEDA 3M83A 1M10A 4UHCA 2JBWA 2QJOA 5CTJA 2WFLA 5ICEA 2NUTA 1E2JA 5DHSA 4J6FA 3UMGA 1AKQA 1WQ1R 1YBMA 4HGRA 3HKBA 3R4CA 1NPDA 7REQA 2UZ0A 1FDSA 3QKTA 4DLVA 5HILA 2XUZA 4F3CA 1V8DA 1UQUA 4ZT6A 1T5OA 3D4LA 3FPFA 3P2MA 3E7FA 3PKJA 4G5FA 1BKSB 2ZJFA 3E61A 1HT2E 4KDRA 4EWLA 2PZJA 4O3FA 1JB1A 3KT0A 4YV2A 4N5NA 5AK3A 3OQBA 5B1HA 3K2QA 2IP4A 3NIFB 3B6IA 2OLKA 2VUTA 1EAMA 4IVRA 3LZDA 3REQB 4GZ3A 3ZCVA 8AT1A 3E23A 4R1QA 4AQDA 4ZZ0A 1SG6A 4NOMA 4WK2B 4CLOA 2HGSA 2BBTA 2FYTA 4IDHA 4IIJB 5E8RA 3N58A 3OEHA 1E5TA 2H57A 1EWKA 4ODIA 1N2GA 3ESDA 4GZ6A 5CFZA 3RS4A 2SNIE 1EVLA 2OOSA 1Q12A 1R2QA 1E7QA 1MJ5A 3FN4A 1Y82A 1DX9A 2E5WA 4OH1A 1U9JA 1HEUA 1PFGA 3DHVA 3HRIA 3OEWA 4P84A 2CEKA 2ACKA 4HDQB 3OCWA 5A3JA 3SX2A 1KZ1A 3PX7A 4P5PA 4AF6A 2J0VA 3DZJA 2PSSA 4QL3A 4KAFA 1MRNA 2WAOA 4R2XA 2QUIA 3AL2A 4KR0A 1QNFA 3LA8A 4YECA 2OFFA 5EIFA 3THSA 3TN7A 4BZZA 3HSKA 3WWCA 2WKPA 5IJZA 5JYDA 2GT1A 3HB0A 4LYJA 3EVFA 3FNHA 1K6IA 2SCUB 4GNRA 2G6TA 4HVAA 4P4GA 3FPCA 3PXAA 1I2ZA 2X1MA 3HP7A 4HJXA 2IHBA 3W8DA 2ZJOA 3I09A 2VPYA 1BWSA 3R3XA 5HXAA 1C5KA 3MCUA 2HIAA 5GVRA 3RKUA 3OZBA 4QU5A 4BPRA 5C8DA 2H1VA 4JC5A 2J9GA 2VF7A 4YAOA 4EHDA 4NCBA 1HLDA 2I99A 4I4LA 3K8YA 4COOA 1JSRA 4GYYA 5LOVB 3FYHA 1DZ3A 1DKNA 1UQTA 3QWBA 1BGXT 3GJ7A 3ZVMA 4YDHB 3VQTA 2CE2X 3P0FA 5K7SA 1BVHA 1PQUA 1YOBA 3WSWA 3K32A 1RRGA 1DKPA 5BN5A 3CVJA 1M2OB 1P1FA 2EFHB 2VHUA 2VJMB 3DNPA 4YJFA 2AE1A 4PGMA 1JG6A 1C9YA 3GA5A 3W3AH 1GZSA 3R3HA 2ZQYA 1RBMA 2E4YA 3N76A 1LI7A 2PK3A 3P0JA 5CFOA 3WYBA 2ZTUA 5AIBA 3DOOA 3GDOA 3EEYA 1NUTA 3PUVA 3NVKI 1FXUA 3DKKA 2WYVA 3NC1C 1RLTA 3O73A 3QVWA 1RQ2A 1QFJA 3U4AA 3VRHA 3GEMA 1EXNA 1KZ7B 2ZSEA 1VMDA 3E5NA 2XV1A 3H13A 3QVMA 5DBEX 4OQNA 1TECE 4PZDA 4J6EA 2JJMA 1RD4A 3OX4A 4L27A 2RK6A 2WHPB 2WDZA 2ZLBA 3QE4A 4R2HA 4UBIA 3HXTA 2FWBA 3CX4A 3KE9A 5TX7A 2JRLA 3TL2A 3UEOA 3ZV7A 4BJ1A 5KOJB 4EEZA 2CFSA 2YVKA 2FE1A 4MQFA 4G0MA 2H63A 2R96A 4P9NA 2DPXA 2AW3A 3A6DA 1DIRA 3IAXA 4NMMA 3E15A 4PGHA 3STTA 4AJKA 4DFDA 4HVCA 1ODLA 1R37A 2XWQA 1F06A 1XVTA 1DG9A 1KS9A 1LDBA 1N2JA 2W2OA 4G1CA 4HAZA 1JIKA 4R31A 2WJJA 1T2FA 2D0DA 3ZGNA 3A7DA 1R15A 2V74B 4DMHA 3I6MA 5ARCA 2KQUA 4DMUB 4CCWA 4Q3EA 3UMRA 4MHSA 4ZVVA 2A1TS 1RQ7A 4WIAA 3KBBA 3PUJA 1AHPA 5FLXA 2XDYA 4PO3X 2OHHA 4QOJA 2B36A 5EQJB 1KWKA 1RCUA 1I2DA 1ZINA 5CVDA 1L7XA 1K6EA 4D9JA 5CH3A 4ARVA 1GGMA 2G08A 2RIRA 1W73A 1G20E 3HZZA 4I4CA 3BRQA 5FPPA 4BAZA 5BOSB 3CB2A 1EYZA 2FEWB 4FX2A 1GQSA 2ZYHA 3V7FA 1AQNA 3CNLA 3OCZA 1D6NA 4K2HA 5KTYA 1CS0B 1NXVA 4ZXPA 4HSGA 3RSOA 4M0CA 