3VR6H

Crystal structure of amp-pnp bound enterococcus hirae v1-atpase [bv1]
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
b'TYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQNIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATPase catalytic subunit A
publication title Rotation mechanism of Enterococcus hirae V(1)-ATPase based on asymmetric crystal structures
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 28
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2012-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3vr6H00
2QAIA 4IX9A 5KNBH 3VR6H 4RNDB 2OV6A 3AONB 3VR4H 3VR5H 5KNCH 5KNDH 2D00A 3W3AH 2I4RA
chains in the Genus database with same CATH superfamily
1E6CA 4ARBA 4EB8A 1AZSC 4TS3A 1ZI8A 1NW4A 2RSLA 3MFYA 4JUIA 1S2IA 1NV9A 3DFFA 3GUYA 3K71B 2AIRA 3NIBA 2RAVA 4QWWA 3T15A 1I4DD 1OHHA 4ME6A 2P2YA 3ZWAA 4O4LA 1TVKA 5BUSA 4PPGA 5L4LA 3ADPA 1XZJA 3DM5A 5KOJB 4J16C 5LQKA 1IBKB 4H7EA 3KT6A 3OCJA 4MV1A 1SQ0A 1XB2A 5FPYA 1FS5A 1W5TA 4URWR 5H3LA 3TCNA 1GZ3A 4QGSA 4DNPA 1I1NA 4PICA 2CLIB 4RHCA 3B51X 4JI3B 1U31A 2VDMB 2IP4A 2GYUA 2ZW9A 3IQGX 2DXIA 1RJ9A 1U3VA 3Q85A 2PEYA 3WLMA 1C3EA 4PYKA 3SZOA 2IP1A 1NVDA 2P9QA 2HADA 1OI4A 3TW6A 1BD4A 1T5TA 1CE8A 3UPTA 1RI4A 4EG6A 2QRVB 2ZIAA 1QFXA 4E3WA 5CGQB 3QVMA 5SV2A 2R8ZA 1AZWA 1GTSA 3W5IA 2C9OA 2EBWA 2VP5A 3ICPA 4K28A 4AYWA 1S89A 5FWYB 5EKUA 4NYIR 5JZBA 2GD6A 3KETA 5FJJA 4UMFA 3PQ5A 3MWLA 1SHTX 5DN6A 2B4TO 3BXEA 1JX6A 2HRRA 2PRJA 3NHLA 5EFZA 3WL3A 3WYAA 2Y68A 1UPUA 1JR3E 2QB5A 5CT5A 1F0YA 3PC8C 5EMLA 4BMCA 3KWJA 1TZMA 4MVCA 5EPUA 1X8KA 5LU8A 1A4UA 4PX3A 2W9XA 3G9TA 3LKBA 3LKDA 4X92A 2TMYA 2H1FA 1SBCA 2P9GA 1KMHB 1UM9B 4D4JA 3FW1A 2EJBA 4D9NA 4ESVA 4OXRA 3IEXA 1XEXB 1C1DB 3SM3A 3WR5A 2IDKA 2QL5A 3K5WA 1TM2A 1CIJA 1UFOA 2FUNB 2NYAA 3NM4A 1LDMA 2I6SA 1FU7A 4LNUA 3TEJA 4C7VA 2QT0A 4JL6A 1WPQA 2AG6A 1XYYA 3CGGA 4GI7A 4OCZA 4EATA 1FNMA 1H4TA 1OX6A 4Y8VA 2ZE8A 3F4KA 3RTCA 1E1YA 3UV7A 1VQ1A 3HBJA 2YRFA 3V8EA 4AKSA 5KMGB 5M7EA 4FYHA 4JY7A 1XTPA 2RC5A 5IW8A 4E09A 2Q41A 4P92A 3U39A 3AW9A 3VVBA 4UM9B 4BO8A 1OX4A 2NV2B 3HCFA 3HHPA 1GT91 2UDPA 2HK9A 4KJXA 4TQ9A 5IC5A 5AT1A 2GEJA 3TZCA 1BZYA 2YMPA 3W5AA 1DAOA 1EFPA 3PWKA 4LVUA 1OASA 4MGYR 4MGZR 1NW7A 3QG1A 4TLBA 4JI4B 1KKMA 3MIZA 2IKQA 1N7JA 2I7XA 3AEQB 1LDGA 3KAJA 5FBWB 4DDTA 3RUIA 5KYKA 1VSBA 1KVUA 1XZAA 3PA6A 1W47A 1MAUA 4X3PA 4JVNA 4ASUA 5JI3E 4EZIA 2VXOA 3E7FA 2PQ0A 3H1FA 1JSXA 1NQOA 3Q9LA 3S28A 3ADBA 5COQA 1UBKS 2AG5A 1G3MA 3KLNA 3Q8LA 1KPIA 4LJ8A 4KN8A 5LZ7A 2PZJA 2VNKA 3AV0B 4OGGA 4E03A 1FNBA 2RCNA 1GNQA 5JLAA 3J7TA 1DXOA 2GGSA 4QO7A 3RPEA 3OHPA 3CVWA 2P8JA 221PA 3LYLA 3MJTA 2JIOA 2PSDA 1VIYA 4LRSB 5ALVA 1YSCA 1AKWA 2P3OA 1BFDA 1GILA 5CNIA 5DSZA 2ESRA 1U1DA 4HLNA 3DO5A 4EY5A 1DMSA 1HNNA 1PFKA 1WMSA 1T6XA 2JLSA 2SCUB 3KDAA 4N5NA 4R2IA 3MUFA 3WYCA 4B5KA 1XRJA 2ZYUX 4ENSA 4NU0A 1ZJYA 1FFEA 2CFRA 2GBIA 2SNIE 2NXCA 1DJPA 1GG9A 1Z75A 3KJQA 4QDUA 4XRGA 2Z9BA 3LP5A 4RIFA 2JRLA 1YIDA 2IUTA 4PPYA 4RY9A 4CTNA 5KNBA 2CHQA 1Z5OA 1MN6A 4ILKA 1Q1GA 1Y80A 5L7WA 3E05A 5DXFA 2ZBFA 4TZKA 1NQ5A 3R76A 1HDOA 1WIWA 2PGNA 3LPNA 1N7HA 3DDNA 1P81A 1S01A 4DR7B 3GMTA 3AF5A 3DE0X 4M8KA 4YGYA 3BMCB 4KO4S 4YCDA 3SXUB 4BQOA 4EHDA 2J9RA 4Y0NA 2QAGB 1A1SA 1ORTA 4BFUA 1JEEA 4AZ0B 3OTWA 5DWDA 1JHAA 1TJNA 1Z08A 4J76A 4WASA 2JAXA 4RLQA 1PI3A 3NDJA 5EE9A 4B8WA 3RTBA 5LZ2A 2WJVA 3DL4A 5M04A 1VM6A 4BO0A 5I7FA 3ECSA 4RK0A 1C8LA 5JR3A 4NIMA 5JE8A 3GGSA 3QMWA 4Y6GB 1E2UA 4LZWA 4EJ0A 1LVHA 1NMEA 3A3NA 3W3ZB 1X9HA 4Z86A 3ANSA 5CB0A 1ZD8A 1G20A 4JFAA 5B2EA 1W36D 4EUEA 3GC6A 3NOXA 4OF4A 3VR5A 2WJAA 4IGAA 1U7UA 1SAYA 1N5LA 1FRFS 1NNLA 1Q92A 1VPTA 3F6SA 4GVLA 3SWWA 5E6UB 1KMQA 3ROZA 4UE6A 3FFBA 4B80A 3DV0A 4GQIA 1K7YA 2R8RA 4NAHA 5T3YA 5E0KB 1UWVA 1FMFA 2X4IA 4GYWA 3ETDA 3T7JA 2EP5A 4QUBA 2UUAB 1DZ3A 3KFXA 1TZ2A 1NVBA 5HKKD 3TIIA 3MWYW 1VL5A 3H9BA 2G07A 4U00A 3P26A 3WNCA 1N8SA 2C9YA 1G55A 3O6VA 4P2GA 2IXAA 4W7SA 1NBAA 4WK6A 1Z0DA 2X0NA 5F2EA 3ZGVA 3L7DA 4E1VA 3CKLA 3BD8A 3PQ3A 3UOAB 3WGHA 4TS9A 5JSYA 2HOQA 2JATA 3NBUA 4RHTA 4WUTA 4B9AA 1D5CA 3C6YA 4KPGA 5ALHA 3FCOA 2FUEA 4RHYA 5EZYA 1NIPA 3JQEA 1JKJB 3GGOA 4X1YA 1CPYA 5FBZA 4X6XA 2PUBA 4CG1A 4GI3A 3K0FA 5ENDA 1TF5A 1U7DA 1ISFA 1Z68A 3T3MB 2WP8J 1DKUA 4LHSA 1FUEA 1RRFA 3DVRX 3VSEA 2QR2A 2Y1WA 1TTHA 1KOLA 3R3HA 3N7TA 1C0IA 3IQXA 4FYJA 4DCVA 4EPVA 5CDGA 1P3DA 3EZ6A 2WHQA 3HWRA 2YUTA 3TDNA 4FNMA 1VE3A 1HL7A 3KAQA 3QPWA 4GRAA 3RARA 4GKJB 3OM1A 2XCRB 1L5NA 4Q7JB 5AJXA 4A8PA 3C5VA 2WIJA 3GB9A 4AYXA 4BFXA 5JIBA 2D74A 3P27A 3KQNA 1LY1A 3EOBI 2ID7A 3GARA 4MO9A 4Q4AB 5HUQA 2JHPA 1E99A 3D8RA 4Q9HA 5AKEA 2IX9A 3KR2A 3IX7A 4CLDA 4CR7A 2O5VA 4I9NA 2X8WA 4B84A 2R8EA 1VGRA 3NBYC 2C4KA 5ALFA 3QY9A 5BUZA 3TQCA 3UCFA 1NPTO 1XHLA 2W11A 1FFGA 3RVNA 4WPGA 2IA5A 5LJLA 3T9BA 1WHTB 1K0FA 2Q1UA 2H5JA 3NAQA 4L5CA 2XRZA 5AWFC 3DE6X 2ZT7A 1V6CA 3CLRC 4UUMA 3VPGA 1QIGA 1VE9A 3R75A 3ZE2B 1RYFA 3NMUF 4J94A 1DRWA 3SPXA 5KQRA 1Y4AE 4JB2A 3EEBA 2B7BA 2PLRA 4BN0A 2ZRJA 3OX1A 1P3Y1 3V9PA 4CMKA 5G4KA 3RYFB 3HJHA 4WGFA 3CMMA 1O97C 4M0CA 4XJVA 2EWMA 1SCQA 4WBNA 