5GAJA

Solution nmr structure of de novo designed ploop2x3_50 fold protein, northeast structural genomics consortium (nesg) target or258
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
134
structure length
134
Chain Sequence
MGTVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRVLVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DE NOVO DESIGNED PROTEIN OR258
publication title Solution NMR structure De novo designed PLOOP2X3_50 fold protein, Northeast Structural Genomics Consortium (NESG) target OR258
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 50
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5gajA00
2LV8A 2LVBA 2KPOA 4J29A 2N75A 2LNDA 2L82A 2LRHA 2LR0A 2N3ZA 5GAJA 2MR6A 2LTAA 2LCIA 2L69A 2MR5A
chains in the Genus database with same CATH superfamily
1YB6A 4OP2A 4OJYA 2CLDX 3FR7A 3FNQA 3MAAC 2Z2KA 4A4DA 3W5DA 1L5GB 5CAEA 1VKNA 2BKXA 1MU0A 3DMTA 5IDVA 3QWBA 5D2CA 5G1PA 1CYDA 4Z9XA 4Y6QA 3V8RA 1EJ0A 3M4YA 4GM4A 1ZDMA 1NRXA 2DG2A 2B2XA 2XUZA 5I3CA 3AIKA 1T1SA 5FYQA 4H0CA 4Y2RA 1HKUA 4WNYA 5BRAA 2WFLB 3ETHA 4P2GA 4EPWA 5AXAA 2VNAA 1WUYA 4LXGA 3F9CA 1EJBA 3TDKA 2FRDC 5FOXA 3BS4A 1QIGA 2E5FA 3PQ4A 2UYGA 1HQYE 2GLTA 3CVWA 4H1VA 1T9AA 1WQ3A 2PTHA 4YACA 1N2IA 2Q27A 3QLUC 2UZ0A 5K3SA 2NU8A 3SQLA 5AW7A 1UIRA 3MPOA 1Z36A 3MRSA 3PUZA 4RANA 5A03A 1HLFA 2R7MA 4QODA 1YSCA 3K73O 1V3QE 4N8SA 4PIPA 2YWHA 3WWYA 2XDWA 2DQKA 4D6XA 3DT6A 4YAOA 4KIGA 5BW5A 3SXJA 1OD6A 1T8PA 1CZUA 2D1YA 1SUPA 1QK4A 2R6AA 1YF3A 4BO4A 2V97A 3IBYA 2IL1A 4LYJA 3OIDA 1FBTA 1M6HA 2XJ9A 3WRYC 3OF5A 5KVAA 1DFHA 2FFHA 5D3ZA 1AGXA 3O9VA 4HDKB 5JQWA 2F1KA 1S89A 1KS9A 1W5TA 1XTPA 2ZB8A 4KXXA 3TZEA 3L7JA 3VX3A 2PAAA 1WWKA 2NACA 4PHGA 5T4HA 1KMIY 3W2EA 1J8QA 5KDLA 1S5PA 1DDOA 3K9FC 1MB9A 1HT2E 1R0CA 4CEHA 1QFXA 1RQNA 3NOOA 1LTKA 2ZRDA 3AEKA 3QY0A 2OB1A 2QTAA 2QD2A 3ZGZA 3I1FA 2HSEA 3CS3A 1U7OA 3KZMA 1KQOA 3ORYA 3SNKA 4JWTA 1IHOA 4EHBA 2H92A 1JHOA 2AW3A 5ALFA 3NWOA 4G0WA 1SH7A 3KJIA 4W1RA 1KU0A 1WXIA 5D5HA 4ALMA 4ZK6A 1NKSA 4YAFA 4BUZA 3A37A 4OYYA 3L06A 1BDBA 3WIEA 4ZEVA 3D3EA 3O84A 1UJNA 1QHGA 1VCIA 3CRZA 4P3XA 5FTWA 5IDYA 3WHPA 4AXXA 1OOEA 2FMTA 3P9IA 2B2NA 4ZI5A 3IUBA 5DW3A 3LBYA 2E1PA 4Y3UA 1SVMA 1N6OA 3IDFA 2QD1A 3E2PA 4C01A 2CSXA 2PUCA 1UMDB 2AZXA 3PXGA 1NDQA 1OVMA 4ZTUB 1CZNA 1II9A 5DK6A 1G7SA 1GKUB 1Z0KA 2JFPA 2PKCA 2VYCA 3O4JA 1BS9A 2AEMA 3I9V1 4J0JA 4MVJI 4U9UA 4NJOA 1E0SA 1MF7A 1MDFA 2QU7A 2QUJA 4KE6A 4B4OA 2C9DA 4F04A 4ZGGA 3B12A 3GN2A 4ZQGA 3R3VA 2RMKA 3LQYA 3BJMA 3DYBA 2PRIA 1WB6A 4NPCA 3GJ7A 4IJWA 2OMKA 1RI5A 4XW2A 1HZZC 1OWMA 4L27A 4XTCS 3FRJA 1M34E 3DOOA 2FVYA 3GY0A 4IS3A 3T15A 3N05A 1Y48E 2X5KO 1H8HD 3E7XA 4I14A 2MOKA 2QRVB 2V6IA 2ZBQA 2ZRFA 1RYDA 2GCNA 4OFWA 4LJ7A 1JJVA 3RTGA 2V5UA 5AVQA 4UBIA 2AMVA 1W36D 2I8CA 4WY5A 4BX8A 2O1EA 4KC0A 5HXAA 1OILA 3QWIA 4JGGA 4E4YA 2OCIA 4N48A 4FDAA 4INZA 2JVKA 3E5MA 4WNIA 5A3VA 3HKBA 4TTAA 3P2IA 3DF9A 3CNOA 4QJ3A 5HJ5A 1KQPA 1X1EA 2P8JA 3SEZA 3SYNA 1SM4A 1S4MA 4KJZA 5HFJA 4YAKA 5EPEA 3PENA 4LHZA 3IURA 2H48A 2ZOSA 4DA7A 1W4AA 1U2DC 2BJVA 1RYZA 3AIMA 5E4YA 5FPYA 3NDPA 1X1CA 4IWXA 2C1EA 4QPDA 1RIFA 1B6RA 1G6HA 1PR3A 1X7YA 1F0KA 1H1TA 2BBOA 2JFOA 3OKAA 5JATA 3LF2A 5ITWA 3AF3A 3ZCPA 3M82A 3VOSA 3ZI4A 4N7BA 2VCEA 3D3KA 3HDHA 3S1SA 2W8BA 2HK9A 2XD4A 3OECA 3FOEC 2GK7A 3EIUA 4LC1A 4D2IA 2R7AA 3DC7A 3H99A 4LF9B 4E3ZA 4XGRA 3NH6A 4I4TF 3AUTA 5A04A 2W4MA 2VPPA 5LDHA 2DAPA 4R6XA 1R00A 1N9ZA 3GRYA 3EDCA 4G0ZA 2A9KA 2WFAA 3EN0A 2F59A 1JQBA 3K8ZA 4KDCA 4MW5A 4D6PA 1JA0A 4LZNA 2BH9A 2QLMA 4NENB 5C4GB 3S7TA 4A73A 1C9KA 3U4QB 2CYBA 1CY0A 3GNQA 4BASA 3BDIA 2AZ4A 3PEUA 3MT8A 1AV7A 1SB8A 1KYWA 2O1XA 3MB5A 3I83A 1SAYA 5JWHA 5JW6A 2X1MA 3BICA 4JLNA 1V0JA 1PDWA 1ETHA 1LB1B 2GSDA 2HPVA 3ZYZA 4ENRA 3GJQA 4ZU3A 2Y1FA 1CR6A 4K03A 3NHPA 4LHXA 2P7HA 4N7MA 3UV6A 4DEVA 4YMVA 4LMPA 1L7NA 3O3NB 3L6OO 2IH5A 2WK1A 2QM0A 4CWAA 4MUFA 1LCIA 1A1SA 2ZUDA 4ZYYA 4UDNA 5G53C 5SZIA 5JYEA 5KWVA 2DFLA 1A5AB 1GARA 1GFIA 4FTWA 3DNFA 4TQAA 2NO7A 4NH4A 3ZHRA 1GQSA 4GMXA 1PD1A 3ZIDA 5I51A 1L5OA 4FGWA 1LRJA 1TPZA 4RHFA 1DVRA 3HYSA 3EARA 1TJ5A 1JEOA 2VP3A 4B4DA 2OZLA 4HD8A 4UFPA 4RKQA 3TW8A 3F4LA 4BNKA 3SOPA 3CONA 3VSCA 1COWD 2VHEA 2E89A 2Q3DA 1VHJA 1JEDA 1ZGAA 2Y71A 4JX8A 4WT7A 4YFVA 2XGJA 3HFJA 1ARZA 4UHFA 4PAGA 3E35A 2H07A 2WVHA 4BB0A 1G1MA 5IP5A 4GX2A 1VGVA 1YQQA 4DXDA 3NHSA 3SQDA 1F5NA 1UWKA 2PSEA 5K8UA 1VXRA 5A05A 2X0FA 5F2NA 4DMFA 1KYYA 1DAGA 4EOGA 4MQEA 1M2OB 1H0SA 1UBFA 4YBRA 2NPIA 4P7FA 1XXHB 4FB4A 2IH4A 3VHRA 5KOHA 3ZJUA 1CUAA 5LLTA 2IV2X 1RJ9B 3RVSA 3ZEAA 4YCMA 3OE7D 1UP4A 1ZMRA 2B1IA 3NWPA 2V7QD 3AZQA 2KB0A 4JXZA 1GPLA 3IH5A 4BX2A 5HP4A 4B4UA 2KLBA 1VCHA 1L5MA 1DQSA 2XWPA 1KFEB 4K8OA 2DULA 2FWBA 1JT9A 5F73A 1I32A 2H4WA 1ZA2A 2DCUA 4OGWA 2C4HA 2W6JD 1EZ1A 4PAOA 1L7OA 1XP8A 3RSGA 1XNRB 2VP0A 4ZAYA 4B33A 2VQEB 2GVNA 2XE4A 3H9EO 1EX7A 3N74A 1VE5A 2KX7A 2OXIA 1NXPA 3K8OE 5FLKA 4B3CA 2IEDA 4RU1A 4BVFA 2XVZA 1BOFA 5ESDA 3V00A 4PGHA 4JYCA 4R2WA 3RO7A 3B1JA 2CHVA 4D4IA 2EG9A 2AG8A 3WK9A 4FLFA 2FSVA 4GQBA 4BDTA 3V8NA 3VHLB 3F5DA 2DEUA 1G42A 1GPWB 1Z38A 4QBTA 1IUOA 4KBGA 