5GAJA

Solution nmr structure of de novo designed ploop2x3_50 fold protein, northeast structural genomics consortium (nesg) target or258
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
134
structure length
134
Chain Sequence
MGTVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRVLVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure De novo designed PLOOP2X3_50 fold protein, Northeast Structural Genomics Consortium (NESG) target OR258
rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords DE NOVO DESIGNED PROTEIN OR258
total genus 50
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5gajA00
2LR0A 2LV8A 2MR5A 2MR6A 2N3ZA 2LTAA 4J29A 2LRHA 2LCIA 2L82A 2L69A 2LNDA 2LVBA 5GAJA 2KPOA 2N75A
chains in the Genus database with same CATH superfamily
1QTRA 2PIAA 3OC6A 4J4HA 1NJGA 2CJWB 3DBHA 4M54A 4QTTB 2YXEA 1FYFA 1HH4A 1YUBA 1D9XA 2ICAA 2ZVDA 3DF7A 3HBNA 4FFNA 1ZCZA 2W2LD 3IQHX 4X45A 4YP6A 2H9IA 1HO3A 5EAIA 3TSAA 1YNOA 3ONFA 4FC6A 5KPDA 2WJ6A 4MP3A 4UVIA 5FPTA 1ZGBA 1TJ4A 3GMIA 2CZQA 3G8AA 3USES 2IUYA 1Z6ZA 3EDRA 2XUAA 4NG5A 2CHEA 5DWVA 3HY6A 1XVVA 1GNQA 5H7XA 4AT1A 1GZDA 5C35A 4FSHA 1ONNA 2Q4RA 2VR1A 4AVYA 2B1QA 5CA1F 3AONB 1XJWA 3TTSA 2G4VA 1VHJA 1FJ2A 2WJGA 3GT0A 1T3LA 3EXEA 4X3CA 4WKOA 1W75A 3F5MA 5LQDA 1O96A 4XARA 1XHFA 3TLZA 1WF6A 1PJ4A 2X9NA 3KHUA 3ZNPA 3RFCA 2NSLA 4DQDA 1QBKC 2C99A 2FPGA 4UEKA 4EUHA 3H2HA 5KNDD 1C1YA 1WXXA 1TU0A 1SIOA 4O2BA 1GGNA 4WY8A 5BN3A 2I6SA 2UZAA 5CG2A 1JG1A 5CPBA 1CZNA 3N3BC 2HFKA 3NHWA 2GAOA 3FBGA 3DDZX 1LV7A 3G9UA 1BMTA 2CLKB 2CBGA 3I6BA 3A1UA 1WKVA 3D8HA 4PNZA 5KNLA 1R3DA 2M2IA 4PC7A 3WIEA 7YASA 1U7WA 4Q39A 1CR0A 1J8MF 2CLEB 2VK4A 2ZS9A 2HADA 2NMVA 5FR1A 5TMPA 1IJBA 2R2GA 2YFKA 3CUKA 1GPWB 4E11A 5EA2A 2FLWA 1TIKA 2FR8C 2PZJA 2BT4A 2ZDHA 3G89A 4H31A 3K9NA 2XWJI 1JYEA 1SC4A 2GKOA 4Y0VA 4ED9A 1FW6A 4C05A 1UDAA 3AG6A 2HA0A 1GAEO 4JEUA 1TRHA 4DB2A 1M2VA 1SOMA 3U4QA 1U0NA 4IGIA 4GPTA 2V7GA 4EKYA 1DZIA 1OWPA 1RTKA 2OMEA 2VCHA 3QFCA 5E9AA 5K3CA 4V1CI 1Q1GA 4INZA 4DIMA 3AVWA 2GXQA 3C3KA 3QE3A 2XITA 3TBHA 4U7TB 4IAOA 2ZSAA 3K0EA 4IG4A 3GP8A 2F1IA 4K9OA 2BTQA 3DOHA 3BFXA 3MIZA 4FZRA 4OQQA 2CL5A 2QM3A 1VCOA 1W5BA 4GDFA 2UYYA 3O8DA 4AURA 1SUFA 1ZU4A 2ZIEA 1RLMA 4EAQA 1MZVA 1QDUA 3H1BA 3UKDA 1O5OA 3PVCA 5C5EA 1W44A 2ZIFA 3DPSA 3DVRX 5CLQA 1KQPA 1W88A 5ALOA 4QXRA 1XQVA 3GEIA 4EB0A 1DO8A 1PD0A 3GRUA 2JB9A 3PFBA 4YAGA 4BLQA 5EHIA 1S4MA 2AXEA 4GP7A 3RH0A 1C7JA 1G8PA 1YJCA 1MIHA 2F8LA 3O8LA 4JLAA 4QWWA 4LF8B 5TVGA 2ZIUB 1ISJA 1D2RA 1KYXA 4FFLA 3FF4A 2P69A 3B20A 2B5VA 3GH1A 3WRVA 5AOVA 4FDTA 4QHSA 4MRSA 3DTTA 3PEVA 3MOIA 3Q72A 2YIDA 4NBWA 3USCS 5DHRA 3O1IC 3WHLA 2ZWMA 5T3UA 1ZU5A 3HVUA 4KYUA 5D87A 4C6RA 2FW9A 4F3TA 1VI6A 1NRIA 3TQTA 4DLSA 1DNPA 1ZNXA 2WSYB 2CCKA 1J0DA 3THYA 3GJTA 3C1UA 4DPLA 2WAYA 1KI1A 4YO7A 5EUCA 5LMNB 1HGXA 5IK2D 1QWSA 3C97A 4HJRA 3I4FA 3AYZB 2VDWB 4D8UA 4EHNA 1ONOA 5BQXA 2LVBA 3MQ2A 3ZDXB 2C03A 2VDMB 4K9QA 4KVFA 4UVGA 4EP1A 2ORVA 3CZ9A 2B8JA 3IEIA 4TQ9A 4IMRA 4U2KA 2OKGA 3T94A 5IN4A 3KR2A 5A9SA 2Q9UA 3GHHA 4YJHB 1F12A 1RRPA 1Z4KA 2QT1A 1VHWA 2X9VA 1C2YA 2WYHA 3IDZA 4Z9FA 2AX3A 2WY2D 2DLCX 3E3AA 4BRUA 1A77A 2MSNA 1FFCA 3CXUA 1R74A 3TJZA 5ADUS 1E77A 4M55A 5AT1A 1XZEA 4EJSA 2E2WA 4IVQA 4TZ0A 1I1HA 3UTDA 1F38A 2XXJA 1F1BA 3IX7A 3VR4A 1LLUA 4WRRA 1YDGA 4BV9A 2J0UB 3R0JA 3T9DA 2NAPA 3I4CA 1Q1AA 2R7KA 4EB6B 1K63A 2Q4DA 4D3DA 1GKLA 1HSOA 2B5OA 2HM7A 2QV7A 2QVLA 2VIIA 4K8RB 4OGGA 4ZVTA 2MSEB 1J5XA 2IEAA 2KMLA 3N2KA 3G82C 3NBKA 5EJFA 4ZAGA 1JR4A 3AW9A 2HA2A 1SQ5A 3ASYA 4CODB 1HEYA 3PHGA 4MVCA 3DE0X 4ZQFA 4KIWA 2I8LA 4R1SA 4BO5A 4BIMA 3GPIA 4KR2A 4KPYA 2G1JA 1WMSA 3EDQA 3EZXA 3OJCA 4RVCA 5FL7D 1YL7A 4D44A 3ABSB 4PSUA 5T6MA 3OKFA 2ZRNA 3Q41A 3N7UA 2WFAA 4KK3A 4TTTS 2R7AA 2AC7A 3BN3A 2X2OA 4D1YA 1EUZA 4YJHA 1D4FA 5I6DA 3DWFA 5BP7A 5IFLA 1X92A 2EW8A 1XZJA 3ZBQA 2CLHB 4EMSA 5FLKA 3AHGA 2FR0A 2ZIXB 4LVUA 4NARA 3EUFA 4JVSB 2VJPA 4YAWA 3UZUA 1JAIA 4LX8A 3Q9SA 4LYGA 1OLXB 2CDBA 3RYFB 2Z6VA 4B6PA 3ZCQA 4Z5XA 1ZC4A 4TKVB 3F67A 3PI6A 4Q1FA 2GJKA 4A16A 1XJCA 3A1WA 4B6SA 3A0RB 4X85A 5D5PA 3UAYA 3CR7A 3A9RA 3OPMA 2ZYWX 1PIWA 1XZQA 4ILKA 1ST2A 2O2YA 2WDPA 1CEQA 1FQOA 4FI3C 2H5LA 4HATA 4KOAA 4LQCA 3H0EA 2KPOA 4CYMA 2OQRA 4KQXA 1D6SA 2CUZA 3BXGA 4A10A 4A6XA 5L9AA 4F5WA 3WIOA 4DMUB 2ADMA 4UNPA 1KK2A 1J2TA 1DINA 5AK6A 3EIHA 4WERA 5JLJA 3LFUA 1E2IA 2YV3A 1JR2A 1A2KC 3QWIA 2SKDA 3M82A 3AG5A 3QOXA 1QH1B 3RSCA 5CNIA 3T8YA 2I54A 2ROQA 3O3NB 2I99A 3STXA 3EARA 1CX9B 3FCSB 1JP7A 3SSOA 2XUHA 1Q2XA 1GPNA 1ONPA 3ZHOA 2LP4Y 2V96A 5HF9A 3FOFC 1AK2A 1MPXA 3RU2A 3TYXA 2PL9A 4U6SA 3HCPA 2XAUA 3DW1X 4QODA 4QT4A 4XSHA 1T3ZA 4URVR 4JBHA 5IJAA 3VFDA 1GL6A 2QRVB 3AEQA 3FRJA 3U3RA 3HXQA 1QYWA 1U7PA 4B1FA 2Y2VA 4LVCA 3E22B 1KP2A 1L5ZA 1NQTA 3K0HA 4R9VA 3VR6H 2REQA 4N7JA 5CTAA 4CEHB 3STUA 1S4QA 4N0QA 4TTVA 4EKDA 1XKXA 4TT8A 1AE1A 4HRXA 2C1ZA 3DQPA 3T3NA 2JAPA 1HC7A 1UBEA 1DARA 2YZMA 3UENA 3QPUA 5DN6D 2H4JA 5KHAA 1CHDA 1XALA 4JR2A 1GKYA 1Z7EA 2OHJA 4RHFA 1YJAA 2WC1A 3D2LA 4OMCA 1DQNA 3C5EA 2AMJA 5CHEA 3COWA 4NRDA 3M9LA 4KACA 4Q5IA 2EATA 4FEEA 5CXUA 