1FL9A 2VBCA 1U1FA 2H5JA 1U2RA 4JWTA 4BMYA 2JS7A 2P5TB 1ENOA 5DLEA 1IAQA 4JI1B 1E8DA 2Y1KA 3IDFA 1XEXB 3QFTA 2HWWA 4H18A 4KXFB 4NY1A 5AVSA 1KMHA 2IEZA 3NGXA 4XWKA 3C3MA 3Q3GE 3ZXUB 4ZI7A 5AK6A 4A8PA 1E5VA 5A4KA 2V54A 2JLBA 2FFAA 1JDNA 2FW8A 5J5CA 4FB4A 2H4WA 1BE8A 3TRFA 3D3EA 1ARZA 3FLMA 4PC7A 2AEEA 2CEAA 1PWEA 4I3FA 4UNRA 3VYTB 3CW9A 2ZE5A 4PZAA 3TKYA 5GM2A 3UKJA 1CQJA 2ZRLA 3KV1A 3PDUA 4Z7QB 4NFLA 3F6SA 5HW0A 4DARA 2F8MA 3PLNA 4IH1A 3FFXA 1U90A 2BSXA 3LTNC 2A92A 4OB7A 1JHQA 3F8SA 1XDSA 3A05A 4GM1A 5HBRA 5HS4A 1PW5A 4ND8A 4DLNA 3L6EA 2AJLI 5HF9A 1F6WA 1GGVA 2P9QA 1T36A 1ZVKA 3GG9A 3Q3CA 1T4GA 4G5QA 4XSHA 5CDFA 3ADDA 1NP7A 1AGXA 2G1UA 1Z22A 4P53A 4B3JA 1E2HA 1GL6A 3E05A 4U9IS 3EVAA 1BHSA 3WFJA 2ID8A 5JISA 4F92B 4DR3B 1ZO8A 2QM8A 1UFKA 3WBBA 4S1PA 2D5IA 1BXZA 1YDMA 4YJ2A 1EDZA 3OU2A 3THXA 1WDWB 1U5BB 5HMMA 1US8B 1YJCA 5DX1A 4FFSA 4YMVA 1NJ1A 4P80A 4DRZA 2ZIWB 5EPEA 1AZSC 3U4HA 1WKBA 2J9FA 1JR2A 5IK2D 5TIIA 1QF6A 1Y5MA 4TL9A 4OX9B 4LDJA 2QN3A 1M2NA 2O2CA 4LPSA 4F9TA 3MMSA 4LOLA 1YNOA 3BHIA 2VK1A 4AB1A 2GZDA 2OORC 3DPUA 1L1EA 1Z0UA 3CSDA 2ZBFA 1FNMA 3C3BA 4MPRA 5BUQA 4XIYA 3RI3A 4H6PA 4XGNA 2XNCA 5AKKA 5KQLA 4KWCA 5B6IA 2OT3B 4OSOA 2EQAA 1GQYA 4L8FA 3KKEA 2H7VA 3BMOB 4ZCMA 3HYRA 3QTTA 1IC6A 1MV5A 1U81A 2GCIA 3HEBA 3O0TA 4L6IA 4Q9HA 1A7AA 5TQJA 1M1UA 2I4MA 3W90A 1JLRA 3II6X 2ORWA 1B1AA 2B5WA 1IN1A 4E11A 4A5SA 2II6A 5LP6A 3CX6A 2W2KA 3NP7A 1U28A 5AW4A 1L1FA 3ECSA 1VL8A 2NV2B 2ODWA 1KXJA 2OAQ1 3G2JA 4EI7A 4UFOA 3NETA 5KU1A 2XB9A 4M9QA 3M4XA 4UNIA 3U7GA 3FHLA 1UBLS 3SXPA 3RS2A 2CXHA 4YBZA 4HY3A 5IULC 1H5UA 1XHEA 2IIQA 4QJ5A 3W8EA 5CP8A 3WL8A 3EA0A 3BD6A 3COWA 2BEUB 2RK3A 5LBTA 3SM9A 3FYTA 2IDKA 1X2BA 3SEAA 2ZUCA 3LG2A 2QI9F 3T7EA 1ZHHA 2IYAA 1N5JA 5E4JA 3GT4A 5AXCA 4PWZA 2QMZA 4BE9A 3NHKA 4LRSB 1ONOA 4WMLA 5KYYB 5K5EA 2O8NA 2BUCA 4V2IA 1V6CA 3ZJYA 2ZIZA 5IKOA 2NU6B 5FEMA 2GS9A 4JBGA 2ZEJA 5I9SA 1Q74A 4ZKEA 1N5MA 1UFQA 5F5XA 2CL5A 3PUWA 2HRRA 2H2IA 3U0BA 1U0BB 4Z9FA 2FX5A 1DAOA 2V5UA 5EUCA 4GP7A 4JXZA 1T1RA 2ZUUA 4MIKA 5LQDA 4G5SA 4BRZA 3BFKA 3VNUA 1R4NA 1EMDA 2W9XA 2P5SA 3GUZA 1JFFB 5KNCA 3HLTA 3LBFA 4KO2S 1ZM9A 2HA5A 1I3OA 1T5TA 2HNAA 2L18A 4WK0B 1GCIA 4IIUA 4Q3LA 5J58A 5B1DA 2IIVA 2GEKA 4JR2A 4CM5A 4RD2A 4UVHA 4D41A 1WUYA 5EWMB 2Q2NA 2Z9CA 4FGKA 2ZUSA 3N8DA 1VJ5A 4PBSA 4UHJA 1WIWA 1ZUWA 1DJMA 2D59A 1GT91 3W5BA 3OMXA 1V26A 1QG2A 3PQ7A 1JHOA 2QTFA 2QRVA 4BWYA 4GLOA 1QIIA 1E1RA 4H31A 2XD4A 1BMFA 1LS1A 2VQ3A 3UJAA 4M0DA 3WGKA 3FPEA 2C4VA 3ITDA 3LKVA 1WB9A 1IY8A 1U8FO 