1M8PA 1OLOA 4I50A 5GV8A 3IT2A 4R51A 3V4SA 1BXGA 5ADUS 3DZKA 3W90A 2Q46A 1I14A 1MC8A 2BP7B 1W4ZA 4JU9A 3QRWA 3KT3A 1GN9A 2X6RA 3NV9A 2E37A 3ZEAA 4B3BA 4D02A 3VR0A 5A4KA 5EJ7A 1UT8A 5CK4A 1QKIA 2CFSA 1HLFA 4A6EA 5DNWA 3PT9A 4O5AA 3GMSA 3KSBC 4IH1A 4KU4A 2O2YA 2XSZD 1NF2A 2ZZNA 1SM4A 2PD4A 4MKHA 4MS1B 5FTLA 4X9XA 4QJ5A 2HF2A 2O4CA 3NWJA 5HXAA 5I51A 2ZS8A 3P0RA 2ZWVA 2PT6A 721PA 3I6ZA 1PIWA 4ND4A 4TQAA 4EO7A 3OZUA 3VZBA 1NURA 4E22A 4JASB 2B82A 5DYIA 3ZBUA 1XU7A 4TGLA 5AOVA 4KJZA 2QPTA 1FUUA 3C41J 4IOMA 5EWMA 5K3AA 4BB6A 2XVAA 3QXGA 3P0IA 1ULAA 3AR7A 3LCRA 5KKCA 2XCIA 2YCBA 1JA0A 2W6MA 2XRMA 3G5LA 2QEQA 5JH7F 2J41A 4GECA 3RBAA 3EBPA 3BBPA 5FEUA 1DWPA 2WJIA 3NHFA 5KHAA 2OYSA 1X0XA 3JWEA 3L7IA 3DZDA 4MQUA 4QOFA 5GPBA 4DWVA 1VA5A 5DI9A 3T1TA 2CXRA 4OJNA 2JFHA 1C0PA 2W42A 3UXYA 2CVQA 2AN4A 2FLWA 2PGAA 3A6GA 3C7TA 2KMLA 1GGMA 5EIXA 13PKA 4Q12A 3OTQA 2VNJA 1IRXA 3V80A 1K4KA 3GGGA 2QN8A 1FYEA 2GZAA 3N8IA 1BE1A 4IJ5A 1XOIA 4P5PA 5A3JA 1FVOA 4Y2JA 5MN5A 1E96A 1G8KA 3WDMA 1JBKA 1NFRA 2MSNA 3PGKA 3N07A 1F2TA 2X7HA 3N8GA 4F9FA 2OAEA 5L3VA 3GH1A 8MHTA 5LB2A 5F33A 1V1JA 1II0A 1H1LB 3HYRA 4FTWA 5L3SB 2Y92A 1SGWA 2CF5A 4MHOA 4MVYA 5C8VA 4RSRA 2FWMX 1AF7A 4RK1A 5AKXA 3GDWA 2J48A 1GZ4A 3BZUA 3IP7A 4URHA 2QW0X 5FLYA 2JHFA 2OHVA 4FE3A 5THKA 2CFTA 1BHSA 3TBKA 3HVIA 1ECPA 4FX2A 3LL7A 1ZY2A 2D2IA 4XPIA 3K72B 1WDMA 5JWHA 4OMCA 1QHHA 2JHAA 2QD2A 1HYHA 3X43A 2L18A 4IM7A 4AI6A 1DQPA 1Q7GA 2IYAA 2IZ7A 1QTNA 1T9BA 1DFGA 2ZJZA 2BHNA 3GVXA 1YNOA 2FI1A 3A3PA 4K9PA 4DIFA 4DQVA 1CS0A 2ZE5A 3ASZA 3BTUA 3D6AA 4PM4A 4HGNA 4CKBB 1U7HA 4NE7A 2QUZA 4UEKA 3L7MA 3UAVA 3H13A 1Q91A 4BNTA 4YRKA 5JC8A 4C2TA 1QH0A 1T6NA 3LUDA 1ESNA 4ZVMA 4O63O 2BUBA 1LGYA 1Z4NA 3C74A 4Y9RA 2I3GA 4DIUA 1Q1BA 1QU2A 4LE0A 3NW9A 2GBLC 2EQ5A 3I37X 3LKZA 2Z0MA 3R24A 2RAFA 4D4KA 3E9CA 4FSHA 4NG5A 4DTCA 4JFRA 3QLVC 4A23A 3GGJA 2NT4A 3SK0A 3ZDRA 1KJYA 1GP2A 4X00A 4US0R 5K3FA 2AW3A 4KRFA 4WCDA 2W6QA 4TMYA 3RGWS 1QK3A 1CUBA 2BMVA 4W82A 5IAGA 1E7WA 2D7DA 1RYEA 4OL9A 3V55A 1YT5A 2JI8A 2O2XA 4O02B 4DA9A 1Z26A 1RJGA 1IATA 2W2MA 3C85A 2G06A 3IBSA 5E0OA 5K3OA 5HZKA 3IKVA 4FONA 3JQ7A 2YWHA 3WA6A 4H0CA 4F72A 3AIMA 3H2IA 3TZKA 3A9UA 4OM7A 4PZPA 1PKEA 2AKAB 1OILA 2I1LA 2JIQA 4G9BA 4UM7A 4P32A 3X3HA 4B4UA 3T3EA 5LZ8A 1RJEA 2QVGA 2W6JD 5EXTA 1YF3A 2OV8A 1FYXA 3EVDA 4LI3X 5FFNA 4B44A 1TM7E 2Y2VA 1N36B 4WJKB 1KDRA 1E3JA 2XBMA 1K4MA 4I2NA 2H5LA 2F8LA 3JCZA 4RLFA 3OIFA 2WPDA 3A32A 4R2JA 4YJHA 3RRBA 4DJFC 3WC4A 2Y4OA 4YRRA 1U7WA 4GBMA 4IHJF 1HX7A 1H2XA 1TVKB 3W3AA 4RO0A 3HUUA 3G0DA 1G41A 4LJLA 2WYIA 1GV0A 2XNHA 2YWBA 2Z2KA 1S7GA 2ZRIA 4FN4A 4X8HA 3TCXB 3X1MA 2HHAA 1RXIA 4Z54A 4LF4B 2C8VA 1SVLA 3U13A 1EGHA 3A1UA 4K88A 3NHRA 4OHVA 3UHAA 2X6QA 5HKOA 5CEJA 2PGDA 4FFBA 2PGLA 1V5IA 1ZD3A 4F4DA 5G0SA 4R31A 1RJ9B 4B87A 3IBGA 3OEWA 5FBVB 4JVMA 4R3WA 3ZWCA 1JQ5A 3UAXA 4JSRA 1MVOA 1LK7A 1Z37A 1XRNA 5A3SA 4CIYA 3HPRA 5CIYA 1CE8B 2Z2YA 5TSDA 2C2WA 3ICEA 1Y8CA 4K86A 2ZPUA 2H4ZA 1A69A 4F3KA 4YXWA 4JLNA 1TLTA 3VR4A 3KTAA 4GE3A 2MOKA 4DZTA 2HLNA 2RGEA 1E9FA 2ZQZA 4B46A 2C7VA 4RD3A 1AS3A 3VNRA 1CW2B 4IFEA 3KYIB 1RHRA 3FETA 5FV7A 3D4IA 4CT5A 5EFOA 3S2YA 1H2HA 1NYRA 2RIPA 1RYHA 4YUVA 1KETA 4DNOA 3W2GA 2YICA 5CPFA 5F73A 1B41A 1QGED 3HGMA 3ZHQA 2HQSA 1GAWA 1P2VA 1VP9A 4MEBA 3A1NA 1WXGA 1ZGBA 1CNEA 1UFRA 2REQA 3K1ZA 2M1XA 3Q3IA 4N6GA 3UA3A 4CV1A 1YK0A 1ZGCA 3ED1A 1GT6A 2VRCA 3TQQA 3VBCA 1QHSA 3BCUA 4GRDA 4JA2A 5JSHA 1B1CA 2P68A 4QZVA 1JDZA 2ZSBA 1N75A 4GM1A 4I4LA 4QXOA 3KYDA 4N18A 1WULS 3EZFA 1KDPA 2Y6UA 3BH0A 4DSTA 3P9PA 5A5GA 1AK9A 4PHCA 2WJ3A 2YIVX 1QB8A 2E6UX 1ST2A 4B3RB 1I7SB 3DHNA 2G83A 2WWWA 5CK5A 4LNUB 4ZZ1A 4U7TB 2D0PB 1WSAA 2G17A 4QEDA 1F17A 1U7OA 1M8FA 1KI1A 4FYWA 3KQMA 4P3XA 1G21B 2JARA 4QPZA 2AI3A 5F64A 3MXOA 3HA5A 3TBHA 3UUEA 5IUKC 4RPGA 4A8TA 2Q2VA 2EFYA 2WDZA 3D4PA 4IG9A 2Z9DA 4FVTA 4MVJA 3ZU2A 4JXKA 1OX4B 4HS4A 4CXMA 1U2DC 5ALIA 3IDOA 4OBEA 4DBLE 1NNI1 4E70A 1ML4A 1KQPA 2I3DA 1WWKA 4KITB 1Q0QA 5DW0A 2YNMA 1EFPB 4D3YA 3K0SA 3N7UA 1JA1A 1XLVA 5PGMA 5C5DA 3T0GA 4L78A 4EUKA 3AERB 4N65A 4BLQA 2B61A 1IPEA 2WYHA 3B2QA 4UNIA 3GPLA 2XR1A 2DY1A 1XN1A 4RMGA 5JISA 1VPLA 2CYBA 1JHMA 3E8XA 4LMPA 1T4BA 1VFPA 3GMIA 3LU1A 1X42A 2Y05A 4HG2A 3ZHOA 1CUUA 3HXPA 5LBIA 5TX7A 1RD4A 2JIBA 3KZCA 4AO6A 2WUVA 3B6ZA 4CU5A 1NX9A 1HR0B 3BE5A 4DAOA 2IELA 2WD7A 2ZDGA 3F90A 1VTKA 1Z39A 1LNQA 3Q8KA 2W2VA 1COWD 3OZGA 1DOHA 5B2ZA 3ZXYA 3Q2KA 2R6DA 2JC3A 2CYAA 5KTPA 1KYWA 3EEYA 4TTSA 4U8HA 3F6YA 4RPIA 2ZPAA 1PJCA 2JIDA 3BGOS 4COOA 1UQTA 4OHFA 5CNJA 2PZLA 5GWXA 3UB2A 2PMFA 4ND1A 1RKBA 1G3RA 2BY4A 4BOYA 1DAFA 3SR0A 3NUZA 5EXPA 2E85A 1CG6A 1PDVA 3B1KA 3EISA 3IJPA 3ONFA 3QUBA 4REQA 4GMXA 4PXSA 3DHEA 2C7QA 3GRUA 1FS6A 1YS1X 1NP3A 1HYBA 1U3UA 3U6BA 3OCZA 1Y8AA 4YONB 1IHPA 3EW7A 1SU8A 1AJEA 1EP3B 4BFVA 1SB8A 3T9AA 4FEGA 4AL4A 4ZVTA 1TW3A 1PJ8A 2CMFA 4I08A 3TGLA 3JARA 1PLJA 1I6MA 5E8RA 1CUYA 4YRZA 2JI9A 3ESDA 4HNTA 1JEQB 1F7UA 1WF6A 4DRYA 5JNRA 4RMIA 4YRSA 4KSBA 4PLCA 1N0VC 3PDJA 3HV0A 4ZWNA 4FB4A 1BO6A 1PSZA 1Q7TA 3NI2A 4Z4QA 4XM2A 3FVTA 3E9DA 2XAUA 4ZT2A 4X8LA 3DKVA 1E2MA 3QVJA 