1PBNA

Purine nucleoside phosphorylase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
289
structure length
289
Chain Sequence
b'MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPVSGHTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
total genus 85
structure length 289
sequence length 289
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1995-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pbnA00
2I4TA 2QTTA 4GLJA 4EB8A 1JDTA 4JWTA 4NY1A 3LA8A 2P4SA 2ON6A 5JPCA 3E9ZA 1Z38A 4MCIA 3QPBA 4BMYA 4YMLA 5IFKA 4JP5A 4LDNA 1ZOSA 1T8YA 4OEHA 1JYSA 3KUKA 1JP7A 5F7ZA 4U2KA 1RFGE 4F2WA 4F2PA 3UAXA 1A9SA 1JDUA 1LV8A 2HSWA 5F76A 3PNPA 3NM6B 1PWYE 4MARA 4QASA 3PHBE 1RXYA 1YQUA 4QAQA 1ECPA 1RXUA 2PGAA 4LKRA 3ENZA 1ZL2A 3P0FA 2A8YA 1JDSA 2A0XA 1LVUA 4M3NA 3UAWA 4L5YA 1Q1GA 3P0EA 2HWUA 3OOEA 2I8AA 1A9PA 2OECA 4TXNA 1TCUA 1Y1QA 4TXLA 3OZBA 4YNBA 3OCCA 3UT6A 4DA7A 4F3KA 4M7WA 3KVRA 3NBQA 1A9RA 4YO8A 3DP9A 1RXSA 3E0QA 1OTYA 4R31A 3EMVA 3K8QA 1V45E 4TTIA 2QPLA 3EUEA 3FWPA 1Z5NA 4DAEA 1NC1A 4BN0A 1U1CA 3ONVA 4QFBA 4JOSA 4LNAA 1PR6A 5EUBA 1OU4A 5B7PA 4WKPA 1K9SA 4LZWA 5F7XA 2OC4A 1T8SA 2IQ5A 5FAKA 4NSNA 4GMHA 4M1EA 4QATA 5F78A 4PR3A 1ODIA 4TTAA 1V3QE 4F3CA 1Z5OA 1V4NA 5F73A 1YQQA 1Y1RA 1Z35A 4KN5A 1RXCA 1JE0A 3DF9A 1T8WA 2QDKA 3NM5A 2OXFA 1OTXA 3O4VA 5CYFA 3OZEA 4NS1A 3OPVA 2A0YA 4G89A 5F7OA 1T8RA 4TXMA 1XE3A 5CCDA 1K3FA 5IU6A 4DA0A 1VHWA 3UAZA 4P54A 1K27A 2BSXA 4K6OA 3FNQA 4L5AA 1TGVA 3INYA 4GLFA 3UAYA 3SCZA 1OVGA 3BJEA 3PHCA 5ETJA 4D98A 1WTAA 1U1GA 4D9HA 1PR5A 1OV6A 1NW4A 4BMXA 2A0WA 1G2OA 1ULBA 1N3IA 1OUMA 3OZDA 1Y6QA 1U1DA 4QARA 2AI3A 3GGSA 1QE5A 4OGKA 1C3XA 5EPUA 1CG6A 1Z39A 1RSZA 4OJTA 4WKBA 1TD1A 3E9RA 4D8XA 1B8NA 5C80A 3KHSA 3OZCA 4TXJA 1PR4A 1B8OA 1JDVA 1VHJA 4BMZA 5F7JA 1RYZA 1RCTE 2RJ3A 5DK6A 2Q7OE 1Y1SA 1YRYE 3KU4A 1VMKA 3EUFA 3K8OE 3KVYA 5CXSA 5F77A 3FUCA 1A9OA 4LNHA 1A69A 1A9QA 4F1WA 2QTGA 4TTJA 1Z33A 4DA8A 2HN9A 1V48A 4DA6A 3NM4A 1U1EA 4H1TA 1TCVA 1PK7A 1LX7A 4L5CA 3F8WA 5CCEA 4TXHA 2GUWA 4X24A 3DDOA 3OOHA 4GKAA 3U40A 1ODLA 1Y6RA 4PNPA 4WKCA 3GB9A 4WKNA 5EFOA 5B7GA 1NC3A 4OF4A 1JE1A 1V2HE 3MMSA 5B7QA 3ODGA 4DABA 1PR0A 4FFSA 3T94A 1PBNA 4TS3A 1TGYA 4E1VA 1RR6A 1SD2A 2XRFA 4DAOA 1V41E 3O6VA 3TL6A 1JDZA 1PW7A 4EARA 1ODJA 1Z34A 2ISCA 2OC9A 4RJ2A 1SQ6A 4UC0A 1Z37A 1ODKA 2AC7A 3OF3A 4TS9A 1Y1TA 3IEXA 1VFNA 3DJFA 5CYGA 5B7NA 4WKOA 1ULAA 1Z36A 1PKEA 3IOMA 3FOWA 3C74A 3D1VA 1CB0A 2HRDA 3BSFA 3BL6A 1M73E 3FB1A 4QEZA 4DANA 4D8VA 1SJ9A 4L0MA 4R2XA 3BGSA 2QSUA 3FAZA 3PNSA 3LBAA 1U1FA 1RT9A 4G41A 4I2VA 1I80A 2AI1A 3LGSA 1T0UA 3UAVA 2B94A 3EEIA 3MB8A 1Z5PA 4DARA 4ECEA 5I3CA 3DPSA 2H8GA 4G8JA 4OGLA 1FXUA 4MCHA 4TYMA 1PR2A 5CXQA 4IP0A 1PK9A 3KVVA 5K1ZA 1A9TA 4YJKA 2AI2A 4L6IA 4OY3A 4R2WA 1SD1A 4D8YA 5KB3A 1PF7E 1PR1A 1YBFA 1YR3A 1JPVA
chains in the Genus database with same CATH superfamily
4WESA 1GXSA 2YHBA 1PVOA 2OCGA 2PRKA 2I7VA 1V43A 3KPVA 1MVLA 3KJQA 5IKOA 4NY1A 3H0CA 5FD8A 3Q9UA 5SZKB 1H0SA 2B25A 5JZOA 1GIAA 5G0VA 4BN4A 4IY1A 2FPPB 2XVXA 4Q4JB 1YR1A 1CU1A 2ON6A 4ER5A 3I5XA 4WK6A 1GSIA 2GARA 1T13A 4Z2YA 2IOQA 1MGOA 4HC4A 3QPBA 4JYZA 4RKYA 4B3DA 4ICIA 1JNYA 3HR7A 1QFZA 4LXGA 2QR2A 4BNXA 3AXTA 3TDMA 2FSUA 4RQUA 3GK3A 1TF2A 1ZJ4A 3WMEA 4YT2A 1WHTB 3BICA 3S8YA 1JZQA 1O6GA 2ECOA 4JASB 2WJJA 3NO4A 4DV7B 1SO8A 2W2TA 1PHRA 3DTVB 3PRHA 4E5VA 1AKEA 1L8XA 1G9TA 1K3UB 3VU1A 4DV0B 4FD2A 5I7AA 3ENNA 2WPDA 3HGTA 4R2IA 1ZD1A 1PDWA 2XB8A 1GPUA 4QNRA 4UUPA 4YMSA 2J87A 5JCJD 3HYTA 2LW7A 3P2YA 4DV1B 3OOWA 4QUJA 1GO2A 3LCUA 1SHTX 3I61A 4GX5A 4NHOA 4DJFC 2I2CA 2XMDA 4J1TA 1X92A 4KO2S 4AY4A 4G0UA 1XPRA 1TM3E 2AX3A 5FIUA 1BIFA 4LAFA 3NHPA 4G63A 3G8BA 4HJXA 3IPYA 3WISA 4FCTA 2LTAA 4YV0A 3WFIA 2EWWA 1NVVQ 2VP5A 4U8HA 2EG9A 1LGYA 2BFOA 1SUIA 3GRCA 2NU6B 2ZTLA 5EZSA 1LQ2A 1V3TA 4IO0A 1T6XA 4J7XA 4EPRA 5BV0A 3V7YA 1SVWA 3WGJA 3DAGA 1WXHA 2WFZA 4DZTA 3GJZA 4PINA 4MGKR 1YI0A 4ER3A 3AEXA 3K9WA 4TXNA 1JTEA 4A23A 5EQTA 1HL3A 5ED0A 2I6UA 4N41A 4J3FA 2O3JA 4HFNA 5KPJA 1DAPA 1NX9A 1KRWA 2VPWA 1WZCA 3MLAA 4O2AB 1EEXB 5G4KA 3OLZA 3UYLA 3WQBA 5KNCD 5B2FA 3WLNA 1LSSA 2QLBA 4JEIA 2PTGA 1UZMA 5AKJA 2ORWA 1V95A 4AUNA 3WGMA 2GZMA 4MRPA 4QQ8A 1MX5A 1SZPA 3H5VA 4FZ3A 3WLIA 1SKUA 4DGQA 2NU9A 1AJEA 1TC2A 2C83A 3T9CA 4TSFD 5CLJA 4EZBA 2UUPA 1F51E 3EZNA 3GW8A 3KD3A 1ZRNA 1UKBA 5DTQA 4MRSA 1PD1A 5LYJB 1YE3A 4NBSA 2G0NA 1PG2A 1W96A 2PV7A 3ZD9A 2XZLA 3J7AC 3ESYA 2B4TO 2NACA 2JJQA 2GCIA 3NOQA 4HGPA 5U1PA 5AKXA 3QFFA 2A9VA 3GZNB 3Q3EA 5HRAA 1Z5NA 5KSWB 2FSSA 1H23A 3UK1A 2GO7A 3GIWA 5C1DA 1X0VA 4EJSB 1LTHR 4MYDA 1MEJA 4P7BA 1MB3A 3LXXA 1A7AA 5AK3A 5L3VA 3EWIA 4BIMA 3VKHA 1N2HA 2DFKB 4FYXA 4U9HS 3BZUA 5FHQA 4UMDA 5LKRA 3DLPX 3C6YA 1JEAA 3GUYA 4YRQA 5F2OA 3C3PA 1D2HA 1S9HA 3HYSA 3Q9NA 2E21A 4FUQA 3WGUA 1JR3E 5FOWA 4GXRA 4WGFA 1FRQA 3ZC3A 3FCEA 4AZ3B 4CQLB 5KEIA 2Q5FA 4FDTA 4ZTBA 4XWKA 1HY3A 4ZQCB 1L5RA 1PL6A 4H08A 4GMHA 4A15A 5F78A 2UZ3A 3SF0A 1UADA 1EX9A 4OV6B 3TRJA 4AS3A 3MOGA 2QMQA 1XVTA 3QYPA 3E3LA 3MJTA 2NGRA 3UJPA 1DXYA 1GSOA 1ZXBA 2SICE 4G2NA 3N86A 2X0DA 3IDQA 4BB9A 