1QGAA 5DBGA 4B1FA 1UPXA 1CD5A 4F8JA 2V7TA 3DXFA 1Q2UA 1YR7A 3LS2A 4TOIA 4ZVQA 4DNXA 3FGZA 1JQJC 3EXHA 3ZC3A 1SUCA 3RAFC 1KEPA 1RSZA 3GUVA 3USCS 4LHEA 1WU7A 4W5TA 1C7QA 3DHVA 4M38A 4M9CA 1F7VA 1EBUA 5DX8A 2QG6A 3A1UA 5HUHA 1NRJB 3WJAA 4LK3A 2P62A 4NBNA 1CUVA 1QNFA 3FDXA 2B1RA 4IVPA 3WQHA 1M2FA 1T9HA 2G70A 1U0RA 3FYTA 2JIRA 3M3HA 3QVJA 1RDFA 1ZCZA 3LPDA 3VU1A 1C7FA 1ZUHA 3AEUB 1KPGA 3H11B 3G7UA 4KQ6A 1RFLA 2IW3A 1ECFA 1Z6ZA 3QG1A 3GFSA 2B8NA 4I9NA 1EA5A 2P9HA 4GYYA 4RCZA 1JI3A 1C8BA 1P0IA 1AS2A 2OHVA 4RSMA 4W1SA 3KQNA 2Q6LA 4R31A 2Z83A 3G9TA 4HAIA 5CFOA 2Q7XA 1SXPA 4E1BA 4MP3A 2IYOA 1PT6A 4HVTA 3ZHVA 3LBIA 4YPFA 4YH1A 3CJRA 2YZ2A 3ZR4B 4EABA 4YYZA 4FNOA 3I9FA 2NVWA 1SOUA 4ZO9A 3E7FA 3O1LA 4LG1A 4BFLA 1TJ4A 5K8CA 2QA5A 1ONBA 2GXSA 2WWYA 4MO9A 3RTAA 5A2GA 1JKXA 1XZAA 1GNRA 4G4GA 3FPJA 4BP9A 1PS0A 2FN4A 1W44A 3NHAA 4EGJA 1M8FA 2VF8A 3P2OA 3U44A 4KWHA 5ICMA 4RENA 2GERA 1LU9A 4BMSA 5I4CA 1RRFA 3M1LA 1T3ZA 4Q4LA 2FJUA 2AXPA 1SK8A 4GBMA 1AKEA 4IDOA 3VOBA 3BHNA 4GC5A 3O4HA 4I1YA 4YONB 2BWJA 3UHPA 1II8B 1Y3CE 3ODGA 4C2TA 1A2QA 3LOPA 4QULA 5T8KA 3FPHA 2HBRA 3OOSA 1V8ZA 2ZQYA 4TLLB 1P9OA 4ZARA 3C41J 2ZBUA 3GQBB 1FC0A 4GRAA 2D00A 4R8MA 5JWOA 3EMKA 1TEVA 1A3CA 1DO0A 2CNWD 1U80A 4JUDX 1ENZA 1Q1AA 5DJ5A 5EOVA 4K0RA 3ZU2A 2P35A 3CXUA 2XUOA 3KP1A 4ZAGA 4CVNA 4V1CB 1L4EA 1ZM9A 2BSXA 3JAKA 3T4EA 1YBHA 1GAXA 1PQWA 3AHDA 3AR9A 2XRYA 1NLZA 3PYXA 4XLZA 1QGUA 1KYIA 3PGMA 4C6TB 4U7FA 1GT91 3L0SA 3QV2A 1PZMA 1WVIA 4K26A 1N33B 4XWKA 4KK3A 1OASA 1Y7PA 4JJEA 3EIEA 4CQLB 1EGVB 1W96A 2ZE5A 2QXYA 2FUNB 4FYJA 4JVMA 1V8FA 3H5TA 3BGVA 2F3UA 3WZ2A 3TJRA 1O97D 2JA2A 5JIBA 4Q9DA 2VA9A 1Y5IA 3NNSA 3ZJ4A 2Z43A 3FCXA 5CHYA 4BLWA 4JV5B 1FTQA 2C58A 4HTFB 3NC0C 4UJ3A 1BA2A 1I1NA 3FUXA 4LF7B 1BH2A 2GWHA 1T36B 5DTQA 1QGDA 1X70A 2MSKA 3ZVMA 1GSIA 2GCOB 3FB1A 5I4BA 3K9HA 1MABA 1M2JA 2XHZA 5D01A 5J4HA 2RCNA 4K6MA 3L0OA 4Q4HB 5MFPA 4V0LA 3H9GA 5EJ6A 1ZCJA 3BCSA 5BYAA 1TCAA 1CUHA 1HK7A 1TTHA 1KEZA 2WR8A 3RABA 2H0AA 3UIEA 5JLJA 2ZW9A 1N5RA 4CIVA 2IZ6A 3OURA 3W6UA 2C3OA 5C4IA 5IAGA 5P8WA 1LC3A 3GD5A 1QIJA 2AOUB 3EXEB 3VZPA 3X1XA 4ED9A 3VO9A 1FQJA 3C3DA 1QO0A 1P6QA 3QKIA 2POCA 1PR0A 3LDHA 4IDAA 1NFQA 5CNKA 3W1EA 5LMCA 4AXBA 3LLUA 4DBVO 3RYFA 4BQNA 1KXJA 4WCFC 5DYGA 1L9XA 4F92B 1X7WA 3VMFA 4WESB 3WTBA 3ULKA 5F5NA 1MOSA 1Y8RB 2I4LA 2HA6A 2NYRA 3MTAA 1SXHA 3ZZMA 1H4QA 1HMPA 2WT8A 4G81A 4A0HA 3RAEC 5K8JB 1QDEA 1QBGA 2PSJA 3HPRA 4C4RA 5TXGA 4X20A 1PKEA 3K6RA 1AVTA 1UDBA 1GU0A 1KKMA 2C83A 1I4EB 2ZYIA 1SBHA 3BZUA 4QU0A 5AKKA 4EUSA 2GDZA 1NC3A 1K8QA 2J3IA 1P4AA 3CLRC 4O2AA 4X24A 2XRMA 3TUJC 1YQXA 1CZHA 4LY6A 4UVEA 1AHPA 1N5DA 1GG5A 4MGKR 1LLDA 4YJHA 1KS2A 1GEGA 2PBLA 3IQEA 1SY7A 3IUSA 2VH5R 1U90A 4FP9A 4TLBA 5AM2A 4LOAA 2RK3A 3I64A 3VYWA 1AQUA 4MWDA 4N0PA 5G3ZA 3SBOA 5GIPE 3WDSA 1J5EB 4P34A 1Y8ZA 1KTVA 3DYVA 1DI0A 1L5WA 2AR0A 1V7ZA 2H1HA 2W90A 3KWLA 3SY8A 4ETWA 1F51E 1E1MA 4OATA 1YZGA 2LVBA 5REQA 3WBBA 2FEPA 3OX4A 1ESNA 4URUR 1K6XA 4F86A 4XVRA 1C9EA 3U1BA 2VHCA 3LRTA 4HMQA 4RSRA 4KR6A 1WM1A 4CNQA 3DBRB 1UAGA 4LVCA 1E9FA 2C5EA 5ISMA 4M0DA 2XNDA 3JVEA 1NNUA 2GXQA 4D1YA 1Y4UA 2I7VA 4RIHA 5HFNA 1AXRA 4DRXB 4LRSB 1RJFA 2OENG 3BA6A 4KQXA 4HX2A 3OIYA 1HZJA 3PGLA 2HPAA 3MMSA 4ITUA 5KYUA 4JT4A 3PWZA 2QGZA 4KQ9A 4OMCA 3TJZA 2B5OA 2JS7A 2V9PA 1WHSB 4V39A 4DCCA 1Z5OA 4DR6B 1WB4A 2GCGA 5C32A 1Y34E 6ABPA 1QLHA 3CIFA 2QBYA 2EVWX 1J8FA 2BDEA 2IYSA 3QIVA 3H5RA 4L75A 2OPBA 4DE5A 4GDMA 5JD4A 1MVOA 2YNMA 2PMKA 1T1JA 2DR2A 4Z1MD 4MI9A 3QVOA 3W77A 4QYWA 1DL5A 3PD0A 3SZ3A 4CM8B 5JZBA 5KNLA 2ECOA 1O89A 3GDHA 1KK3A 1VBNA 2DGDA 3RUIA 1QF7A 1S3GA 5EHIA 1KYTA 3TLJA 3T7AA 1O57A 1AXGA 3BULA 3KWJA 2HQ1A 5AI5A 3ROXA 3C3KA 2B5WA 4QUBA 3ZDBA 4MNTA 2WLTA 4I36A 4JS0A 4KYIB 3RS4A 1ODTC 5AKEA 1WP9A 2JF0A 3QE4A 1CZKA 4NZZA 3RRFA 4FIDA 1P4GA 1L4UA 2XGSA 1P19A 3RR2A 4P5PA 4J1TC 4WERA 5CB6A 4UQLA 1DIOB 4BFCA 1QFZA 1GG9A 1HFEL 1U0SY 1M10A 3TFOA 3B36A 4C04A 3AF4A 1ORIA 2IHNA 5DTEA 1V1JA 4KX5A 4KODA 3NJRA 5AYVA 2Z09A 3B1VA 1PJ4A 3UMFA 3RHTA 3C97A 2J0QA 2HRDA 1NPDA 1P72A 5ICFA 4H77A 5TNXA 3SZGA 1A9QA 1AQIA 1FYWA 4C4SA 4D79A 1F3LA 2WUWE 2D4HA 2X7JA 1T24A 4CZ2A 4GD3Q 2VCYA 4CCYB 2JASA 3ZHCA 4IJQA 2A9QA 1DWUA 2EWMA 3SEQA 2A5DA 1EYZA 4YCBA 4QQ8A 1R74A 2EGUA 1Q16A 3N2LA 2X9QA 2XCQA 5H1YA 3ZV6A 1E6WA 4MS4A 4G01B 2FETA 1A8QA 2WJHA 3L1KA 1NQOA 2OV4A 1QLWA 3WXMA 2HC9A 3O4VA 4O6VA 2A0UA 4PC3A 3IBSA 1E62A 3JQ7A 1UKCA 4I4CA 4K6FA 4KSCA 3V4ZA 4Z54A 5EJEA 3G8YA 4FSHA 3LQ1A 3NX4A 4IRUB 1JKFA 1PL6A 2C2BA 4PE5B 5LBIA 3QXHA 4KSYA 4RZIA 1RR6A 2Q0SA 1FIUA 4H7DA 4X95A 4ZD6A 1KJIA 4LI3X 4DEXA 5K0BA 1JHAA 1RVDA 2R00A 2YWFA 1YUBA 3I5YA 4YJ3F 2Z9BA 1ZZGA 3Q6NA 3GZNB 4KGDA 4P4SB 4X7PA 4B0OA 4CLDA 4RXMA 8ADHA 4F21A 3AFNA 2VHTA 5IYZF 4E2ZA 3KPVA 2E4VA 3ZWXA 1ZNWA 2A78A 3HHPA 3MZ0A 2GZSA 1N8NA 2JIZD 3O26A 2GD6A 5K51A 5CCEA 5A71A 4YROA 4PINA 3NT5A 3O7MA 4XIIA 1PQPA 2QLBA 3CINA 1DZIA 3RV4A 5JSKA 3II6X 4NCJA 2D7JA 3ZLTA 4EG0A 2BBTA 2C98A 2BH2A 2LKCA 2UKDA 1G6OA 2QR2A 3NHJA 2Z1NA 1E6KA 4RS3A 4B79A 4YAWA 4BLTA 4RLFA 5CFLA 1MEEA 4RC9A 3T61A 1J8YF 3EF1A 2LV8A 4RULA 3STXA 5C1BA 5ECYA 1TO2E 1QRRA 