3QV2A 4LV6A 1P1CA 4MHOA 5J9FA 3U1TA 4AP9A 1KI4A 2NUAA 3PD7A 4FNOA 5HGXA 4HWKA 2O8EB 2Z5LA 2XR1A 4FPXA 1DB3A 4JGBA 2ZWPA 2IS1A 3WRYA 4D4GA 5AVQA 3HUFA 5F64A 2F8SA 1IK4A 4P4TA 3FPAA 4MUYA 3R2JA 2PPVA 3CFYA 3QMVA 1Q21A 5E4FA 1PJLA 1NSYA 3W78A 3WGQA 4DC0A 3E9MA 2VNKA 4JBGA 3ZIUA 1CS0A 3ILVA 5GPBA 1XNHA 3AI2A 3IAM6 3GGJA 4GLOA 4KO8A 5CLHA 3H75A 1U7HA 3L5KA 3FD8A 5AR1A 2DPGA 2QPOA 1FP7A 3R9IA 4AN4A 5D1HA 1T9HA 2H51A 5IULC 2NPOA 3HXOA 1AX9A 1ORTA 2XKKA 2XW6A 4OHBA 1FW8A 4XSVA 4BAZA 2B34A 2CL0X 1E0KA 1DAIA 3JATA 4BRWA 2I2XB 3KTFA 2H5EA 3K0AA 4KPUB 5LYJA 4EA6A 1UOEA 2QPAA 3PX7A 1N0WA 2X6TA 1GLGA 4AZWA 2WLTA 3MJCA 3KUKA 2I67A 4UE6A 5AW0A 2FX5A 3EEBA 3OFJA 5SZIA 1KSGA 1S1CA 3DPIA 4LF4B 4GX1A 3S7TA 1WNTA 4N9QA 4ABTA 3CRMA 5EFOA 4JJZA 1CNEA 2OP0A 3ZS9A 1SZCA 3H19A 1NBME 4KLAA 2YHUA 3OURA 4X3OA 4ZAYA 4OHOA 4PU0A 2RB4A 4YMUA 4HH4A 3BMOA 5EN4A 2QYHA 1ZMXA 2WWXA 5AM5A 4LGCA 1YE3A 3PITA 3MT8A 5K0NA 2PQMA 1ZRMA 3WGLA 4L5JA 2QL9A 2EJVA 3BMNB 3BE5A 4W1PA 1DWQA 2GJAA 5EIAA 1CBUA 4TL6A 4UTRA 1NXXA 3HDVA 3IQFA 4KWIA 1A8UA 3E3LA 4MS3B 3FCYA 3VTFA 2QTVB 1C9KA 1RRVA 3E9YA 4BX3A 3WL3A 1DXHA 5KOIA 3DB2A 5HM6A 1JPUA 1VCHA 5LWQA 1ID8A 4GI1A 1J20A 1YB1A 2QMQA 2BFCB 1BQ4A 1UOOA 2CB0A 2Y0CA 5A5EA 1AMOA 1P2SA 1PW7A 2ALJA 3JZIA 2D2VA 4H3SA 4LY9A 4YONB 5I4BA 5K8IA 4IJVA 3TLBA 3UXMA 3O74A 3JR7A 3PHJA 5EJMA 4OD0A 3E3OA 3KYDA 4ZYZA 2AW5A 3BEDA 3AUUA 3BRCA 4GWLA 1H8ED 3MGKA 5JSYA 4RHYA 3LDGA 1XF9A 2EZTA 4FFOA 5ALUA 4CQJA 3OQ1A 1XBTA 4AN0A 5CEJA 3D7RA 3KG2A 5IWCA 1KKMA 1NY6A 1YI0A 1IBKB 3IMGA 1B8NA 1U80A 1F8UA 2X15A 3D6UA 3KEOA 5IUJC 2Y66A 1EA7A 5E38A 1YCGA 3NQ41 1QRDA 4IH9A 1NBHA 2J3IA 2JLZA 3AETB 5KCMA 1V9LA 8ABPA 1PJSA 4H2DA 1M6VA 1UCFA 2Q5FA 2FEPA 4PSCA 1KMMA 4DE5A 3ZXUB 2W7TA 3OOEA 2BKXA 4PBRA 4MTLA 3MEQA 4RMNA 3OX4A 4HGZA 3AIKA 2PRJA 4YFVA 5JAQA 5J2TB 1HI9A 1I9GA 4CGZA 2XXAA 1LTHR 1WD5A 1TQHA 3DDOA 3G79A 3H8VA 3L7KA 5GADl 3J80A 1LK0A 3AWIA 3VR2A 1Y5MA 4IGAA 1IE3A 1JHQA 4Y2SA 2A67A 4FYHA 3R6WA 1Z28A 1U02A 3CZQA 3D4LA 3LUAA 1PFKA 1JIQA 3KLPX 3NRBA 4JVOA 4RPCA 4WNAA 4OLHA 4XIJA 3TI7A 3V1LA 1E4YA 1N4DA 3CJTA 1FSGA 1V1RB 1KC3A 3H5NA 5JY6A 1OH7A 3SIPA 3K1ZA 4NNJA 1QYIA 1AQIA 4ZVNA 3UTCA 4AX4A 4KR9A 4EVRA 1TF2A 5ALDA 5K3BA 4UUBA 4CMAA 3K1AA 4ZYTA 3QVMA 1NVAA 1NNLA 1MA0A 1UBOS 5BSMA 2FRDA 2JVJA 1COZA 2LNDA 3WJ1A 1RE0A 1ZJZA 5C81A 1ZXBA 4HI0E 4I19A 5CA0A 4NFSA 4EWLA 1BOFA 4CIBA 3RADC 1WXDA 2CW5A 2HD4A 2Z8YA 1U8UA 3JRNA 2COEA 3HNRA 5L3VA 4DR5B 4K6CA 1QMPA 2BIFA 4JXZA 4MB6A 3RRXA 1PTJA 3DMRA 3ONNA 1C1DA 4S1OA 2X0NA 4WLOA 4RTJA 4TYWA 3V8MA 3GAMA 5BW8A 3AZOA 1A69A 1Z5GA 3G0GA 1TTTA 1Z0SA 3N6VA 1SU4A 1A9SA 4D9EA 3AUAA 4KX5A 4RZSA 4AECA 4M9ZA 2D54A 1XU4A 5C8YA 3VVCA 4UATA 3O8OA 3FLMA 4FD2A 1EIZA 2Y0BA 3HUUA 3T7AA 4QYMA 1RWMA 3M6IA 1ISMA 1KR2A 1TXGA 1V3QE 2BMDA 5SYMA 4BUJA 2C2WA 4LCJA 5EQJB 5U4QA 1E5DA 2QJTA 1RC8A 3B8HA 1ZJ5A 4KOEC 4D8TA 1YQ9A 5IHPA 2XQIA 2H18A 5IT0A 2XT9A 3UPUA 4UU0A 4IIFA 1T9DA 2I6GA 4QDJA 2BMEA 4F6RA 4CKXA 3D8BA 1YS9A 2Q2WA 4U6QA 5L7TA 1U0JA 1WBDA 2D5BA 1YOVB 3GLHB 4KITB 3VH3A 3ZK7A 4ZVLA 1ITZA 1DQZA 4ZVRA 1QH8A 4ZYXA 4IXMA 3A27A 1QF6A 821PA 4NCXA 1PGPA 1X2BA 3ME5A 3I6MA 3FCXA 3PB3A 3PC3A 2PL3A 4NU0A 4JH0A 1NMXA 5DNUA 2YJ3A 4OP3A 3WSWA 3D81A 2B6NA 3EB9A 3F5QA 3Q2OA 4PYNA 3OD5A 3I9NA 4PPNA 1JI3A 1PQUA 2FPIA 3ROTA 4DCPA 5CD9A 1KDRA 1XNRB 1I7NA 2IITA 3TL3A 1OXXK 3SDZA 4QPJC 5D5HA 1EB8A 1R15A 4E5KA 1IG3A 4M8SA 3OQBA 4TRRA 3UV3A 1OGIA 4QQRA 1U28A 3HJNA 4R51A 3UHJA 1VKOA 3GD5A 2LDXA 4PAWA 1V1MA 1DKOA 4ZAFA 4C5BA 2QVZX 2ON6A 4RTQA 4KL8S 4GPEA 1TCAA 1WU7A 3CZCA 2AA3A 1G9XA 4WDRA 4XWWA 3S4YA 4LTDA 3QEAZ 3SF0A 3V80A 4MNTA 1PNTA 3FKJA 1JZSA 3BF8A 4P82A 2QSUA 4CIVA 2CEAA 3EISA 4WL0A 2QN9A 5FBQB 4F4FA 2Q5QA 5LB2A 2C7OA 2RHJA 3QITA 2XGGA 5HM8A 3H8JA 1X8JA 3EGOA 3ZV3A 3IQDB 3RVOA 2EBFX 4QJ5A 1GSAA 2G08A 1F51E 1NDHA 1CR6A 1MVNA 2IP4A 3LYUA 1QGAA 4MQMA 5EVCA 1P91A 3DMTA 3I8XA 4DIFA 3F46A 3AEUA 3PTLA 4E2ZA 4L7VA 3MN1A 3MUEA 2O8FB 1YDFA 1XB2A 3HB9A 1JLRA 1MB4A 4TLMB 4F38A 3L7NA 4BNGA 1KMQA 1QZZA 4J2OA 4GX2A 4DUGD 2PG3A 3CN7A 3LZDA 4AWAA 1JQKA 3RS5A 4B79A 2PLRA 4JJ6A 1YULA 2QX7A 4YN3A 3GP5A 4LJ9A 1YBVA 2VP2A 5CNJA 3SX0A 3G2QA 3NNNA 3L7IA 4P84A 3RRZA 3D0RA 3OTGA 4RO0A 4B84A 5KWVA 4PE5B 2I62A 3QG1A 5G3YA 1Y6RA 3RU3A 1PFGA 1C4KA 3BIOA 4RVHA 4Y8VA 4ABYA 3FNIA 4E94A 4TXMA 1JF8A 2KB0A 4Q4LA 1F0YA 1S5PA 2DPXA 3J81A 1DEXA 1S0UA 1U8TA 2N0SA 3NCHA 5FTKA 3N8HA 4IFEA 4YLGA 1MAVA 1QORA 4D41A 2YY6A 2C7BA 2Z8ZA 3UHAA 4NE9A 5AVUA 4I55F 3VH2A 4XRGA 2GVNA 2R8RA 2G8LA 3PF9A 4H18A 2HJHA 4BX9A 3L7CA 1MC4A 5CB6A 2F6RA 1NHGA 4P2BA 3W5IA 5IZCC 1P62B 4JQCA 4P08A 5AM3A 4J43A 4JQOA 4DCVA 4KR0A 2DWUA 2VQ6A 3LQ1A 3TGWA 1U6IA 3MWFA 4NEHB 4QEKA 5GV7A 1OFHA 4MRPA 3WTBA 1ECFA 1W52X 2AQHA 1P0IA 3I32A 1I2CA 4MPDA 4MEJA 2W93A 3KQWA 1JB9A 5EIHA 3ZD8A 3H05A 4QUJA 2EFDB 4EX7A 2F17A 2ZYVX 2V03A 1HORA 3JQFA 1I4WA 2Q9CA 2JIRA 2NVBA 1S8FA 5L3SA 2N42A 3K4PA 4YRBA 4PZ0A 2GN4A 4Y9UA 4W82A 1U99A 4HNSA 1RAGA 2RB5A 3L41A 2W6ID 4BBPA 5MN4A 5HDQA 2WWIA 5FOUA 3BFVA 3PPWA 3SR3A 1M0EA 1WPRA 1EQ2A 1QO0A 3IP9A 4LXIA 4RVSA 2D3TA 3IELA 4MUEA 5DGIA 1N8SA 