3VOBA 3ZCQA 1UDRA 4C78A 1NMQA 4WD3A 2CY0A 4QX6A 4GLJA 4E5MA 4BNWA 2B83A 2QRMA 3HCNA 2HLDA 3K7EA 1XKLA 1KVTA 3CW8X 3TIGA 3LO8A 2LZ0A 3DV0B 1TQDA 4W8HA 4E5DA 2CBZA 1N5DA 4MHSA 1MC1A 1EZZA 4ZGGA 3HMKA 2K6GA 3BTOA 4P7GA 5ALLA 4AZTA 1SCIA 4IDHA 4EUSA 8GPBA 3TQFA 2EZ4A 1DE0A 3G8CA 3D5TA 3KU1A 2AFIA 4Q3DA 2A0WA 3DHYA 4XWYA 4N0DA 4HF7A 4YTEA 3RCBA 4X65B 1XJ5A 4CM9A 2GCOA 3FLAA 1NQUA 3HB1A 2VSFA 2WD8A 2A9OA 4JCOA 4KB5A 4KGDA 4QYXA 1EX7A 4FU0A 1H2ZA 1ZNZA 4AN1A 2CFIA 5HIAA 4I55F 1Z38A 3OZDA 5C8YA 3FOBA 4O4IA 5HCIA 4A1FA 5EZYB 5CLGA 1B0PA 4U2DA 4X1YB 1DG3A 4M9CA 4PAOA 3K0FB 1JXOA 1KYZA 2P2LA 2PXHA 1V8FA 1U2ZA 4AWBA 1MU0A 2H7XA 1DKNA 1TYEB 2XXJA 1Z2NX 3I1YA 2AJ8A 1Y7PA 4BFZA 3WYDA 1W85A 1UP7A 4XDYA 1YE5A 1P2BA 1DRJA 1HWYA 1I3LA 3OT1A 4MUHA 1P3JA 3PR3A 4QU0A 3K9BA 4TYQA 5CU7A 1Y3HA 3D02A 3AVYA 3RWBA 3L7YA 2Q3HA 5BVHB 3RS5A 2QJRA 4ZQCB 1E6WA 1MX3A 2C07A 2RGNC 4ZEMA 5HUJA 4EB6A 4D3SA 2PM8A 1EFLA 2E21A 4PQEA 2YYYA 4FJ1A 1D1SA 2PCJA 2QUJA 1JFLA 3RAJA 2QJFA 5DE3A 3TAUA 1ZCBA 1KI3A 2W93A 3EMBA 3NHWA 2H52A 2XD9A 4BGEA 5LBTA 3D3JA 1GLNA 1DKMA 3B1FA 4XXHA 4RH0A 3KALA 4S05A 1D1TA 2GR9A 3COYA 2E0IA 1OXSC 5HWSA 2QYTA 5I4KA 1K2WA 2XEXA 3GAFA 1DKRA 1ZKDA 2JZCA 3ETNA 2GHQA 1B8PA 3PUWA 2I1VB 4R8SA 2GF9A 2A30A 4C2UA 3IC5A 2C0QA 1XF1A 1A77A 1ZG3A 3O82A 4O2AA 5DTRA 3TPFA 3AZPA 5G4KB 5B3JC 1EWQA 3U3ZA 4ND3A 1SXJC 2HIGA 4PSKA 1GKKA 4DG5A 1EUCA 3OD1A 5NULA 1BRMA 4XVRA 3DR3A 3H8WA 3UOWA 5JY1A 1VGVA 2R6FA 4DF3A 5KIAA 3LUGA 3BTSA 3V00A 1UIRA 4TV9A 2FPGA 1BXGB 2JASA 3NVDA 3TTTA 5IANA 4WBSA 4QUGA 1G9TA 4B09A 5A0VA 3HC7A 5CH3A 1DJMA 4G09A 4GX2A 4GGOA 1IN4A 2A78A 2CUNA 2DWQA 4C0QC 5B1YA 2C3PA 5J9FA 4AURA 2MWMA 3PQEA 1J1UA 1ECFA 3AR2A 4D9HA 5KDDA 2H7CA 2XUOA 1T91A 2WM2A 3HUEA 5LNK1 4EHKA 3IP9A 5LQAA 1X7WA 4BNMA 3GJ8A 1TDJA 4FDAA 4EI9A 1R3UA 2HA7A 3HN6A 4JU8A 4OLHA 3FIUA 1GR1A 1GDDA 1O96A 3KTOA 4MMXB 2W48A 2FVXA 4R84A 2V6MA 1T25A 2VYVA 1CF9A 1ZUWA 3V1TC 3OTOB 1EINA 2FEWB 3NBZC 2GQ0A 5A4DA 3D7NA 2PANA 1A9OA 4ZGWA 1HZJA 1O8BA 3IVGA 4EW6A 5BN5A 3VA7A 1PVDA 1MFZA 5EWMB 2VHXA 2A9PA 4MULA 5TJ9A 2P6OA 4E7PA 2QNIA 5CT4A 1U04A 5JW6A 3NDIA 2MMGA 3T7EA 1QIEA 4X97A 4X85A 1YC5A 4IVRA 4BV9A 4YQFA 4ZOCA 4CQLA 1ZD2P 3L2OB 1NXXA 1XWFA 4P4UA 3UVEA 4BE9A 3COJA 1RRGA 2BGMA 1Z7BA 1QWSA 2A0XA 2XX3A 3HZZA 4IDFA 4UATA 1Z5PA 5DBOA 1LDYA 2RKBA 3WICA 3ZWDA 1NM5C 4B6SA 3EVGA 2J9FA 2R751 4C43A 4MS3A 3RVRA 1HT2E 1PD1A 2A7XA 4X7BA 3AGQA 4YAEA 5LP1A 1ZM9A 4ZA2A 3ND9A 1I01A 1IN7A 1C7RA 1D6SA 2CVHA 3SCZA 5MGBA 4HATA 4A8HA 4AJHA 5B58T 2JLZA 3V8VA 1JDNA 2I87A 1FCJA 2TSYB 5CFZA 3JW8A 3L79A 5I4BA 1JAYA 1F2TB 3G7NA 3TOXA 3WSWA 3EXEA 4I5GA 2VNAA 2IX3A 2Q9CA 5D00A 3RUCA 1N7IA 2YVQA 2QP3A 2ZJ5A 1GQQA 3I09A 4FP9A 4DB4A 2FCRA 3KHUA 1QGUB 3HY3A 4RENA 3EBOA 2CYCA 3MD9A 3QVXA 4BNKA 3NAZA 3CV3A 1XTBA 1ADFA 3GRZA 4XPIB 2XB6A 3DLPX 3RF7A 2A0KA 1U6JA 1QHHB 4PGGA 2V1XA 1USUA 3O93A 4AMVA 1JTEA 2Q6TA 4YV1A 4ATNA 5E1OA 1W2GA 2NZVG 3Q8MA 4IOKA 3PFBA 4V39A 3V2UA 5I8WA 1S3IA 4H16A 4OFXA 4YCLA 3VYSB 5I3ZA 5I9BA 1Q6ZA 4DAEA 2WM3A 1EWVA 1EVLA 2PNJA 1TI7A 4BZZA 3HL4A 3MTAA 2Y1XA 4XDGA 3TE7A 1E59A 1NC1A 5AHXA 4E0BA 4E1BA 2CMDA 3AXTA 4FKZA 1BROA 3KEMA 4P9NA 2YRWA 2XAAA 5JJKA 1QC5A 3IEUA 1V9LA 1P0MA 1V37A 2C8JA 4HAUA 4BO7A 3P71T 5DASA 4XAQA 1RWVA 3G8BA 1TQ6A 3HTXA 2ACKA 4CQMD 4DGQA 2WWYA 3D64A 2AL7A 1EDEA 2PO7A 1NMZA 2OQIA 2Q3CA 1WZNA 1NLFA 4DR2B 4OQLA 5K3FB 2BI4A 1R0KA 2XGMA 3TD9A 3Q87B 2WAAA 3CE9A 4ZZ0A 3KJNA 3PYLA 1K8RA 2AEJA 4TMXA 5ILOA 2P9BA 4DMMA 3UEOA 3R7BA 3WJ7A 4A2WA 4GX1A 1T5SA 5JWOA 3TK1A 1RWXA 3JQ7B 3Q8WA 4GBJA 1T8RA 4TTJA 4EA6A 3FWKA 1FXWF 2OZKA 4XD2A 3ZWNA 2V7GA 2FZ4A 3UJAA 3ET5A 4WCFA 4YMTA 1IVSA 3BB3A 3M4JA 1IUPA 3M0EA 3K1AA 4OXKA 5E6SB 4JP8A 3F5MA 3SQDA 1SKYB 3AR9A 4M9SA 1O95C 3LUFA 2Y4NA 4HSGA 4FNOA 4I9FA 1WABA 4JBHA 4QJBA 1M73E 1SXIA 2PL5A 1ESZA 3PTZA 4PR0A 2V4ZA 3ZCUA 3K0BA 4OMUA 2ZBEA 2F55A 3KSMA 4A16A 4JJEA 2LCQA 1JJFA 1JJIA 1PJ4A 2XDQA 3KTDA 3TH5A 2HJWA 1L9KA 4EKNB 3FOCA 5HQ3B 1Z3IX 1WLSA 2C00A 1B15A 1LB1B 1NRXA 2GPNA 1V47A 2WFLA 3K15A 4TWJA 5C0OE 3GAZA 3HV2A 4INJA 3TWOA 3BE4A 1SQFA 3OC6A 2OYCA 4MR8A 4ZOLB 1R50A 4G07A 3D7SA 1A2BA 3OWXA 3IEVA 1NJ5A 3OOYA 5JMOA 5AUPB 1B42A 2WTEA 3MWEB 2ORED 2DH5A 3GAAA 2WF8A 3WK7A 3FPLA 4CMEC 2J4FA 2QRHA 5EGNA 1E2KA 1B93A 1L7AA 1RW4A 1NQVA 2PD3A 3WKBA 3MGGA 4XYGA 4OQMA 3DAGA 4NP6A 3EGIA 3VVCA 3AF1A 4M7WA 2CNWA 3IBFA 3UO8B 1D6NA 1F4LA 3TECE 1KZHA 1ESEA 1Z6QA 3LMKA 4HTFB 1MQAA 3VO1A 2VBGA 2IYFA 1ZRMA 1FUYB 2CHVA 4ZVOA 2M32A 2QV0A 2WSMA 3PI6A 4HFMA 3TXXA 4J9UE 3PFFA 3KTAB 4DXAA 2DT5A 4F8YA 2A5LA 1N92A 3B70A 4N40A 5EJMA 5DNEA 1L5HB 1BQ3A 3VQTA 4FOOA 1GLGA 4TL8A 3VR6D 3D3KA 5JRDS 1TC2A 4LTMA 3MBKA 4CN9A 2K4MA 4II7A 3K2QA 4IJWA 2VCYA 1YKSA 2IUYA 1DRVA 5T8KA 3ZY2A 3DF7A 4XGRA 5HFAA 1JSZA 2OZLA 3A26A 2REQB 2G4LA 3BSSA 5LC1A 1E4OA 3Q9SA 5ILQA 4LBYA 5DGDA 5B2FA 1EJ0A 5H68A 3WOHA 1HM5A 1CV2A 4W5QA 1QRSA 1JDBC 2A1UA 3JTEA 4QTUB 4XIGS 4JI0B 3KYDB 4F5WA 1X80B 4KVAA 3K8ZA 3TW0A 2HT1A 2O52A 4F92B 5BT9A 5I5EA 4CQNA 1VB3A 3HCWA 5BOSA 4JYZA 2HU2A 2HWKA 2ORIA 4Y3UA 1C7JA 1XQXA 3WOVA 3MBOA 4D56A 1T1EA 5IF9A 