2DHCA 1Z0UA 1W87A 1Z35A 4KN5A 4TM8A 3OA2A 1GNTA 5IZCC 2I4NA 4WXPA 4AVYA 2QM8A 1EBUA 2VOJA 1NATA 2ZIAA 3R3WA 4ZVMA 1YBVA 3REQA 1XZPA 4XEHA 3SF8B 2H57A 4CLRA 2HJSA 2MYUA 2R6ZA 3MGBA 4D0SA 2DLCX 1NSFA 2IDKA 4YEDA 1BCSB 3VTZA 1TU3A 2BGNA 3MSCA 3R76A 3ZGVA 5J43A 1D2EA 3GFBA 1QU3A 2JCYA 4TRJA 3A4YA 3OZEA 1Y5RA 4JLSA 1BHO1 4W5TA 1EGMB 1C7JA 4GYYA 4HRYA 5EP1A 3D3KA 4EIWA 2VSOA 3COPA 2VF4X 4GZLA 4Q9NA 1E4EB 4JT2A 3LECA 4BO9A 2QIPA 5CA1A 4AJHA 2P9FA 4Q4AA 5KDOA 2QMEA 4NE7A 3ANMA 1EP2B 1GM5A 3EFEA 221PA 1UDWA 1E1QA 1JIKA 1K2WA 1O97D 3NPMA 4DILA 4YYZA 5LP6F 2ZVPX 2QE7A 3NHAA 4R68A 3ZDFA 2CDRA 3NUQA 2BPOA 4ZI7A 3KT3A 1B26A 5JIBA 2PEZA 1WB4A 2HMAA 3FNQA 4D0NA 1GZVA 4TWBA 4EHIA 4RXTA 3H86A 2BFBB 2EERA 2J85A 1KDOA 1GHTA 4CR8A 1WBDA 3INYA 1CR6A 3QPAA 3UAYA 4MQBA 1W85B 1DQRA 1YMQA 2H4ZA 3A32A 3MCAA 4A8PA 1XF9A 4C22A 3R3XA 5JAMA 2O2YA 3PT9A 3OX1A 5C1PA 1K2VN 3BRCA 3MCZA 1XZAA 3ZXYA 4L28A 2HRQA 1W46A 2WR8A 3H2ZA 1XHFA 2GN8A 5B4TA 5JANA 1UPCA 3AR6A 1JKIA 1KMHA 2W11A 5JXHA 2X19A 1OGYA 1OWNA 1USUA 2B4QA 1T3GA 3BTOA 3P71T 1NI4A 4JITA 4KQWA 3LFUA 4AWXA 5DBIA 5KQSA 4P0QB 4RULA 2FNAA 2R751 3PI7A 4PCUA 1UMDA 1GP2A 1YFJA 1DIAA 2HWWA 5FWAA 5F3WB 4OVKA 2C2BA 2R9VA 1ZXXA 4JLUA 3OPMA 3KM0A 2D8AA 3O92A 4WVFA 4XD2A 1QPBA 1ADYA 1GPJA 1GPH1 1VE3A 3RVJA 5JXWA 5C51B 1VE1A 1FP4A 4PO9A 3AIOA 1YNSA 3LGXA 3T4XA 3QVSA 4GX0A 5IABA 4QXRA 2XBMA 3FMVA 4F71A 2B6HA 2WF6A 4R9RA 4PBRA 2IPAB 3UICA 4O2BA 4TMZA 1Z8DA 1TAGA 5ALHA 2FFHA 3T7JA 5JWOA 1AXGA 2ALJA 3FF1A 4GICA 4ZC1A 4ABTA 1JKJA 1IAQA 2Q3FA 3ZCUA 3ZWVA 5GWXA 2I7TA 2AN4A 1PX2A 2ZTUA 3OZCA 1C9EA 1EINA 5JPIA 2HR1A 1KVTA 1JIIA 1EFTA 3K9CA 1JEOA 2XECA 4M60A 1WKBA 4AX4A 3KHTA 3ZVMA 2G06A 5L7TA 1RJGA 1ISHA 3INNA 4GOJA 1MV8A 1RE0A 3R7WA 3ZLVA 4IS3A 3GBVA 3PRYA 5LYYA 1E3WB 5H3HA 1P5FA 5BUSA 1FBTA 1Z12A 2FWAA 4JSYA 1RP7A 4UHJA 3MT0A 1V7CA 2PA0A 3JY6A 2G9QA 2JKYA 2GK4A 3PWTA 3T61A 3OQIA 4OQXA 3SSAA 1TB4A 4C1NA 4U2DA 1D1PA 3GPCA 4QICA 4V02A 3S7TA 4A0HA 3RVOA 1W36D 4OHWA 1PJCA 1WDTA 2L19A 3H04A 4XZ3A 3RYFB 4O02B 4IG9A 1E9BA 4LHYA 5DBGA 5BOVA 4F9TA 2Y0EA 2PNFA 4N0QA 3CZMA 2C2GA 1EP3B 4B4WA 4B46A 3DE1X 3V1YA 1L8OA 3C8MA 2CLSA 4W99A 3M5PA 4WW0A 5DGHA 1OXVA 2X0JA 2G1AA 5GOTA 1CS0A 2RGCA 3VNRA 1ZUIA 5J4LA 1DE0A 5KSPA 5DGIA 1AQNA 1WLYA 3DZKA 1TTHA 4FIZA 4J2OA 4K7JA 4LZJA 2GHRA 1GU7A 4P31A 4PQFA 1TAUA 1F0KA 1Z5UA 5CITA 3D02A 1UANA 5D7NA 2X8AA 2QTGA 3O75A 3LPLA 4X20B 4MAAA 1YV9A 3DAPA 4RY2A 3U3ZA 4JJAA 1UJ5A 3WB1A 3DT8A 3O91A 1Z63A 2QUJA 1GZ6A 4GC9A 4EEKA 3C14C 2IVZA 3AY6A 3IAFA 1FW8A 2ZWPA 4Z4GA 3OEHD 2GT1A 2IBMA 1G64A 3G2NA 3SS8A 3JQFA 1TUIA 1O8BA 4H1TA 1U7OA 4IGFA 1U28C 3S68A 2SECE 1N2ZA 1JS1X 2ZE8A 8ADHA 3P5SA 5K3CA 1EVYA 4LC9A 1T9AA 3LHFA 2VHTA 4EY6A 3CHYA 2PH3A 1OR8A 2CZQA 1F1BA 2EL7A 1LNSA 5LXTB 4KXNA 2QMZA 5DBHX 1AGPA 1OV4A 3PVZA 3COJA 3SJCA 4Q3BA 3PEYA 3B3FA 4IHJF 2OYCA 4DT1B 1MOSA 2QSZA 4WASA 3ESZA 4AMZA 2A4KA 3U17A 1XNRB 5EGSA 4RD0A 2FR8C 4NMHA 3V2IA 3WRYC 3WRXA 3VPBA 5JD4A 4V03A 4YDQA 3T7IA 1II8B 3L06A 2ZQ5A 5BPFA 4OMCA 4QC2A 4KB5A 2YZMA 4RPKA 5DDIP 2OO7A 2RMKA 4OHMA 3M6UA 3TLZA 1G8GA 3ZGZA 1SCUA 3D4OA 1XKTA 9LDTA 4C2AA 1E79D 4JD5A 2AEFA 1G8KA 5F3RA 1SC6A 4ZT3A 1MEOA 1UQTA 3R74A 2WUDA 1NTOA 3P9QA 4AG5A 3IR5A 3FUWA 4B3JA 5JC8A 5KVVA 3LTNC 1B1CA 1ZO8A 1JEYA 2G1PA 1JHYA 2BF7A 1IZZA 4HS4A 1HXHA 4PS0A 5ALKA 4ESOA 1B4DA 1YDMA 1YQTA 4U6NA 4HAZA 3PX3A 2OAQ1 2Y77A 5EXXA 3S4YA 1FY2A 3SK0A 2PS1A 4L8YA 3U7JA 4BFSA 2N3ZA 2PMCA 1KDRA 1PR0A 3SLGA 4WACA 2QTNA 4YQYA 2WTNA 1X1DA 1UZLA 3GT7A 3EGOA 2H17A 4X6UA 5HFNA 3ADBA 3EODA 3UJBA 1S3FA 2E85A 4NFHA 2WT4A 3GAMA 1V41E 2FUG1 2A7XA 3BGVA 4CMEA 1Z18A 4IDFA 4WXMA 4ZK6A 4NI5A 2QLFA 1GCOA 4EGAA 1EVZA 4DRXA 2W42A 3SWWA 1CY1A 3KDAA 3V4LA 2WT8A 3F5SA 3C7DB 5HCIA 2NZYA 1AA9A 1OHHA 2VZ0A 2ODTX 1ND5A 1PIWA 3LA6A 3T6KA 3MQ4A 4MUXA 2GTPA 2VIIA 4LK3A 1FQJA 1EM6A 1WULS 2C92A 2P5YA 2YY5A 2XX3A 1E0DA 1X19A 3PJDA 3HBNA 3IIMA 1B74A 2PZLA 2HPZA 1K8YB 4RF3A 3DFKA 4O33A 1W30A 2BISA 2AF3C 2ZIZA 3QWBA 4L57A 2J0VA 3DTNA 3MUEA 5CG1A 2HD4A 3IJEB 3ISVA 1L4EA 2R8ZA 1WETA 5HGXA 4B75A 4EVIA 1NG1A 1X8XA 2G25A 5KBYA 3DJFA 4C29A 5TB5A 5CX1B 2ES4A 3L0PA 4ZZIA 3KQNA 1RTKA 3TQTA 1RPZA 2BC9A 2QSYA 3CSSA 5CYGA 1HE8B 1NDUA 4P81A 3JQAD 1T4CB 4I8IA 5K6AC 4J0DA 5TS3A 3P8ZA 2W00A 1YZQA 1D6SA 1IN8A 1FS4A 1P9OA 1Z17A 1BCRB 2OHOA 2RGNA 3D8HA 3D7RA 3QPUA 5FAXA 3IOMA 2QA5A 3IBCA 1POWA 2P3QA 4ZFNA 4PTYA 3I9NA 5ECYA 3S7ZA 2H06A 2PS3A 3P1JA 4WWHA 1KU6A 3RH0A 2AK3A 5F33A 2VQDA 3CKLA 2C84A 4L5BA 1NW9B 1ZQ1A 4V0OA 4BQFA 2WD7B 2H1HA 3DVAA 3HXLA 4TWZA 2GBCA 1C5KA 1RJ9B 2QD5A 1NLZA 1M73E 1FRVA 1W49A 1V6AA 2OE2A 2VNHA 3B36A 3EVNA 4YJFA 4XGKA 2YXLA 4CQMA 4DIKA 1MAVA 2HCJB 3GLUA 2FSGA 1GYRA 3DEAA 3I4CA 2IP4A 3IJRA 5EJGA 4KKXB 4TN5A 4XYLA 1YBAA 2UZ4A 3P94A 4EABA 2ZWIA 3QK7A 2I71A 2NUBA 3WIUA 4YRIA 2CLMB 2IXDA 3L77A 5ADWA 1RM3A 1DX9A 2D5IA 2G8LA 4HBZA 1SK9A 2ZULA 1KZ1A 1K92A 4KMMA 1GKYA 3CUUA 1JG2A 1FDOA 2EJCA 2J9XB 4UUQA 1FYWA 4EZIA 3U44B 2QBYB 2NUAA 3F2IA 3EXG1 1DEAA 4KWTA 3EEIA 3PQ7A 5HJ7A 1VLZA 3JVIA 4TWAA 3GZTB 5DOZA 4RESA 3I62A 2PKXA 3TD9A 2JGDB 