2FPGB 2H2WA 3PQ5A 1RRFA 4EQ6A 4QDJA 2P27A 5GM1A 1XPJA 1K86A 2LVBA 3HB7A 5EJ6A 1J4AA 1X0VA 4TS3A 4X71A 1XGKA 1K9VF 1SR8A 2BFPA 3ZLTA 2BW0A 2G83A 2WUGA 4NC9A 2ZRJA 5D3KA 1QZ3A 1O87A 5AKLA 1AN0A 3UV3A 4OK6A 4DABA 1SCUA 2QL5A 2I7VA 1LDGA 1C3VA 1NF3A 2V8OA 1FBTA 3FMIA 4KK3A 5NLLA 4RSRA 2VT7A 3ELDA 3UAOA 3ZY6A 1G8MA 1O97D 3B2NA 2B0CA 1VXOA 4RPCA 5AI6A 2DLCX 5IK2A 2FI1A 2PKYX 5KO2A 3JQ9C 5IHXA 5PGMA 2XGOA 1OFVA 2Z2KA 1F8GA 5DSXA 4JI6B 2PMEA 4AIIA 2UV8A 4YT5A 4G09A 5BWLA 3GUHA 1EJ2A 1R8QA 3FTPA 1T43A 3MD9A 1FXWF 1UPFA 2VA8A 3GJSA 2G4LA 4EMUA 4H6WA 4B75A 4HLUC 3D5TA 2I34A 4TRNA 3NV9A 2JC3A 2R00A 4XIFA 3EARA 1O96A 4US0R 1X7ZA 5A4JA 2E21A 4X9XA 4HMOA 5E9QA 2CV2A 2A88A 3CPJB 3D81A 3D8UA 4B7ZA 2QW8A 1KGSA 1PK8A 4PC2A 5J1SB 2ZUEA 2W8BA 1R3DA 3LY7A 2YXEA 5EMNA 4CETA 1MB2A 3LBIA 3IQZA 2AS0A 2KX7A 4H1WA 1RNLA 3C6XA 3DJYA 5SYMA 3RIMA 4ASUA 2C99A 5FBVB 1PR0A 5E2IA 3ESRA 2GDZA 3QVGA 4ESOA 4I8IA 2ZT6A 4R81A 4HHEA 1DT3A 1WVIA 3I2KA 4MEAA 4XARA 3HM2A 3LRTA 5AVVA 1VGVA 3H9JA 2O8EA 1KJIA 4IX9A 3DD5A 2HBRA 2COKA 4JLOA 2WWVD 7ADHA 3P2YA 2FDRA 1NA5A 2V7QD 1H2RS 1VHDA 2OV2A 3BMNB 3HVUA 3NIDB 3HXKA 1IE3A 1KY4A 4JHXA 4HDMB 4LZWA 4OLHA 3CLUD 2FLWA 2A94A 4IH4A 5CA1B 1P73A 1VG0B 1J0AA 3CISA 4ZZIA 4G2NA 1EZ4A 2FZCA 3TKAA 1NVMB 4CRWB 1UZUA 3W1EA 3SQWA 1ZIOA 2XUFA 3B7PA 3PFFA 4GLJA 2Y67A 3F5QA 5E3HA 1JR6A 3D5EA 2GVDC 5K20A 1N36B 3CQ9A 4X00A 3RJ9A 3KHUA 3T4PA 3CV3A 4C0SA 3ICOA 4MQ6A 3SHQA 3TZEA 1XVVA 4UPDA 5CT8A 3IA2A 5FWDA 5AXBA 3C3CA 3VVBA 5JR3A 3QV1A 4HJRA 5I7VA 5DM70 1PP4A 1BDMA 3L7JA 5AVXA 4F72A 1H9BA 4RGVA 3QVSA 3AKDA 1UMBB 4NV0A 3VOSA 2I2DA 1LK0A 4IDFA 3W04A 2O2YA 5KVSA 1EVKA 3HKCA 3OZCA 2ZXFA 4DLUA 4JBYA 3O1HB 1B76A 3F5FA 4I5FA 2Q5LA 4RE5A 1T5BA 4UBJA 5DNEA 2PUTA 3MB5A 4WZBA 3K2EA 3CURA 4WOBA 1YZLA 1RJ9A 1DUVG 3QRWA 1ZD8A 4DRXA 1U94A 1ORDA 1VJ0A 2OCLA 4I2VA 1FP4B 1I1OA 1DOHA 1P4RA 3CUWA 4GKVA 1P3DA 3GL9A 2RH9B 4JU8A 1C1HA 3HFGA 3L1VA 4PS0A 4QATA 3GRKA 4WN9B 4ZIRB 1UC8A 1ZMXA 1VCOA 1MDBA 2H4JA 2GEBA 3RREA 5BT9A 4BO9A 2QRPA 1OZGA 2P2NA 1UQRA 1O94D 1W52X 3GEHA 2K5UA 5LQSA 1XCPA 4YYEA 4OHKA 1KBZA 4B3DA 1ID1A 3E4CA 4MYUA 5GPBA 4JQCA 2BI8A 2AMLA 5KYUA 5HQ3B 3UA4A 4HZIA 2I29A 3H1TA 5CB8A 2CNBA 3ZCRA 4Z9BA 2VBGA 1R6VA 3AF0A 4M7RA 1XNQB 4LSMA 2VEDA 3JAKA 1XQVA 3ZQ4A 1CE8A 1WMEA 5TC4A 3UWSA 1IUKA 1C9NA 3TIVA 4RK6A 2KBEA 2XVMA 1Y98A 4AJIA 1YCDA 2HREA 2WAYA 4KYVA 4MV8A 4US1R 4AUKA 3H4MA 3QEMB 4D5GA 3E81A 1DWPA 1VKJA 1FVHA 1M2KA 2IHTA 2XUGA 4R16A 4EKGA 1G64A 2FPLA 3EEQA 3FYUA 2WF8A 3PHBE 5LB4A 2C2HA 