5KNCD 3I5XA 3GFRA 3EUWA 4QTTB 4EABA 1ZJ6A 1OWNA 2G9NA 4Q4HA 3NRCA 1W44A 1US8B 1OCEA 1SKAA 1UMCA 2HREA 5ULLA 2I66A 1L7DA 1PS8A 1RWKA 3PR2B 3ACDA 2H2HA 3IS3A 4KSYA 1WSBA 1GDTA 2ZSFA 2GAJA 1EPUA 1Z15A 1BA2A 3SFVA 1YIOA 2O23A 4DLWA 5LYJB 2ODNA 5E9JA 2FOXA 3BD7A 1EGAA 3E5RA 3KO8A 2YMLA 1UKVY 3M6VA 1M7HA 3D4OA 4YCJA 3B6MA 4B3TB 1E9SA 4H4CA 4DDWA 2ZRQA 3K16A 4LYFA 3UFXA 3A11A 4BTLA 4TN1A 2E87A 1AUPA 5BUQA 3ABOB 1R6VA 3X1DA 3MLEA 3U5TA 2ZCUA 1L5LA 1MGPA 2HNBA 1TC1A 2ZSUA 3DOIA 4WZAA 3AYXB 3PEYA 4CFZA 4BPBA 3P0EA 3RKUA 1N2HA 3WRYC 4K1LA 1EVQA 2G9ZA 2H2IA 1H2RS 3VR2D 5HJ7A 1P29A 2OV1A 1M9NA 5FO1A 4FYIA 2M2IA 2XI4A 3CMCO 3MERA 5DLYA 4CLHA 4IIEA 4F1KA 1ZOOA 4JYBA 1P61B 3W2IA 4RY0A 5F2NA 4NXMB 1X86B 1KZ9A 2WD7B 5K0ZA 3HCEA 1MORA 3W4IA 4LC0A 4HQLA 4QRDA 1D4FA 4QU5A 4IHAA 4B3XA 3ZDFA 3BB1A 2ZYAA 4YV0A 2I4NA 2EZUA 4AMYA 4NJOA 5HM6A 4DADA 2PT7A 3N2GA 1S2GA 2FN7A 4LKRA 3TTXA 2EG9A 1H2BA 2O6LA 2QX4A 3L93A 1G3QA 3OEYA 5JYDA 1EFTA 3DZHA 2WTAA 3PNSA 1R0RE 1E4YA 5JSZA 1USIA 3NKFA 1CZOA 4L9SA 3VI3B 1ZSVA 4F5YA 5CURA 4AS3A 3U0VA 4DY6A 4REQB 2IXBA 4NCHA 4JI1B 1P62B 4H6XA 1O6FA 1QZUA 3AC0A 4KPEC 4H60A 5C5IA 4FE4A 2GI4A 4BNGA 1GQ2A 2FN9A 2P62A 2ZOSA 3FBTA 4YAIA 5CNMA 4KFRA 1Q1EA 3GA7A 1N5IA 5ESXA 3EJ6A 3X2FA 2LDBA 3HWSA 2W58A 3KHTA 4H4EA 1NA5A 4H31A 4K03A 4XFKA 3KSAC 1GAQA 4AKTA 1QIMA 3JARB 1A97A 1U0OC 3ZHCA 1MB2A 2BMDA 5M29A 1W29A 3PP8A 4PLPA 3JVDA 4YASA 2ZUTA 4ZXPA 1NQWA 4UTOA 8OHMA 2QRZA 4NZZA 1ML3A 3O4JA 1A5BB 4C05A 5K99A 1P2FA 2CZCA 1XMIA 3BICA 3E18A 4JI2B 1ZK4A 1ZXXA 2G1KA 5JS7A 3EZ7A 1SC9A 3FUUA 4L4RA 2WTBA 1VI5A 2ZU0C 2ZB2A 3ZVKA 4JBXA 1V35A 4RJIA 1M67A 3IUMA 4UCFA 4KOAA 1NJFA 3TKLA 2RGUA 2VPPA 3Q3HA 3RNLA 2LWIA 1Q0TA 4U7WA 1ULZA 1YQWA 3L18A 1C7ZA 2O14A 3OZTA 4L51A 4G4SO 3MRVA 1LSOA 3OLWA 3VNAA 4MRRA 2YUIA 1M0WA 3F5DA 4D0SA 2J0VA 1YZKA 1C9DB 2X13A 5M3BA 2C2KA 2PLAA 4A82A 1T6BY 4X20B 5JFOA 4KHPB 4ZT4A 3ULKA 3RIEA 2HSEA 3FUWA 3STXA 4CT0A 2AFIB 4JSTA 2H59A 4EG0A 4G41A 1OBVA 4ZHSA 3G2IA 4R1NA 1WKCA 1YCHA 3T94A 2FSIA 1XZPA 3HKEA 2QXTA 1IY1A 4R01A 4Y1FA 4UQLA 1KY2A 2WJJA 4OAOA 2JFGA 3FGPA 3JWGA 5C8YB 4JLMA 2NUTA 2QHXA 2PS9A 1A5TA 3UMJA 4MUXA 2ENWA 3FWPA 5DRTA 3DFKA 4F86A 2ZZMA 3LT5A 5ITWA 3CEHA 2G8LA 2ZITA 5CB6A 1UF9A 5BSWA 1AK2A 4FYXA 5I9NA 3FPFA 4JBWA 1SCBA 5AHOA 3IP5A 3MQFA 4AECA 1W85B 1EFRA 2XJ9A 2J5XA 2A4KA 1BN7A 3OT1B 3RVBA 1PU2A 4N5IX 1KI7A 2VT3A 1OV6A 1AKNA 3K70B 2W7TA 3R3XA 4LY9A 1RJDA 1FXUA 3W7VA 2B1QA 3O95A 2IDZA 2ZJ4A 3RAGA 1GTL1 1XD2B 2D1SA 3I4CA 4Q7QA 4QAQA 4OLJA 1UP6A 2ORWA 1CUCA 4EB6B 3CTMA 2I6UA 1Y1PA 1D2NA 2P0YA 2CC2A 3UUGA 1Z0KA 2MYUA 3BBLA 3EQ2A 5K2MA 1RHJA 1KIMA 3DTYA 4PWZA 2WJYA 4D26A 4C06A 4GIBA 1WB6A 2NACA 1JYSA 3HKDA 2Q3BA 4IG4A 3NHAA 1NNUA 5DF1A 3NIGB 4GVXA 5AW0A 1H2EA 4QYMA 5IT9A 1WOYA 3L4BA 3OMXA 4M83A 2GNOA 5A2QA 3OJCA 2JW5A 3C2QA 4A92A 4Z8XA 3R8XA 3WIVA 1NC3A 4O2AB 3FGNA 3KXLA 1Y8QB 4L6AA 3WMFA 5BPFA 4BLRA 3DYBA 3PHLA 5EIEA 1EUCB 4W1PA 2YFYA 2Z30A 3C15C 2GN6A 2G09A 2NNLD 3GT4A 1OTXA 4MH0R 3DMTC 4TV9B 3SJAA 4NX2A 1ATIA 4PCUA 2P1RA 4KWCA 1KGSA 2PH7A 4PS1A 3TLJA 1T0BA 4KPUA 3KJFA 2WKPA 5JXIA 2ZT8A 4IQ4A 2F3TA 2DBVO 1V7PC 3DT8A 4RK6A 1UCFA 3KV3O 4F97A 3PR1A 5LLTA 1TZBA 5AI0A 4UFPA 1Y5RA 4OG2A 5JHHB 1YH3A 3JD1A 1X7WB 2DJIA 2NGRA 3P1JA 1BD3A 4YCSA 5AVUA 2IPAB 3E6AA 3U44A 4QDOA 5DSXA 2AR7A 3H86A 1O96B 2W0SA 1FP4B 4RJKA 1ADYA 3TJMA 3I58A 2AHOA 1BGXT 4CE6A 3QYAA 3PHCA 5EPEA 3CXUA 4EJSA 5J43A 4EHBA 5CG1A 1W34A 3ONDA 1ISMA 3A4YA 3OPYB 3NEJA 4D98A 2CLOB 4MAFA 5BN5B 4AAYA 4CN8A 2NO1A 3RYHB 3JS5A 4WKBA 3GFVA 1T0HB 2IOQA 5TT1A 2F6RA 1R0XA 2RK6A 5B4UA 1ZU4A 4K9MA 3O2JA 3NB0A 1O89A 3I72A 1F51E 1Z28A 3G2NA 4BUZA 4CHGA 1R4MA 3AV3A 3QVOA 4N3NA 3WHLA 4CQLB 3L4BC 1JJBA 1A9PA 4TUYF 4O4LF 3QY0A 4J7UA 2I67A 3UQZA 5B1IA 5K9ZA 1AOXA 3S5JA 1TUBB 2YHIA 4IL5A 2H2FA 1H85A 1F8UA 2J9FB 3F9IA 2I2FA 4MS3B 4B2LA 3VV3A 2C9CA 4HVLA 3ENVA 4DV2B 3FMIA 4KIGA 5DJ5A 4LRWA 4YBZA 1WTCA 2H4HA 4N7MA 1OAOA 1K5DA 5E1BA 3UXMA 4MA5A 2FEKA 2O19A 2QN7A 5ILGA 4YPFA 1B16A 5LA6A 2A14A 1PFVA 3AB8A 1C3LA 4OGLA 2WHYA 1UJ5A 4IO1A 5AQ1A 1NJGA 3HDQA 5DGHA 1XU4A 1EGVB 3WKEA 3T1YB 1V11A 1CY4A 4BFYA 1SKQA 1KOFA 3ONWA 4JLJA 2XMBA 3QF7A 3RB8A 4ZYTA 1GYRA 4NECA 1ZGGA 1UBEA 3RC1A 5KX5F 1X39A 3IP1A 4IDAA 4RLHA 1X38A 2NM0A 1ORRA 2YJ3A 2Z98A 5CH5A 5E95A 5ED4A 3AI2A 2VN8A 4WKGA 2QI9F 3L4EA 4M7OA 2LV8A 4P2BA 2XTAA 3UB3A 2QQ0A 4BBJA 1P1JA 2QKYA 3BWEA 3HCPA 4EJSC 3VUFA 3BM5A 4BMDA 1XVLA 4R5MA 1XO1A 2H1OA 3WZLA 5F7ZA 1Y0BA 3O21A 4G89A 2UXBB 2O3TA 1UBHS 4JIGA 1BKSB 3NVKI 3IPXA 3VC2A 1GDHA 1DIHA 2FKNA 5A6SA 4M86A 1BMFD 1NSYA 2GDZA 3PDWA 4G9EA 4I6GA 2FF5A 3ZWXA 2O5EA 1BVHA 2DVMA 2WZBA 4JODA 4OYYA 1NW9B 3QX8A 2RHHA 3ISTA 4JBIA 4RF4A 2PZGA 3HI4A 3QF4A 5G1NA 4Z7OB 1PX2A 1QC5B 1MTOA 3STWA 2AQIA 4P6VF 1DJLA 1RCTE 2WJZB 4IJ6A 2HMUA 2IIBA 4JLPA 2BUAA 4KI0A 4UZFA 3IUBA 1XPRA 3B8EA 3ES9A 1ND5A 2FZEA 4HGRA 2JBWA 2VNIA 1KSJA 1ZQ1A 2ZJFA 1ISSA 3VZPA 1G4HA 5HF5A 2DWOA 3SYTA 1HBJA 1PSWA 3ZUPA 1KP9A 3A9TA 1J24A 1OC2A 2JAUA 2DX7A 3IEKA 4JUAA 1DPFA 3NATA 5CDFE 5CFOA 4CL8A 1EGMB 4RKYA 5A05A 2VA8A 4RSMA 1L9XA 1XZ8A 1XTVA 