1PBNA

Purine nucleoside phosphorylase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
289
structure length
289
Chain Sequence
b'MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPVSGHTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
molecule tags Pentosyltransferase
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
total genus 85
structure length 289
sequence length 289
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1995-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pbnA00
1U1FA 1V3QE 3LBAA 5F7JA 3EUEA 3OPVA 3IEXA 2GUWA 4R2WA 1N3IA 2OC9A 2ON6A 4QASA 1OV6A 4MCHA 4JWTA 1Z33A 5B7GA 4MARA 5ETJA 3E0QA 4NS1A 2RJ3A 2IQ5A 4OGLA 4BMYA 1ODKA 1A9RA 1JDUA 1PR6A 5I3CA 1Z35A 1VHWA 1PF7E 1A9QA 5F73A 1JE1A 1PR1A 1Y1RA 3OZDA 4F2WA 3GB9A 1ZOSA 4QFBA 3MMSA 4ECEA 5CYGA 1OVGA 3IOMA 4PR3A 4M1EA 3NBQA 3UT6A 3OOHA 1OU4A 1PWYE 3BSFA 5F78A 3UAZA 2QPLA 4QEZA 2QDKA 1JP7A 1NC3A 3FNQA 2A0YA 4D8YA 2QTTA 1PW7A 3EMVA 4KN5A 4OGKA 1JDVA 1RT9A 1A69A 1YQUA 1ECPA 4MCIA 4F1WA 3E9ZA 5CXSA 1ULBA 3P0FA 1RXYA 4TTIA 4RJ2A 4WKCA 3OZEA 1PKEA 1A9SA 3TL6A 1U1CA 2AC7A 1ULAA 3C74A 3KHSA 1WTAA 1Z5NA 1RCTE 1B8NA 4TXNA 4TXJA 1RSZA 2QSUA 4JP5A 3PNPA 4IP0A 5B7PA 3E9RA 1TCVA 3FAZA 4G89A 4OY3A 3EEIA 3ODGA 1CB0A 3FUCA 4DA6A 1NC1A 1V45E 4LZWA 4TXLA 4DA0A 1OTYA 1LV8A 3LGSA 1Y6RA 5B7QA 4F3CA 1A9OA 1ZL2A 4NSNA 5CXQA 3DDOA 3T94A 3BJEA 1VFNA 4EB8A 4YO8A 4D98A 3D1VA 3DJFA 1I80A 4WKOA 4QATA 3MB8A 5EFOA 3K8OE 4DAEA 3FB1A 1VHJA 3OZCA 3O4VA 4UC0A 4WKNA 1A9PA 3F8WA 1PR4A 1TGVA 4OEHA 3NM6B 3UAWA 4TS3A 2OECA 3BL6A 1JYSA 4G41A 1YRYE 3ENZA 3OCCA 4P54A 1V4NA 3DPSA 2Q7OE 3GGSA 5DK6A 2HRDA 1Z37A 1V48A 4DABA 1TD1A 2XRFA 4U2KA 1JPVA 4GKAA 2HSWA 4BN0A 1PK9A 4L5AA 4OF4A 1Y1SA 4BMXA 1XE3A 4L6IA 1JDZA 1ODJA 4TS9A 1RXCA 2OXFA 1Z5PA 1Z5OA 1RR6A 2H8GA 3QPBA 1T8WA 3OOEA 4L5YA 4DANA 4M7WA 1PR0A 1G2OA 1PR5A 2AI2A 2PGAA 1Y1QA 4EARA 1ODIA 1TGYA 3PHBE 3KVYA 5F7OA 4E1VA 5F7XA 5JPCA 4D9HA 5K1ZA 4G8JA 1T8RA 3UAVA 5IFKA 4R2XA 1PK7A 1TCUA 3FWPA 5FAKA 5B7NA 2B94A 4H1TA 2HWUA 1T8SA 1QE5A 3FOWA 5F76A 1A9TA 4DAOA 4L0MA 5KB3A 4LKRA 3PNSA 1YBFA 4DA8A 2HN9A 2A0XA 1RXSA 1RFGE 3OF3A 4FFSA 3U40A 1JE0A 4LNHA 4TXHA 1T8YA 2I8AA 3K8QA 5EUBA 1U1EA 5F77A 4YJKA 3UAYA 5CYFA 1OTXA 1Y6QA 4QARA 1T0UA 4TYMA 1PR2A 4PNPA 5CCDA 1Z38A 1SQ6A 1Q1GA 4TTJA 4GLJA 4BMZA 1V2HE 1NW4A 3P0EA 2OC4A 1Y1TA 1V41E 4GMHA 1ODLA 2AI1A 4D8XA 1JDSA 4GLFA 1YR3A 3INYA 5F7ZA 3PHCA 4I2VA 2BSXA 2A8YA 3KVRA 3NM4A 3LA8A 4K6OA 4YNBA 4LNAA 4WKBA 5IU6A 3DF9A 1RYZA 1C3XA 3O6VA 1VMKA 1LX7A 1K27A 1Z36A 5CCEA 4F3KA 4JOSA 2A0WA 3OZBA 1FXUA 1B8OA 3NM5A 3KVVA 2AI3A 4OJTA 3BGSA 1CG6A 1JDTA 5C80A 1PBNA 4LDNA 4F2PA 1M73E 1OUMA 4R31A 1SD1A 5EPUA 4NY1A 4L5CA 1SD2A 2I4TA 3SCZA 2QTGA 1RXUA 1K9SA 1U1GA 2ISCA 1Z34A 2P4SA 3KU4A 3ONVA 4DARA 1U1DA 4DA7A 3KUKA 1LVUA 1SJ9A 4QAQA 4D8VA 4TXMA 4TTAA 3DP9A 4YMLA 1K3FA 3EUFA 4M3NA 4X24A 1Z39A 4WKPA 3UAXA 1YQQA
chains in the Genus database with same CATH superfamily
3A9SA 2ODPA 3LBAA 2C94A 1XXHE 3KFXA 4I14A 4R41A 4QHTA 2AFIB 4MVJP 1E0AA 1FB5A 1QB8A 1U7HA 2GLXA 4FFBA 4IOLA 3NU1A 2W5UA 4N49A 1M3SA 1E2EA 3P45A 3I9MA 4OP2A 4ND2A 5DF1A 4EPTA 4YIHA 5L6LB 3M2TA 4RZXA 5CDYA 4KMRA 4S1PA 5AVQA 5IFLA 1IOLA 4DGSA 1A7JA 1EAMA 2INGX 2V7WA 2G40A 3OKAA 4P7JA 1JX6A 3SJBA 1P39A 3VUFA 1AN9A 3Q7RA 1GVNB 2V7TA 1YK1A 4KSYA 4ND7A 3TFQA 3R6WA 4QPNA 4BGVA 3T5BA 1IZ0A 2R4QA 1OF1A 4J49A 1C9JA 3ZU3A 2QRUA 3EH2A 3OLVA 2B8EA 4UDOA 4IO1A 5ALXA 5L7YA 3VPGA 2C8KA 3H18A 4MARA 3WB2A 2ES4A 1NNSA 4F2DA 2AV6A 5AKEA 1NW9B 2GAFA 3EA5A 4KP7A 1SUBA 4ZQGA 1HDZA 1P77A 1TMKA 1QVZA 4WZZA 2PS9A 3NVAA 4GMFA 1MV5A 2F59A 2PJRA 4DMMA 2FOLA 1QGYA 4TZTA 4WHMA 4Z0HO 2PNJA 4BMYA 2ID8A 3L7BA 1ZICA 3O75A 3NB0A 4JYZA 4ND3A 3CKKA 1P4GA 3DOEA 5JPIA 3UZUA 2WTUA 1JLLA 1OW3B 1ABBA 2OGZA 3G85A 2DBZA 1OREA 5JZVA 2X0IA 3VR6A 4OHYA 1H8HA 1UQTA 4PQFA 4JENA 3UWSA 5DSXA 2JKVA 2WLSA 4TMFA 2WJ6A 2WSLA 5T3YA 2MSEB 4YCAA 3W5HA 2BFEB 2RDMA 2BR3A 3WYNA 4BVAA 4W5HA 3B1YA 2O6LA 3SJZA 4YLYA 1CFJA 2BCGY 2WILA 1RBYA 3DV0A 3LH5A 4CTNA 2D5BA 3WHIA 4I3GA 4P08A 4CL3A 1YZNA 4Q7JB 3EF3A 1E63A 2H52A 2VAMA 4CN8A 4XAQA 5EN4A 4C7VA 3GLHA 4KEAA 4QXOA 4HLNA 5EMNA 2XDWA 4LG1A 3W6UA 4DMGA 2G8NA 5GMOA 3VPSA 2W83A 1V8DA 4PAWA 4BPBA 4GRIA 4CUKA 4FW9A 1JFVA 3R0VA 4BNFA 1NYTA 4H3HB 4Z99A 1AN0A 1ZN8A 2R751 3ZD8A 3BG5A 3F9RA 3AEYA 1J23A 3B3JA 1UPAA 4ZDJA 4S1WA 1SBIA 1E89A 3PWSA 2WT4A 4BV8A 2IZOA 4OK5A 4NFYA 1R6AA 4ROTA 4X3OA 4DMFA 1RLJA 1QZUA 2VUIB 3O83A 4KRGA 1BAPA 4X1YB 2ADOA 3GRKA 1QYRA 3X1KA 3QLTA 3SZOA 3R4VA 4DFDA 4L50A 4UHCA 1JP7A 4AY2A 5BV1A 2J0QA 3FMGA 5HIAA 3URKA 1QFXA 2DUNA 4TMKA 3U81A 3VDRA 3VNAA 4YLGA 1Y1KE 3PU6A 3N53A 1PBTA 4DNQA 5KDOA 1YV9A 4J2OA 1FNCA 4JUFA 4DGQA 5MFPA 1MORA 4TRRA 1F6DA 3TM4A 1RT9A 5GY7A 5BMVF 1WDMA 4OIFA 1EVZA 2A5YB 4UOEA 1XZEA 3ZX5A 4MIEA 2IYTA 4NBSA 1EVEA 5BR1A 3X1MA 5A4IS 2VHZA 3AT1A 3FCCA 3JR3A 2ECKA 3DULA 3IVCA 4UHFA 1G6Q1 1L5WA 3PIIA 3TL3A 1OBCA 2ZE5A 2IF0A 3EDQA 1JKFA 3TW4A 5KYXB 4RIIA 2XQVA 3GVIA 1ADGA 3K73O 5G40A 5EVJA 4DSAA 4YRIA 2IW3A 2RONA 1CPYA 3H5RA 2CSXA 4WE3A 4BFTA 1QZZA 