3VR6H

Crystal structure of amp-pnp bound enterococcus hirae v1-atpase [bv1]
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
TYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQNIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords V-type sodium ATPase catalytic subunit A
publication title Rotation mechanism of Enterococcus hirae V(1)-ATPase based on asymmetric crystal structures
pubmed doi rcsb
source organism Enterococcus hirae
total genus 28
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2012-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3vr6H00
2I4RA 2D00A 3AONB 2QAIA 4RNDB 5KNDH 3VR6H 2OV6A 4IX9A 3VR4H 3VR5H 5KNBH 3W3AH 5KNCH
chains in the Genus database with same CATH superfamily
1EAMA 2JZOA 1MNQA 1AQYA 3WIDA 5LYJB 1GITA 2JCBA 2HV9A 2P9CA 4BOYA 1DAFA 4MSUA 3A6JA 5BMVF 2W2QA 2O6HA 1GILA 2OCYC 3RJ9A 1JQEA 2ZWMA 3EE6A 1Z3IX 4DDWA 4G0MA 1UM9B 5AKLA 1HNZB 4L5CA 3EDMA 1IPHA 3PT9A 1KOFA 2XITA 3ICVA 3KAPA 2QYHA 3TLXA 3DEZA 1NFRA 4EFNA 5KVCA 2P69A 3CJTA 4FN5A 2OV2A 4HDCA 1SG6A 4AYTA 2Z5LA 1REQA 2HXSA 4F96A 1QDEA 5LOVF 1Z2AA 4X97A 2HBZA 4MLPA 1OBVA 2OAGA 2R4QA 4ICIA 3ZGYA 1MMFB 4MV5A 3S2GA 1VGRA 1XZFA 3UGKA 4EKIA 1V5WA 4DSAA 2NQ8A 5JCOA 3E9ZA 1UBRS 4B2PA 4BS9A 4F3RA 1SCDA 1UZAA 3BXGA 4F93B 3IVGA 3PXXA 2UXDB 5AW4A 3Q3HA 4DWWA 3O2JA 2K5UA 1XK6A 2ASEA 2DBRA 4UZEA 1Y3FE 4CR7A 1QYDA 2Y4NA 4I1VA 3EWSA 4YYEA 4DJAA 3I9NA 3GELA 2D2EA 3BREA 1X1RA 3TINA 1JBKA 1P18A 3GLVA 2WIDA 2YVAA 4QUEA 3T9EA 4Q03A 2J0VA 3C8DA 5MGBA 4KYTA 1B74A 4KQGA 3G2KA 3R41A 1LZKA 5AM1A 1C7IA 3CCCA 4HGZA 2WTUA 3P94A 5E4YA 2PSSA 1D09A 1MVOA 4ME6A 1N2CE 3RHZA 3ZWNA 5FBWB 5C1OA 2DLDA 1BW9B 1YIAA 3BSYA 4JBNA 1AHIA 2BBWA 3H0KA 3N2GB 1G2OA 1U9IA 2DC1A 1N3IA 1N6OA 1J22A 1P5ZB 1FFHA 3ESYA 3LL4A 2PANA 3TJZA 5DW0A 2IOFA 4BFZA 5IZCA 5I3CA 1TK3A 4P08A 3ACDA 1T26A 4BUJA 4CMGA 2AOUB 1GG9A 1Q83A 2B6NA 2HB6A 2Q5LA 4DCCA 1JIKA 1UPFA 2EFEB 2QRKA 4YS6A 1GUDA 1IUOA 4WX2B 3BDAA 3AF0A 4JHXA 2YDXA 4TTJA 2QUZA 5HS4A 2AN3A 3OOSA 4EG5A 3JQ9A 2G07A 2WUVA 2BTQA 4ZDIA 4AQYB 1BS9A 3LHKA 3OLYA 4KWTA 4NE2A 2AC2A 4MUXA 3DTVD 4MW4A 4DYVA 1VE5A 2BZGA 4JLOA 2HBRA 3NHRA 4P83A 3OZXA 2QW0X 3ZX5A 1AHNA 2JK1A 2VBCA 3IVAA 3I9KA 1T6NA 1UJ6A 1IXRC 4OATA 2PS9A 4D0GA 1GKUB 2X7HA 1FZTA 5DB4A 3X2EA 3L46A 3G9ZA 3UAYA 4W1SA 4IDAA 5ALJA 3DV0B 2QOEA 3K30A 1PWXA 1JX6A 1RLIA 2RIRA 4J1NA 4POAA 4TX1A 2J6IA 3ZZTA 2VXCA 1G7CA 2IYEA 3C3EA 2KJQA 1L5FA 4PLWA 5MFPA 2GEKA 3KUDA 1YZFA 5ALGA 3ND8A 2JI8A 2PSFA 4I81A 1AD2A 3R5TA 3OFJA 4Q7QA 1T4BA 3H4VA 3WDSA 4MRSA 3FR8A 1REQB 3DMYA 3E7XA 3N0VA 3RGGA 3TLCA 2FF5A 5C1DA 1W35A 5FUYA 2GN2A 4FBGA 2FCRA 4G5OA 4HNSA 5BPHA 2F1HA 2Q07A 3QXSA 4X3CA 5BV1A 5H4GA 4M9CA 2FMFA 3ES9A 1VMAA 1X1QA 4AKHA 3TR6A 3WGQA 1NRIA 4TKVA 1JG3A 2P3LA 5AJVB 1U2PA 4K9NA 2BN4A 1BEEA 3M4YA 1GNRA 4G1FA 5JYDA 1PJ4A 4QM7A 1IJFA 3PSAA 4R0NA 2ZRHA 1USUA 2I3GA 5AI8A 3PI7A 1U7TA 4ID9A 4QELA 2WE8A 1HDEA 3R4VA 4TLLB 2IZ6A 4PRZA 5HKKD 2OGUA 4OB6A 1RVV1 4ZVNA 3ZZ0A 1WWKA 2C99A 4KJXA 1QTNA 1CK4A 1G8FA 1RZUA 3SJ7A 1G9TA 2BGIA 3D7LA 5CDHA 5IN4A 1FRZA 1PZEA 4OYYA 4LXIA 4XGIA 1FXWF 3KXDA 1KOLA 2QTBA 3SQLA 1P5RA 4B6FA 2BUBA 3MSXA 5L3QB 3I61A 3UK7A 1ISIA 4XAQA 3A7DA 3E27A 1CQXA 1KMNA 1F8YA 2Z8ZA 2ZTUA 4TXLA 3WKAA 1EP9A 1ONBA 1SHUX 4GZ6A 1Z4MA 3KL2A 1P60A 1SXJA 5EMHA 2CFSA 4QBIA 1SU8A 4PHGA 4CQNA 1EKXA 4NZYA 1OV4A 3GBVA 4EVRA 1XU4A 3KZNA 3KOZA 1ELOA 1B15A 2BTQB 3T54A 3HKBA 1XRSB 3TH5A 3I5XA 1XCPA 3QG1A 1CUGA 1KH2A 2F8MA 3G8AA 4IGFA 2AI1A 3AGQA 3EC2A 5K3CA 5CHEA 1HOXA 1Z6GA 1IZ7A 2B4AA 3DLCA 3WRXA 3QY0A 1WXFA 5HJ5A 4JBXA 3HUUA 3UWOA 3AU8A 4LGYA 1M74A 1S9DA 2FZWA 2XVMA 3TCKA 3SFZA 1PL0A 4MITA 2BFDA 3GJZA 1PZHA 2PXCA 1NJSA 1MJGM 2TS1A 5DX1A 2WJWA 1TMKA 2ZUTA 1N2JA 1PZMA 2GHIA 4Q19A 2ALJA 2EYUA 5AXCA 4NY1A 1JT9A 3DWIA 4MWSA 1H6CA 4F97A 1E1RD 1KY5A 2HCFA 3VHLB 2GKSA 1V8FA 2XKAA 1V8PA 4GU5A 2R1TA 4H7PA 5E95A 4K1XA 4AICA 4K81B 3WIVA 4E5MA 1VLVA 3T06B 5JJBA 4FIZA 1XAGA 5F76A 4C21A 1S4MA 1XEFA 3FCSB 3JTEA 2IHJA 2VP5A 4UNQA 1KDYA 3H16A 2DHCA 1ESZA 1DUVG 5K3OA 1WMFA 4TKVB 2HJRA 3EYAA 2IK8A 2A8YA 2CGEA 1Y1KE 5T8KC 4PTYA 3V4VB 1JHAA 1P39A 3HNPA 5EJ5A 3JZDA 1IONA 1RAIA 4AYXA 1J6UA 3MOSA 1XTUA 2OXTA 2B0CA 1C30A 4FYIA 1YV9A 4MAMA 2N75A 5EUQB 1E0JA 1ODKA 3P9QA 2GF0A 3NPMA 2FMHA 3E23A 4OH1A 1YJQA 3H42B 3OZRA 3KXPA 5EJMA 3QELA 4MDYA 2GHTA 4RZQA 1PO7A 3IUEA 4OI2A 3OEWA 1WVIA 4BFSA 3EUEA 4D4LA 4ZO8A 1E6EA 2CDNA 3U44A 3DBVO 2NTEA 2V9PA 4D82A 4YK7A 1QK4A 4PONA 4WXMA 3LDFA 4II2A 3A4MA 1AF7A 1JU4A 3KYDA 2VXBA 5EFZA 1HA3A 1JNYA 3TGPA 4UM9D 4EJFA 4MQ6A 3OTIA 3WZLA 3AW8A 3DO5A 1SXJB 3NJ8A 3H5IA 1L7VC 1IQPA 1L7EA 5HPYB 4BNYA 3EIWA 1Z18A 1F4LA 5D00A 1N0IA 4ZWNA 1JAXA 3W2HA 3DJFA 3CLSC 3RYCB 3HKBB 1G38A 1XR3A 1LVUA 5JQGF 3GG2A 4LV8B 3SJAA 1MLDA 3HKCA 2H31A 3WLMA 2DHEA 4MWDA 3L8DA 5I7SA 4FC7A 2C8LA 4HSGA 3KFVA 4WVFA 4XD7D 4EGFA 5B3JC 2VZLA 3P1JA 3LZDA 5E1BA 5FQNA 4BQNA 3JAMA 2R6CA 5LQCA 2HPAA 3U09A 4BPBA 2GEDA 1UXJA 2ZI4A 4ZXPA 3QW2A 4YR9A 3ZHZA 2XMBA 3V7FA 3O4VA 5IM4A 5B7QA 5ALLA 3GNTA 1FB5A 1L3BA 1SG9A 3K9BA 2Y1DA 3N70A 3OF2A 4KYIB 2G06A 4PPQA 1IHXA 