3GZTB 1EI9A 3GVCA 3HCRA 3RREA 2JH9A 2DQ4A 3HLTA 1BXRA 1FJHA 4D99A 1EDOA 3K1AB 3KSDO 2H2WA 3UUWA 3VTAA 1QHIA 3U62A 3WIOA 4ZO9A 5AD1A 2CV0A 3IVAA 3U1VA 1BWQA 5E3HA 1G60A 4OSEA 5AW4A 5IT5A 2VR1A 3OLVA 4QDKA 1V3TA 1WMAA 2A59A 2XDQB 1JI0A 2IZ5A 4MMYB 4F5DA 2R2AA 2WFLB 1SVNA 3PQ4A 1GTJ1 1I2AA 1OSNA 1T9GR 4BLOA 3B1WA 1NN0A 3IA7A 3WRWA 2HBRA 1ZBQA 3RANA 3SVZA 2YQ5A 4MR8B 1VKOA 1Z34A 3LLSA 3CWQA 4C0BA 4BJ6A 5IAKA 1QOQB 1RKVA 2DH6A 3LQ4A 2ID4A 3Q5DA 2Q3FA 3J81k 3RNOA 1F6DA 3NWOA 3LK7A 5H70A 4CJXA 4IRXA 4UBLA 2GXSA 1JIKA 3DFMA 5BSTA 5C1OA 3W6OA 2RAUA 1QE0A 1EXMA 2P79A 2YZKA 3D1LA 1XHFA 3G2MA 3PJDA 4MQLA 1BE6A 4P81A 1AO0A 4Y1GA 4CT4B 1X8JA 4Z7NB 2A6PA 4GX5A 1EBFA 3KU4A 3P2MA 1AUVA 5DGCA 1RE1A 4GMHA 2R0QC 1DXHA 1UAGA 1N8NA 4LF8B 1LI7A 4ZJYA 1K08A 1Y8RA 4HUTA 2V7UA 3CJTA 5ALEA 4JGBA 5IUJC 3JQ6A 3G0HA 1KU6A 1NVEA 3IQWA 1SZCA 1KR2A 2O3JA 2VKQA 4LPSA 1SBZA 4ZYXA 2K7ZA 1G21E 3NOOA 2HQBA 5G1OA 1DDOA 3C3PA 1OKKA 4XVCA 3L6RA 3NT5A 4TRMA 3PDIB 5CLHA 1RWOA 3RBZA 3R40A 3DOOA 1NJ8A 2RGRA 5DM70 3VYWA 5K3SA 1BU8A 3K9NA 1PLKA 4JLUA 3PQ6A 4IYRA 3VU3A 1OLUA 1E2GA 2Q5HA 3JQFA 1BKDR 2XQIA 3LXUX 3ZQ6A 1RWBA 4B6PA 2QXYA 1ZVKA 2OZLB 3CEJA 3NDPA 1GV1A 1NNSA 3KZKA 4EY6A 1H5QA 3LT2A 2E4YA 4HX2A 1WCWA 5EYPA 3HCBA 3PT5A 4K3UA 4GDFA 2B34A 1MJHA 5AVWA 3BMXA 2VTKA 2A1UB 3RRFA 5HHTA 4GOOD 1XPJA 1CEEA 4HP8A 4TTTS 3ZI7A 2UXCB 4BASA 2PJRA 1A82A 1KI8A 2EEZA 4WXHA 1OC4A 3NG1A 5BOSB 1WXQA 3QYPA 5AVSA 1WF3A 4HNAA 3K3PA 1YIAA 5F35A 3L3BA 5DOZA 3UPDA 3NEAA 1FDRA 2PL3A 5FL7A 1G7TA 2HSJA 3M33A 4Q4HB 2JANA 4UVGA 1OAKA 1XTRA 2A0YA 4HN9A 1AKTA 4RAQA 3V6LA 1Y6FA 1MQ9A 2F4VB 1DL5A 1YS9A 1QORA 1Q20A 2QTHA 3AYZB 3SLKA 1N3YA 4L15A 2C03A 1UPBA 3C1TA 5D87A 2G40A 1Z7GA 3CUKA 3IUYA 3KQSA 4RSGA 3AHJA 3UMBA 1AU9A 4B4OA 4EDHA 2O8EA 3IALA 2D7JA 3W1WA 2P2GA 5GONF 4OBWA 3ZGOA 1W5BA 3EGEA 4DHEA 3WWZA 3JWHA 2H4YA 3DW3X 3NIWA 3URMA 3ZXXA 1CUVA 1EP2B 4WZAB 4G1MB 4GL4A 2KWIA 4IRUB 4CCAA 3K9CA 5CA1F 2Y1GA 1NIJA 1ZMXA 1SR8A 3MUOA 1F4VA 1YR3A 4KLRA 4XQEA 2AR0A 3TFWA 2VWHA 2XT9A 3OPNA 2FDXA 4II3A 2GCEA 4MW0A 4BWYA 5LQRA 4NESA 4HOYA 2VK2A 3FB1A 1DS6A 1JHQA 1R4NA 5JDIC 2XYGA 2PTGA 2QD4A 3EG9B 4WKOA 5E7MA 2C20A 1YK1A 1JPNA 1T0IA 3NJ4A 1CX9B 4L4SA 2DR2A 1P5HA 4RACA 1Q57A 5J4VA 3BKXA 1LPMA 4UVIA 4CF6A 1UEIA 1NTRA 1ZN8A 4L3VA 3V4PB 4ZU3A 2MINB 3QBEA 3UXEA 3V1LA 3IE0A 2MSWA 1KWGA 1I3MA 4C2AA 2UYCA 4G0VA 4PBSA 5AM4A 4KQGA 2ID8A 3CLVA 3X1JA 2RJOA 1U9YA 4EY8A 5JSZB 2H7VA 1U7PA 2ZE6A 3L0BA 3TLXA 3VNQA 2XE7A 3M5PA 4KWTA 2QLJA 1A8IA 1O3YA 4EO4A 1NVWQ 3PWZA 2BPOA 4Y9SA 4Z9XA 1RJWA 1V2HE 4UD6A 1ONPA 5JCJD 3LQ2A 5FUQA 1TQHA 1PUXA 1TTPB 2FFBA 3I39X 2YV2A 3I9MA 4IGIA 2O06A 3N87A 4N1AA 4N7JA 2C77A 4WBNF 3BVPA 4GAEA 4B76A 1GITA 4DMUB 4DC0A 5IM4A 1FBTA 3TTSA 1AQYA 4PC7A 3DULA 4HLUC 2OO5C 3PHBE 4XWTA 1TEXA 5BQPA 5KOHA 1MO5A 1IL0A 3BA6A 2C92A 2GEBA 2IEZA 3FKSD 3IUPA 3JYOA 3BMQA 3C48A 4OMFG 3ZHYA 1B2RA 1Z4OA 1I3NA 1PT9A 1U0TA 4QU8A 3TPZA 3M5CA 1JZSA 4FNGA 1M6WA 4NXNB 4E13A 3CHYA 3HY6A 4TSKA 1II9A 2IL1A 2BFCA 1WZEA 2BGNA 2I8LA 3AUKA 2BE9A 3LBYA 4WNIA 2M6RA 4E5SA 3IAS6 4LZJA 5IKMA 2UZ4A 4MDFA 4FYVA 3MTBA 1TK3A 1N6PA 1G1AA 5SYNA 1BMTA 2I91A 3MJRA 1W88A 3X1WA 4NU8X 3V8RA 1J70A 1JKIA 1KO1A 2DWCA 4HRVA 4F5EA 1GA1A 1G42A 1P9WA 2ZVDA 4J8PA 3UK0A 1M1XB 1QTQA 2R6GA 4PPNA 5F7XA 1CZKA 2R8YA 4DQXA 2V7EA 3UF0A 3GLSA 2F1OA 4CMIA 1OWMA 2I80A 2PYIA 1D9ZA 5FNVB 1Z0SA 2NPFA 2VOEA 1T1IA 4LECA 3AEZA 5BXQC 2WEKA 5I3CA 5JD4A 1R00A 2ZIXA 1VXRA 2H1IA 4XIJA 1RP7A 4R40A 1L4UA 2NZUG 4ZVSA 4II2A 4QBTA 3ZD8A 3N3AC 2NUTB 2FFRA 3GI1A 4Y6LA 1GQFA 5SYMA 2WMYA 3LL4A 1L1QA 1YI0A 3I8OA 5G2OA 4FXOA 1MDBA 1U8EA 2RJ3A 3RVQA 4C04A 1INLA 4KIUA 1ADJA 1JLLA 1OWOA 3KZOA 3TW8B 4Z9FA 3UOGA 4QVGA 4TS1A 3HKCB 1IH8A 3MHPA 1C8KA 3SQLA 2Z5GA 1WSWA 3FNBA 5KTKA 1PJSA 2ALJA 4ETMA 2W2KB 1Y6RA 2YZ2A 3FFWA 1ST3A 1TMKA 4M1ZA 3W8EA 3KFLA 2GN0A 3OC0A 3D6JA 5I7AA 5TARA 2JJ2D 1QV6A 2CXQA 1IXZA 1X8LA 3KX2A 1FYWA 2RHMA 2VJPA 3BFJA 4G1FA 1S8AA 1W581 4L4YA 4XB1A 4DZZA 4KL8S 4MLDA 1JG2A 2PEZA 5TVGA 2YIDA 1RXVA 2VP0A 2ACEA 3LRTA 1T4MA 4MJ3A 4DVJA 5AVJA 2VHCA 1L5VA 3N8HA 2P75A 4PNZA 4YDRA 4C9BA 5I9IA 5JU6A 4XVHA 3ROFA 1C1XA 4CI0B 5CEFA 3EPJA 1E5LA 4PRKA 1YOBA 4H7JA 4C4YA 5JAPA 3VTKA 3D4BA 1TO2E 5LUBA 5CFLA 1O58A 1U5BA 3EWIA 5GJBA 4G0QA 1HLDA 1TF7A 2P6UA 3BHMA 4RJJA 1NI5A 4BP8A 3HWWA 2FR8A 4EVQA 1AB5A 3KC2A 2HU5A 2R6JA 2W37A 4S04A 2PX4A 2PVPA 1XDBA 3E8SA 1PT5A 2IJGX 1I7LA 4UCXA 4IS3A 1QJCA 2FQQA 3M34A 1VMAA 5K0TA 4NENB 3UHOA 2AOUA 4EEZA 2ZR7A 3MC1A 3AP2A 1PK9A 1J5XA 1HQYE 1OXUA 2HTFA 4GI1A 4PAQA 3SC6A 4Z49A 5B6JA 6GPBA 2AD5A 4RJTA 3ZD6A 4L02A 3DEAA 4KPUB 5BSVA 4LZAA 5IZCC 2OC4A 2VSXA 3I30X 2BLLA 4EYQA 4PTLA 3U56A 3LCUA 1NN1A 1E69A 1MJGM 3HVJA 4CODB 3IXLA 3GUVA 1ZA1A 1P2GA 1FTYA 3G13A 4NWIA 2PBZA 1UBUS 2XA1A 1F2VA 5CITA 1W0CA 1T3SA 1XZEA 1IPFA 1FY2A 5A62A 2ZIFA 1I0LA 2C54A 2IZ6A 3EXIA 3JD3A 4WEQA 4C1BA 4CF3A 2BEWB 3U3MA 1OU0A 1LW7A 1Y4UA 4YJDA 4EJSB 1C9JA 2C4MA 4MKIA 2PMDA 3GPDG 3E3MA 3UA4A 2XOXA 1IXSB 3WNDA 2G9RA 5DGIA 5EHGA 1YV9A 4R1QA 4BV3A 4HEHA 1CFZA 4E3ZA 3I42A 3H9QA 4OIMA 2WF9A 2C2HA 4FFNA 4OL0A 2JGFA 