2QLJA 3T9AA 1F0KA 3UNXA 3K2EA 1W0CA 4JT2A 4KHPB 3AEUB 3GG9A 3LS2A 4DLPA 1DARA 1VYUA 1GTRA 1WTAA 3LPLA 4GL4A 4L28A 4QYTA 2I9PA 1HDYA 4LF4B 3A1CA 3K72B 3GFPA 1IUPA 1DTEA 1Y80A 3ZWCA 3LXRA 2WRZA 3SEQA 2Q3CA 3S2EA 4BJ3A 5C7YA 3IJRA 2WAXA 3C3MA 2R7NA 1DL5A 4RTJA 5DCWA 1KO1A 4YECA 3COVA 4MUKA 4BGIA 3H9BA 3VRHA 5BRJA 3WXMA 2KM1A 1WETA 4TOIA 5DN6A 3SX4A 4C7OB 3HDHA 1L5GB 3SXUA 4TT3A 1MT0A 5CM9C 5LM3A 1N2EA 3PJEA 4EEZA 4IH1A 1AQUA 2JH3A 3LE8A 3B36A 2FWBA 3KZCA 3ZCQA 3EZGA 2PX5A 3HFSA 1YB1A 2C59A 2VJCA 4EATA 5LVAA 4CEIA 2GX6A 1ZMXA 3WRVA 3M6XA 4E2ZA 4Z6KA 2GAIA 3EZXA 1L9XA 4CCYB 3JQFC 2I67A 3QVXA 3I4LA 3TZKA 3T95A 4DA6A 3E18A 2QZ4A 5KOIA 2VJMA 3U13A 1N92A 1MEEA 3SDBA 2IV3A 3C43A 3DEZA 2O48X 5KNDA 5G02A 5HS4A 4QWMA 1RRVA 2PD3A 2FX5A 1L5ZA 1SCUA 4S2UA 1H5QA 2IEAA 4WJZA 4PZDA 1SIUA 1NXQA 3BIWA 1W96A 3D7NA 3I01A 3K5HA 3OCXA 3QXCA 2BEUA 4PIPA 4DNOA 4INZA 3FN4A 3RQSA 3UHOA 4D44A 4F8YA 4CT4B 3A31A 3T94A 3P0HA 4CQMD 2H3HA 2VJKA 4DMUB 3I12A 4DYVA 1X7HA 4YO8A 3M9LA 4GOND 3WB9A 2SKEA 4MV5A 1B3BA 3UCFA 4R3NA 1VDZA 2B7CA 3WADA 3FRIA 1HFEL 3NQ41 3RUAA 2O7VA 2ZSEA 1E9EA 1GKIA 1YRLA 4QPCA 3A9VA 3GROA 4AUKA 4B4OA 4CEHA 3L0CA 3O2SB 4IUDS 3DQQA 3I8XA 3AJDA 1MRNA 4HXEB 3SZUA 4ZCRA 1G8PA 4W1RA 1V9SA 1EXNA 2RHDA 2CZGA 1JQKA 2MSWA 2ZIFA 3ET4A 3EZNA 2KYRA 3O8OA 4DMHA 5K0EA 4AD8A 4R7TA 1SWWA 4B87A 2ZB4A 2CHQA 2IDMA 1T3ZA 1JXMA 2RHCA 3SNHA 1FP6A 5A2GA 1BA3A 4ZOEA 1FDVA 1NN5A 1SB8A 3ILXA 3T7SA 4BIMA 4JGGA 4WZAA 1T15A 4LYHA 9MHTA 1MAWA 2P40A 4KO4S 1IJFA 3ITKA 3NYQA 3R3ZA 1RYMA 4CBVA 4P7KA 4XTCS 1CERA 2ZJ2A 2RI0A 2OV4A 2AUTA 2X4IA 5D2CA 1UDAA 5C8VA 2XODA 3CINA 5JQGB 2HU7A 1ZQ9A 2PEYA 3K92A 3M6AA 3D0RA 5DJ5A 1GQSA 4FBGA 1XB2A 3I9JA 4YV7A 1KP2A 1X7DA 2DCUA 2A5LA 4JMPA 1PDVA 2XMPA 3LPMA 4L74A 4LYDA 1QYDA 4XCQA 3RHFA 3BD7A 4GBJA 4GDMA 4GU5A 2P5TB 2WUVA 4MRVA 4UU0A 4CMEA 5JD4A 4DABA 3VKWA 3OE7A 3OF5A 4IXNA 3NEAA 4QYSA 1P1IA 3I4FA 3NT5A 4PCLA 4UNPA 4UUMA 2OHHA 2OZPA 3LFHA 2NTNA 1U5AA 1P4AA 5KBYA 4FHEA 3MJDA 4DUYB 1JZTA 1B42A 4DCSA 1FFDA 2QDXA 3I39X 3TNLA 2OFWA 3USZA 4BRZA 3RC9A 2XUOA 2I3GA 3ISTA 4Y2XA 3WLIA 1O94D 1CUYA 3ZDZB 3S81A 4QTYA 5JLAA 4CT0A 3COSA 1SKBA 4F6CA 4O6VA 2OXFA 1EJ6A 3LUGA 3GA0A 2XMDA 4YH1A 2ZB2A 5DP1A 3W6ZA 3KELA 4ZO6A 3KQKA 2RHLA 3ONDA 2OESA 4JKIA 1FU4A 1L4BA 4HWTA 4LA4A 4X54A 4DILA 3WLNA 3OJOA 1QE3A 1BH2A 2OZLA 3FTFA 5JBNA 3CX4A 3NBXX 3S44A 4CQNA 3TNDA 3WFIA 4KR2A 121PA 3U6BA 1OLUA 1H6DA 3FNFA 1RIFA 5K6AC 1AGYA 3LM8A 3HUEA 5BNFA 2PGAA 2YZNA 1ZISA 4I1VA 4MW9A 3S68A 1GU7A 2XMGA 2WVGA 3HB5X 1F3LA 2R25B 1XDZA 2OKGA 3MWYW 1CY0A 2QZPA 2HO4A 1SCDA 3AIKA 3FM9A 3ESRA 1O77A 1T5DX 3Q7SA 4RVSA 4U39A 5CAEB 2OBFA 2ZTUA 4BNZA 5HM8A 3KLOA 4KZKA 1RHMA 1ZN2A 2POCA 2W6JD 1TVKB 3D0QA 3G17A 3I9FA 4B8WA 4RD4A 1E3JA 1V8OA 1G38A 5CFQA 3W1VA 1NVUQ 1F2VA 3PL5A 3AVVA 2DSNA 4PC7A 3ORSA 1SBHA 4Z54A 5F76A 4GM1A 1IY2A 2C2MA 1A8IA 2M9MA 2D2FA 4D6XA 1Z63A 3UMMA 4RMJA 4Y1RA 2OLEA 2Z58A 4U8HA 1N25A 1XEXB 3PNSA 2UYYA 1T3TA 2RHWA 4LXHA 4WIAA 1ZK3A 4AMGA 4WDQA 4L4YA 3EXG1 4BVBA 2QL6A 2Q49A 1BQ3A 2ZATA 3QPDA 4JLSA 4G67A 5EY5B 2PWZA 3EMBA 3VVCA 4BGEA 3D7LA 4RIFA 3D4OA 4L0CA 2WTMA 1HUQA 2JH9A 3JPWA 4F3RA 1JE0A 5ANRB 1GUFA 2I1LA 4MDHA 4OMFG 1U9CA 3V8PA 1CQJA 1WIWA 4CF3A 2YN4A 3DNFA 1M0WA 1YAHA 1SK9A 1EFRA 1I9GA 1W4CA 4R1LA 3HCCA 2HPAA 5JXIA 5AM2A 5TNXA 3ZNPA 1Y6ZA 4D80A 4YDQA 1CIPA 1PSZA 2FVYA 3AEZA 3IB3A 3T7DA 1RVDA 4TRNA 3L07A 4JYMA 4DHEA 5A0TA 3RWOA 5M29A 2YQ5A 5I4IA 1B0UA 3ETHA 4DWOA 2IBTA 5JSZA 1P6UA 1UPTA 3WIVA 1E0SA 1RMYA 3KKEA 1P8AA 1WCXA 2BBOA 3NC0C 1XCJA 4QUEA 4TYMA 2VF5X 3V8NA 1FZQA 3GLGB 1J1UA 2PCLA 2IS1A 2WAMA 3WRYA 5FOQA 4D79A 5AKHA 3FXAA 1GZ5A 3OY7A 1VE9A 3G1UA 4UULA 3E1GA 3SX2A 3BHIA 1E61A 3GN2A 4MR7B 4UVGA 5KC8A 4IQFA 2I5PO 3SJCA 1B15A 3WGLA 1XZCA 2DULA 1YIAA 2P1ZA 3AEQB 2QT9A 3G79A 5BMVA 4HGRA 2FPIA 2G8LA 2H3EA 1Y42X 3BA1A 4II7A 1QDEA 5EA2A 1ZHHA 4WUTA 3W3ZB 4D96A 1O0BA 1XVIA 4CL8A 2UXCB 1WHSA 2C5AA 2VA8A 3VJKA 2P8JA 2PXAA 5BORA 2XE6A 4ZMSA 1IJEA 3F5DA 1G9XA 4Y6SA 5B2ZA 1W4RA 2WTNA 4W9NC 4H4DA 4XCXA 4Z0TA 4ZVKA 3RTCA 3VA7A 2ZW9A 3ZY4A 3L4EA 1ZUNB 1QH1A 2VA9A 1XV5A 3DW1X 5G4KA 3KBBA 4LFAB 3FA2A 1G5PA 1MO4A 1X7ZA 2G76A 4XDGA 3HXOA 5TT1A 1DLIA 3MD9A 3PXUA 3B1KA 3SQDA 4DOMA 1E2MA 1RTTA 2BSXA 1YJBA 3RAGA 2Q9AA 3GVHA 3IUSA 4OI4A 4H2DA 7MHTA 1PTKA 2WJHA 1Q83A 2OVFA 3Q6IA 1JLMA 3D3KA 1A76A 3OC0A 1UOQA 3DMHA 2ZR9A 1NVTA 3ELBA 3JWIA 4NS4A 2YNMC 3OPXA 1JI0A 2MSCB 4F4HA 3MIIA 2KX7A 5BRAA 4CG1A 3L0PA 1NSYA 1KZ6A 4PRYA 2BKVA 1NQ5A 4YP7A 1N0WA 1V2GA 1DFHA 2D4HA 2WKWA 4O2BA 5FV4A 2GEBA 3FBGA 1Y1PA 4DCMA 5C51B 2J85A 4HDRA 1JAZA 1IB0A 1T5BA 3FDIA 2J87A 2WP0A 3NIBA 5FBRB 4GX2A 4X95A 2FQ1A 4Y8VA 5FUMA 1V8BA 2E4WA 2YJNA 1QCDA 3C0KA 4P3OA 5BSEA 4Q3BA 3UJPA 4F7DA 2PH1A 2W70A 2A84A 4O2BB 2IYRA 1TZCA 1EGHA 1FUYB 5D6OA 3KOZA 4KLZA 3LUKA 3MGGA 2TSYB 4Q3CA 4OHZA 1NWCA 1CUHA 1F14A 1LJ8A 2JJ8A 4PG7A 1OT3A 4YT2A 4P3KA 5CLHA 1HV8A 1WKVA 1SCQA 1XTBA 2WU0A 4HYYA 4QVGA 3TRFA 3TXXA 5AJWA 4BEBA 1T4CB 4HWKA 4JC4A 3K32A 4RHTA 3GZTB 1V5WA 1G17A 4IQGA 4MRPA 4AP6A 4EW6A 4YRBA 4PFJA 4FDLA 2CFSA 3UICA 2OHGA 2C2KA 4EYQA 