1KWKA 4CEJA 3RRBA 3TAHA 1AMOA 2BTQB 1FSSA 1MGOA 3P0EA 5AJYA 3OFKA 2GBGA 3RJZA 4DLXA 4F4JA 2YXPX 1E9EA 4O8CA 1SWVA 4LOIA 2OTCA 4LXHA 1PJTA 4I1PA 2NUBA 2Z9DA 4CU5A 1XQXA 3OSZA 1ICIA 2XCTB 1YNSA 4CPDA 1P29A 2P78A 1JIIA 2W6ID 2ROQA 2GTIA 2ZQZA 3DHWC 4X6XA 4DLAA 4YRKA 3FBWA 3FDZB 5IF3A 3B82A 1AO3A 1TD9A 3DFUA 2AI3A 1F38A 5ES3A 1XG5A 4EKGA 2QVLA 3L2OB 4WA8A 2X76A 3BH6A 1X7DA 1J99A 1M1YE 3CLKA 2IY8A 4P7KA 2R6JA 5IXYA 4AJ4A 1AU9A 1DELA 4WUTA 1ZW1A 4K86A 4XM1A 3G5UA 5DSXA 1NZJA 2GEUA 3X3HA 4RTQA 3HZRA 1KHTA 1JG1A 2MINA 4UM9D 2FPRA 4NXNB 3HVHA 4DA9A 1SIWA 1A7JA 2IYYA 4YMHA 1RXWA 4BUJA 3RVBA 3L1IA 2ZYSA 4FE3A 2X86A 2Z30A 5AM0A 5EXTA 2XEDA 3A06A 1O6FA 2FZVA 1FSFA 3JASA 4RTNA 5ALKA 1FFEA 2OCKA 2O7VA 2XQGA 1YVRA 3LOQA 3M3DA 3WYDA 4F2WA 3HRHA 3LTNC 2DPHA 3H5LA 2FF5A 2QTCA 3L6BA 4PZAA 2HTFA 2R7LA 4OK3A 3DO5A 3TAXA 1XLTC 1EVYA 1MJNA 4KTTE 4RJ2A 5CPFA 2FH5B 2OCAA 1FJHA 2WWFA 1TQ6A 821PA 4E21A 4NFSA 3KE8A 1TK3A 1DOZA 2WG1A 1S01A 3HR7A 3C6ZA 3L7CA 3LBHA 3WDKA 1EHIA 3MINA 1FNCA 1SJ9A 2A1IA 3DTVA 4D9JA 1WMFA 1IMOA 2HCBA 3NDBB 3ZHZA 3LUGA 3L1HA 1Y98A 3KTFA 1SB9A 5AKGA 1GGMA 4A7PA 2VT7A 4LVOA 4OLHA 1W1IA 3U48A 3HB4X 1JX6A 3LQ4A 1V43A 2FVXA 4RNCA 5JSUA 4CHGA 3E9DA 2ZTLA 1XJ5A 1I2BA 3D43A 3M6LA 2PX6A 4P7JA 4QJIA 1KJWA 3M6FA 1B7GO 3PUWA 1QC5B 1SHKA 3AEQB 1QHHB 1DC6A 4FFMA 4A8PA 4MVJA 3GLHA 1CKEA 1CP2A 2BF4A 1U5BA 1XVAA 1XZFA 5FPKA 1QIFA 2JL1A 1SXJC 4RKEA 5DE3A 1C9JA 1RMTA 3A6DA 3DZCA 1XV5A 4UCQA 1EX1A 4ZA2A 5AXBA 1ZJZA 1JXQA 1QOZA 1VLJA 2F9FA 3ODPA 3KHKA 1JVSA 4A0GA 5KUTA 3LWBA 2HRCA 3QW2A 5A4FS 1N3YA 4DLVA 3OQHA 2XQJA 2AZMA 2CZGA 4KJXA 4EG1A 4D92A 2IU6A 4X8LA 3BCHA 1BO6A 2JHFA 3DE1X 1KVRA 3QPWA 1MH1A 2Q62A 4MUGA 4EAAA 3SX2A 5KJ6A 1QRUA 3O8RA 1B0ZA 3MJCA 4MLDA 3VYUB 1F8UA 4NDNE 4GWLA 1I6MA 4LAFA 4LXUA 5A6VA 2NP7A 1YAHA 2I6SA 4RZXA 1RHQA 3H42B 2GF0A 2FUKA 1EFKA 1NBIA 5ALIA 1TM7E 1A0OA 1CERA 2EWVA 1WTAA 2JW5A 3VR4D 4N5LA 5JYBA 4BQSA 3EZYA 2WUDA 1EE1A 1EG2A 1FBNA 3F78A 1MFZA 3IIKA 3C7KA 3MMXA 5LUBA 1NXXA 2QGNA 2HHJA 3MEQA 1Q7TA 2PVCA 3IHLA 13PKA 1VDMA 3NORA 3O6VA 2LIPA 2VVTA 3OEHA 5EPOA 3MJHA 1AMUA 1OT5A 3BL5A 2FPMA 4NIMA 2IWRA 5H59A 1ZUNB 5C5EA 5LP1A 2IZ1A 2WSBA 3EBPA 4RORA 4Z4FA 2Y9PB 3T1YB 3OP4A 3KQQA 3NHMA 3BJEA 4KR0A 4RY0A 2LZ0A 4BU0A 5D3MA 1AUPA 3TLGA 4RJIA 5JANA 1VKRA 1RLUA 4FGZA 3L46A 1CUUA 3TZCA 3BWEA 3FI0A 3TD2A 3T7DA 4UNNA 3TG8A 2A4KA 4OEHA 1W2WB 3WIVA 1R9JA 1FJGB 3NYWA 4X7RA 4BB9A 1TM5E 3A2LA 4FFSA 3BB1A 5KKCA 3Q72A 1JDVA 2MYNA 2NYVA 5EPUA 4A2PA 1C0LA 2RAUA 1QF6A 1TEHA 1VPEA 2O7NA 4ZJPA 5I3ZA 3IE1A 4EUFA 3DZ8A 4W63A 3F47A 4KN6A 5IN5A 3HO1A 1A5ZA 4JEMA 2BJHA 1V11A 3BOSA 4AQ7A 4DIDA 2MYTA 3NHUA 3OFVA 4QDXA 4X3CA 4EHFA 2V8BA 3A10A 3JVDA 1CW2B 4UREA 2RBKA 1VL6A 1FFSA 1FUEA 2QTFA 2W0SA 3K6JA 4KXWA 4MUYA 4KWIA 4X1IA 4XSHA 4K28A 5GQSA 2H4JA 4I2NA 5IHPA 1ISMA 2GD2A 2O7SA 4ZO6A 4AQDA 4U8HA 2Z58A 5EQJB 3M6MD 2GAFA 1OX6A 5ALPA 3LT1A 4UHJA 4X1OA 2WWHA 1WOMA 4K2AA 1FCJA 2H63A 5CW2A 2O8BA 3PVZA 2JLAA 3PZRA 4ENPA 1TGVA 1CXZA 2ZYHA 3MMZA 4GBED 3HCDA 3ADCA 5IJ9A 5IM5A 2WJ3A 4QBKA 2CDCA 3BIFA 3N6RA 7AT1A 3PXEA 3QPAA 4UHCA 5F9FA 3EGVA 3GL9A 1ISIA 4IP0A 2D2FA 1M1UA 2R66A 3DL4A 1I9CA 1R4ZA 3MM4A 4LQDA 4ZAVA 3NDRA 2FMHA 3RQSA 1ACMA 1VP9A 2C9OA 3HU5A 4EZIA 5K3OA 3T9EA 4JT2A 4YRTA 5IUNC 3N2EA 1MUUA 3CRVA 2YJGA 3ET4A 1ZL0A 4M7WA 3TINA 1XTQA 2LCFA 3R7WA 4MP6A 2D8MA 4DBZA 3I5MA 1DLIA 1CTQA 4OHYA 3L6UA 2C7GA 2HF7A 1NU8A 2ETVA 2YMPA 3NT2A 2Q29A 2PNFA 3L9XA 3R0IA 4LZLA 2M6LA 3L4JA 3OOEA 4DDUA 1WUIS 5AD1A 1AIPA 1EK2A 4CKWB 1CFJA 2VQ3A 3N70A 3EIFA 4MW9A 1KZGB 4YRBA 5FKJA 1AA9A 4HPJB 4WD3A 2GSWA 3I72A 3RAPR 2YS7A 5CDUA 3ETGA 1DC3A 3NTQA 4LGVA 2Y2UA 3WYFA 7YASA 1U8AA 3ZKAA 3K94A 3IE2A 4G0OA 1E5LA 2DUWA 5DPMA 1WUTA 1VG8A 1PI3A 4PZZA 2R65A 1FTWA 4RMGA 1QV9A 4U6NA 4KQHA 3LSTA 1ZL2A 3G85A 3PXUA 5F1KA 1EI9A 3U9TA 4Z5XA 1D8TA 1J9EA 4MZXA 2DHRA 3IYLW 1VYTA 4JOCA 3G0HA 1CUJA 2H57A 1XK6A 4HXGA 3BCRA 3D7MA 2JVIA 5I7UA 2JGNA 1XQ6A 4LSMA 4Y9UA 4ALIA 1E89A 2JLBA 3INRA 3VR0A 4P98A 3DAYA 4I9FA 3UMGA 2AJ8A 4EUKA 4IYJA 4F4UA 4XXHA 3FRHA 1NYRA 3QHAA 4LGYA 4B2YA 1O94A 1BAPA 4BNZA 5MFZA 4LX8A 1M7BA 1VTKA 2Q8NA 4UM7A 4EI7A 1IUKA 1YO6A 2BFBA 4PNEA 4D9NA 1XEXB 3BFXA 2V7WA 1PGQA 4IQFA 3NBUA 3TTXA 4HNHA 5A9TA 3WQQA 1R8YA 2ZSUA 2UYQA 4GZ5A 4ZGBA 4IF6A 3H97A 3FMFA 3EDYA 3F46A 4MGHA 2GD1O 4HDOB 4DM3A 2C9CA 3O47A 4PLFA 2V3CC 1Q92A 4TT3A 2WG0A 2WQ7A 1GNTA 5EP2A 1WCWA 1OFUX 4GM0A 2F1IA 4R05A 1CR1A 5D86A 5FULA 1NVFA 3TRJA 2ZM6B 3WZMA 1KF0A 1U0HC 4MW6A 4ARZB 5A7FA 5KX5A 2ODEA 3ZDCA 2JKVA 5EFOA 2O3RA 4ZAFA 4O4IA 2FR8C 3B53X 4ACBA 2HIAA 1XZPA 3DEAA 1IY9A 4N0EA 1YS4A 2PZFA 4AQYB 3VKFA 3N8GA 1HYBA 1T4GA 2EJUA 1KSJA 2A9FA 4MKXA 3QWHA 2YZKA 4R1QA 5FNVF 2CXRA 3S1AB 2FSPA 1XRRA 2JFFA 3ANNA 3OLYA 2XMZA 3LH5A 2R8BA 3JAMA 4CG0A 1A9XA 4RXUA 3U4QA 1V5GA 1ZGZA 3IEPA 4L2IA 1RQ7A 4IIUA 3JWPA 4JSYA 2R8ZA 1XTTA 4PSVA 4BHTA 2AYXA 3LUJA 4BNWA 4ZRDA 1M6YA 1UKEA 1HTWA 5B1HA 2Q2OA 3OQJA 3KDPA 4DILA 1RWOA 4I4LA 4UE2A 1EAYA 4BN4A 3U7IA 1VBFA 1YVEI 2J6HA 4PN7A 4AY2A 5D87A 1UK9A 2CVPA 3I12A 1PL0A 2XBMA 2O2YA 4H6VA 5AW6A 3RSOA 1VXOA 5A5EA 5IEBA 5IZCC 1NHWA 