1YUNA 2W8BB 5AOBA 3C5CA 5K8CA 2NZ8A 1JU9A 2OGWA 3CNNA 3AVUA 4XOUA 3JAWA 4YFVA 1A8HA 3VKGA 1R4MB 3B6IA 2EU8A 4TZ6A 1JXMA 3R8CA 5EUMA 1DIBA 1Y3AA 4ZCMA 1SVUA 1J8MF 2EJUA 2V6IA 5BORA 4J6EA 1GVHA 5HKBA 1T2CA 1GTMA 2HHLA 2CJXA 3ZBPA 2I4LA 2YHIB 3ZQJA 3GLIB 1F8YA 3V2GA 3N3BC 2NIPA 3PC6A 3L8YA 2HO5A 1F3LA 2M6SA 8AT1A 3OQBA 1N4AA 3T7RA 2YC2C 1OI2A 1UQUA 1JDPA 3DL0A 3R3YA 4G5HA 5LA6B 4WXYB 2XBUA 3NTRA 3LHSA 4O2LA 3M82A 1SZPA 3O4GA 3R6WA 4YCCA 3RI3A 4YCBA 4DY4A 3AUUA 1BX0A 1V41E 1QPGA 3KNZA 3IKTA 3FNFA 4BQRA 4EYEA 2HCJB 4YQEA 3TXYA 2FPLA 4IP0A 4BB9A 4LCBA 3ETJA 4IOLA 4D9CA 1F2DA 2XDWA 5TMDA 2UU9B 2ILVA 4UW9A 2QIPA 3A1DA 3IAUA 2Y1LA 3NWEA 5FL3A 4Z9AA 4ALKA 5CFRA 5LU9A 3IELA 3L05A 4LWZA 3RRZA 3TLEA 3LW7A 3T7DA 3D31A 3VU1A 3H2BA 2IS4A 2C1XA 4RY8A 1HLPA 4UHBA 3C14C 4KRYA 2A92A 3QBJA 1KA9H 3AF3A 1KSFX 3K2BA 3DP9A 5FUXA 3VKHA 1HMYA 3AI3A 4KDRA 3R9KA 3VX3A 1H23A 4TLAA 3E15A 5BYKA 1YMQA 2PXAA 4FGSA 5BNIA 1DQRA 5B37A 5IDQA 3MAAC 4LJSA 1XX6A 2B8NA 3HRIA 3HZHA 4CM6A 1AKUA 1OV4A 1FK8A 1VHDA 4K6GA 4NBRA 3K09A 3O0TA 2NUPA 2DPLA 2WHPA 4MKFA 2W0MA 5DI3A 3SY8A 4D9EA 2HN9A 2PT5A 1E2QA 3QIVA 4J75A 3M3DA 1TRKA 2IOFK 3L6DA 3UMYA 3MAJA 1Q44A 2G04A 2ODQA 2GPSA 2E82A 3LH5A 3OEED 4J1NA 3T5DA 2WVHA 3PE6A 4HB3A 5GJVC 2VYCA 1YHNA 2XE8A 3MT7A 1UPCA 3ZY5A 3NASA 4KIFA 1PQ4A 2A5JA 4A0QA 3S29A 1ZN7A 1AGYA 3ESQA 3K5HA 3VYRB 4S1OA 4AUEA 5A1JA 1OH8A 9MHTA 4L4UA 2JAOA 5CDTA 3QPVA 4WK2B 2GZ3A 2IHZA 1I5OA 1WPGA 3PLRA 4IPTA 4P35A 2WV9A 3CIFA 1ABEA 1B6SA 1I36A 2OXFA 3K0CC 4G4SP 3RG8A 4E4RA 2H9YA 4EF5A 1V9CA 1DINA 1IEWA 2JJ8A 3INTA 4MI9A 4C4AA 1LUAA 3D6FA 4K6MA 1PFGA 1DAKA 1YUMA 2E4AA 3Q41A 3ZDAA 3DXFA 1Q74A 2P1ZA 1JV2B 4KBFA 1GA4A 2GO7A 3M6MD 1YCGA 1JG7A 3CISA 3CSDA 4MI6A 2NOAA 4MIYA 5KI6A 2HGSA 3K9GA 2ZJ3A 3C3AA 1S1MA 1P9NA 1PW7A 3LM8A 3PNPA 4NYMQ 2JEZA 4W4TA 2NP7A 3I4LA 1L3IA 3V4OA 1CR4A 1L7XA 4L4ZA 1U6KA 3IPRA 3WHPA 2OSBA 1GUAA 2PZAA 3G8YA 3SKYA 5BPHA 3H75A 4AROA 3QOYA 2DZDA 2BSQA 4X8OA 4E33A 2XMGA 4FX5A 3E22A 1YVDA 2FWNA 3GRKA 3LZ6A 3ITDA 3LFUA 3WQBA 1JHDA 4JJZA 5TNXA 2QLFA 4UHHA 4IQ0A 3ZIUA 2ZWMA 4E5PA 1P0CA 2H06A 2C84A 3NETA 2H07A 3D54D 2PMWB 1URPA 4Q93A 4WVLA 1I0ZA 1Q21A 1QHNA 3L6CA 3BRWA 1F38A 3GROA 5BN4B 3ETHA 4C0XA 1A9ZA 4DQ0A 3N0XA 2UUOA 2Z6UA 5DM0A 1UBMS 2LKCA 5FT9A 4GWKA 3S2SA 2XMPA 5CD1A 1D3AA 1W94A 2H6EA 4B32A 2JJQA 5EIAA 4MB6A 1E3MA 1F0KA 1J8DA 4UOEA 2IEIA 1YL5A 3IAHA 3ZK9A 3H3FA 2I4TA 3RHTA 2VHEA 1Y8RB 1GYPA 3OFNA 3QWBA 4A0SA 4UQPA 1ORVA 5HTKA 2OUIA 3BXOA 3GLRA 4WXRA 3WL8A 4BQEA 3QXXA 1OX5A 3ZR4B 2VJCA 1MB3A 3OX2A 2GJKA 4KO2S 4R8KA 2C5EA 1RC1A 1X19A 2VJLA 1I6KA 1UDCA 3FVVA 5ERGB 5DRYA 1Z88A 1O4VA 3FNEA 1T1RA 4PEVA 1HPLA 2R8BA 3E0XA 3OH8A 4IFBA 1SHUX 2AMLA 2QTVA 4MVJE 2EIXA 1CY1A 3JSXA 3N28A 5EZQA 4EOGA 3O1LA 2LVBA 1L7PA 1WCIA 1P91A 2YINC 4GYKA 3IUEA 3M2PA 2IW1A 3WS7A 1QZXA 4DCTA 1VMDA 3G0OA 5FUBA 1SWWA 5FCDA 1MV5A 5AKJA 1FFCA 1IC6A 4OHXA 5EYPB 3SYMA 1A4RA 5TGDA 5BQOA 1XXHA 5EOVA 3CNQS 2JI6A 1JZQA 3GFQA 5I6DA 1USGA 3TNLA 1ZZGA 4RPHA 4ZV9A 5HE8A 1QFMA 4BO6A 1E77A 4HNAB 1Y7LA 2VWGA 2OE2A 2HZ7A 3BFXA 4MQ4A 4RZHA 5CLQA 1NATA 4S0ZA 4YJFA 2FZ5A 4D9JA 5CD9A 3KPWA 3PYMA 3HE3A 1ARZA 2J85A 2QNRA 4KO3S 3ZHSA 1BOOA 1CHDA 1Y9DA 3D6TB 3M5WA 4JC8A 3ZY6A 1H4QA 3RFTA 4OP1A 2JVIA 2Q4RA 4Z4IA 3GRRA 4KIJA 5HMMA 2DRIA 3FMFA 3AL3A 1EMDA 4ZHQF 4H18A 3HKBA 2CVPA 4OQXA 3W7BA 3P9QA 5CVDA 2NNWB 3OTGA 2DPYA 4O4IF 3OX4A 5A0TA 1EM6A 4D0GA 3KWFA 4IDCA 1DB3A 1WEHA 1Z8HA 5CM2Z 4M76B 4J1TA 3BYZA 1JUDA 4PYNA 2QLMA 4CCYA 4DM3A 4RTNA 3FHOA 2O8EB 4FW8A 4NOJA 3OCCA 4HNQA 3REQB 4GEKA 1I7PA 1OJLA 4UUNA 2OT3B 1L5OA 2ABWA 2BFEA 5J2UB 5UKDA 4L5BA 5GQSA 3FPEA 2WTMA 3UWPA 2CCGA 3BCSA 1HK7A 1ZJ4A 5I01A 1XDWA 2F00A 4KR6A 3DXYA 4UVEA 5HZMA 2X0IA 4RULA 3VU0A 4RNCA 1ODCA 5AJWA 4A6PA 3RVPA 1GOTA 3U61B 2Q99A 1R4NB 2PXXA 2BFDA 2FJPA 3M89A 1TM4E 1AGXA 1L4MA 1SKBA 1UL1X 1FRVA 4JJGA 5KYYA 1FNNA 2W2PA 1Q50A 2FZGA 3FFTA 2YJZA 2NAFA 3V7FA 1BDBA 3LS2A 2VDOB 4KX3A 1U9IA 2P6NA 1GFZA 3HSSA 4WERA 2O7QA 4ZQBA 2C98A 1M6EX 4BX0A 4ZT3A 4OHUA 4BFCA 4F93B 4IDNA 2RH9B 2O2ZA 2Q3LA 4ZU1X 5LL6P 4HAYA 1TD9A 3OSZA 1DEAA 2JKVA 1CUZA 4L8WB 1A95A 3RU9A 5AVYA 1RXSA 4O4HB 1CJSA 5IYZA 1N2CA 1NUAA 2J3MA 1KMIY 4UHEA 4X7PA 3UG6A 4ABYA 2G9QA 2B92A 3JSAA 1QG4A 1XLUA 5KYVA 3DL7A 3QU7A 4FJ2A 1QZZA 2AFIE 4PLHA 1WUJS 3D0RA 4OVKA 3Q72A 3U40A 4NV3A 2IIVA 4PPFA 2G82A 4D1YA 1RJFA 1YFKA 2FZLA 1FSSA 3H2ZA 1XAIA 3ZNPA 4UM9D 3L41A 5BR1A 3PF8A 1YRWA 5KOHB 4BAZA 3I3OA 2K5UA 4QG7A 2ZSDA 3ESZA 3WLTA 3BMQB 3ZCPA 1XCGB 2GFIA 5BV7A 3PC7A 1UUFA 3REGA 4EEKA 4MRNA 2GBGA 3FMOB 3V8NA 1CC1S 5ALGA 3CSUA 4MGKR 3G9QA 4P3KA 3T6KA 2FUCA 2PJUA 5HF9A 3TVTA 4TYMA 4D41A 7ADHA 1WBBA 4YROA 1OVMA 1UXJA 2IF2A 1SVSA 4JXZA 2BF7A 2JGDB 1FF9A 3CR3C 5CTJA 1W88B 1GGKA 2N42A 1O6CA 3ACCA 4KSCA 4X6YA 1U8TA 4DREA 2HDWA 4EGSA 3GCDA 4R8LA 4JYMA 1RFLA 3ZE0B 4QARA 1G3UA 2IS6A 1QGDA 3I62A 3Q12A 3LC7O 4J1QA 1GPNA 2E5WA 4EMUA 4I36A 1TGYA 1WM1A 4UDXX 3MMNA 5FBLB 4BP9A 1VPDA 2RGYA 2YWJA 3RIMA 1TNDA 4ZIRA 5DYNA 4CNBA 3MJSA 3A37A 2RI1A 4NJEA 4BZWA 4CMIB 4B7AA 4RCVA 3U9TA 4EKEA 5ARCA 1DCMA 4N0EA 2X1VA 3RDPA 2JIRA 