4L4XA 3LY5A 1CUUA 2X5OA 3DWEX 3NPMA 5HIKA 4HDQB 3EPKA 3I6MA 4YAFA 3TIXB 5BUSA 3QMMA 1EZ1A 1M67A 1P7YA 2Y1CA 4QSHA 5IBQA 4EK9A 2EG9A 3NWBA 3P2MA 2N42A 3H0KA 1ZCZA 4FDVA 2PCJA 2B83A 3UPDA 3DBHB 1S2MA 3NBFA 2V3WA 3KSDO 4HYTA 1EFPB 1KYTA 1RW4A 2BF7A 3ZJ4A 2PUEA 1P5JA 4IXTA 5BO5A 4CKEB 2XNSA 4RHUA 4BNHA 3FPEA 1ZPDA 3LF1A 5IS2A 2EXXA 4CLHA 5FUBA 4UMDA 3ZG6A 3ELDA 4LBZA 3CZ4A 4MPDA 3O2NA 521PA 1LQUA 1XSEA 2J4FA 4URFA 2F3TA 1VE5A 3MJCA 1N7GA 4HI0E 4LZZA 4BX0A 1TF5A 3B78A 1JEOA 1HT2E 3FF1A 4HPXB 5E6SA 3TI7A 1PSWA 4YRRA 2ACEA 3QOFA 4E70A 1EINA 3GNLA 2YOHA 3LPNA 5JQGF 4GX0A 2PKEA 2BZSA 1G6HA 1HEUA 3I2HA 3L0DA 3OOSA 3PP8A 2ZYHA 4JI2B 5D85A 2GBLC 1P74A 4HNTA 3DDCA 4Y6GB 1J8MF 4O4JF 1GGNA 3DGFC 2JIQA 2AN5A 1QP8A 5JS1A 3GP5A 1AJEA 2HSDA 5BSWA 1ONBA 2YJ6A 2ETXA 4H9GA 3VFDA 1UWKA 3WL4A 2HLDA 5D1NA 4HLDA 3EQZA 4Y7DA 4DIKA 2O54A 3VC1A 2OC9A 1B76A 4WVLA 1OV6A 5KKAA 2ANCA 5JXGA 2HWWA 4ED9A 4ZI7B 1A8UA 1C3LA 3L40A 3MGCA 4CRWB 4CXMA 4MROA 3KUUA 3QXXA 1Z33A 3TSOA 1E96A 4EUFA 3HCPA 2WQ6A 1Z3IX 4D3XA 3DYVA 4XVCA 1IQPA 1DWPA 4RM3A 1K7CA 4DTIA 5J47A 3B1ZA 4RZUA 2W8BB 2FDCA 1F7UA 3EG9A 1LVGA 4LVNA 5K0JA 2P0AA 1H4SA 2NZYA 3NP9A 4NS1A 1PJSA 1VLQA 4QULA 5ALPA 3RPEA 2GHRA 4LY3A 3SVLA 5ADVA 1QHHB 1AH2A 2CXUA 1T4GA 5AIBA 1L1EA 4PU0A 3FSGD 4ZCMA 5IHXA 5TF4A 2GWHA 1PS8A 5IBRA 5IJ9B 5EUQB 4RLFA 2Q4RA 5JCJA 4BNJA 1BGWA 1N6PA 3GV0A 4RK1A 4RH1A 4IEFB 4P1ZA 4DIBA 2HC9A 1CP3A 5E1MA 3STUA 1O95D 3ZXUB 1Q6ZA 1FTQA 1YAJA 1OXKB 1V26A 3GUYA 1L0BA 1PLKA 3ZD6A 3ANLA 1X1BA 1RPNA 3OIGA 2OAP1 4ZA2A 3SYTA 1F8UA 1FP2A 3TQTA 4L76A 2CSUA 2W0MA 2WU4A 2W98A 1MA0A 5CNJA 3I2KA 1XL1A 1BXGA 2Y6UA 4FDTA 1RADA 3FZYA 3FWZA 2YFYA 3EFOA 3O84A 4O0MA 2R6GA 4MUIA 1X1EA 1ZIPA 4XIIA 2HCRA 3OZWA 4DTCA 3A25A 2HDHA 2YNMD 1JDBB 2XYHA 5B30A 2QP4A 4XYGA 1NJ6A 2C9CA 4KXYA 4YJ3B 4DN6A 1FYXA 5THKA 3RYIB 4WX2B 3IAUA 2QA5A 4PHTA 4LXUA 1B7GO 4P4LA 4HX5A 2JCXA 1E6WA 1L7DA 2E7ZA 1XAJA 2WJIA 2QRJA 4W5NA 2TYSB 2VXOA 5ULLA 3SSNA 1PJ8A 1GDDA 3HJUA 3T12A 4ZZ1A 3U19A 2YHIA 2YRWA 5EJMA 4WESB 2Y71A 3FVVA 2AYXA 3HHPA 4LV8B 1N6RA 1W4ZA 1X42A 1VG0B 2CVZA 2GOYA 3PRHA 4Q18A 4OGWA 3I01M 2YXEA 5K0ZA 1AS0A 3HA2A 5AM1A 2ZTSA 1NI5A 2QJRA 2OB2A 1DCMA 4MPTA 4ZEWA 4MGIR 5KQSA 4GMXA 4ETNA 5FIUA 2VNSA 4Q1CA 4BVKA 3JVVA 1HG0A 2EKDA 1WSBA 5AOVA 5IVPA 1V1JA 1A69A 1XF1A 3K9CA 1E79A 4KQ6A 1VJ0A 1XYGA 2P69A 5FAXA 2JLCA 3DCYA 2Q2WA 4IQ8A 4MH0R 4PXAA 4E3WA 1JIJA 2ISQA 3IALA 3KQOA 4WLEA 3EA0A 1DEXA 3KJIA 4AY6A 4E5NA 4TZKA 4EABA 3FR8A 2RGDA 2ZAMA 5LD2C 1KXJA 3IUPA 5F33A 1NUSA 1GFZA 4O63O 5DPMA 3VTAA 1UBLS 3MSCA 3IXQA 1WZEA 4UTVA 3K0AA 3HL0A 2YWHA 1Q95A 4LYFA 4IL5A 4ND1A 3RF7A 3T5TA 4IG4A 4YYEA 3AKDA 3GELA 4EFDA 5JPDA 3L8MA 3M4NA 1P45A 3MK31 3GBVA 1SVIA 1TE2A 2IXEA 1NOIA 3EZ2A 4O4IF 1Z6QA 2HTEA 3PS9A 4P7FA 2FY8A 4OK6A 2AKEA 2VCEA 3NHZA 1IY9A 2CMFA 3WGUA 5J63A 1KE2A 4EG5A 4HLUA 4PY2A 1EAYA 4LNUA 3K5PA 3VR3D 3ND8A 1LU9A 1JB9A 2Y1FA 2AJ8A 3Q9UA 2QUAA 2GPNA 1C9EA 4JUCA 2O8FA 1QFYA 1NT2A 2WUEA 2LW7A 4MGHA 4QU8A 2YWBA 1E8DA 4EPXA 3PGVA 3A2MA 2H92A 2Q99A 2NXJA 3ID6C 4DPMA 3OM9A 2FGJA 2O06A 4EMUA 1N7HA 5M34A 1DKQA 1DBVO 1LNSA 1SURA 4HX2A 4RL6A 1ZMBA 4XIGS 3BL5A 1G6KA 1GUDA 4GPZA 4OYLA 1FP7A 1X0VA 1N8SA 2GBCA 3AQIA 1V5IA 3R75A 3TLJA 4F86A 4XKJA 3H7AA 4DJTA 5D84A 1STOA 4FNOA 4O29A 3UO8B 1MZVA 2I3BA 4RS4A 4FK8A 3MAJA 5JLJA 3IE2A 1VKRA 2QG9A 2QVBA 3PNQA 3HRKA 5JSYA 2ZUEA 3LGSA 1BSVA 1XRJA 2P41A 2JFBA 2EQ5A 4RMHA 3ZWKA 2OXTA 4UEJA 1C30B 4BZWA 1ZKDA 5A71A 3GRPA 1OYWA 4YXFA 3TE6A 2AMFA 4IDOA 3I5UA 1MX1A 4H3KB 4RD6A 4Y9RA 3ZLVA 2JFZA 2FFBA 1DKOA 3F74A 5B3KA 2DU8A 4G0UA 1GKLA 4QGHA 4C76A 3R24A 3D1VA 4RPIA 4QG3A 3LK6A 1MFPA 5CEFA 4BFLA 1MB9A 1HWYA 1MABA 4RAQA 5TMEA 3AUSA 4KREA 4RABA 3EXIB 1FRVA 1CUJA 3H5LA 4ZJZA 4XM0A 2E4UA 2HPHA 4MYDA 3EVNA 3U4CA 1TTQB 4FB4A 5I47A 4HQFA 1NF8A 4IYJA 4KPUB 5CBPA 2J9XB 2QAGB 4DR2B 1ENOA 2OVBA 1QGDA 1NW7A 1Z29A 3IJEB 1A95A 2PKYX 2QLFA 4ARSA 1PL7A 4IUYA 1FU8A 2W2XA 1Z4MA 2RSLA 2FZGA 3BMQA 3OZSA 5FPYA 3RK4A 3L6BA 3SMVA 2WB4A 2ZBUA 2NN3C 4OHBA 1RWXA 5H3CA 2JFOA 4MKIA 3RBXA 3HK2A 5AOBA 3CO5A 3NNSA 5JARA 3GFTA 3K6SB 5F2KA 3FGPA 3SIPA 4B81A 5FNZA 2WYWA 3HWSA 4BNDB 3FPLA 2PV7A 2ZYGA 5C46F 4QYMA 1D2GA 4DY4A 5IMBA 3CEAA 3D5TA 4HVTA 3BMQB 3T0IA 1GL9B 2GAAA 5JAZA 1NXXA 2ZPUA 3FDZA 3VKGA 3EHEA 3HNOA 5LXTF 1W29A 4QELA 2BGGA 3VR5D 3V8EA 4N5IX 3NV9A 1TF2A 2DYKA 3SOZA 1CY6A 1UFKA 3FOAA 3QVLA 5LDHA 2Y27A 1VA4A 4ALLA 3LBNA 3LY8A 1OE0A 4LW8A 3H5VA 5KX5A 2HA0A 4MS4A 4NHOA 4BKMA 1RU3A 1UFQA 2P2NA 1OBHA 2CJWA 2ZAYA 3ILSA 2Q3DA 1FVFA 1I2ZA 4KTTE 2GJSA 4G6ZA 4WK2B 4X65B 4JZYA 4EF6A 1KI6B 5LOVB 2WQZA 1PK9A 1T9GR 4HB0A 3NGXA 4XQGA 4POOA 2Q50A 5M5BA 4IH9A 4PHHA 4JEUA 4UPDA 4BMXA 4BO3A 2B2CA 3WGVA 3U3ZA 1T2VA 1YK0A 1RMTA 4WH0A 1GRQA 3TUIC 3NMUF 3E8XA 1TVCA 1EM8B 3FLAA 3AEKB 4CIAA 3EFOB 4BQOA 3OF2A 2XCOA 3F6YA 4O1MA 1N6OA 4E2XA 2IHKA 4D6YA 3V4RA 1Q5PA 1O08A 3WFJA 1EHCA 3ITNA 1MA3A 2B69A 2C7GA 3N2KA 3O3NB 1G5HA 2WMNB 4ZOLB 4ALMA 1F48A 1T4BA 1YI8A 1QP0A 1BHO1 3I04M 4OP3A 2P9TA 2I2CA 4AWXA 1NVVQ 4RY0A 2UDPA 3WKCA 4Q4AB 2IXTA 2ARKA 4DV0B 2QTHA 2YWGA 1BXZA 1ZJYA 2A1TS 