4HWRA 1Z6GA 1FS5A 4U0KA 1KI3A 2MYPA 1YR7A 2XIQA 4LVCA 4W6ZA 3FGOA 2GTIA 3MM4A 4CM8B 1OR8A 2O3SA 1UR5A 3DBIA 1GN8A 1DMSA 1IEVA 1OI2A 2HSEA 1MRZA 2J5XA 1NONA 2VRWA 3DTYA 4R2IA 2VXYA 3QVJA 5I9MA 1TJPB 2DWUA 3F8WA 2ECFA 3I42A 4AKHA 4QZVA 1PSDA 1DZIA 1WF3A 4HDKA 4LDNA 1DEAA 8MHTA 3WGUA 4Z8YA 3H75A 2A86A 1LK7A 3RTBA 1SAYA 3TNFA 3VSEA 4CM4A 4N76A 1V16B 4AS3A 1F6DA 2KPOA 1R5BA 3A7EA 2Z1MA 1YB4A 4CN9A 5K0BA 4ADSG 5BWBA 4Q3KA 2WP8J 4JS0A 1BHQ1 3FB4A 4JJGA 2Z57A 3RVQA 1X14A 4UEQA 1LFDB 1R8YA 2VSYA 2QAJA 3FPLA 1J0BA 4KIWA 2Y0CA 3SX0A 3PWZA 3SDSA 2Q5FA 1VYTA 3VX3A 2C54A 2BM1A 4DZZA 3TLEA 2VTEA 2Q27A 2OBMA 3C5WP 2AGVA 1HUQA 3LDFA 3N39C 2EWVA 4C7XA 4Z4HA 2DAPA 2VWPA 5LOVF 2FJUA 5BNFA 4P32A 2XRFA 3QKWA 3S8MA 4HB2A 4G86A 2W6QA 3MERA 3OZTA 1E9VA 4KK4A 4O02B 2P2CA 1P2VA 2CY0A 4RMIA 3O92A 4ZEOA 2LCQA 4MDHA 1EZ1A 3MJSA 3C8ZA 1CCWA 1JA1A 2WIBA 4LRWA 2MR6A 4A82A 1XG5A 1P44A 3IJPA 4HNAA 5EE1A 3AEQA 2NSHA 3IO3A 4E15A 4EG7A 5K0EA 5KOIA 3JR7A 2B2CA 3C7DB 3QPVA 3W7BA 5AQ1A 2JKZA 4JJAA 4MRRA 4CKBB 1X1QA 4X8LA 1X7YA 3VJMA 1R6TA 1Z17A 3KSMA 1FF9A 1ZR4A 2GRAA 1FRNA 3A4TA 3HYSA 3R9KA 1RAFA 4DIKA 1KEUA 2A9JA 2Z5FA 2P6UA 1G5HA 5CVJA 2BI7A 3ANTA 4FM9A 4EB0A 1GPH1 2XYRA 4PRZA 5G0VA 2RI6A 4MZDA 1G8HA 4OHFA 2FPPA 1OAOA 4HG2A 3PEYA 1QO7A 4M1TA 3I12A 4RY8A 3TOSA 5JW6A 3LKDA 5CJPA 1OYOA 1XYGA 4C7BA 2EGHA 2IXGA 2DX7A 5U9CA 3A0UA 5JYBA 1EX6A 4CN8A 8OHMA 1P8AA 2WFAA 5FUBA 3WK4A 4DADA 2ENUA 1AM4D 2E4ZA 5TVKA 4AY4A 3DT6A 3LDUA 3MT0A 2AXQA 3FDXA 4P3YA 1ADCA 2ZRGA 1JU4A 3VC2A 1G0OA 4YLGA 5I9TA 2QBYB 4YREA 3W6OA 3E27A 4A0QA 3M4JA 4LV8B 2AEFA 1XWWA 3CPEA 2C9MA 4JB2A 4BX2A 4F1WA 1L5WA 1VHJA 1IYZA 4RV5A 5D2CA 3FE2A 5D87A 4DWWA 1B4DA 5EHZA 4FOSA 5H5JA 1TD1A 2OL4A 3BXZA 2R5WA 4EEXA 4NH0A 1Z7GA 4MR7B 1FS4A 5AM0A 2O1XA 3K5PA 3O3MB 4YN3A 2WPNA 3FOEC 1P2BA 4LWPA 3W5IA 1R3UA 2RKBA 2TMYA 2J33A 1ZK0A 2FSUA 5AVTA 2VCHA 5DISB 2QENA 4YA6A 3EW9A 3L8FA 4MGEA 4DIUA 2HJSA 2ACEA 4WT7A 1QIFA 4X44A 2EV9A 4DTCA 4PGAA 3EXFB 4HEQA 4TLAA 2GA8A 5ITSA 2FCAA 3WYGA 1P1IA 4WRRA 5KPJA 3EEOA 4B3CA 4IDCA 2WUDA 1DPGA 3K20A 1ZBDA 2V3WA 1B6GA 1ONSA 2HA0A 4GU5A 3RARA 4BNVA 3AM1A 3T1QA 2WD8A 3QF7A 4BFXA 1A0OA 5BN4A 2I22A 1E3DA 3O93A 1VFPA 5SY6A 2BCGY 1ZJ4A 2PN1A 1QE3A 1N5KA 2VN8A 3OQ6A 4PNPA 3OFND 4QDUA 3HFJA 1PJTA 1ODIA 1PT9A 3EVDA 5CAEB 3ELWA 4PLPA 1RPZA 1P1KA 5AJYA 2X0NA 1UOOA 4DMKA 1EINA 5C52B 4UASA 4Q7MB 1TLTA 3NTXA 4QHYA 3D59A 5TS2A 2JFYA 3JD3A 3ZBPA 4EO9A 4BQNA 5JSHA 3VVLA 2EFDB 4XIIA 1EPUA 1S7CA 1M1YE 1RXSA 2FFJA 4IILA 1ZOIA 4UNNA 1C1DA 