1DG1G 1BVHA 3ZDBA 3U3RA 3GGCA 2R48A 1F0PA 4GS5A 2RAPA 2CV2A 4KV9A 3UMBA 2WEKA 3V1UA 2GD1O 3MJ4A 1HDGO 1G2PA 1XWIA 2R5NA 4FFNA 1PR2A 4M8NE 3WBJA 1VJ1A 3H19A 4YRBA 5JYDA 3E23A 4F2GA 4AF6A 2PX3A 2X1MA 1ZYUA 3IIJA 2IEZA 4LCEA 2KE5A 5BSHA 1NJFA 2QE7D 1ORRA 2P90A 3ANSA 3RG2A 3SHTA 5KWIA 2OFWA 2WJAA 3NS7A 1Q0TA 4W5NA 4EHLA 4KN9S 1H2WA 1A7KA 3HWX1 3MK31 4A1FA 4EB6B 1GN8A 2BYTA 1O0BA 2RGYA 3T7KA 1ISSA 5FCDA 4UEJA 4AFNA 2G71A 4ETWA 1B6SA 2FE4A 3ZIAA 2PSDA 1EE9A 3BA1A 3CN9A 3QLEA 2GF0A 3BWCA 2FCRA 1TIKA 1IQ0A 1YR3A 2OR3A 5L4NA 3E4DA 3WOVA 4XWAA 3FLBA 4DJTA 2AFIA 4L7VA 1KMIY 3S2IA 1ZM3A 3HBAA 5JSYA 3O03A 3RJZA 2A5DA 1NHGA 5AM1A 3EEOA 5FPTA 2B7LA 2YMQA 3S1SA 4DA4A 3CWZA 1J0CA 4ND7A 5CB6A 2IY7A 2R7KA 4JLDA 2NNWB 2UYQA 4ZIRA 3AGPA 5IFKA 9ATCA 5IJWA 1LF0A 4N3CA 5SZIA 3CLHA 2FRXA 1W4LA 1OKKD 4PF1A 4W9NA 1T8YA 1BDJA 4OEHA 4OFWA 1RWXA 3U9LA 5K0GA 1U2TA 2A86A 3ND9A 4H9GA 1OLUA 1T3LA 3KUKA 2FMXA 1P2BA 2RHGB 1ZVKA 3IHLA 4ZO7A 5H81A 3Q8LA 3SX0A 1JKFA 1MB9A 3ADPA 2J0UB 3GDGA 2WLSA 1NN1A 3TQSA 2WAOA 3JVVA 3ZHYA 5BQOA 5CFQA 4IKPA 4NCJA 5DSXA 2CFIA 1KC3A 3D2CA 3IHKA 5F3DA 2HIAA 2HSWA 4NFLA 4NU8X 4BKRA 5G4LA 3UBMA 3V8QA 4DA9A 2W83A 3ITEA 1WKCA 3HK2A 3OJ0A 1IIRA 1A4XA 3D6NB 3KQOA 2HY7A 2D2FA 3RC9A 1IJEA 4JU9A 1BGVA 1XWWA 2VPTA 2X42A 4OD0A 4KJXA 3W6OA 3AVPA 1J8YF 4WA7A 1DKLA 1LC3A 4IMIB 3GRZA 4M55A 4PHFA 2PGAA 3G2JA 4YRRA 3ET5A 5HJ2A 2Q0HA 1WY5A 3ZI4A 1DEOA 1C41A 1YJXA 1ISRA 3K9FC 1Z4JA 3THXA 4W7SA 2HQRA 4E6PA 1MKYA 3BXPA 1AIPA 1CR4A 3ORRA 4M3NA 4RDCA 1JLRA 3VPFA 1U2SA 3W1VA 1GA6A 1Q44A 3GLVA 4O4JB 4D6PA 5IJ9B 4IQ0A 3WV5A 4D42A 4KR7A 3OCYA 1LU9A 1HRDA 2VJAA 2M98A 4OP1A 4JR2A 1Y3AA 3HA2A 4M6WA 3WHKA 5J2UF 4IVNA 1X7YB 1KBQA 2R8YA 4LGYA 1XZQA 1HT0A 1Y5MA 4FOSA 4C4PA 4HZIA 5J2TB 2F1OA 4RW0A 3UJ8A 1F8UA 3H16A 4KKVA 3W1EA 4BFXA 2FPMA 2LKCA 2HXGA 1T8UA 2DH5A 2WHPA 3F8SA 1ZH8A 3UT6A 2WU1A 4F3KA 2F9LA 3ZVLA 1ZGHA 3OD5A 4GGPA 3CYFA 4JA0A 3INTA 4LRTB 3E2MA 4KQKA 1IL0A 1X7DA 1YIAA 4HB2A 2V5AA 3ESRA 1KVUA 4UBKA 3TTYA 5AIBA 4LFAB 1Y63A 2J4FA 2IGBA 3IKLA 2WY2D 4DPKA 2HUNA 2I76A 2QLTA 4Q4DA 2FLKA 2G17A 4CM6A 4ITUA 4TV8A 3JVUA 4DN6A 1ZIDA 4QBHA 4EY8A 4DF3A 4YAKA 3NCHA 1DGQA 1LCIA 2ZJ3A 3HXPA 3QPWA 4G0XA 2HFJA 3NRCA 2GUGA 2HMSA 3JWIA 4K87A 2BM0A 4RPLA 1IMJA 3WLOA 2R1TB 4EKDA 2DZDA 4F4DA 3I8SA 1K7XB 3JQDA 4TVOA 2D59A 2JS7A 4ZRNA 4NLLA 4ND8A 2HNBA 3SOZA 3WMGA 4DNPA 2I9KA 3ICEA 2O2IA 4OGWA 4P36A 1A8SA 1M75A 3A6FA 4N7RA 4J1NA 3ROGA 3VXKA 1CLUA 2FPKA 1JJ7A 3AH8A 3LY9A 2B2CA 2XQGA 3TZEA 2FN3A 1M6HA 5A9TA 3WKEA 2D8MA 4MQMA 4NBLA 3RTAA 1P73A 2ZSAA 4ZQBA 4BBPA 1IXYA 4FT2A 1E58A 3KBOA 4CF5A 1RU3A 3GFTA 4IRUB 5IYZA 3PQ3A 1RQRA 4M76B 4DIEA 4RMJA 3HEBA 3UUGA 1YBHA 2F1IA 3RC8A 1WP4A 3BSSA 4CQJA 3CQ9A 4DQUA 2OM2A 5CH8A 3C1TA 2DPMA 4Z86A 3RAJA 3QY9A 5BQ5A 2FN4A 3PR3A 3DHNA 1J23A 1U80A 4MUGA 2C5EA 4B7XA 1JQBA 1PQUA 3COZA 3HXKA 2JAXA 2P2GA 2PMBA 5EGNA 4F38A 2BFFA 2ZU6A 3CPJB 4B33A 5HOQA 1CZKA 1GQQA 1M54A 1CDEA 2AB0A 3K8ZA 2UZIR 3R9KA 4BNVA 4IXMA 5KYWA 3QENA 4RD4A 3RSOA 3U9TA 5AW3A 2I6XA 3ZY3A 2W2KB 1EQ2A 1EK5A 3EZFA 4X1KB 5EWJA 1DLIA 1NJ6A 2Y92A 3E9QA 3N7UA 1LF5A 3DF9A 2ZEJA 3F6PA 2C9BA 3L18A 2VDRB 4FFBB 4JHXA 1WEHA 4UTZA 5C81A 1YDHA 2XMPA 4P80A 5KHLB 4F1JA 4ZHSA 3ECCA 1K9VF 1NIJA 2I62A 3K1AA 5EUMA 4CV1A 2GETA 2Z0MA 2HEIA 3QG1A 2QW8A 2C5LA 5AVRA 5JFTA 1ZSVA 2PLRA 1OHHD 5ELMA 1IY8A 2WSBA 3OPVA 3BD6A 4MAFA 2VKTA 3Q8KA 2Q3LA 4YYEA 3ENKA 4I4LA 1N2IA 4JDPA 3SXUA 3GCZA 5EJ4A 3CX8A 4QVGA 4XCXA 4IF4A 2O5CA 2JFQA 4BKMA 4CM4B 4HQ6A 5JADA 2IH2A 1JUDA 2Q6OA 3JRXA 4DDTA 4G8CA 3UMFA 4NMMA 3EIXA 3ZLBA 1YKGA 1CRQA 1FUYB 1UBOS 2OB1A 3DZBA 3AUKA 4F8JA 4K6GA 1Z56C 1FX1A 2Z5LA 3ANLA 4WFJA 1JKXA 3O4FA 2HDHA 1YHZA 1PP4A 2OD9A 2WTEA 5DEOA 5EZ5A 2VZ8A 4L5AA 1UH5A 3OPXA 4OBWA 4FE4A 4L7QA 5KINB 1M8KA 1P0CA 1VECA 3OU6A 4RZHA 5ELXA 1SD5A 3JYQA 3G0BA 4O4HA 2ODNA 3PITA 4OHOA 4J0IA 3UWPA 3GFQA 5L8VA 4A9AA 4DJDC 3IIKA 2WMDA 4UEQA 4ZMRA 3IRVA 5FUQA 2A88A 5AT1A 4GDFA 3ZHXA 5HTKA 4EL0A 2XCLA 3T7CA 5DH9A 5HRCA 1E9VA 1LVHA 1XVVA 2EKQA 3KZMA 3QF4B 3MPUA 3IPLA 2C5SA 2HOQA 5HS6A 1KEPA 5H3CA 1CHDA 5KJCA 2CJXA 5ALJA 1PR5A 3K0AA 1T35A 1QH1A 3BC1A 4XYGA 1DDIA 4Z4QA 4XFJA 3CLUD 4OBXA 2ZAIA 4YHBA 1PVDA 3EC1A 3WDLA 2RH5A 1YVDA 5HMMA 5BYJA 4CYMA 4J43A 3VBCA 4CQMD 4KXLA 1AZSC 4QYIB 3HDYA 3SMVA 4IQ8A 5EKTA 2GEUA 4J16A 1KQGA 2WKRA 4TMWA 1SXJE 1Q0PA 3F78A 3PD1A 3KYIB 1RVDA 5CGZA 4PR0A 1EPUA 1XDUA 2CBXA 1JIJA 4MB0A 3VOAA 2BGGA 5IP5A 5IVHA 4O08A 2YFQA 3KFXA 4KDCA 2FUNB 2G8NA 5IAOA 1W8DA 4MGIR 1VJTA 2X4DA 3FVTA 5HKKD 2G0AA 3HYNA 2BLNA 3JATB 3VC3A 4D4IA 3WJ1A 3D0KA 4MQ5A 16PKA 1G8MA 3KOWA 2C2KA 4FFDA 3D4NA 1P1JA 1Z8HA 2J3IA 1KDVA 3EQ6A 3E15A 1P19A 3OM8A 4MEAA 4O8ZA 3RBXA 4CFSA 4EHFA 5LMZA 3UJCA 4TMYA 3CX7A 4Y6RA 4HVCA 4HT3B 5K01A 1O87A 2B21A 4LUCA 4L5JA 4OUKX 1GT6A 1XDSA 4BJ5A 4D57A 2HX1A 2VSFA 5CFOA 3KJZA 2JLSA 1FFWA 1U7WA 1YVEI 3Q8WA 4DRYA 4IPTA 1DFGA 1LQUA 2X41A 3GNLA 1R0SA 4PY2A 5DOVA 3PFWO 3VR2D 3DUFB 2BRUC 4E2XA 1RHKA 2YMPA 4GSLA 1YGPA 3PFBA 1IIBA 2NVUA 3WK9A 2IYFA 2O2CA 3MMZA 5BV7A 2X1HA 2Z2KA 1G5QA 3K05A 5G1NA 4BFTA 1QF6A 4EMTA 