1NXXA

Micarec ph 5.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
114
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MicArec pH 5.5
rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
molecule keywords DNA-binding response regulator
total genus 40
structure length 114
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxxA00
3H1GA 2VK2A 2FQXA 2PL1A 3QX8A 1Z15A 3CFYA 4H3KB 1VPWA 3GRCA 2NZUG 1VKRA 4O1HA 4PEVA 1QP7A 4Z4FA 4MR9B 3HDGA 2WWVD 2JVIA 2QW1A 4JP1A 2RJOA 5C5CA 3OLZA 4KZKA 1SXGA 4Z0NA 4LE1A 4JAVC 1NATA 1QNLA 4ETIA 4LE0A 4EVSA 2MSLA 3CS3A 5BR1A 5JNUA 4RU1A 1NXVA 3HZHA 5IBQA 3BRQA 1DBPA 2M1ZA 2ZAYA 3FFTA 5JNTA 4G0MA 3LUHA 1GCAA 4F3TA 1EFAA 3W9SA 4MQEB 4RS3A 4F11A 3ILYA 2QVCA 4XARA 3RVJA 1BDHA 4G0PA 1FFSA 1LJLA 1MVOA 2FMHA 4MR7A 2IOYA 2JK1A 3H5VA 4XAQA 1A2OA 4ZYLA 1S8NA 3HM9A 4G97A 1QP0A 3KSMA 1NXTA 3RQIA 2LP4Y 3EAFA 3HV2A 3T95A 2FVYA 1DCMA 4OG2A 2JBAA 1FFWA 2LUOA 3CKMA 2R48A 2PUBA 3F7NA 4G86A 1QO0A 3O2QB 5ABPA 3F6CA 2AYXA 2I6FA 2IPNA 4RXTA 3KS9A 1YMVA 4YRZA 4ZJPA 2GKGA 2JBAB 1PEAA 2RGYA 1LJUA 3GV0A 3DLBA 2JB9A 1ZAYA 2GI4A 3LKBA 1ISRA 3Q9SA 2FMFA 2WMYA 3A3KA 4RK4A 1NTRA 3MIZA 3N75A 2XDYA 1BA2A 2QSJA 2V0NA 4EVRA 3NBMA 4E7PA 5F64A 2TMYA 3H6GA 4IF4A 2CHEA 4WWHA 4OLAA 3DGEC 1JWLA 4MLCA 4RK5A 2HQOA 3IP5A 2OQRA 5TQ2A 2E4UA 5DLEA 4Q7EA 2LPMA 2P9HA 3T6KA 1ZH4A 4NQRA 2PUDA 3HK2A 3OLVA 3RH0A 2DRIA 4TLMB 3CRNA 5TPZA 3IPCA 3M6MD 5FWYA 3CHYA 1USIA 5KI6A 4WT7A 3G85A 3UKJA 1RZRA 3JY6A 2P4UA 3IDOA 5CHYA 3N0RA 4KV7A 1PEYA 1JFVA 1ZGGA 4RY0A 5FWYB 1MB0A 3H5OA 3E3MA 5DCLA 3LUCA 4NV3A 3QEMB 2FQYA 2FXIA 4D6YA 1Y1LA 2VYCA 4ETMA 3H5LA 3L49A 3M9XA 3I5AA 1NXWA 4EYKA 1Z12A 5BQ3A 3HVRA 2PUGA 1JLKA 1P2FA 4EYGA 4Z4IA 3KJXA 4XXHA 1YK1A 3LUJA 1JYEA 1TMYA 4TLLB 1D4ZA 2E4YA 3OLWA 3O75A 1JBEA 5KQLA 2YHBA 2WRZA 4Q6WA 2A9PA 1Z26A 3KHTA 3QK7A 3DGFC 1F51E 3FMVA 5IC5A 1TJYA 1Z2EA 4XFKA 1KRWA 5IEJA 3H1EA 3NNNA 2HSGA 4YCSA 4RZSA 3EDCA 3H75A 3EULA 3UUGA 3QEMA 2FEWB 1M2FA 3JVIA 1U0SY 3H5TA 3Q7RA 1CHNA 4UHKA 3KLNA 3QEKA 3IP6A 2KYRA 1C0EA 3QLUC 1GUBA 5TE9A 3GWGA 4NCBA 1DBQA 3D02A 1PHRA 4MQEA 3NHZA 3G1WA 1NY5A 3H6HA 4QICA 1R8JA 2M98A 1U8TA 2FN9A 4RK1A 3A0RB 1GLGA 4Z9AA 2B1JA 1U2QA 3OO0A 3N0XA 2WB4A 2MYPA 1KGSA 4MR8A 7ABPA 5HM6A 1RXEA 3SNKA 4KRFA 2N9UA 4ZMRA 4G0ZA 1JFSA 1LBHA 1RPJA 3LMKA 5IULC 2PUAA 5JS2A 4O1IA 2MYUA 4OTZA 1ZN2A 4D74A 5FWXB 5IUNC 3H5IA 4MAAA 2L2QA 1APBA 5ED4A 1WETA 5EWMB 2PKXA 1P6UA 1QKKA 4LDZA 3IPAA 1OXBB 3GA5A 5D2CA 1RNLA 3VNAA 2FSPA 4YGXB 4MS3B 2CWDA 1DBWA 3CLKA 2ID9A 2PJUA 3RVKA 2PMCA 2L17A 2MYTA 2AYZA 2FW0A 3HO1A 3A0UA 4KNYA 3KYJB 1NXPA 4EYQA 1BAPA 4S04A 1E2BA 2WJWA 4EY3A 3MM4A 3C6QA 3EQZA 1ZITA 1F4VA 5FBHA 4KQCA 2FMKA 3OQOA 5JS1A 2E4XA 1ZY2A 3MF4A 4MR7B 5TQ0B 3L6UA 1JFTA 2HJ9A 4FE4A 3QELA 2E4WA 3KYIB 4PE5B 4GNRA 3QX9A 2E4ZA 3T38A 2GWRA 3OQNA 1BDIA 1D1QA 1MIHA 1XHFA 1U2PA 2FEKA 5EWMA 4CBVA 4G0OA 1VLZA 1YIOA 4PICA 2IPLA 3EODA 3HDVA 4G0XA 4RDCA 4RSMA 3OLYA 1JYFA 5TPWA 2FLKA 3O1JC 3TX6A 3CU5A 5TQJA 1EHCA 4QPJC 4Z4HA 4RKQA 3Q15C 3RVSA 3LTEA 5C5EA 1W25A 3Q41A 1EWVA 4KVFA 5TPWB 3ROTA 1QQAA 4KK4A 5KC9A 1M2EA 1TM2A 3N6VA 4MGEA 3JPWA 4N03A 4ML3A 4EUKA 1ABEA 1JX6A 3E61A 3SM9A 2NT3A 4YO7A 3BBLA 4W5QA 3JS5A 4RXMA 4WXEA 3BREA 4IGAA 4DQDA 8ABPA 1HEYA 1A0OA 5IUJC 5FBKA 5KQGA 5JNVA 4FE7A 1EWKA 1T34A 4DN6A 2LIVA 1YS6A 4MRMA 2B4AA 3C3KA 4WUTA 4RWEA 4Z4CA 1YTUA 2FTKE 2W42A 3HJFA 2GX6A 4B09A 3GBPA 1Z16A 2HQBA 2LBPA 3QLVA 4KQ9A 1QO0D 5CNJA 4KFCA 3FFWA 3Q7SA 3K4HA 4XASA 3HS3A 2FLWA 3Q7TA 3NNDA 5T3YA 5I4CA 4KPYA 2F8SA 4OLBA 2JCGA 1W9HA 5IUKC 4MS4B 2BGGA 4MR8B 1FQWA 4F8JA 3OLXA 2PUEA 1PNTA 1QP4A 3QLUA 4IILA 3DBIA 1EAYA 1YMUA 2L19A 1EWTA 4RK7A 4N41A 3QLVC 3EGCA 6ABPA 1B00A 4YR7A 4MLDA 5FWXA 5B3JC 3SQNA 2IPAB 1JF8A 1U04A 1YVUA 4HNRA 2WY2D 2CHFA 2E4VA 4RKRA 3KCNA 5BRJA 3F6PA 5KWSA 5HKOA 1YK0A 1JDNA 1QMPA 1L5YA 4HNSA 3RVNA 4L85A 4W5OA 4NICA 3ROFA 3HXMA 2NT4A 1D2AA 3LFTA 5EWJB 2QV0A 1PNRA 5B3JA 1RXIA 1KRXA 2PUFA 4Z4GA 3O1IC 5DGCA 2JRLA 1Z13A 3RVOA 9ABPA 3FGZA 2QXYA 1ZGZA 5JNWA 1ZH2A 2VUHB 3NNSA 1URPA 1IIBA 4YWHA 1DG9A 1E6KA 2GBPA 3C3MA 2A9QA 1M5TA 1KMIY 1A04A 1DRKA 5E3JA 4W5RA 3M9WA 2NUBA 3MYYA 4G0YA 3SG0A 3RVMA 4G0QA 4Z9BA 5BRAA 6CHYA 1BVHA 4F06A 2J48A 1LK0A 4HYEA 5JNSA 1SXHA 2OENG 3HEBA 1DC7A 4O5AA 4YLEA 3TB6A 2L18A 3D8UA 4S05A 3SAJA 2RJNA 3LUKA 3LOPA 4D6XA 2RDMA 3S99A 4W5TA 1VRVA 3BILA 2PAFA 3HUUA 4YV7A 3GBVA 3MA0A 4MS3A 2ZWMA 4MR9A 5TPZD 3MMNA 3CZCA 4N76A 1Z25A 3KTOA 1DZ3A 1ZESA 2A9OA 4JOQA 3I45A 4WXMA 4YS6A 3O2SB 3UK0A 1CYEA 1GCGA 3N8IA 3KLOA 2WJAA 1BDJA 1OXKB 1ABFA 2H0AA 3JVDA 2R47A 3HSYA 3JPYA 1AB5A 1DCFA 1D1PA 1TVMA 3QLTA 3BRSA 1P8AA 5TQ0A 2MSWA 2YHAA 5EWLA 5JNRA 3QELB 1H9CA 2X7XA 