1YQEA 2YN0A 3JWIA 3TIXB 2O20A 1V1RB 3OIUA 3ZXIA 3O90A 3DOIA 5IXYA 3GDFA 1OD6A 1JVNA 1U65A 3F90A 2R1TB 5HIIA 3M2PA 4LW8A 4WNIA 1E94E 2A9KA 4W5JA 4IRXA 3T5DA 1VHDA 2HSGA 3HO8A 1KGDA 3K32A 3EGWA 1X87A 3BIJA 1YDFA 3ENZA 4BVLA 1C3OA 1SEVA 3LA8A 2P6NA 1PJRA 2ZBFA 3L4BA 2E55A 4Q93A 1Q0ZA 1XCGB 5G1PA 5ADVA 4Y2SA 9LDTA 2XF2A 3J7TA 4KO1S 3ROQA 3WWEA 2V4MA 1DRVA 5AW5A 3VNBA 1YA4A 3KAQA 1K1EA 4OU4A 1C30B 3D3KA 4L5BA 4P4TA 4MI6A 4H0CA 1CY4A 4ISBA 1XQ1A 5NLLA 3RAPR 3HU5A 3T7JA 4WZBE 1QFMA 1CERA 4LK2A 4OYRA 5E0OA 4MKHA 2Z2JA 3N53A 3QELB 4IZOA 4MIOA 4YFVA 4EI8A 1UFVA 2XT0A 1NZDA 4KOEC 3C8MA 3MUNA 4R83A 4AZWA 1EDBA 3FWYA 1BH6A 2XVYA 3CLVA 3BK7A 3IAFA 4LNAA 4DQVA 3ZDFA 5KWVA 4ESVA 3GQVA 3KYDB 2WSIA 1LDYA 3IESA 1XZEA 1I80A 1SRQA 4E1VA 1Z0IA 3BH6A 2W8BA 1AB5A 3FCOA 4HO1X 5ERYA 4RAOA 2Z6QA 2I65A 3C6ZA 4YUZA 3I3SR 5ER6A 3HB0A 3VVCA 3DKRA 1J0EA 3A1CA 4J3FA 4OHCA 4HFRA 3H5RA 4HVLA 4BZXA 2JD2A 2AJDA 4F5WA 3ZBQA 2QG4A 1T91A 1LBTA 2LGJA 1GZ4A 4NV0A 1A27A 1FS5A 1I2ZA 1T6XA 3HKCB 4GQIA 5C35A 4YALA 3AL2A 1CR0A 1K7FB 2FMXA 4X71A 5DULA 4BZQA 3JAKA 4EYSA 3PTZA 1CNMA 1CUYA 4EENA 2VP2A 3EXHC 2Q5QA 3DKKA 2JFVA 2UYGA 4LISA 2JK0A 2BFBA 2NTYC 2P2NA 2ROQA 3E9NA 4I5EA 3OPMA 2ZSAA 4JBWA 4NZPA 2VHTA 1Y81A 4YAJA 4UQOA 3CNBA 1ZJJA 1J1UA 4KSBA 2Q0SA 1T29A 4FWTA 4G0YA 2VHQA 1MOZA 1KYXA 1XLWA 4UXJA 4W5RA 1K9SA 3HSYA 1IEWA 3GC6A 4UHJA 3T52A 1DOAA 3N3BC 1E62A 4C87A 1ZIOA 2C9OA 3ILVA 3NCTA 2ZBRA 3DD1A 1FE8A 2JJ2D 3MNFA 3GFSA 1Q21A 1S96A 1Z36A 3D6UA 4U8GA 3WIUA 2NV2B 4DGQA 1OZAA 5CVUA 1KI8A 2QN8A 5CB8A 1N5KA 1C0IA 1K86A 3G1UA 4H15A 5FUWA 2IV2X 3UM9A 2F1OA 5FO1A 2OXRA 2LDXA 4GW3A 2Z3VA 1C3OB 3R0VA 4MEBA 2EBFX 2YFYA 4BC1A 2P9TA 2RCYA 2BBOA 1TZJA 2O1XA 5L7YA 1ADGA 3KQTA 2O3JA 3FYSA 5AW7A 1U0GA 2HU8A 5JG7A 5JAOA 1DKRA 5AJTA 4MS3A 2G80A 1JR6A 4KVAA 1XLTC 4C4YA 3COSA 1ZC4A 2PQ2A 3GEEA 3K8YA 4JOCA 3HM9A 3DBRB 3PB3A 5KHOC 5AHKA 4JEIA 4KXUA 1U7PA 4KQIA 4ZK2A 4DLPA 1SCBA 3IXQA 3Q9UA 4RFSA 3EBOA 3THYB 5L4SA 4CMCA 1WD5A 3M8KA 2PGIA 3KKKA 4UPDA 1TCVA 2ATXA 3KKQA 1EZ4A 4NBUA 3ZDXB 1ZM7A 4NAVA 2BGLA 2QVCA 4U00A 4Q4CA 2XJ9A 4MUGA 1J06A 1TYCA 1IWBB 1XJWA 3GP5A 4AKSA 1N9ZA 2IQIA 2JGMA 5A6VA 1ZD2P 2OLEA 4G5GA 3QA3E 4PGMA 3UJ9A 4MV8A 1T2EA 1KK0A 2G09A 2W8BB 4KOAA 3X2FA 1H1TA 5CXUA 2V7PA 4JB8A 3ICOA 2JJ1A 1KJIA 3KT3A 1Z5PA 2GCPA 2H0AA 4FW9A 4HNQA 4KXVA 3ZS9A 2NO1A 4XLZA 4D9MA 2LBPA 3OO0A 5M3BA 3OE7D 3UHPA 1RKQA 1AQNA 4FMDF 3DMHA 1ECFA 2UYOA 1RD4A 2RC6A 1DHRA 1N6IA 2RBKA 1YR8A 1CUHA 3U1VA 1A9XA 2ASVA 2WNIA 2IEAA 3M6FA 3ITDA 2BD0A 4MUEA 2CSUA 4MAFA 4P7KA 4JT4A 4Y2PA 5TGTA 3JAKB 2KS6A 3VJMA 5E6RA 3SR3A 5FUXA 3JVEA 1Z12A 1UOQA 1GV0A 2F90A 1SRRA 1AUXA 4OK3A 2OBFA 2BFBB 5CAEB 3PHBE 5AJYA 3ZEIA 4AUKA 4YCCA 5CB0A 5FBVB 1AUOA 4B7XA 2D0PB 4KFCA 3IJRA 1IBKB 1KWKA 2X9QA 3IEUA 2WC1A 3OMWA 4IEIA 3SXJA 1ZMBA 4DS3A 5FX2A 2RD2A 2PUHA 1HT3A 4JB0A 3OCXA 3SOZA 4UHHA 3VU0A 5AUPB 2J5QA 1H6DA 2J0EA 3E8SA 4UVGA 4H27A 3DTVA 5IMBA 5GPBA 5LQDA 5LXTA 5EHZA 4QJ3A 1PFGA 4TWJA 3SC3A 3VJKA 1S3FA 4B3CA 1KVSA 4HV4A 1Y4ZA 1KEZA 3H3XA 3K05A 4LZPA 4O25A 4F45A 5A5DA 3I5AA 1D2CA 2EKPA 2HU5A 3UKDA 5JSZA 4F3NA 3W1WA 2HI0A 4OQFA 4FK8A 1BXZA 2PMFA 3IAM6 1EZ1A 1PKEA 3RUDA 5KX5A 5J4HA 2X0RA 1ZX1A 4FW8A 4INJA 3P26A 3L3BA 4IQGA 5G0SA 1J0AA 2ENWA 2J45A 4CG2A 3GVIA 1VIYA 3G2HA 1VXRA 3T4UA 3IUPA 4I4TF 5HA5A 4KFRA 5JSFA 4AF8A 2ARKA 5CVEA 5LR6A 2FJPA 1HDZA 3LLVA 3T7KA 2I8AA 2AX3A 4RFSB 1J25A 1ULAA 1ST2A 3CQ9A 1OREA 3EVAA 3GEHA 3JW8A 1Y33E 3MTIA 2C5FA 1IQ0A 1T8WA 2VLBA 3H83A 3TDNA 1T2DA 1AJEA 2ANBA 4URFA 2EJCA 3UY4A 2BDUA 4XUDA 3ORHA 3TPFA 4ESOA 4BNLA 2A9JA 3D43A 3GUCA 4FDUA 3UMJA 1XZAA 2OSBA 3HA7A 1NQAO 4XFJA 4D4HA 2ONZA 1P7CA 2IUEA 4MP6A 1IVSA 2ZB7A 3SSAA 4B4WA 4MGHA 1I4DD 2VJYA 4RHFA 1NMZA 4I1UA 5CP8A 3S1LA 4DE5A 2Y1FA 1DRJA 5LZ7A 1SM4A 2AMLA 2MU1A 1KNXA 1M8GA 2HXYA 1NSYA 2LUOA 4F21A 1E5XA 5HKKA 3DEFA 3NGLA 3L7AA 1KH3A 1PNQA 1YUBA 2QX6A 3D02A 4G4JA 2CNBA 2YYAA 4QO8A 5E9AA 3RRBA 4BVEA 4Z4CA 1X9HA 3QXCA 4ZMSA 1A9XB 5IJXA 2K2QB 5BUSA 2JHPA 1PW7A 2AG0A 2RGYA 3QFFA 4U7PB 3JYHA 3ISVA 2P2DA 5DYNA 4MGKR 1HPLA 3CRQA 3VGPA 5E6RB 3X1YA 5I7VA 1TTHA 2I33A 1C2YA 3E3MA 3HCFA 4KHZA 2XCRB 3J7AC 3Q2KA 2R7NA 3AVOA 1X7HA 3IDSA 4QHTA 4ZCQA 5TS3A 4DG9A 1E3QA 4QU0A 2DB3A 4F5YA 3A0RB 1KFCB 5H3CA 1TAUA 1X80B 4JLBA 1HDCA 4ZCMA 1TM2A 4G1VA 5THXA 6Q21A 1IJEA 3JQDA 1RAEA 2PGNA 4QXPA 3TRDA 4LUCA 4Z3KA 1D5CA 1VRVA 2VRCD 4LC1A 1KVTA 4DAEA 5LXTB 3DTVB 2C0CA 1ULZA 2ZRAA 1NQ5A 3Q7TA 4EF5A 1PS8A 2H2IA 1LJLA 2TMDA 3DEIA 2PEZA 4C7BA 4C6TA 3HG7A 3HKEA 5H59A 3R3WA 3COWA 4ZODA 4IH1A 3ABSB 2EXXA 1E2UA 4XQ0A 5JADA 4MRPA 1U2SA 1HKHA 1IWPB 4CMKA 5JSZB 2O57A 5L7WA 4O0LA 1EEXB 2I71A 3MCZA 4WCFC 3AF5A 5KX5B 3ELBA 3ZJUA 4ZOBA 4P32A 5EXXA 1KDOA 4PYJA 1M2WA 3GBSA 5GOZA 2R8PA 4MTLA 1SPXA 3W05A 1X1DA 3QQ5A 4LV6A 1K2WA 4ND5A 2O0LA 1PJLA 4XGNA 4ZHQA 1WLSA 1E1RA 4LJ9A 2X8WA 3I6YA 2I4LA 3QXJA 2W42A 1YGPA 4MVJG 3G9QA 4HWGA 2BP7A 5BNIA 3HJRA 3Q6IA 3R3HA 4QRIA 4G4SO 4CM1A 4JI7B 3Q8XB 1GKIA 1HKUA 1CZLA 2JI6A 4LPSA 3OURA 5C3MA 1NQUA 2JFUA 2C1ZA 2EZTA 4IV0A 1BMFD 3IUNA 1G2PA 5EJAA 2WQ7A 4AJNA 2BZSA 1HETA 3A36A 5K0FA 