1NZJA 2ST1A 1C2YA 3G9QA 1Q11A 3R0VA 2GFIA 4FMCB 1JXAA 4WBSA 5EE9A 1MENA 4PX5A 4RIIA 4S2UA 4KACA 4S3MA 2ECQA 3OZ7A 4WOPA 4WINA 5BN5B 1XEXA 1OFHA 1Y6JA 3JQGA 4HG2A 3A1EA 3FJOA 5EVCA 1WMFA 3EH2A 3MJCA 1W1UA 2O1XA 1BA3A 3EN0A 3N1UA 3MTAA 4FYIA 2HCBA 2QVYX 1NMSA 3ABSB 4E0BA 3L6CA 4IX1A 5MN4A 2J09A 3FBWA 3UBTA 1AQIA 2K4MA 4BB0A 1AGXA 3MS7A 4LZZA 3EZ9A 3UPUA 3AP2A 2D62A 1YOVB 1I2BA 2WE7A 1E6WA 4YMWA 5REQA 3TLGA 3CY6A 4JNKA 4U7HA 1NOJA 3HZHA 3UW3A 4E5MA 3EQ8A 3O83A 1PK7A 4K86A 3FDZB 1JYFA 3FNIA 4HEHA 1ZA1A 4BTVA 2HDOA 3NVKI 1A88A 2VAVA 2ZRBA 3O7WA 3PUJA 2C4WA 5A7HA 1XZIA 5I7OA 1XCJA 2HK6A 3OTGA 4AJ1A 1H93A 2CJWA 3ZV7A 1EX1A 4LBZA 4MJLA 2EFGA 5D5QA 5JI3E 1ZK3A 4OP2A 3KZXA 1CY8A 4MVJI 4BEBA 3U40A 1SG0A 1ODLA 2BDEA 2ZBUA 4JT8A 4WLOA 1E0SA 4D4KA 2C7PA 1NUPA 1CUFA 1NM5C 1UPUA 2TMYA 3AFHA 1WHSB 8MHTA 1E94E 1Z8FA 3H2GA 4PGAA 3PP8A 3QVMA 3MTIA 3Q15C 5C7IO 2OCDA 2CJYA 1FXWF 2C29D 3JASA 4TGLA 4KZPA 4WZBA 4RVUA 4ND2A 4LHXA 1VGRA 3CISA 1Z2OX 3A06A 2IRWA 3KT0A 2OV1A 5B7GA 3ZHOA 3IEVA 1U7TA 1TEHA 5IK2D 2OGUA 3GFGA 1V2HE 4OTZA 3SQOA 3U4GA 5FH9A 1W0KA 3EA5A 1PDOA 3AETB 4NCBA 2I54A 3QX8A 4E94A 3RC7A 4HVLA 2CXNA 1JHZA 4GR4A 5FO1A 3HDVA 3U3DA 1W52X 3VR3A 2LGJA 4MJ7A 4Y2PA 4YAIA 1V37A 4YCSA 4LZLA 4CM3A 3DEKA 3M6MD 1LH0A 1MO6A 2YWEA 3EZ7A 3DA8A 3OZIA 3H3FA 4AURA 3N2GB 3JD2A 2ZIXA 4CGZA 3V8NA 2RB4A 1LDEA 3O6VA 3S2FA 3FR7A 3ORSA 1BGXT 1VPVA 3AVTA 1JNXX 1F2TB 3THSA 2HA7A 3IP6A 4HNHA 2O0HA 5K0SA 2DR0A 5TPWB 5ADVA 3QVVA 5THQA 3W3AA 4C76A 4URXR 3CU5A 4HO1X 4XDZA 1JHUA 3WGOA 1JAXA 4URZR 3W04A 1FJXA 3UGQA 3IEKA 3G9TA 2A9FA 3A9CA 4HRVA 5FULA 4D45A 4DXDA 1IC6A 2PPLA 4KHPB 1NQTA 1T2DA 2H2GA 4IEFB 2JJMA 4ZYWA 2YJZA 3B53X 2O6HA 4MRMA 5A9RA 4PRYA 5J47A 4WH0A 4GKBA 4JBHA 3P9YA 3CCCA 3BG5A 4RYDA 1IXKA 1PU2A 3KB8A 2Q9UA 5WRFA 3ZCRA 2EG5A 1P18A 3IUJA 3AY7A 3OVMA 2NQ8A 2NQTA 1AC5A 1OZAA 1DWOA 3B89A 3WNCA 5BN4A 4GOKA 1EXNA 3BK7A 3GVCA 2VDLB 3PJEA 5FEUA 4POOA 2DCMA 3HFSA 5SY9A 4M87A 3ER9A 3CKKA 5ALIA 3ELUA 4DBLC 1AGNA 1QQ7A 2WG1A 3QBJA 4HX9A 1CB0A 2PV0A 4GYKA 2VBIA 3CUKA 3A31A 2W2LD 1COWA 1SG6A 5JEEA 4O29A 3BXXA 3DMYA 1MU0A 3UMYA 2N47A 4J90A 2GZ1A 1NJGA 3L7BA 4MGYR 5K2MA 3FNHA 1IRIA 1HLGA 1UEJA 5HFJA 3V33A 2Z2ZA 1KQFA 4Y7CA 5U9CA 4Y2UA 4I55A 3KYDA 3M5WA 3O3MB 4DDWA 2IWRA 1PSWA 1U2ZA 1FNCA 3CEPB 4LXQA 2A1UA 5IVIA 4BFWA 1NBEA 4LJKA 1PVVA 4CMCA 3ZVKA 3MOSA 1MQ8B 4X63A 3RVDA 1ENOA 4AB1A 2Y1DA 1E7YA 2ADMA 4B31A 1FFGA 2JBAB 2PBZA 3E03A 4F5EA 4WRRA 3LYLA 1P31A 3HFGA 1K06A 2G40A 5FBHA 2ZR7A 3ZIUA 3FR8A 4REMA 1AUQA 5ITSA 1F7UA 1IBSA 4P2GA 4CIXA 2Q62A 4RD1A 3DXFA 1HX7A 5NLLA 4OYYA 3PYXA 1RYMA 2JI8A 2XJ9A 2QMHA 2ONJA 4NBWA 1E2MA 2LCFA 2P6MA 3O95A 3RWMB 4MW0A 3WQQA 3PTAA 3S28A 2BGWA 2HZ7A 2LCIA 2PX4A 4MGZR 4GKJB 4CMGA 3FVWA 2PZ8A 2I7CA 4NCXA 3V6LA 2JD1A 1G5IA 1VPTA 4F45A 3OSUA 5BW4A 1U7ZA 2AOUA 5EC8A 4ZEWA 3N2EA 2E89A 2JFGA 3A2NA 3L8HA 4ARZB 1ZQ9A 3WIDA 1SD1A 4R2HA 3DG9A 3FSJX 3P0IA 1DIGA 1NJSA 1ZK0A 2IOFA 3RFXA 3A70A 1GZSA 8LDHA 5KB3A 1LBEA 2J0EA 3IQFA 4JJFA 3NBUA 5LQSA 3S40A 4KYVA 2QZJA 3PLAE 2GN6A 1KQNA 1P9NA 4QDKA 1YS2X 3SYKA 5KJEA 2ZQYA 3REFA 1HYQA 3C98A 1RQGA 2XCQA 3LCJA 4QGBA 3RSFA 3PLNA 3I6QA 1GZ5A 3EZ2A 3Q5GA 2LIPA 1OYVA 2DPHA 4A8JC 4O8CA 3MXTA 1XJWA 3SDBA 3LW8A 1F06A 4WSOA 3PE6A 2C31A 1HE3A 1OWOA 1J5EB 2OVBA 3U3JA 3G8CA 1XDBA 3WFZA 4PLWA 1KK0A 5AUOB 9LDBA 3LCMA 1IUNA 3ZGLA 1KI2A 1CJSA 1Z0FA 1II0A 2JFBA 3AOEC 1QHNA 3FZGA 4K9OA 1O58A 4RZ3A 1C9KA 4D3DA 1Z6ZA 2PXXA 3DW3X 2PMKA 3QHPA 4I0WB 2CBGA 2R00A 3HKBA 3DLBA 3RYTC 2C2ZA 1L7RA 4RDHA 5LM3A 3I9LA 4EUNA 3KEMA 4ZANA 1GZ4A 4MDEA 4NBVA 5DYTA 4BAUA 5T4FA 2O2JA 2WJWA 3EMBA 3IMGA 4PX3A 3E9DA 4W9MC 1MGPA 2QTBA 2ZVDA 4B76A 5KCZA 1DLJA 3NRBA 1YU6A 2ZJ4A 2H11A 4GUAA 3AHGA 3H5NA 4NH0A 4Q0MA 5DPMA 4CTOA 4LY6A 5HJEA 5JVDA 4AY3A 3NM6B 3OQ1A 4WQMA 2CMFA 3ITNA 2J6HA 3RFFA 1L5YA 4FYJA 3DBLA 4MIOA 1AN0A 1NNI1 1OJLA 2ZANA 4MYTA 1P5JA 4AP9A 4DVJA 2ACWA 4XPIB 1MZPA 2XMSA 1W1WA 2YRFA 3KELA 1QO0A 3LX4A 4ZHQF 2JHFA 4YV7A 1IHYA 1JDSA 2F3RA 1FUEA 2ID7A 3P5BA 4IW3B 1TQ8A 5B58T 3RM3A 4B2LA 1KORA 3SS9X 3T12A 4E2YA 3UAWA 5I9SA 1GAEO 2BVNA 3VNAA 1K63A 1S5PA 4NCNA 4R6WA 3P9XA 3ZWPA 3EH1A 4U6QA 4LHSA 3IGFA 1V1JA 4DCJA 1BFUA 4HLUC 1J1UA 4GFDA 1IDN1 2EYQA 2NX2A 3MPOA 4IUYA 4TLEA 4JSTA 1EM8A 1LPSA 4BO8A 3JQ7A 3RUAA 1ACJA 1DB3A 4EJMA 3CJTA 4GM4A 1JQLB 1XUOA 2PD4A 2ZBQA 3FCYA 3QEMA 1ZCZA 2P77A 5CAEB 5IDWA 3R41A 1V5IA 5G0TA 1M2OA 3NOOA 1CCWA 4MPTA 1UODA 3OG9A 4FKMA 5ICGA 2HM7A 3OPYI 4WCFC 5JNVA 4I1PA 2GZHA 4RYLA 1FUIA 1P77A 4E7OA 2BFDB 1AB5A 2IYVA 4RHTA 1GTSA 1OWPA 2ERYA 3T5GA 3CF6R 4J1QA 2UUAB 1UBFA 3TTWA 4B7AA 3PHIA 4LJ9A 4R0VA 2GZRA 4PSDA 4YFYA 5YASA 1TU0A 4TTIA 4NEHB 3EXAA 3MG9A 2EDAA 4QE3A 3TW0A 1K3TA 3Q9LA 5T64A 5BN3A 2G9RA 1TEZA 3JWEA 3QWIA 4DLLA 2WB2A 2VK1A 4DAEA 3RNOA 3V48A 4ZYLA 1Q21A 1Z4PX 1PG0A 2XY4A 3CMCO 1R0YA 5DE3A 3AFOA 1P1KA 2JVJA 3OEWA 1CB7A 2DWPA 1TL7C 5IVKA 2J3KA 2J9YB 1QG6A 1ZVQA 1DCKA 3B9PA 3WGIA 3JZIA 4KRYA 5ALDA 2AEMA 2C4HA 4C0LA 3ZWCA 3OJEA 3W2HA 3LBNA 4Z53A 4CZ2A 4V0RA 3H87A 3TTSA 4DLPA 1XQVA 4J76A 5EJMA 1T8SA 1KY5A 4BNTA 2YJ3A 1B0PA 