4JB0A 4EYOA 3T8YA 4KK3A 4WZZA 2CD7A 3IP9A 5CNMA 4XLTA 1J56A 5CNKA 4W5NA 3O74A 1DCKA 1ZDMA 2PE5A 1NXXA 3RVRA 4MYRA 1RZRD 1JDPA 1MAVA 2QR3A 3OMXA 1D5WA 4EGSA 4ZMSA 3GYBA 2PUCA 4LZLA 2JVJA 1QQBA 5GOTA 1K66A 3KKEA 4RXUA 2JVKA 1ISSA 4LDAA 3P9YA 1DRJA 3CG4A 4LE2A 4P98A 2MSKA 1SRRA 4KREA 1DJMA 3OMWA 2HPHA 5GQSA 3DLHA 3CG0A 3GT7A 1CEYA 1SD5A 3DZDA 3H1FA 1L5ZA 3EJWA 3TO5A 4F12A 1E6MA 5T7BA 2F8TA 3F73A 1JHZA 3CZ5A 4LX8A 4FB4A 5EWLB 1AB6A 3O21A 1K68A 4JA2A 4NCAA 2H3HA 1NXOA 3CNBA 4Q6BA 3RVPA 3LUFA 3RVLA 3VNBA 1P6QA 3MQ4A 4L4UA 4EVQA 4LRQA 4JB2A 5TQ2B 3A10A 5IEBA 1DC8A 3FDFA 5DKFA 4MRMB 4Z4EA 2PLNA 2FEPA 3C97A 3URMA 3LUDA 1Z18A 3ILHA 3OQMA 1Z17A 4JASB 1JH9A 5KC8A 1NXSA 2IPMA 2QVGA 3LUAA 1C4WA 4N0PA 1LBIA 1Z2DA 3LKVA 4QYMA 4RK0A 4Z99A 3B2NA 4RY8A 4QYWA 4YP9A 5KQPA 4MS4A 1SXIA 3SY8A 3NHMA 3HCWA 4MS1A 1E6LA 2QZJA 1FFGA 3OM0A 1TLFA 3O2JA 3KG2A 3TMYA 4IMJB 2IYNA 4H60A 1JL3A 3O1HB 5HSGA 5HQJA 1M5UA 2FMIA 2A9RA 2FQWA 2R25B 4P1ZA 5CNIA 3N53A 4E7OA 1ZVVA 1GUDA 4MS1B 2IKSA 3FFXA 2FKAA 1DP4A 2O20A 3GL9A 1I3CA 1ZHHA 3IP7A 2Q5CA 2QU7A 3K9CA 2VUIB 4IMIB 4MQFA 1UDRA 5IX8A 2HQRA 3I42A 5EWJA 2MYNA 4RK6A 5KQMA 2FN8A 4MQFB 3N0WA 4H3HB 4N47A 3H5WA 4RY9A 4GPAA 4HNQA 3HUTA 4KMRA 2ID7A 1XWWA 2R4QA 4MPTA 1USGA 1MB3A 1QPZA 3C3WA 2PL9A 4DADA 4IRXA 4OBBA 5DTEA 4N0QA 3EQ2A 3LUGA 1FSPA 4TMYA 4UHJA 2IDMA 4OATA 3R0JA 4PZ0A 4ETNA 4RV5A 3RVQA 1PUXA 4PYRA 1USKA 3JTEA 3OO1A 3I09A 4ZPJA 4Y9TA 5PNTA 3TD9A 3CTPA 4TN5A 1XHEA 1YS7A 2NZVG 3OM1A 4M88A
chains in the Genus database with same CATH superfamily
2VPPA 4NBVA 4J2HA 1K2WA 3GEIA 5F2KA 4QXAA 2ISQA 4OHVA 4ZHQB 2CLHB 3JQAD 3K3PA 4NV1A 5FUBA 1VPWA 1ZZGA 1E1QD 3IQXA 2NU8B 4RD1A 2CE7A 2HPAA 1YB7A 3CF4A 3OURA 4FUTA 1ECFA 2F43B 1T5TA 2RC5A 5SZKB 4JI3B 2CLSA 2YFKA 3SR0A 2QG4A 5L4SA 1LBTA 2PM8A 5JS7A 3AUYA 3FM9A 1A7AA 5E7MA 4EKDA 1NATA 4FMCB 5JPCA 2PEYA 5L3VA 4X6LA 4MK4A 1X7GA 1XELA 3Q0TA 2QHXA 1NPDA 4EPTA 1S8FA 1SHJA 3BF7A 1IEVA 4INAA 1NXVA 4MQLA 1RM5A 5G0TA 4P2BA 1SUSA 5IBQA 2ZT5A 4ZXFA 1P1RA 5JNTA 2V58A 1TFRA 4AURA 3GGSA 4DXHA 2WVAA 3GMDA 4QREA 1L5LA 2PUVA 4YFYA 4MXDA 2PUWA 1FLDA 3V8BA 2VCHA 1PR4A 1YR7A 2HA5A 1BTOA 4G0PA 1ANKA 1EQUA 2B2NA 4XARA 4P53A 4XW2A 3SHVA 2DFKB 3H97A 4CEJB 1NJFA 3AEZA 3KSMA 4HRVA 4RIIA 4HPWA 1NMSA 3ORSA 3HKDA 3WKCA 4IIHA 2AF4C 3AEKB 3DWIA 3WY9A 1A5BB 1REQB 1NN5A 1OAKA 1VBFA 3I2HA 5E8RA 2NSDA 1ENZA 4CG3A 1SKAA 5A0FA 5MN5A 3Q8LA 5ABPA 3ZDDA 3NT5A 2MINB 3Q1KA 3HYTA 1XRRA 4HS9A 3AUXA 3OC0A 2YFHA 2G6BA 1UCFA 3GV0A 2VHWA 2FU5C 3ECSA 4GXQA 3DWFA 2EJUA 3B53X 3FHTA 4BRSA 3CH5A 2P4SA 1WXGA 3DZ8A 3NYRA 2WWGA 3F47A 4A36A 1OASA 3C1UA 3F9IA 4BZQA 4A3SA 1GN8A 4FEEA 4XQCA 1TRHA 1TYBE 4UM5A 1R0RE 2GJ4A 4QARA 2PFSA 1O9HA 1ZK4A 2XWPA 4LSGA 4EJ2A 3VNUA 3HK2A 2QN6A 3OLVA 4AJ1A 4BASA 2X1HA 1JV2B 2F4NA 1S01A 5TPZA 5CDUA 2DFDA 3QFCA 1HSZA 4QUGA 3EGIA 3EOZA 4TLEA 3A25A 1E1CB 1AX9A 4HATA 1KMCA 4MLPA 2BELA 4HUQA 4DBVO 4U63A 3SJZA 1VCNA 5AVSA 4YI5A 2WUWE 3U6KA 3EVFA 4U7JA 3V4OA 2VEOA 3IALA 4ER5A 4J2TA 3E3MA 3TLAA 1CJVC 4CDGA 1M67A 1TDJA 1XU7A 2FXIA 2G9QA 4ZYUA 3PICA 4RELA 2I2FA 4R3NA 4OI2A 3BWMA 4MVWA 3C3BA 2WV7A 3EZLA 1DARA 4L5JA 4TUYF 3F9RA 3LI2A 2Q3MA 1U31A 2YY7A 3KM0A 4L3WA 2X13A 5CB4A 4ABTA 2C97A 2ZIAA 4AYXA 3U7RA 1E2PA 3CE6A 4Y3UA 3MUEA 4Z4IA 4HNAB 3WZLA 2YYZA 4D9FA 2CXNA 3DL0A 3FJ1A 2HCJB 1I1QB 4EKNB 4F2GA 4F2WA 1PJ8A 8MHTA 2JI8A 3KWMA 1KKMA 3D64A 4FR0A 1QXSA 2JD2A 4LHYA 1XVLA 2UZAA 5KYNA 3EXEB 1WXQA 4CKWB 4U8HA 2D8AA 3D54D 1FP6A 5H80A 1TUGA 3HRHA 1NV9A 4RVHA 1OAOC 4NV0A 4Q19A 3VNSA 1FP2A 1WDLA 5KZMB 4ZVKA 1ZUNA 4L0MA 5J59A 1HF3A 2O2ZA 2J59A 2QRGA 5AMXA 2HMYB 4L6CA 1J9EA 1EJ2A 4JCOA 3F2VA 3UJCA 4D8WA 3CMMA 1CY0A 2V9ZA 4Q82A 4LMBA 1M8GA 3TSAA 2FPGA 4AZ3B 1QORA 1T6ZA 3D02A 3LW8A 1Q5PA 3JZDA 4HX5A 4YMTA 5CB4B 2FG7C 2HCBA 3NOVA 2JFGA 3DMHA 4HFJA 2HMWA 4FHGA 3VXKA 4AZSA 5AVTA 3RTDA 2YNMA 3DEJA 1GSOA 2GPWA 1MOQA 1N32B 2P79A 4NBUA 2JGIA 3LYLA 3WQRA 1A3CA 1KGSA 5A9TA 3RS5A 1N6NA 4YP6A 4P7FA 1PWHA 1VHLA 2Y6VA 4S3MA 1NNI1 4LF7B 3C6YA 3L93A 4MUIA 3V55A 4QXQA 3WNCA 4BO0A 1QGOA 4PO1A 2GR9A 4ZEXA 3OCCA 2ATXA 4PU0A 3ZKAA 1V4NA 1D6NA 5FFNA 4V0KA 4BQOA 2G77B 2L2QA 4L4XA 1QG6A 2B5OA 3RUEA 4XB2A 3RHZA 2WM3A 4ITRC 4EGQA 5F33A 1BH6A 1JLLB 2EIHA 2WAOA 4RE6A 2ZJ7A 2J08A 5DRYA 4ZVMA 4JI1B 4ZHSA 3UMYA 3GA5A 2DYKA 2LDXA 5A7HA 3VNAA 1KQOA 2WMNB 3ROKA 3IVGA 4AJJA 4KPUA 1ZO8A 1YS4A 2AYZA 1RKXA 2WSIA 1D4OA 5BVGB 3DXFA 1H4VB 4LKOA 5EC8A 1KVQA 3WRYA 4YCJA 4CLDA 1J24A 4JXKA 3VC7A 4CIYA 4AF8A 1GRCA 4QBKA 3WKAA 5H68A 2NTNA 1M6EX 3Q5EA 4A1FA 7YASA 3L6UA 1SBCA 3B9RA 3BWCA 1ZM2A 3D0RA 2I2DA 3QUTA 4YAEA 4MZDA 3HA7A 1Y3FE 2GPBA 3CKYA 5KYTA 2P5TB 1N2IA 3GLHA 2CMGA 5EVCA 1PBTA 4ILKA 2RKOA 4AAYA 