3ZZMA 1PT9A 1M73E 1PU2A 4YPFA 4DCMA 3GGSA 2D8MA 3CKKA 3FNFA 4WK0B 1R8JA 3R0ZA 1U5CA 4Q37A 2VQEB 1JSRA 1S5PA 4ND6A 4ALIA 4LRUA 4NKRA 3ZVKA 1KJZA 2JGNA 3PQ5A 2IS4A 2FH5B 2RFLA 3HJHA 5DNUA 1IG0A 1CJKC 1FFGA 1GGKA 1MD9A 4W5NA 1DLIA 1P4AA 3Q7EA 5CIYA 4RTSA 1E60A 1A2OA 1KE1A 5ITWA 3I39X 3UGTA 5CGZA 4Q66C 3AKCA 4Q3EA 4HBZA 2XUZA 3A7EA 5KPJA 3DO6A 5JNUA 1LSSA 5HOEA 2GM5A 1JR3D 1TM1E 1MENA 1P44A 3DMRA 2HY7A 3FVWA 2Y6VA 1CB0A 2EFGA 3DHYA 4GGMX 3B2EA 2H1OA 4RANA 2Y0DA 5ICFA 3QKSA 1UOPA 3D5TA 3FCCA 3HB5X 4F1KA 3KQKA 4D25A 3D0KA 4OO3A 2PJUA 3CEAA 2PYDA 3GPDG 3PEUA 2IU3A 2OXCA 2ZYSA 2FN3A 1KWGA 4D3FA 4UZFA 4BPRA 1PN3A 4N0QA 3I09A 2L17A 1JJBA 1KAQA 2FGJA 2YASA 3HVHA 4P1ZA 4ZQCB 3RADC 1GNQA 4A4DA 3QLUA 1Y3CE 3C1OA 1TTTA 4HGPA 4LC9A 4G4GA 1H93A 1LQ2A 4FN4A 2GDJA 4UUQA 3HKEB 4XD7A 4HRAA 4MA0A 4FJ2A 4C6TB 1QIKA 3NAZA 1HWYA 2PCJA 2GZHA 4JUAA 3PPVA 1FNNA 2NXCA 4HQRA 4YLGA 1NM5A 3NTQA 5AKKA 5SY6A 3VNRA 1FP4A 1P1HA 5FLXA 1UJMA 1X3LA 5HCNA 5CA1F 4Z6KA 5C8ZA 3FA2A 1X86B 2ORVA 3W3AD 4BNKA 1P1RA 2DZDA 3B5EA 3KZKA 4OQNA 5F51A 3RO7A 5FAKA 1J07A 4CKYA 3NONA 1PFUA 5J4YA 4ZHQB 4DQUA 4QQ8A 1UP6A 4A8HA 4PQFA 4FYJA 2VTDA 2H7CA 1KDRA 2BP7B 2IX9A 3S8MA 3EMDA 1DBPA 2CEAA 3WOVA 3MPOA 2EBHX 3M1IA 4MB6A 4Y6PA 4Z7NB 1BA3A 2HN9A 1NT4A 2M32A 3B8HA 1UXKA 4NE9A 1BKDR 1JYEA 3CH4B 4C3ZA 3DCYA 4M8IA 3E9MA 4QQKA 5HKLA 2GWRA 4KPFC 3WYFA 1RAAA 3K9QO 3KKMA 4B47A 4D9CA 3P4UA 3SC4A 3Q88A 4EF6A 3A3OA 4K40A 5CR9A 1SCJA 2AR9A 1WDTA 3TOSA 5B6IA 3ZHCA 2YJ3A 1VC2A 3V4PB 4WZAE 3OT4A 3R9XA 1XLUA 3U4AA 2QQFA 3AUAA 2MYNA 3IVRA 1KHTA 1YNOA 1U0NA 4N3NA 1DZ3A 3WYDA 1Y9DA 1DT5A 1NJFA 1B6RA 1NNUA 5TT1A 3RYTC 4JOBA 4H77A 4RPHA 2P2YA 1VLLA 4RA6A 3VX3A 2AMFA 4UAVA 3AZPA 1QNFA 3F67A 2B3DA 2C3UA 3GG9A 4N5LA 4UEQA 4M8KA 2VT6A 5JD3A 3RC2A 2WYHA 1JWLA 1PJTA 2IYWA 2CJFA 2GZMA 2ZRMA 3G0OA 1TEHA 2VDLB 3QKSB 4UM9B 2CNLA 2CL7X 3NOOA 4EFMA 4QG7A 1DPGA 2CHFA 2C4KA 1D3AA 3PC8A 1KO4A 4HKTA 1H5QA 1NZFA 3IGFA 3P0FA 5EJGA 3T3EA 1JEOA 4QYTA 1U81A 3PFGA 2BE7A 4O4IF 4UFOA 2HV8A 3ROZA 1DUSA 1T9KA 4ATNA 1AM4D 4EYGA 4IGKA 4KMSA 4V1CI 5J2UA 1TAGA 3J81A 4L3WA 5HFAA 3REFA 1QWOA 4XWGA 4BNJA 1GQSA 3CLUC 3G0BA 2Z2YA 1JMYA 3GF4A 3EODA 3JQGA 3CX3A 4UUMA 4F3CA 4WBNA 4W5OA 1PJAA 3L6CA 2KBFA 2LKCA 3BHIA 3N8GA 4FFNA 5KQGA 4JR1A 2O07A 5BMOA 3VTFA 3LXXA 4INZA 4EPTA 1SK9A 1YE3A 2GZ3A 2QRVA 5LP6F 2CY0A 4ZTUB 1FP4B 2XR1A 1UFQA 5ECYA 2HRQA 3K2BA 4OA5A 1N0UA 3F4KA 2PRKA 2W43A 3ZKAA 4BMDA 4DIEA 1XVIA 3CSSA 4HAVA 4E1AA 3ER9A 5EGSA 4B3SB 2ZJ0A 4GHWA 3AO0B 4W1PA 1YZUA 4UMDA 3RTCA 2IPXA 2G9QA 2P11A 3RTBA 3OCWA 3UK6A 1MU0A 3A9VA 4PBRA 5E4FA 1XL0A 3EFEA 3MM4A 1XZIA 3AETA 3AIOA 1MA0A 1WTCA 2JJ2A 3IP1A 3NVMB 5KYVA 3ZQKA 2BJVA 3OPYI 4G9EA 2W48A 2VQDA 3U3KA 1E7WA 4I1IA 1K4KA 1L4KA 3CW2A 4HPWA 4BTEA 4K6FA 2JI4A 2CSXA 4YRGA 4BNIA 4D56A 2NQTA 3ZCXA 4COOA 1C14A 4XWWA 4U0JA 3TQTA 3B1YA 3AM1A 5B53A 3KUUA 1OLSA 4R1LA 3Q1LA 6LDHA 1FVOA 3ZR4B 3UJ8A 1K3UB 3WLPA 5KU1A 2WA1A 3R9XB 1EVZA 2RHGB 4BO1A 3O8DA 1UFRA 3V55A 1IWOA 5BVHA 3C4JA 2RHCA 2GZ1A 4ZO6A 3DP7A 4UBKA 5C81A 3CNEA 2GETA 5JVDA 4BO8A 3VUFA 1AT1A 4X6XA 4Y0AA 2Y99A 3EEYA 3PX3A 5BUQA 4I50A 5C1PA 1QZZA 5KTNA 1F5NA 5EKXA 5KC8A 1CDZA 1Z0KA 2ZVJA 3OUZA 4JWTA 4AJ2A 3E7WA 2ZIZA 4H35A 5A4DA 5IF3A 2QLMA 3GVCA 1C7EA 3ZE2B 2OG1A 5H02A 3ZCVA 4K8OA 3WFZA 1M1XB 3ASYA 3LUAA 3WRYA 1CY0A 2Z08A 4INOA 5EVCA 2YVQA 1QSGA 3KPWA 1U7HA 4JLMA 2PXXA 2V58A 1YVRA 3OE7A 3PQFA 5F4BA 4OQQA 2I7DA 3JZFA 4L0QA 5J2UB 1VI2A 2J08A 2WYVA 4PFSA 5F77A 3JQGB 4BE9A 2X0EA 3LCJA 9GPBA 3ZY2A 4WBNB 4RE6A 2NNWB 4WADA 2JCYA 4WN3A 5A5FA 1OOEA 5H9VA 2KBEA 1QLJA 1SUIA 5GJWC 4G5QA 4NHOA 3CF6R 4GP6A 1TA9A 1XF9A 3LV8A 2QRVB 3QU4A 1U4NA 4TV9A 2QZSA 4PXAA 4UPVA 3C7KA 4EG3A 2VJMA 1MT3A 1P2SA 3AF4A 3DC7A 3GGOA 1JXAA 1PYDA 2GPTA 1WVGA 1B41A 5BQFA 4EM6A 2Q5OA 3DAFA 4XH9B 2YHBA 2G9ZA 5HFJA 4R84A 1RQ2A 1K88A 1F1BA 3V2GA 5G40A 2BYTA 5FLYA 1GRVA 5EY5B 4X54A 2BFEA 4HB3A 1JIUA 4JI0B 2FX3A 1NLFA 2A0WA 4PYOA 1NY5A 5COQA 4U4AA 3IXLA 4WA8A 2ZTSA 1E58A 3BOSA 2Y1OA 1FNCA 3CIFA 3FNIA 1KYQA 4OQPA 3ZVMA 2W11A 2HNBA 5JAUA 2R11A 3E53A 4HNAA 4BRSA 3HY4A 4RD2A 2OV6A 2C5HA 4L8WB 1CZHA 1A5SB 1C7RA 2ZVQX 1OLSB 1UJ5A 1G9XA 3WICA 4O4JA 4RVCA 3I72A 4GNRA 4DMLA 2DOKA 3IO5A 3K5PA 1P5JA 4II7A 4H6WA 4YBRA 3UJPA 3V8PA 3X44A 4HC4A 1I0IA 4DR3B 5BVHB 2H9IA 4MDEA 1E9BA 1O9GA 3RFFA 3FPJA 3OOJA 1GRRA 3MMSA 4X1OA 3ZV7A 4DG5A 5CDSA 1RJGA 5JVDB 2YWCA 3P0IA 4C4TA 4CTOA 2EL9A 2R8ZA 3E7PA 3HYNA 2Q3LA 3KJGA 3LFHA 1JSXA 2DKOA 4MW6A 3UAZA 4W82A 3GFQA 1LKZA 1GYRA 4C6SA 3B3AA 1FFEA 2D4HA 4OQXA 2I78A 3ZOKA 1YBVA 2VHWA 3KR0A 1FFCA 4D45A 1TJ5A 3LKVA 3OIFA 4X1IA 1VHTA 4OAQA 3VZDA 4EY3A 2OHFA 4KN8A 1QAQA 4WUVA 5DGXA 2XTZA 3Q11A 3JQ8A 2PZFA 6GPBA 4B6RA 4RWZA 1P3JA 3TOCA 1PWHA 4K8RB 2NP7A 4JBLA 2XZPA 1E3DA 2VQFB 2OB1A 1DKMA 4WLUA 4M9QA 1JE0A 1IN7A 3KHKA 5LZ5A 4ZO7A 3PC3A 1PNOA 2QL9A 1GCIA 1GQFA 1LVHA 2V7GA 4MV4A 4BV2A 4CFSA 3ZG6A 4DLUA 4Y1RB 3RVKA 2NZJA 4ONEA 3R7WA 2J9ZB 2NUTA 3VR5D 3ZE1B 1ZMTA 4G9BA 2HUPA 1H4SA 3GJXC 2Q27A 4TV9B 4BEBA 4JFAA 3MA0A 3GH1A 3WL7A 3BXHA 2YY6A 2VJMB 4XD2A 3PF8A 1K5GA 2E4WA 2EFYA 2NXJA 4E7PA 4PFKA 