2XCUA 3DCYA 2PS9A 4EZEA 5I4CA 1MTOA 4JEHA 1GPYA 3PYLA 4KH0A 4NNPA 1Z3IX 2YWJA 4D9FA 2X8LA 9MHTA 2C5BA 2ZRJA 1W0KD 4WN9B 3K70C 1Z83A 1CRPA 1SVSA 1Y81A 2I3DA 2YFKA 1WM1A 2AYYA 4RADA 3M4YA 4FYKA 2Q0XA 2QY6A 4KQIA 2XIQA 5I4KA 1CJCA 4Q00A 1QH9A 3VR3D 5JTUA 3ZW8A 2EEPA 4JMLA 1GLNA 3IS3A 5G1OA 1E64A 4LZPA 5DW0A 4MGEA 4BJ3A 1YRHA 4M53A 3RKSA 1AOXA 3ZXXA 3TJMA 5HX7A 3HJAA 1EX7A 1T8WA 1H42A 3A27A 3L6RA 2Q9BA 4UNPA 4MRAA 3RHTA 2B5WA 3QMWA 3WK6A 3ODPA 4IDOA 3UPDA 1AO3A 3O4VA 2IIPA 4IZHA 2ZSFA 1J21A 3C48A 4LSZA 4QBFA 4V38A 4JL5A 5HF5A 2C20A 3SX4A 3P9ZA 2NG1A 3BH6A 4QTUB 1TLTA 5E0KB 2HT1A 2I80A 5AQ1A 4KAFA 1VL6A 4JJ8A 1QH0A 4ASUA 2CVZA 2B82A 2CF6A 2VDQB 1Y4DE 5D3QA 1U8ZA 4K9MA 2GAAA 1G1MA 2BI8A 1OIWA 1SEPA 4LOJA 3L1JA 3PC6A 3CWCA 4AN1A 4EF5A 4BO7A 4LI0A 5AW6A 3OTHA 3OX2A 3DM9B 1UKAA 1XE3A 4B79A 2ZUBA 1R1DA 5AHOA 2Q3EA 1DRKA 5KTNA 2NO7A 1KIAA 1ZD9A 2NUPB 3A10A 2OGTA 2Y1FA 4M21A 4NYJR 2VA8A 2GZ3A 1QIGA 2XUHA 3PENA 4KVAA 4XD7A 2IEAA 3NXKA 5C53B 1FSSA 2PLAA 3SFTA 1K8RA 3NGMA 4O3MA 2VP9A 4O2LA 3GVPA 3WGZA 3PFGA 2GM5A 3K0FB 3V3KA 4QBKA 1HEUA 4NFYA 3QBTA 1GZ7A 5BQXA 2XNCA 3WQSB 4BLQA 1CUAA 4MVCA 4R1LA 1AHIA 4C5CA 4UQLA 3AI1A 4LNUA 4AIRA 1FCJA 1GVHA 2QL7A 3PXAA 1FQWA 1HETA 1TT5A 4D9HA 1G20A 1SNYA 4EF6A 1ZIYA 3JZFA 4JLAA 3TW8A 4QBGB 1WCIB 1ZNQO 4FEGA 2A94A 2UZ1B 5HXAA 1VBFA 4TMFA 2QG9A 1QYVA 1AHNA 2A5JA 2G4CA 1FMLA 4R8MA 4AUKA 1CX9B 4EGFA 2P27A 4Q1EA 2AXQA 5KOHB 2B9VA 2BFAA 1EJ6A 3P2OA 1C3OA 5FTJA 2GN2A 3PC4A 3ZS8A 2CJFA 4Y1EA 4FHZA 1P4AA 2XQJA 2GLUA 5CVVA 4ARSA 2P2SA 2H92A 3IQXA 1A7JA 1WF6A 3GGSA 3FH0A 4KLZA 5CK4A 2AGVA 2QD1A 1HRKA 1T1JA 2CKMA 2RSLA 4KFSA 4PPNA 1HT2E 4COKA 4DJEC 4F6LA 3SQMA 1EUYA 3S3TA 1J8FA 2WUEA 1KJWA 4TKLA 3R8FA 3GGJA 3OFVA 1Q15A 2P91A 1L5HA 4KX5A 3A37A 2H48A 3TNFA 3L1IA 3BCSA 3OLVA 4PZ9A 4EM6A 1IM8A 1Q7EA 1I4DD 2WF9A 1CULC 3T3IA 4AS2A 5TMDA 3QMPA 3RHSA 2DULA 4OMUA 4D3YA 1NA5A 4AJLA 2Z1NA 5DX0A 1FFAA 3ZJ4A 1IBRA 2FR0A 2NOAA 4DSAA 2XOXA 2BFPA 3E5HA 4S1TA 3SEZA 3TZCA 4CMHA 2O8NA 2PUFA 2YJ4A 1A8UA 3PXDA 4HWKA 3I3SR 2Z6AA 2AOVA 1DOHA 3KOUA 4NPCA 1AXRA 1ESMA 3IVCA 2QRUA 3DEIA 1UKCA 3JYNA 1N5JA 1M2VA 2JGJA 4LWQA 3PC8C 4MW5A 5DGXA 5E1BA 4AYTA 4AMBA 3DOFA 2GCOB 3U5ZB 1GPKA 2FE1A 5EHZA 2DETA 2BN4A 1EWYA 1TRKA 3B70A 2WB4A 4Q4JA 2OCXA 4HSEA 5JMTA 5K0FA 2FGJA 4Q18A 2LNDA 3WGKA 4H6XA 4HAUA 1J8DA 1U0RA 4HGNA 1BE0A 3LV8A 3EGVA 4ALIA 3UMGA 2IH4A 1ZWKA 1GPBA 3ETJA 1UBJS 3F96A 2AW5A 1T36A 4J7CA 3DPIA 3L0DA 4M7OA 3SJBA 1F2VA 2PT5A 3NOXA 1OBFO 4CTKA 1SVKA 4HXEB 4TTJA 2VJKA 4U3JA 1TEXA 3KOYA 1N1GA 2W37A 4IDNA 4JYPA 5C9ZA 5HUQA 3H0EA 3I6YA 1L7QA 3W2TA 1VLMA 5TMPA 4RNDB 4K9SA 4CKWB 4DV2B 4DQKA 1NVWQ 1XO1A 4JI3B 5DWDA 1BMDA 5EYPA 3JW8A 2WV7A 1D5WA 1X1TA 2FPXA 5DNWA 5C4GB 3DOUA 4FGSA 4PGMA 5BSRA 1DX6A 5DM1A 2NZWA 2AJBA 2P62A 1EZ4A 1YZFA 1TYZA 2Q3DA 4NV0A 4UNIA 1HEIA 4PGGA 4C6HA 2FN8A 3HB1A 5AXAA 3ADOA 1MA3A 3ZU4A 4CWAA 1ZN9A 2VF5X 3BXOA 3CKYA 1BD3A 1ML3A 2B34A 5A3JA 3DAOA 1UCFA 5BUZA 2V9PA 1DS6A 1AKTA 2NU6A 3O1LA 3FI0A 3UB4A 3WLLA 3QVTA 4YP5A 2G1JA 4LQCA 1Y8QB 4JUBA 4K28A 3BX1A 1AZTA 4MHTA 2W5UA 4JKYA 1XTBA 2CD7A 5L3RA 3MYYA 1P44A 1YZLA 2IHVA 2D00A 3KUDA 4MR9B 3VR4H 3ZZUA 4JIMA 1XQ1A 4LJYA 3T38A 4FWIB 3L04A 6LDHA 1I94B 4OM7A 3TTUA 5EFOA 1BNCA 1R74A 5JE8A 1NC3A 3L7NA 2FJ0A 4DIDA 1JPJA 2ZDGA 4OF4A 1JE1A 1Z5GA 5HGJA 1UEXC 2AMJA 4M86A 2IS1A 3MGCA 1RXEA 1MOZA 1VCMA 2LBPA 3SNHA 1HURA 2ZB2A 4QKQA 4Q4LA 4A8JB 5FWYB 4EW1A 1JFVA 4PLYA 1VHDA 4OHVA 3RJTA 4EUHA 1C29B 2HLPA 3KE9A 3TLYA 3DE3X 2ZIEA 2B3DA 2DTXA 1RQPA 4PLPA 1IQPA 1BA2A 2Q5JA 3GA7A 4BNGA 2AKYA 1CQIB 2IUYA 2DY1A 4HTFB 1TKCA 3HI4A 1M1XB 1TA4A 4H0FA 1ILWA 4NBKA 4IUCS 1UP6A 3ASUA 4RSMA 1HTWA 3EAGA 2R1VA 4MYHA 4OG2A 3TL6A 4BPRA 4CFZA 5GADl 1R8JA 2DPXA 1VMEA 1FEZA 2H63A 2QXYA 3NBAA 1R9NA 4UVEA 3WE7A 4ZOQI 2B69A 2PANA 1RI4A 3R6GA 1Z34A 4A0RA 2GPTA 5KNLA 4UTNA 1F2DA 5TJHA 5CFMA 2WVHA 2JJ2A 2DHQA 5GONA 5JH7A 4WCFA 1PI3A 3H2HA 3A3KA 2R6GA 4DV3B 4EHHA 4JI4B 4TLDA 2GPNA 3T0IA 3WB9A 5C80A 1ICEA 1FTYA 1X1CA 2JI7A 3K32A 2F90A 3E22B 3JD0A 4M37A 1PJRA 5IDYA 2Y0CA 2TSYB 1G42A 3G89A 2IW1A 2OLJA 2XMGA 2JDID 3CW9A 3H5AA 4CQLA 2P9TA 3FPLA 3OLYA 2DOKA 4A2PA 3HM2A 2D1YA 3ASYA 3SDZA 5DM4A 2IYEA 1HUQA 1T4BA 3T7TA 3ZJTA 4Y9UA 3TMKA 4QQNA 2XBLA 3EIEA 3SEQA 1UAAA 2BEWB 3LUAA 5JCXA 1VJ0A 4M98A 4DY4A 3KL2A 4WIAA 3P4UA 1ZX1A 1Z36A 2PWBA 3GMIA 2NU8B 3LUPA 3QBEA 1KMNA 1PR9A 3FOZA 1VC2A 3EFBA 1W19A 1Y9AA 3AF1A 1Y8RB 3DL7A 3X1YA 2A35A 3I05A 2DBQA 3D6HA 3PX2A 3SYRA 4WCDA 1CP2A 1G0OA 1Z5VA 4EFLA 4U63A 4DVGA 1NN5A 3K3PA 5BSWA 3CUYA 2FWNA 1BCSA 1HDXA 1G4UR 3AQIA 2E4AA 2MJLA 3I9V6 4MWOA 5FWXA 5DCWA 3RUDA 1E1LA 3ROMA 1M1UA 2JIDA 3N6VA 3R2JA 3N8NA 5I9NA 4B0OA 5B53A 3T3PB 1I2AA 2WJGA 4BC0A 2PGIA 2RB5A 1JDPA 2VYQA 2WF7A 3TLCA 2AL7A 3VH1A 5A6VA 3AHHA 3K20A 5AI9A 4L4XA 2DFVA 3UWMA 3V80A 4DQ0A 4OLAA 1GNRA 1I4LD 2JBHA 2OAGA 1V0JA 1MJHA 4JBLA 3FMPB 3V7NA 2FMUA 2GBGA 4RJTA 5HIJA 2F3TA 5FV4A 4WJLA 4GGOA 2WJYA 3CUSA 3NWEA 4Q9DA 4BB6A 1PQ4A 4DARA 1DZ3A 3CIOA 2BFBA 4HDKA 1P1RA 2V6IA 2P8JA 1BHJA 3GGPA 3GO4A 5C5IA 4FXOA 4ZI5A 3O4RA 2JEOA 3A7DA 