1SJ9A 4B2YA 1YRYE 5IABA 1VL5A 3CVUA 3G7SA 4RSGA 4GZMA 4UZSA 1Y80A 2ZB4A 4UASA 1QWOA 1WCIA 5EGSA 3QUAA 4NBSA 5JJLA 1IG0A 2ODBA 2UZ4A 1J0CA 4F3RA 2BM9A 3D6NB 3RTCA 1GG8A 2ZAIA 4IM7A 2AQKA 1DTSA 1U5BA 3P7MA 1FLNA 4J4BA 4GKKB 1MHPA 1RCUA 1IXKA 1L5HB 1OV6A 3D4IA 4FILA 1FIUA 3GVHA 4MAAA 3U6KA 5CDGA 2Y76A 3KOMA 3OIFA 3ASUA 3C5CA 4ZQEA 3K2EA 4O4LF 3D6TB 5HXAA 3BDAA 4H6PA 4M0FA 1KMNA 2IIQA 2H9AA 3WV5A 5J4YA 5CAEB 4M0DA 3OIWA 2QY6A 3THRA 3O8QB 1XROA 2ZYRA 3ZGOA 4QUEA 3PFGA 1II8A 4FHFA 4R0MA 1GTJ1 2W70A 5FTMA 1BXKA 1KA9H 2WNHA 3BD7A 1ABEA 2EKDA 3M34A 3QEMB 4MUMA 5COAA 3ZH2A 1GUZA 2AEMA 5KWIA 1Z22A 1X1EA 4Q1CA 1MMFB 5C3UA 1UXGA 1YZHA 4N5MA 4DNPA 3ZDQA 1P39A 3NDIA 1KWKA 2P4HX 1I6MA 1XA0A 4TWZA 1NUUA 1RNLA 1YRWA 1Q1BA 3ESDA 2V6FA 3K32A 3QLVA 3RARA 3VKVA 5IMSA 2F3RA 4V1CB 1ML4A 3BX1A 3K6RA 5JRZA 3KSDO 1X1RA 4RZUA 4C0QC 3OT1A 2V7TA 3HRIA 4LGVA 3QYPA 4GM4A 1C81A 1KYQA 1EWQA 1M83A 3MSXA 2PH3A 3IERA 3CX6A 3WHPA 1YU6A 3U40A 2RI1A 3GBPA 4JP2A 2HQSA 5JMPA 3KQNA 1Y7HA 1IU9A 2QSZA 3WGKA 2DJIA 1SHZA 4YP5A 3WK9A 4JQYA 4HDAA 4HEJA 4HNTA 1U7OA 4L85A 4CLXA 1DELA 4RIHA 5EHGA 2BM8A 5J4VA 5C51B 2A88A 4OSPA 1AU9A 2NNWB 3U3JA 3ZQUA 2G1KA 3VPCA 1BHO1 4B32A 3ZY3A 1MTOA 3SS9X 5A62A 5ESXA 5EYPB 2DHRA 1GPUA 4W5NA 1OXTA 3EN0A 1NTRA 1Y82A 2IPAB 3B51X 3M9WA 3N74A 1LW6E 3N2EA 2ZBEA 4OQDA 4QOGA 3LMKA 1EIWA 2BMWA 5DTMA 1PR6A 3RC1A 3VGJA 4FK8A 4F2DA 4C7OB 4KQIA 3FNHA 4P3NA 4OYYA 4V0OA 3PENA 1E5XA 2QTBA 3OG9A 4K9MA 3SHVA 2BTQB 3DC2A 1A8SA 1OX6A 1RQPA 1T3GA 3CPSA 1KRWA 3KL4A 1TL7C 2HF7A 4LJ7A 3P9IA 4RXUA 4AKEA 2P40A 3B12A 2P77A 3CE9A 4KLCA 4ND2A 1V47A 1EDBA 3ROQA 1JMKC 4W8OA 4DV0B 4KR3A 2GA9A 3CLKA 1X80B 1W88B 4OLFA 3KR1A 1PZEA 5IC6A 2YQ5A 2OSBA 3JQAD 4MULA 5H0IA 3FWNA 4LOHA 3PFKA 1GPAA 3STHA 3P9SA 3IVCA 1NU8A 3UMVA 2ZR9A 2F3QA 1L5LA 3ZE7A 1E3IA 4FT2A 5HGJA 3TL6A 3W6ZA 2C2OA 1P4SA 3PLNA 4X97A 3A70A 2C58A 2C42A 4MJ3A 4Q7EA 1FK8A 4NYJR 5JZOA 4XJSA 1QOQB 3IJEB 4M7PA 4N0DA 3ZDZB 1I1QB 1E1QD 4EF4A 4BMPB 1NDQA 5IVHA 4JGIA 1VHTA 4HFMA 4YLEA 4YYZA 1X7XA 1RRGA 4RM2A 5EIWA 1ZGZA 2PZBA 4LI0A 5FWAA 3ZKAA 5GY7A 4KAAA 4IQGA 2FI1A 2G7ZA 3GARA 3I05A 4M1OA 3O4GA 2J9FA 1IVSA 4CMBA 1YS7A 4R2LA 1Q5PA 4LC0A 1IXRC 4LRXA 1J8QA 5CU7A 4YMTA 4U2DA 2C9ZA 3PRHA 2O23A 3JTEA 4YV1A 2P79A 2QENA 4MWDA 6Q21A 5KYWA 1W59A 3ZDRA 2X3UA 4L74A 3RASA 5K0BA 2ZJAA 1ONBA 3C0KA 1NLYA 4H7KA 3ZVNA 3F7TA 4IQ4A 1I7LA 5JS8A 5TPZA 2HPZA 3KXKA 1MV8A 4QPPA 4FYWA 3PDJA 3H1TA 1T29A 3QFTA 4Q48A 3IVGA 5EZQA 1TVCA 5JCPA 1EDOA 1GTZA 1UXJA 3ZGVA 3TFOA 2GERA 4E5DA 3HDGA 1RZ3A 2A14A 3KSBC 4N0PA 1ACLA 3E3MA 4L8LA 1XXHE 3CLTC 2PO5A 5HVNA 5CA1A 3MWDB 1RZUA 3KWFA 2Q9AA 2XEXA 4YXWD 2L2QA 2OV1A 3MFYA 3H42B 2VRCA 3PE4A 1FOEB 4MW1A 1NZFA 4QU9A 2FSHA 4BC1A 2I0FA 5REQA 3WLJA 3QVKA 2HCBA 3IAEA 1D4OA 1E6CA 2ODEA 3VNRA 1YZQA 2YW2A 4X94A 3CTPA 1KU0A 3AX6A 3KQUA 4JT2A 1WDWB 3ACCA 2CFRA 3O4FA 1EHCA 1PL7A 1JA9A 1Z8DA 2G70A 2SBTA 4MR8A 1W7AA 2DEUA 1F48A 1I3MA 2WFMA 3QEOA 5FYDA 2E4XA 4R9RA 3ZQJA 4HK4A 3THWB 2P2DA 4EA8A 3PGKA 2J67A 1PYOA 3F6CA 1U8FO 3DR5A 3KB6A 1Z0KA 5DTRA 4F21A 1G2QA 2FWPA 5BN1A 2YKGA 1EXDA 3FUXA 2YC4C 2FPPA 2ZTUA 1GCOA 5L95A 1NFFA 2HREA 4R01A 4UPDA 4M22A 4R8KA 4LOAA 4NULA 3K92A 4BBZA 1B1AA 1P9OA 3C5VA 4YACA 8OHMA 3MTQA 3D6VA 3VHLB 4RBNA 5HOEA 3QA3E 1GSIA 4NCNA 4PQGA 3STVA 1LXCA 5C9ZA 4YHHB 3AVQA 1LBSA 1E18A 4CDMA 1TO1E 1X7DA 5JZMA 1P60A 3FWHA 4BMOB 1BGXT 2ZU6A 3BORA 1JR3E 1SURA 3DV0B 1NUHA 3K1YA 3ZNQA 4OLAA 4YRRA 1I6WA 3TJRA 4AZ0A 3QU2A 2Q62A 4DDHA 4PAQA 4V39A 2Z3ZA 3VZDA 4DBVO 1NMSA 1TCCA 4CEJB 1G3MA 3OFSA 4QQ8A 3VOBA 2IY8A 3VYSB 5IVDA 2NUTA 1DJNA 3H13A 3S2YA 1MB9A 2I6TA 3UY4A 3WK5A 4MRMB 3OQJA 4D8YA 3IE0A 1POXA 1XZIA 1X70A 1E61A 4AL4A 4DDKA 2IE0A 1VIDA 4AUKA 1ADBA 3R5SA 5KOYA 1RHUA 4ETNA 2ZYGA 1H05A 1MJFA 3ZY2A 4TXNA 3PUZA 1T0UA 5TV2A 2WIJA 1MEEA 4AG3A 4ZOLA 3UXHA 4CQMA 4QBTA 3G8CA 5BN5A 2ERXA 2JFZA 3C8MA 3LCCA 2D1TA 2QLMA 4YBZA 2WFLA 1TPZA 1L1EA 2FMHA 1FFXB 1ODFA 4MJLA 1JIKA 1O6GA 1HURA 2XSZA 3KSUA 3NKVA 1FYVA 1I4TD 2H2WA 3HN7A 1D2NA 3MJ4A 4M4SA 2OOKA 1I14A 2O8CB 4PC6A 3ZZMA 1XCOA 1M73E 2BKVA 2WTEA 3UKOA 5C7YA 1U7UA 1A04A 4KJZA 1FRVA 1Z0UA 1IJFA 3L92A 2VZ0A 3OAAD 4Q37A 3BM5A 4RIEA 3TLXA 3VAAA 3W5VA 1YE8A 2FMTA 3T7RA 1IY8A 4MB0A 5E7MA 5H16A 4ZCSA 2OZPA 3O5AA 3LQYA 4LZWA 1FZQA 2Q5IA 2GYWA 4Z86A 4F1JA 4YT4A 2SNIE 3O73A 3X1DA 2H48A 2PKQP 2V7PA 4OHRA 4C4XA 4F91B 1YTUA 4YCMA 1S8OA 3FJOA 3JQDA 2IXFA 1LPSA 4G5GA 3S2ZA 3FWPA 3PQCA 4C04A 1S6YA 3ES9A 3DZDA 4QBGB 1XEXB 1XIVA 4KBGA 3Q88A 1VCNA 4RV4A 5B58T 3WG9A 3GFRA 1QGUB 2RGNA 2XYRA 4PYMA 2C4TA 4P0QB 4KXXA 3UMJA 1ZWKA 2IYAA 2I1QA 1U9CA 3PDIA 4G1MB 1VHQA 4AMGA 3AB7A 3TCNA 4CLRA 3DF9A 5H02A 3QF4B 3A0UA 3CZPA 3IIMA 3AI7A 3KQOA 1OBOA 1W46A 3OEHA 4L8VA 5GM1A 1XCBA 4C7VA 1J21A 4OHCA 3C6QA 5KSWB 4WEOA 4QO7A 2HZBA 2IX9A 2JRCA 5LD2B 1HRKA 2R2AA 2R5FA 4G8DA 1LWNA 4JY7A 4BQFA 1IQRA 1XZAA 2H5IA 5BMVF 2P7HA 1RXUA 4AKSA 3FH0A 3I5UA 3VKUA 2JIZA 3GMTA 1W5AA 4NLLA 3OEWA 4F5YA 5DYYA 4R71A 3TUIC 2LCFA 2NM0A 3NRJA 3EF0A 1AD2A 4FWBA 5LXTB 3PQ8A 2AL7A 2QN2A 1JMYA 4XX0A 1ZRHA 3P2JA 4ZOLB 1T5HX 3FPEA 1RBZA 3EUAA 3FPGA 2FPXA 3Q7RA 2ZBFA 