3MGCA 1WF3A 2HV9A 2RK6A 3D9QX 5E4TA 3GZ4A 4XGRA 2XCLA 1GWNA 3GNQA 4G0XA 2HHHB 4WGGA 1VJTA 3RLIA 4Y0VA 3P9RA 3FTFA 5EGNA 3SXJA 4IINA 1UF9A 4IQ8A 3O1JC 3VM6A 1TCVA 4TUYA 1YJBA 3OE4A 4F84A 4MUBA 4QDJA 3DDSA 5C5EA 3KWLA 5AI9A 1SHTX 3UB4A 3NDBB 2Z6AA 4RHEA 3MJDA 2VWGA 3Q0EA 1DQPA 2OL4A 3DAFA 2FR8A 4KK4A 4NFHA 4OOFA 1V96A 4RPCA 4YA6A 1LPBB 3V4FA 3L43A 1LPSA 4WUVA 4TKUB 1I7NA 2Q3LA 4QFMA 4U8GA 4WLVA 3SM9A 2DHRA 3DBHA 1AS3A 3PI6A 3Q4GA 2DOKA 3MNFA 4ND8B 4PONA 4EFMA 5A04A 5HJ5A 4H18A 2AMLA 4GOLD 1Y6QA 4X0EA 1DINA 3RNOA 3MWYW 4A2WA 2JAPA 1NOJA 1GLVA 1MRSA 1XMOB 2B8TA 3WLJA 4PZUA 2H11A 3AR3A 1YBVA 3E48A 3WMXA 5JVDF 3PHIA 2XB2A 2OMEA 4X6UA 1SIOA 1A8HA 2Q1YA 5KKNB 4GHWA 3SF0A 1A5SB 3LUBA 4FONA 1IVSA 1YTUA 1SBNE 1ZI6A 2FTKE 4BKQA 3H1BA 4L72A 5BURA 5CURA 4QM6A 3GBPA 3PD1A 3KLPX 2QTCA 1PVDA 1XR3A 1GYPA 3CE9A 3HB5X 5A3VA 1NASA 2E5WA 1PYOA 3GJRA 1YU6A 3KUKA 4JC4A 2Z95A 2ADFA 3D7SA 3WQQA 1WS6A 2GA9A 4WESB 2FOLA 2IL1A 2MR5A 4DA0A 3LO5A 2VP6A 1WWKA 4KYIB 1E0SA 1FDSA 2HU2A 4RVFA 4C22A 4YMHA 2W6ID 2QTZA 2OD9A 1RYMA 1JJIA 4IDHA 1W49A 4K03A 2FMXA 1JI0A 3NWBA 1R37A 1UK9A 3PQ8A 4LDNA 4KR0A 4WD3A 3THSA 2ZYTX 3ZVLA 4LOLA 2BMVA 2WF5A 1BN6A 4PLVA 2IRWA 5T67A 4FIZA 2VTBA 3DTTA 5AKIA 3W5DA 3HFGA 2HTFA 1R6UA 1WM1A 5JAPA 1V5EA 1RI2A 2C9YA 5C32A 1GU0A 2RMKA 3GJYA 1TL7C 4HN2A 2WD7A 2KE5A 4H31A 2J0UB 3G59A 2O3QA 1PNRA 3ESAA 1UMBA 2XEDA 3D0KA 3KE9A 4P3OA 1PSZA 3NDPA 3GEBA 4OXXA 3VHLB 5AWFC 3FZQA 3H13A 2XZTA 1Q6YA 3AUSA 3AQ4A 1E6CA 1SO8A 5B1YA 1QCYA 1SUPA 1DJLA 2JF0A 4F21A 2PX6A 3RSSA 3Q1LA 1PGPA 2BI8A 1GEGA 3IBCA 2IHTA 1T26A 2HBRA 3IP8A 2HOQA 3MS4A 3X2FA 4D8YA 4ZTZB 2GZ1A 3OJFA 2XMQA 1VE5A 1Y33E 1D0IA 4NBLA 5AW1A 1KFBB 2ZSUA 2HB6A 1FSZA 3I9KA 2WP8J 1AJEA 3HEBA 4YLEA 4OXYA 3ZQ4A 4YRIA 3C43A 1NYRA 2F3QA 1EE9A 4IQGA 4RL4A 2H29A 1GUYA 5IWAB 2Z2KA 2E0IA 4NFYA 5KNDH 2OILA 4PANA 1CNEA 3QJ5A 5ERGB 1F2TB 4HDAA 5K51A 5DP2A 1O58A 2OK7A 3SKYA 5ALWA 4EARA 3A37A 2GN0A 1D2EA 5KQSA 3WIUA 1CR6A 5J5CA 4AG3A 4PX5A 5MGNA 5LBTA 4BLSA 5DNDA 1EM8B 3O8CA 3HYNA 4HNHA 3OKFA 7GPBA 2Y1OA 4OXRA 1DIGA 4QTUB 3KOYA 3QKRB 2PXHA 1E4YA 1RJ9A 1XL0A 1VMIA 4DCOA 1UWLA 1QQ5A 2KM1A 1JG1A 4Y6OA 1TVMA 3ZWQA 1T6XA 1FS4A 4DE5A 2FF5A 1J2TA 4OSEA 3WVNA 1DC6A 1HURA 1IZ8A 3V7YA 5AW6A 4FGKA 3IO3A 2QLBA 4FI3C 5HRUA 4YREA 1PE0A 2R4UA 3O74A 3O82A 4JYCA 1THMA 4KCGA 1VRCA 1JG4A 2G83A 3RVRA 5LYJB 2NM0A 3HCPA 1MAVA 3A3PA 1UODA 3HPQA 2FWBA 4I5EA 4IGFA 2BGJA 3GYBA 3VVCA 5CDFE 5L7WA 4Q1VA 1KMNA 3RWMB 3K5WA 3Q7QA 8ATCA 1ESEA 2AGVA 3WV5A 1DRJA 3PQ4A 2IHZA 1L7BA 4FLMA 2RHDA 1M33A 2WE7A 3ETDA 1NN0A 1COWD 3MRTA 4EYEA 1KDOA 2BOVA 3N1UA 3PCTA 1T0BA 3ZIAA 4NCHA 3OQHA 5DSTA 1E0DA 2HA7A 4GQBA 5LOVA 2JIDA 4Q21A 5EIHA 1OY1A 1VI6A 2XJ4A 1Q22A 2AOVA 4IDDA 2EU8A 3G0IA 3IT0A 1XD2B 3JASB 3QVMA 4HH4A 1HDOA 1L4BA 3AEQB 3HV0A 1P9LA 3CPEA 5DFAA 4B73A 5EMMA 3ZV6A 4G4SP 4J9VA 4WFIA 5H1YA 1Z8HA 2ZT7A 1GGNA 1F60A 3BGIA 4H1UA 3RVPA 4OVKA 1R88A 4DT1B 3NGMA 4Z2AA 2CNNA 1N9GA 1UPCA 3QOFA 3AVWA 4H4CA 3HZOA 2W0MA 1ILEA 3DAGA 1Y1KE 3M2TA 1MJGM 3PITA 3Q87B 4DVJA 1T5HX 4OGWA 4CM8A 2EAUA 3FGPA 1OAOA 1S2NA 2EX0A 3CW9A 3B60A 1KJWA 1BH2A 4D0SA 3ME5A 2CJPA 4JXJA 1E99A 4A91A 5DW3A 1ORWA 4YUWA 1YQTA 3IODA 2W6ZA 3FUCA 4HGNA 1JQAA 1WRBA 1LBSA 2DSNA 3B2NA 4LC1A 4XFJA 3O0DA 1HDGO 2ZYDA 1SB8A 2XZPA 1J7KA 1ECPA 1I1OA 3L0CA 3OM0A 4FDLA 4X1OA 4ZARA 2E5LB 4C0HA 1CUYA 3BE4A 2JEOA 4CU2A 1WL8A 3AHFA 1FEZA 2IYNA 2WLSA 3EFOA 4ZCQA 2DEUA 2D62A 3VR4H 2IS4A 1QU3A 1NUSA 4CCWA 1LNSA 3N53A 3VPGA 1JHQA 1QLJA 4HYTA 4Z0HO 5ADUS 4X62B 1ZJ6A 3BZWA 3OJXA 5AJTA 3ZWYA 1BX3A 3T34A 2VJBA 4EH1A 3KEMA 1YMQA 2IVZA 3CINA 1JLMA 1XFDA 1Q0PA 1MJHA 5EP1A 1MKYA 3M5WA 1FDIA 5IU6A 1K4YA 2PNJA 4MCHA 1PF7E 3PPXA 3RS7A 1Q92A 4KNWA 2JFBA 4OJQA 1DI0A 3BJZA 3FJYA 4ZOLF 5EOVA 3G89A 4O2AB 4DARA 4RK6A 1K5PA 1WTCA 2MR6A 5KNBA 3EIEA 3H5WA 2W2TA 3L7OA 2EATA 4QSMA 1CUSA 3ROMA 1NW3A 1SC6A 1ZUHA 4KAXA 4E5SA 2Q0HA 1ADGA 3SE0A 1S89A 4D0GA 1Q0ZA 2AXPA 5HX7A 1TC2A 4B4KA 3EXIB 3FYDA 5BPFA 1QPZA 4V1CI 2C0QA 1L7MA 1VP9A 5I3ZA 1SXPA 1DJQA 1QDUA 1X42A 4DWVA 2R3SA 2W2LD 4BYMA 1SQSA 2HA0A 4AF7A 2B3TA 1NAIA 3UO8B 3LVFO 4A23A 4C05A 3DH0A 1K27A 3REGA 4ZI7F 1ZHOA 1Y3IA 2RGUA 1DG1G 3JTEA 3M1IA 3OPYB 3R6LA 4F1KA 4N6NA 2VDKB 2WOOA 4YWJA 3QG1A 1L1QA 4I6JA 3UY4A 4JP1A 5KAMA 1ZGAA 3OHMA 3QFRA 1N77A 4BVHA 3GJ6A 3HUFA 3NJ4A 5BWBA 3HKEA 4P83A 1GT6A 1CEXA 1NMXA 2ZGVA 1Q0UA 4E3ZA 2C1XA 4JJGA 4EPYA 1GL9B 2UXDB 5JZBA 5HIKA 4G26A 1CRQA 5G41A 3QMMA 3OX4A 3HCOA 3PDCA 1P4GA 3C14C 5KBYA 3WBBA 2J3HA 4B3FX 3GLGE 3B7GA 4E94A 2JFPA 2WJJA 5GINE 5AKLA 2NU8A 1CUDA 1LTHR 2PKQO 1OV6A 1K5GA 3ROQA 1CQJB 4QQRA 3QVUA 1PO7A 1QIGA 3A6FA 1YRWA 3GJTA 3SHTA 3WHLA 5ICCA 4AMYA 2WWIA 2Z2JA 5GVRA 3X2SA 