2VTVA 1M1XB 4MIKA 4C4SA 4EA9A 4Z7NB 1TQ8A 3KWLA 1ODIA 1E1LA 2J41A 3TSYA 3NKVA 5BQ3A 1CF4A 1VZ2A 3TPZA 2FWIA 1CUXA 1QM5A 2ZSDA 4QUAA 4K6KA 4KIUA 2O6HA 1C0EA 2PYZA 3BXGA 3FHLA 4Z86A 2V7EA 1U0LA 3TFWA 4IMIB 1N6LA 4U9IS 5F2NA 3GGCA 2V3CC 9ATCA 1XXLA 3MTIA 1EFLA 4Q4LA 3RGGA 5HKKA 2C4KA 2ECFA 3MW8A 1ZD8A 1T4CA 3Q7EA 4FQ7A 4IIUA 4ITUA 4KFTA 4LNUB 2CHVA 1M1ZA 5U4XA 1EVJA 1L7PA 1PFKA 4HNVA 4GDFA 1GILA 3K2IA 3NNNA 1U3WA 2OGWA 2J3QA 4C3UA 2P2LA 1KC1A 2X2PA 5DM2A 3K0KA 4DAOA 1JIVA 2JFHA 1U7PA 1NFFA 2V0CA 2WPDA 5TMDA 3O8LA 3K5WA 3KOXA 4X20A 1ZMRA 2OZLB 5F1OA 3HO1A 4Q4CA 2QNIA 3QWAA 1BOOA 2A0XA 3CUEF 4EKIA 5IJ0A 3SYMA 3FYDA 3AVUA 3AB7A 1RXSA 1SIBE 4HQ0A 3L7AA 3H5TA 4PAOA 4ARCA 2PZLA 2GZHA 3HB4X 4IJMA 4ND6A 4TV9F 1XALA 5BSVA 1NONA 2Q6TA 4H08A 721PA 1N5RA 2R9VA 4XW2A 4DVGA 5LU9A 2Z3VA 4BKOA 1R1DA 2I80A 2XGSA 2HLPA 2HSGA 3LDGA 2WM3A 3ESAA 3GJ5A 5KJ1A 5B1HA 4C0WA 4CEJA 3VI3B 1MPXA 1KHTA 4OUDB 3VR3A 5JBIA 1Z6GA 4N3GA 4Z4IA 3GRAA 3ZWPA 2RB5A 3KEFA 4QARA 4BPRA 2WA2A 4JBLA 1J9GA 2Z95A 1WD7A 2E2WA 3V2HA 2ZUWA 2BEJA 4D9IA 1WV1A 1KI2A 3JVEA 1JHQA 1SKAA 5CCDA 3WP0A 5IX8A 4PO8A 2Y0PA 4TTJA 3FUUA 3VZDA 4IRXA 3AFIA 3QHQA 1C7EA 1VLLA 3DKPA 2JA1A 3G8YA 2ZVPX 4XB1A 1EFVB 4KGDA 2YZGA 1SG9A 1NW4A 3SEZA 4CHGA 5IKPA 4IDNA 1DJQA 4DWVA 2R8OA 4L95C 1PYDA 4M8IA 3OZ7A 3M1LA 3PEVA 4GMHA 4Q6BA 5KSOA 2ZYUX 3CH4B 1WW2A 1KH3A 4J0DA 1MEJA 1WEHA 2GEUA 2ATXA 2JVJA 1AGNA 1ESEA 2WIGA 4PLWA 1MAAA 2OO5C 3AUYA 3BXPA 4PQEA 5HZKA 4IO0A 2EX0A 4BUZA 3SZMA 2E87A 4IINA 1JA1A 3KYIB 2HMWA 2EW1A 5EIBC 5F3WB 2DB3A 1YR9A 1YR3A 1P2FA 1KFEB 1EFAA 1IBLB 2NO5A 2YRXA 4IKEA 3WNCA 1H1DA 2GCNA 3TJRA 4Q4JB 3FOBA 2LUOA 2Z0MA 4HLCA 3CX7A 1CS0A 3AUFA 1OGJA 2B0JA 4QLOA 4L73A 1KHHA 4MR9A 3BWXA 1PZGA 4PBSA 4C5BA 1DADA 5BWLA 1KDTA 3DZFA 4OB7A 5AQEA 2C5FA 1AKUA 3CY6A 2Y0CA 4U63A 4LSGA 4A0GA 1C1HA 2I3ZA 2LDBA 1VMKA 3PVZA 2VYND 1JKJB 1OSNA 2Z09A 3SJUA 4BP9A 3E48A 5G41A 2GSWA 2BDUA 2HREA 5THQA 4EAAA 3NEYA 4GX1A 1OXSC 1EM6A 4KK4A 2IVFA 1EJBA 2J8ZA 5LCXA 4A8TA 3GDFA 4WZBE 1NLMA 4DDVA 2GEDA 3C48A 3RYFB 4HQKA 1KO7A 3IP5A 3H6HA 2Q3LA 3M5WA 5LP6F 5CUQA 3WIDA 3RM3A 3C4VA 3OFKA 4Q3DA 3ZU4A 4ND4A 4WGFA 4OHWA 2FEXA 2ZM5A 2GK3A 1LV7A 1Z5GA 1FXUA 2MDTA 3IAXA 1YULA 1L4FA 2PSEA 2FZ5A 1GG2A 1O4VA 3UCEA 2GZDA 5HUQA 2A6PA 3C5EA 3GZNA 1BH6A 5AXBA 1H2XA 2FZCA 4GE3A 3KQUA 2BELA 2Q6IA 3EGOA 5BN4A 2OO5A 2PZ8A 4PRLA 1F2UB 5C80A 4P0PB 3DD5A 2AH5A 1NHGA 1FNBA 3N2KB 3N0WA 4DQVA 1WMAA 2QR2A 3LCVB 1W49A 4F9EA 3C2QA 3RIHA 2IPLA 2PX2A 1YO6A 3GUVA 3R0ZA 3WDMA 5KTTA 5B1SA 4BCDA 1U99A 1JQ3A 2RH4A 4Y2QA 3FKQA 3KT6A 5ALWA 3NJ4A 1LVHA 4TTVA 1P7CA 4C0SA 4HNRA 1XWIA 3KVOA 4O2LA 1ESCA 4QG7A 2LD4A 2FSGA 4KVAA 2I2BA 3U7GA 4YY3B 3K05A 1P2TA 1QNLA 2GEVA 4O8CA 4PLYA 4RDCA 4AX4A 2ETVA 3DLBA 1K98A 3O4HA 3LRPA 3TJZA 1IN8A 3AG6A 3SLRA 1NBEA 1X86B 2OHXA 3H75A 3IPLA 1EGQA 2FP3A 1GXSA 1IHDA 1ZGBA 4D8VA 5B6PA 4DUGD 1N33B 4OXQA 5AXCA 1BRMA 1V71A 3VH4A 4MINA 2VJDA 2HJGA 5AW2A 1Y8AA 2EYUA 1LWOA 3GFBA 3VH2A 4AC9A 4BYGA 2FN9A 3EUFA 3H1BA 1Q1ZA 1QBGA 3RUCA 1E9AA 3O4GA 2H11A 3CLTD 3H8VA 4X24A 3OJFA 4II2A 1RYHA 4INPA 3ZY2A 4A82A 1GD1O 1Z13A 3OQ1A 3JQ6A 4DMLA 5LKAA 1W5SA 1DVRA 2E5FA 5HMMA 3HJAA 3TLBA 1Z7YA 2UUBB 4AT1A 1UWCA 1WF6A 4CM8B 1Y63A 2HCJB 1XTJA 1WUYA 1KJWA 1WPRA 2MHCA 1JIIA 1L7VC 2FQXA 4DG9A 4EJ6A 4FONA 4QWWA 5DWDA 3SKYA 5KYTA 1RZVA 4MICA 5AYVA 4D0RA 4CTJA 3U3RA 1X1RA 2W2VA 3NGMA 4KFCA 2VI5A 1J49A 3DQPA 3BL8A 3K1ZA 4EG6A 4NBVA 4QPJC 4KV9A 4R2JA 2BJHA 3SSAA 2P2SA 3UQYS 4LV6A 4JU9A 3F0TA 3PUHA 4B3GA 4XWYA 1P2DA 2ZITA 5AOCA 2IVZA 1J56A 1J8YF 1JWLA 2GPYA 2PE5A 2YYYA 5IJZA 5B58T 3CLRC 4TN1A 3I0NA 3OPYB 1GITA 1T43A 4Q47A 1VSTA 1R74A 3BQ9A 5LQNA 1O1YA 3ADBA 5LZ4A 5DI9A 3IQFA 3FPJA 2AFRA 2IWHA 1U2SA 3GJ6A 4DLBA 3W5BA 2ATIA 4OGLA 1ODKA 1Z6YA 1YDEA 2VVTA 4IIYA 4HQ6A 5JJBA 2WWGA 1D7OA 5A1TA 3MEQA 5ER9A 3LF2A 5JEDA 1PD0A 1Q1EA 2AOWA 3DONA 2ZYSA 4K2HA 1JMVA 4QOIA 3VR2A 3B82A 1PFVA 2H51A 3CLTC 2VCYA 2WICA 1BG6A 2C7PA 4D57A 1E9CA 2R86A 3PWTA 5HK8A 1JE1A 1OXXK 2IPOA 1Z4OA 2WSIA 4D4IA 1SC3A 1GNTA 4KDEA 3TEJA 1CJMA 1F7VA 1X3LA 3H5WA 4N8EA 4U7WA 1KOGA 16PKA 3GB9A 5E3HA 1EA5A 3MGKA 4PBRA 2ZPTX 4C88A 3QKTA 3O94A 1QO7A 1IEXA 2Q0QA 3EQ6A 3OLXA 2X5KO 1PLJA 4UFOA 1VMIA 3WLRA 5EEHA 4HV4A 2NADA 3V8BA 3UKDA 1MX9A 4M87A 4ML3A 1E8MA 1Z2EA 1GGHA 2B8WA 3A27A 3ADOA 1AUOA 1AGXA 3CTPA 3NHLA 3ZD9A 1M8GA 2B1QA 2EC5A 1K08A 4OKSA 3U5TA 3UT6A 5EQFA 2VWQA 3SIXA 5F98A 1J21A 1WA5A 1E5DA 2NU6A 2J0SA 4ZOCA 4DLZA 1RQLA 2JEZA 3K1AA 2CEAA 3KFLA 2OHOA 3U7IA 4F1JA 1A72A 2F9LA 3KHUA 5LP6B 1FNNA 3DAYA 4F5EA 5KTKA 5JS6A 1NUQA 1KO5A 2Q4BA 2R44A 3QEOA 1PT5A 3L8EA 1N4DA 2DUUA 3I9KA 1W25A 4R0NA 3A0RB 3S1AA 6ADHA 2R1VA 1IU9A 1SIOA 1VJ5A 4DDHA 1Q0HA 3KT0A 2A35A 4JLDA 4ER3A 1Y9DA 2XNKA 3DJYA 3L9WA 4KO3S 1CIJA 1H6AA 2HHHB 1D1TA 2RK3A 2IKSA 1NAIA 4CMGA 1EE2A 2FHPA 4JDPA 4Z8XA 3DMPA 4OFXA 3TEMA 3WK6A 3ZXSA 2QPOA 5L6MB 3HG7A 2AD1A 3IQZA 2E48A 1U6IA 2IODA 2OHVA 3PXCX 3TZBA 4BFZA 5AKXA 4OOEA 2RGWA 2VF7A 4WZAB 2QTRA 4X8LA 1ULBA 3RVOA 3VYSB 4AUNA 3EBLA 1S5PA 2P9QA 3OM1A 5K2MA 2WSSD 3W5SA 1X38A 3K9LA 3HBJA 4JB3A 1ZA2A 3L7YA 