4XDYA 3TLBA 2CV0A 3FPHA 1YVUA 1S01A 1Z12A 4WNAB 3OTHA 2WV9A 4NKRA 3CR3C 4OQFA 1TVMA 3CN7A 4ZI2A 1XWIA 4EY7A 2P0EA 2N46A 1QV9A 3L0IB 4CYMA 3PGXA 3PNVA 3WR5A 2ZB8A 4ZD6A 2NLOA 3QUCA 1KH3A 1ZJ6A 2RARA 2DQZA 1IAVA 1XVIA 4MNTA 3L4EA 2X86A 3RT7A 2HL6A 2AG0A 3CEMA 5BQOA 4KFRA 2HLHA 4MIEA 3L5KA 1KI8A 1AUVA 1S4QA 4CT0A 2PYDA 4MQEA 1H3EA 4QHTA 4HQ0A 4QYXA 3E7XA 4QU9A 3A1TA 3RODA 4B0PA 5FP0A 1MQSA 1H69A 3NUGA 5AXDA 3QEBZ 1T8SA 4CV3A 5TXGA 6REQA 4GP6A 2QOEA 2RCNA 3LC7O 1MV8A 1YGYA 4J4HA 3GC6A 5A7FA 3TZLA 1MOSA 1RS0A 2J0UB 4EKDA 3BXPA 4G37A 3MTQA 5KTMA 4IO0A 4D79A 2X5OA 1D04A 1HG0A 2W4MA 2AZTA 2LWIA 4H1TA 2ZJ5A 4TT3D 4ZDWA 4F5WA 4ZYLA 1KMCA 3VU3A 1VM6A 2HYIC 2H0QA 4DA8A 2BGNA 1U28C 4NFYA 2YJNA 4NBUA 1FX1A 2JD2A 1DKUA 3GBVA 2QTVB 2C20A 1COWD 1XD9A 4UZSA 2IUFA 3Q7TA 1SEPA 4Q66C 4RQUA 3HS3A 3W79A 3BE4A 1JQEA 4M87A 4K9SA 3WP0A 1U0FA 1UAYA 3A6ZA 3FR8A 3IRUA 4GPTA 4C1BA 3NJRA 4PN7A 1WABA 3SIPA 4Z4CA 1Q7RA 4YO7A 4JLUA 2C7QA 2R6R1 1D09A 2D2IA 1S2GA 3T1OA 1E4VA 1P2FA 4JEUA 4RPJA 1NWHA 4TTQA 3TX6A 4KRFA 4YP7A 3ZGVA 2PX5A 3PHGA 4RZ3A 4TKVB 1KJJA 4UJ3A 3V33A 5MFZA 1CVLA 4BZWA 1DKMA 1NFRA 2DKNA 5I7SA 4QOGA 1KWGA 2B61A 3F3KA 4IIEA 3QBEA 5FUYA 5JSQA 5BSVA 1JA9A 3G2HA 1CRZA 3EGXB 2VJCA 3MC1A 3HGMA 3UK7A 4C0HA 1O08A 1VP9A 3JASB 5CG1A 1N77A 1LBTA 3IKVA 4QTUB 1KK2A 2XWPA 3KQYA 2DTDA 3RVLA 1M8PA 1P81A 4O2RA 1HDIA 4XFDA 3PQDA 3IBTA 3AONB 1LA2A 4YRIA 1Q95A 4MARA 4LHEA 4Q9AA 4HB0A 1HURA 1ZH8A 4E5KA 1O5IA 5JJIA 4U7WA 2W6JD 2PFSA 5F1YA 3REQA 1W47A 4V0MA 1Q20A 2JKVA 4YLYA 1QU2A 3FW1A 1PR1A 1ZICA 3IV9A 1ZGGA 2P2YA 4IIJA 4BNZA 1EB8A 1UIRA 4M4SA 3DMGA 3H5LA 2LE0A 4IQ0A 4ZOCA 3HDQA 3LCCA 1K0FA 4GXTA 3QPCA 3G8BA 1J39A 2FN7A 5ERYA 1RWWA 2HV8A 2YXDA 3VM6A 2VTBB 2IPNA 2CYAA 3FI9A 3JATB 3WGNA 5CCBA 5HS6A 3E9RA 3DCJA 4OUKX 3WY9A 5LU9A 1E4OA 4HT3B 4OGKA 2EEZA 4LBWA 1TLFA 5ELLA 1IONA 3A8TA 4K8OA 4HZUA 1P4GA 1F7VA 1QLJA 2N0SA 1SVKA 3EVBA 3OE5A 5IVHA 3TM5A 4ARAA 3LVQE 3DEIA 3MT7A 4HGPA 2PVCA 4J91A 5DOVA 1EI9A 3W0LB 3KQTA 4HYYA 3MRTA 4JYPA 2NO9A 2H59A 4OAPA 3TI7A 3VNRA 4ZQCB 1W8DA 4YP0A 1S9DA 3WKAA 1JAXA 2RHTA 3O8BA 1ZUNA 2ZAIA 4DR6B 1CUAA 2XMDA 2SCUA 3N2LA 4RCYA 1KAEA 3P45A 3E9DA 4RESA 2WINI 1LLFA 2HM7A 4DM3A 3OQJA 2ZRFA 1N0WA 3NFYA 4M8LA 4ENTA 2QR5A 3OKFA 1RWMA 3QHQA 5ALHA 2MSWA 5IARA 1W94A 2GETA 3NG1A 3BFJA 4EK9A 5FV4A 3MN1A 3A9UA 3BTUA 1NZFA 4PTLA 2QZZA 2Z6AA 4EB6A 1EM8A 4CLRB 1TMGE 3OZAA 3ZJ5A 3PNBA 1BMDA 4AJEA 4E13A 1XVUA 3PB3A 2HBZA 2DTXA 2PJUA 3FIJA 3IIKA 4XCVA 1ELOA 1SU4A 2FAXA 4IG4A 3TOXA 3BFVA 4BVFA 