3P4XA 7GPBA 2PFGA 3HBFA 3L4SO 2F9MA 2WE7A 1OFTA 3DFFA 3IAM1 3P0EA 4TQ9A 5TVKA 1YULA 3B38A 3O3NB 1P80A 4JJZA 4L8YA 2VDWA 2VRCA 3G2MA 3PA8A 4M1KA 1ZISA 1TIKA 1G3IA 3MJSA 3UA3A 1RLTA 1Q0PA 2HUNA 4HF7A 3ER8A 1SBNE 2HHJA 2BFEB 1RYMA 2JAPA 4B2LA 3KTAA 3LWDA 4KPGA 4DA7A 3WLHA 1XMSA 4I55A 1B76A 2X6RA 3C7CB 3KQSA 1OTXA 2R2GA 3L6OO 1SK8A 4DPMA 2MMCA 2HJHA 3WL8A 5T67A 1HNXB 4YCNA 2XHEA 3OJEA 3UW1A 2P4HX 1DCTA 3QHAA 4I6JA 1J1ZA 4HNAB 2P35A 4RA9A 3V34A 4LWOA 3ZDQA 1FUKA 4CG0A 1TVEA 3A37A 2QMQA 3AEQA 2ZU6A 4FMCB 4BGIA 5ECGC 3BWCA 3RRZA 1EE9A 2F43A 3DOOA 3JYOA 4Q3NA 1MQ8B 3C6BA 2FG6C 3CF4G 2QK4A 4O4JB 5ICEA 2IOFK 1R0CA 3L07A 4EYQA 2XBLA 4IICA 3FNGA 2V6BA 1T6BY 3MT8A 2LP4Y 2WHPA 5FIUA 4CF6A 5IANA 4XM1A 1J0BA 4HHEA 2C54A 3DV9A 3BD8A 1D2AA 1RBZA 1ZEJA 3DTTA 1NW5A 3LX5A 1U5AA 2O7VA 4EJ2A 4JP8A 3ZI0A 1QKJA 2YFHA 1KVQA 4F06A 1THGA 2GB4A 3WLFA 5BXYA 3PPXA 4PC2A 1BMFA 3L01A 1VI6A 2YMQA 2P62A 2Q7OE 3TRKA 4B9AA 3JWHA 1USGA 4X1IB 2QMOA 3TLKA 1ZNZA 1O94C 2VSYA 2I1WA 4J43A 4PQEA 4B87A 5EMKA 1AKRA 1TMOA 1G0OA 5K1ZA 1RXSA 3JQ8B 4X41A 5SYNA 3U0VA 3VA7A 1Q92A 4YYZA 3KQOA 1O1YA 1TB4A 1PG2A 2FEXA 3SDZA 5IWCA 4C9BA 1CVLA 1GTSA 2MJLA 2PV7A 1CY2A 5DHPA 2VUHB 3AHHA 3DWEX 3NDRA 3PENA 3HM2A 4U39A 4ZT5A 5L51A 2HCBA 3RFUA 3IE0A 4OB7A 2VDUE 2I2AA 2QPTA 1JR3A 2VYFA 1P1IA 3HS3A 2XOEA 2G83A 5FO0A 2WJ6A 1LBQA 3WGUA 2NUTB 1G3RA 1T13A 1T15A 2J3IA 5FQOA 3V4SA 4EUEA 2DYKA 1O0BA 1A50B 1H9AA 3QF7A 3LX8A 3MBIA 3HL0A 4GRIA 3GA0A 1L5LA 3G6WA 3P9YA 5JXHA 3QVTA 2F8SA 1EQAA 3BJMA 1OROA 3W5JA 5KTOA 3I9OA 1K7SN 1YBFA 1N6NA 3LCCA 4XI9A 1M34A 2FEKA 4N9QA 6ADHA 2IYAA 1K6EA 1E0DA 3O3MB 5JAPA 5LDGA 2J9FA 3DULA 4OOFA 1ODCA 1Z38A 1RJFA 1E6LA 3ANXA 2OCDA 3KTAB 4S0ZA 2GF9A 4RAQA 4I55B 3AEKA 3PCXA 4NBRA 4LAFA 4ZPJA 1QKIA 3S0JA 3JZMA 5BRJA 4CKWA 5J58A 2OP1A 1WBJB 5HE8A 3RTAA 3T7SA 1YTUA 4RA9B 1VE9A 5LQAA 1Z0UA 1K7YA 2L2QA 1F17A 3HMKA 4YFYA 1SHLA 2PLWA 1Q22A 5ALHA 1SFRA 3TZEA 1UPUA 3AEQB 3I1IA 4AP5A 3GRKA 2RHJA 3W3AA 6PFKA 2F43B 2ID8A 3LFTA 3FCUB 3BEOA 1B0AA 2F8LA 1OAOC 2RG7A 3GPBA 3D6FA 4PO8A 3G5MA 5AESA 1E6KA 2WR8A 4HLDA 1WULS 2I4MA 3EUFA 3KKZA 1KL7A 2WHPB 2X76A 3M5DA 4M36A 1BRTA 4AURA 3SS7X 4YEDA 3N58A 4FOTA 1U3FA 3PQ8A 4F1JA 5CLLA 1F2VA 2D1TA 2VYND 3I8SA 4TROA 3V4LA 1AKYA 2L18A 2MTBA 3OFKA 4LKOA 1J39A 2NO4A 1U90A 3H87A 2YICA 3GFBA 1SZPA 2ADMA 2Z3WA 5L6MB 2R7MA 3T5MA 4RTPA 3D5EA 1MVNA 3WBJA 2J6CA 1PI3A 1P2DA 2C58A 4CF7A 3E9DA 4ZCIA 4WASA 1OB5A 2JLBA 2NO0A 3BB1A 2H5IA 1FFDA 3EZ7A 3KR1A 3LVRE 3OU7A 3QUTA 2HD4A 5LNK1 1N2BA 1NBEA 3N8HA 1UFKA 1XRLA 2RHRA 3BILA 4LBWA 2XRFA 4N8DA 1CF2O 3ZCSA 2ONKA 3FGZA 3ON5A 3WQRA 2Y3IA 5K8VA 2QW1A 3MRSA 4PHTA 4ZVOA 2R751 1MA3A 4FX5A 1GPH1 3PNQA 2Y1LA 4G37A 4Q1AA 3U60B 2H63A 1MAUA 3RKUA 2YJTD 4PYMA 4RJLA 5BWNA 2HRZA 2VP6A 1IUPA 5IKEA 3D5QA 1E2BA 3HYLA 1KYIA 4XTRA 1N7IA 2VWPA 3BULA 4IJVA 3UAGA 1EK5A 4ZI7F 5TJHA 3QV2A 1WEHA 4J03A 1HL7A 4Y2GA 1OLOA 7ABPA 5KS2A 4FS3A 3TSCA 1BE8A 3A4NA 1JQKA 1P45A 2AJBA 5I9TA 1GADO 3VZQA 4IJKA 3NH9A 1P7PA 4BZWA 3HBMA 3F97A 1M34B 1ST3A 1PYGA 4KX5A 4QFBA 3UC5A 2J4CA 5HP4A 1RTTA 3ILXA 4DRZA 2GD2A 4MMYB 5JXGA 5FWDA 4JJKA 4A92A 2QL7A 4J9VA 1KI2A 3EQ9A 1U02A 2RGCA 2TMKA 1RM0A 1QP8A 3NVAA 1U8ZA 2P9HA 3F5MA 1LEHA 3OIGA 1YBMA 1GKYA 3CSDA 3GIWA 1IY1A 3BEDA 1XN1A 3OF5A 2I0FA 3N0TA 4F9GA 5K05A 1K0FA 4CKWB 1OMOA 4W5TA 4LRYA 2PR7A 2ZSJA 3LU1A 2NSYA 1QG0A 2RHMA 4DZRA 3MWLA 2ZTMA 5AVWA 4M54A 3SIXA 3TZLA 2HCJB 1X77A 3PR3A 1JJAA 1SKYB 1XZQA 2R6GA 3D0RA 2NLOA 3W3ZB 1U0OC 4Z9YA 3ONFA 1P19A 3MB8A 1J0CA 1NW9B 4UTPA 1BN7A 2R8RA 3N05A 5T7BA 4IHJA 5CT5A 3HXOA 2CFCA 5BYKA 3TQSA 1L7RA 2L69A 4ETMA 4ER3A 3QPBA 2JD0A 4GKBA 1YR2A 4K1LA 4JUDX 1JNXX 4MV9A 1NXQA 1SKQA 1U7ZA 2VF5X 3SBDA 4BBAA 4DSNA 2YFKA 1BG6A 1DSSG 4FHDA 2HK8A 1YR6A 3MUEA 1PFYA 3GYBA 3OG9A 1XTQA 3I2HA 1H4QA 2JLVA 4C08A 1SXPA 1NP7A 3PUXA 3OA0A 4B17A 2AUTA 2VP9A 5HHTA 1TZCA 1ODFA 3D4OA 5M29A 4MA5A 1KQOA 4CUJA 2VHYA 4BKPA 1NGSA 2GPAA 4OJQA 4UVHA 4D6PA 1VG0B 1Y4AE 2D5CA 2HCRA 3AF3A 4WESA 3KJIA 1M2EA 2M98A 4MJLA 1QRAA 3O95A 4EAAA 1N2OA 2YXDA 2REBA 5DISB 4QT4A 3NHWA 4MS4A 4CU2A 4Z3OA 2V96A 5I9BA 2CLOB 4YRIA 3VO1A 2IPNA 1KEUA 4I6GA 1MO2A 2PV0A 2UAGA 2WUGA 2AQKA 2COEA 2PX8A 2VUUA 3NWOA 4L3OA 2Q6LA 2ZR9A 4ZVMA 4ZXFA 1KIAA 2IYOA 3L1UA 3HCBA 1YKFA 4ZJUA 3OHMA 1Y7PA 1VMIA 2FW1A 3W5VA 4CFYA 1GTZA 5FBQB 2W2XA 3AK4A 1ECJA 3NYIA 4XEUA 3DEJA 2RH5A 4PAGA 2C94A 3E2IA 4C07A 1ZD8A 5ALZA 1MJ5A 1UWKA 1E2EA 3ADDA 1C3JA 1LSJA 3MTJA 1EX6A 3LRTA 1RM5A 4RM3A 4DA8A 2J5XA 3B7WA 7MDHA 3P2OA 1VJDA 4RJJA 3WGIA 3DBOB 5A9TA 5BSVA 5D5HA 3SGLA 3QVJA 5LIPA 4Q6BA 4CLDA 3LUFA 5IARA 3HDYA 2PX5A 3BUSA 3A9SA 1NSFA 3PE6A 1Y6GA 4MJXA 1JJ7A 1VMKA 3GJ6A 2XYGA 3QFRA 4JGGA 2BKUA 1T0UA 1X7ZA 5G0WA 4A9AA 3W9BA 3VRHA 2YXBA 4MWBA 3SXPA 3L6UA 4CMIB 5KKNB 4D9KA 1P2BA 1FFSA 1D1TA 2M1ZA 3HGQA 4GRAA 3EEOA 1BOOA 2OT3B 1KETA 4IHJB 4P38A 3T9DA 3ZCUA 1DHTA 3PDWA 4LV5B 4OIFA 4TVOA 3OWHA 1PR4A 1Z17A 4V24A 4WLOA 4C0XA 1A76A 3M5PA 1EGAA 1ZI6A 3AI2A 4WNCA 1UQTA 5ENVA 3PXUA 3B8EA 1VP3A 5AVTA 3FDJA 2ZULA 1K8XB 4CKBA 3DVSX 4E2WA 1B6SA 2X58A 4H7EA 1IM2A 4D99A 1GLNA 3H0CA 3PQDA 5A1JA 