2ZJFA 3ZKWA 4BUJA 3TECE 4J1NA 4N7JA 3ZK9A 4R7ZA 3TWOA 1NP3A 5K03A 3H3XA 2FGKA 5CK5A 4D9KA 1TEHA 4YCSA 4YXWD 3BOSA 1MLDA 1K2WA 2BGNA 3N59A 3CMMA 3E9NA 4NIMA 4F2HA 1H5UA 3I64A 5CDFE 4M1ZA 3E53A 1JPJA 4YCCA 4J0FA 5AHOA 3IPYA 3BGWA 5HRCA 1TZJA 1QFJA 3A1TA 1YI1A 1BQ4A 1R0ZA 3DEJA 5CVVA 1YE5A 3LUFA 3SEFA 2X9GA 5IEBA 4NCBA 4Z7OB 1NXWA 2I4NA 1BEEA 1YE8A 4PSUA 2F17A 3BM5A 1YMVA 5EHQA 2ZRGA 2AZMA 1M34A 3X43A 1RS0A 3F5QA 7ABPA 1PZMA 4R6WA 3T1NA 4MOWA 1P9RA 2AQ8A 4IIJF 3JCZA 4BZPA 1RACA 1JIXA 1I01A 2JBHA 3KJEA 3U2QA 1MT3A 4DZRA 1SQ5A 1KEVA 4PYKA 4F4JA 3GMIA 1QIGA 4EX7A 4OXNA 4ZIRB 5JWHA 1FXWF 4M6WA 1E3EA 1YHZA 5REQB 1J07A 4G01B 1LGYA 3I28A 4IIBA 2I29A 2VDUE 4M9XA 3OOYA 5AHRA 5LKRA 3CUUA 1M72A 1E62A 3VO8A 1Q17A 1H65A 4MS3B 3WBKA 4C9BA 3LGAA 4DXHA 3JD0A 1IXSB 4DA0A 1MRSA 3UJHA 3I42A 1KH2A 1PJRA 3NORA 2DKNA 3F7OA 1WX1A 4MMZB 4EENA 5LWHA 4I3HA 1G1AA 1LJUA 1E4YA 3PUYA 1TEVA 1X94A 1H2AS 1K8RA 1VYTA 1IOVA 1GNLA 2XRMA 4EP1A 1YFLA 3KKNA 3W2HA 1HM5A 4HL6A 3FIJA 4TGLA 5KNLA 3RUPA 1OIXA 4ZXFA 3VYUB 1TTTA 3GGGA 2E4XA 2JGAA 7GPBA 1KJZA 3RSSA 4YGYA 4ZU1X 3E9YA 4X92A 1I3CA 2IU3A 1SHKA 3RIYA 4JD5A 5J40A 5IEJA 1TI7A 4A8JC 3MLEA 3P9PA 3F1KA 4ZEVA 2Q2QA 3K6JA 2ZKIA 1NJFA 3NHRA 2FRDA 4L7VA 3F46A 3KZMA 4MQLA 2I91A 2D1QA 3R9XB 1OLOA 4UUBA 5KVQA 1WZUA 3KM0A 1JHDA 1DWOA 3EVAA 4GECA 1YL6A 1EXDA 1YJXA 1W36B 1CF2O 3C39A 3UUEA 4NCNA 1XBTA 4J0JA 3RODA 4W7HA 4BGDA 3KSZO 5AW9A 3AM3A 3GEEA 3LVRE 4NHEA 4QJ4A 3U7QB 5GZ3A 4J3JA 5I7SA 2MIIA 3WLQA 2OB1A 1KQGA 2F55A 1W88B 4EFNA 2VR1A 1C14A 2AR7A 2AVDA 1MOQA 2D54A 3GCXA 2C88A 4HPWA 3BAZA 4WJKB 4LBYA 3UAWA 4LSZA 3CSUA 4FCWA 3K9FC 1GQQA 2MSNA 4HAZA 4LRWA 3BE6A 1QQTA 1B6TA 3UEOA 4A5SA 3CF6R 1VB3A 4G24A 1LI4A 1GU0A 2C5EA 3F8TA 4HDCA 2QW1A 2A4MA 4XR4A 2WLTA 2XDAA 5I9SA 1N6IA 1HO3A 3O82A 3RRJA 4M38A 2QE7D 2Q5LA 1OKKD 3I45A 3PTZA 4EA7A 4RJTA 4AZWA 2JLYA 1UINA 4H59A 8ABPA 5F9FA 2ECQA 2YINC 5I51A 4X84A 3H8SA 1INLA 5L3SB 3KU1A 5EPOA 1Q22A 2AT1A 2WSBA 1FQWA 3R6DA 4CCAA 1ZJWA 3ENVA 5CXUA 3T4UA 3PCTA 2YXBA 4L5AA 1CQJB 2MTBA 3PR2B 2MCFA 5JXWA 1WCIA 4NENA 4U2EA 3HKCB 4AJJA 1NUPA 3RS5A 2RCYA 2EARA 2CCKA 3BJRA 3HABA 5JNWA 3HI6A 1YRWA 2BZ0A 2CXPA 1LJLA 2VH2A 2GJ8A 2OILA 3DT6A 5B1IA 4UM7A 1ZK0A 1T36B 1M66A 2P35A 1U2QA 1G7CA 1ORDA 3QQPA 5AW0A 3ZV3A 1RZRD 1WE2A 2QM8A 3GIDA 4K3VA 1K89A 1QV7A 2CLFB 2BT4A 3L4JA 1LBSA 1ANKA 4PGHA 3VTKA 2CC2A 3ACCA 3GY0A 4C0JA 4YJ2F 3ZNOA 4G4JA 3E84A 1UBNA 1ZNYA 2FB9A 2CK3D 2NOAA 2PUHA 3IAM1 1GPMA 2ZUVA 3R4CA 1UUFA 1EGVB 4UATA 1X7ZB 3HXQA 1WDTA 2YRFA 1JYEA 1LBQA 4P8RA 4BNTA 4Q9LA 2ZUSA 3HQ4O 5EIBD 2FMUA 4RQAA 5DNVA 1DG1G 3QFTA 4KE6A 4X66B 2I2XB 4N9QA 5B3LA 4HRYA 4BATA 1F9EA 4NZOA 4N18A 1FTNA 4O4HA 4RQBA 4E7PA 4X62B 4KQJA 5DXFA 1T9AA 4LY9A 3DZKA 2PFSA 4R9NA 5BN4B 5B1YA 4Q3KA 4R2XA 3LLVA 2FR0A 3BJZA 3B2QA 1P1HA 3GC6A 4INAA 5AESA 3O47A 3GDHA 4R8KA 1YOVA 1UZNA 2Z2IA 3N8GA 4OSOA 3RJ5A 1PG2A 1PD1A 2WM9B 2HA6A 1J7KA 3JSXA 1P0IA 3IE1A 1ID8A 1KTVA 4IF6A 2YJ5A 3BD8A 3HLTA 3KZXA 4CVNA 4IMPA 4K46A 3ZI0A 3HGTA 5IH3A 3C3CA 1D2CA 4J0CA 4L2IB 4CKWB 4ACAA 4YMIA 2PNFA 3KRTA 4LKRA 1E9VA 3V42A 3DO5A 2VIIA 5DOZA 3EVGA 1MZPA 4YRTA 4HVLA 1YOVB 4KCGA 1RP7A 4YX9A 1P4RA 3GJXC 4AROA 1ZD2P 5GP1A 2Y1XA 2QX4A 2FF5A 1TZMA 4S2EA 5EWMA 2NU9B 3QEKA 1BW9A 4J4TA 4M8KA 4CR7A 1AXGA 1EU1A 1OAOC 1LBTA 1O0SA 1NWHA 2Q3FA 2VRWA 4PCVA 4IDFA 2CWDA 2P2ZA 2QTAA 3PX3A 3K96A 3H05A 4RY8A 3LCUA 4DT1B 3ZE7A 1A27A 4IHJF 2AW3A 3D31A 3LNCA 3AHFA 5KQGA 2PX6A 2B92A 3PC8A 3K0CA 2HK6A 1GUBA 3FR7A 4IDGA 2SECE 1FRFS 2C4VA 4YAIA 5TQJA 4Y3UA 4YJKA 1C3OA 3OZGA 3A6JA 2XMSA 4AJEA 2JI7A 2WVAA 3VBEA 3I6QA 2NZVG 5KNCA 2XBUA 4TTPA 5FADA 2GHQA 4YAEA 3L92A 1WCV1 3NIDB 4KVFA 4P93A 1JGTA 3B3QA 1R4MA 3MTAA 4FGWA 1L7AA 2XAAA 4MEJA 4PANA 2RGBA 2R6JA 1SZPA 4TV9B 3UJ9A 1S9DA 4EZIA 1FUIA 4LPSA 2SCUB 2CLCX 4ZYLA 3QLVA 3ANMA 4OAQA 1OWNA 1JIQA 3TQSA 1P4SA 1W5FA 1U8FO 1JJVA 2YYAA 1U04A 2WHPB 1HBJA 3L9XA 5HE9A 3M33A 5IXJA 5LDGA 1MVOA 1PGQA 1K0FA 4BEVA 4TM8A 3AOEC 5T4BA 3MUEA 3RJZA 4ZHQB 3OZIA 2EBWA 3PNMA 1WXGA 3G8CA 4HDKA 4ZKEA 5KTSA 2WUFA 1X39A 5DULA 2ASVA 2AA3A 3B3GA 3QVSA 1X2BA 4WLFA 2ZSAA 4J3NA 4AMYA 2FLWA 2JAOA 4CNBA 5MGBA 3C98A 5DI3A 3EDYA 4GG1A 4Q9DA 4G0VA 2TMDA 1WQ3A 1RM0A 2P65A 4TQUS 4OUDA 1ZM2A 1T1JA 3QW4B 4IFTA 4RF3A 3DOUA 2JCVA 2H1VA 2ZJBA 3N07A 4X0EA 5TS3A 8LDHA 2RH9B 3T0FA 3R8FA 3HR4A 3Q2KA 1SC4A 1KERA 5FBZA 2W2KA 2W6IA 3WZLA 5BVGA 2DFTA 2O52A 3KPWA 5AJVB 1VL2A 5EG5A 5TC4A 1B43A 3PG5A 4KUGA 5L95A 1H0RA 4DRXA 2EP7A 1C3XA 2BSAA 3LU1A 2IGBA 1U7UA 1H1TA 4V0SA 1K27A 4FYXA 1DJNA 1YUMA 5JH7B 4A92A 5KSYA 1FLVA 2D3TA 3UJAA 5DLQC 3L7OA 2IK8A 1D9ZA 3G0CA 3AERA 3ITEA 4U1RA 1ATIA 3GJRA 2PH7A 4GM4A 1M6WA 1MC5A 2IYUA 1EFVA 3KAPA 2X15A 2QHXA 3PUXA 3WWEA 1HOXA 3AHEA 5JDIC 5ES3A 2P67A 1KVTA 5C8DA 1YONA 1CEQA 4RDHA 4Z2AA 3OZBA 1ZCFA 4XRRA 1OAOA 3NR2A 2G9QA 2VPWA 3C15C 2HU5A 4GIBA 5DOVA 3GLGA 3OLZA 2EDAA 2NPIA 3IKMB 3I37X 2VDMB 5DEOA 1NY6A 2A5FA 3EGXB 3BGSA 4Z8YA 3SC2B 3V97A 3ON5A 3JQBA 3MT9A 4XJTA 3NYRA 4JFAA 3WJ1A 1O9HA 1AS3A 2PXXA 4IV8A 3C70A 3WLJA 4R31A 1H0KA 4G1EB 5C52B 5C5EA 3VPCA 4J0QA 3JZIA 3ST7A 1G8JA 