2YJ5A 4QDTA 1E6EA 1RABA 1G8YA 2OFPA 3UAOA 1WR8A 3QKRA 3EZGA 4MGIR 5CLQA 5CFNA 3L0YA 4ZYXA 4R9NA 2R60A 4MYUA 4Z7JA 2WDZA 1R0BA 2QMZA 4HS9A 1BGVA 1CUSA 1QVWA 1CWUA 2BHNA 3A2KA 3ASYA 3R5FA 4JKIA 2B61A 1E94E 1SCAA 3M49A 3QKWA 1NVDA 3AG5A 4UHEA 5AK5A 3R41A 3C8DA 1DJPA 3FIUA 2GBLA 5L7YA 1ZH4A 4XCVA 3SZMA 3W5AA 3PC4A 4CF7A 1MAWA 3Q7SA 4UMDA 4YDQA 2YN0A 4WECA 2FZEA 2E18A 3BFKA 2JFZA 1ILEA 5JG7A 3I6IA 3BK2A 3KAJA 3OUTA 1EHYA 4JHXA 1RQGA 2XDQB 4I6GA 5ECWA 3L5KA 4QPPA 2RHLA 2X8JB 3PC8A 2PWZA 4HGPA 4R8RA 4Q7EA 1EX6A 4R2IA 5CA1B 2P9JA 1XJ0A 2VZEA 1RZRD 1NJGA 5COAA 3AUSA 4D9MA 1RJ9A 2PCLA 3M2PA 5I7SA 3OIGA 4ZVNA 2PY6A 3HZHA 4QQKA 1Z0JA 2CD9A 1OV4A 2BM9A 3KJEA 4MICA 521PA 1H05A 1XQVA 2A0YA 5A4KA 3O74A 5J9FA 3O2QB 4B45A 3OJXA 4YJ2F 3ABIA 5ES4B 1L7QA 1E61A 1JFRA 3L8MA 2YBDA 2M98A 5B30A 2YXDA 2GR9A 3SK0A 3ZNNA 4M1TA 1OLSA 3GDFA 4ZI7A 1PT7A 1RBYA 1IB0A 4QRIA 1YL6A 3CEAA 3N7AA 3U2QA 3ZZ1A 3CLRD 4YP9A 3AJEA 4GMDA 4OMUA 2W22A 4FYHA 5B6PA 1CBUA 4ZOEA 5EGNA 4ZT5A 4KFCA 3PT9A 3DDHA 2ZYDA 4GR4A 4ML3A 2FCRA 1Z06A 4N5DA 1Z2DA 3AX6A 4QLOA 4WZAA 4QFCA 4M1MA 5E9JA 3RSLA 4C0AC 3E3LA 3E9CA 2WTAA 1BWQA 2PS1A 4JJIA 2VSXA 1V6AA 3CKMA 3KL4A 4KVZA 5FADA 1A8SA 1RZ3A 2PGNA 4R8SA 5LA6B 1NI4B 4YVFA 3FVTA 3U19A 4R1LA 4POAA 1J0CA 1MVLA 1VYUA 2ZBEA 5KMGA 3PQDA 3QH4A 4PZPA 4I50F 4ZHQF 5KSWB 4C2BA 5DGHA 3STTA 2NV2B 1XMVA 3PLRA 4YCSA 4XPIA 4EUNA 3THYB 3VX4A 1E69A 3AR6A 4PPQA 3V9AA 1IB6A 3I73A 3FPGA 4RK0A 4CDGA 1KI7A 1RADA 2GHQA 4DLPA 1W2GA 4EF4A 4FBMA 1U7PA 1SU4A 4JJKA 1JHUA 5DN9A 1UJBA 5HHTA 1R37A 1XMXA 4AJOA 1A04A 3PEWA 2VXOA 1EVZA 4LRUA 3NJ4A 4R8KA 3UKOA 1T5DX 2I78A 1OZFA 1MCZA 1QIEA 4UASA 4Y2PA 3RIGA 2EU8A 4TLEA 3B7WA 2CFRA 3AR7A 4ETNA 4KR2A 3ZWCA 3D7LA 1LV8A 1Q14A 3L7MA 1N2JA 3BH7A 1R4MA 3MQ4A 4G1BA 1DBWA 1QFYA 4ZT3A 4WKBA 4ER0A 3OFJA 4GOMD 2G9ZA 1XZEA 4LXIA 3GYGA 2H2GA 4EGAA 3Q8KA 1U28C 2OBXA 2AJDA 3WYBA 1ZRMA 1G8MA 4N3AA 5GM1A 5TQ2A 2IYPA 1HWYA 3GFBA 4M22A 4YMGA 1P0QA 2I22A 2P67A 3JQ9C 3B8HA 3D6AA 4ZXFA 5A4IS 1RYNA 2VL7A 1HUQA 1GPUA 3H19A 3PCRB 2YX1A 3IA7A 1TQ2A 4GXRA 3IEIA 1X7XA 3R3XA 3FB4A 4UJ5A 5IN4A 5CLIA 1DC4A 2A0FA 2B8WA 5AKJA 5IK2D 1JPVA 1UPUA 2IEAA 3QA3E 3Q3HA 4YRDA 4X65B 3Q5DA 1Y0BA 4CV3A 4ZODA 3TTSA 1II8A 5JAMA 4QT0A 3NIWA 4DLYA 4CF3A 1QH8B 3P5SA 2YWBA 2BTEA 5JSZB 1ZX1A 3E22B 3H2BA 2Z4TA 2RHMA 2QDKA 1A2OA 2JKYA 4CETA 1EP9A 1CF2O 4NOKA 4XYEA 4AWAA 4KUGA 2G08A 1XNJA 2Q07A 1BMFA 4CKWA 3RBVA 3BEOA 3EF3A 3RFFA 4AFNA 2YASA 4FCVA 4AK9A 5CFRA 1ILWA 2Q6OA 4D44A 5LPNA 3T4XA 2Y99A 4L8YA 1JWAB 4UTXA 3W05A 3WLSA 5JDIA 2ERXA 3SM3A 1JDPA 5YASA 4HQOA 1GRNA 4B3DA 3IODA 1K3FA 1KAMA 1Q3TA 1SHTX 4QBGB 1ESDA 1H2AS 4P4NA 3G0DA 5T3UA 3TL2A 4F2GA 3SVTA 4DJJA 4ZIRA 4MYTA 2A8YA 1EK6A 3LXRA 2OD7A 4TQ9A 1D2RA 1YACA 4LY0A 4P7BA 3M4NA 5DHSA 3SHVA 3AVWA 4AMYA 1BU8A 1ZD5A 1KC3A 2IZ0A 3CZ4A 4GL4A 5BSHA 4RTLA 3CJQA 1ZGJA 1J23A 5LL6P 2Q5OA 3KTAB 4FDUA 4BQEA 4ID3A 2BI8A 1EXMA 1UBSB 1T4BA 3BWMA 4C06A 2ISCA 3RSQA 1EJ2A 5FOWA 1XZHA 2JI4A 2TYSB 4WWHA 1VCOA 5AW9A 4Z49A 2AXQA 4CMIB 4F38A 2CNOA 2JCYA 3HCOA 1JFFB 2W6CX 4FFWA 2ZSEA 2WJAA 1CY4A 3EC7A 3HJHA 5E3HA 4XSGA 3LZCA 4WBNF 2JFGA 5EMNA 3URMA 4GP9A 3KT3A 3K0SA 3VNRA 1ZRNA 4WDQA 5JZVA 4D5EA 3WLTA 5J2TB 1EFRD 5JVDF 2ZYVX 5ECGC 2IS6A 3CFYA 3HI6A 1PR6A 4FJ0A 3CNHA 1DJLA 1TLLA 4RYLA 5DASA 3WGQA 1WBBA 4IIEA 3EXEA 5T6MA 3A28A 2ZAGA 3IEMA 1FMFA 2XCOA 1C4WA 1SC9A 1QS0A 1E8DA 1X1DA 1JVBA 1U8TA 3GUZA 2O2CA 3EDMA 3BQ9A 3HABA 3JQGB 2KM1A 3OETA 4PRYA 4MVXA 5IKEA 4BPBA 3O8CA 1KDOA 1E3JA 2QNRA 2WIDA 3BGIA 4NZYA 1I7LA 4J4TA 4GZ6A 4F2PA 1KMHA 2FWPA 3I4FA 3FY4A 1FVHA 1IM8A 1N0VC 1XK7A 2VJYA 2WAMA 3DKPA 3E70C 4LJKA 4RJJA 1AO0A 2O50A 2VP5A 1YIAA 3LDGA 2XNKA 3PITA 3GXBA 1UBGA 4YRQA 3FD8A 3KB2A 1U9JA 3PPXA 1NW8A 1HDCA 4LMBA 4RVDA 1I5OA 1OWOA 2JBAB 5K09A 4NNPA 2R6HA 2XYRA 1AHHA 1QU3A 3L4SO 2V9ZA 4B9AA 1D2NA 2X5XA 5D6NA 1YHZA 3T12A 1EA7A 1C2YA 2Q21A 1NUSA 4LOKA 1N5OX 4OSPA 4BE4A 4C05A 3T4PA 3QTBA 2JLXA 4OLJA 1L1FA 1J7JA 2JJ2D 5CEEA 3GP8A 5CITA 4MKFA 3ZDDA 3K0KA 3WNVA 1P5FA 5AW1A 5IRCD 4M9QA 4LYHA 1UXJA 1LLQA 1OGJA 1P62B 4JVOA 2PKQO 2ECQA 3A14A 1W75A 1QE0A 3GLIA 1UQUA 2ZJ8A 3D0QA 3N0TA 2IYAA 2J7KA 2W2KB 4GH5A 2OOSA 2RJNA 5KYKA 4GKAA 2IW1A 5DV9A 4AKEA 5KTRA 2NAPA 3RC2A 1RFGE 3OMWA 2H5IA 2XUDA 3UMMA 2SICE 1W0KA 3TLCA 3RRZA 4ZZIA 3JD4A 1WD7A 2QAGA 5AXDA 1TAHA 2HADA 3ITKA 3T9DA 4MR7A 1UXIA 4UVDA 2PWBA 3RS2A 2AVDA 3RFUA 1ISHA 1TK2A 5JMOA 1YI0A 2ZREA 3FPEA 3U9LA 4KN5A 1NBEA 2VXBA 4M0PA 4GP7A 1GYPA 4D96A 1J39A 1L7BA 4CV2A 5KTNA 2VKQA 2VTKA 2PIAA 3UUEA 3ASVA 4UOZA 2UZ3A 2YWEA 3A7DA 2HWKA 2CE7A 3AOEA 3Q9LA 1MD9A 4L7QA 3ANXA 3CW2A 1YIOA 4MO2A 4TTPA 1BS2A 2D06A 4EI2A 4IJMA 2J46A 3ONWA 4KNYA 4L95C 2RHWA 5JXGA 4J0FA 4B6RA 4MLPA 2UYHA 1SIBE 3BWYA 4QAJA 1IDOA 4PC6A 3SBEA 3T9AA 5KTKA 1D6NA 1TTQB 2GESA 1Z7WA 4G25A 2B20A 1XRNA 2CFTA 3L43A 5JNWA 4EECA 1MW9X 5BMOA 1ZWKA 2K7ZA 1F7UA 3IEVA 3K5WA 1D2CA 4P53A 3GEHA 5BWBA 4IRMA 1PKXA 2ZM5A 3TI7A 1STOA 4Y1GA 1MX9A 1OI4A 3N76A 1VSBA 4E12A 1L7EA 1WCV1 2XXJA 5BYBA 4XCQA 3U26A 1L1QA 3WGZA 2OECA 2DTXA 1GG8A 1SCJA 2ZBDA 1E5QA 1NIPA 3JPWA 3WV5A 5KZMB 3EQ6A 1QIHA 2NTVA 4Z8YA 