5SV2A 1O4WA 3H8SA 5I4KA 2BI4A 2AJLI 3KX2A 1Z6TA 2XGSA 1HDOA 2XV1A 4P0TA 1KY3A 4HFMA 2HTEA 3MWEA 2QL6A 2XIJA 5H81A 4WESB 3RVQA 4X62B 3SHTA 2A67A 1R64A 2IHVA 1YJAA 3ND7A 4UMVA 3UHAA 3B6KA 5H68A 1RZRD 4GBJA 4MS4B 3VTZA 1IJBA 2PL1A 2EJBA 1LF0A 5BNTA 3I6QA 4C4PA 2R00C 4UD6A 4WTOA 1P9NA 1IAQA 5KDDA 1J90A 4MYHA 1U98A 2PBLA 3PNBA 3V1LA 4P7BA 3L1VA 4Q3DA 4K9KA 1CRWG 1RI4A 2AC4A 1ISRA 2P9YA 4RSHA 3PUVA 5T8KA 4AZ0A 1AQJA 1JR4A 4QVGA 5CXQA 2EP7A 3GGCA 4E03A 3H1FA 1NQVA 2P3QA 1F0KA 1G21E 3PUIA 3NRCA 3K1AA 1MFPA 1SQ6A 3K94A 4Q7EA 4WNYA 4S35A 4D3XA 2QU7A 4ARSA 4TXHA 1ZGAA 2PKQO 4RGVA 3UB4A 3AMVA 7YASA 3Q5EA 3LM8A 3ND6A 1C8KA 2VNAA 4A7PA 4KR0A 1JIIA 2REQA 4Y67A 4NYIQ 3WMFA 4ILEA 4A16A 5C9ZA 1KAOA 3M4NA 1SUBA 2LWIA 2P2GA 1JF8A 2P65A 3HXTA 4MAAA 1SEPA 4PO9A 1UWCA 3TLJA 3KSRA 4MWZA 4TOIA 3U6BA 1YAHA 1ZGBA 2O1SA 1K92A 2O8EA 3VR5A 1X7ZB 1WNTA 4QBHA 5FJJA 4F4FA 3WLLA 1YJBA 2QRPA 1Y8QA 3NWPA 1HE2A 3NB0A 4GPTA 1OLXA 1OWLA 4O02B 3WB1A 3R0XA 2Q28A 2JAOA 3IOCA 3TMAA 2C4VA 1GLVA 3A6LA 4LRWA 4D6YA 1RWOA 1C41A 4J0QA 1FSFA 3B5IA 4PF1A 5HFNA 1IHYA 1TYEB 2G9VA 5GADl 4YASA 4RTMA 1S02A 1HSZA 4HGRA 1QG6A 2F3QA 1V48A 3USZA 3WLEA 3PFHA 4X84A 2BBSA 1CUZA 5KREA 1KEEA 3NUZA 3VR6H 2IELA 3ZX4A 5B3JA 4Z7JA 3VBEA 2CVOA 2ZRKA 1CE8A 3AFHA 4V0KA 4MW0A 4CLXA 1EPUA 1MBZA 1RXEA 4F3KA 3AIMA 3OTOB 3SVTA 3ZLBA 3WB2A 3P96A 4MRNA 3ZJ5A 4G85A 4CKBB 1IATA 3LKDA 4C0AC 1R9MA 4LXGA 2O19A 3LQKA 3KJXA 1W6UA 2DKNA 2F00A 4FOOA 3EDCA 1H8HD 4IVRA 3W7VA 3WGTA 4Q34A 4QOSA 1MAWA 3CW9A 1JH9A 5J3JA 1YRWA 3TEFA 4DCGA 3MWEB 1J2JA 2PUDA 1Z13A 1Z4QA 1ZD1A 2HWWA 4BB0A 1KRXA 4A6DA 2PCLA 2ZSKA 2E21A 3COPA 2Z9DA 3PDIA 1CJSA 4B34A 4ZC8A 1SUPA 4EJSC 5AW6A 2JFWA 2E5LB 4QYIA 2Z8XA 3D0QA 3OD1A 2ATIA 3QWBA 4M1SA 4PZPA 4CIAA 5KIAA 3LO8A 1OTHA 2H65A 3HCAA 1PR6A 2WPDD 1DBSA 2CBGA 2F59A 4M1EA 4UE3S 4CF5A 5B2ZA 4ZN6A 3K1TA 1R16A 1SOVA 2GNPA 3CISA 4JLWA 1C1DA 3QLVC 4F0JA 2UZ0A 1EBUA 1VJCA 2EP5A 3KT0A 4QEZA 3WHIA 4AZ0B 5JXJA 2JLUA 2YCLA 4EPRA 4EEXA 5BQXA 2ZJYA 5EXTA 5ITZA 3SSMA 1BE0A 4JENA 4PYRA 1DRKA 1UK9A 1N2HA 1R0RE 5KVVA 2Q50A 2XCSB 3K1AB 3OZBA 3T0GA 2BM9A 3KOXA 5JECA 4P92A 2R0QC 5EUBA 4F56A 3PEWA 1KR2A 1FDSA 1EVYA 1SQGA 3PRYA 4IOLA 4R1OA 5DM70 5BWLA 3FZYA 1JBEA 1IBCA 2RIPA 2ZIUB 2REQB 1GARA 3HYCA 4B7AA 1JAIA 1RKVA 3E4CA 3T7AA 2O8EB 1IB6A 1SIUA 2J0UA 1XJ0A 3MQ2A 1BQ3A 4NNJA 1YR9A 5CX1A 1F8XA 2ZPAA 3TZKA 3U3ZA 2AUNA 2WSYB 4OSPA 1JEDA 1Y8QB 4TYQA 2PUVA 1YDGA 1V9SA 1TRHA 1WMSA 4KX3A 4IYRA 2C9ZA 1OLXB 1PTJC 2V7UA 1GTG1 3O6VA 2XB2A 2D06A 2D0IA 1V39A 1RDFA 1ZRMA 2GUGA 4CV3A 3UHJA 3RAJA 3E70C 4XKJA 1EQ2A 2DERA 1DWUA 3OWOA 1ZVVA 1XMVA 2Q0XA 5GZ6A 2X8AA 3VMMA 4YUXA 3CLUD 1RMYA 1RQLA 3PXAA 2IPMA 1A7UA 4UHKA 4YP0A 3TFWA 1M72A 3EIQA 3G17A 4TRMA 3VZBA 1CE8B 3P9RA 3FYDA 3T99A 1GQYA 5DTIA 1GUAA 3T3GA 2I2FA 5C8YF 3ROTA 2WF7A 1KI9A 2B1GA 4F2PA 5C32A 2RGDA 4DBLC 5JXIA 1JZTA 2A94A 3NXKA 3AERA 1AMUA 3NBFA 421PA 3PDUA 3R3YA 4QBGB 2A14A 1PFVA 4H7JA 2R8EA 4MI3A 4A8PA 1Y7TA 3OQIA 4HI0E 3H9CA 1NUAA 2PH7A 4P22A 3TNYA 4XLLA 3DYVA 4HTFB 1SU4A 2Q29A 5FOWA 1CUJA 1ZP6A 4H1TA 2CJWA 2JJ8A 3PDIB 3ITKA 2X5JO 4XYMA 1FK8A 2GPYA 4DC1A 4WZ6A 4QYIB 4JU9A 1XYVA 2IP2A 3O74A 2V8OA 2GCEA 2NW6A 4RZXA 4BBPA 5HRUA 2MYUA 5SY4A 1AQIA 2NPOA 1LLDA 2QAJA 3AXTA 3GJQA 4PLPA 2VYNA 4HYQA 1T2VA 4MB0A 2OFOA 4WQMA 5CYFA 3A6PC 2HWUA 1XU9A 5KTKA 4B7ZA 5ILOA 2H54A 3N75A 3O1JC 1C1DB 5BSWA 4J49A 3I2YX 1DX9A 1ONSA 2WD9A 1NC3A 3PEEA 4HPXB 1KVRA 1QAOA 1U3VA 2QZJA 1XGKA 1K8RA 4UQPA 2X6QA 4H17A 2VAWA 3PHHA 2QLBA 3Q41A 5ITZB 3AOEA 4B79A 3LWBA 3BAZA 4AJ4A 1U0LA 3HFRA 1KTVA 2I3ZA 1CJVC 1M75A 1NC1A 2JFOA 2YHUA 1I7LA 1R9NA 2ZQ5A 1I36A 4G07A 4K05A 4MQBA 4U7TB 5EPUA 5FTMA 1Q0LA 2MSCB 5MHTA 2IBSA 2CZQA 2WIJA 3QPWA 2K4MA 9MHTA 3BGWA 1ZINA 3N7AA 3PG5A 4B85A 2CBXA 3NYWA 2SICE 2VYQA 5DHRA 2XMQA 5IAAA 2OK8A 4XLTA 3VO9A 2Y0EA 3ZLUA 4KLCA 2FK7A 2C2WA 3T38A 1H4TA 2J0UB 2PSJA 4PG7A 3ZDDA 2I91A 5CX1B 3T5AA 4BLPA 3BQMB 2XXBA 2XJ4A 1WUYA 2A3RA 2A5DA 3KKEA 1L8QA 5HWSA 3HJTA 1AC5A 1T5SA 3TFOA 2I4RA 3N07A 4Y6QA 2XH8A 3WYNA 2OXEA 5EKTA 3I62A 4XR4A 5AUNB 2ZT7A 2BH2A 3IULA 1PAUA 5K0SA 1E61A 4B4OA 4ER5A 4MZDA 4KODA 3PKJA 4K3UA 4D9BA 1S8AA 4QPNA 5E3HA 2ZG6A 1RYNA 2P67A 2V98A 4R2WA 4RLHA 4WFIA 1BTOA 1A69A 5IX8A 4S24A 4J8PA 1UCFA 1PJCA 3UJ6A 3FLMA 2O05A 3UG6A 2V7QD 4KRGA 3WTCA 3X1XA 1PQWA 4NJMA 3JVDA 4LDQA 4RTNA 4BXOA 1EJ0A 2GJKA 1E63A 3GUVA 5H82A 3MERA 5JMPA 3AERB 4IGEA 3HJNA 5EJEA 4YROA 3K9FC 5DM0A 4XZ3A 5HRAA 4OX9B 5PGMA 3OQIB 4X63A 1ZCAA 2A6PA 2ZRQA 1VDZA 5EUCA 2GN0A 2CJYA 2Q0HA 2R6JA 3B3GA 3H5OA 1P1JA 4QUAA 3CRRA 4EJMA 5IT0A 3EN0A 5FA8A 1AURA 3ZOZA 2NWQA 2QE6A 2Y1EA 3AX6A 4CLEA 2QZ9A 4TMKA 3OFND 3DZBA 4WSOA 5DNEA 3AL0C 1PGQA 5BVGA 5I9SA 4CT5A 5ULLA 1T5IA 2ZJ1A 3Q40A 2QPLA 1S3SA 1E5TA 3ZCPA 1SQ0A 1QVZA 3H13A 1NNSA 5ESDA 3U49A 4KQXA 5KOIA 4NZNA 3KQYA 1Q44A 1VKZA 4MKFA 1V26A 3GB9A 5J63A 2XQGA 3NALA 1F38A 4QL3A 4TTTS 5K9ZA 1PD1A 1R6UA 1UANA 2QTCA 4FILA 2UU9B 1RFGE 4US0R 3DE5X 1XXLA 1QX4A 5FI5A 5BRNA 3JQFC 2JH8A 2RARA 3ONEA 3LHSA 4UXHA 3GDHA 4KP7A 4DLXA 2IODA 1I7DA 2ZB4A 2D1SA 2D00A 5KYWA 1ZCBA 3JPYA 3RQSA 2ZJOA 3BPSA 