3DFKA 2FSHA 1U5BB 3N76A 4R2JA 4CHGA 2JA2A 1P4JA 1ZJJA 3RT7A 5AFSA 1GKIA 1WQ1R 2Q7XA 1RXUA 5DYWA 4CEJA 3GEDA 3N5KA 1EFRA 2J3LA 2QM3A 3QU7A 5EKUA 4D56A 5ALVA 5K8UA 3AEKA 1IBLB 2FMHA 4X5OA 1W35A 2ORWA 2OHHA 4IV8A 1HTTA 2VYNA 3OU6A 1G3MA 2ZLBA 2FEAA 1FSSA 4J75A 3HKEB 4C0BA 4AYTA 1YUBA 4QL3A 3SU8A 2NP6A 2W6IA 1II8B 2WIAA 1M1NB 4H1TA 3E7PA 4OG2A 1JT9A 3OQ6A 4COKA 5JY6A 2JFVA 2HDOA 2J07A 3F7NA 4FQ8A 2FPKA 3BCHA 5EZSA 3RUPA 3DZGA 3QKSA 4ZZIA 5FTLA 2I6FA 1CJBA 2OZKA 1KEEA 4BPBA 4ZCLA 1KOGA 2PKCA 2X14A 1DHRA 5KYUB 4QVGA 2O7QA 1V8ZA 3KT8A 1FUKA 1LJUA 5JVDB 1PJ2A 3GO4A 1YQDA 2Q8QA 4ANFA 4RK4A 5JH7F 1NTRA 4NG5A 3WBFA 4ESEA 1JQKA 3VX3A 1OLUA 1G8KA 1WHSA 4M9CA 1ZU4A 3VVLA 4WZBB 4FDMA 2ZRHA 2AG0A 2AOTB 1TU4A 1TZKA 2AYYA 4GYKA 4JODA 5LYJF 1GQOA 5E0OA 1ADFA 2A1TS 2PK3A 2AFHA 4KH1A 3WNQA 3S1LA 4FOSA 1VE7A 5L3RA 4TYWA 1P33A 1U0TA 4J1QA 2QD1A 4FBGA 3RVBA 3KUUA 2GRAA 3TQHA 2GM3A 3MINB 1F0NA 2H16A 4KAAA 2VIIA 3R5FA 2LRHA 3DBRB 3KWJA 5IAJA 2MHCA 2C31A 4BMZA 1MFPA 3P19A 3G5TA 1CHDA 3FI9A 1RP1A 4MKFA 4WFQA 1IY1A 3L4SO 4NYMQ 4FYVA 5D5PA 3HU1A 3ZU2A 1YVRA 3AGQA 4Y2PA 1RLOA 1W4LA 2Q41A 3CC8A 3DAOA 1N4AA 2WAMA 1C0PA 5JFGA 2ZROA 3F49S 4PXSA 4HQOA 4LV5B 5BW5A 4LZAA 1AS2A 3CEMA 1OFTA 3NJ8A 5DP1A 4ZKDA 3GA7A 1NXWA 1XTIA 1ZM7A 4U2FA 3R3JA 2AVDA 3RS8A 4K81B 3QHAA 2GZSA 4US2R 1FVXA 1IHXA 1Z4LA 3WJ1A 4RF4A 4AMZA 2V54A 4NYIR 3PGXA 1TOAA 5TX7A 2J3EA 4FHCA 4BGVA 1TECE 4TLLB 4D5GA 5CLQA 1NR7A 5FR2A 2PWAA 4BVFA 5KSOA 3VPDA 1A1VA 3NT4A 2EP8A 1N25A 4X94A 4OQLA 2ZIUB 1ORRA 1P61B 3B6KA 4G0NA 1U3CA 3NIBA 1KYYA 1UBKS 2WHXA 3OJCA 4XQGA 3TXAA 3D7NA 4XIGS 1RR6A 1GGHA 1SUCA 2QVLA 2XVMA 4HXFB 5B1DA 4U2BA 4B33A 2R7AA 4O4JF 1NW7A 5DK4A 2IA5A 4DLNA 3TWOA 1JJAA 1V3UA 1JJFA 2W6PA 3FGOA 3IYLW 4MWDA 4FCCA 3ITEA 5G0WA 2G72A 1I13A 2H9AA 3LLMA 4GEGA 1CUVA 4RLFA 3RREA 4BRWA 2DKOA 4NCBA 1DBQA 1T6NA 1PHRA 2AX3A 1Y8AA 3FIUA 3GIDA 4AJEA 1M2KA 3JYLA 4FB5A 3WLSA 3BK1A 4OHKA 1NG1A 3SLKA 3LE8A 1TAUA 2GFIA 1U8TA 1XK6A 2D74A 4Q3NA 1AN0A 4YJ3F 1UIMA 3FDIA 1H9AA 2OQVA 1WUIS 3A2NA 2H4YA 3O8OA 4INPA 4P7KA 5F73A 4V3CA 2RIPA 1KTIA 4E6PA 1EBBA 3G2MA 5L45A 2N9UA 2RFLA 1U7OA 4LHSA 2H17A 3K0CA 5JASA 1E2DA 2QZ4A 1I6KA 2G08A 1SD1A 5SYNA 2Q21A 1G21E 3WMGA 3ICWA 4OKNA 5B1SA 2FMUA 2GARA 4WY8A 3CCFA 5EHZA 4JV5B 1KXJA 1RP7A 4KPUB 3IHLA 4BEWA 4MQUA 4L6AA 2QI9F 3OC6A 4FKMA 1QB8A 4ER0A 2PV0A 2GN9A 3ZLVA 3IPAA 1OXBB 2VF2A 3C7TA 3ZIAD 4Z7JA 5CK5A 1NF8A 4IWYA 1E2HA 4GX0A 1U2ZA 1L4NA 1UBSB 3ESCA 2B9EA 3MTBA 2R1TA 3IVMA 2FGKA 1UOPA 4IFEA 2G0AA 4EY3A 4IUDS 4Q7QA 4F3YA 4MO2A 3CUEF 3NVDA 3OOJA 5ERXA 1L4FA 2AZDA 3ZBTA 4NYJQ 1Q2UA 4GKAA 4IBOA 1PWEA 4OSOA 4UFNA 5G0UA 4P36A 3D7KA 5GM2A 1ICEA 4OHCA 1ISIA 1OPRA 4D9NA 4DNPA 3ZDRA 5C35A 1PTKA 3NOQA 1Z3IX 4FGLA 4C7KA 1M7BA 1V11A 5IM4A 1I51A 3W06A 3Q7PA 1Z6ZA 3A8TA 2Z58A 1KC3A 4YRBA 1TQ2A 1UMCB 2C03A 5IXSA 1G8JA 3EYWA 3FMIA 3H2JA 3O9VA 3ONVA 3I01A 4RDCA 3VOBA 2R7MA 1RC0A 1RQPA 4IDBA 3T3OA 3EJ6A 3D2CA 3GLHB 5ES4B 2J0VA 2FK8A 5GJCA 4F46A 1YC5A 1DHTA 1JVSA 3SIWA 3ZCXA 3KQKA 3OF2A 1OU4A 1GO2A 4JGGA 3NX4A 3HN7A 1E2IA 3BS4A 4X00A 1WXFA 4J0CA 2GUGA 4YNBA 2ZBFA 5FA8A 1ZRNA 3OZIA 3IPXA 4G1EB 5DCWA 3MEQA 1I6WA 1VHDA 3OESA 3ZS8A 3RIXA 4C01A 1KHTA 1YZKA 3WFZA 3G17A 3QW4B 1HTBA 3BBLA 4GP7A 1TM7E 2C57A 1XVUA 2X8LA 1RPAA 1S9DA 3PE6A 1A8SA 5JJCA 4N54A 3KZNA 2JHCA 3K16A 4UU7A 2QAGC 4QNMA 1KDYA 3UNXA 3FTNA 1H0HA 1PJRA 3CNOA 5IJ9B 1O96B 1RKBA 1A0OA 2GDJA 2VJPA 5CFPA 1O3YA 5KQGA 1Y7IA 1ST2A 5B7PA 3CSSA 4LC0A 5DYIA 1JT2A 1WHTB 5CFNA 3FPEA 3M6VA 3WI7A 1KDTA 1Y42X 2IOQA 1WUKS 4L08A 3FN4A 4OFWA 1UBCA 1K5HA 5ADHA 2NMVA 3AI2A 3P9KA 3L7BA 2C58A 2PMFA 2PY6A 3AR9A 4Q4DA 5E7JA 4QU9A 2W42A 3HJFA 3JALA 3EVDA 4MCAA 4XCQA 4HVCA 4KQ9A 4KFCA 3V1MA 1DFIA 4LRSB 2VDUE 2O5CA 1JP7A 3QEAZ 3FUXA 3ETLA 2F59A 2PWPA 1H6DA 3DVLA 3HJCA 3L5OA 3UWKA 4RQUA 4R8MA 1UZLA 1J8YF 4WNAA 4NRDA 1XYGA 3JQFC 2YW9A 4BBZA 2XTAA 3AFIA 4Y0AA 5I5EA 1W5AA 4C7JA 2E49A 2L19A 3O8LA 4AJ9A 4AXXA 4OX9B 4D81A 2C88A 4DEYA 3HWX1 4CKWA 2AC2A 3ASUA 5LR6A 1NT4A 2O7VA 5DHPA 1M9NA 5JZSA 3TW4A 2NZJA 2G6TA 2IYXA 1BGWA 3D59A 5KWSA 2IXFA 3F6PA 3EARA 2YCBA 3RSLA 3X1JA 4BWVA 4EUSA 4RDXA 4AQ7A 3HY4A 3IOMA 2MIIA 3PKJA 2R8YA 1OJ7A 2YZNA 2ZAOA 3RJTA 4MINA 5AVWA 4PTYA 3DVRX 1KYXA 2CC2A 3GJ4A 3HO8A 5KYVA 3REQB 3RK1A 5CB4F 1UKYA 1Y8QB 2MMCA 2X9QA 3I76A 4DRXB 1X1SA 2ZT8A 1MB2A 5F7XA 2NTJA 2WUGA 1NTOA 4IXWA 5BWNA 1XF1A 3FW1A 2CVHA 3IUJA 3NIFB 2GXUA 4BNHA 4ZYYA 1T1SA 4UEKA 3JR7A 4UKDA 5CVVA 3SGLA 4TV9B 4BNKA 1DKOA 2QQFA 2QZPA 1VA5A 2QQ0A 3LWNA 1UMKA 3GH3A 3WLTA 4A6DA 4IUBS 1HQYE 1U7ZA 1XDDA 1DAIA 4FFOA 3PTZA 3T4PA 4DIKA 1M6YA 1YC2A 1J0BA 3C3MA 2O8FA 1IM8A 2G07A 1BWPA 3C15C 4I6GA 5EI5A 4B87A 2ZCJA 4XPIA 5EJAA 