4MVJD 3T52A 3UJBA 4QXAA 4JVSB 4W5RA 1E1RD 1SPXA 1M1YE 2I65A 1GL6A 4NH0A 4XM2A 2BIFA 3Q7IA 1OROA 2HK9A 2PWYA 4M21A 1P75A 4JLUA 4WBNA 1R88A 2FKNA 1E5TA 3W5JA 3PICA 1PEYA 2WKPA 1TCAA 5DTRA 5FTWA 3FDJA 4MV9A 4NYMQ 2AZ4A 5KDDA 3E22B 1CW2B 3UBTA 1FUEA 3BC1A 1EB8A 1M6VA 1VKZA 2REXB 5EINA 3JQFA 3T5MA 1QONA 3L5OA 3GJYA 2VWGA 4Q7LA 4S1OA 2EW2A 3LCMA 2UV8A 3V4PB 2VHCA 4FBLA 1A8HA 4FX2A 4R5HA 1BFUA 4W8HA 4ZP1A 2B1RA 1L7RA 5CURA 3TOCA 3AHJA 1I3NA 4ER5A 1HK7A 1X8JA 2RIPA 1F51E 1ECJA 4FZ3A 4R2IA 3UUWA 3WHKA 5AW8A 2AD5A 2QMZA 5FCDA 1ZVVA 1HA3A 1FFGA 2ZXUA 4KQHA 1GRCA 1RM5A 1LSOA 3OQPA 2ZCVA 2OO7A 2JFUA 4BNGA 3RRXA 1GZVA 3LKDA 4UW9A 1DIRA 1N2CB 1RRFA 2G5CA 1V3QE 3ZEAA 2O1EA 5I7VA 3W8DA 3V2GA 4XEUA 4LE1A 4N1AA 1BW9B 3WYDA 2X1VA 2BMEA 1KZYC 4PRZA 2XAUA 3I92A 3TX6A 3N8IA 5K3EA 1BGXT 2VYNA 1FUUA 3WKEA 2JFYA 3DHEA 2J7KA 2P30A 4QQ8A 2J33A 3RBZA 3WRXA 2OCXA 4TPKA 3KBOA 1A2OA 4MCHA 4AKHA 3GFSA 3DF7A 4HFNA 2AJDA 2CB9A 1FK8A 3OOWA 4RJJA 1SUEA 4JP2A 3LG2A 4NYMR 4I55F 2H5JA 1L4LA 5F23A 5BNWA 3ZGVA 3SJAA 4OH7A 1PZXA 4MUYA 3RS4A 1GR1A 3DDHA 2KE5A 3RFCA 1A8PA 1AZSC 2B2NA 2Q6LA 1FJ2A 3GG2A 2VZ8A 1CF9A 1KKUA 3IEPA 2QT0A 3LW8A 1SHTX 1Q57A 4HGOA 4R1PA 4FFWA 2J9FB 5ITZB 1Z35A 5C81A 5NLLA 1EFHA 2IYPA 3WBFA 4AJOA 5MHTA 5C8YA 4FJ0A 1KAMA 5E38A 4MGEA 2R1TA 4KAAA 1VG1A 4DEYA 2O8BB 1WZ2A 2QI9C 1C1DB 4B3MB 3G9TA 3GFGA 2JLZA 3TW8B 5DXJA 1XVLA 3BMOA 2WJPA 4M1SA 1RQXA 1SZJG 4NYJR 5HIMA 4MUNA 3SBDA 1IIRA 4KG7A 3VNVA 1XXHA 3WR5A 3UHAA 4GC5A 1OXBB 1YB4A 1UP6A 2PLWA 4YPFA 4H7KA 4NARA 3IKTA 1N9ZA 1N5OX 3EJWA 3WQSB 2OYSA 4PVDA 1XJCA 5TPWA 2O8BA 4JYBA 5CVDA 3MMSA 5P8WA 1LC0A 3CT4A 3F49S 3KC2A 1KI3A 3U6KA 3ADCA 3Q8LA 2E1PA 2Q8QA 4Q82A 1QO9A 1AZWA 1VE7A 1WKCA 3W5IA 3TKLA 1UJNA 3HU1A 5ALQA 3JARA 1COWA 2C7VA 1ZJJA 4QXRA 3WWDA 3C8ZA 4IIFA 4R98A 4BMDA 5G0VA 2NUPA 3ADPA 4N5MA 4JB2A 4YBZA 3G49A 5CU7A 5LQCA 3SNKA 2Q6OA 3UFBA 3D8SA 3H4VA 1S2LA 2XCIA 5AXAA 3U4HA 5A5DA 4C6TB 3RIXA 5BV2P 4EG1A 2C1EA 2O8EA 1NRJB 2BMDA 3O2QB 4GI1A 4U6SA 1CUDA 2AQIA 2JEYA 4IZ6A 5ICCA 5J4LA 3OOJA 2R4UA 3HNPA 4X1IA 3SLKA 2YXDA 5BSRA 5FNVF 4EOGA 2P5UA 5CFNA 2O8DB 1ODFA 2HF8A 2WYOA 2IHBA 3PFBA 5FF9A 5AWFC 4BO6A 1NTRA 3EXHC 5DGHA 2G08A 1P0PA 4ZHSA 5K8TA 2Y05A 4CLDA 1M2JA 3IAFA 3GD7A 1FZTA 4YMWA 5AKYA 1PW7A 3P4UA 4IDDA 3F6PA 2BGJA 1ULHA 1DEHA 3KYJB 1XZ8A 4YQEA 2LRHA 1V95A 5LIPA 1U5BB 1Z2CA 4X3CA 3UMGA 3X1XA 2W93A 3KB2A 1RAFA 1W5TA 3DXXA 1TEZA 3M9XA 3S2YA 1LK0A 1X74A 1XLTA 2C2XA 3OZUA 5JV5A 4QUKA 4XR9A 5CA1A 4MTCA 5FWNA 1O87A 4GEGA 5KMGA 1L5YA 3UHPA 2IW1A 1DT3A 2X3UA 1ODCA 1UT6A 1V0JA 1AKTA 1RQPA 2WTXA 5TIIA 3ROPA 1QVWA 3SLGA 4BQRA 4RTKA 1U9IC 1PNOA 1T1RA 2I1WA 3HJGA 1NPDA 2R8RA 4TL9A 4F9TA 2C3UA 2C95A 2XQFA 1UK8A 2OR3A 1R0CA 3C74A 4P32A 2GZSA 4PX5A 4UE2A 4WBNB 4W9MC 1TUBB 2ECOA 1NU6A 2D7DA 2HFJA 1T25A 1LW7A 5FI0B 2FSIA 2VUTA 3M6VA 1Q84A 1XKXA 1VSQA 1YSCA 1M6NA 2WYUA 3ESBA 2EEZA 2GESA 1D0VA 1PVOA 4HR7A 3IBGA 4BX8A 1KMNA 1X0XA 3F47A 1W6UA 3JQ9A 4HDSB 5FTMA 1A1SA 2BMFA 2NTEA 2RGXA 3GHHA 1LDNA 3OMXA 1Q16A 3QENA 4GSLA 5JNVA 1KYVA 2HZBA 1EA7A 2CLEB 2QVXX 1G4AE 4C5CA 4PE5B 1JEJA 1SN7A 1KEEA 4FYHA 4J7UA 3CR3C 4U0JA 2Y3IA 4RPGA 1T4DA 1TCVA 2NO0A 4KXMA 1KKLA 2D2EA 1NI4B 2VLIA 2VK1A 3A6GA 3MMNA 1DTWA 4FZVA 4G5GA 3E82A 2A59A 2BBWA 2R8YA 2VQ3A 3HVUA 5T4HA 4BQNA 4DJJA 3P9ZA 5FLKA 3EEIA 3DNMA 2PFGA 2VT2A 2N47A 1IXRC 3EIOA 2PXHA 4R01A 3QX3A 3BJIC 2W22A 3DE5X 5TSDA 3S27A 2DTDA 5HM6A 3WK9A 3BQNB 5LPNA 3W04A 3AHGA 5EL0A 1UT8A 3LQ4A 4PONA 3WB0A 13PKA 4BMPB 4UASA 1FSSA 5JSHA 4WFQA 1E3SA 1S3FA 4EF4A 3NFYA 5D00A 2QSZA 3PDHA 5LD2B 2VPYA 2XT9A 1YVUA 5EWLA 2C7QA 5HNKA 2L42A 3B53X 3A1EA 1E2FA 2RK6A 1ZSYA 2A0FA 5C8XA 2VKQA 1TK9A 3NTQA 2C97A 3CF2A 2BEVA 1ZJ5A 3EZ7A 3JRWA 1HYBA 1I80A 2AR0A 4LHVA 5JAHA 4JR1A 5EFOA 2XF2A 1DFIA 4DNXA 5BVHB 5IG2A 3AFNA 2GERA 3CBQA 2PS1A 4FFLA 3FB1A 2YVUA 2DQZA 3NUZA 1CVLA 3DHYA 1VIVA 4NK5A 4O08A 1QYIA 1ZM4A 1NMSA 1VHJA 2ANBA 4Y2PA 5BQPA 3O4VA 4J07A 3E7PA 1L3IA 4M6WB 3GPCA 3LK7A 2G4LA 2B4QA 2M6SA 4MQMA 4C0HA 1JBQA 1S4MA 2HOQA 4L8FA 1C50A 1GPH1 4DYHA 3EWAA 1JPUA 4BNKA 3A58B 1C7ZA 4GNRA 3JQGA 4XDZA 1RHRA 3D4LA 5JNUA 5TXGA 3IDSA 4OEHA 2VHXA 1WXIA 4A2CA 5M3BA 3UKJA 4MKGA 1LWNA 4O25A 4B6EA 5KTNA 1IB6A 1UBUS 1WXFA 2IITA 1IDN1 3W5DA 1S1CA 3K20A 2HV8A 3IP7A 1ZC4A 2DBVO 3GOQA 1KYZA 3VZCA 1ITZA 1JHPA 4WLVA 1VHLA 4C0KA 3NDBB 2O5EA 2IYWA 3BFKA 1NNI1 2Q7OE 2W2MA 3HY3A 5MFZA 1TKRA 4LDZA 2XB4A 1X2EA 2D7CA 1XTQA 3IAEA 1NLFA 3MJHA 4NG4A 1B4DA 3ZZMA 3L02A 1W34A 3GDGA 1P2VA 2CDNA 2BM8A 1WXDA 2XD9A 1A2QA 2IOHA 3KTFA 4H31A 3NCHA 4PLTA 2IWRA 3F71A 4CM1A 4WY8A 4E09A 2PUFA 4MQ6A 5D5QA 2XDQA 5KC9A 2IH2A 1R8SA 1OI4A 3QBEA 4OF4A 4O2BF 1J99A 3RH0A 4IX9A 4PNHA 4MRMB 2O20A 2WG1A 4I4IA 3SQNA 5U1PA 3RSQA 3HUTA 1OYOA 3UMJA 4FE7A 1FXWA 4YJFA 3W5VA 4D26A 1X9HA 2C2YA 1Q77A 2H8GA 5CXXA 4J4HA 5JDCC 2DE0X 3VPAA 4G37A 2FFJA 1HR0B 1D5CA 5K0LA 2OXIA 2FG7C 2NV6A 4F92B 5HVNA 3QI2A 4UQLA 2ZVQX 2CLDX 5DT9A 2WWVD 2JLVA 1MIHA 1CDOA 3K9NA 3PZRA 5CRIA 2JZCA 1N5DA 3HKBB 5TT0A 3RE1A 3CISA 4N8DA 3GDWA 4QYIB 1DIHA 1MEOA 3HADA 3AZPA 4X93A 3HWRA 4BRSA 5FA8A 1DV1A 1G291 2BUBA 