3LVQE 3I01A 3W2IA 2JIQA 4OKNA 2AE2A 5JDCC 2HIMA 1T3GA 2NO6A 4MMXB 4LF9B 4XWAA 2AD5A 5K8IA 4DV1B 1NJGA 4AB1A 1Y7IA 2OC4A 3CS3A 3OX4A 4K9LA 1SBYA 4WFKA 5EIBC 4FXOA 3RVSA 3LVFO 1W5AA 4GMFA 4TL6A 3G3EA 3ASUA 3A6KA 2A30A 3C3YA 2OV3A 3N2EA 3BFKA 4JL5A 4U1RA 1QE3A 4E07A 4WL0A 5F23A 4M99A 5D84A 4NQZA 4ROTA 4WLNA 5ALQA 4D8TA 1GTJ1 1IHUA 4KK4A 5HUJA 1L7MA 1DMSA 1KP9A 4PZYA 4IDBA 5A3SA 2ODTX 4A2WA 2GZDA 4XIIA 2ATCA 3QU5A 1N6RA 5K3AA 3AZQA 1JTFA 4C3VA 3MEQA 2Y2UA 2Z8YA 3KLBA 3OPNA 3ILYA 1A5BB 2AV6A 4XUCA 3VZRA 3OM0A 3WY9A 5IVKA 2I2DA 4NJMB 2IW3A 2C4MA 5CX4A 4DDKA 1EWTA 2KLBA 4HQNA 4JYMA 3PQ7A 1R5JA 4NBTA 2ZCUA 1V3TA 2IZOA 1RACA 1XDUA 2Z4SA 5JH7B 4ZAWA 1JXOA 2UKDA 3H65A 3I37X 4AS2A 1IBLB 1KSFX 3CKMA 3WHPA 5L53A 4HXGA 4RZHA 3LRXA 3VKWA 1G9SA 3WYGA 5LQUA 1LPBB 1WF3A 5DDIP 1IN4A 3VJLA 4BO3A 1YR1A 5DTEA 5IDYA 1T2CA 1FP6A 4DLLA 2W7TA 1X38A 2G7MC 4HYTA 1GUYA 3WLOA 4ENRA 3HGMA 1IZ9A 1FA9A 2XUAA 5BVGB 2HDHA 2H2DA 1LPPA 2AA3A 2JVJA 2OAEA 4NYMR 1S3GA 4YN3A 3TZHA 2W58A 1XHFA 3OJCA 4GBED 4ANFA 2H00A 2I9PA 3AG6A 2JI9A 4WCFA 4EKDA 3NMUF 1OH8A 5HZMA 3ZHSA 2L0XA 2PGDA 1T1JA 3QHPA 3VR4H 4CIWA 3ABRB 2ZAIA 1Z35A 4Y3UA 3ZD9A 1L6RA 5ALSA 1RZRA 4TS3A 2OY0A 4HX2A 5KYTA 1QQ5A 1FLNA 3DZFA 2G82A 5HW0A 3V2UA 2C8KA 1NSTA 2GA9A 4JYCA 1LJ8A 5AVSA 1RC1A 1YUMA 2BRUA 9LDBA 1GG2A 3VV3A 4G6ZA 5KYWB 5LD2B 2WKSA 2OQVA 1M9NA 2FHSA 3IV7A 5EG5A 1OKKD 1PGOA 2WOOA 2XD4A 3KBOA 1VCMA 2XWSA 4I66A 4MV0A 4FEGA 1DX4A 1O94D 5AJWA 2I7CA 2WAMA 4FLMA 5BUCA 4DCVA 4B71A 2RK3A 3W77A 5BT8A 3HEAA 1QB8A 3A1TA 5ITSA 3QE3A 4JXXA 5LYYA 4X93A 3C3DA 2IBTA 1K7XB 3OLQA 4IHKA 3IRUA 4LQ4A 4ZEMA 3UWPA 4BNTA 1RMQA 3OOYA 5A7FA 4IJUA 4UCWA 4NR0A 1QHEA 3WNQA 1Z4JA 4WJZA 4EEZA 2F1IA 5EP1A 1G66A 4QDZA 4C7OA 1PEAA 3H97A 3X1DA 3UTCA 1SMKA 3B5JA 4H3HB 1IEXA 721PA 5KHLB 4RJ2A 5FNVF 4YT2A 2BFWA 4JZKA 1ETUA 3E0XA 1U0RA 4YRDA 3U81A 1HT2E 5CLJA 1UODA 1HF3A 4CQMD 5BNWA 1PWEA 4PXYA 3EZ9A 2W2TA 2H1LA 5DRYA 5K0EA 3LUCA 2V65A 2H1CA 3A1DA 4BDTA 4URUR 1KDTA 4NHEA 1HFKA 3B20A 1UPAA 2O2CA 2FSUA 1MAAA 2XGGA 1J8DA 1W25A 5CUQA 4ZALA 5TEVA 1TUBA 4CBVA 5JTUA 4YAGA 2V6JA 2IPOA 2XDQA 3GUZA 5D87A 4CKEA 1XZHA 3VI4B 4QTXA 5IDVA 2XYPA 1XL1A 2OMKA 5K0TA 1IG3A 1ICIA 1CU1A 2VHUA 3IOMA 4WCFB 5J5CA 2R6FA 5ALOA 2FK8A 1WMEA 2ZJ3A 1H8HA 4R4JA 5I01A 3KDPA 5YASA 3HJUA 1QMPA 5ALKA 1M2KA 4NXMB 3QV1A 5ADWA 2E4YA 3HB9A 1DIAA 4BRWA 4TYYA 3JQPA 1IN8A 1C7FA 4IPTA 3W2FA 3F1LA 2W22A 4KQWA 3LPLA 4UHCA 1XNHA 5FOSA 1SB8A 3UH0A 4F2DA 2HF2A 3ORQA 4UNPA 5E3IA 4COKA 4B0PA 3AI7A 2OCBA 1MQAA 4L6AA 2VF7A 1G7TA 4M49A 3W8FA 4F8EA 5AYVA 4DILA 2WPDA 1KBQA 3QBTA 1BD4A 1QFYA 4IS2A 1RRFA 2J3LA 3O2SB 3OCZA 4C30A 2NO5A 1FYDA 3QBEA 4AJEA 1BWPA 3R3SA 3T3DA 1FLVA 4IOJA 4RE5A 8GPBA 3WK8A 4EA7A 5KC9A 3L1HA 3SKXA 1LI7A 1XVLA 3KSMA 5IKXA 4DUZB 1FMJA 1QTIA 3U9LA 1S3IA 2IZ5A 1OQAA 1EDOA 5I45A 4D3SA 4BFYA 1G7RA 4CT4B 2YWHA 3FUTA 3SSNA 4HAZA 1FX1A 2MINB 1OIWA 3TLEA 2I6FA 3H18A 3H1AA 3EGDA 1IK4A 2PZEA 4AU1A 1C3EA 4O2AF 4ND1A 1XDBA 1N75A 3O2QB 1ZK2A 1NBHA 1R74A 2XMSA 4YPOA 4C7OB 2I7VA 1HTTA 4I5FA 1CJBA 1Y82A 4MUIA 3EEQA 5C34B 3N2KA 3WMEA 2B1QA 3MOIA 1Z33A 2QR5A 4LOHA 4Z86A 3AVXA 4L50A 3KXKA 2H18A 1JHZA 3B1WA 1Z5WA 1TC2A 4QSMA 4BNFA 3B78A 4IXNA 5KYXA 2B61A 5DEOA 1GA6A 1PJQA 3NIBA 1P1FA 3L7DA 4TKLA 1XA3A 4OSEA 2PUBA 4RK0A 4WBXC 3TQCA 4ZOAA 3VDXA 1UXHA 2BMAA 2VHXA 3EPKA 3NBAA 1E4YA 4RBNA 3U3RA 1FJ2A 1PJZA 2C3OA 4D3YA 4CM5A 1PYOA 3I42A 3L02A 4Q47A 3KSDO 3GXBA 4E2XA 4MPPA 4CG3A 4HUTA 3KYIB 4DT1A 4I5IA 1SOWA 1TUBB 4TYMA 3S2YA 2H4ZA 2QGZA 3HHEA 4CKEB 4H1WA 2MSWA 4ZYXA 4IP0A 1ZH2A 3H8JA 5B58C 4W9MC 5C31A 1G42A 3USES 2PIDA 5CJ2A 3ERCA 3QFHA 1GFSA 2NIPA 3RRJA 1YQQA 3PFNA 2YWGA 3WGLA 2A0FA 1A0OA 3GGPA 3CRVA 4Z8XA 1A9PA 2WZDA 3KAKA 4BQQA 2CT8A 2D7DA 3F6CA 3REGA 4W7HA 5JNTA 4AP9A 4XWOA 1YQ9A 4KB5A 1MTZA 1XVVA 1TCCA 2YWXA 4GZLA 4Q4AA 4F12A 3CT4A 5EHQA 1CHNA 4NPCA 2PDAA 1YB7A 4KNYA 3HFGA 3DNFA 5IT4A 4EO9A 4YP7A 3GUUA 2I80A 4ENQA 1E9RA 3PFBA 4KIGA 3AWDA 2OCGA 4TSFD 4DDVA 1JKXA 4S1PA 2X2PA 4ZA2A 4MH0R 1FSPA 4F91B 2QG9A 3Q6MA 3I9JA 2IW1A 1ZUNA 3C74A 3EUWA 3GEGA 4MXDA 2XNCA 5EJ4A 1PQYA 2EFHB 2VPPA 1Q2UA 3DDZX 4PCVA 4RELA 3QKUA 4B1FA 3KKLA 1W48A 2F1JA 4JYBA 2A5JA 5FHQA 1YI1A 1C81A 3MRVA 5LZ9A 4F3TA 3MB5A 1W36C 3I76A 4DWVA 3I0ZA 2ZREA 4PLYA 5C3UA 1VXOA 4OLHA 3EGDB 2FN4A 2XE4A 4EJ6A 1LX6A 3MJEA 4HAYA 1LI4A 1VP9A 3WIBA 2WJYA 1CNFA 1GG5A 1WE2A 2EFCB 4ND4A 1DKUA 4Z2AA 2Q6VA 4ZCRA 3HCRA 1M8JA 1V37A 3T5CA 4K9RA 3H9BA 1HYHA 4KO3S 2IBMA 1ZA2A 3N2KB 1F7VA 1VG8A 1VPLA 4LFAB 4FI3F 4QZVA 1E20A 4HNRA 2DH6A 3AILA 3VH2A 4XGRA 2DUWA 4MW1A 3C45A 4DLTA 1DELA 5KYXB 1CP2A 4LC0A 4YDHB 3TQRA 3LYAA 1FQKA 3DNPA 3O8OA 2IV3A 1CULC 3G6KA 1RWMA 3TD9A 3CUVA 3A1NA 5F9MA 4UDOA 4IYJA 3MG9A 2AN5A 1A7KA 1YQUA 3PT5A 3IC5A 2ZJAA 1J8MF 1E66A 4OP3A 3L6EA 3DR5A 1Z29A 5KAMA 1VKOA 2A1TS 3BWXA 2R6ZA 4DT1B 3PPWA 1N57A 1CRPA 4NONA 1FW8A 1SJ9A 4EI2A 4L51A 5SZKB 1KP2A 4KGVA 1U6KA 2OORC 4PZ0A 5JNSA 3IODA 2QHXA 3FUCA 4ODIA 4LECA 6AT1A 5JY6A 2V7QA 3JALA 3HL4A 2RGXA 4P7FA 2WW8A 1AGXA 4BMNA 1W1UA 5FUVA 3UQYS 4B4UA 1BXRA 2EF1A 4PSCA 2PUWA 1Z25A 3TKYA 3VYVA 3ZWOA 3O4JA 