1RZVA 2C07A 2RHGB 4PRLA 4TTPA 1SQ6A 4UDXX 4RC9A 5GONF 5BRAA 1WB5A 4R5MA 2BSAA 4E3WA 3CGGA 1N6LA 3ZLTA 1NBHA 4ID9A 4WDQA 1FXUA 2AC4A 3ISVA 3DEZA 1GA4A 2WA1A 2R6R1 2X0JA 4YCDA 4EB0A 3U7HB 1MO3A 2WJZB 3HUUA 4JSRA 3DAPA 4XEUA 4PCUA 1Q74A 2I1LA 3VBEA 1B6GA 3MD0A 3PIIA 1YFJA 2PDAA 2EZ8A 4EHFA 1GUZA 2YXBA 4GGMX 3V8MA 3SS7X 1ZUD1 1KSHA 2GF2A 1MZVA 1UZUA 4KXLA 5B7GA 3IRVA 3GLFA 3KLOA 1ZR2A 1CYEA 1L3IA 2PT5A 1Q6ZA 4HB0A 2OP0A 4FIDA 4YFVA 4JT9A 3JPYA 2X6RA 3AERB 3GDFA 1Z5NA 2HA4A 1N78A 1A9PA 1UM9B 3HDJA 3S4YA 2VDLB 4QXRA 4FEAA 2MSWA 2O1SA 1XQVA 1CJCA 1Q3KA 1M54A 2CJFA 4E4TA 3OJWA 5IH7A 4YPOA 1H9CA 1ECGA 4BFYA 4HWRA 3EX7C 2WF7A 3KR2A 5CNKA 2AN4A 2PH1A 2WVHA 1ZCZA 2IZ5A 2NO0A 2REQA 4RF3A 1ICIA 4HAUA 3W5IA 2BONA 2XUKA 1GTSA 1KNXA 2EG5A 1QQBA 3HU3A 4BNXA 4LDAA 1N2CE 1WA5A 3V2IA 4US0R 1O4VA 2WF9A 3U4IA 5T64A 3EWNA 2O57A 4GWLA 5EZQA 5DI3B 2HL6A 3ZDZB 1VOTA 1G63A 1DKUA 1KYZA 1JEEA 1PR6A 1TTQB 2W8BA 3OIYA 1GPDG 4G1FA 3RFVA 2Q28A 5HKAA 1SGWA 4NBWA 1L5ZA 1SCBA 3JRWA 5EUQB 2PIDA 3MHTA 2WD9A 3AVPA 4Q9DA 3TS1A 3WGKA 3PD0A 3WIEA 1JHZA 4GKVA 4OB7A 2F8TA 3REOA 5HWSA 3VZPA 2A4MA 4B47A 1KZYC 2C2ZA 2XVXA 4B4WA 9MHTA 1BEUB 2Q6IA 3FPCA 2JW5A 5JJBA 1AUQA 3VGPA 3A3YA 2JFYA 1POXA 3PFBA 2OZLA 2VF5X 2WIFA 3BA1A 4PQEA 3U80A 4AG6A 4D41A 4YMVA 5A05A 3KL4A 3GLKA 2WSBA 1AM4D 1P19A 3BWVA 3KV3O 3L7IA 3QNMA 4V38A 3I73A 3M34A 4KMOA 4I66A 4QWMA 3LX6A 3TRKA 1K7YA 2D1SA 4IXTA 4X93A 4JUCA 1VECA 2G9NA 4JBNA 5KNDD 1XVTA 2YQ5A 3KQYA 3PXUA 4DSTA 2IUYA 4V2UA 3TLYA 2JLRA 4N7JA 4N5IX 2HJHA 2Y4NA 5FORA 3VPAA 1UAYA 1NOKA 1UKVY 3L9WA 2P4QA 3LF2A 3MHPA 5E6UA 3MLAA 2P90A 4HDNA 2CLKB 5EJ9A 3SBDA 4YDQA 2PGAA 3H9GA 3TEFA 5BUCA 4LJ7A 1UKEA 1PQWA 2I91A 3J81k 1QR2A 2DQKA 4I46A 3SN6A 3HO6A 1KI7A 3KG2A 3EPHA 4R41A 2HMVA 2FAXA 4H60A 1G8PA 1UOQA 2B82A 1KEWA 1T3LA 3MQFA 3PKIA 5AKHA 1J07A 3ZVNA 5F7OA 2QLJA 3MOSA 4GO1A 2HXYA 4UNIA 1AZWA 2J9FB 3HXLA 5FO0A 1M7HA 5L4NA 3NHAA 2CB0A 1NAHA 2Z3WA 3EFOB 5C3UA 2L0XA 2W22A 3DDWA 4JFAA 1DRVA 2J46A 4C4ZA 1G17A 1GY8A 2XVYA 4CIDA 5LZ4A 4MUMA 3K9CA 5L6LB 2NYAA 2RGAA 3IE2A 1TVKB 4MQFA 3GK3A 4FYJA 1I32A 4NCNA 1PLJA 4P4UA 3ZWVA 1B8NA 1BVYF 4CL0A 4BNLA 3ZTYA 1MQAA 1R4NA 4KNVA 2B78A 2X0KA 2QAIA 4GQAA 4ROSA 2O8NA 3LYAA 2PHZA 4TQUS 1FTWA 1UZAA 3NR2A 4JZKA 4PAWA 5HCIA 2B8JA 5TXGA 3L7DA 1YZVA 3B2QA 3DHEA 2H5LA 3H3JA 4TPKA 3CJQA 5DB4A 1DSSG 3TUJC 3VPBA 4BZXA 4TL6A 3SZRA 4KDEA 2DB3A 3UGQA 5DJ5A 5FDFA 3FWNA 4HPJB 3PEUA 4X20B 2QL9A 3GJ8A 1MXFA 1RI5A 1F0YA 1R6VA 4YJ2F 2CMFA 4DADA 4NDAA 3K8OE 1GNPA 2H48A 4JI5B 5CLFA 1TJPB 2D1TA 3TZHA 1P0FA 3W1WA 1KKUA 3CYFA 1SVWA 2YC4C 3I92A 2FRVA 3VSCA 4QATA 4B8YA 3QXGA 3CO5A 4ZN6A 3CO0S 4CEHA 3BCUA 4Q03A 4YJDA 2WMDA 3P20A 1T0IA 5BN5A 3SC3A 1W8DA 4GYWA 1JBKA 2FQXA 1ZM4A 2X3YA 1Q84A 3PXCX 4V39A 2YICA 3BMQA 4CYMA 1R0YA 3FVWA 4IGKA 1Y8ZA 5GY7A 2FZGA 4E5MA 5LPNA 3K7EA 3AONB 2C00A 5ITWA 1SVMA 3IUBA 3ED1A 1Y0BA 3AIMA 3RSCA 1OROA 4KZKA 4AZ0B 4Z5XA 2CK3D 2YY5A 4OQXA 1EAMA 1LDGA 3KZVA 1DMRA 1Q7RA 3PHJA 3M0EA 5DHTA 1QRSA 1YAHA 4BX3A 2FPIA 3ADDA 3TBKA 2QRLA 5IXYA 3UGJA 2FSSA 5JNUA 2XSZA 5KNCH 3C3DA 2PX0A 4LXGA 3WB9A 1DADA 4KEAA 1AKMA 4QFBA 1DELA 2IIVA 3QIVA 4P4NA 4BU1A 5JQGB 4G0MA 3LUHA 3MXTA 1ZLYA 4TWZA 5KOJA 1GA6A 1M72A 2O3JA 5BNFA 4KRYA 4MQEB 3NRJA 2PUFA 3CT4A 3I0MA 4P7GA 2X0DA 3RVJA 1VKOA 4BQFA 1ZK2A 4LV6A 1LBEA 1AQJA 1QP0A 3RB8A 2FPOA 3UK6A 3U5TA 3PEFA 3HI6A 1GG9A 3F7OA 4DV0B 2QWXA 1Z5OA 3T0GA 2GA8A 3T95A 2BP7A 2BTOA 2V5UA 3ABSB 2XLCA 3CKMA 2H4JA 4J1NA 4UTVA 1E8MA 1S8AA 4I4IA 2ZI7A 2FEXA 3H11B 3MPUA 5JMOA 4G5QA 1DLJA 1HKUA 1JECA 1U8UA 2DQYA 3DAHA 3F6CA 2WPDD 4QULA 4YBZA 3RAJA 3SFZA 3WLFA 3QU2A 1PN3A 5IK2D 1MAAA 4N3GA 4D4LA 1ZAYA 4R2LA 1FDUA 4N3BA 5DBFA 4BO3A 2JLSA 2C2OA 1TZMA 4TV8B 4L5BA 1CNFA 3AEQA 1G3RA 4X6YA 4FHZA 3GLTA 5DHAA 1AXRA 3S8MA 5KU1A 3K9HA 1CJKC 2R11A 4BE9A 2SCUB 3ONEA 1PBNA 3GLHE 2CV2A 3K9FC 1QHYA 3A27A 1MG0A 4W1RA 3DBLA 4DC0A 2PU7A 3DE3X 2AJ8A 3Q0IA 3C5HA 2O8EA 4HVLA 1SD2A 3TL3A 3U3ZA 3JZIA 3BDAA 5U1PA 2H1WA 2W58A 3KQVA 3TZCA 2IQ5A 3LA6A 4TTAA 2O48X 2PRJA 2XGSA 4K28A 4PZCA 3UCEA 2Z3ZA 1U5AA 1YR6A 1NW4A 2P4UA 4BNUA 1H66A 4CKZA 1HT3A 2XMRA 1CZNA 5I3CA 1QIJA 2HCFA 5K99A 2C4WA 3BZUA 3BSYA 3H5OA 3LT1A 4R83A 1CLEA 5A0VA 4YJ2A 1FFXA 1X70A 4FEYA 4I1YA 4PTLA 5DDIP 3BFJA 2NTYC 3EQ7A 3PUWA 1KORA 3SFTA 5JSZB 2VSNA 5M2QA 4HN9A 2KJQA 3IIMA 4A6XA 3HVRA 1WDKA 1AQUA 1BWSA 1ZVKA 1U7HA 2OV6A 2FW8A 3BB1A 4WLNA 3K96A 2FNAA 2A5YB 3GB9A 1DT5A 3L2OB 3WGIA 2H3EA 2K4MA 2HF8A 1F38A 3KDPA 1D4ZA 3FETA 1X1RA 3BZBA 3AH8A 2CZQA 3PNOA 3SSMA 3O4GA 2GJKA 3VOTA 3VSEA 5HPYB 1V25A 3DE7X 3HWSA 4EHAA 1TCCA 2EFCB 2QTTA 2WKPA 3KHTA 4QXOA 1S5PA 5CK4A 1Y48E 2GXQA 5CX1B 3FMVA 5CA1B 5FPSA 1XTKA 4AN0A 5IAAA 3HL0A 