1LJLA 1CUIA 3DLTA 4NCNA 1M2OA 3SSOA 4B48A 4YAFA 4I9HA 5JATA 4WQMA 4DREA 2BFEB 1DAFA 4LECA 1COWA 1Z6TA 1HYQA 1P0FA 2HXYA 5E6SB 2QLFA 1LQUA 4A0GA 4EYSA 3EC7A 4EHHA 3GLKA 4DRYA 2D1YA 1HO3A 5CA1F 3HA2A 4EFLA 3NPAA 4UBNA 3LL7A 4G1FA 5KCMA 4M38A 1ZH2A 3PR3A 4RL6A 5GADl 1ZL2A 1Z3IX 4S2UA 3A1SA 1SQ6A 3GJQA 2Q6OA 1Q14A 1ZGCA 4GKKB 1M0WA 3SF8B 1GTVA 1Y8AA 4MYHA 1VPDA 1R8SA 2WAMA 4GUDA 2C78A 2CHFA 3KJZA 4K9QA 2Y05A 4NE2A 4R1OA 5LDGA 3E4DA 4MA0A 1G8AA 3DP7A 1DIOB 3CE9A 1K7CA 3P27A 3S1LA 4L4UA 5GOZA 4BMVA 3GG2A 1Q7EA 5BYAA 5KOJA 1F1BA 4WDRA 5EKXA 1QGUB 2CJWA 4XLTA 5EERA 2GO1A 5HF5A 3TJZA 1RI3A 2DFNA 3RTDA 2J3QA 3ZD9A 4IS3A 1WUKS 2YWGA 4DDWA 1EIZA 4LXXA 1SO8A 5A05A 2C9BA 3QIVA 1PEDA 4GF5A 1AOXA 3O1JC 2XJ9A 1SBIA 1QGED 1W5EA 4Z54A 3VTAA 4C7OA 3VYWA 1LGYA 1LJUA 5B12A 4V02A 4MWEA 1JZQA 1R7RA 2CUKA 1KYWA 1FP2A 1KOFA 2CXXA 2O07A 4C07A 4H6VA 4EKEA 3BCSA 3F4LA 3K9HA 4FNMA 4DNQA 3DAOA 1FFXA 4PGFA 4PQGA 1XF1A 3DBLB 3WVNA 3B3AA 3GLQA 4C6TA 3A1UA 3D2LA 1AS3A 3B6ZA 5AMXA 5HJEA 3ZWDA 4G3XA 4HVTA 1M2VB 3KZNA 1E3JA 1R64A 1CS0A 3H5AA 4EH1A 1E5LA 2J3LA 4JUDX 1GRRA 3UCFA 1EUCA 1I33A 3QG1A 2GEJA 1QP8A 3U62A 1TCBA 4MTCA 4JI5B 3SFTA 2NUAB 1FTGA 2ZT5A 4YASA 3IIEA 2OWDA 4HFJA 2D3TA 2VUUA 1XEXA 3PA8A 2J45A 3R0XA 3UTDA 3ZWKA 5EG5A 3T1TA 1U0JA 4YCBA 3ERCA 3SM3A 3TTSA 2G5GX 1HE5A 2XE7A 4ZGGA 1E1DA 3NC4A 2OG1A 2M6LA 5FUXA 6AT1A 4P0PB 1AJEA 3AB8A 3AR7A 3GNQA 3T34A 2HN9A 3NJ4A 3T3OA 2W5UA 3C6QA 4Z3OA 3H9CA 3HCEA 3MG9A 2YY7A 4E2XA 3KT8A 4Z5XA 5G0UA 3TR5A 4E12A 3QU5A 2A5GA 2E55A 3MJDA 5CHEA 3HCDA 1RHQA 4K87A 2DJIA 5DSZA 2CLFB 1I1QB 5FO0A 1EVYA 1SUPA 3R7LA 5ENVA 1A9TA 3HUFA 2YVUA 2BHTA 3O8OA 5EJFA 1WCYA 2SKEA 2Z2IA 3KIPA 5LZ9A 2NIPA 4XX0A 2H2HA 4WADA 2BFFA 2CNNA 5KYXB 3HCBA 4JFAA 3SD7A 3PJRA 3ZE6A 2Z3ZA 4BU1A 4FDVA 1VLZA 3KFXA 1FLVA 1U8CB 3S55A 4Q9NA 1T9KA 7ABPA 1JTFA 3LPDA 2X9LA 3PKIA 3PVCA 4S2EA 4XWWA 2IYXA 2C5BA 4DSAA 1US8A 1UJ4A 1KORA 2P9BA 2A5DA 3PWTA 3AHHA 1A9SA 2FUNB 4X7BA 1LLUA 1R4AA 2VUSA 4QXAA 2QYOA 5EE0A 1II9A 2BEWA 2C96A 1VDMA 2EZ4A 2FN3A 1CNEA 1QIMA 3AL3A 3IBYA 3N75A 1A4IA 1JRLA 1KPGA 2BGJA 1ZL0A 2PA3A 1DAHA 3MW8A 3PCRB 2IXAA 1ISRA 2P1DA 1CUEA 3M1LA 1KYQA 2X0EA 3WB0A 3WQRA 5D5HA 4AP9A 3LDGA 2ONYA 4F1KA 4M99A 1E3MA 3R09A 1N34B 2UUAB 2PFGA 5CCDA 4BTVA 3K71B 1NG9A 2EKDA 4MA5A 4ARUA 4P33A 1W30A 2BJWA 3LHIA 1OZFA 3DW3X 1DRKA 1S1CA 2QZ4A 3BMOA 3MHPA 1C1YA 3DS8A 3PRKE 4Q82A 2C03A 5KBYA 1PZHA 4B2YA 3QMPA 3AHIA 1WE2A 4ZVMA 4P31A 1LDYA 1GEEA 1VB5A 1L8LA 2B20A 4FS3A 4R6WA 1MH9A 4LMAA 5B7QA 1SKMA 5JPIA 