4QU8A 2QVGA 3HCNA 5TF0A 3MTAA 2BCEA 2ZRPA 1DMSA 3FOBA 3FYDA 1W94A 4IDNA 3GIDA 4Q4CA 4BNIA 3ZWCA 1A96A 1JQJC 4EECA 4HLUA 2JFXA 3WQHA 1K06A 5DYTA 1LI7A 2CGEA 1MAWA 4KLZA 3J81k 4QG3A 1NIPA 3ADPA 1SD5A 3GGDA 3QIAA 1MPTA 2CMKA 1PUIA 5AJHA 4TRMA 3R3UA 3WIVA 3VXKA 5DULA 1NNEA 2YXDA 3V34A 2C2GA 4UVHA 3SM9A 4X20A 4YT8A 3ZVMA 3A26A 4CCAA 1Z6QA 2W2XA 3QWBA 2C54A 3ZY4A 2H2IA 4JJ4A 3ZU6A 2WUWE 1UMCB 2VWHA 2KLBA 2WWRA 3MM4A 1XMSA 3QJ5A 3IXLA 4K9PA 4UAUA 4G8BA 4ARSA 1KBOA 5LNK6 3AKYA 1JQLB 5K0JA 5L7WA 1OVGA 3UAZA 1P61B 2FOLA 2MSWA 3THOA 1GQSA 3LCMA 4M7OA 3UAGA 4NENB 1DVRA 1UK9A 3KBBA 3M70A 3NTUA 1SB9A 2FCAA 3RBZA 4FDLA 4LC1A 2HQRA 3WGNA 4Q4HB 1IMOA 1V2HE 4IDFA 3RS7A 3VYRB 4S2UA 2QR2A 3BK1A 4RKWA 1C3JA 1QX4A 4J49A 1DKNA 5D85A 3WLEA 3B9BA 1JHUA 2PZAA 3OTQA 4ECAA 3WMRA 3OU7A 3D0KA 4C1NA 1ZH8A 2X8LA 3B6JA 2HMSA 4Q9LA 2YWDA 3DO5A 2P9YA 3QQ5A 2B1JA 3DEKA 1NKVA 4O4LA 3PXBA 4GDMA 1XDBA 1GRQA 1K75A 4QPDA 4RXMA 1QP8A 2HF9A 5FBKA 3VUFA 3Q9NA 3G2OA 5EINA 2JHGA 3VR4H 1UBNA 4A36A 4NC9A 3PE6A 2VJOA 5CITA 1E98A 4TLEA 5ED0A 4OXXA 3D8NA 1MU0A 3W7BA 5KSYA 1EVEA 4NY1A 2ZCUA 5FNVB 5KAMA 3VAZA 1AH2A 4CQNA 2OLEA 5ARCA 2ECOA 5F21A 4IOJA 4I3FA 4YUYA 3L8DA 4MIEA 4MWSA 4WHMA 4XYLA 2PLWA 4XWTA 2HTFA 1L7DA 1ZSYA 5ADVA 4TTSA 4K0KB 3RSZA 1KI6A 1KEUA 2BRUC 1P7YA 3HEBA 3PQ3A 3T9CA 1I10A 1W30A 3RG8A 5C8ZA 4LJLA 4GX5A 1BWRA 3DV9A 3DZGA 3OFVA 1NP7A 1CZHA 1KMHB 3GMDA 3IAUA 5JJIA 2J3JA 4PZUA 2FVXA 5JCOA 1IEXA 1KI2A 2DJ5A 2B78A 3DD1A 4EW1A 1CK4A 4QUDA 3SMVA 1JSLA 4PTZA 1NVDA 4V3BA 3GQBA 4MUNA 4O2AA 5AJTA 4BB0A 3VBCA 4J0QA 2IXDA 4ZDIA 4PFQA 2FUKA 2Y93A 3JVDA 1IXZA 1UZLA 1YB5A 2BM0A 3AFNA 1G6Q1 1PQYA 4F45A 1BXRA 2EJUA 2EQAA 3PIIA 1Q15A 3HB1A 3QUBA 1ODSA 1BD3A 2PM8A 1SCDA 3KJIA 4OY3A 2WINI 2HMYB 3EVAA 2OXEA 1QG2A 3VVBA 1RLOA 1KAQA 1OXMA 3HA2A 4K05A 2V9CA 1NUTA 1N6PA 1ULBA 2Q6VA 2LE0A 2XGMA 3A3OA 1HZJA 4G0QA 1Y8RB 1ONSA 2E4ZA 4PR0A 4TSFD 3T3DA 1Q95A 9ATCA 1GM5A 2Y1FA 5H81A 4LX0A 2VT6A 1QHIA 2QP4A 2W71A 4JVMA 4A15A 1RXVA 2GD1O 2I4MA 3B3JA 3N5CA 3EK2A 3VDMA 4LBWA 1L1QA 2NU6B 3P2EA 4PHHA 4XM1A 1YCHA 5B6IA 1CY4A 4Q03A 2OG1A 2M6KA 3T3OA 2O59A 1N33B 1JNXX 2XCRB 4BXOB 2OUKA 3JQ9A 3G59A 2GN9A 3MRXA 1K5DA 2WJWA 1T0BA 4INAA 3ZVRA 3AVTA 1DCMA 1ZOIA 3ND6A 2RKBA 3EXHC 4WOKA 1CUFA 1TC2A 5AIBA 1OLUB 4HSEA 3PNKA 5CBKA 3FOEC 1QUFA 4C2UA 1RYFA 4HBZA 3PYLA 2GZMA 1LS6A 2HRRA 3I72A 4QLAA 3FZQA 4BMNA 2IYNA 1MVOA 1C14A 3TNFA 3WSTA 4BFTA 4ESOA 3V4SA 2FYTA 2Y1DA 4RLFA 1U5CA 3GVXA 5FPPA 4W5JA 3HDYA 2WSSD 1NFRA 2AWNA 3NONA 2DY1A 1GNTA 1OW3B 2F43B 1UXIA 4YP0A 3H3FA 3ZNOA 3P2KA 1C8KA 3RBAA 1PYDA 3U7HB 4L9WA 4ZQIA 1C7IA 5CB0A 4ARAA 1EK6A 2XNDA 3FB4A 2C4NA 2IXAA 3LRPA 3UA4A 1M5UA 1AJEA 1WEHA 2D13A 1BW9B 1JKJA 5IBQA 2BFWA 1OX4B 4EL5A 4G26A 5IF9A 1ODJA 3SBEA 4KBYA 4YC7A 3ZHYA 2YFQA 1FDWA 5BRNA 1C0LA 2P6NA 1J42A 1H8HD 2GPYA 1F1JA 3HY4A 4EFDA 3KKLA 3FRHA 3EQ2A 1UJ6A 4PFJA 2PCJA 3KL2A 3VO8A 3NEPX 3G7NA 3WYAA 5LDHA 2ODQA 1XNQB 2WSSA 4KVGA 1O54A 5DLEA 4GOJA 3SOPA 2ZJZA 5EWMB 4LOLA 2POCA 1CY7A 1RCFA 1EI9A 1YVRA 3WMGA 2VLBA 4DUZB 4H15A 1XMQB 2MINB 1ABFA 1I4LD 2R1ZA 5HKKA 1IM8A 3LZ6A 5CIYA 3IQIX 1TVKB 5JYDA 5KJ6A 5AVSA 1DL5A 1WCXA 2IWRA 3IVRA 1FDOA 4GI7A 3BUSA 3MCAA 2IHNA 2H06A 4ZT4A 3RREA 4DJEC 1JE1A 1LUAA 4R2JA 4ZO8A 1DTWB 2YYZA 1U7DA 4Z54A 3DGEC 1LKZA 5K8UA 2DBVO 2GCGA 5LQMA 3FMOB 3HBFA 2MMCA 3JAWA 2IXBA 4J7CA 2KI5A 1MAHA 5DOZA 3D2CA 4LJ6A 1GQFA 2G63A 3DEAA 2ZULA 3FPCA 4MR7A 4PHCA 3EJ6A 4JV5B 2O54A 4JP5A 3SBDA 4DABA 1DEHA 2PN1A 3A9TA 4NHOA 1V7PC 2JNWA 4U6NA 2VP4A 3UJPA 2VRBA 5KOHA 1OH5A 3E7PA 2ZWAA 4HNGA 5TQ2A 1EE2A 1V4NA 3X1JA 1SM4A 1E3LA 1CIJA 3FVVA 3H5IA 1F3OA 1RAEA 4LRTB 4D6PA 4HZIA 3A32A 4JAVC 4GMKA 1EFDN 2H1CA 4KK4A 4UTNA 2DM6A 1U9YA 3GCWA 3IOEA 4PCUA 3VZCA 1EHYA 1X3LA 2DR3A 2O0KA 3IIJA 2CCJA 3B5IA 1B6RA 1XD9A 2AN1A 3CCBA 3OZBA 4LYJA 3JWEA 4HWPA 4OQLA 5BRAA 4UULA 1NNUA 4UBLA 1T2FA 3HU3A 2ZZMA 4TTPA 3DEFA 3D6AA 1CQXA 4O1MA 1AGNA 2WG0A 2Z4RA 2GYVA 3AIIA 2YVAA 2EGGA 3JQAB 4BE9A 2HQBA 4ENQA 3NM5A 5DM0A 1XJQA 3G9ZA 2YZNA 1N0VC 3ZI0A 1C80A 5IAOA 4DLVA 2C8KA 2IYTA 3QM1A 2OL4A 4G0MA 8GPBA 3SZUA 3CV3A 2PBZA 3OQIB 3G02A 4S1PA 4URFA 1OPRA 2YWHA 1KS9A 4DXHA 2ATEA 3QIVA 3VR5A 3B6EA 4EAAA 2W00A 3BD8A 3N3AC 4F5DA 1CEYA 2OP1A 1DHTA 2AVNA 3DD5A 1JFTA 3BT7A 1CCWA 1KFEB 2YJ4A 2FEAA 1SVSA 2COUA 4RMIA 4CKWA 3U81A 5I45A 4O4JB 2QLLA 4MEBA 4WECA 3BGIA 5LB4A 2YJNA 4PYOA 1Q16A 3RR2A 3QU7A 1EEHA 2D1SA 1QR2A 3IODA 5AHWA 2BGJA 3SYMA 4L3WA 4Y1RB 5LDGA 4MXDA 5CBPB 3AXTA 1D0IA 3I4LA 3GAFA 3LWDA 2EG5A 3CLUD 1A7JA 5E1MA 4QUGA 4Q93A 1XKLA 1HLPA 1C3EA 2WFLB 2H00A 3ONVA 3ONDA 2BCGY 2YVUA 1QF9A 4HUQB 5J23A 2AMYA 2WV9A 4GL4A 5BR1A 3UYKA 3DE3X 2JIBA 3R7WB 3QPDA 5CAEA 1P7PA 2H1VA 2TMYA 2NXWA 3LYAA 2W2KB 2XB6A 2ZFUA 3JQPA 1AQYA 3V7UA 1QIKA 4CDRA 1NONA 2P3OA 2P5SA 4FR5A 1QCZA 3R6DA 2QYSA 4ZZ3A 2D0OB 2GQ0A 1TTPB 2UZIR 3A1FA 3AEXA 3COYA 2UZ3A 4IUBS 3TTXA 3OSZA 2Z3WA 4CM8B 3EDMA 2QVCA 1T9ZA 2GNAA 3NYWA 4RESA 3S1LA 2YOGA 1ZNYA 2OCPA 4Y6OA 2GJ8A 4A6EA 5GAJA 2WUVA 2A3RA 3H2JA 4TMXA 4HLQB 2IA5A 2WHPB 4UMFA 3H8SA 3WK6A 4E5VA 1D9ZA 1GPLA 3WYNA 3L0SA 2E1PA 5HIMA 4X95A 2GLTA 5F2OA 2IV3A 