5CCDA 1GG8A 3NASA 1YZGA 2XODA 4G56A 1QGOA 4E4RA 4EW3A 3EIEA 1E2MA 4Q4AB 2QV0A 1JLHA 5GGXA 4B6EA 3R0IA 3UUEA 2G28A 2IUSA 2Q2NA 1BDMA 1Q7EA 4C2UA 3NTUA 3OFNA 5G0UA 5JNLA 3ZZ1A 4PYLA 4HNTA 3K7EA 1KSHA 4JASB 1IM5A 3VQTA 1I1QB 1ISJA 4B4KA 5EMMA 1XMOB 3SEFA 3IYLW 1V7ZA 1OVGA 3O4GA 4BB9A 4HEJA 1ZUNB 1M34E 2PWYA 2IHKA 4ND7A 4R8KA 3UMFA 4F8YA 2RJNA 2ZSBA 1I1NA 2VHEA 1CUFA 1L1EA 1Z0SA 3P2MA 3PEVA 4XXHA 3JWEA 3MGCA 4ZICA 1P7YA 1NI3A 2X40A 3BB4A 2FF7A 3R8CA 5TRTA 5E9WA 2H9YA 3W9YA 4F11A 4HZIA 1QBKC 1PJ8A 3HCWA 4NYJR 2AN4A 2RAFA 5JJLA 3E9QA 5HBRA 1DG9A 4PW0A 2WUWE 1G5TA 4TWIA 3NHSA 4IVNA 1Q2XA 3LT4A 4WBSA 1TC1A 5FUQA 4IDPA 3V8NA 4NARA 4BGUA 4LCBA 1G2IA 2OO5C 5BW4A 2RHHA 2FWNA 1Q1NA 1ZUD1 2QGFA 5KQMA 4Z54A 4M0EA 3Q87B 1F60A 4MR9A 5IABA 1DCFA 1ZU5A 4B2IA 2GEBA 4Q02A 5FWYA 3K4HA 2ZOSA 5A06A 1UDCA 3AJEA 2WJVA 2VJKA 5DNCA 3EPJA 1SIWA 5K3EA 1IQRA 1IXKA 1PV1A 4PE5B 5JO9A 5GINE 3O8OB 4CMBA 4X3OA 1DCMA 4K03A 4WKBA 5ECDA 1C2TA 3CZRA 1GQOA 1W73A 1GVNB 1P4GA 2BR5A 3ADOA 3BH7A 2A58A 2FJ0A 4I08A 4QQNA 3N86A 5BT9A 2FWJA 1YJXA 3B9QA 2BCJQ 3WDKA 1MC1A 4I8IA 1XDGA 3DE3X 4JBGA 1HRKA 4GOND 4YHHB 2UVDA 4MLDA 4D7AA 4FHCA 1K4MA 2XD9A 3IEKA 4EFKA 3G8DA 1ONNA 221PA 1EZZA 4B3DA 9ATCA 3AGPA 2KYRA 4DG8A 1XZDA 1SBCA 3IPAA 4RMJA 3IMFA 5J5VA 4DANA 2CV2A 4OA8A 3RC1A 3JALB 2IYLD 4C0BA 3R7LA 2OG2A 4O4LF 2NUPA 4QUHA 3CZMA 1B00A 1SHTX 1XRPA 1BXRB 4NMHA 2V03A 2CW5A 3QXGA 5LA6A 5K0GA 3LQ4A 3UK0A 3DFKA 3PNOA 3RUFA 3ZHXA 4GX1A 2GXUA 4DY4A 3IHKA 5IYZA 1RZ3A 4HLUA 4KE7A 5HDQA 2OE2A 4CIDA 2B1JA 1SCQA 2XECA 3C4VA 1QOQB 1YQGA 2OILA 4GXNA 3FI9A 4K6OA 3OX1A 2I2CA 4N7JA 1PWZA 2Z2KA 3QU9A 3GLGA 1P2FA 5BYJA 2FW7A 3OA2A 1NVEA 4FHGA 2CHEA 2QVYX 3E22A 2D62A 1QQAA 1FPMA 2ZAGA 4N82A 3ZW7A 3FYUB 4I50F 1ZVMA 5EXPA 3FPFA 3MAAC 1FQJA 1ODJA 2I3BA 3U4MA 2DQ4A 5FPHA 2CCGA 2IZ7A 1HC7A 2C2HA 4EPYA 5CH3A 5EZYF 1OLUA 4H31A 1PT5A 2VKTA 2QSYA 5FOXA 3SIWA 2MSNA 4BV8A 3CLRC 3SY8A 3FSGD 2VSNA 4P82A 3IP7A 1F6DA 4ZV9A 1MPTA 3EFHA 2IHZA 3UHFA 1QGAA 3RTDA 1XIVA 2NV6A 4K2HA 5I47A 1YBAA 2DPHA 1T2AA 2GM3A 4IQ8A 4JLAA 4NX2A 4D1YA 1G64A 4MR9B 5IW8A 3PJDA 3QUCA 1OKKA 2FYTA 1FTGA 2CXHA 5E1DA 1FU4A 2REOA 5KOYA 5FWYB 3FB1A 1N5LA 1H65A 1T6YA 3O73A 1O94A 2D5IA 1UT5A 1HT0A 2Z43A 4MUAA 4EF4A 1JDBB 4CIYA 2AIRA 1SAYA 4S1NA 3COJA 2OV1A 5EXEA 5U1PA 1RXWA 2EW2A 2C88A 3OKPA 3ABOB 3LOQA 4UTZA 3U3JA 4PLGA 1OA1A 4I0WB 4RVGA 2ZSHA 3ENQA 1LSOA 1TNDA 5BQOA 3TQIA 4DSTA 4J7UA 3FHOA 4BVGA 1EWYA 4E5DA 2XB9A 3AHDA 4YB8A 3UG7A 1VRWA 3E9EA 4ZV7A 3N0XA 1D5WA 3MJHA 3VR3D 1CQPA 1V5EA 5TGDA 1OYOA 1KQGA 4XRGA 5D1NA 1NJ2A 3R76A 3ISJA 5HIMA 5JLAA 5EYPA 4RENA 2G88A 2Q49A 1Q7CA 4B5KA 1MDBA 1DTSA 3WKEA 2NUPB 3WQBA 4CQMA 3CRMA 2DBYA 1NDUA 2G5TA 5HYVA 2WKRA 4TN5A 4YJ3B 5LA6B 4F5EA 5IYZB 4JJ8A 4XFDA 3WNCA 3HMQA 3LUKA 3TBKA 5JMWA 2IS1A 3A4VA 3GX1A 1B8OA 4RQUA 3PFFA 5EESA 1NWCA 3SFVA 2I1LA 3KPYA 5KTRA 2GM4A 5JR3A 2WB4A 3LW7A 5TMPA 3CWCA 1JIVA 2DFNA 1QWSA 2NZUG 3P8ZA 3H2GA 5TQ2A 3O4RA 3UWMA 2X41A 3NAQA 3NH6A 3GLGB 4D81A 3V7WA 3OCJA 4I4NA 3MCVA 2WTAA 2W90A 2XXJA 1JA9A 3IT2A 2B1IA 1GL6A 1NUTA 1WPRA 2YWBA 3F49S 3NEYA 1RT9A 4KZPA 1TQ2A 2JHCA 1DJLA 3LUJA 3C48A 4HRYA 4LY3A 3HVKA 4WE3A 5F78A 1PHRA 4YQEA 5G53C 4E32A 1O77A 2RBEA 2X5NA 1ZESA 2PFKA 5TXGA 1OAOA 2ZJZA 1EXDA 3EW9A 5CD1A 4NIMA 3DONA 3ACBA 1X7DA 3LQ2A 5HF5A 2IYFA 3BHNA 1OLUB 3MF4A 5F35A 4DGSA 2E4ZA 1KO1A 2WF9A 2YYZA 4FYWA 1J8VA 3LSYA 621PA 3D54D 3KR2A 2C9DA 3PC7A 1TW2A 4DIFA 5JAZA 4NZZA 1EFLA 2VSFA 4TTQA 3SHFA 2INGX 4MYSA 2O4UX 3PUHA 3R09A 4GYKA 5I4CA 4MDHA 5L6LB 3VKHA 2Q3HA 4LGMA 3TZBA 4HQ6A 4E13A 1FZQA 1UKZA 3WBBA 4YMLA 2O2EA 1IOLA 4MKRA 3ZWBA 2C2MA 1CDOA 3EULA 3HLKA 5I8ZA 1ZJYA 3A11A 4WOBA 1S8NA 2VNIA 2FSFA 2RGNC 2A84A 1QS0A 5EEHA 1IZ8A 4Z1MD 1Q57A 3F3MA 5ERGB 2BH9A 3MLEA 4XOUA 3K9WA 3TM5A 2VOJA 3HACA 1I33A 2AOTA 2OENG 3M4ZA 3RE1A 3WFJA 2C96A 2O7NA 2IY8A 4BO7A 4BEWA 4TGLA 3RVPA 4EYKA 3HU2A 4YBZA 3IAS6 2G7ZA 4GI3A 4QLBA 3I83A 4Y9SA 2LD4A 3IBSA 3MIIA 3T1HB 4YNBA 5UKDA 5DNDA 3TLAA 5EYPB 2PMEA 3VC3A 2OCPA 3S1SA 2RH9B 3RAEC 2VATA 1KFJB 4MO2A 3ZI4A 4BKRA 2Q1SA 3WL3A 4CQMB 2A35A 3CZ5A 3ZV6A 3MELA 3ZK7A 1SD5A 2ECQA 4JC8A 1P75A 1XEWY 1JVBA 1QRUA 4LY9A 5LKAA 4L74A 5DN9A 1FQOA 4GLFA 2AVNA 3PKZA 4POOA 4DMRA 4P5EA 4DVJA 4OI4A 1I01A 1XRNA 5I9NA 1NYRA 1M1UA 2YNMD 1N6LA 1B4DA 4IAOA 2FPIA 2E82A 3BL8A 3IMKA 1ZNYA 2GDZA 4ZP1A 1L5HA 1E6WA 1U3GA 4WAUA 5HILA 5TQ2B 3WK9A 4JDPA 5H83A 2ID4A 4JQCA 3HCDA 1IVNA 4GF5A 1VL2A 1UAGA 3SOPA 1E64A 4PINA 1SCKA 1HYQA 4ESHA 5KINB 1N8KA 2WB2A 2AEMA 2FZVA 3TKLA 1HE5A 2DUNA 1TA4A 4C4ZA 2H0QA 2HDWA 1CY6A 3KKNA 3G2PA 3PGLA 3W4JA 4Q1CA 4WERA 5ENZA 3RSHA 2ZGVA 4ZVSA 1K6JA 2PBZA 5JCOC 3K9HA 1WB6A 4LE1A 4BQSA 3D8RA 3E15A 3STUA 3VTAA 2IKQA 3QW4B 2UUOA 4BX8A 1FUIA 3WVNA 1E18A 1O89A 1XRJA 5LVAA 3MFQA 4ZAVA 4TSFA 1JQ3A 3TTSA 1PS0A 3RIXA 1J00A 2H92A 3GLQA 2WZCA 1QJ4A 3NW9A 4Y7DA 3NS7A 1U2RA 4FYPA 1O97C 4TL9A 2I6GA 2FSPA 3DL2A 3GDOA 3HHPA 4DC0A 4NVRA 3NBXX 2BFCA 2PX4A 1FLDA 5MN6A 1KZ6A 4KUHA 4JV5B 1YA8A 5KPDA 1LK0A 2HRRA 3AR9A 1QS0B 4URVR 1R8QA 2YTZA 2Z5GA 4NV1A 4ZZ3A 5EJ7A 1U7WA 2B5VA 3AJAA 1QYRA 5IMSA 2V1UA 3MWGA 2DTEA 