4WY8A 5JS2A 1ULTA 3H1BA 3NP9A 2DHCA 1RWWA 3ZHBA 4B81A 3JYOA 4UTZA 4NYJQ 3S2UA 1AUVA 1OW3B 1PNRA 1TLTA 4MKZA 4EG3A 2ZETA 1UDWA 1T5LA 1D0IA 3A3PA 4NEHB 1VMKA 4C0XA 4C4ZA 3IUYA 5ALJA 4D7AA 3K0EA 1TLFA 2GQ0A 1RAAA 2NTNA 3F67A 4TGLA 2EAUA 2OUIA 2P9TA 1RC0A 1ONPA 3B3JA 4HYQA 4OYLA 4WPGA 1ZSVA 3CV3A 1G4UR 1RCTE 3HFRA 3HB9A 4X60A 4WFKA 5EIBC 5TS3A 1W0JA 2PGXA 4IZOA 5JO9A 5KS2A 1G41A 2AC7A 1VRCA 5BSFA 1Y3DE 2CXSA 2Q0HA 3S70A 5BN3B 5F98A 1YU9A 4XE5A 4LV5B 4TSFD 1DRJA 2XKBA 4JJ6A 1RD4A 3DDWA 3PQ6A 4WXYB 5AIBA 4LNUB 2YW2A 1E3MA 2AEEA 2BFFB 4FEAA 4LJ9A 5CTAA 3GELA 1C50A 4MQMA 4E51A 4UKDA 1OQAA 5F5LA 3R9XB 3IT2A 2GJ4A 1T2CA 3MWFA 4ZRNA 3ZN2A 3RVQA 2XH8A 1LTQA 1NI3A 1USGA 2H6EA 3SJUA 4A2WA 1USVA 4K6CA 3EQ7A 4QYXA 3C39A 1XZMA 1CR2A 5EJ7A 2AZTA 2G0NA 1V3UA 1Y82A 4EMSA 2BR4A 1ORRA 2N1MA 4D3ZA 2VSNA 3OQ6A 2JANA 1ZESA 3QPUA 3QE9Y 2ZAYA 3CEJA 4EFNA 1DCTA 2ZPAA 4IV8A 3T1OA 3MPUA 2CK3D 5C5CA 4PXSA 3JZAA 2ODTX 2A5LA 3AR3A 3JZMA 1G6Q1 4OP1A 4RTOA 3K31A 3CG4A 3PFIA 2C2ZA 4JI5B 3PR2B 2Q2VA 4B6QA 1D7OA 2ZSDA 4OXXA 1Q22A 1YFKA 4BKPA 1T9KA 5AVZA 2AJTA 5C34B 1TAGA 1N2EA 1G98A 5B58T 4D74A 1KBOA 1M1NB 1UFRA 1VE7A 1NVAA 3SS8A 1U2PA 1ZK0A 1XWFA 1IXKA 1MIOB 2F8MA 4V38A 3BM5A 1SKAA 2O1SA 2RC5A 1UOEA 2Q7DA 4MKGA 3HB0A 1W5SA 5JARA 2ILVA 2VJNA 2J5QA 3IXMA 1P2BA 2R4QA 1EUQA 4QL3A 1VJ1A 2PSDA 2COEA 2QU8A 2REXB 2ANCA 3LL4A 2D5LA 4E2XA 1FXWA 1Z6AA 1J07A 3KLOA 4K7JA 5JSFA 3ZWOA 4MR8B 3FUWA 4OXNA 3MWEA 4YJFB 5FI1B 4I55B 3BTUA 4LW8A 4D8XA 1E99A 5HCNA 5M29A 1VKJA 5EP4A 4NG4A 1U7TA 4RH1A 1UBEA 2GPAA 4EWLA 3L02A 3DPUA 5FNVB 2OQVA 3VRHA 4PSKA 3GROA 5GOZA 2ZR8A 3KXKA 4P4GA 3O92A 2AQHA 2YJ6A 3KUXA 4RW0A 4TLDA 4RETA 5BSEA 4O63O 2K2WA 1UDRA 2Z0MA 1T6ZA 2QNBA 4J9UE 2N46A 3KUKA 4YCJA 5FPQA 1E63A 3NYRA 2IEYA 3WGVA 5CH5A 3TTWA 3HN6A 4O29A 5JAZA 4CKXA 3CUKA 5DTRA 4YUVA 3HRIA 3ZW9A 4MEJA 1IOWA 2IU4A 3MCAA 4PONA 5JTTA 1OE0A 2WD7B 4PXYA 3RM3A 4B71A 1FFXA 1OPXA 2I5PO 4X1KB 5FUBA 1QQ5A 3VAZA 2GM3A 3H5IA 4JUBA 3WRWA 5JQGF 1KOGA 3EPLA 5FUYA 3ZY4A 2XOKD 2W2LD 2ZWAA 3BHJA 3K9WA 2O2ZA 4PICA 5AJTA 4QHYA 1VJRA 2PL5A 5EHXA 4J7UA 1NLYA 1VHWA 2VYVA 2Z1MA 1BJTA 1EP1B 3PSAA 4OQ4A 4RV5A 2C84A 3UXMA 5JMTA 2HYIC 5ELXA 3PGXA 2AHRA 3E9RA 3K0FB 5DXAA 3CXRA 5T4BA 4X1YB 4BFUA 4BMDA 2DYKA 2BSQA 2A1UB 1PVDA 1H4VB 2BLLA 4U8GA 3IL2A 3CRW1 1NUQA 3BRSA 4CHTA 1S2MA 3DMDA 1F4PA 5KYWA 3CMCO 3TE7A 1RU3A 1XU9A 3H4IA 4D99A 1ZU5A 3LP8A 2VYQA 3WQSB 2VZLA 4BO7A 4EY5A 4N40A 5KJFA 3AVPA 4YECA 4F2DA 2OCYC 3C6XA 4P4UA 3GCWA 1MP0A 1XA0A 3UAYA 1V5EA 4KXLA 3F7NA 4YRNA 1Z28A 2FN9A 4JC8A 4L74A 2OCDA 2HK8A 5CB0A 1Q7RA 1NY5A 1QHHA 2A3RA 2A7XA 2HLPA 1MT0A 1BYUA 3GJTA 2GAIA 3UXHA 1VKOA 2FFBA 3KE9A 4WDRA 3AFHA 5EKTA 1YDEA 4IINA 3PQ2A 4WLEA 4IOKA 3NH9A 4YQZA 3ZOZA 1SZCA 4G85A 2DKFA 2GOYA 1A9RA 4HAYA 1KE2A 1KIFA 2AF3C 3DNPA 3VYTB 3HYLA 3MRTA 3LO5A 4MCIA 4RGBA 1J9GA 3I1JA 4OHWA 4MR9B 5AJUA 4EX7A 5F76A 1A4UA 2DUNA 2IEGA 4B09A 4D9KA 5JCPA 1OA0A 3LI2A 1VMEA 3AKDA 5FL3A 1IEVA 4I3GA 3OEED 3NT4A 5CNIA 5I7RA 5J4VA 2ORVA 2IZZA 4LYFA 1QBKC 2PKRA 4M54A 2C0QA 4YS6A 3UMCA 2C3MA 4RCYA 3U7EB 2FW1A 2OCXA 3PUJA 1XQ9A 4TMZA 3ZY6A 1WZ2A 2W98A 3TOSA 1YL5A 4JB2A 1UFKA 1XAJA 4LCJA 1CUYA 4MROA 5FOSA 1KSHA 3TW0A 3NHBA 5B57C 3H05A 2IDMA 3H4TA 1GILA 2FSGA 5EZYA 4BB6A 1LI7A 2C7BA 3FYUB 2IOFK 5CLFA 5K0LA 2VWHA 1IOVA 5J23A 2RD2A 3R3YA 3ED1A 1ZJ6A 2ID8A 4N49A 2H1WA 4AD8A 4RF4A 3MXTA 5AW8A 4MV0A 1LSSA 2C2HA 4WMLA 1G20A 4GX1A 2D5AA 4L0MA 4XWTA 1K0FA 4GKJB 3T6KA 3SSAA 1U0FA 1U3UA 1FP2A 1QWSA 1ZUNA 4IIFA 4ZHQB 4PYKA 3CO0S 4C2UA 3UUFA 2WM8A 3W8RA 5NULA 3QM1A 4OI1A 3R0QA 2GN1A 2RC6A 3DS8A 3NIFB 2O0MA 2SBTA 1ECLA 2X41A 2YOGA 1L4KA 4LJYA 4OI4A 4UD2A 5JFTA 4KQJA 5KYGA 2WJJA 2JAHA 2ZIUB 3NANA 4HNGA 3I0NA 1V1MA 1Z6QA 1FFDA 3V1YA 4EJ6A 1PZXA 2B25A 4PSAA 5HJ7A 2JDIA 2CHGA 4IMPA 3G2NA 2ZWVA 5EQTA 4R69A 3PXDA 1XXHE 4Z7QB 2HLDA 3MBKA 2ONJA 5KQRA 3N6XA 2UUCB 5FBWB 3D2BA 3KVRA 1QPBA 4IUDS 3A0RB 1FSGA 4DSUA 4DR3B 3CCBA 1ENYA 1M73E 4OQNA 1ZEMA 2BL4A 2JHPA 3KQYA 4B48A 3EPKA 4RSGA 4CLOB 4B6SA 4RF3A 3QEOA 5FHQA 2YBEA 3IVXA 2LE0A 3EEIA 1YU6A 2NW6A 3IE0A 3WKDA 4YCCA 3DC2A 5FLXA 1IBCA 1VMDA 3HVIA 2VK1A 1ZNZA 2C96A 3A58B 4L5IA 4CM6A 4PEVA 1VZ3A 2A5YB 3ACCA 1X7GA 2RGXA 2CNNA 2F64A 2P69A 3DDSA 2X8LA 3CZ5A 3CZ9A 3JQBA 5FUQA 4HDMA 1GLGA 3MS7A 1DIAA 4RUKA 4F85A 4RQAA 3ZHXA 1Z2CA 4PFSA 4QECA 3GT7A 1TUEA 3P0FA 5DNCA 3DLBA 1J06A 3DOEA 4RKWA 1K8XB 1NSTA 5L6MB 4JSRA 1OAOA 1EVEA 5BVGB 5HKBA 4JFRA 2JJ1D 1ISFA 2I7XA 3AETB 3EGIA 3T5CA 4WLVA 5E7JA 3GRAA 3EGCA 1N4DA 2QE7D 4FMCF 3V32A 3SHOA 1V7CA 4OAPA 3I32A 2WFMA 3LGXA 4F97A 4IGEA 5TPZD 3AI1A 2A4MA 1BXGA 1E9CA 3EVBA 3OZUA 3F71A 3RU3A 1GUZA 2FR1A 3I92A 2GRAA 1LJLA 4Q47A 1IOZA 5D5QA 2YC2C 4KQKA 1IMJA 4IIJF 4DNFA 2ISQA 3LECA 3OQBA 1ESZA 1VECA 3O8QB 3QX3A 5IAJA 1OFUA 1SOAA 2ZJAA 2VDNB 2VPXA 4RFSB 4UAGA 4TKZA 3W79A 4EYQA 2B7CA 1V3TA 4BXOB 3VOTA 1RTTA 2NP6A 1YQWA 1UINA 1Q1ZA 2NSLA 3LU1A 1EFVB 2FN8A 2YQ5A 2AOVA 2BEWA 5HQ3A 5LOVA 2I4IA 2HLHA 1ODSA 3DZJA 4Q39A 1T0HB 4XWAA 3RODA 4WXRA 3BTOA 1YGYA 3UENA 1RXUA 1C3JA 4TRJA 1VL8A 1GXSB 4C0SA 3LUFA 4OH7A 1FMLA 1N2SA 3A6PC 1SUEA 4OJKA 5BV0A 3KXIA 4BLSA 