2PH3A 3SBOA 2PBFA 3VU0A 4DCVA 3KVYA 3OTIA 1U9JA 2F3PA 4G81A 5CNKA 3V7UA 3TVDA 2BLLA 2X58A 3W2IA 4CLRA 1BMFA 4OSPA 5GJVC 2IBSA 3JQCA 4DLWA 4LMAA 2WB2A 2GAOA 1UBKS 2Z5FA 4RX1A 2JFWA 5CFPA 1KYXA 1Y9AA 2FFHA 1CV2A 2GCOB 3Q4GA 3SAJA 3EISA 4H1TA 2D0IA 3PD1A 4TKVA 2IV2X 2M6KA 1DIOB 1J09A 4P3YA 5AFSA 4CKXA 1GSHA 1WY5A 4CCSA 2P8SA 1SC6A 2XMBA 3LCCA 5C7IO 2WQ7A 4B6SA 4UTNA 8OHMA 1XPUA 1KVUA 4FEYA 1GUAA 2JJ1D 2QAGA 3X1DA 2YY7A 2WYHA 4EJSA 5KWIA 1QZTA 1KEZA 1GA1A 5GM1A 2XZOA 2OY0A 5TGDA 3ZS9A 2BEUB 3CB4A 3Q12A 4RVDA 4RMGA 1IEWA 1WEKA 5LNK1 4FLFA 5HYVA 3WGHA 2WINI 1MB4A 4DQ0A 5FPPA 4YP9A 3V48A 5DNUA 3V7FA 4YEDA 2C9OA 1L4UA 2JCBA 4R6XA 1B3RA 1GZHB 4YDSA 5THXA 2PLNA 1TT5A 4IFIA 2DH6A 3MN1A 4AM8A 2QG6A 3P2YA 3OQOA 4MVYA 1AKEA 1E9RA 1HKUA 1ILWA 4IKPA 4X5OA 2OBYA 5I7RA 4KVZA 5AHKA 4E5MA 1XD9A 5K3AA 4D41A 4RV5A 5COQA 5DMHA 2H1WA 5AM0A 3RRMA 2AC2A 2O7QA 3BERA 1XRRA 1SD5A 4UAUA 2HBYA 3AC0A 2BVNA 4WPGA 3F6CA 2V98A 3BQMB 3I1FA 1PR2A 3ZHCA 2X77A 2QP3A 4LFCB 1ISRA 2HBQA 1G8HA 1NDHA 2PD4A 3KWFA 3WK7A 3U4DA 1EQUA 2VJNA 3TG8A 2D1SA 3B5EA 4XJXA 4A2WA 1WB4A 4EY5A 5HRAA 1JJIA 1I33A 3CKYA 1NRXA 2O7RA 4Z9XA 4UHKA 3W0LB 1Y7TA 3Q41A 1GZ7A 2IZ1A 4MUAA 1J42A 2PRSA 4ASUA 1DKRA 1F2DA 4P22A 1XTVA 3ZE1B 2OGSA 2XPCA 3A1DA 4AYTA 4CHTA 3IQGX 1T9CA 2JK1A 4YRAA 3PQ7A 4JROA 1CYDA 1OGYA 1TVEA 1U2TA 2XHEA 2J46A 5TJ9A 1IPHA 4BTLA 3ZZUA 8AT1A 4U9UA 4AZVA 2ISSD 4RESA 2ZU6A 4I2NA 2VYVA 4HRXA 2DPGA 3T1HB 3KL4A 4B2LA 1DZ3A 3KT8A 1U0EA 4UEWA 5LQRA 1XMQB 3BK7A 3PHCA 3AZQA 3DC2A 1JAIA 3KVRA 3OZAA 3GGJA 3F67A 1AF4A 1WXXA 3DMYA 3HJBA 4LXYA 5E7IA 1SBYA 2PUBA 2Y76A 3PCXA 4CM6A 5IU6A 1RYZA 2DY1A 2O3TA 4UQOA 5BWBA 2J6IA 1RPTA 2PKQP 1FEZA 2QZZA 1TL7C 4FYWA 3ZD7A 4HZIA 2QUIA 4GT1A 4LYEA 4BVEA 3M81A 1XN1A 4L9WA 2O57A 3C8UA 1VLZA 3A1NA 3WIOA 5C1DA 1SKMA 4II3A 3EVFA 1V5FA 3ROTA 1JKMA 3SYRA 4LHWA 1KFJB 3ENNA 4MWGA 3DXZA 2HMYB 2EZ9A 3G7UA 3G2HA 1HSOA 1ZA1A 3G0DA 2XDQB 1R0RE 1R7RA 1DZIA 1E64A 1F5SA 2ZIVB 3IP1A 1O57A 5ICSA 1QHSA 1EWQA 3ZOZA 1JILA 4EGQA 1FJHA 2FDRA 4P38A 4YRZA 3PQ4A 3KKZA 4PQYA 3X1WA 1E2UA 3I04A 3GL9A 2Y67A 5CLLA 1D2MA 1Z4PX 4XSHA 3UWPA 5BNTA 4WKGA 2FCAA 5KQPA 1P3DA 4RYLA 2O0HA 2DJIA 3QSGA 4KK3A 1YS9A 1I8TA 1F1JA 1N2BA 3VR4A 4F2PA 1M73E 2VUHB 3IELA 4I8DA 4AO8A 3B5JA 5FX2A 1U2RA 3K0HA 5K2OA 1O6ZA 5FPHA 3RS2A 2UYCA 3FNRA 2CW5A 3EULA 4N54A 4ZPJA 1W88A 3QFCA 4PFSA 4JI3B 3SCZA 1M1NA 3WSWA 4I46A 3ICEA 1BN7A 1QTIA 2RAFA 1RKXA 4Q0MA 3KP1A 1SU4A 3QVGA 1QUFA 5LA6F 4EM6A 5BY2A 1NF2A 4GF5A 1U3GA 4RTRA 1EWTA 4R9UC 4KLAA 1JHZA 4ZVRA 2D1TA 3OLYA 2D06A 4UZSA 1NTOA 3N0XA 6YASA 2BCJQ 3A0UA 2R6HA 3VJMA 1FDWA 3DMFA 1V11A 3ICVA 2XQJA 2X1MA 4U6NA 5JEEA 4K8OA 3WC4A 1ISFA 1LVUA 1WP4A 1X7YB 3SC3A 3PVSA 4IJKA 4QAQA 4E4RA 2GUGA 3R6TA 3CPSA 5JZOA 1QRDA 2C2GA 1Y6FA 3G23A 3DP9A 1ND6A 1Z83A 2H7CA 1EB9A 3QJGA 4KXWA 3HU5A 3OCWA 4EMSA 3CE9A 4MKHA 1U4OA 3L46A 3GO4A 4P4TA 2FZ4A 4XGIA 1CYEA 3GLFA 4L3WA 5CYOA 3WFZA 3I3SR 1NBHA 1HY3A 1PNQA 5KAPA 3FTPA 3K0FA 4PG6A 1Z39A 1XOIA 1DPFA 2WWWA 2HNBA 3KOYA 1XQ1A 1KDPA 4FHFA 5FTNA 2IEIA 2CFOA 4DB2A 1U1FA 2C29D 1TM3E 3PNYA 3QLJA 3DWGA 4I4CA 3M82A 4B7XA 4Y6RA 4ZN6A 1SZDA 1JG6A 3P26A 5AKZA 3NONA 5EJ6A 4D9CA 2J5QA 5CT5A 4Z5XA 2PJZA 3IFSA 1G7TA 4Z4CA 5LP6A 4M54A 4ZDWA 1XRNA 5ALEA 3ZTWA 1MB2A 3LWZA 2FWNA 1CS0B 4QASA 5JZSA 1V47A 1KRHA 6CHYA 1NM5A 3FE2A 4MYHA 3ANYB 5CA0A 5TF0A 2WJAA 3SFVA 1N7JA 4LMPA 1WMEA 2FW7A 3GEMA 1HNWB 1IXZA 3IP6A 5EUMA 2RIRA 3QU4A 2QIOA 1RKVA 5ALIA 5IC5A 5JTTA 1YVEI 5FORA 4IHJB 4KACA 3KTOA 1JR6A 1HTWA 3PPXA 4YRCA 4XGKA 2GPJA 2ZVDA 5CT8A 2ZI7A 3M2PA 3U3KA 3VTZA 2X8JA 1A9RA 1XMJA 2ZROA 1PR6A 1G3QA 1QIFA 2XNJA 3DL0A 1W4LA 3EVZA 1PZEA 3DL2A 3WLKX 1SVKA 4FS3A 3F98A 4PGGA 4GLBA 4B31A 1VHWA 2CUZA 3HRIA 4EGCB 4EPVA 3QE9Y 1H0SA 4GPBA 4BC0A 4FYIA 3I76A 2IS4A 2BYTA 4OV6B 2ZDGA 3QVKA 3ZQKA 4RC9A 3GFRA 5IM4F 3QPCA 1ZXBA 2FUCA 1PF7E 4M7PA 1HQYE 1A9QA 1E4OA 4R1QA 4ECAA 1UKYA 2OLJA 4CF5A 1EZ4A 2X9QA 2ENWA 4PYLA 4R5MA 4FOTA 1LK5A 1MQAA 1CKEA 3KJHA 4K6MA 1MC4A 2QMYA 5E6UA 3UXEA 4AG3A 2ZBFA 3C8DA 3IA2A 1DJPA 2ZBDA 3O4JA 3CPHA 2FMXA 3FNGA 1QGOA 3TNYA 4EY8A 2CWWA 3NI2A 4QXQA 5HEKA 1CXZA 3SZGA 4AXXA 2BFBA 1XHLA 3IVGA 1V1RA 4UDXX 3TPFA 1QG6A 1WVIA 4NOLA 4RZSA 4W99A 2O2GA 4Z1OA 2QUBA 4IBOA 1ZH8A 4K9NA 4IDQA 5MF6A 4LVOA 1G63A 1UJCA 1ZVKA 4XVHA 1N75A 3EGIA 2PJUA 3BWDD 4EGJA 2OCIA 2RGNA 4JFRA 3RYCB 2RCNA 5LZ5A 2NYRA 3SZRA 5LYJF 3BSFA 1ZU5A 1PDWA 4RVUA 4KBFA 1MRZA 3TKAA 1NKSA 1XT6A 4OQNA 3UAZA 1FA9A 2ZRLA 3B13B 1NFRA 2I2WA 2CFRA 2D1FA 1YR1A 3ETJA 3FD8A 5REQA 3K71B 2FSSA 5K8IA 2BAGA 4RUKA 4D9EA 2VZ9A 1NBWB 4Z9FA 2LNDA 4M1WA 1AOXA 1Y5IA 2ZUTA 3ZBPA 4BKPA 1AHIA 1C8BA 3T7EA 1LLFA 4IQ0A 2EQBA 2GWRA 1G55A 3OZFA 1XELA 4P53A 5EVCA 4DLNA 5FOTA 5HTOA 2WIAA 4ZYWA 2PA0A 4IZHA 4BQEA 3B3FA 2VBIA 2VSNA 3ILYA 3T15A 3TI9A 4B6GA 5E95A 2QX9A 3EIHA 4O1IA 1O97D 2Q3BA 5ADWA 5I7OA 3LKZA 4F72A 1KH1A 4FEAA 2Z2YA 4NPAA 4XPZA 1JKXA 1YZLA 2YASA 3NIFB 4NFSA 4E5UA 5K8JB 4LSWA 2R0QC 5FBKA 2V58A 2QLNA 5C3UA 1CCWA 3CB2A 3AEUA 3JVIA 3LPCA 1RXYA 2WJJA 1AMOA 4UFNA 2UXDB 4DEXA 1BQEA 4LTMA 3G2OA 4NYJQ 3BVPA 2GJAA 4I36A 2O2ZA 