4HGOA 1RI1A 2J32A 4ZQGA 1YDFA 4QASA 2ZVJA 4YCSA 2GCGA 4IZ6A 1TEHA 1YCFA 1ID1A 3H9CA 1QH9A 3MOIA 3KAKA 3NAMA 3OTIA 1B2RA 4W8OA 1JA1A 4GSYA 1ZMRA 1IRIA 4QGAA 4PW0A 4QHSA 1N5OX 3K31A 2X6QA 2AB0A 3EFHA 2JAHA 1NN3A 3M5DA 2HPVA 3CLHA 1HDEA 3EEOA 5CPBA 3UMFA 4WKBA 1NLYA 1RWXA 3G1WA 6LDHA 4HKTA 5ALUA 3VR4A 3LDHA 1QAQA 2WNSA 1GLGA 3DPSA 1MP0A 4QE3A 4LRWA 4A8JA 3N0XA 3WAKA 1ZONA 3U7QB 2Q1XA 4CMEA 3HKDB 5D6NA 3SNKA 1DIHA 1O7JA 4NMWA 3GN2A 2EWVA 1JIJA 5FWAA 4RTSA 1YNOA 1I5EA 1U0HC 3GY0A 4DB2A 1OBVA 1OBOA 2B92A 1RYYA 4V2IA 4CU5A 3IEXA 2CV1A 2VZEA 3PCRB 5ESRA 5DYNA 2QL6A 1PJTA 4YXWD 4QU0A 2PR7A 3OE1A 3SBOA 1APBA 4QUKA 1FX0A 1P3DA 2QB5A 1TO2E 2VDOB 3GGJA 3PFIA 4BTLA 4Y2UA 4D3ZA 1Z2AA 2QGZA 4AJOA 2IDZA 1NBEA 4W7SA 1RNLA 4NYJR 3SC2A 2OUKA 3T5GA 4D96A 1YDMA 2VK8A 4G9BA 2PMCA 2JAQA 4GSLA 3NHWA 2HMAA 2ZT6A 3ZJTA 1H2YA 5F78A 3WGLA 4ZJYA 4JEMA 2CNOA 5BP7A 2K7FA 1IJKA 4C7MA 3UWMA 1C7QA 1UBRS 3DMTC 2V97A 3HJTA 3KVOA 3Q8KA 4I5DA 3GPCA 4BNWA 1HQDA 5BWMA 6ADHA 3SHFA 2NSYA 3BXGA 2O3UA 1OTYA 2QRNA 3EVZA 4TWAA 3T4EA 1LEHA 1S4MA 4URVR 5CT5A 2NXCA 1JFTA 1WMFA 3ZEIA 2XADA 3NOXA 3PGJA 4J0FA 1RHQA 2PS3A 3RODA 2CN1A 2OAQ1 3Q7EA 1F3OA 3CN9A 5ANRB 3IVXA 3OQNA 1KI8A 1P1FA 3JSXA 1OT3A 4OQEA 4RPKA 1PTJC 1BE1A 3FB4A 1I3NA 2PPVA 2O2CA 2VOEA 3IVRA 4K40A 4KB5A 3FPHA 2IU0A 4D2IA 4ZK2A 3HUDA 1OLOA 5EJ5A 5AHXA 1E5QA 1QTNA 2AHRA 4QDKA 2B35A 4BLVA 2X9NA 4IFTA 3WJAA 3ED5A 4OLHA 1NHGA 5FH9A 4DIBA 4D7AA 4ZI7B 4Z4HA 1OWOA 1CZLA 4HR7A 2O1XA 5JAIA 2Z2ZA 3QQ5A 2FG6C 3CF6R 3Q41A 2QQGA 4GX2A 3ZUPA 1RWVA 4P80A 5INTA 1E3MA 1B1CA 4Q66C 5EZ5A 2P5UA 1UMDA 4LBZA 4Y2JA 1P81A 1Y9DA 5FUYA 3BXEA 1P7WA 3KVYA 3FYCA 4BMCA 4LIPD 3RF6A 4N03A 1G42A 1NFRA 1UWCA 3E61A 4ZMBA 4B0PA 1JHRA 4HDKA 1XX6A 3PVCA 1JALA 4P0TA 1YRAA 1OI7A 1MQ8B 2F17A 4OKSA 4RGVA 3A36A 5FBLB 3U3KA 3LBYA 1WNFA 4BN4A 2ZR9A 4C04A 4LTMA 2UUAB 1KZ1A 4PYKA 4KIWA 2B0JA 5F9HA 1PZFA 4GSKA 1JXAA 1U2SA 3SYTA 1K08A 5LDDC 3KELA 1GQRA 3DW3X 5K3BA 1Y5RA 3FZGA 5K3SA 5HUHA 1CRPA 5BYKA 1KEVA 3LSYA 1S7CA 4RETA 1CULC 2ZIZA 3F90A 2WHEA 4I9FA 3WLLA 2XBMA 2BKLA 4CLXA 1K92A 2GX6A 1UEIA 3A1SA 3DT9A 5CMLA 5BN4A 1ORIA 2AI2A 1VYTA 4YCAA 5CNJA 1G9SA 3WK9A 4XASA 4RKEA 3PLNA 1BU8A 4PQFA 3NZEA 4OLBA 3ZWAA 2F1RA 2OORA 1HYHA 4BZZA 3HTXA 1GTMA 4NTZA 3PWZA 1N7HA 1ZI8A 2X5XA 5FUXA 4UD6A 3THOA 3G7NA 5GM1A 3SSAA 4RYDA 4YACA 3P71T 4RZHA 4EKEA 1POWA 1PUIA 1C4XA 3G1TA 4RH3A 1CZRA 1F6BA 2FR0A 3MGKA 4CT0A 4F56A 8GPBA 1XMIA 1X9GA 4DJDC 1A69A 2IPAB 3SQNA 4EUHA 2PG3A 1U04A 2Q9UA 2RAFA 5AJHA 3LRPA 2V7TA 2E4VA 2X19A 3L01A 4P4LA 1SOAA 1E7MA 3D0OA 4IF6A 1OX5A 4AWBA 4TYQA 2XB6A 2P91A 3ISJA 3RWBA 1XVIA 3OQPA 2C4VA 2AXQA 2GH1A 3FHLA 5LNK6 3ELYA 4R1TA 4ZQCB 1Z75A 4LF4B 1SQGA 4QPZA 2A33A 4TVSA 3HB1A 3P0RA 3P9XA 1TADA 3WLMA 1EP1B 3AY6A 3A6LA 1KRXA 3FLEA 4YC7A 1NVGA 1TTHA 4UMEA 2H2HA 3RVOA 1SN7A 5A3RA 1SA0A 3CH4B 2VUHB 1JTVA 3L6OO 2YFQA 3N2EA 1EFCA 4Z2YA 3DMNA 4L9SA 2PX8A 2VAPA 4CR6A 1Y6FA 4K46A 4BP1A 4NDNE 3R5SA 2H2WA 4JELA 5C3MA 4X54A 3MAJA 4M1EA 4O4JA 4HBGA 1CEEA 1ECLA 2PX4A 3RVMA 3V8NA 3J81A 1R6TA 4NDZA 1WZ2A 1ONBA 1YONA 1DC7A 4F7WA 3DOJA 3BWXA 5JOQA 5GIPE 3TJRA 4EJMA 3IAHA 2WG1A 1O6FA 4DCGA 5IVKA 2RDMA 5IZCA 2GTPA 3CNEA 4DZRA 2I2BA 2VJDA 1VRVA 4RGQA 3BDIA 3NWPA 1EFVA 3LX4A 4LECA 1Y6GA 5ESDA 3KYCB 3D8TA 4Q3CA 1W36B 1ML4A 3DF7A 3GAAA 3P5SA 3T7JA 3VUFA 2YYSA 2OVFA 4NEQA 4I1PA 5DBIA 1LD3A 2TS1A 3JQ8B 4ND6A 1DU4A 4NCXA 4TXHA 3G1UA 2VG8A 3NHJA 2A9OA 4JOQA 4DPMA 3OZSA 2ZFUA 3MLEA 4GVPA 2VT6A 1RBYA 1PJCA 5DHFA 1U98A 1DO8A 1ABFA 4Y9RA 5AKGA 2FCAA 4B7AA 1FC0A 3HSYA 3RC7A 2X3FA 3K72B 2VUUA 4LEIA 3K0SA 4CHTA 3DPIA 1E6EA 4MV7A 2Q5QA 4L8GA 3UJHA 3PQ5A 4BV2A 5JZOA 1F0PA 4DV1B 4BFVA 3LPLA 3PJGA 4IIDA 3V4RA 4GDMA 4YDHB 2C5SA 1QF6A 4DYDA 3OEHA 4W5NA 2X3UA 2PE5A 1SHKA 2NO4A 2RI1A 5GGXA 1IMJA 3KOUA 3I6MA 3U19A 2K2QB 1M1ZA 3KYCA 3G7SA 2CD9A 1G98A 2GQ0A 1EGHA 2TMGA 4ZDWA 1K66A 1SCKA 4DDHA 4BECA 4ZU3A 1PTJA 1T25A 2BKVA 4TLBA 1NQOA 2AIRA 2IIQA 1OIWA 1UBTS 1RWOA 4RACA 1ISPA 2CF5A 3GJ3A 2D59A 2QEQA 2OHOA 2BFOA 1AO3A 5E2AA 3R76A 3TOXA 4ZYXA 3GT7A 1CJUC 1ABBA 4GZ5A 1P75A 4P4SB 1V4VA 3CM0A 3NETA 3W79A 4LFAB 1IB6A 4YAFA 4F12A 2IHNA 4PTZA 1J1IA 2RAPA 2M9MA 4E5KA 2QN2A 5JS8A 4WHMA 1BS9A 4B2LA 3NH9A 2EYUA 5K45A 2XCUA 1EFUA 2ZOSA 3ZHVA 5AESA 1E1MA 1JDJA 3PUYA 4ZVSA 3I05A 2J4FA 2O0JA 3ZCTA 1Q19A 4GZ3A 1YB5A 1WCWA 3VZRA 2DLNA 3BE8A 4A16A 3FMFA 4EVQA 4M46A 1SCUA 4BKMA 3L05A 4QA9A 5J3JA 2H00A 1E5LA 4M60A 5IYZB 3KAPA 3E9RA 4WNYA 4LTDA 4Z9XA 1C7IA 5HS6A 4ZCMA 4S1TA 4OD0A 2W2VA 3BX1A 3EFBA 1CDOA 2ZDQA 2VP2A 4WA7A 1NXSA 2OORC 3OCVA 1OFUA 4RMNA 1S1CA 1C4WA 4N0PA 4QYMA 1ZAKA 4IUCS 5AOAA 1UK7A 1G2QA 1GG8A 3CLRD 3KPJA 4I36A 4MS4A 3ROEA 5C8ZA 2BYTA 3KT0A 