3KAPA 1JPJA 5KU1A 5I7OA 3WLOA 1ZMXA 2E82A 3U6KA 1ZQ1A 1J20A 2V7UA 1G5PA 3HC7A 5AO9A 3R4VA 3UBMA 4NCBA 1QSGA 2IXFA 3I37X 1PJCA 4NCHA 2RG1A 4PNPA 4AO6A 3WAGA 1T0PA 2VQ6A 3CEPB 1ITZA 1CY2A 1GPMA 5C18A 3L1VA 1S2NA 2QNIA 3A2MA 2OT3B 3AT1A 3K0HA 1FYVA 2CN1A 5TY0A 4MGZR 5LP6F 2WBLC 3C1AA 1A7AA 2DBVO 3INGA 4LX0A 4XVQA 1L5LA 4L3WA 1D4AA 1T8WA 3KEOA 3A9RA 4RD0A 3VDRA 5CR9A 4QREA 3DR3A 4P5EA 2PV0A 1NXOA 3IV9A 4FDVA 1AC5A 2RH9B 2Q5IA 4ENQA 3AL0C 4R7GA 2I55A 1MX3A 1RWPA 3TLMA 3IUPA 2QPTA 4UU0A 3IKLA 2KMLA 3EZXA 2OXCA 4RK1A 1HL3A 3ZHYA 1I3MA 2ID9A 2W2PA 5FT9A 4FGUA 3RVOA 5ALWA 4A8JC 3NHRA 4EMTA 1IZZA 5L45A 1RPZA 3AGPA 4JKOA 4DARA 1YV9A 1KDPA 4MTCA 4IXTA 3W4JA 4ZDWA 1UWVA 2AFHB 3R3WA 1DFGA 4EJ0A 3K70B 5T7BA 2PLAA 4GOLD 2ZYGA 4CKZA 3S1AA 2OORA 3X2EA 5JXJA 3PFKA 2W11A 5I6DA 1SA0B 1AGNA 3JALA 1L6IA 2D1QA 2WSIA 4CEIA 3TBKA 2HDNB 4BN5A 1TEXA 4BGVA 2XRZA 3ZE6A 4M7PA 4LJ6A 3ZIAA 1GQFA 1LSOA 3QI7A 4MLZA 2WTBA 5F3RA 3TIFA 3R0JA 3AJAA 3GRZA 3TOXA 3J81k 3CLUC 1IRIA 2X0KA 3WR5A 2UVPA 2B6HA 2ZAMA 1MJGA 3DXXA 1OYVA 1JL3A 3A6EA 3R3JA 4RPLA 3EWNA 5FFNA 1NW3A 2PYZA 1MPXA 2WW8A 3GRKA 1T34A 3K1TA 5K1ZA 4Z51A 5THQA 3T0GA 4Q7QA 1P44A 4Y6LA 1D04A 3EWIA 3TAUA 3PC3A 1NN5A 2LTAA 3PFFA 4ZV4A 2NIPA 5GV7A 1SBYA 4EYKA 1CQZA 1SVIA 2V3VA 2X3YA 5KCMA 2VDQB 4X92A 2AEJA 1J9ZA 4DLTA 1J42A 1UOOA 3C5WP 4HQFA 4RKFA 5KVCA 3TM5A 1XVLA 1NQVA 2FP4B 2GDJA 4QEDA 4NWIA 4D5GA 4OB7A 4XYLA 5A9SB 5COBA 1HI9A 2CXUA 1THGA 1MT3A 4JL6A 4GRIA 4HLCA 4XJTA 4J2HA 2CB9A 3D3WA 3H6KA 4KEAA 4L76A 2IT1A 4ZVUA 1QHEA 1YR8A 2HCFA 1DQNA 2HUPA 2XE6A 4KLAA 2IPAB 2QXTA 1L7DA 1KVTA 3F2IA 4MQBA 2IEZA 1LUAA 1CCWA 1OX5A 3GT0A 4IIXA 4YAEA 3D5EA 3IO5A 1IHDA 1I13A 3VH2A 2H7VA 1E9VA 2OLJA 2WNSA 4RTMA 3LC0A 5CA1A 4JA2A 1II0A 1GFWA 4HWKA 4KXUA 2V0GA 2C4UA 1DO8A 2IF0A 3R75A 3MGAA 1ZH8A 5E1OA 1QMPA 2I33A 3BIXA 2ZSIA 3H04A 2ZT5A 2WINI 3IEXA 4RO0A 4V2UA 5TPWA 3RJ5A 4NESA 1I2AA 3ZBPA 4EX6A 2R85A 3ELWA 5DH9A 1KAQA 3PTZA 1R50A 1VRVA 2IHUA 2GK3A 3BMQA 4G1FA 4UHBA 3ZZUA 3ZVNA 2FLWA 1NE7A 4O4JA 3VHXA 1G5IA 4DGSA 4E5KA 5ADVA 3EFEA 1FRNA 1AZTA 5EHNA 5ED4A 2F43A 4EEXA 2I9KA 2P6OA 2AKAB 2JJMA 2GUGA 4KFRA 1DOAA 1KQFA 3CUUA 2ZI6A 3QFHA 4IHKA 3FMIA 1BXZA 1REQA 1OYYA 3ELDA 2JGFA 2EGGA 2XCLA 2Z8ZA 1RRCA 1Y5RA 5EKDA 2VF7A 3RKUA 3ZIUA 5B3KA 1WW2A 3E6AA 4C30A 2LW7A 3WRXC 3QMPA 1NV8A 2FJ0A 3GBSA 3MRVA 5BSWA 5JYDA 1KFBB 2Q3LA 1NHGA 3Q40A 1XMIA 1L8AA 4QATA 4C1NA 4UTRA 2ZKIA 3IT3A 1NVTA 3R7LA 4TZTA 4XUDA 1U3CA 3C3MA 1FP4A 4ZC1A 1M2WA 1QTIA 5BR4A 3TXAA 4TLMB 3AUAA 3ECCA 5J1TB 3S8MA 1VHTA 5CDSA 1NI4A 3K09C 1XMQB 1FTYA 3BGSA 3HU1A 3GIWA 4IWYA 4AKSA 3IOMA 1AKNA 2OXEA 1QHFA 2V7GA 4NU5A 5B2ZA 1H94A 5A1JA 4HADA 5FL7A 1UMCA 3V4PB 2C8JA 3VU8A 3OZIA 4H31A 5KQGA 1G9SA 4WK2B 3TMYA 4I99A 2BEVB 2Q41A 5AVWA 1ZM3A 2PLNA 4JENA 3TSOA 1L4YA 3DPSA 4V0MA 3H5NA 5HF8A 4KAFA 1ZH2A 4NYJR 5DMXA 1X0XA 1XEFA 1Z2NX 3NP7A 2D7DA 1ZVQA 1Z3CA 5ECDA 3RU2A 4RA9A 1XXLA 1L7RA 3NIGB 2PV7A 4HRYA 4HZUB 1DTSA 4QOGA 3B2NA 3D8SA 1N36B 2DMRA 4IQGA 2WP0A 4QIHA 2NUPA 2VR1A 3GEBA 2GJ8A 2INGX 2IHZA 2Q50A 3PHHA 4B35A 1P9LA 1Z08A 2FAXA 1V9SA 4M98A 5KTPA 3LX6A 3IR5A 4FW9A 1VL1A 4JLAA 5DHRA 2XMBA 4UDOA 4ATNA 4F96A 3BSWA 1ZUWA 4DIOA 3LMKA 2IYTA 1JH8A 3IR7A 4XLTA 5IWCA 2YJ3A 4ENWA 4IHQA 3B2EA 3KEFA 3JWJA 3QBDA 4LC0A 1RAFA 1NAIA 1UM9B 2VDOB 1GZ6A 3UT0A 2XSZA 3PU6A 3QFRA 4JI8B 3HBAA 4ZQBA 5JROA 3ICVA 1EP2B 3NVDA 1YUMA 3CCFA 1SUAA 2ZPTX 3SE7A 5EGSA 4ZVLA 3WYEA 1NPTO 2CVQA 3GAFA 5CDGA 5JZMA 1YKGA 4G5RA 1R3UA 1HETA 3GPLA 2NPFA 3W06A 2YIDA 5DBOA 3CNBA 4GPD1 3SLGA 2HSDA 3ML1A 4UCFA 2VLIA 4TV8B 4OGFA 5E7QA 1PJZA 2W4IA 4FKMA 2CDAA 3QELB 4W99A 3E22A 4B2LA 3UA4A 4G36A 3MTJA 3WK7A 1CEXA 2I3ZA 3OHSX 5KKAA 2BUBA 3N7UA 2X23A 4MIYA 5DX1A 1PGJA 3FUVA 4N3GA 4Q7LA 1H5QA 4EMUA 5ALNA 3DLIA 1AJEA 1K5PA 1U3TA 2C95A 3M6UA 1Y5NA 1PLLA 2PGAA 4KWCA 4ND3A 2B35A 5DHTA 1X94A 4EF5A 1W7AA 4TZKA 5DCWA 4O4HB 4BNNA 5JHHB 3TR6A 1EFTA 1U0JA 4L5BA 3PDHA 3P9SA 5LZ7A 2JA1A 1TI7A 2Z4RA 4BEVA 4CLHA 4FFBA 5TSDA 1CZOA 1J0XO 3O4RA 1PK8A 3V2UA 5L7TA 2XMCA 1D1PA 2FU5C 3VPBA 1GRVA 3IMEA 2X4LA 3FSRA 3UANA 1EH5A 1K5GA 3ZBTA 3FOCA 4PYNA 5DO9A 5E2BA 3VISA 2FWRA 1RKXA 5DM70 2NV0A 3EYAA 2VP2A 8ATCA 1CYEA 3KSMA 3VZQA 3U5TA 1DTWA 2O6HA 1BHO1 3RU9A 2CXPA 4Q1BA 4B4VA 1JE0A 3JYNA 3MS4A 2WZBA 5I8WA 1U9YA 4JJ8A 4M55A 5JEEA 3P2MA 3PNVA 1JFFA 5LJLA 3JPYA 5CT4A 4CN8A 2VJMB 1JTVA 1YB7A 2OBYA 5DM60 1BJRE 2IX3A 4ZOLF 4OLBA 3PUHA 2O06A 3GLKA 5I8ZA 3PYLA 4O8ZA 4TV9A 3HCCA 3H2SA 3HDYA 2NX2A 3U7RA 1PJ8A 2QTWB 3OE5A 1SURA 4PZDA 4QARA 5J2TA 5A7GA 3P4UA 3HQ4O 3MD9A 4PANA 1QH1B 4PU0A 4CT4B 2PH5A 1QZ3A 1EQ2A 3CB2A 3BSSA 4BO0A 4GX0A 2ECKA 3ZK9A 6AT1A 5DGXA 4KWEA 4QGBA 1E2KA 4N6OA 4PO1A 2WB2A 3T9CA 1I1QB 5J2UA 1QQBA 1FX0B 1J22A 4BFZA 2RH8A 5IHXA 1O6ZA 2BGWA 3EXG1 4ZGWA 3GGGA 3MUEA 3BE8A 3QPVA 4NYMQ 1OU4A 2D5IA 3HXLA 4WGFA 3FFXA 4DN6A 2PM8A 1GNVA 3HXOA 4V0OA 4Q3EA 3BH0A 3GARA 3QU2A 2QEQA 3H2ZA 1HT0A 4YT5A 1ELOA 2B8TA 3ESRA 3MTDA 3UH1A 2MMCA 4LWPA 1TL7C 2JBAA 3FSGD 5DGIA 1LEHA 4ESEA 1DHTA 4QXOA 3BD7A 2WPDA 2QAIA 3LT0A 3Q7QA 4EGFA 4CTOA 3EEOA 3A36A 1WZNA 3EGXB 2GBPA 3OQIB 1T1EA 1TJPB 3C6QA 4MPPA 