1PKEA 5LBIA 4B3TB 3EIXA 3ZJTA 2IRWA 4IS3A 4AK9A 5KIAA 1V9LA 1ZI6A 2QQ0A 2AC7A 1GO2A 1RYFA 1HMYA 4HO1X 5FWXB 2Z6AA 2QPAA 2DTXA 2EJCA 3HBMA 5JCOC 2I34A 4LYYA 2X2EA 1IXYA 2AUNA 5BMOA 2ZFUA 4CM5A 3UY4A 3Q0TA 4KR0A 3HA7A 1M54A 3BE8A 3DE2X 4YAWA 1YCHA 4LYGA 2HA4A 1EXMA 2D0DA 5J2UF 2P11A 2PGNA 3THSA 1UEIA 5FNVA 5JI2E 1RJ9A 1D09A 1PGPA 5DHFA 1FSZA 1S4QA 2RHJA 2WT8A 3Q0EA 4WN9B 4DXDA 1U8ZA 2Y4OA 4LDQA 4NKRA 5KTYA 4DA4A 2UUCB 2VTBA 5DLEA 4LV5B 1BHQ1 1E2KA 1NIJA 2GO1A 1OPXA 2QSUA 3GNSA 4I4LA 4LX8A 4UAJA 4CM3A 5JH7A 1RC8A 3TIVA 3CU5A 1U0NA 3EW9A 2FMFA 3OAAA 5TGTA 4JP5A 1JG3A 1HYGA 1C8LA 4G0QA 1JPNA 1R5OA 1TZBA 2Q1SA 4G1BA 1YVRA 5B7PA 3U7HB 4GYKA 4RK5A 5J5VA 1VB5A 1Q6YA 1TIKA 4AI6A 4MW4A 3E5MA 5KNBD 4HQRA 4IG9A 1N0IA 2YMMA 3Q8XB 1QLHA 3AVTA 2MYPA 3KZKA 1BVYF 5GOTA 3EWSA 3SXUB 3W8RA 4TXLA 3DB1A 3L4BA 4QDZA 5IC4A 1RRMA 1ZD4A 2YWXA 3PUVA 4B43A 1APBA 5FUQA 3A10A 3C5WP 2NVUA 4BNDA 4DRZA 4ABYA 3COWA 1J90A 3AILA 1A9OA 2FA9A 4NZYA 2AOUB 5ALYA 4ZVTA 3R7BA 3KYBA 4NSNA 2DERA 5IDYA 1G9TA 4QHSA 3ABRB 4JEIA 4JK3A 2VP9A 4JC0A 3RVMA 2QY6A 2UKDA 4YR7A 5M04A 3T1TA 2I7VA 4OKNA 4XLLA 1E2QA 1LLCA 3OT1A 1VFNA 3D2BA 1VQ1A 1A2KC 1JG2A 1GTMA 1D4FA 1KK1A 1XTPA 2RBEA 2VPZA 3IHKA 4LOKA 3VNQA 4W6QA 4YCBA 2HJ9A 2ZI5A 5FI1B 3A2KA 3OIFA 4MS4B 3OY2A 2GEKA 2YCLA 4PGAA 5KOHA 2DWQA 2F8LA 1CS4C 1VE3A 4FKMA 4I55A 4V0RA 3T7RA 3UGTA 5BYAA 1T3HA 1ZOOA 4OXYA 4MR8B 4A0SA 4RKFA 2E4AA 5EQDA 4LJ4A 3DBIA 3U61B 1BKDR 4RWEA 1U90A 3MAAC 1DQPA 1Q7GA 2BC9A 1CR2A 3DVSX 3P9QA 4QJ5A 5IDWA 2VQEB 3Q8KA 2QXTA 4FT4A 4F97A 4AKIA 5BN5B 3ZC3A 1UEXC 3ZDDA 1GPJA 3K2QA 3KZ1E 2WMDA 4EHLA 3N2IA 1J1IA 4P58A 5KQRA 1SVSA 2UYOA 3EPPA 1BMDA 3QXSA 3QE2A 2JGDA 1I5OA 3EOBI 2J9YB 1MO5A 3NM6B 4RXTA 2I71A 1XNRB 1JG1A 1ZGJA 4MUJA 3OKCA 4FQ5A 4OQMA 4ZO4A 3JZFA 3ZY6A 5JO0A 3RAEC 3ZJUA 2QVLA 2MMCA 2G80A 3R3YA 3WYAA 1JYSA 4Q21A 5F21A 2G71A 1PX0A 4MPRA 1P44A 4O2RA 5EJ9A 1DC4A 5CCXA 4AQYB 2Q0XA 1UXOA 1KJ9A 1H2HA 2ORIA 1EP1B 3P97A 2P3OA 1NATA 1PTJC 2VT3A 2GZ3A 2UYGA 3AR6A 4MQFB 1V4VA 4P4UA 3H9EO 3MWDB 3RYHB 3KZNA 3SXJA 4C4OA 2UYHA 2ONZA 1K7FB 2EJVA 3B20A 2HIAA 1RNLA 5ESRA 1AM4D 1JPVA 1FYDA 2XTNA 4GKAA 1UOOA 2A1UB 2Q5JA 4BN0A 1H93A 3WLPA 2C84A 5EIEA 1M34B 1GNVA 1KJJA 3CX8A 3ZW8A 2CVQA 2FJ0A 3CURA 3D6HA 3DDUA 421PA 1E94E 3QZUA 5TARA 4BWYA 2R8XA 4UNRA 4BV9A 3U4MA 1V7QA 1KI7A 2G9ZA 2CUNA 2XNCA 1ZX1A 3GLVA 4K1LA 2CUKA 4BB6A 4PCAA 5LIRA 2X6QA 1AB5A 2OG1A 2RARA 4F93B 2AJTA 4XFJA 2ID9A 5HGJA 1JECA 1Y4SA 1MO6A 3TZ6A 4PYJA 4GKJB 2BGIA 2R2GA 3F5SA 5DI3B 5L3QA 4ZRMA 4G97A 4U2DA 4RS3A 5I7HA 4OBXA 3V5NA 4Z9YA 1BWQA 1O8BA 3K16A 4R3UC 3WOVA 3LQYA 3QJ5A 2FSFA 2OZVA 3V1UA 5JJKA 4EI8A 3FFBA 4EO4A 4EVIA 3PQ5A 3DPIA 5SZJA 3UW1A 1DOZA 3M6MD 1JHXA 2ZRAA 2CK3A 1FYVA 1Z4KA 3N39C 3QYJA 1GA4A 4TRJA 5DTJA 2MR5A 4FWIB 2WU3A 1I1QB 1QUEA 1MG5A 1KK0A 2PRZA 4O4IA 3U3JA 1V3TA 4OPMA 4RHFA 4JUDX 4BWVA 5JD6A 1YE3A 3VR0A 2R11A 1ZGCA 3WO0A 1I4OA 1JEQA 3DAHA 1L8XA 1E7QA 1QZ3A 4AWAA 1Z74A 1BVHA 1NVFA 1P80A 2ZQZA 4DLYA 3FFAA 4GO1A 1TJNA 3DR5A 4OBBA 1YDFA 1TFRA 2BE9A 1KBOA 1A9TA 4CL0A 4KITB 2AS0A 2QYHA 1N2HA 1MOPA 1DWQA 3NOOA 3KYCA 1JYFA 1XTZA 3MAGA 3HCWA 4X1IB 3ABSB 1SBQA 4B45A 3REFA 1CQZA 2VUSA 1Q14A 4NECA 3HR8A 5EZYF 5HJ5A 3TF5A 4DSZA 2VJQA 2IH5A 3F97A 1KJ8A 2Q2OA 3E2IA 1LZKA 1RM3A 3EDMA 5H5JA 1W1WA 2BR4A 5CB0A 4OI2A 1NJ8A 3W9BA 4AXBA 2DMRA 1QNFA 3BUSA 4B2PA 1LBHA 5KTOA 5FO0A 5J2UA 3EMDA 2CFCA 2BTQA 3K8QA 1J9ZA 2WY2D 4R8MA 2QN2A 4GHWA 4V2UA 2H65A 1JFFB 2C96A 2C82A 4LPKA 2Y9MB 3CJTA 4RFSB 3V8QA 2CXTA 1NJSA 4RVGA 1JSRA 5EXXA 4W82A 3DZ8A 2GBPA 3GNQA 5E9JA 1N8NA 1Y6QA 3Q6MA 3WLAA 1NSTA 1K68A 2AOTA 1P17A 2FF7A 2BKLA 1FTYA 3BXZA 3I1JA 2FPLA 3KSRA 1M0EA 4V24A 4MUBA 4FNMA 1MDBA 3ILHA 1O4WA 4K7JA 1SQ6A 4S35A 5C1OA 3IQWA 2XA1A 5HCUA 5C4MA 1JHVA 2YV4A 2ZGVA 1RXIA 1SRRA 1AKYA 1RCUA 4D4JA 5EFZA 3VU1A 2ATVA 3W2EA 1DBWA 2X0KA 1HH4A 1XHFA 1JUDA 2J5XA 4RK0A 3E5HA 1IZYA 2NSHA 5JHGB 4HDMA 3CZAA 3P0EA 5JIBA 2PQ6A 1Y1TA 3NHSA 3ANSA 5EMMA 2R6ZA 1AZLA 1E7MA 4N01A 4IHJA 5BOSB 2RC6A 1TU3A 1X92A 2CL6X 2NVBA 5I48A 3DCJA 2XCLA 4GE0A 2ZJ1A 3TD9A 2EBHX 1JEAA 2P9YA 4H7IA 1Y6JA 3RT1A 2WNSA 5K0GA 3EMKA 3OEYA 2EGHA 2PL9A 3AW9A 4HXFB 3BXFA 3ZVMA 4QNNA 1MB3A 2P78A 2J9GA 2DQSA 3BRWD 5LYJA 2EZ8A 3EQ9A 1ONOA 3HKDA 1WABA 4NICA 1QIIA 4Z4GA 3E1SA 3NM4A 3RREA 4J90A 5BOSA 1M8JA 1N57A 3EYWA 3PUKA 5LR6A 1QHEA 2XADA 2YV5A 3T3PB 1F12A 1JRLA 2HXSA 3LLUA 5L8VA 2QJTA 5C1BA 1BX1A 3QV2A 1JQBA 4WFKA 1GT91 4B47A 5FB3A 2QRMA 3RIGA 2JJ1A 2VSQA 3B1WA 4FOSA 1H9CA 4DQLA 4O4LF 2FSHA 1XTRA 1G6OA 4R69A 4F3KA 1L4MA 1EGAA 2B5OA 1IBCA 2GLUA 2OD2A 4JLBA 1ML3A 4JYPA 4KWIA 3TZLA 4Z3OA 4UHBA 3AXTA 1DRUA 4Q4AA 2XE4A 2X0DA 1XRQA 3EWNA 4AP9A 5E6RA 1EWVA 1WS6A 3QVJA 1EXWA 4L2IA 3THOA 3ZWVA 4IEEA 4OATA 4S12A 3FBWA 4IGAA 2WAAA 2VZ0A 1XQ6A 4O4HF 3RG8A 1KO8A 1Z0JA 3AF1A 1Y9ZA 2YZKA 1QFZA 1OBFO 5B37A 3N70A 4OBWA 4DLLA 1P18A 4CIVA 3ETDA 5JQGA 2O19A 2P6UA 1ND5A 3ZUPA 2ZI4A 2IC5A 4OJTA 1S8OA 4JKOA 2I9KA 1R6VA 2LCIA 5F5XA 4R9SA 3GDOA 3LIIA 1T91A 2ZREA 4IUBS 4KWEA 5TRTA 2DHRA 1X7GA 3HLYA 4F4UA 1COZA 1HG1A 3GGDA 2XQIA 4KFSA 5E4JA 1B8PA 4MWTA 2KSQA