3MSXA 5I48A 2R6ZA 1P19A 1Y1QA 1KC3A 1DU4A 2H9IA 3L6BA 3IQDB 3O9VA 2X5JO 1ONBA 2G1JA 2BGJA 2C7BA 3M6UA 1TQ8A 1U7ZA 3LUJA 4IILA 1OBFO 2HIAA 1Y4DE 3DPIA 3OTHA 4WACA 4FDTA 3N8NA 4FCTA 4YH1A 4AJIA 1RE0A 4M1OA 2GASA 1SBNE 3VSDA 4AO8A 1JLLB 3DBRB 1VFNA 2ZAMA 2MIIA 4ANFA 2IYRA 5ARBA 1C3XA 3HJBA 2XGJA 2Q4DA 3AZQA 3BOSA 5BMVF 4WE3A 4A9AA 1NR1A 5DX1A 4WW0A 3EF1A 4NV1A 2Z2IA 2IDJA 3I64A 1DKLA 2PZ8A 3OE4A 2BFBA 3FOFC 3HJFA 3WGJA 4QYWA 3PUIA 4C29A 2MR6A 5JRZA 1E3EA 1QYRA 4QTYA 5JC1A 4DRXA 2YY5A 2VPXA 1K06A 1FU4A 1SD1A 3LX8A 4MGHA 5JAOA 2X5NA 4C4ZA 1XEWX 2LCFA 3V8PA 5MGNA 2AMJA 2BCJQ 4ZO8A 1J2JA 2MSCB 4Z4CA 2X8JA 1WL8A 5JVDF 3RIHA 3C7AA 1E2FA 1L7EA 2YXBA 1BCRA 2NV0A 4BNHA 1K98A 4HT3B 3QBDA 5JZSA 1K8XB 4LEIA 4KC0A 5HQJA 1L5FA 3DMPA 1E8DA 5MF6A 1SWVA 3TYXA 2GN8A 3THWB 1C1XB 2Q0SA 3T9CA 3TQSA 2DB3A 3OZIA 1LPNA 5C2JB 5IASA 1FIUA 5I9TA 1D6JA 1NY6A 5EUBA 1AE1A 3LOQA 1E6KA 3BIJA 4NBWA 1T8UA 2PT9A 1U5BB 2YDXA 4JXJA 4KMRA 1WA5A 1TECE 5KYXA 2CDAA 1VHJA 3CNLA 3O4IA 4GPIB 1NLMA 3BPSA 3N7AA 3O8NA 4MQMA 3KOZA 4BBPA 2GM4A 4LS3A 3OPMA 1C3OA 5L53A 1P0IA 2C04A 5AO9A 1KDVA 4CKYA 1Y1LA 5HIIA 1OF1A 2AOUB 3AFGA 5E1MA 5IH7A 5BSGA 4RNDB 1QQBA 1OYWA 3I76A 2XNCA 4UUQA 5BV2P 4CR6A 3GXBA 1ZHHA 3EXHC 1GQSA 5J5CA 2X14A 4ZN6A 1DELA 3GNSA 1DRKA 2QE6A 3FYUC 4K87A 4DC9A 3KSRA 2QM8A 1MIOB 2PRSA 3BIFA 3OE1A 4QWMA 5FF9A 4I3GA 3SE0A 3VSAA 3NXKA 2PA0A 2WR8A 2YN2A 1RAGA 1IBLB 1UK9A 4ZARA 4EEXA 4CQJA 2OBMA 2YXNA 2K2WA 4RHUA 4YT4A 1PR1A 3H9CA 4Q6WA 3VJKA 3EXIB 4L2IA 3WKDA 4D9GA 5HK8A 3CVYA 3UJNA 1NW5A 1MOPA 3ND5A 5JNWA 2FVYA 2DT8A 2HM7A 1JWAB 3CR8A 3CH7A 5DM2A 5T41A 3LUCA 2Q2QA 1F20A 5LQSA 2ZRDA 3PFNA 5JD6A 2JDIA 2HY7A 4MJLA 4MSUA 5FFFA 3REFA 2H4WA 4LV5B 5BSKA 4DYVA 1A9RA 4TMVA 3CU5A 3EARA 2JFVA 2PUVA 3HDTA 1UODA 4DG8A 3TIFA 3F7NA 5KNDH 2OD2A 4ZXFA 2Y6VA 4EL5A 1DJOA 2ATIA 3WK8A 1JG1A 1R9MA 1S8FA 2BJVA 1VECA 2RGBA 3Q8XB 1FDIA 4LOLA 3MAGA 5IH3A 1NDUA 3SOZA 4W5WA 1IJKA 3G9ZA 2X0EA 3ROGA 4I66A 2CXUA 2D5LA 2RGXA 1JE1A 2NTYC 3MWFA 5CYFA 1JS1X 4KAFA 1M1YE 2WZQA 3L8CA 4LOKA 2VYNA 3ORSA 4X1KA 5KS2A 2OBLA 3FPAA 4IXNA 2QRPA 1KYTA 4UVDA 2C59A 3WNZA 3EGOA 4NK5A 1C7QA 1NQAO 5K0CA 1PNVA 1R7RA 4G5OA 4E88A 1CWUA 2XUZA 4GKKB 3ESXA 4YACA 3ZZTA 4W1QA 2FV8A 2XUPA 3OPQA 3R3ZA 3RS2A 2F3QA 5KKAA 4D6XA 1ENPA 2BM9A 4BMVA 2IWRA 1Q14A 5DWVA 3C1OA 1DZIA 2H2GA 3AFNA 4O29A 3W5SA 2CVOA 4YR7A 1ACJA 2B6NA 1AD2A 2H9AA 3OG9A 2R7NA 3BE8A 2O8DB 3R1IA 4TV8F 4J3FA 4KO1S 1AHPA 1DAHA 2NTJA 4PFSA 3ZVRA 1OXBB 3BXZA 5KJEA 3HYLA 4QJ4A 3RRYA 2OGTA 1G0NA 4KKVA 2QD1A 4MWDA 5AI5A 4PR3A 1EQ2A 3IT3A 2H4XA 1TFRA 6REQB 4AP9A 1RBQA 1PD0A 1F60A 3HJNA 4ZU6X 5DTQA 1Q0LA 1R8SA 3LQYA 2ECOA 3RVJA 4GMDA 1GKUB 1SUEA 3N74A 4ZTZB 1SUWA 5ALOA 3D6NB 2E3JA 4CL2A 5JAUA 2GPTA 2NUPB 2WHPB 2W6OA 3KBOA 3RK4A 3S4YA 1E5TA 2B7LA 2WJ4A 1SURA 3IV7A 2VO1A 3TVYA 1L8LA 3FB4A 5AVTA 3ZDEA 1DKPA 4JP3A 2FPWA 1C4OA 5DLQC 3WGQA 4K9SA 1C0LA 1YQ9A 1G2IA 2J6IA 2KI5A 3BIXA 3EUAA 3H2JA 4LHWA 1X1BA 4YEDA 2Z2ZA 3T3NA 3MTQA 5DDIP 1EDBA 2FY8A 5BWMA 1M5TA 3ADDA 1JR3A 2OESA 2YWFA 1I3OA 4GKAA 1ADCA 3EW9A 2NVUB 1G63A 1FJGB 2NT3A 4F46A 2P8SA 5F3DA 4NVRA 4OQ4A 4HWGA 3C6QA 1CQIB 1ZH2A 3MW8A 5HJEA 4TT3D 5YASA 4F6RA 4YT5A 1ISPA 2YV4A 3LDFA 6REQA 4U9UA 4NS1A 1ZLXA 4YCMA 4KQFA 2FPIA 4MYTA 2ZDQA 1C4KA 1Q2UA 2GLUA 1VRCA 1PL6A 4JB8A 4L5YA 2M6LA 3PS9A 1J9GA 2PQ2A 5SZJA 3MT9A 4HAVA 2NSYA 2BKEA 4ABTA 5JSFA 3VOTA 4DA6A 5BW5A 1QCYA 5F76A 1Q7CA 1QXSA 3TAXA 2FH5B 5DWQA 5DCUA 4ZT6A 2XUAA 2Z09A 4G9GA 1Z4MA 4DANA 1R5BA 1V4VA 5SY6A 3WGZA 4DZRA 1EK5A 2VS1A 1Y89A 3GRAA 4JJIA 1MQSA 3A9WA 5L4SA 2RHLA 2J8ZA 2R79A 3E22B 4GI5A 2ZUEA 2WBLC 2FE4A 4NMWA 3DFUA 1A9TA 2G0TA 2JHGA 1LEHA 3CZ9A 2JD1A 3CY6A 5EKTA 4B3CA 5FTMA 4QBFA 2BFMA 1LQUA 4HPXB 3EK2A 3FUCA 3VH4A 1IWBB 1SN7A 3HN7A 4PZEA 1CZRA 5EESA 1U80A 4UAGA 3ZQUA 3DCNA 5KWEA 2V7PA 4HDSB 4A8JA 3LZCA 4F45A 4EY7A 3D6MA 2ATVA 2PKEA 4JJFA 4RGYA 4BCBA 1BDMA 1P44A 3GEPA 5DOVA 3LIIA 2ZWAA 2F3PA 1EUQA 5FI0B 2CNBA 2PO5A 4GOXA 4L50A 4UU1A 1JIXA 1UKEA 3UAWA 2DFKB 1GEGA 1A2OA 2FEOA 1JSCA 3P9SA 4XLZA 1QRUA 1M1NA 5FWNA 2G5CA 1QDUA 5TE9A 4QXPA 4RPJA 3MUNA 3N05A 5JS2A 4XSGA 1LSJA 4YP9A 1WD5A 2PJZA 4LDPA 2AX3A 2EHDA 3ZVNA 1O94A 4EFDA 2QTVB 4NG4A 4WUVA 3QPAA 1A4IA 2NU7A 1BEUB 1JZTA 1FDUA 2A3NA 2AEEA 3A9SA 4F5ZA 3PWSA 1WCIB 3LX5A 5P21A 1DC4A 2R86A 3JQCA 2R84A 1SUDA 1SHZA 3JYHA 3QUSA 3V4RA 1LH0A 1NBEA 4COKA 4BMZA 1DC6A 3FNIA 1OXXK 4U7GA 4WZAE 1P0PA 3BKWA 5C1DA 5JTUA 1QB7A 4PTYA 1XXHB 4KMOA 4UNSA 5KQLA 5AJVB 2PZKA 2VXYA 4FYYA 3R5FA 4ZCLA 3NFRA 1E8NA 3SIXA 3KQQA 1RAFA 5FTNA 2AWNA 1RVDA 3JQAB 4V0QA 5A9SA 1Z56C 3Q98A 3QKRA 3VH1A 2YTZA 1CEXA 4C03A 1OHHD 4YJFB 4M7PA 1IZZA 1IYZA 1BHO1 4KXMA 4ROSA 2DBQA 4QT4A 3JY6A 3FPCA 2Z3VA 3A05A 3FWYA 4I5FA 1JIVA 4ODIA 4C6SA 1H2YA 2D4AA 3HA3A 1OZ0A 2HT6A 3GP3A 3PDUA 3GJZA 1VL1A 2AQHA 1XCLA 1BDJA 1EQUA 2CJWA 2XUKA 4LK2A 2FUG6 1C29B 1DDIA 5CJPA 2DYKA 2J5KA 2Y9MB 4UHCA 3A9VA 3USCS 4CEHA 1J2RA 2JLRA 3G88A 4D6PA 2XWSA 4KNVA 4FDVA 4JX8A 5C4GB 3NIFB 3PJEA 3RFXA 4CCYB 1EKXA 1B43A 1EB9A 2Y0BA 3VOSA 3WLJA 3VBEA 3WLSA 2DPHA 1Y4SA 3QW4B 3VHXA 3W04A 3WFJA 4UBJA 1H94A 