9LDTA 4YDRA 5KJ1A 2P27A 3DL7A 1AH2A 1WG8A 2NSHA 2OPHA 5FNZA 3QXCA 3T7KA 5FPYA 4KFUA 1GN9A 2C3PA 3VYTB 3P0IA 1ISMA 1BHO1 2QX8A 3DQQA 2A9RA 2H9YA 1M6VB 1RC8A 1CDEA 3JVVA 5ED0A 5EE9A 1D0VA 2D3TA 4KZPA 2IKSA 5EPUA 4C3UA 3JX9A 2IYYA 2VA9A 2Y2VA 3GL9A 2D5BA 4HNAA 1KR2A 4CKEA 2OSBA 1XLWA 2YCLA 2ERYA 4D9MA 2LKCA 4LF8B 3FR7A 2JJ8A 3RSZA 2P9BA 1A88A 5C37A 4L0DA 4YQEA 2GCEA 3L4BA 3FUUA 3L4BC 4IS2A 4DC9A 4F8EA 2UYYA 1FBTA 1UDRA 1JQBA 4KQMA 4X84A 3NASA 1KDZA 2AR9A 3AZQA 1E94E 5FOWA 4DRXA 3RK0A 5ICSA 1UXOA 2HSZA 1MAWA 1R12A 2BKEA 2DH5A 4XVUA 1YACA 3WB1A 3E2PA 4OA5A 1R00A 1LPNA 2ATEA 2V5AA 4ZQFA 1IM5A 2WG0A 3V4PB 1N3LA 5ECWA 5C7IO 2AOUB 3PL1A 2Z4RA 1U3DA 1QVAA 4H0CA 5AT1A 1OLSA 2ZJ5A 1GR1A 1HEIA 3UXHA 5LQNA 3SC4A 1JPNA 2ZW9A 1VPVA 5I4BA 1FSPA 4OQQA 2BT4A 3IDZA 4TMYA 2GT1A 2R66A 4L51A 2Z6UA 1AHHA 4HAZA 1WCXA 3CTPA 2NZVG 3WC4A 1NVDA 1D2HA 4DF3A 5CA1F 3D3QA 4A2QA 2R1UA 3PC4A 2NU7A 1S2OA 4K9DA 2ZS7A 4I8IA 1MC4A 4D0LB 2V55B 2ZBEA 3RS2A 1KOLA 2B7CA 1U0LA 3U16A 3MTJA 4UOEA 4P58A 1H6AA 5DN9A 4D8XA 3DMTA 5F7JA 1H8ED 4DA8A 3LIPA 2ZAGA 3EWIA 3IR6A 4RORA 1JHVA 1L4YA 1M2HA 2XNKA 3JQ6A 4HZUB 4JAVC 5COAA 3JQAA 4BHTA 3TCKA 4D4HA 3AIKA 3KSRA 4DLTA 4EPRA 5BV2P 1JQ3A 3F67A 3F78A 3IEVA 4RZ2A 3UTDA 2OFOA 1EB8A 1J9ZA 1ISGA 1XWIA 4DT1A 6YASA 2G4VA 1H2XA 3MCUA 2HW8A 2JJQA 1GCAA 3BA6A 3FX2A 1C7ZA 1CU1A 2WSSA 4RVOA 1P7CA 2IPXA 4ZD6A 3TTWA 4F3TA 3C8ZA 5AJWA 1Q2XA 1M2WA 3IOCA 3M6LA 3QV1A 4CM8B 2JJYA 1FFSA 3TSYA 4C6HA 4L3OA 3H5VA 2REQB 5KOJB 2C92A 2ZJ4A 3OOYA 1WBDA 1KY3A 1ZD2P 5K01A 2NU7B 2O1WA 3E0XA 3WJ2A 2MSDB 2P1RA 3CLSC 2OCYC 1H4TA 2ONJA 3RQIA 3QTLA 2C1ZA 4E33A 1BMFA 4CM9A 5KTRA 3JAMA 2QTFA 3KQLA 2Y0EA 2NVOA 1E20A 4AECA 1DEHA 4B5KA 2X0EA 4C1NA 1QO0A 2NTEA 1JSXA 3PDIB 4BUZA 1E4OA 2Y1WA 1OXUA 4PR3A 5I9LA 4H7KA 1Z8DA 5ITSA 5LZ5A 4CLHA 1I01A 3AUTA 1H2WA 1QDLB 1RWBA 2AX4A 3CX4A 3Q9SA 4TV8F 4EA6A 4UNQA 2GNPA 4ZCTA 2PMWB 5BR4A 4MI6A 5B6JA 2Q2OA 3TNFA 2AJDA 1DZIA 3VC3A 1E4EB 1IY8A 2JAXA 2TMYA 1C30A 3E9DA 4IF4A 4GW3A 1G19A 2HLNA 5LYYA 3GFGA 1QRUA 5AVXA 3E5HA 1KVUA 1KFEB 3NPAA 5DLEA 3PRJA 3ZZUA 1PT9A 3CCCA 4UMFA 5IVDA 1BSVA 1ULAA 3LS2A 3ORRA 5AVZA 1T24A 1V5FA 3GLRA 4PBTA 3Q40A 3DOCA 4K9RA 4A26A 2RB5A 4L8VA 2BR4A 1D5CA 3C1TA 4QYTA 3PDIA 1USIA 4HEA1 4K6MA 2V1XA 3TR0A 1ST3A 1GZ6A 1XLVA 3ZVRA 1G41A 2DF8A 3CISA 3OEEA 1O95C 2VJMA 2G82A 3Q6IA 1ZGGA 2GJ8A 1MJFA 3UUFA 2R6GA 4IJQA 2BMAA 1SUEA 2ST1A 1MO6A 1J8MF 2QUBA 5D87A 1W4RA 3Q6NA 4IIEA 2ZULA 3VDQA 3AF0A 3WGGA 3H5NA 5C7YA 2PLRA 5LN1A 2WK1A 1EP2B 4EYKA 4PN7A 4CM4B 1DTWB 2F1JA 5TMPA 1FFXB 1PL0A 2H6EA 3W8FA 4A5OA 3OPYA 1GG5A 2AZ4A 4HUJA 5EA2A 1H42A 2CSXA 4HRAA 2R62A 4GMGA 1AKEA 5CX1A 5CA1A 4KX3A 2ZB2A 4J1TC 1TYEB 1G4AE 1K86A 2B7BA 4G1VA 3NWOA 3ZHCA 2FFBA 4IHQA 2XB8A 3OZAA 4KXYA 2FPUA 4EPXA 3EHEA 3E8MA 3LP8A 2Q5LA 1C5KA 4EG5A 4KN8A 2CDBA 5IC5A 4BGDA 2N75A 1KI6B 2ADMA 1CDZA 1BE0A 4KU4A 1E2NA 3ZZNA 3KQHA 1FJ2A 1T5BA 4ILEA 1QS0B 3ET4A 1KO4A 1YA4A 2Z5VA 3IAM6 3OIFA 4KXQA 5B4TA 1IN7A 1PSWA 4ZAGA 1HBJA 5JWOA 1Y37A 1LWOA 1BXRB 1L5HA 2WWXA 4PZ9A 5KSWB 3I6QA 2GHQA 3H4VA 1ECJA 1GUBA 3BH7A 4HTAA 4HG2A 3ZBQA 3ZCVA 4EJ0A 3ETGA 3O38A 4HWGA 3SEZA 3VKGA 3D6JA 3RV3A 2CCJA 5CVJA 1S1MA 1T15A 1PV2A 1UBEA 2YV4A 3GCXA 2K2WA 1Y7TA 4MRRA 4UULA 4UU1A 1Q1NA 4QOJA 1R2QA 3FNFA 4BB6A 2DBRA 1N6KA 1YHYA 3ZTWA 2X4LA 2R6JA 1KBQA 3LY8A 2YNMD 3EXHB 5JS2A 4O1IA 5DSXA 2FSUA 3H2GA 1LGYA 4X91A 4DOMA 4MVJD 1N5DA 2NADA 2GPAA 1EM6A 3K9NA 1C8LA 3TQIA 4B4VA 1FQJA 1X15A 2PT9A 1GNLA 1H0SA 3OZBA 3PE4A 2WA2A 5DLYA 5DOZA 4RPHA 1PQPA 1W96A 1PD1A 2X4IA 3GNTA 4EGFA 3PC6A 2WSMA 1XEWY 1GEEA 2IF0A 3EVCA 3M6XA 3A1EA 2PUJA 4TVBA 2I7XA 1U6KA 1C4KA 1ESCA 2MSNA 2XE7A 4L5CA 2REXB 5CGQB 2PBFA 4YGXB 1RSZA 5F52A 5ADWA 1SVSA 1UC4B 2NWQA 1IMOA 3CBGA 3OU7A 3W5VA 3IIKA 1OBCA 1CP2A 4OP1A 1CRZA 4DA7A 1L7RA 1IU9A 1C8VB 4JQZA 4BB9A 1V3VA 4DM7A 4ENQA 3RE1A 4ZYZA 2R65A 1HDIA 4LDPA 4RHCA 4AWAA 2ILVA 4UVHA 4PYIA 1XZQA 4LZWA 4NR0A 3I62A 1P39A 5IDQA 2I3ZA 4IM7A 3RYFB 4M0DA 3JQBA 5A4DA 1FNBA 2YRWA 5FIUA 1P45A 1WXDA 3KYIB 4M9XA 4E5UA 4X45A 4FE3A 3P97A 2IHUA 5ALHA 5ADVA 3S40A 2F4VB 4YT8A 3T7CA 1ZD5A 1JMYA 3PHLA 1R6XA 2WJ3A 5EWMA 3X3HA 2HIHA 1YIOA 3UXMA 2C5AA 3I04M 4DCVA 2AE2A 3NHPA 1BKSB 2DJIA 4B2PA 2ENWA 2ZE8A 5K2OA 2AR7A 4L16A 2JLQA 2Q5OA 5C18A 5IJZA 1GKUB 5C4GB 2FP4B 5JEEA 3PEVA 4Q7KA 4Y2VA 1B42A 1SU8A 4QPJC 1PG5A 5AI5A 5ARCA 2QTWB 2I1VB 1RTKA 1I4WA 3AYXB 3HY3A 5AI6A 2QJTA 1NI4A 4MVCA 4CDMA 2ZVPX 2UVPA 4IDGA 2GS9A 4MGEA 5BW8A 3AFGA 5BUZA 2J9RA 2W2KB 2PO5A 4QLOA 4JOCA 3T3GA 1IZ7A 1K6JA 2RB4A 4PG7A 4W5QA 3C3EA 3HCAA 1L1EA 3W2HA 3FZNA 4JCCA 1Z4JA 4RXMA 5KYYB 3L5KA 2Q9CA 2P9QA 2YWEA 3O26A 3OWOA 4YJKA 3TLMA 1Z5ZA 3HNRA 2WTEA 2BHSA 2YWDA 2DAPA 4Q7JB 