3RFUA 1PLKA 2AN9A 4KE9A 1L6IA 2PT5A 4K6KA 3ZZ1A 1WDLA 3EGVA 3DJYA 1FDSA 4WKPA 2C3OA 1EE9A 5E1DA 4EVIA 3PJEA 1NV8A 4ZDWA 1QM5A 1RAIA 2ZUUA 3O21A 4D0LB 1SG6A 2A59A 3KXIA 5JANA 5K1ZA 2W5UA 4QIHA 4CLRB 3FJYA 1T10A 3MERA 3IGFA 3Q11A 4WQMA 2I1LA 1E94E 2L18A 5K3SA 3RJZA 3OHPA 1H85A 1QZTA 3D7SA 3QEMA 5A3VA 3E2PA 3DL2A 3T06B 3OP1A 1TGVA 1YRLA 3MB8A 3BWMA 2WOOA 1UBRS 2QI9C 3ELWA 4YAOA 4YQEA 4WOCA 4HWRA 2Y27A 1JU3A 3KHTA 1PSWA 4LEIA 3LPAA 2GEDA 4H7EA 1WV0A 1QAQA 4QC2A 4AJJA 1D07A 1ZN9A 4PQEA 3WWYA 4DWWA 3ICEA 5EMMA 1ZVMA 4ZCPA 4QJIA 3V4PB 3VR6A 5TXGA 3O83A 5HQJA 4CKWB 4EATA 1M2OB 4UHCA 3DZJA 1E3DA 2QMHA 3C8UA 4FDUA 2N47A 4ZXFA 3ZDCA 4YRFA 2DUJA 1SH7A 1KS2A 4N5HX 1T2DA 4QPNA 1NRJB 3OZDA 4HP8A 3U7FB 3GY0A 1COWA 4Q9AA 5ITZA 5JD6A 3WFJA 2O7SA 3COZA 3M1IA 3QVUA 4ZI7B 3LD9A 4B4OA 2GBLC 2IYPA 4KFTA 3W2IA 4AJ2A 4DIKA 2BGKA 3I2IA 4V38A 3NG1A 1R66A 4PSAA 1NOIA 4ZMBA 5AI8A 1EGAA 1ZITA 2Q46A 1J56A 2DQZA 4F84A 4DC9A 4YCNA 1KNQA 5EP2A 2ODPA 1E1QA 4EY8A 4GOND 4Z7NB 1U1FA 1OXUA 2QX8A 3BZWA 5IK2A 5HW0A 3T5DA 2NU7B 1TJ5A 4ZJYA 3FDZB 4JXXA 3W79A 3U3KA 5KVCA 3RHTA 2AG1A 4BNUA 5KOJA 2BFNA 4F1KA 1L7PA 1ADGA 4PX2A 4YAIA 5JAOA 1PG2A 2FTKE 4NBKA 3T3EA 1IQUA 2VDWA 5J2TF 3SF8A 4RUKA 2H1SA 1FX0B 2JL1A 2BFBA 5IF3A 1RPZA 3U39A 1H2ZA 4IIXA 4CMIA 5BSHA 3HO1A 3DXXA 2R6HA 1JA0A 2I8AA 1YA6A 1W5SA 1E6WA 4U5XA 3VJMA 1FLAA 1RKVA 3R9XB 1PV1A 1Z4OA 5FDFA 3A6PC 4G0OA 3E9ZA 2GPJA 2I34A 4JEIA 4Z2AA 3NOOA 2CV2A 4GF5A 3EW7A 1SG0A 3WL7A 3SR4A 1E79A 5A5DA 3BSFA 4CG2A 2HRZA 2PMFA 4DQLA 1H6DA 2Y0EA 4NAHA 2ONZA 4JLMA 3TRDA 3Q8KA 1JWAB 1EB9A 3K9QO 3IHKA 5ERGB 2ZRHA 4JENA 3U9LA 2ONCA 3GLFA 1C9DB 1EESA 2O2IA 1YQXA 2Z56A 2F4NA 2DX7A 4RMGA 3O3MB 4M76B 1BWSA 3BRQA 2RI6A 2MTBA 1Z39A 1ODKA 4DREA 1U81A 4YBRA 4G25A 3LBHA 3OZCA 4HS9A 2O2DA 1C0IA 1J0XO 1KJQA 2BJVA 3WL4A 5IC4A 2Q1YA 3OLCX 2OZEA 3H9JA 1OWLA 2J7PA 3C3XA 3TD2A 1BS2A 4H7FA 1J23A 2VDUE 3QHPA 4O5OA 4UUMA 4TZ6A 2QK4A 3OPYI 5K2MA 2AX4A 3NAMA 1TJPB 4JLKA 4JJAA 3TF5A 2OV2A 4TLDA 4OXQA 1R2QA 4D0RA 3G9XA 1TADA 1EX6A 1MC1A 1SCKA 4PY2A 4CN8A 2NT3A 4O4HF 5JHHB 4MI3A 2OBBA 3P94A 2I4IA 2HYDA 1F2UA 2BP7A 4LRYA 4NCJA 2C9DA 3SKXA 1NLZA 3PT9A 2QZ4A 2PD3A 3DE1X 1FVOA 4HX9A 1E1RA 3AUXA 3L4KA 1G21B 1RWPA 1E2DA 2TYSB 3UG7A 5CRIA 3C41J 1GZ7A 1N9GA 2PUWA 1Y6ZA 3DDSA 3PXDA 3RFVA 5B36A 3OZSA 1CFJA 2OV4A 1A7AA 1LRJA 2B7LA 3I53A 3I9JA 2AOXA 3W5HA 4CNQA 4CV1A 4CBVA 3AL3A 5K8JB 4MQ5A 2LKDA 1NQ5A 1L6RA 1I32A 1PFUA 4MQUA 5ALLA 4X1YB 2WJZB 4ZRNA 2GN1A 1MUUA 1JJ7A 3NM4A 5JO9A 1AZWA 4B4WA 2OZKA 1DIHA 3U7RA 1TVMA 4BNZA 1O95D 1ZUHA 4UU7A 1A71A 5BUZA 4EY3A 1Z9BA 3AOEA 5B6PA 4UPVA 3IPXA 5F4BA 4TYNA 1EFVA 1Y8CA 2ANCA 2YJ5A 1LB1B 4R2MA 5D51S 3CH6A 5IN5A 3OP4A 1VG9B 4KPFC 3DXZA 1XPRA 4J2TA 5CB4A 1XXHA 4L6AA 4NONA 2CJYA 4FYIA 4P92A 2WJYA 1F5NA 1M2JA 4BKRA 1KK3A 1DBVO 3RYFA 3IESA 1E1KA 1JTVA 1JG7A 1GITA 1JLSA 3DFUA 3LQ2A 3NT4A 4RZ3A 2PZ8A 3SQLA 2YBDA 3GEDA 2QA5A 2P65A 3OZGA 1B0UA 4J0CA 3U5ZB 3TDKA 1EUCB 5BW4A 4ZTBA 1KYIA 3KJHA 4H7HA 1DBRA 5BPHA 3PIDA 4Y30A 4RD6A 1IZ9A 4R16A 5FORA 1WKCA 5JG7A 2ZRLA 3UKJA 4D4JA 1RWWA 2CV0A 2AF4C 1ZM7A 2TMKA 4FEGA 1E7YA 1IN8A 2QSYA 4IDOA 1ZGGA 3OM8A 5DXJA 1EVJA 1X1QA 3WLIA 4R3UC 1OROA 4D3YA 5BYKA 2BFEB 3GJSA 4GYJA 3OCCA 3TW8A 5K4AA 4AXXA 3M0EA 4MRMA 1PT5A 1NBMD 1YFKA 5DYGA 5FXMA 2HWYA 3LLSA 3NC0C 4QVKA 1XLTA 4J0HA 3KT0A 2Q1SA 1L7AA 3OZXA 1TDJA 1K7XB 4CUKA 1B43A 1PBNA 1SIBE 1YZUA 1ZVVA 4ESVA 3IAHA 3GAZA 2Q6KA 4G81A 3GJ4A 5ALMA 5FPHA 2CKDA 3KUXA 3WYFA 1JR3A 2DP4E 1K86A 3OAAA 4P4SB 2SHKA 4JLOA 3S2SA 4RZ2A 3VR3A 5KNCD 2JIPA 5JTUA 3HJUA 3M6XA 1XEXA 5M2QA 1TCVA 3BHJA 3IAAA 1H94A 3BERA 3CS3A 3R5KA 1IBCA 3NUQA 1X8KA 3CH7A 2I2AA 5CP8A 1OF1A 4EZBA 1BOOA 2CUNA 1JEJA 3GOHA 1KKLA 2VNIA 3NHPA 4M60A 3RS3A 4EHKA 3KZCA 4RXTA 2DHEA 4LGMA 2BFCA 1L9KA 1V5FA 1P7ZA 1OFGA 1ZNQO 2G9QA 4C08A 4LW8A 4DM3A 4J0FA 2FXVA 3ZWYA 4OU5A 2GHTA 1SXIA 4PF1A 1SKQA 3A4NA 5DP2A 5FHRA 5I7AA 3ZG6A 4IOMA 2VBCA 3LUFA 3INRA 3L8ZA 4NG4A 4YJ2B 3DZIA 5EE1A 4XFJA 4M7RA 4UNQA 1HDCA 3U31A 1YOBA 3DUWA 1TJ3A 3P9CA 4NF2A 4URZR 5AK4A 1OI7A 5T7BA 1KZYC 2NT4A 4IHQA 1DAEA 5ALGA 5KYUA 2QTRA 5C1OA 4W7IA 1A7UA 5AQEA 2HJWA 5GZ1A 4N8SA 3RI3A 3ETNA 1YRAA 4NE7A 3RFTA 3LA8A 1TEHA 2BY4A 4HEA6 4RVUA 5CK4A 1TGYA 3AETA 1Y8AA 2ONYA 2R00A 1MO5A 5IC5A 3BSYA 4PTYA 3OF3A 4HGOA 5D7NA 3VGPA 3BH6A 4X24A 3D0QA 5EPEA 3BG5A 2EKPA 2LCQA 3OIGA 4G85A 4MIKA 3VMMA 4BP1A 5EKTA 4LF5B 3ULKA 2G9UA 3BMCA 5ALNA 4QLOA 2OZLB 1EFPA 2RHWA 3RHFA 3UATA 4JB2A 2IY9A 2YXLA 3PDWA 3AM4A 4WW0A 4AX8A 4QGAA 3ESYA 3K20A 4G0VA 3DEIA 3GEGA 4G01B 2GDZA 5I8ZA 5GJWC 4ER5A 3SP1A 2YN2A 2WU3A 4D3ZA 1GTVA 3K70B 1A5SB 3HP7A 1GGMA 1E60A 3OZAA 3QLJA 4IHJA 2X6QA 2OYRA 4BCCA 1FDTA 3DVAB 1JEOA 3NXKA 2AFIB 4MCAA 4LE0A 3GEMA 1T9BA 4Q7KA 4REOA 5BN3B 1C30B 1Z6GA 3L1JA 4K9NA 5HCIA 1UT8A 4EO7A 4RU1A 1KPGA 4TKZA 1L8QA 4G2NA 3H0KA 1UMKA 3A4VA 4IYJA 2WT9A 4KSYA 4Y9SA 5CD1A 3H9BA 1V11A 4TYPA 1IONA 4MITA 4TN5A 2BR4A 1YBMA 2XNJA 1VDMA 4LVNA 4C3OB 2XMPA 3ITDA 1JLHA 2D2FA 4Q4AA 2H6EA 3CURA 4P3XA 5J58A 4NJMB 4A03A 1E92A 3ESBA 4JSRA 4GEKA 3BICA 2C4WA 5JS6A 1Z56C 4N6NA 4KH1A 3KQLA 5DNEA 4BXOA 1CQIA 4BNTA 