2DLDA 4WKPA 2ZIWB 2HBYA 2BLNA 4B2PA 2FSVA 2PL1A 4KO8A 5IAAA 1WW3A 1JW9B 1N1DA 4R3UC 4UD2A 3K0KA 1XEAA 1DIGA 4NLLA 1F7VA 5E2BA 3DDSA 1Z16A 3KAKA 1IAQA 1ZM7A 4W6QA 4QLOA 1PV4A 1P5RA 2BGUA 3LFHA 1G291 2FRXA 3OZEA 3PXAA 3UUFA 3V34A 4AKEA 4FMDF 1GQRA 2XCLA 4E14A 5LIPA 1VZ3A 4BMPB 3AB3A 1NUTA 1NVMB 4PSAA 5DN6D 4UARA 3W9BA 1BG6A 1J1IA 1RI2A 5KYYB 3PQCA 4K6KA 5IBPA 1QGZA 5J23A 5HGJA 4UTXA 2GILA 3V3TA 1YQEA 1PKXA 1TA4A 4ZV7A 3CNHA 4R8MA 1Q22A 4GW3A 1EUZA 3AHEA 4E11A 3IT1A 2ATCA 2F1HA 3HU5A 3MT0A 3UPUA 4P58A 2AVNA 3B9RA 1XZCA 3MK31 4MUKA 1UADA 4YRGA 1RTKA 2WKWA 3DZBA 3HCOA 4KNWA 3UG7A 1O0BA 2IE8A 1JEYB 3RSCA 3R9WA 1ES9A 2JGEA 5BYJA 5IYZB 1N2CB 4RLSA 3SM9A 3UW3A 3U4GA 5B3LA 2QU7A 2QD5A 1DI0A 4LDNA 4Z3DA 4RD0A 3SZ3A 3JYNA 4MMZB 4AJ4A 1Z4IA 2JZNA 1U94A 2ZPTX 1NUHA 2ZJYA 4JT4A 3EC7A 4MNTA 1NYLA 4XFJA 4BEJA 5HRUA 4NE9A 2OORC 1FFWA 4I4TA 4TQUS 3QXSA 4DCNA 1B14A 1PHPA 3PKIA 3I01A 4MV8A 2LR0A 1XZLA 4FFWA 1OIVA 3K0EA 1QCCA 3PGJA 1NN3A 4IO0A 4QELA 4B82A 4F1JA 4C08A 4G5GA 4YX9A 4OLAA 2P2SA 2W83A 1V26A 2VUHB 4DNQA 2J3DA 3CVOA 1AX9A 3IKMB 4M0FA 4ZV4A 3T3DA 4QFCA 1DTEA 3EXG2 4HGPA 1FLDA 3EEIA 2O8BA 4ASUD 4ILEA 4GXQA 1F0NA 1E6UA 3KVOA 2PSFA 3U7RA 4FMBB 1M83A 3F9CA 3SBEA 4YY3B 1R10A 4RPKA 4I9UA 4B73A 3W9SA 1H3FA 4ZOBA 4O4JF 1L7OA 3GDOA 2VHTA 3OAAA 2K7FA 3WRXC 4D9IA 2GZ1A 4FR0A 4ZO7A 3SZGA 3EHEA 2A8YA 1RLTA 4R9UC 4FBLA 1RQLA 4BDSA 1EFVA 1BH6A 2YW9A 4ZIRB 1AMOA 4L3WA 1IM5A 1QE5A 4X7RA 3OCUA 4MW2A 3JYQA 4HNVA 4OGKA 3BDAA 4Y2TA 5K0SA 2VQFB 5DBGA 3PNOA 1C41A 1E3TA 3I6BA 5D01A 5AW8A 2PMCA 2H4JA 2FMXA 4MV6A 1WY5A 3UICA 1XTTA 5F23A 1PWHA 4ZI2A 4AWAA 1E9DA 1D5WA 3EXHB 2QVXX 2P41A 5IU6A 3JD4A 2PVCA 2WF5A 1EVJA 5KNBD 4ZI3A 5K20A 2ZUVA 2Y0EA 5DIZA 1W7AA 2FN4A 5JLJA 1C0KA 3ICCA 4R54A 1QX3A 2QTWB 4W63A 3TS1A 1I2BA 1UJMA 1X2EA 3A6KA 2ZWOA 4TL9A 3PE3A 5HMLA 3AF6A 2WAYA 1F6WA 3H05A 4DDMA 3EIEA 1XL0A 4WBXC 2OD7A 2XE4A 2AX4A 3BD9A 2BFBB 3IP3A 4WZ6A 5GV7A 3S2ZA 1PVOA 5FHQA 4XCVA 4ND2A 4O0MA 4PO1A 3S99A 3ROTA 3VO8A 4D5GA 1DDGA 1XMXA 1QP8A 2CD7A 3K9HA 2DERA 3ISVA 2V3WA 5HX7A 3I3SR 1WBDA 3VKUA 1CUSA 2X8JB 3OBIA 5KTRA 3ZV6A 1JEJA 4IKEA 2FRDC 3MYRA 1GUZA 1IN6A 3TM4A 4Q24A 3EXFB 4RVNA 3GFGA 3VR5D 1E5DA 3T99A 5JZMA 4U7HA 2VH1A 5LOVA 1JLHA 1PFYA 3EYWA 1KO4A 3MA0A 3M9LA 4QHSA 3T7IA 4B9EA 3UMMA 1R6AA 4O59O 3SHOA 3MOGA 3Q7TA 5KYXB 1WR8A 4PFJA 3OQ1A 4QM6A 2C3UA 5HIMA 2BTOA 5FBHA 1YZNA 3IBCA 4C4XA 3IR7A 3ITKA 3VNVA 3MM4A 1A1VA 1TUGA 3BGDA 3IHKA 4KUHA 5LMNB 2FMUA 5JZVA 1T8WA 1P9OA 4B7UA 4GQAA 4RWZA 1FJXA 2Q21A 4X6LA 1XMQB 3WYBA 1GL3A 1PUIA 4NHOA 4RIIA 1OWPA 5KHLB 1DBQA 4TVBA 4DIKA 5HM8A 2WWHA 3E2IA 3F46A 4JQYA 4I46A 2VPYA 3S1LA 5A5DA 4JGIA 1BHQ1 5H80A 3RSSA 3GLIE 1ZO8A 3OPVA 4DSUA 1G3IA 3BD6A 5CVTA 4QPPA 3OQJA 4IV5A 3M1AA 2QMHA 2D1FA 1G5IA 4Y30A 4I9GA 4ZO4A 1EE2A 1G19A 3TG8A 2GAFA 2PCLA 3K20A 4FHZA 4AJNA 3AUXA 4XGIA 1GLVA 2I62A 4UHDA 2GXAA 3OUUA 5BSFA 1UPTA 3ZDQA 1D03A 5CCEA 1RQ2A 1VLMA 2DOKA 4JROA 3TEMA 4YRNA 2IHBA 2Z6QA 4LY0A 1ZR4A 1T5LA 2HBZA 2VRNA 5JAQA 4GZMA 3HZRA 3IXMA 4LBWA 1E61A 2EYUA 3FPSA 4Q19A 3ROPA 1WV0A 3F3MA 4ZVPA 3U3DA 3QEBZ 4CETA 2RG7A 3H5OA 4U2EA 4WRRA 4JQCA 5C7LO 1UOOA 1FTSA 2JD2A 5EJAA 1A8UA 1LTKA 3AP1A 3WDKA 1W30A 1KYQA 2VXCA 1BHJA 3N0VA 3N59A 4HEA6 5G1PA 4G0OA 5TVKA 3O03A 1SIBE 3GLFA 3FZNA 1EXDA 3L04A 2VDRB 1GAJA 3D2LA 4Q7LA 3RWOA 2JJMA 4I6JA 4MW1A 3S2UA 4LUCA 3C8HA 4MUJA 3C3CA 1CVLA 2JGKA 3EIFA 3CVUA 4X1KB 1N3BA 4S0XA 3WDSA 4X6UA 1N6IA 1TEHA 4RD1A 3TW4A 2XKAA 2RI6A 4DA7A 5CCXA 2W00A 3PEUA 1AXRA 1TYAE 1V7ZA 3F9RA 3M1IA 1YRHA 4S1WA 4YI3A 1S5PA 1KSGA 1NUPA 2LDXA 3LUKA 3REOA 1IDOA 2IEGA 3THRA 5KDOA 3FLBA 3OIGA 1SBTA 1MW9X 4OP3A 2QR5A 1Q7EA 3IOCA 4FMCF 3EUEA 3PWTA 4EUHA 2HTEA 2XRFA 2AW5A 4HQ0A 3RJ9A 3RV4A 4BN5A 4D82A 3HJGA 4TMKA 3BT7A 2FGJA 3L7AA 1AG9A 4D0NA 1K7FB 3RTDA 4QHYA 1I30A 2POQX 3V46A 1RYNA 5L3QA 4M3NA 3W5CA 4MPTA 4W6ZA 4EHAA 2G3YA 1KZYC 1R66A 1B7GO 3NBKA 3FAKA 2DULA 5BURA 3U9SA 2NXNA 2JBAB 3HBFA 3UAGA 1FRQA 5EJ4A 4RXUA 2CLKB 4R9RA 1APBA 3EEOA 4ZQHA 2P9JA 3AJ8A 3UJ6A 2PRIA 4FEEA 4HGQA 1P1IA 3CB2A 5LSAA 3BZWA 4PRYA 1HE2A 3ANYB 1F5NA 1G17A 4BO5A 3C5EA 2WSBA 1JWBB 1GY8A 1NU6A 4BE4A 2XECA 2GN4A 4FFRA 1YZVA 2XLBA 1DXYA 1MOSA 4JKIA 3QSYA 4AG5A 3C5WP 1XPOA 2J07A 4NULA 2XIJA 3FZGA 3OA0A 1G2QA 3LWZA 1PLLA 4Y0AA 3SS9X 4BEBA 5A4JA 1H93A 3HA7A 3JVEA 1HZZA 3RYCA 4U7DA 1ZK0A 2DG2A 4H7FA 1UJNA 4L3OA 1OOEA 2EERA 1KXJA 3EQ9A 4AD8A 3PHHA 2EF0A 5G40A 1XJWA 4YAWA 4F6RB 5GVSA 5I9MA 1P1RA 2X1MA 4U2FA 3DM9B 3I2KA 2JFPA 3EVAA 2W2OA 3U37A 3AQIA 4EM6A 2FPIB 1CY2A 4G1EB 1DQYA 2EKBA 2OOKA 4QBKA 4QREA 4AMZA 1YRQA 1W49A 4EVSA 3CLTD 1Y34E 4M0UA 1KYIA 1KZGB 3F4BA 5KC8A 3DGEC 4DV0B 1SOMA 3GQVA 5J2TF 3T4UA 3HXQA 2RHCA 4CM1A 5KU1A 5KNCH 3OLYA 2PBLA 4B8ZA 2D8AA 2O7SA 2EX0A 3A28A 5DTJA 5KQGA 1U3GA 4DIOA 3MVEA 4CRWB 2CNDA 2V55B 2VJDA 5HKKA 4IEIA 5H8WA 2YWEA 4JYCA 2OLJA 3QV2A 4LMAA 4LJ5A 3S2FA 5JAMA 3CXRA 4N39A 3MXTA 4E2ZA 1PWZA 5EA2A 1XK6A 2ODPA 4PCLA 1GNPA 9LDBA 4TVSA 2AXQA 5G0WA 4DQDA 3ZGNA 1HNZB 2GXUA 4HK4A 3T5PA 3PUZA 1PTKA 2H29A 3ZCRA 5AW7A 3W2HA 4JB0A 1W2WB 1X7YA 1TYBE 3FOWA 4KQJA 5I8ZA 1NN5A 5AXCA