5AICA 5B64A 5I51A 3OBIA 5CVDA 4JH0A 4LX8A 2AOTB 5BW5A 2VRNA 1SC1A 4UM5A 3DKPA 3LRXA 1YB2A 4HYTA 5I48A 1YE8A 4CT5A 3AZOA 3CB2A 2D3TA 3GMDA 3HVJA 5FEMA 3VNSA 3URKA 4AMGA 4RPCA 5H4GA 1ZESA 3QEKA 1JYEA 4MYUA 1IBKB 1OLSB 5KKCA 2JIZA 2C4NA 4DYDA 3ZV3A 3B3QA 4Y2GA 2NAFA 2FVXA 4YFVA 1RHJA 1ZH6A 2WAXA 2WZQA 1R6UA 5JLJA 1GUYA 2AWNA 2FQWA 4EW6A 3GD5A 3PD7A 4DHEA 3K70B 2HB6A 2HADA 4RVFA 5EY5B 4JXXA 1I1HA 1DKPA 3TKAA 2G4LA 4QRDA 1PF7E 4PFSA 3RFVA 3ON5A 4JBWA 1WVGA 3LDAA 2O8FA 2XQIA 3G1WA 1OXUA 3SE7A 5KOJA 1VJCA 1JR3A 5J63A 1XEFA 2GASA 5B30A 3ZHSA 2O7RA 4ZTUB 5JSFA 4AK9A 1EFCA 1YMUA 4TL6A 1BDMA 3BMCB 1VSBA 4FCVA 1KZ9A 1T91A 1B0AA 1RYYA 1LLUA 3K35A 3T3DA 3FW1A 3GJSA 1TT7A 4RJKA 2M6KA 5ALFA 4HH0A 3KUCA 2X6TA 4U7WA 2QAGA 5E9JA 4YMLA 4XI9A 5IEBA 1ZLYA 2BL4A 5IN5A 4GGMX 5CVUA 3JQ8B 4F4UA 4XR9A 1IEWA 5LMNB 2NP6A 2GPWA 2PT6A 3BB3A 3BAZA 4FDUA 4PSAA 5D2CA 3JWHA 5K3AA 3DDZX 4ZVOA 1JP7A 4MPRA 5F7ZA 5ICFA 1UBHS 3TQOA 3HV0A 3UENA 2Z98A 4EJ0A 4OHYA 5KNDA 3H8SA 1E1DA 1J9EA 1ENYA 1KZ7B 4MV9A 2C9OA 4Z4FA 1JDUA 2DBYA 2FPSA 3VR1A 1RDFA 2ECFA 2FWMX 4B8YA 3BMQB 1I01A 5A9SA 1CLEA 1KH3A 4YJ2F 3UB3A 1DNPA 4UATA 1GR1A 4QNNA 5I8ZA 4F5DA 2MSEB 4C30A 5HKLA 2X77A 5HS4A 1U98A 3PNPA 3TS1A 2YHIA 2RHJA 1KPGA 4QASA 2D5CA 3PF9A 1NP3A 4BJHB 4ME6A 2GN0A 2CEKA 3MWEA 2JFZA 1K75A 3L7OA 4KMSA 5ERYA 3WGTA 3IIEA 4HPWA 1L5OA 3H9GA 2IHZA 2IWHA 4CL8A 5KWSA 4GLOA 4A3SA 1ECJA 5TXGA 3MJFA 4OXYA 4Y0AA 4ED9A 4B83A 1BWQA 4DSUA 4R1QA 4F84A 2ODWA 3O0TA 2VAPA 4X3CA 5IEJA 1GTG1 5IYZF 3IP8A 3LL4A 1RLJA 2XUJA 5KVCA 4LRXA 1Y1LA 1D4OA 1I32A 3C3BA 3JAMA 3U61B 2I22A 4QXPA 3MFYA 3QF7A 4XB2A 4CEHA 4DDVA 4I6GA 4CETA 4BFCA 4MCJA 2P9CA 1H8HA 5F4ZA 2XUAA 3LZ6A 4JJKA 5F35A 3V9AA 4BP9A 1BDIA 1E3JA 2QVZX 1D3AA 1OAOA 1TFRA 3NNNA 4MSUA 2WKQA 4EA9A 1FFSA 3NH6A 4LMAA 5E6SA 1F8GA 3JD4A 3HJGA 3ZE2B 4B7UA 1JEYB 1HH4A 1QTRA 5EIBD 1Y6GA 3U1TA 3U7GA 2Y4OA 4JX8A 3RSSA 3I39X 5ARCA 4EL5A 5B3LA 4IG4A 2FMKA 2ZS9A 2Y0PA 1XNGA 3QI2A 1H4SA 2H08A 2PUAA 3N59A 2AQIA 1XMXA 4O4IB 1II8A 4MULA 1ZVJA 4OQPA 1FMJA 1SU4A 3S2ZA 3EMVA 3KOXA 1TKRA 4D8UA 3K4PA 2VCEA 1NXWA 4EY5A 2QPLA 3EUEA 3O1HB 4W6QA 1CUVA 3MJEA 4IHAA 2ZZMA 4ARCA 2RAFA 3KR0A 5K0JA 2GKOA 2O48X 2YY6A 3WX0A 2WWTA 2BM8A 3HO1A 4NFSA 5FBQB 5B12A 3BOSA 3EW9A 5IXYA 1ABFA 3G8YA 4BN0A 3HKEA 1TDJA 1FSPA 3DLHA 4AZSA 1X1AA 5IM4F 3DWEX 1PS9A 3NAMA 2FQXA 4EPTA 5C8YB 2ZI7A 1CR0A 3TSZA 2Z6QA 1YUNA 2XEDA 3BMOB 3JU3A 1C1XB 3BB4A 4CG2A 3U4AA 4I6JA 1VHTA 4HQKA 4RGQA 1WKVA 3OWOA 1I6KA 1Q0ZA 4W7IA 4LXHA 5CB4B 5JD3A 3MD9A 1EHYA 3KSZO 3WIEA 2KLBA 3GELA 2I2DA 3DV2A 3K31A 5CR9A 5H82A 5JAIA 5CLQA 4M1EA 4UARA 3K73O 3TGLA 3TFQA 1SR8A 3P7MA 2PXHA 1JTVA 5DI3B 1SUEA 4B40A 1ZOLA 2HJ9A 4MQ6A 4AXXA 1EHIA 3ZNQA 5I5GA 2G9VA 4IKOA 1Y48E 5EJ9A 2YW2A 3WBBA 2OKGA 3L0IB 3PXGA 1X74A 4DTCA 2CWWA 4PXAA 4DJJA 3CX4A 1UDBA 5DSTA 4WNCA 4OHUA 3D7SA 1E1CA 1DAFA 1P4SA 4Q82A 2VXOA 1Y7TA 1R0WA 1X7WB 2AG6A 1IE3A 3B60A 1CF2O 1USWA 3WIOA 4EHNA 5JAPA 4PU0A 4LSGA 5GGYA 2VYCA 1KI1A 2XQKA 3ZLUA 3SHVA 1ISMA 2ZB3A 4XSVA 3GGOA 3L6OO 3O74A 5HIMA 4LF5B 3OE1A 1WU8A 5LCXA 3QRWA 1HQDA 3D3WB 4KOAA 3AIMA 1NW3A 2WI8A 2C8JA 1QZTA 4R2JA 3LD9A 3V4VB 1E1RA 2A9KA 2XVZA 4YPOA 1JAYA 1RHRA 1IM2A 3QX3A 4FFLA 1P33A 2B1GA 2P2CA 4KWIA 1UJ4A 1RWNA 1BW9A 3VPGA 2JVKA 3QE3A 4CKEA 4HPXB 2ZRFA 3MWGA 4YXWD 3RREA 1QDEA 4FYWA 1CJUC 4RH3A 4UOQA 1IK6A 1SU6A 5FNVB 4H35A 3QVGA 2YL2A 5A03A 1YUMA 2YVAA 1IJBA 1OH8A 4Q7MB 1WQ1R 4TQAA 1IXSB 2R86A 3D8SA 1DINA 4JLNA 5DX8A 4LXYA 5EQJB 3I64A 5T67A 4YMVA 2ZSIA 5JWHA 3K30A 4YJHA 2C5HA 4OXIA 3K72B 3KKZA 4Q3EA 3I28A 1CE8A 2VJCA 2DEUA 5HKBA 2OOKA 4DM3A 5JJLA 3OM9A 1DOZA 4II2A 2KBEA 3TB6A 3ROZA 2REOA 1RWWA 2Y1OA 2YNMD 4RETA 4FUTA 2HSDA 1AK9A 3CM0A 4IIJF 5A4KA 1DJLA 1BMFD 1R66A 4ZV7A 2YVKA 4MUNA 1QMGA 3OZDA 3EJWA 3M2PA 2Y93A 1S89A 3JQQA 4UVIA 2XMRA 3C6ZA 3L4EA 1M6YA 2AKAB 3NBZC 4GOND 3UKJA 3QTLA 1Y1PA 2PUCA 3QLVC 2X2FA 3IA7A 1EUQA 4TYNA 3G5MA 1MD9A 2P78A 3EIFA 4N8SA 2JGRA 3BJRA 3PNKA 5CU7A 1QORA 3L0YA 3BFXA 3FHOA 1T8PA 1T4DA 3M6IA 3W8RA 1XVIA 1N77A 3I92A 1WSBA 1Q7RA 1B8OA 2GMWA 3RJ5A 4LBYA 1NR1A 1A9XB 2XE7A 1WG8A 1SBIA 1WW8A 2PYZA 4HWRA 3WSVA 3WXBA 3OOYA 1R6AA 4JVLA 3D2AA 1MO5A 4LJSA 3QOFA 2ZB8A 3C85A 4Q01A 2ZRAA 5EIWA 3S6JA 1UIRA 4RH0A 4F12A 2H3EA 1PL7A 3HV2A 5TGDA 4EYKA 4L07A 5KC9A 4ER7A 1CW2B 1HEYA 1KJIA 4CKZA 5F21A 1ZR4A 2HRBA 5ERGB 5DK4A 4FYVA 1OAKA 1EUDB 4ZEVA 3RTEA 4BWFB 4PLTA 4DR1B 4REQB 2FFJA 2H07A 1V26A 3GLTA 2OLKA 2Q6TA 3K0SA 3TQFA 1XFAA 2CJPA 1T0PA 2CZGA 2JGNA 3NAGA 3QOWA 4IUDS 5F52A 3C24A 4H1WA 3GJ8A 2WU4A 1RIFA 3UXEA 4KE8A 1ULZA 3PPYA 4Z9FA 1Z6QA 2JFVA 1WU7A 3I01A 2RK3A 4CQNA 3O2JA 3FFAA 5LOVF 4OHPA 4D9EA 4JLWA 4JY7A 4E03A 2R96A 4FR0A 1QR2A 2BSQA 3TIFA 4G3XA 5D1NA 4ZV9A 5L3ZA 3D9QX 4G86A 3UJDA 1NQXA 1QRUA 4Q47A 1ZKDA 1IONA 2HN9A 3H65A 5B6JA 2P2ZA 2DKNA 4G23A 4R8SA 5AFSA 3RKRA 3LTEA 1LNQA 2HU7A 1M0TA 2V54A 2X4IA 1SVUA 3LI2A 2PQ2A 3MJSA 5CX4A 3VR5A 2RH9B 4PNZA 5LA6B 3MTGA 1JI0A 4PXSA 4K9DA 1JLMA 4L3WA 4E51A 1SXJC 1TCVA 3PWZA 1LX7A 3G9XA 5IZ4A 2NO5A 3IVMA 4BGIA 2EOAA 3G7NA 1FU4A 4MS4A 1PR3A 3E2IA 1FU8A 4OSEA 5I9BA 