1B1CA 3BSSA 3I6IA 2DWQA 3H1FA 4WTOA 2C29D 3SFZA 4GC9A 4P7KA 2IKSA 3K70C 4H7IA 2BTEA 3DGFC 1G38A 2HSGA 5ES4B 1JG4A 1LQUA 1U2DA 5FJIA 3WLHA 5CLJA 1WL8A 2QN8A 4BGIA 5IEJA 2W8BB 3ORYA 1BH6A 3F4KA 3GDWA 4C3UA 3VC3A 1BJKA 1X74A 4RIIA 2VAVA 1Z2OX 3RS8A 4ZDKA 3UH1A 1GEEA 1XN1A 1CRZA 1AKRA 1QGDA 3C8DA 3SR0A 4TLCA 3P0EA 3TH5A 1ATIA 5FFFA 1OI2A 4PZYA 1QRUA 1C30A 4EYQA 3G2PA 1T3TA 5BV2P 1YQWA 2HV9A 3L77A 2O7RA 2C9YA 2I7VA 3HP1A 3UUFA 3UV7A 3OHSX 2YNMA 3QWHA 3D4BA 2EHDA 2DLDA 3P4UA 3R8FA 2XE6A 1YDMA 3UT6A 1JVBA 3LVFO 4AO6A 4HXFB 1ZL0A 4U3JA 4E7PA 2QTFA 3TXAA 1UK6A 4C4OA 2GK3A 1VPLA 2EWMA 1QONA 1GEGA 2H8GA 4IIJA 1G98A 1E5QA 2HBYA 2IP2A 2QX6A 5CTJA 3WDMA 3CVWA 1NW8A 3A05A 1N2OA 1QIDA 2WQZA 3EZ9A 3GDGA 2J07A 1JDUA 4OL9A 2BI8A 1O0SA 3GO4A 4I9NA 4IGEA 4BPBA 2IW1A 1FUUA 2BFOA 4EGQA 1NT2A 1JXMA 4G0ZA 4NMLA 4RPLA 1YC5A 3LHSA 3D6FA 1TCUA 1QIMA 1YKFA 4UM9D 2C2MA 3CKMA 4FONA 1K6JA 3QSGA 4QTYA 3JYHA 3RW9A 2EWWA 4DY4A 3E7WA 1JEQB 1P9LA 2IHZA 1A2OA 3AKCA 3F7MA 1XGKA 4IX9A 5KAPA 3RSLA 1ZCBA 2NIPA 3OJ0A 1LSSA 2ATVA 2IV2X 3BXZA 4K03A 2MIIA 3SSMA 3ENNA 4JDPA 4JT8A 3N2GA 1H1DA 3GT3A 1FSZA 4FFSA 4FB5A 1MBZA 2ZRMA 3F3SA 3K0CA 1M8KA 2I6QA 4NH4A 4Y2TA 4JP8A 2J9FB 3MTBA 4ZOQI 4IHAA 3EC7A 3JD1A 4L1KA 4IFIA 3URMA 2JHPA 3EMDA 3VR4D 4EARA 4EHJA 5B57C 1SULA 2B25A 3HUDA 4Y9RA 1WMDA 5CA0B 3EOZA 5JJ5A 4EUKA 3H7IA 3FAZA 4CLOB 2FR1A 3G88A 4OFWA 3PQ4A 4PW0A 1N6HA 4P0PB 5KTPA 3NYIA 4EPTA 2CC2A 2AGVA 2HDOA 4OM7A 2QP9X 2P8JA 1FJHA 4HDRB 4CCYA 4KAJA 3D9QX 1EK5A 4QJ3A 2EARA 1WXQA 2FPRA 4NFYA 2WDZA 2B1IA 3B1JA 3O2JA 4GKVA 4L76A 1IPEA 4PIPA 2ZBVA 4AF8A 4BO6A 3KYJB 1X9HA 2IEBA 1ZVQA 5CIQA 1NJ1A 1T8PA 2P35A 3RGWS 2J85A 2ZUSA 4LC9A 1Y6FA 1ZRSA 2FZVA 4YNBA 4W63A 2FN4A 5HTOA 4E21A 4YMSA 5LZ2A 2PUDA 2GPWA 4B35A 1CNMA 1E5LA 2IIBA 1ECBA 4XAQA 1YMQA 4RWZA 2E37A 1Q0UA 4G37A 1Y5IA 5EZSA 3RQSA 4BVFA 4EUSA 4Z6KA 1IUPA 2NUPA 1YK0A 4Z3KA 3CZRA 5E2BA 2WYWA 1XRLA 3HS3A 1C5KA 2IYOA 4ARZA 2HDHA 1PS8A 4P22A 3PNLA 4A91A 2B7CA 3IE1A 2BGNA 2JS7A 3DLPX 1YIAA 3FHOA 3EJWA 1R6VA 4E5PA 5NLLA 4B4UA 3OUUA 3R77A 2XT0A 1YQEA 1N7GA 1R3UA 1Y3HA 3NYQA 1CLEA 1CQWA 5COBA 1QH9A 2IIPA 2P68A 1E5VA 2F67A 2Z2YA 2HQOA 1MX5A 1VRWA 1M2NA 2WHEA 2AYZA 5JSQA 1USVA 2EQBA 2WT4A 4LOKA 1L7XA 4MQFA 4RSMA 4FZVA 3DAHA 3L7BA 2PV0A 4MMXB 4M89A 3U13A 1H4QA 3PGXA 3K8ZA 2JDID 4C2BA 3W3AD 4K8OA 3IE2A 4UHHA 5GGYA 4I36A 2BEUB 3DEHA 2GB4A 1PN3A 1R9MA 2HCRA 4KAXA 2H1FA 1SHJA 2OCBA 3KD3A 3KPYA 3D3WB 1YAHA 3LC1O 3QKIA 5A02A 5DX0A 3C3YA 2DWPA 2XYPA 2WIKA 1VE1A 4J6FA 3TXYA 4MGKR 3QKWA 3VOTA 4EENA 4PLZA 4XR9A 2VT7A 4M36A 3DNFA 5CH3A 2J08A 3QOWA 3DZBA 4JEHA 4MW7A 3JCZA 2I7CA 3CCCA 5ALSA 3WIBA 1SC6A 1AZTA 1Y1KE 1Y9EA 1JAZA 1KO1A 4G23A 4P4GA 4NXMB 2WVJA 4GC5A 1N2CA 2DFKB 3MBOA 2GD0A 3MUOA 4TVOA 2WP0A 3GAAA 4NV1A 1RD4A 3RT9A 4AWBA 4YV7A 3HGMA 3ZXYA 4ZI7F 3BWYA 1N5LA 1SRQA 3W9UA 2AD5A 1WSBA 3AKDA 4O1IA 3HPQA 1OFVA 3LUCA 5BYJA 5KJCA 4ZIRB 2ZJ2A 4ADSG 2ZR7A 3PC7A 4PO3X 2A9VA 2YHBA 2IVZA 2R48A 4UCFA 4X61A 3ZYCA 4WOJA 4B6EA 1LBHA 1ID1A 2G83A 3DYVA 3LFTA 2RGWA 3OU6A 4ZVQA 3KQYA 3OEEA 2CXPA 4KQJA 3CW8X 4X93A 3LLCA 5BN5B 4CQMB 4EHHA 5HS4A 4A26A 2B3DA 1Z5PA 4OKIA 5KYNA 1AMUA 4D9CA 3K6SB 4ENRA 3WL6A 4G56A 4CMJA 1FTWA 1TRKA 4BZXA 4AKGA 1JFRA 5A6SA 2YFYA 3DC7A 4KI7A 2R6FA 2KWIA 1EFVB 2AD1A 1FP2A 2CKMA 2Z2KA 4TQGA 3QNWA 4UM5A 5FWNA 3L4BA 4AJNA 5HFJA 2JGDB 1DXOA 3G0DA 1AKTA 5HQTA 1XU9A 4YQYA 2B82A 4KQ9A 2J5RA 2H7CA 2FPGB 4G5QA 3Q6IA 1F17A 3RWOA 1XZ8A 1YS2X 2DOKA 3L7MA 5DHUA 5BQPA 2VJLA 5ICMA 3BJZA 2OD2A 3Q0IA 4IMIB 4ATNA 3GJ8A 4QREA 1D4ZA 1GQRA 1Q0PA 1VBFA 3PICA 3IYLW 2ZWIA 3A6GA 3K5WA 3M7IA 4L27A 3O3OB 1I6KA 1M8PA 3H4IA 3H2KA 4QAQA 2WHXA 1PEDA 3DG9A 4PLYA 1A4RA 1LV8A 3I39X 3T15A 2XRMA 1BRMA 1V7CA 4LY3A 5IZ4A 5LZ9A 2UYHA 2CL7X 4HZGA 4WGGA 1NE2A 3GNQA 4ZCRA 2E4YA 2VUIB 1D09A 2JGEA 2IPNA 2YY5A 3CSUA 2FWRA 4QBIA 4Y6RA 4AICA 5KMGA 3KTAB 1Z8HA 1BVUA 1GXSA 1NN1A 1USGA 2M1ZA 3E1GA 3H83A 1MHTA 5DEIA 1Z26A 3BH7A 1X1TA 2R4UA 1A4UA 4ZODA 3AEKB 2JVKA 4UAJA 1DS6A 4QUKA 3M5CA 3BDVA 3UJ8A 1QR6A 1E9VA 2HTEA 4RVNA 1Y7PA 2VTKA 1CQJA 5EUMA 2EIXA 4Y2PA 4B48A 4D9BA 4OU4A 2ZRBA 5AKYA 4DRXB 1P2BA 3CG0A 3G5AA 4XOUA 4QQFA 4E1VA 4I6EA 4Q3LA 1OI4A 4Q3BA 2G3YA 2VBFA 4ZO9A 3VR5H 2PXHA 4CM5A 4B40A 1LBIA 3H16A 4FIZA 1WZEA 1M10A 2P9GA 3IC5A 4R1OA 5CGZA 3PGJA 5CH8A 4CR6A 2BZ0A 1PGQA 4XQGA 1T5OA 5CFNA 4RPIA 1VMKA 3GNSA 4HTFA 1WUTA 5LKRA 3LUGA 2IZ0A 1DG1G 2QM7A 5GQSA 4LDPA 1E6MA 3F3YA 1ZLXA 4QOHA 3UCEA 4MAMA 1AS2A 3CUYA 4NBVA 4YP1A 2UKDA 2NZUG 2G8NA 4Y2JA 4DA0A 4I4TB 4EPVA 3P0FA 2YWXA 1GTRA 2HCFA 3IJPA 4KNWA 2CXOA 1RS0A 5JAMA 3CQ9A 3B7WA 4PHGA 1BFUA 1UANA 1CSEE 4BC0A 3H1PA 3NTLA 1QMGA 1Y1QA 4XEHA 3BL5A 3W04A 4CM8A 2HI0A 3PQ5A 4GXRA 4IUDS 2VXOA 3FKSD 1VCIA 1B8UA 1W5TA 2B20A 2JBHA 2OMKA 1AQLA 4LPKA 1JAYA 3U56A 6PFKA 3ZDAA 3KJQA 3LK6A 5KDLA 2BUBA 4GPD1 5KEIA 1GT6A 1NVKA 2X7HA 2D5AA 4OI0A 2YXNA 4GM0A 3OT4A 4C0LA 1OBFO 4I1YA 1KVSA 1XD2B 1SIWA 4ZU1X 5GZ6A 5DT2A 1M1YB 2GHRA 4J7XA 4C0SA 2DY0A 4H1TA 4MIYA 2GXAA 1U3VA 5EJIA 4E2FA 1SBQA 2JAOA 3P71T 1F9AA 2E48A 4HZUB 2Q3JA 1JQDA 2BFPA 1V41E 4RJLA 4TV9F 3U3XA 1PX0A 2EDCA 4XDGA 1BDJA 