1Z6XA 2I22A 2YHAA 4LOJA 2HNAA 3DP9A 1D2EA 1M8FA 2W9XA 2AOTB 2WV9A 1U31A 3KJEA 4KTTE 4R2LA 3RUEA 1R8SA 4C7XA 1FLAA 1SZDA 5L3SA 2H7YA 3F46A 3FF1A 4HAIA 5GMOA 3V7NA 1N2ZA 3BF7A 5FI3A 5JD6A 4HX5A 2PX0A 2HPZA 1DWOA 2YVKA 1B93A 1EWRA 1SY7A 2ZYGA 2R8OA 1HMPA 1C80A 4NU0A 2JFYA 4DV0B 1VL8A 4I19A 4N18A 3LLCA 4ZOEA 2Z1MA 4YWHA 4JXJA 3GLFA 1IAVA 3A14A 3HWWA 4Q6WA 2ETVA 3RS0A 4WK2B 4GWKA 3JYLA 4KBYA 1Z75A 2POQX 1NN0A 1Z37A 3PVSA 9ABPA 3LGXA 3LUBA 4P3YA 4WKGA 2V7WA 4OLAA 3QEKA 4K7JA 2E18A 1FRQA 4PO3X 4RQBA 3FROA 3OF3A 1M1YA 2CLDX 3RQIA 4F84A 1XTJA 2YHIA 1Y4UA 4EQ6A 3H99A 4OD0A 1I2DA 1YK0A 1NKSA 4RS4A 2GNOA 3L8GA 2FPIB 1L5HB 3ONVA 4LE2A 1JTEA 4V3BA 4TRRA 5CFPA 2AYXA 1ZD5A 1IULA 2H8KA 3ND9A 4PLFA 2FE1A 1IB0A 2QF7A 3PJGA 4GGPA 4M1OA 4R8LA 2ZANA 5EHGA 4LA4A 3O3CA 4G1CA 5AO9A 3WHLA 1T5TA 5ELLA 4YMTA 1HG1A 3Q5GA 4TV8B 2PWAA 5B1SA 3GR6A 3GAFA 4IIJF 4EPVA 2V3CC 2AN1A 5LQSA 5BWMA 1NONA 1TX4B 2IYZA 5COAA 3T0IA 1FYFA 4KAJA 4YRBA 2WK1A 3THYA 4JNKA 4B43A 4L0MA 3VKGA 1C3LA 1ODSA 1X2BA 5DXJA 2FLVA 4M87A 2I2BA 3CH7A 3JZAA 4RVFA 2BKEA 4M38A 5EHNA 4OJMX 5JMOA 3ZWQA 4G5FA 4AD8A 1MJHA 5BWCA 4XW2A 2H5EA 4FC6A 3IQIX 1A7AA 1J24A 2G63A 1G3MA 3GJSA 2RGRA 2ONJA 2FUG6 1EE2A 1D7AA 3ANLA 5K0JA 5DXAA 2JFPA 3QLEA 4TQAA 1PUJA 2FQXA 3VFDA 2GM9A 2XVZA 2BFCB 2JAUA 1ADCA 2I1QA 4DTCA 1Y48E 3PK0A 1R4NA 5J4VA 1L4LA 3BCUA 2RONA 4UBLA 1PFQA 3CLTC 3UENA 1DXYA 5TE9A 3EDOA 1EVLA 1XTSA 2VDNB 2ISQA 1NVVR 2PKEA 3H2SA 2R00A 5F5NA 3ZNQA 4GIBA 1ZUHA 2C95A 3QOFA 4ZT2A 3NG1A 4O8CA 5ALTA 3I45A 1BHO1 1I8TA 1SXJC 1VJ1A 2IT1A 5L3SB 2GHQA 2X3UA 3MCAA 3PUWA 4DVGA 4B80A 4YAKA 1YBHA 1YHYA 3WB9A 5K4GA 5SY9A 3HR7A 4J76A 4BAUA 1XEXA 3NNDA 3IXMA 3ORFA 4OHKA 3W2TA 4CETA 3DOJA 3QOYA 3GLFB 2WVAA 3BM5A 3O84A 4KW7A 3LLUA 3DLIA 4B0OA 3NHUA 1AN9A 3NHLA 3OKAA 5F3RA 4B09A 1J5PA 3P2JA 1M6WA 4AKTA 2PD3A 1X92A 4O3FA 5IJ0B 3O9ZA 5WRFA 1U63A 4C0HA 2VK1A 1M1YB 1TM4E 3T1VA 3CX6A 1PJ2A 2B37A 1KI3A 3QVWA 3PRHA 4LJ4A 1I3OA 2YHIB 3CRZA 4EQ6B 3GJTA 1CZRA 1XPOA 4DWOA 4MRMA 3DFUA 4PCLA 1P3Y1 1QZ3A 3MJ4A 3L41A 4L4RA 3FZQA 4K9QA 4S1TA 4GRDA 3S70A 1QGZA 2OWDA 3X1WA 4KPUA 1H2AS 3BVPA 3JX9A 3W78A 4HVCA 3R0JA 3TIIA 4H7FA 3DOFA 3NDJA 3K8OE 1QCDA 4J90A 4EY5A 2ZS8A 3PCRB 1XVAA 3P2KA 4MGYR 2EJUA 1MABA 1VIDA 4K9OA 3R7AA 2FUEA 3GUYA 4MWTA 1MTOA 3BSFA 3ZD6A 2IE8A 4ON9A 1KJWA 4G8JA 3SD7A 2LW7A 2R6R1 3E2MA 4IJQA 2JEOA 3RHFA 3RSGA 5LL6P 1F3OA 5D3KA 1E5QA 2YOGA 3JSAA 1PEKE 1NA5A 1QVVA 4L28A 1E69A 3JY6A 2XUGA 3E61A 3OLXA 1UOOA 4IXDA 4QDJA 2VPIA 4R68A 1E5DA 5F52A 3STYA 4RZIA 3TEJA 3L6RA 1VOTA 4NOMA 3QEJA 5LCXA 1CIPA 1U0SY 3SZOA 4RHXA 4J7CA 1GPNA 4ER0A 1NV9A 2Z57A 1J7KA 1CEYA 3HP4A 3O1HB 2G8NA 4DA6A 1EYZA 1DEXA 1UZNA 2JIRA 3IMEA 3RUHA 1R4NB 5IG2A 4Z0NA 2DT5A 2Y71A 3DW3X 4HEHA 4V0SA 1HLDA 3SHQA 2JG3A 4L7QA 1U6JA 4IWNA 3RVNA 2DBQA 4EJSA 2DR0A 3E3NA 5HZKA 1QU2A 4X5OA 4BVKA 2FKNA 3UUFA 1QLHA 1G5QA 2VRWA 3X1ZA 4ACAA 3FSGA 4DIOA 5CIWA 4RL4A 3X43A 4DMMA 5I9MA 3AR2A 4PX5A 1C0EA 2HLHA 5FJIA 1ACJA 1NHWA 1B14A 2Q21A 1RQRA 2OR3A 2APJA 2MWMA 4OHWA 3U62A 4EMBA 1RI2A 3TZQA 3N59A 4X1KA 4EA8A 1KA9H 1XEXB 1XYYA 3HO6A 1ZH0A 1TD9A 2QRLA 3FOCA 2UUBB 1E8DA 3QPUA 1SVWA 3IQXA 1MX5A 3NM6B 3QOWA 1AS0A 3GV0A 5ICSA 4Y2QA 4U5QA 1W4BA 2H8GA 5H9WA 1H69A 2CXOA 4GMKA 3NWJA 4KIJA 5H3HA 1WU8A 2Y05A 1U28A 3RRYA 4PYQA 2IL1A 3KOWA 1H0SA 3LP8A 5LQMA 1YRHA 1S89A 2AFIA 1CBUA 1DPFA 2A5FA 2VTVA 4ZPXA 3VR3A 4A03A 4AZSA 5IPFA 1BS1A 1LW7A 3DH0A 1VLHA 3E7FA 3EG5A 4F4UA 2HWYA 4IH9A 1I6KA 3GFRA 3WJ2A 4KPUB 4ZCSA 2XA1A 3BF8A 4Q4LA 1UAAA 2GH1A 2Q1WA 5LQJA 2AVDA 4AO7A 1A4UA 3HJFA 5I6DA 2EW1A 1FMTA 1VHQA 3C0KA 1PTJA 1CUAA 2HQSA 3ETEA 3ITNA 3JD3A 5TV2A 2HHCA 4DMHA 2V3VA 5IJWA 1MABB 1ZMOA 3MT0A 3DWFA 3LMKA 3L7MA 3KJZA 2GSDA 1GJRA 4UAGA 4UVDA 2HZ7A 2WMYA 2C4WA 4R2XA 1C0LA 3KQHA 4ETWA 5I9LA 4LRSB 3DHEA 4CTNA 4EZBA 3P9ZA 1E77A 3L4BC 4NFHA 1NXWA 5K0NA 3AVYA 1YIDA 3G2IA 1OT3A 2BAGA 1P61B 2XAAA 3BSWA 3DOEA 1M2JA 3W9UA 6YASA 2Y1WA 1UC8A 1PZFA 4RKYA 3V3TA 1CVRA 4N7BA 2WKQA 1GZ5A 1FDIA 1EFPA 3QNMA 3M83A 1NTOA 5IC6A 3Q8KA 1E7RA 3PR1A 4Q9HA 2KW5A 3W4KA 4TUYA 4C7MA 5KSZA 5DF1A 5H1YA 4JA2A 3TQFA 5HJ2A 1Z7BA 1U0EA 4Q9KA 4AWBA 4QAJA 4XGKA 4XVUA 5JO0A 1ZIXA 4XVCA 1SHKA 5B7NA 1NATA 1S2OA 4LQCA 4Z2YA 1E89A 4QJ5A 4EJSB 2GCOA 1MIHA 2X4GA 1ABEA 3HCEA 5IJ9A 5K45A 1NP6A 1N1MA 2XBUA 2PMWB 3CUKA 1YACA 2ZYIA 3GLIA 2WNSA 2AXNA 1E98A 1QF9A 2LRHA 1DIOB 4Q7KA 2JARA 5E2AA 3T12A 1OXKB 1QDLB 3BQ9A 2B2NA 3KU1A 4P33A 3LYUA 1OXTA 2HFKA 3PITA 3WI7A 2BI8A 1KZGB 2FW0A 3A58B 3FCEA 3JQBC 1JEJA 2K2WA 4JT8A 4X1KB 2MYPA 1TO6A 3W2EA 4C0JA 3LP6A 4DDMA 2C59A 1X8JA 3HP1A 4LF5B 3SQXA 4IRMA 4KQJA 1I2CA 5GIOE 2X5KO 4ARBA 2FPSA 5IKPA 1ZNWA 4A2PA 2PE5A 4Z1MA 5TB5A 3RDPA 2ABWA 1ADJA 4GICA 1E7YA 4FZVA 3R5FA 1OAAA 1Z0AA 5GGYA 1P5FA 2ZDQA 1OJLA 4PWYA 2C29D 2AFIB 1MX1A 3HV0A 3Q15C 2WYIA 4OHPA 3U3XA 4EHLA 4CTMA 3BMQA 3FTCA 3L79A 2G70A 4QARA 3HXMA 3PWZA 1UEXC 1YC2A 4CL0A 4CYMA 4QQRA 1WKCA 1XMIA 3OZEA 1HT1E 1EVKA 3O0DA 1F9AA 2MOKA 3PD1A 2YZMA 3FFAA 3W4IA 1QHGA 1O8BA 1R3UA 1R0XA 1T0HB 3FPAA 4KO8A 3TL2A 2EKZA 3UK2A 3BE6A 1RJ9A 1YA6A 3THOA 2Y9PB 3QYAA 5CB6A 2R1UA 2QMEA