1M2FA 5AIAA 2VVTA 1VSVA 4O4LA 4Y98A 3BFJA 2GEKA 3OLQA 3FZNA 1RHMA 4GG1A 1L1RA 3R7SA 1DBPA 2PKWA 3N28A 3VR4D 4S2EA 1V6SA 4DW8A 4IRMA 1Q3HA 3DKKA 1AK1A 4GF5A 2FI1A 2IHBA 4WBNF 1NRWA 1VKZA 4AKSA 2B20A 2OHXA 3MSXA 1RS0A 5I45A 3P9KA 4JQZA 3E18A 3Q7TA 5DVZA 3KEGA 4NZMA 4FLFA 2VA9A 3FLAA 3FVQA 3COVA 1GZUA 3PR2B 1Y6RA 5HM8A 4CF4A 3JAWB 4G1UC 3TAXA 2HKIA 1X7YA 4XGNA 1V5FA 3LDFA 4FR5A 5AI8A 2XUDA 1U5BB 1CD5A 2N75A 2P4EA 2R6FA 3VDXA 5K03A 1J22A 4PYKA 4KFUA 4FWTA 4ZDJA 4LRQA 1O6ZA 3N87A 2X6RA 5FTNA 4XGRA 4G2TA 5KHOC 2RGDA 3G68A 4C7BA 3SSNA 1MH9A 1H5UA 1R16A 2WTXA 3G1TA 2HJGA 1YT5A 3HN7A 1ZJJA 1JJIA 1Y37A 3RFUA 4OQYA 1WSWA 3JQRA 3QU4A 1FFHA 1PWEA 3N8HA 4TRMA 3TTVA 4K6FA 4MUYA 2FW9A 2ZSEA 2IXFA 3EXIA 3NUGA 4MV3A 1KP9A 3G0IA 3OQNA 4R05A 5CT9A 1ZW1A 1JILA 4I55F 4C7OA 1F20A 1EBBA 1MAWA 5BSGA 5LWQA 1QVRA 4R0MA 2XZDA 5EKSA 1GN9A 1HWYA 1O4VA 4GECA 3T5TA 4RJ2A 4B3BA 1SQ6A 3AF4A 5DT2A 3ZWKA 2O0JA 2GZDA 3O31A 2OMKA 3RI3A 4B8WA 2VF8A 4C0AC 4Q9AA 1U9IC 2GJ8A 3G5AA 2LD4A 4NS4A 1XXHB 3AEQB 1RRGA 4LYYA 3SVTA 3NIWA 2NADA 5FOTA 2CL7X 1E9CA 2NAPA 4HNGA 2XUIA 2VPZA 2Y1CA 3IDZA 3ONDA 3WLQA 1FMFA 1EUCB 3U7HB 1GQOA 2IYSA 1KO5A 1UL1X 2WYOA 1CEXA 3EXHC 4CEJB 1ZN7A 1Z7WA 2CNBA 3ELBA 3KSBC 1H9AA 4ON9A 3WGQA 1LFAA 2F67A 3T34A 4LHWA 1HNWB 4NV1A 1KIFA 3OCXA 3DL2A 4MGHA 4G0PA 1JIXA 3EXEB 2X22A 3OICA 2FH5B 3T7SA 3T9AA 1H1DA 2ECKA 3VDNB 4V1CI 4EENA 3W8EA 5COAA 4MYCA 4MWCA 5B7NA 1DMRA 4X3OA 5A6SA 1QV6A 1NVGA 1TMKA 1XQXA 2JCBA 3BIOA 3G2IA 1PN3A 4NZZA 2BELA 2EX1A 5F5NA 3OP4A 5AHWA 4DEYA 1WMEA 3E6AA 2H51A 3QE0A 3I32A 4FXPA 4ZOLB 5JNUA 3SJUA 4KDRA 1TF7A 1IH8A 3HWRA 4A16A 4KYUA 3UC5A 4DQXA 3GJYA 3GQVA 3UHJA 5LLTA 4RV9A 1YL6A 1GGEA 2E49A 3AVUA 4XTCS 4BNKA 4RVOA 4MV5A 1FDWA 1S2NA 5L7WA 3CR8A 3KUUA 4IDPA 3N58A 3Q2KA 2GZ2A 4B1FA 2PRYA 3T4PA 1ZJWA 3AL3A 2NT4A 2ACVA 3RIMA 3CNBA 1C81A 1NQOA 5TQJA 1EJ2A 4MUBA 4GM0A 4DS3A 5L53A 2UAGA 2VPYA 2TMGA 4UUAA 4JGIA 3TMYA 5ICMA 4I4TB 1TJNA 2GAIA 1EUZA 4HDMA 3N9IA 5EJFA 2V4MA 1XFDA 3OMLA 3ZE9A 1T0UA 3EPJA 2DFNA 3RCBA 4Y6GB 3S44A 2IS6A 1NFRA 3EG9B 1Z5PA 3DDCA 4NCKA 4HV4A 5K2OA 1EKXA 1XSEA 3G6KA 5L6MB 2WQ6A 2AUNA 1QYIA 3C1OA 1G55A 4Z54A 3HVRA 1CUHA 1UBEA 2XWBF 1VIDA 1LDYA 1SAYA 2CCKA 5C7OO 2B8NA 521PA 3GAFA 5JROA 1SWWA 2FFBA 5CX1A 2PUTA 1E1RD 3O82A 4IP0A 2LIVA 4U0JA 5CFLA 5TIIA 3X1KA 2HPAA 4TWRA 4UBMA 4NVRA 4LVOA 1M83A 2YTZA 4L4RA 2A0FA 3TZ6A 4ZRMA 4L8VA 4J0KA 1JSZA 2QRZA 4FMDB 1RZVA 2Q6IA 4J75A 1H4VB 5LQAA 1NNLA 4IIXA 4ZV4A 5M04A 2PCJA 4YJKA 1N33B 3GDFA 1KYZA 1FUUA 3IUQA 4FZVA 3DQZA 1QV9A 2PFGA 1NQUA 3DMFA 4OY3A 1SWVA 5EZYF 3VKVA 5B58C 2H0QA 3ST7A 4I1IA 4B6PA 5BXQC 4YIKA 1KWGA 3ZQJA 3ETLA 2AFRA 3DR5A 2H85A 2X9GA 1GG9A 4CCYA 4FK8A 1GFIA 1DARA 3SXJA 2ATVA 1HO3A 2J45A 2JB9A 2Y1GA 1VMAA 1CDDA 2YMMA 1RBZA 1L7EA 5HUHA 1YCHA 3OPYA 3AEKA 3L3BA 3RVMA 3L7JA 2B5VA 3R5HA 4RF5A 1U7HA 2WWWA 1TO2E 1KE2A 3ZUPA 3IXLA 4B84A 3CNHA 2F1RA 2DHRA 3K0HA 3KX2A 4OYHA 4P5DA 2HH9A 3W7VA 2KLHA 1NPTO 4AYWA 2UU9B 3B2NA 5E7QA 4ERNA 1I3NA 1SCAA 1JDBC 1AGYA 1PT6A 2WZDA 3LCCA 5GZ1A 4LY3A 4MLCA 2H3HA 4B87A 4QWMA 4MDFA 7AT1A 4YP9A 2VRCA 1WSAA 1CUEA 1ZOSA 2ZYUX 1U9CA 3HP7A 3KYJB 3ZWQA 2GEVA 1DTWA 4ENUA 2ZWVA 3Q6IA 1KP2A 3FLEA 1ZEMA 4U2KA 2XEXA 4Y3UA 3LLVA 3GF4A 5ALRA 3JYLA 3N53A 1GPMA 2HI0A 2W43A 2I4IA 5E1MA 2VLBA 4QPJC 3C4QA 4ZXFA 3I9V1 3O4JA 2H0RA 1ORTA 4A73A 4LBWA 1H1TA 2V7PA 3ZHZA 1YQXA 3MNFA 2DFLA 3ZE6A 2OORC 4ZN6A 5AW7A 3NEAA 1HI9A 2J9RA 2QI9C 3L7LA 5EXEA 5IMSA 2WHRA 4NYJQ 2C2WA 2PYDA 1N3BA 3NDRA 1ADFA 4B3SB 4BO5A 4EHAA 4J3NA 4MLPA 3TDKA 1HDOA 2ANCA 4QPZA 1YRQA 1ESCA 2FOIA 4TT8A 3UMJA 1P1CA 1WUYA 4X7PA 3RUPA 4RTNA 1DQZA 3GDWA 2OHJA 5MF6A 2OM6A 4I5FA 3P0FA 5EWLA 3RK4A 2Q49A 1CUGA 1Z08A 2PH7A 5LVAA 4BNLA 5B2ZA 1IWOA 2FZVA 2W6MA 3H0KA 5KSYA 1T6NA 3KQSA 2P9GA 1Q5PA 2JIMA 4XYBA 5ESWA 1ZC3A 5ENZA 3G0CA 3AESB 5KX5B 3MHPA 3QZUA 4QRIA 3Q41A 1WBBA 2G09A 1UPBA 2O3TA 2ZYGA 2AEJA 1E6MA 3VR6A 4BWVA 5L4SA 1F38A 5E0OA 3EDOA 1IZ7A 2Q1WA 3UWOA 1JZSA 3L49A 3GH1A 1XCOA 2QOEA 3OZBA 4FPXA 4RPIA 5CNIA 4YNBA 3ZEAA 3WL8A 4LJLA 1ZH4A 1U6IA 1TYBE 3H9UA 1Q74A 4MI3A 5GTDA 1DQSA 3FROA 4QNMA 2QGFA 5AHKA 3TPZA 3PIDA 2A5FA 2C4KA 4ZAWA 2MWMA 3WXMA 3ZY5A 4YRZA 5LIPA 3KHKA 3F9IA 1N7GA 4ARBA 1CY4A 2BEVB 2PQ0A 3O8LA 1X1RA 2F9FA 1A9RA 4UTVA 3C45A 1CVIA 1Y9EA 3T99A 1YI1A 2WM3A 3QFCA 5JSZA 1U2PA 1N0UA 1NUTA 1KFBB 1PW5A 1SQSA 3KYCB 5FHRA 4B71A 5TC4A 3BWYA 3K8QA 3NW9A 4QJBA 4BU0A 3GI1A 4DSOA 3GLSA 3DNPA 3I52A 1XAIA 3W77A 3UK2A 1SXJA 2V0CA 4ITRC 4YY3B 4IJWA 4W8GA 5A02A 4O0LA 2NXCA 4LKOA 1DTEA 3E35A 2Z08A 3LSYA 3EF0A 2GZSA 2WABA 1VBMA 4FZ5A 2P5UA 2X1LA 4U7TB 5I4IA 3ZD7A 4PV7A 4FI3C 1MHPA 1NBWB 2IBTA 3NYRA 4JOSA 4X97A 5JJKA 1TU4A 4BECA 1GYPA 2QMYA 2OD2A 2BZSA 3J7TA 5KTSA 2DECA 4YIHA 1JIVA 2PL5A 4P4SA 4YCCA 1NYLA 2XOKD 2MTBA 3WLTA 4I7EA 3WZMA 3DEZA 4IDBA 1ODSA 4GDMA 4WZAE 3I73A 4KBFA 4IXTA 3W8NA 4DNFA 10MHA 4H4EA 2AJDA 4MR8B 1GRVA 3DDWA 3FGPA 3N7TA 3Q3GE 2QJTA 4RSHA 4ZT2A 1T3TA 5TF4A 3V3TA 1AH2A 2IZ7A 1WXGA 1UIMA 2WU3A 4PR3A 4XA8A 1K5HA 1G0NA 4ALMA 2HK7A 2GBIA 4ZYXA 5BWNA 3BREA 3PFHA 1Z5OA 1Z4LA 4MS1A 2JK1A 1G60A 