1P81A 1SBYA 3EVFA 5F2EA 3WA7A 3ZU5A 4YRAA 1FXWA 3BKWA 1Z5NA 4KMRA 3RC8A 4BJ5A 3R6GA 3NTRA 4BQSA 3SWWA 4ZTZB 2EZUA 4IDCA 3WMEA 5J2UF 2GZ1A 3T35A 3HYNA 2ZJYA 2H17A 4DRXA 2AMVA 4UU1A 1B0AA 4YCLA 2BEJA 2XMCA 3K1AB 1QTQA 4F6LA 2Z95A 4H27A 2OV6A 3MMNA 2GD6A 2UV8A 5HKOA 2PZFA 3JVUA 2IUFA 5AI5A 4RADA 4E6PA 3ZEIA 3Q7SA 3S3TA 4RKYA 4TVKA 3RNLA 4HTFB 1YE5A 1U65A 4QVIA 2FFHA 3SM3A 1JHYA 1A0OA 3SC3A 3DBRB 2A5YB 1N2GA 1JLLB 9LDTA 2ZYSA 3PWSA 4JC0A 4M8NE 3T5CA 1IZYA 4HN2A 3Q3IA 3O4IA 4CXMA 2WU8A 1RABA 2W11A 3AP2A 1KHHA 2ENUA 2VWPA 2HA7A 4PR3A 4Z3OA 3HR8A 2ZQZA 4WOPA 1BMQA 2FZCA 4V02A 3GU3A 4LZOA 1PJAA 5E4JA 4QRDA 2R0QC 1NATA 3C70A 4Q3EA 4MQEB 4FP9A 3GPLA 1ZR4A 1QG4A 2W8BA 3PHLA 1ATZA 3C4JA 2PUJA 4D80A 2ZG6A 3TZBA 2XE8A 1LJ8A 3OOWA 3TX6A 3G9QA 4JL5A 1NU6A 4JLJA 4PPGA 3GGSA 5EGNA 4L5YA 4U2FA 2VYFA 4WZAB 2XMDA 2GAJA 4NHEA 4C06A 3AY0A 2W37A 2X2PA 4MK4A 2PQ2A 3I9V6 3DWIA 4PEVA 1EK0A 5GP1A 3RK4A 4DHEA 4DTIA 2E5WA 5EPOA 2W2PA 4EG6A 3C3BA 5A04A 2Z6QA 2NYUA 2FV8A 1BN7A 4FHDA 4ND4A 4O4HA 4BV3A 1B4DA 4FM9A 2ZE5A 1XNGA 3VAYA 1QYVA 1AGPA 4MR8B 3N0WA 4KVAA 4L02A 3U44A 3NJ8A 4WWHA 1MRNA 3FM9A 2AOUA 2WSLA 4LFBB 3HDQA 5LZ4A 2MR6A 1ECJA 4UEJA 1QS0A 2FPPB 4G0XA 1JFFA 4DY6A 4ZCMA 2BHLA 4WBNF 1KOJA 4RH3A 1EWRA 3D3EA 3KNZA 4IDGA 3W05A 4B7AA 1ESDA 1JEQA 1PT8A 3OMWA 1JQAA 1VGQA 2IY7A 3MWDA 3DM5A 1QDLB 1Y4AE 4I1UA 4AJHA 3WGUA 1T5TA 1RIFA 3QYAA 2PX3A 4BB6A 3L0PA 4WFQA 5ECDA 4ZHQA 5B2EA 4ND8A 2K7FA 3VSBA 3A31A 3PKIA 1VL2A 4AJLA 4S1VA 2P2GA 3ZK8A 2X9QA 3BRSA 1BN6A 3E9DA 4BWVA 4U63A 3FBWA 4NVRA 3BCRA 5IG2A 3UBMA 2CDRA 3M2PA 3VPSA 2GGSA 3CBGA 4N5LA 4JX9A 3KDPA 5E6RA 4CKCA 2FSIA 2CCGA 3MLBA 2ZIXA 1IM2A 1X94A 2C31A 2JHFA 3H65A 4KXVA 1QFJA 2P4SA 4EYKA 1Q17A 1WOMA 5T67A 2ZKLA 3T3MB 1TCBA 4F9GA 5AKJA 2JA1A 3PWKA 3OE7D 1EFRD 1XMPA 2XA9A 1JR6A 3UHFA 1E2KA 1VG8A 2PKWA 1V4BA 2CBXA 2X8WA 1M2GA 1Y9JA 2FRXA 4PAMA 4BYMA 4F60A 1BO6A 5GJBA 3GP3A 1EJBA 3QBEA 3K0CC 1NPTO 2BGGA 2GM3A 3WV4A 4QA9A 4EI2A 3MJSA 3D3QA 4JZYA 3I62A 1L3CA 2D5LA 4ZQGA 1PR3A 1D2EA 3V1MA 3Q1KA 4FHGA 1XOIA 3CF4G 3FNGA 4AG6A 2I2BA 2O0JA 1JI0A 2VQSA 4ONEA 5BQOA 3MRSA 4XJXA 4ZTUB 5CJPA 1JIJA 2B6HA 4MJ7A 1JYSA 2BF7A 2ZGVA 2ZREA 4B8YA 5EESA 1HDIA 4UBMA 2VNHA 4QKQA 1Q77A 1NR1A 1EE1A 3I01A 1RBQA 3RVKA 3THXA 4PHTA 1JPVA 2XUGA 4R4JA 5J5CA 2WM3A 3IO5A 1DV2A 2A0FA 3B48A 1J4AA 2OC9A 1GUBA 3E27A 1EUDA 3PYXA 1NR5A 1XWIA 1VBKA 5TQ2B 4ZHQF 5HJ7A 5LJLA 1O9GA 2BE7A 2Q99A 4M9SA 3VBEA 3K94A 5PGMA 1C7ZA 4W8GA 3R3HA 2PANA 3IEKA 3WLOA 3PEWA 3K70D 1LTKA 1S9DA 2R96A 4KZPA 3WQQA 4ND8B 5DI3B 2YHSA 2I91A 1IRXA 3A28A 1ELOA 1KE1A 3LQ4A 1WVMA 2OFPA 4E70A 1CF9A 4EG1A 4PAGA 5EE0A 3I1YA 5E0KB 5KJEA 4PZLA 3L18A 4FTWA 1ZD2P 4H0FA 3KCQA 1DADA 2GWRA 4B87A 4D0SA 1NJ6A 3AUTA 4FGJA 2Q5EA 4A0QA 3PVZA 1CJUC 1KAEA 2GZ3A 3C3DA 2VF8A 5ALEA 5G3ZA 3BULA 4OX9B 5JAZA 1OD6A 1T1SA 4K3VA 4RACA 4A82A 1JJBA 4XLTA 2JLAA 4D0NA 4TMFA 3G5UA 3GI1A 3T5GA 3G17A 4BVAA 1TYDE 3DOOA 1IOLA 4G8CA 2G6TA 4K6FA 1HFEL 2VF4X 2DF8A 4Q6BA 5B7QA 3VVMA 2VDNB 1PD1A 5H83A 2MDTA 2SKCA 3BA6A 5CB8A 2NP6A 2ZYHA 3P0JA 3CNHA 5JH7B 1WIWA 1GR1A 3BMNA 1BS1A 2DUUA 2J45A 3QW4B 1V4VA 4J0KA 1PWEA 3EZNA 5DHSA 3AWDA 3S0JA 4ZQHA 5J43A 5CCBA 4XOIA 5LLTA 1PI3A 3BFPA 1T5LA 3OJEA 3Q7TA 3QKUA 4IIVA 3MTJA 1U3FA 4DCTA 1YK1A 4ENTA 3ZX5A 4F72A 4MV5A 3IDAA 1G7TA 1NC1A 1QG0A 1ZK4A 1Q91A 1F14A 2B99A 2QI9F 4O25A 4N9WA 2HYIC 5J40A 2AMFA 1ADYA 3KAJA 3U4DA 1DX9A 3C48A 3VC7A 1E5TA 1Z5WA 1G3IA 4R8RA 3WNCA 1KQGA 2V3WA 2CFOA 4Y2VA 4RVFA 4HGQA 4KSBA 4FEYA 2WWGA 1ZUNB 3BFJA 4EW6A 2R6DA 5EJ7A 1QZ3A 5H59A 1JYFA 4X66B 2QLJA 3HEAA 2GJ4A 3F7NA 1DLIA 2XCUA 1YQGA 1XRMA 4FUQA 3TTTA 3G3EA 2OM2A 3RDPA 2YR0A 5I7OA 4OHUA 4R6XA 5J63A 5BY2A 3FUUA 1BMFA 4M3NA 4LWOA 2IDMA 4TMTA 2DBZA 3RCBA 1F5SA 1TMOA 1S96A 3N7TA 1I51A 4YR9A 3MTGA 5G2OA 2AJBA 3MWEB 2AYXA 3T1HB 1VLQA 5FBLB 1CZKA 2ZVQX 3DE6X 4B2LA 4PQRA 3ZWWA 4GKJB 1IN7A 1LQ2A 3ZIAD 5EXXA 1SXJC 2QTVA 1G41A 3JQ8A 1GRNA 4TLLB 4KXMA 1IOWA 3DH0A 3M83A 1UIMA 2JIQA 5DBIA 4C20A 4CLOA 1FQKA 5G41A 4DILA 4Y9TA 1S89A 1OJLA 3H5VA 4MCIA 3DS8A 4CIDA 4DT1A 1AXEA 1U31A 5AKEA 2J7KA 4I1VA 3JYPA 2ZT6A 4A8TA 5KNBA 4LK3A 1AZLA 1KZGB 4Z4GA 4CFSA 3VDNB 4WNYA 2B1GA 4ZT5A 4RIGA 1D6MA 2A78A 1UQTA 2P1DA 3CUSA 3OEYA 1K4MA 1B14A 4G41A 4Q9HA 3MW8A 2EYQA 1H2EA 4C7KA 4G1CA 2KQUA 3L7OA 4J90A 1RVV1 3M9XA 3VPAA 1O8CA 5CYFA 3QE0A 3ZBTA 4BMCA 1JHZA 4G9GA 4YCBA 2VQFB 1AV6A 1RU3A 5BR8B 2C84A 2BYTA 2Q5CA 3OC0A 4WLVA 4OXRA 4BNDA 5D3KA 3KZ1E 5DTEA 3NUZA 4JODA 2FW7A 5FR2A 4I3HA 2FP4B 4JOCA 4RD1A 5L53A 3QPWA 4WLFA 2B8EA 2AR9A 3G6KA 3IULA 2GZ2A 2V1XA 3LRXA 1AUPA 4EPWA 4BQPA 4XQCA 3GDFA 3SLKA 1KI9A 1SQFA 3OZWA 5HIIA 3UAVA 3WLPA 3DE7X 2E6KA 2QD1A 3EEOA 1G16A 3DB1A 1DBSA 2BDTA 2L42A 1P0FA 3PC4A 2PWBA 2V74B 1XTSA 3EIOA 1O9BA 2XPCA 3ON5A 2WP8J 1R5BA 2P30A 4B7ZA 4BQQA 5K6AA 2FGJA 1HMYA 3LX6A 1V1RA 3Q5EA 1THZA 4ZRDA 2FOIA 4E22A 3A9SA 1QRRA 3TPCA 4Q3OA 1SQ6A 2HPVA 3LGXA 1PGOA 1IEWA 4XQEA 1IBSA 1PFVA 1OTXA 3P97A 3G2IA 4AQ7A 1P0CA 1SFRA 1N25A 4X6YA 1H2BA 4RQUA 1N5OX 5J2UB 4ZGWA 4GLJA 2C78A 2OORA 3NORA 5GONA 4BNLA 1UBLS 1NSFA 3DKPA 1B3RA 5CT5A 4C4RA 3HJGA 3VZSA 1DAKA 1DUSA 