1BGXT 4E5NA 3PKJA 4KZPA 3B6ZA 3CH4B 2ZSHA 1NZDA 2GEJA 2RHDA 3OZ7A 1M8GA 1YOBA 1SKUA 4OCZA 5DP1A 4DCOA 3KWFA 4JBIA 5FORA 1GTJ1 1R12A 2ZIGA 3C8MA 4YAGA 1FK8A 4GT1A 1Y33E 2ODNA 4MULA 4YRSA 4KX3A 4RGQA 3Q87B 1Z33A 3GZ4A 3P9NA 3O8OB 4M36A 5K8IA 1QDUA 2Y1KA 2VRCA 3MNFA 4DQ0A 1RS0A 2AIRA 4LMRA 4YIHA 1NSFA 4GOND 4HP8A 1HOTA 2HPZA 4RVOA 2A92A 1NV9A 2Z1DA 5JCJA 4W9MC 4U3JA 4HC4A 3U49A 1S1CA 5JAQA 1J2YA 3O21A 1XCLA 4KMOA 4UNSA 3PV0A 3HV2A 1M76A 4KKVA 3WGMA 5GWXA 2HWUA 2OCBA 3G9QA 5LXTF 1AN9A 4JI6B 4XYBA 2YY6A 3L7NA 4KTVE 4U2GA 1GGJA 4WGGA 2EF1A 3SJZA 3TM4A 1QP7A 3D8TA 3HY3A 3F8WA 3VVLA 1Y89A 2IIQA 3EEYA 3UXEA 4BECA 1NMEA 1JHPA 2XQIA 3PDWA 5JXWA 2X19A 2R2AA 2PDAA 1L1EA 3K9LA 3O3CA 3CW8X 5GOTA 2V96A 4IJ6A 3CF4A 3I76A 4V0SA 3IUQA 5A6SA 4RA6B 4BTVA 1B16A 1KP2A 3AVOA 4M46A 3NBFA 1ML4A 3PD1A 2J4CA 4F9TA 3JZDA 4JUIA 1FRQA 3LY8A 5JALA 3NQ41 4KNWA 2EDCA 4ZWNA 2IXBA 1UKBA 3AK4A 2FSHA 3WBJA 1WEHA 5TT1A 1MLDA 3ZVLA 4AW9A 4NAVA 2I76A 3H65A 2F1HA 3DQQA 2XR1A 1MZPA 2EW1A 4PX3A 1MA3A 721PA 5LIRA 4A16A 1E4YA 2HUNA 4HDRB 2YS6A 4HV4A 3HR4A 4ER6A 3GNTA 3M6AA 2O8CA 2EZUA 3Q41A 3S4YA 4Q4AA 2OG2A 2BVNA 4D8UA 2EBHX 1RXSA 2B37A 2FNAA 3BXEA 3JXEA 3KQUA 1N5JA 3A6ZA 3ONVA 5HUJA 5K9ZA 4AMBA 4CIWA 1Z8HA 2V7PA 5H81A 4OAOA 2P2GA 4D43A 3IIEA 4GQAA 3LQ2A 4Q01A 1SKMA 4EJSC 2DLNA 3L49A 3LPMA 1KFKB 1BH6A 3U4CA 4L8LA 2NU7B 2O3QA 3JZIA 4BKMA 4BNTA 1GGVA 2NWQA 2UZ4A 3FMVA 1IUNA 2Q3BA 4YFYA 4YP6A 4E5SA 2D62A 1IC6A 3C70A 4QTXA 4QQNA 5LQAA 2UVDA 3MOIA 3SYKA 2O8NA 4DRYA 2OXRA 2E5LB 3K9NA 1CUIA 2YFHA 4J29A 1BW9A 1B1CA 4FMCB 3ES9A 2BDTA 1UKAA 5LKAA 3LLSA 1G0NA 1TO1E 1CP3A 1JHQA 3NTLA 4BE7B 4XJSA 1Q3HA 3M34A 3AM4A 1BD4A 3CLSC 2AN5A 4NCXA 4FSDA 3R24A 4IDPA 3U4HA 2V4ZA 1LI4A 5CFZA 1SFRA 2RHBA 4AMVA 2EX1A 3CGGA 1CVIA 5EIWA 2AYZA 4IIJB 3DF7A 1A4RA 1X15A 2YRWA 3OTGA 1JDTA 3FNIA 4H16A 4HRXA 2BFFA 3L8CA 3LUBA 4H0FA 1O0SA 3HBMA 3OT5A 2WYUA 3A0UA 3U81A 5BMVA 3R9XA 4EPYA 5EIHA 3KKOA 4GKVA 2VBFA 4X93A 5JH7B 4PNZA 1JNXX 2KBEA 2DT8A 5EE0A 1G2PA 5DM1A 4K3UA 3WL5A 1PS8A 4KQCA 4U7PB 1DBQA 3N2NA 2PIDA 5FCDA 1E1QD 2PZAA 5DZSA 4J75A 5MF6A 4LYDA 4E94A 2O05A 1GYQA 2LXNA 3R5JA 5ERXA 1WMDA 5AHWA 1LF5A 4MUHA 4Y8VA 3R3ZA 1YB4A 3QUAA 1ESEA 4ZALA 5KPJA 4JLJA 4LHYA 1OZ0A 1PFVA 2WU3A 4LY9A 3G02A 4PSDA 4XX0A 3MGBA 5TF0A 1AZWA 4CM1A 2OO7A 3IFSA 2G72A 2X0JA 4RZHA 5C80A 1UP7A 1X8KA 4GHWA 1ADYA 3UMBA 2N75A 3JR7A 2Q0XA 1Q2XA 5I5EA 4N6NA 5L8VA 4HRAA 2PMWB 2XB4A 1OWLA 2O0KA 5JI2E 1TTPB 3CH5A 3JSAA 1M1NA 1BX1A 4ZDJA 2QL5A 3RF6A 2HV9A 1KBZA 4DJFC 1WZEA 2IIBA 3I1IA 4K5QA 4K9PA 3UHJA 4CM5A 4YJGA 4MV4A 1XDZA 1VL2A 5AKZA 1ECGA 4TX1A 3ELYA 4BMVA 2ZS7A 4C7OB 2FOIA 2VTEA 3AF5A 5IUKC 2HXYA 2WZCA 1MH9A 2PPLA 2PS3A 3PL5A 1W4RA 3BA1A 2ZWIA 3HZZA 4HNSA 2D7CA 3DJFA 5E9AA 4CMBA 1TRKA 2ZBGA 5LZ4A 1WCIA 1IIRA 1P77A 2CUKA 3KB6A 4MR8A 4MIEA 4E2YA 1FW6A 3ZD7A 4LF5B 4G4IA 5GONF 1LPMA 2C00A 3UT5A 4LMAA 1WPXA 1OYOA 2P2NA 2X1VA 2ASEA 5DMHA 3SX4A 3PQ7A 3VC2A 3DD5A 3BUSA 3T3MB 1Z13A 2WKSA 3NXKA 3OX1A 1E1KA 5CVJA 3TEJA 2L42A 2O7RA 1U99A 4CQNA 3GEPA 4I1VA 1N9KA 1KARA 2OXFA 5BY2A 5ADUS 1UZUA 1FMCA 1GCIA 1GQ2A 3ANSA 3G5LA 3HU2A 4PAMA 3PG5A 4XAQA 3N07A 4YTEA 5L4NA 1E92A 2PGLA 1D1SA 2I3BA 4R1OA 3HKCB 2IOHA 1HY3A 2VYFA 1Z35A 4MW7A 3U3ZA 3PNSA 5TEWA 3W6OA 2ERCA 2QJFA 3NVKI 4D42A 5DNVA 4I66A 2VIIA 1POXA 1XZLA 2IPOA 3HBFA 3V1UA 1E79A 1TZMA 3HGQA 4ARVA 4CG3A 2DHDA 2J9RA 1G66A 2CDRA 3H8VA 5T64A 2LR0A 5FBRB 2XTZA 3E9QA 1C8LA 5HF6A 1QH0A 2JGJA 4U7DA 1YS6A 1FTNA 4OBBA 2ZB3A 4CYMA 3Q11A 4RZ3A 3IULA 2HA3A 4J6EA 3PHJA 4D3FA 4JQSA 4MJXA 5KSYA 1TZCA 5HZHA 4G0UA 2I8LA 1SKBA 2E7ZA 2DF8A 3B6IA 4REQB 4TL8A 5BVHA 1WF6A 3JQAB 1NQUA 1HXHA 3T3GA 3V3TA 5KWSA 1QU2A 3R5TA 4OXRA 2WIBA 2CLSA 2DRIA 2LUOA 5BSMA 5FIUA 5B12A 1TU4A 2GBIA 4YP0A 2QPOA 3QEMA 3S3TA 2HA2A 2OHFA 2X4DA 1M2NA 3ITDA 4OHPA 5EINA 4B4WA 3UXYA 1U8FO 4KG7A 4TTVA 3VPSA 1E6CA 1P3JA 4COKA 2L82A 5BNZA 4YBZA 3B78A 3ESBA 2P77A 2ZAIA 5BO5A 3G8BA 5KOIA 1BE8A 2I4OA 3AYZB 2EF0A 3MQFA 1XLUA 2LDXA 5J5CA 3EVAA 3FUCA 3M70A 3VR6H 2DLCX 2BUAA 2VUIB 4R71A 3AY6A 4R3UC 1NRIA 3JX9A 3AXTA 5IZ4A 2HFKA 2CBZA 1C7JA 2BR3A 3BMNB 3AWIA 3H3FA 1IWPB 4IX1A 2FPWA 4R9VA 1VFNA 1CB0A 2PL1A 3VKUA 5JS7A 3NGLA 4IIGA 5I9BA 1PGPA 1Y1TA 4TLAA 1TVCA 2ZI9A 4D9HA 1Y7IA 3TUZC 5FBKA 1BCRB 1ULSA 2BI4A 1DQYA 2VT2A 3CZAA 4J0IA 4KDFA 5AESA 5HOQA 5EL0A 4CTJA 3HP1A 1ZSNA 3CGWA 4I3FA 3L4BA 1G8AA 2GI4A 3TNJA 1K06A 2FWJA 1JZSA 1KVSA 3H7IA 4A8TA 5KPDA 1OJ7A 2FB9A 3WGLA 4DB4A 4OYHA 5F1YA 3EGDA 4CGYA 2HQBA 4O4LA 1VDZA 5BN5B 5IBPA 1RIIA 4ZVTA 1XWIA 1HFJA 2C31A 2GRUA 2WMOB 2ZJ6A 3K5HA 1Q1EA 1SQFA 3NEYA 3RVJA 3SF8B 3LIIA 3N86A 1O03A 2ZE7A 5G41A 3T3HA 3ROGA 4DW8A 1OH5A 5C0OE 1FU8A 2NU9B 4ZYWA 3TPCA 4K05A 3ZU6A 3RS9A 4DKJA 1Y3HA 2WQZA 3DTYA 3QIAA 1Q74A 4OJMX 3ETCA 3K30A 1SPBS 3FYUA 3CLUD 4AICA 4EATA 6REQA 3PEYA 2BEJA 4PGGA 4R84A 2WKPA 2E4XA 4AG5A 5I9LA 4NCIA 3O93A 4DV0B 3DOHA 3QXXA 5GIOE 2XXBA 3OJEA 4TMTA 3THWB 2BEKA 3U62A 4DEYA 2EARA 3KQPA 1YOVA 4CKBA 4XWWA 1Z6YA 3BN3A 2G80A 1E2BA 2XJ4A 5CFMA 1P9RA 4C43A 3MT7A 3QU9A 3PDCA 4A6EA 5D3KA 3DAPA 3V97A 2JLZA 4J0GA 3HU3A 4GGMX 3M6WA 4PQEA 5BRNA 2RCYA 