2FP4B 4EP1A 3HN2A 4BLTA 1KMMA 5KVQA 4LRSB 3RW9A 3U56A 1I0LA 2MSNA 2XTZA 1J42A 4OAPA 3DOOA 3KKNA 3OF5A 1L4BA 4KJZA 1RYFA 1KZGB 1JE0A 4IGAA 3RVNA 4YUZA 1YJQA 4ROSA 2JGIA 4RTJA 4ND3A 3U3OA 3DQPA 1SUFA 4TMVA 3V1MA 4ND4A 4D92A 3NM5A 3CVUA 2BEUA 4MJ3A 3FHJA 2ICAA 2HMYB 3O8DA 4H18A 3L93A 1E5XA 3MMXA 3PF8A 1RRKA 4RK5A 3FPCA 1H66A 5I3ZA 3ORFA 1G8SA 1CYEA 2A0YA 4B6FA 2V0NA 2KYRA 3G0HA 2HMUA 4MJXA 1YTUA 1B1AA 1M67A 1NOKA 2NLOA 3I01M 4MQ4A 4Z9BA 5FWNA 1IVYA 1KFKB 2FDXA 2P6PA 2GA9A 2XNKA 1H4QA 1UK9A 3BJZA 4BV3A 4M1OA 3DAYA 2QRVB 3DJYA 3HBJA 1LRJA 1QIJA 1T5OA 4OHFA 4EAQA 5KNBA 1ATZA 3GFFA 2A1IA 5IJAA 1GPLA 1XBTA 4OGGA 3KD2A 1K27A 5DP2A 1H94A 1YSCA 5CBPA 2EQAA 4L75A 3X2EA 4WZ6A 1FPQA 1NSTA 2HJVA 5ILOA 1HOXA 1CEEA 3HB9A 3RSQA 4BLRA 4OFBA 1O9HA 3BDIA 1TM4E 5GP1A 3ZGYA 3SSMA 3ZZNA 2V5UA 4Y2VA 3GVIA 2PIAA 2WW8A 1CJBA 3QKSA 4P3PA 4RKFA 4Z0TA 5BP7A 5BV1A 3U6KA 1R0LA 4GNRA 2VYFA 3DE0X 5E6RB 1V5EA 3VYTB 4BFVA 1NN3A 1XCBA 2R6AA 2ZXFA 4JQSA 1QRSA 4XX0A 1GPAA 3IT2A 1HKUA 3OQ6A 3O9ZA 4QDOA 1HFEL 4QECA 1E8DA 1NW4A 5EN4A 3QPVA 1JDNA 1HV8A 3CRZA 4G4IA 5CM8B 3ZVRA 5KNDD 1U2QA 3EXFB 3KL4A 5SV2A 1ULBA 4IZOA 4ZCQA 5CFRA 3VH2A 4FW8A 3LBHA 3TO5A 3PEWA 4AYXA 1AKYA 4E2WA 3B1FA 2AI3A 3A1WA 3O73A 4MA4A 1S2DA 5KO2A 3GWGA 4Y30A 2HHAA 4MTLA 5TT0A 4QBTA 3UJ9A 1BE1A 3E3AA 5L3SB 3AJAA 5AWFC 4YROA 1Z39A 3E4CA 3M5DA 1M6EX 2GVZC 4IBOA 1XZJA 1RWVA 3ICQB 3PGMA 4HI0E 1V3UA 5K0BA 1WY7A 2OVFA 1HMPA 3WLAA 3FOFC 5J4YA 2XGMA 3H5LA 1BE8A 4BKPA 2RBKA 2FPUA 5DYYA 3SPXA 4G5RA 1C8BA 3OIVA 1TVKA 2XDQA 1UR5A 3BMNA 3PVCA 4PZYA 4R8RA 1J8MF 1GARA 4KQ6A 3CJQA 3LDGA 5JAOA 2J07A 5IXJA 5EIOA 1QGED 4YMHA 3K8YA 4YP0A 4LSMA 3IAM1 4G0ZA 1G59A 1XJ0A 4IRXA 5LUBA 3WHIA 2R1UA 3U60B 1XKXA 3AFNA 1DCMA 2M6RA 1GKKA 4NDNE 3KFVA 2HV8A 3K8OE 4OO3A 4WHMA 4HNAA 4WEOA 2EWMA 2Y8EA 4P53A 3UXYA 3RNLA 4LHEA 1W76A 1A72A 3AV3A 2E6KA 1LS6A 3OE5A 3N0VA 4KW7A 3GFPA 1R64A 2DFDA 5FBRB 4O2AF 1AQYA 1HZZC 3SVZA 4NJMA 1GRQA 3VRHA 2BFMA 4DLXA 3JALB 2QD2A 5BNIA 3L6DA 2F43A 4D97A 1WUKS 4MIEA 3P4YA 4A1OA 3ZJVA 4RZXA 3IQZA 1YIDA 3SC2B 1EVLA 1ZGGA 4Q1AA 1XB2A 3VAZA 4HXYA 3MAJA 1Q3TA 3NHYA 4KN8A 1RMTA 3PCRB 1ADCA 1U3FA 4IX9A 4RK6A 3VSCA 3ZZ1A 4D4JA 2HRRA 4DCCA 2BMVA 4B9EA 3H99A 4DIFA 2M9MA 5JS2A 3NGXA 5DTIA 1HE2A 1XL0A 1ZHOA 1ZPDA 4O25A 4QOIA 2CFRA 1XN1A 2XDAA 3JQCA 2WWRA 3NVDA 3TR0A 1OFUX 1G98A 2P40A 3G23A 5IJXA 5F9HA 1ZUHA 1IQRA 3GLGE 4KNVA 2VRCD 3T1QA 2A5LA 5ERXA 3TOZA 4TV9B 2BZGA 2YXEA 4IJKA 3V4PB 3HCRA 6AT1A 2PSSA 2BUAA 2BTQA 2VNKA 4L8LA 4O63O 5JZ9A 5BY2A 4RELA 1L7AA 2P9YA 1UOEA 3KPUA 4F96A 1M1NA 3PNVA 5CPFA 5B3JA 1WOYA 5EWMA 2QUIA 4WNYA 4GRDA 1DC6A 2BJHA 4QBIA 4M0PA 5TMBA 1Q92A 4JLPA 1EGQA 4R7TA 5F1OA 5J5CA 5BQPA 2O7QA 3QUSA 5ALTA 1CS4C 3AR2A 4LW8A 3RV3A 2VDUE 4HAXA 3OO1A 2WZCA 2ZLBA 4WA8A 5FX2A 1QCYA 1NT2A 2KBFA 3B1ZA 4HWOA 4BP3A 3DSRA 4YLGA 5JFGA 2OORA 1ZOOA 4INJA 3IDFA 3VX3A 2YWCA 4YALA 5TQ2B 1GUBA 3T3NA 2DR2A 1X8LA 1UMCA 2VT7A 2XCOA 3QUAA 3DD5A 4WL0A 4W5OA 3WL6A 3IPCA 1R0RE 4XIGS 3K1ZA 2V3VA 3MBIA 2VSNA 2XCTB 1SHLA 2ENWA 2VHEA 4UASA 4ZU3A 5CAEA 1I3KA 1DT5A 2BEKA 2R85A 4JZYA 4MQEA 5D3MB 4Z99A 2F1JA 3RTCA 4TKMA 2BCEA 2XUKA 3LPMA 3IDOA 1GD1O 2K2QB 3BRQA 3PUXA 2P6OA 1CP3A 1NY5A 4GYWA 5KYUA 1R3DA 5B7QA 1NUQA 3UMMA 1AQ6A 2I67A 3HDJA 4PFQA 4XQEA 2CY0A 1JDBB 4WFKA 4FQ5A 4D0GA 2FEKA 1YCGA 4FGZA 3VR6D 2O2HA 2A33A 3PDHA 2R11A 3IHTA 3OM0A 1KSHA 3OWHA 5FRDA 1OH7A 2P8SA 2ATEA 4BZWA 1Y9DA 4RIGA 1RR6A 1RJEA 1U8AA 2F48A 1HM5A 3EBOA 3OTIA 2VHXA 2JGLA 2NV2B 3U2QA 1QXSA 4CN9A 4ZMSA 3AR5A 2JG3A 2HUPA 2GM3A 2IYYA 5ER6A 4PSVA 1O95C 3TGPA 1ODJA 1Y4ZA 3SIPA 3EPKA 4BYMA 1ZI8A 4DIMA 5CCBA 2D7DA 3RVBA 5IG2A 4ZGGA 2ZUSA 4WXRA 1CPYA 5HQ3B 1W6RA 3F7NA 1I0ZA 3MUFA 1TVMA 4FINA 3CEJA 3OZUA 2WAMA 4PYOA 5BW6B 1XI2A 1M6WA 1G6Q1 2AC7A 1ZM7A 3HJRA 4NV3A 4M9XA 4BLPA 2D54A 4E07A 3DKVA 4Z4EA 3T3MB 1OXTA 3KZNA 1GUDA 1OX4A 5FBZA 3OCWA 3WWCA 1ZZGA 3AKYA 2JEYA 1W581 2ZUTA 3DW1X 4KRGA 1NNSA 1T3ZA 2RGWA 1G7RA 5CDUA 4GIBA 2GJ9A 3IT1A 5AI5A 3OJLA 4XLZA 4C5AA 4NQRA 4ETIA 3D8BA 3MEQA 1N2JA 2CFCA 1QHXA 1L5FA 1QYCA 3CINA 4N65A 5DISB 4BO1A 1QGUA 4QPPA 3D64A 1P8AA 4G4GA 4EMUA 5K0EA 5KJ1A 4BVAA 2JAPA 1ESZA 1PT5A 1YDEA 1OE0A 2QDXA 3I5AA 3T5PA 1W7AA 3BYZA 4CL0A 5C3MA 4I9GA 1VYHA 2WWXA 2XVMA 4KZKA 4OLFA 3ZU6A 2EFCB 5K8IA 4RD6A 4N3GA 4POAA 4YRGA 2IK8A 3D1VA 3HY4A 3HMQA 2E3JA 3FYUC 2Y99A 1WQ3A 1CJMA 3NV7A 3U3XA 1JEQA 3BSFA 4KQXA 2IZ5A 5E6UB 1JG6A 3FFTA 3LC0A 3TMAA 3LW7A 2D0PB 3MYRA 5HJ5A 2PD6A 3DMTA 5A4DA 4BLUA 1O08A 3R8XA 5T3YA 1JQAA 3EWNA 1E2FA 4IDAA 2Z6VA 5JS1A 2JIPA 2BKVA 4Y1GA 3ZCQA 4M7PA 2ZP1A 5I5EA 3FB4A 3WYEA 2PSJA 1SXGA 4BX9A 2HL6A 1V9SA 1HFWA 1F60A 1MB4A 3O26A 2HTFA 4JGBA 4OL9A 2ET6A 4QODA 1HDRA 5ECDA 1KA9H 3U80A 3VGJA 2NZUG 1GCGA 2NYRA 2IUUA 5EHIA 1E5QA 3UAVA 2E5FA 3W8DA 2PSEA 2GI4A 2WV9A 3DKRA 3LO8A 2JCSA 4XIIA 4G5OA 1YS4A 5JI2E 3IL2A 3H75A 4QDTA 1P3JA 3TPCA 4AKEA 4HRXA 1PE0A 3CCBA 3TW6A 4XM1A 5HHTA 4OATA 3K0FA 5IAAA 1KO1A 3SEAA 3VOTA 3ZCSA 3M6VA 4Q66C 4B45A 1PK9A 1TZJA 2AFHB 2C2OA 1K0UA 3H1GA 4TSRA 4EGCB 1E4YA 3Q7RA 1WB6A 4IFTA 4H7FA 2QN9A 4FN5A 3VVLA 1Z0IA 3OAAA