1KEPA 2HA4A 2Q9BA 2QMOA 3CLVA 1O57A 1OHHD 2XCIA 3HN2A 3QGMA 4GG1A 4YYEA 5LP6F 2GXUA 5TIIA 4RGYA 3EXIB 3FCAA 3DVLA 2VZ8A 4FGWA 2YZ7A 3ELBA 4C0JA 2WVHA 1T0PA 3N75A 3FRIA 2HWXA 4RGQA 4TSKA 1E2QA 3AR5A 3WJ7A 1UPTA 1YQTA 1E4EA 2B94A 2E9SA 3ANLA 4H1UA 3X1WA 1H6BA 1UM9B 1FUEA 4K46A 4R83A 3ZQKA 2B4KA 3THWA 4Z1MA 3FX2A 5JFOA 3HLKA 3IL2A 3WWDA 5B1SA 3PYMA 3AEUB 2V45A 1N6KA 1UPXA 1E59A 3OT5A 4UXHA 2RHOA 4K9RA 3AVXA 4HAYA 1U8EA 4URYR 5CFZA 4J3NA 3PT5A 4Z7OB 5C37A 4KXLA 4R68A 4MS4B 3S2FA 3QPAA 3AEZA 5A05A 1W48A 3EYAA 3N28A 5FPYA 1H5UA 1Z34A 3M33A 5H9WA 5AUOB 2PBLA 4J3JA 3CO5A 2RGEA 3CWCA 1CT9A 1RE1A 3D6MA 3FNRA 2AJCA 1KJWA 2I2WA 1E1YA 3NHRA 4EABA 2VSXA 1J0AA 3FMFA 3IB3A 1OUMA 2PKRA 4II3A 5CW2A 1X7ZB 1X8XA 4E09A 3W8FA 1F7UA 4UTZA 4P98A 2ANBA 3TTYA 2IU4A 4L5CA 2NVUB 3SEAA 2AUNA 1R8SA 3NHBA 4GHWA 4ENPA 3E9CA 3U26A 3H5AA 1HE8B 1VE5A 4JFRA 2F64A 2IYEA 3H6KA 5K7SA 2C00A 3CNQS 4IIGA 1E2JA 3BBLA 2WUDA 3AR4A 1LDNA 4RZHA 2FPIB 2QORA 3IIEA 3SZ3A 1OI3A 3H9GA 3S7ZA 4E4RA 2P2CA 4KKVA 1L5RA 1QPBA 4P7GA 3WXMA 2WNIA 1BWPA 1NUAA 4CMEC 1EVYA 1X2EA 3CX4A 3WMXA 2RCNA 1SN7A 3SVLA 1YR7A 2E1RA 1WHSA 4WCFB 5AKIA 3ZWNA 4DR2B 5A7GA 5DBGA 1Z4QA 4EMUA 5ILGA 4FC7A 3L6EA 3HRHA 1S2IA 1TK9A 5CJ2A 4WEQA 5ELMA 1KE2A 3KKQA 3NP9A 2R1TB 3IKMB 1V37A 3HN6A 1FQJA 1EGHA 1JLKA 1QCDA 2FFRA 4ILEA 3WKAA 1QNFA 4HAOA 3K09C 3ENWA 4CT4B 3A6ZA 3AV3A 1NF9A 2Y4NA 1WUIS 1DQYA 3K35A 2BEVB 5BV0A 5I9LA 1CUGA 1LLCA 4JI7B 2BH2A 1K97A 4QEZA 1FZTA 3BCUA 4OHPA 3PQEA 4HLUC 2I4NA 3Q2KA 2QJRA 1V16A 4HDKB 1KK1A 1U2PA 2ES4A 1GQYA 3SHTA 5HE8A 4KRYA 3B3QA 1JDSA 3NVKI 1QAMA 2C4MA 2VJYA 1E1DA 1S3SA 4G5HA 3UPTA 5K3EA 1WSAA 3DMPA 4YO8A 1PQ4A 2O20A 2OCKA 3OCYA 4NPAA 4PYQA 3VU3A 4ASUD 1M54A 2C7RA 2RAFA 4XB6B 4A0RA 1JILA 4KH0A 2QN6A 1HTWA 1Z7WA 1ZINA 2YHIB 3KK0A 3TRHA 3UCXA 2VQEB 2BKLA 1FFBA 1TVKA 2DTXA 2VOEA 3E82A 3S2UA 2BEUA 3TUZC 3X1MA 4X1YA 4CL0A 4ESHA 2CFIA 1SUIA 1PG0A 1R12A 5B1HA 2M6LA 3FCUB 3T7CA 1FFXA 3TPFA 1QO0D 5A9RA 3GLIE 2XGOA 4LY6A 1X9IA 4Q01A 5ALQA 3BF7A 4FYKA 5A4MS 2F8MA 4KQCA 3EX7C 2X3YA 1QP4A 5ESDA 2PKQO 4MP8A 1W0JD 2PU5A 5IVKA 5LMUB 3HO6A 1JQ5A 2SCUA 5CDFA 3QLTA 4QDKA 1OBVA 3I23A 1T5BA 3AUFA 3P0HA 5E7QA 2BFDA 1RJGA 4NV3A 4GE3A 1KOFA 4BCDA 1JU4A 3D7NA 4DMKA 2GA8A 1OVMA 4QXQA 1XTZA 1XX6A 1TYBE 2JGNA 3JU3A 4TSRA 4C01A 1ZW6A 2ZJBA 1CUYA 1JXQA 1O7JA 2IU3A 4B0PA 3O47A 4EUEA 4ZYYA 1XEWX 3LG2A 3L8YA 4HEQA 1V8BA 4LBYA 3N2YA 3U7EB 5EXPA 4BE4A 1UBMS 2GTPA 3TB6A 3VTAA 2ODNA 3W9BA 1T8SA 3ODGA 3CMMA 4HYYA 2AN5A 2W2QA 3FYUA 2GN6A 5EIFA 10MHA 2DPHA 4ER7A 1ZD5A 4CM9A 3TTWA 2JCVA 1NHWA 3W6PA 1N57A 1NVMB 1WUYA 2ZUVA 4R2IA 5JALA 1XAJA 1MIOB 4WZBA 1U2RA 4GBGA 1L7EA 4REQA 1OIXA 5ALZA 4BO2A 2FG6C 3PX2A 5M04A 1CP2A 4N40A 1H22A 4E32A 3LC7O 2WABA 1M2KA 2JFVA 2PUHA 1DIAA 3VVLA 4OAQA 4WNAB 1J5EB 3L79A 3DOFA 4KO3S 3NO4A 4WJKB 3L6UA 1T25A 3LQKA 2C9OA 5CM8B 4YREA 5JNRA 3NGXA 1XPUA 5K3FB 3ORHA 4UCQA 4N65A 1F8FA 2GARA 3RK0A 1ZNWA 5AXCA 4U5QA 4COOA 4HGPA 4DEVA 4FOTA 4ISBA 4LA4A 3R7SA 3QKTA 1NQXA 3M6VA 2DG2A 4KE7A 2I6FA 2ZSHA 1UFOA 5L4SA 2A7XA 1JSRA 4JX8A 2G07A 4MJXA 1MZPA 2H1RA 2IDJA 3A4IA 1CIVA 1LJLA 1JLMA 3KQSA 4NBNA 1QP0A 1A1SA 2WIGA 2PTGA 3DHVA 2DQSA 5EXEA 2EBWA 2O1WA 4DYHA 2HC9A 2QIPA 3I45A 4QEDA 4TYMA 2Y4OA 2G4CA 4TKUA 3CXRA 4I08A 2OB2A 5KMGB 1G5QA 4NDAA 4GKBA 2AWOA 2NOAA 4CCWA 3OOHA 4J2HA 4YJFB 4D3XA 3EY9A 1HA3A 4A9AA 3I30X 2P4EA 3C98A 1RQ2A 4JUCA 3UW1A 4XM0A 3UK7A 3ZWXA 1T36B 2CDAA 3T34A 2W2KA 2R7NA 1GDDA 4ND6A 1SHKA 3UXEA 2Q5JA 2BLNA 2PMCA 3CZ5A 1RQNA 3EA4A 2ZUWA 4C0WA 3SQDA 4ZOEA 4BZWA 1RRMA 1Y3AA 2HGSA 3KKMA 1I33A 3SDBA 4L8GA 2VHZA 1RRKA 3FAKA 1O8BA 1ZMTA 4I4LA 1OC2A 4WZAA 3AF6A 5MHTA 1G2IA 2EKQA 1AGYA 2QUIA 3HU2A 5EKSA 1SVUA 1P7CA 1Z47A 4B6GA 4EJ0A 2GHQA 5IJWA 2FPLA 1M2FA 2GZDA 1UFQA 4P1ZA 1CJSA 4C4TA 1GFSA 2IHUA 4DA8A 1F6BA 1NQUA 4NJOA 5DBOA 1R6XA 4C3VA 5HX7A 3V3KA 3FSJX 3MGGA 5KNCH 2JIOA 1VYUA 2XBLA 3PV0A 4HDCA 4X8LA 5JBIA 5KYWB 4ZN6A 1GVNB 5C1DA 1G55A 2WHRA 3WRYC 2HXYA 1IFXA 4PRZA 1GD1O 5H82A 4RLQA 4LIPD 1GZVA 1M34E 3ZHUA 2PXXA 4OAOA 4QHYA 3ZTYA 1UMBB 3QOFA 2G88A 2O52A 1IY2A 2G28A 3F0TA 2WR8A 3G5TA 3B78A 5IH3A 4DIUA 1KEWA 2Q3HA 4RK7A 3PU6A 1T5DX 2AJ8A 5IJXA 4WXRA 2MSCB 2X0KA 3TL2A 4G6ZA 1SVLA 1P6QA 1PE0A 5C5CA 2O14A 4YIHA 2QEQA 1TKRA 3AW8A 3HSYA 4P34A 3MJRA 5IM4A 4XGRA 1QDEA 2X1VA 1KKUA 1G8YA 4AY6A 1OIVA 5FT9A 5F2KA 2QMUA 4FJ1A 4C14A 3U49A 5JU6A 4BMYA 2R5WA 4GD3Q 3QZUA 3WKDA 1HFKA 5F7ZA 1PR2A 1AGXA 1KZ7B 1NQWA 2QQFA 5FQNA 1TK2A 1YO6A 3EA0A 2PQ0A 4DCSA 1YS6A 2ZP1A 4CKBA 2OCXA 3A7EA 3D5TA 5A03A 2QJWA 1I6LA 1WULS 2HBQA 2VHTA 3IQXA 4YGYA 1SXGA 2CN1A 4KQMA 5KWJA 1ZWLA 1DMRA 1XJ5A 1OXVA 1LPPA 3ILXA 5DCLA 2F1HA 1FU7A 1QHNA 4Q7JB 4RS4A 2CLOB 1JHAA 1OMOA 3VA7A 2XWPA 3HP4A 4Z1OA 3U6BA 3GROA 2PFSA 2WJ4A 4IIYA 3MA0A 3VR0A 4B7UA 1OJ7A 1D5CA 3K0FA 2IPXA 3AFIA 3PNPA 4MYRA 4PGFA 2X23A 2XUPA 2K7ZA 3FHLA 4EA9A 1KYVA 2A0WA 5JYBA 2QUAA 2WG2A 1RR6A 1CRQA 1U0FA 1YH3A 3HKBB 3Q10A 4GI5A 2XVYA 1L4GA 2ZIWB 3MT9A 1PVOA 2AR7A 1X13A 4MQEA 3TO5A 4JOSA 5HOQA 1M34A 2HW8A 4EFLA 4TWAA 2XXBA 3ASVA 1O95C 4ZCLA 5AW5A 3OLWA 5F2NA 2DC1A 3NWEA 3PA6A 3LQRA 2Z6UA 1ADFA 3RTDA