3HUTA 1GG2A 2OESA 1H23A 2Y6VA 4G5HA 1JLHA 2DR0A 3PE6A 2I29A 1MDBA 3KOMA 4D45A 1VQ1A 2QUHA 3M3PA 4C9BA 1BYIA 2ZRQA 2QRUA 4IZIA 3K2EA 2CLOB 2JBHA 1XYVA 5GGXA 1XVIA 2Q3MA 3FTPA 2DBZA 2P6UA 5KNBA 3GLQA 3KBBA 4RH0A 4HFRA 4XWYA 1ECCA 1N6RA 4PRLA 4R0VA 3VC7A 2BKAA 1CS4C 4G5QA 4QRDA 4YCLA 5KNDA 4FD3A 5KTMA 1C30A 4Y18A 4DDHA 1FDSA 5CP8A 2Z6UA 3AI3A 4CM4A 3HL4A 4MI6A 4HGYA 2K7FA 1X92A 1UMKA 1CHNA 2FF7A 4UEJA 4BGIA 5FUXA 4MA5A 2P8SA 3TQRA 2QDXA 2R8PA 4LJAA 4QOSA 2A59A 1T3HA 3CF2A 3QY9A 1LJ8A 3SYTA 4F91B 5FPPA 3R3SA 1B00A 2FZ4A 4K6OA 1W4CA 1D5WA 2D5CA 4EVIA 1USWA 3TSWA 2DH6A 4R4JA 2OP0A 2ZBPA 1SHUX 3ILXA 5I01A 3SM9A 2H59A 1XZ8A 2P11A 1ZVMA 5IARA 3ANMA 1TQDA 3P26A 4NI5A 3HADA 4XSVA 3ZDEA 4KP7A 3UB4A 2Z2XA 2QX8A 1G21A 5B2EA 3OWHA 4FSXA 3D4BA 3AUYA 3EQ2A 3NGXA 3IP3A 3KU4A 4IH1A 3THXB 4QRHA 1YDWA 2SHKA 1A8IA 1SC1A 4KMMA 4ZQFA 1Q57A 4ZZ1A 4AYTA 4DA4A 4DR4B 3OZGA 1BWPA 4JK3A 1LPAB 4D0GA 3QXJA 2YHIB 3VPGA 4BKUA 1ZWLA 1PTJA 1FYXA 2WMNB 1CX9B 2QROA 3ZBQA 3H7AA 5BWNA 3V9PA 4L9RA 3RB8A 7MHTA 3C5HA 3OFSA 1PWHA 3EQ9A 2CVOA 1KQNA 4DIEA 5MGBA 1SOVA 4HPWA 1XD2A 4RCVA 1T25A 2HIGA 3QMMA 4RFSA 5EAIA 3SSMA 2B82A 2BR5A 4V0ME 1U3DA 5EG5A 5HBRA 1XBTA 4BNDA 1CETA 1FP7A 2DECA 1D07A 1GA6A 2XMGA 1E0JA 2K4MA 3B51X 3LWDA 4L72A 4HWSA 5KYVA 3GLGB 3NFYA 1N7JA 4B44A 5FB3A 1NLMA 3LNCA 4ONEA 3IOEA 1P2UA 4LYEA 5CA0A 5F77A 1PNTA 1YBMA 2AUMA 2X1LA 1VJDA 3DB1A 4I7EA 3R7NA 6ADHA 5ALEA 3WHLA 1P7ZA 3SWWA 1GTMA 4HQLA 2B0CA 3UJNA 3F5MA 2P30A 3I58A 1XL0A 5JS8A 3WFIA 1MAUA 1QGZA 5HJ2A 2CV2A 1PL8A 1FRZA 1J8DA 4O25A 2YINC 2TMKA 1QDLB 3H5WA 4ND4A 4UAUA 5KI6A 3VR2D 3ZY5A 4AWXA 3VI3B 1Y42X 1B15A 5KC8A 4GPAA 4WVLA 3TTYA 1PR5A 1T4CB 1U98A 3QF4B 1QG6A 1DCKA 1D6JA 4LRQA 3I9NA 3JAWB 1NR7A 1Z17A 2WWGA 3NRJA 4MEBA 1UKYA 4ZOLB 2FW6A 1KJ8A 5TJ9A 2B7LA 1O9BA 1UEIA 1XTVA 2CVHA 1NULA 2OKGA 2PZKA 2W2XA 4US1R 1U1EA 4ACAA 2PVSA 1Z0ZA 2VTBB 1K2WA 1VJGA 3BFJA 4UEWA 5CXQA 1W59A 3CKKA 3GCXA 3O8LA 4D98A 4AULA 4UZSA 1RCFA 2AK3A 3I3OA 4UM8B 1Y37A 4C3VA 3HTXA 3F96A 1Y6FA 1ZH6A 5EHZA 1TUGA 2H9AA 5HIAA 3TX2A 5ULLA 5HFAA 3SPXA 1DDIA 1JLKA 4JQYA 1PJBA 1XTKA 2WDPA 4KZKA 4NDAA 5G0UA 1X9GA 2MSLA 2I2AA 4XGKA 1Q0ZA 4DJEC 1H1LB 2ZU0C 4J1SA 3TJMA 3ZI7A 5FV7A 1OH8A 1Y6ZA 1JAYA 2KQUA 1NMQA 4FGKA 4RAQA 3M81A 5F7XA 5HS6A 3B52X 4YRRA 2EQBA 5DOVA 1FZTA 5G2OA 1JWLA 3DZGA 5A0TA 1W88B 1EB8A 1SNYA 4NK4A 4WY2A 2MU1A 4KIUA 4A92A 4N3CA 2DPMA 2FWAA 3KXDA 3QPBA 3OOYA 3WLRA 5FTNA 3KV1A 1Z6XA 3D4LA 3D6JA 3EWAA 3Q8WA 4TN1A 1EZ4A 1VZ2A 5CM8B 3I5UA 3ZZNA 2YL2A 5B37A 1N0IA 1K08A 4FPXA 2G36A 3SZUA 3PFGA 4P08A 3LQRA 5DLPA 3H0KA 4ZC8A 4C29A 2FPIA 3E3MA 3E9EA 5CLGA 2W2NA 1GL9B 3ESDA 3KLMX 3TOVA 1RRPA 1DBPA 2F8SA 1QQAA 3RYIA 4CE6A 1XTIA 4HAOA 5AW5A 3P32A 3GDGA 3K1AA 1ZC4A 3EG5A 2W6OA 5JY6A 1D2GA 3C87A 1KI9A 1M6VA 3R1IA 4NYMR 1KI6B 1B93A 1JR3E 1ZPDA 2QM3A 3WS7A 5FJJA 2WEKA 2VQSA 3IBGA 5FLYA 1W76A 5H4GA 4RQBA 5E4FA 1XKQA 2QTHA 1RYMA 1SBCA 1O7JA 5EEHA 3AERB 3CM0A 3ACDA 4W8GA 2FP4A 3FHOA 5A9SA 2ACWA 5HQJA 3SC3A 1A96A 4J76A 1WMAA 3QQPA 3M2TA 3CBQA 1NBMA 5LWHA 3IIJA 4J4HA 1G59A 2HREA 4TTRA 4NOMA 1DE0A 1QWOA 3FCEA 4LRTB 5TDHA 1HBJA 2EHJA 4H7PA 4OQQA 3JQRA 4DYDA 4EQ6A 5AKXA 3PWSA 5H9VA 5KQPA 3RT9A 2FFAA 4LHWA 1KO1A 2FMKA 4JVLA 4TUYF 3TSAA 3DBVO 1H8ED 4DS3A 2W58A 4CMAA 2X22A 3WL3A 4IJKA 5CDFE 3DMFA 3LX5A 2ZZMA 3DAOA 3NATA 2J5BA 4LBZA 4LDZA 1JBKA 2NU6B 3AEXA 4E2WA 3PUIA 3QVGA 2VA8A 5FUWA 1YS7A 1I7QB 1PHPA 4HFNA 1R0KA 5LOVB 1JTEA 1YJ8A 1IPFA 1TQ4A 3P9RA 2CBGA 1PV1A 2NV6A 4MVWA 4KO2S 3HKEA 1HDOA 2EKZA 2QQ5A 1QZTA 5DWDA 1QTQA 1YHNA 1N77A 3W2IA 1R88A 2WUVA 1GFSA 5CX4A 2HA7A 3C6KA 4YI3A 5HRUA 1R18A 3AEZA 1WKCA 5LYJA 3M5WA 5F78A 4WOJA 1V26A 4MB6A 1IXSB 2JI9A 5D7NA 3VGPA 1FSPA 4ENVA 1RI3A 1CUEA 2PCJA 2I2BA 5FNZA 2B4QA 3WLAA 1KSGA 1J2UA 5IF9A 2P3LA 5ALRA 1W52X 5H4HA 5IVIA 3RNOA 4RHEA 5C2JB 1I24A 1X42A 4G5OA 3WJ1A 4F60A 1ONNA 1HT1E 3OU7A 2OO5C 4D46A 5C5IA 4FT2A 1UQTA 1M8JA 1DEKA 3IHWA 4B3JA 1M6EX 4M3NA 5EI5A 2P5SA 2G4LA 4QVIA 1I7DA 4LF6B 3VKHA 3PNQA 2MWMA 1AZLA 4D3XA 4B75A 3WKEA 4LGCA 1LPNA 1BN7A 4ZZ3A 2BAGA 3O8BA 2JLWA 4YMWA 1MENA 1L5YA 2HPHA 4NBRA 3CX3A 2RONA 4KO1S 1EDEA 4P9NA 3ISTA 2ZIFA 1TKBA 2AW5A 4W8HA 2UVQA 1W34A 1LBHA 1UM8A 3FZGA 4ZT7A 3MG9A 3F4KA 3G0GA 3S2SA 2OLKA 3ZWBA 3MLBA 3ZE2B 5A02A 4AKTA 1S2IA 1UXOA 3WBKA 1NX6A 1RHRA 4D9IA 4OL9A 2NU8B 3EEFA 2G4VA 2RAPA 3L8GA 3RF7A 3NOVA 1P3Y1 3F8SA 4DV3B 3O5AA 3NALA 3AW8A 4P38A 5L3QB 5AHOA 3VKVA 2BEVA 2YIJA 3NIBA 3LBFA 1V25A 1XUOA 1KAHA 2C4VA 3WJ7A 5C8DA 1S8FA 5HIMA 4E1VA 4NDZA 4ARAA 4WI1A 3IIIA 1KI4A 4N18A 1U2RA 2V4UA 1R0SA 1IAVA 3TZHA 4IH9A 2VUSA 2BGKA 2G6TA 1JHYA 4PPFA 2J33A 4L73A 2QV7A 3D0KA 2G17A 1SWWA 3WIBA 4ARIA 1UPAA 4DZRA 1YDHA 1LDEA 3H5VA 3QFFA 4IIYA 2TECE 16PKA 1EBFA 2OCPA 3D6UA 3NNNA 4GU5A 3WOVA 5FEUA 4CEHB 3MMNA 3AEKB 5DBIA 3PJDA 1QH9A 2GN8A 3Q0TA 8ABPA 4ZCSA 4FNMA 4H0NA 3D7NA 4L6AA 3OQ1A 3N75A 3OZXA 3OX3A 3NBZC 4QVGA 3ORHA 3UYLA 3V33A 1KZ7B 2UUOA 1W29A 5EZ5A 1E59A 4RPIA 2PKXA 3GJ8A 3IELA 4FMPA 4EG6A 3H0EA 4ESVA 4D0LB 1FLNA 4HDAA 1T5IA 3NTXA 5EWJA 3A9TA 3W7VA 2A3NA 3WY9A 2D0PB 1Z88A 4B4KA 1KVQA 1CIPA 1KKUA 5HIKA 4DUZB 4MQ5A </