2AX3A 2J3KA 4FGUA 1WKVA 3VO1A 5DSTA 2ZKIA 3OP4A 3R9XA 3DT9A 4DXHA 1QHIA 3SZRA 1VLHA 4IWNA 1U7ZA 2HQBA 3HB5X 4J0IA 1SCQA 3GQVA 1K8RA 4OBWA 2HO4A 4XI9A 3F73A 2BEUA 1SIWA 3SZMA 5B3JC 3AFOA 4CNQA 1B74A 4JNKA 5G4LA 3R5XA 1ZAYA 3KLMX 4EB3A 1XKQA 3CW2A 1OAOC 3LT0A 4RVFA 2JIZA 3WO0A 4XSVA 3T5MA 1CUUA 4D25A 3DKPA 2VJOA 2ZZKA 3ONNA 4YRDA 4BNGA 4YRMA 1I51A 2VDWB 3GX1A 1TTQB 5EAIA 5AK0A 5CFRA 2PS0A 4GMFA 4INAA 1M75A 4MUAA 5CA0F 2VHEA 5ESDA 1E64A 3NM6B 3M1AA 4YPVA 3LSTA 4RVSA 4CM7A 1OB5A 5H16A 2WOJA 2DM6A 1ZX1A 1CDEA 1W88A 3VDNB 3W5DA 2C7PA 4G5YA 4MSUA 4G25A 3DV0B 3RT9A 3TOCA 1K8ZB 1Y3HA 2R5NA 2WK1A 2VAWA 2Y1EA 3RWOA 3CEPB 3OTIA 3UHOA 2EX1A 1V2GA 1XKTA 2R6HA 4R69A 4G1EB 3D7SA 2R4TA 4IDDA 3U9SA 4CG1A 5C81A 3G59A 2PBFA 2CXQA 4ZYTA 2JVIA 2ETXA 3H42B 1QS0A 2O2HA 4FMDB 3K9QO 1CWUA 1V7QA 2GAAA 3FSGA 1R0CA 3H8SA 1VJ1A 1D0IA 1L7PA 5F7OA 1K88A 3T1NA 1U9IA 2PIAA 3HEAA 1ZZGA 2YJ6A 4EHKA 3AF2A 5C8YF 2B4TO 3NKVA 2Q5CA 5CVCA 1S5PA 2JFXA 4RXUA 2N3ZA 2WY2D 3CINA 2R84A 1MOQA 2F1IA 1ZK1A 3SJCA 4QDTA 2FPGA 2BEVB 3JQ8B 4ATNA 1LVHA 4G1UC 4O2AA 3HCNA 1DWQA 3GIDA 3IOMA 4B1FA 1SKYE 4U6QA 4WPGA 2HJ9A 3ZCXA 4B81A 5KCZA 1QXSA 2AZXA 1GZ3A 2W93A 1TI7A 4DLPA 1GLNA 5AI4A 3ZNPA 1YOVB 5C1DA 2Q07A 4QBKA 4NMXB 1WPGA 3MZ0A 2X8BA 3A1VA 1ZM3A 4XLLA 3IV6A 1VOTA 4MJ3A 3E3MA 1G42A 5CJJA 4M0PA 1AKWA 4TRJA 1VIYA 4D9HA 2PL9A 4RA9B 4LXTA 4OQQA 4B31A 2FW1A 2JATA 4HNHA 1RYHA 5JCJA 3QLVA 3GZ4A 1YFZA 4HWOA 4PFQA 4KOAA 3ZZNA 3LUBA 3HBMA 3OPQA 4BCDA 1JTEA 2ZSBA 1MT3A 5CNJA 1YDFA 5K0JA 4C3ZA 3L7CA 1UAGA 2BF4A 5JE8A 5CDFE 1Y6FA 3HXLA 4H1UA 4B79A 3KQLA 4I55B 3FCCA 2OA0A 4BO0A 2JLAA 3IFSA 3PFKA 4DC9A 2BYTA 3U44B 3IULA 5EYPA 1KRHA 2BEKA 1JGTA 1WETA 1WHTB 4FYMA 3CX7A 1KMQA 3FGNA 3EPLA 5ALWA 4JROA 3KXIA 3IP1A 2BSQA 1ZONA 2P0AA 4PZ9A 5A7HA 4EELA 1USGA 4EOGA 4FWTA 4X1YB 1NVFA 3C6BA 4BJ6A 4IDBA 2CDBA 3GUVA 1JBKA 1JQ5A 2RAUA 3PYXA 3TCKA 1L3BA 4X6YA 4DDUA 1EUQA 3AUSA 1ZM7A 4CL3A 1P2UA 2B83A 1OU0A 2Y1GA 4AUEA 2R7NA 2WIAA 1UZNA 1FDVA 2QXYA 3PGMA 3PF8A 3ZU5A 1EVQA 2PGLA 1YJ8A 3L5OA 2IS2A 4UOZA 1UMCA 3P2IA 3G2QA 2VXOA 3Q8XB 4HDMA 4IYRA 4MR9A 5DMHA 5DP1A 5F64A 5CA1A 1QQBA 1FP1D 2ZU0C 1WPRA 3BYZA 3V2UA 2Q29A 4MV5A 5KQPA 1AMOA 3DD1A 1MORA 4P7JA 3EXEA 1PU2A 2Q6VA 1KZ9A 3HBFA 4YI5A 2YZMA 2ZE8A 2Q5QA 4LJ7A 5DGDA 3TX2A 4FGSA 1VRCA 2NX2A 4G4IA 5FRDA 4QOSA 3WL3A 2CMDA 4IGFA 1GU7A 3NT2A 2WSMA 4H4DA 1QP0A 4HDCA 2OD2A 2ZDQA 2EW1A 3I01M 4L2IA 1OBCA 2H1LA 4MULA 4ZCSA 4E2YA 1YVPA 3WGZA 2GCGA 4O4JF 1N5IA 1KK0A 2C29D 4PX9A 3F96A 3VYRB 3EX7C 1NW3A 1UPCA 2FWRA 5HDQA 2E48A 4HFRA 4OD0A 4RFSB 3H1PA 2HTFA 1VPWA 2XEDA 2IS4A 3EAFA 2HEGA 3AUFA 2C2KA 4C01A 1UP6A 3DMPA 1B1CA 1XTRA 3ZWOA 2R62A 3X1DA 3QENA 2Z08A 2PKRA 4IXMA 3E22A 3KYIB 4Y9DA 4PG6A 4I1VA 3GUCA 5JWHA 1WUJS 4M7PA 4BVKA 1WOYA 3R1IA 1FP4A 5KDDA 4J3FA 4NQRA 3O7MA 4GFDA 3UHJA 1P5ZB 1FFBA 3IKLA 3DM5A 3GOQA 3PDIB 4OA8A 1VGRA 4EHNA 3PNLA 4ACBA 3NWBA 5HKLA 2R0QC 3MCZA 3E8SA 3HJAA 3A06A 3C0KA 1HE4A 2B7LA 2V4ZA 3HYNA 4B33A 2EQBA 2PX2A 2AN9A 2XMQA 5K3AA 1E8NA 2B4YA 2SECE 1A9QA 1FPQA 1OYYA 3HO6A 3B1YA 4IDQA 4Z8XA 2H2GA 3A6GA 5AO9A 3TE6A 4TZ6A 5TPZD 3STXA 2B25A 1U2DA 2B1GA 1GFZA 2WNIA 5EZYB 3BSFA 4EW1A 5AKGA 3TQHA 1X6VA 1G1MA 3WADA 2EBHX 2JW5A 4MINA 10MHA 2HA6A 4ZP1A 1R4MA 5EHNA 3CKKA 3S99A 3V4VB 4JI8B 1EGHA 1NW5A 3EFHA 521PA 2AYXA 3D43A 4ARZA 3PU6A 1YJBA 2H4XA 2ZSIA 3DTVB 2PQ6A 5K3BA 3VPBA 4ZDIA 9ATCA 4GWLA 3QEMA 1NYRA 3C85A 4ND1A 4WOKA 3CYFA 4I50B 3NGMA 3URMA 3VUFA 3O1LA 2P6NA 1NMZA 1PT7A 4ZVRA 1KF0A 5C1BA 1PL8A 3AR5A 5IVPA 5KNBA 2FMHA 1I32A 4QPJC 1I9GA 1KZ6A 3G2LA 1O03A 3ZHUA 1B14A 3UT6A 2UUBB 3RYIA 3ORFA 4UARA 5CLJA 4J0EA 2VHWA 2ZIFA 2YKGA 2XMRA 3KCQA 3F4BA 5DX0A 3RVKA 4A5OA 5IFLA 4YJ3F 1I14A 1PV4A 4PW0A 2DH6A 2IYZA 3NW9A 5IRCD 2D6FA 2PGAA 2SKDA 4J1TA 4WJZA 3IBGA 4DCPA 3A25A 4JIGA 5HRAA 2H7XA 1CB7A 1ZN8A 3BBPA 3QX7A 4O4HB 5E3IA 2DWCA 4TM7A 1EDBA 2HK9A 2ZT7A 4KAJA 1E32A 1Z0FA 4XIJA 4Y2RA 3E6AA 2E5LB 2WU1A 4BP8A 5KTNA 1WLYA 5C5IA 4WOPA 4C89A 5M29A 2J1LA 2IW3A 3KEMA 1G21A 1SU8A 5EFZA 1FB5A 3T99A 5CU7A 1CT9A 2W6PA 3WLPA 4XLZA 4KQGA 2O59A 1VLMA 3TBHA 1LDMA 2JJ2D 3DEYX 1QK3A 4YY3B 1CDOA 4F4DA 1U7XA 1BE1A 2VDOB 4OMDA 5LQAA 5LYJB 5TPWB 4HS4A 4KFCA 2GARA 3ISTA 1MEOA 5C8ZA 1R0ZA 1ZISA 1NIJA 2KSQA 2XB8A 2CSXA 2CVFA 2L69A 3GNTA 1QJ4A 3L6DA 3OQPA 2C84A 1H85A 3CF4A 1OLUB 4MW0A 3SS8A 4C76A 1E20A 2W6ID 4F93B 1AE1A 5IAOA 2AW5A 1KKMA 1N2CB 4KTTE 1IMJA 1ORIA 2A58A 2HIGA 1UBKS 3HA3A 3QLTA 4X95A 3SNKA 3KTOA 4ZFNA 4I1SA 8ATCA 4KIUA 5E6UA 4PZPA 3OO0A 4ZGBA 5KDOA 3COPA 4MV7A 3UT5B 4G67A 4WKOA 2Q9AA 4CCSA 1AY0A 3Q7PA 5BQ5A 4JLNA 3SLRA 2WYOA 4DQDA 1L5FA 2P2LA 2VSQA 4Z7OB 2IUEA 1MX5A 4S1TA 1GA1A 2BR5A 2GEUA 4LGVA 4U8GA 2C4MA 3AX6A 4Q3DA 2WQZA 2WW8A 3MOSA 3WDKA 4AZSA 3EBLA 2BZGA 2DSNA 4R68A 2FN8A 2WHEA 4CKWB 1IJEA 3KOYA 2QYHA 4MV0A 3TW6A 3CX3A 4Y2HA 2X2EA 2XTMA 3KAPA 2YL2A 1OV4A 3ZEAA 4B3TB 1J9EA 2D5AA 4GQAA 4YCCA 4NJOA 5FBKA 3B52X 3A6EA 5EMKA 3EVNA 1N7HA 2E4WA 2VIIA 4Y98A 4UFPA 2AIRA 4B6JA 3LPAA 4BMXA 3SFVA 2NOAA 3B82A 3HBNA 2ST1A 3MWGA 1K92A 1JAYA 1XZNA 5KHOC 1ZSYA 2OV3A 3R7AA 1M5TA 2I6GA