4TTVA 2A67A 1EGAA 1TO1E 2BFWA 1M74A 4OHXA 1LS1A 1VL6A 5ICGA 1TMKA 1UR5A 1S0UA 1E3TA 5SY4A 3UOGA 5I9IA 2JLZA 5LUBA 3ZDCA 4JC0A 4X85A 5HF6A 1M66A 4FK8A 4QOHA 1G21B 3H2ZA 4WY2A 1G5RA 3FRHA 3TRFA 3UJBA 2LGJA 4G8BA 5M29A 1PQYA 2ONYA 2P6RA 3VJKA 3G9ZA 2VAMA 1Z16A 2LBPA 5AVOA 3BJMA 1OXXK 1X77A 2ZIEA 1PZMA 2RHBA 4MWEA 3TI9A 3A1DA 4UBNA 1PFQA 1P1IA 5JSZA 1K4KA 4KPYA 2JFUA 2YMLA 4LX0A 4B0OA 5ELXA 1BXZA 1F2DA 4H4EA 5BNWA 2ZTHA 2Y1FA 3CNNA 1MOPA 3FCSB 3ZOZA 3GJQA 1K4MA 3CX8A 3NEAA 1YJQA 2R6ZA 3BMNB 5DM4A 1ZD8A 3ESBA 1VSVA 6ABPA 4CDRA 3NAGA 4H27A 1JF8A 3HR8A 1RQRA 3V9PA 2J31A 5K4HA 2YHIA 5IKXA 4DBLE 4L5AA 4I4LA 1E79D 3H4IA 4DILA 2KBFA 3B6ZA 2KSQA 1S2MA 4I1VA 4NBNA 4G25A 1J1ZA 3ENWA 4TTTS 3I3SR 5CVUA 4MAFA 5HQ3A 2RGNC 1FVFA 1NBWB 4YX9A 1FYFA 5HBRA 1I3KA 2JD0A 3LFTA 4GU5A 4OU5A 4WKGA 3TZBA 1FRQA 5TB5A 3PUZA 3VSDA 1XTTA 2FPGB 1PG2A 2J5KA 4AJ2A 2V6JA 1XD8A 2R8OA 2N3ZA 1NHWA 4ZGWA 1WBBA 3MRSA 1LDNA 4UTPA 4TT3D 3PR3A 4IZHA 2WSSD 4C5CA 4O02B 4OBWA 5CB8A 2WT4A 5JFOA 4UPDA 1IFXA 4PLPA 3QLEA 2QUKA 5HDQA 3T1OA 2D5CA 5A9RA 2HXGA 2D4AA 4GBGA 3BSSA 1CXZA 1KMIY 2GKSA 1VMKA 3ESDA 1SA0B 3I39X 2A0KA 3UJ8A 3MYYA 1VBNA 1XU4A 3NUGA 4FU0A 3AI1A 3UW1A 4BKRA 2ASVA 4NCIA 1G5PA 5JNSA 2VLIA 4CM5A 2PWBA 1HUQA 3F6EX 5DNYB 5TGDA 1XEXA 2ZCVA 4KBYA 1K8QA 2I2WA 4ZCPA 4DJEC 1QIKA 4W5TA 3OZDA 1J20A 5ECGC 4DBLC 4EO7A 2I67A 4TXMA 3K71B 1GGFA 1H23A 1YQ9A 4JN6B 4YT2A 4IIFA 1V95A 3R40A 2CYBA 1G59A 3C74A 1Z45A 4EBBA 2VBCA 1ATZA 2H2AA 3C7AA 3F5QA 1V48A 3LDUA 3HNOA 1KE1A 1DZ3A 5IBPA 1VL8A 3UMVA 4FCVA 3I2GA 3EE6A 1TVCA 2OBXA 2Q2VA 1JSZA 2Q29A 1ECBA 4TN1A 3LNCA 2UUOA 4NBTA 2I3DA 3KOMA 3T1HB 1GPLA 1D1PA 5CEEA 5IVHA 3UPUA 2C4KA 2XAAA 1YQUA 2HA2A 2OO7A 1QKJA 3QELB 1H2FA 2EYQA 2R00C 3COYA 1NMYA 4M99A 1EU1A 3CH6A 5GZ3A 3V8QA 2HUPA 1YXMA 2XNSA 4E51A 3H42B 1ONSA 4OI0A 4L9RA 2FN3A 3PQ3A 4G2TA 3AHGA 4BCCA 3SD7A 4FFMA 1SRQA 2XW6A 2AMYA 3KBBA 2B8NA 1S4QA 2QQ5A 4KQFA 1L5KA 3V32A 1PS8A 4LHVA 4XD7D 2W83A 2IKQA 1WVMA 1NMZA 4XVQA 3K1AB 2RSLA 3RANA 4KR2A 5HVNA 2JH3A 4C4XA 2PRYA 3OOSA 2DX7A 3GR6A 5JXGA 2HPHA 1A5ZA 1QYCA 3EK2A 3OOWA 1GZSA 3IT2A 4MROA 1JRLA 3M7IA 4HO1X 2WHRA 1U90A 3N2NA 3MCAA 3FTQA 4K9MA 2IIBA 2QRKA 3KKKA 3OF3A 1LLFA 3PT5A 2O8BA 2VP4A 4DMFA 1E2EA 3BB3A 1HX7A 2CJYA 4PS1A 4CF3A 2A4KA 4NK5A 4Y2SA 1IULA 1HZZA 3CVXA 4ID3A 3BTSA 5IHPA 3KKOA 3K5IA 4U39A 1IN4A 2V7QD 1F7UA 1YQQA 2CVZA 2PCLA 4F5YA 4EY4A 4UTXA 2YVKA 3AM3A 4UOZA 4CKCA 3WGOA 1VRWA 3F5FA 4Y6PA 3QA9A 1IK4A 1DC8A 1TX4B 5H9VA 1WY7A 5K8CA 1TNDA 1FSFA 4L22A 2AA3A 4Z54A 5LQJA 1USUA 1HE5A 3C97A 1RHMA 3I4FA 1FVOA 5EIWA 3OZXA 3HWWA 2CE2X 4J49A 3ILHA 1QWOA 2ILTA 2YV3A 4MUGA 3ML1A 3SDZA 3I6YA 5DT9A 2CFOA 2J9GA 1EVZA 3KQPA 5HCUA 4PAQA 1VBMA 5HE9A 2ZSIA 2BC9A 3O4RA 2G5CA 4GXRA 1NZJA 5TLSA 1QHFA 4RLSA 1P7VA 2JASA 2TMDA 1M5UA 5HQJA 3KJZA 3PQEA 3QENA 4N39A 3FOCA 4IW3B 1JGTA 2LW7A 4A0HA 4PIVA 1CY4A 3WKEA 2G3YA 5AJYA 4I9UA 1AGRA 2LV8A 3LUPA 1VB5A 4UNRA 4C2TA 1KH1A 1R1DA 1JQEA 2H4ZA 3QNWA 3OOEA 3R0QA 1NSFA 3MMZA 3W7BA 3SX0A 2CFIA 5FFMA 7MHTA 2OGZA 2I6TA 1RQGA 1WCIB 2J6CA 2F6RA 3DVQX 3S7ZA 2D7JA 3IVCA 5H5JA 1ZEJA 3TSZA 1B15A 2I0FA 1QYWA 2QE6A 1Q1BA 1C1DB 1PJSA 1UJ5A 1EUZA 2YQ4A 2ZP1A 3H04A 3QFHA 2C3YA 3VH2A 5K6TA 3NW9A 3N07A 1WR8A 4LMPA 2JLYA 3N5CA 4BIMA 2ID7A 4MAMA 3FCUB 5AW5A 4EB8A 3TTYA 3O5AA 4HS4A 1EDEA 4LJ6A 5L7YA 3NP9A 3FTCA 4ARSA 4MWZA 3CVJA 3SPXA 1G8YA 3M3PA 2Q9AA 4TRRA 2J41A 3N9IA 5C8VA 4N0QA 2R87A 4QTZA 1ZMXA 1N2XA 2V59A 3HMKA 3HDQA 3M5PA 2VKTA 2JJ2D 4O4JB 2GTIA 3IEIA 4K6OA 2ID8A 4JMLA 1G5HA 3AG5A 4ETNA 2XKBA 3DPUA 2OYRA 4DUPA 5CYGA 3MVEA 4U6SA 5M3BA 1XHEA 3VMFA 4MQMA 1XAGA 2I55A 5IXJA 3KVVA 1KF0A 4MVYA 2QJFA 2AWNA 2BGRA 3AF4A 4OHFA 1WXEA 5H3LA 4CUZA 5KHOC 5KHAA 4PEVA 3OBBA 4ARVA 3EUFA 3L82B 1VIMA 1OAAA 1WMDA 4AWXA 4B3XA 4XZ3A 3RTGA 2XUZA 4ZVPA 3AP3A 2MSLA 2XKJE 2Q3FA 1B3RA 2Q3CA 5KSZA 1GTVA 1HORA 1KP9A 2YVQA 4RU1A 3A28A 3L8ZA 1OVGA 1DBPA 4TSKA 4UBLA 4YALA 4H08A 1B43A 5I7HA 1PL7A 1V1RB 4GMHA 1FTYA 1DO0A 2RHHA 4GBJA 3IERA 4HWKA 1USVA 1M0EA 2J5QA 4ZVVA 5DGDA 2ZRAA 3QMPA 3V7FA 1QX4A 4OQYA 4JEHA 4PLWA 4N8DA 3CZ9A 3RYCA 1NR1A 2RG1A 3QVOA 4TZTA 3SBXA 3ST7A 4BJ3A 2GZMA 1MJ5A 1NXTA 3I9JA 2LP4Y 3TQCA 3W6ZA 1J21A 1ORHA 1P72A 1J2JA 1GSAA 1JQJC 3ZE1B 3A9VA 4EPWA 2QSYA 3BE6A 3GZJA 2PZ8A 5ES3A 1OZFA 3H0CA 1Q20A 1RM4A 2HADA 3C8HA 3CIOA 3SXUB 2IXDA 3EG9B 4MWGA 4OGLA 4QYXA 4Y6RA 4RHUA 1BDBA 4M53A 1H2RS 1QK3A 2NZ2A 5H3HA 2M6LA 2D2XA 2IEZA 2AHOA 3QIAA 4LGCA 5JYDA 3FR8A 1TC1A 4M0EA 3CPJB 3O9MA 3C6MA 3LKBA 5BWOA 2FMFA 2VJQA 1XD2A 4HLNA 1A7JA 1UJCA 3OSZA 2YDXA 4DLVA 1NP7A 2ZTMA 4MH0R 2K87A 2ACVA 3C4VA 2IP1A 3JAKA 4NU5A 3KVRA 1A82A 3VR3A 4FX2A 1GGKA 1PDVA 1U81A 2XOKD 3H1AA 4WWHA 4YJFB 4GBMA 4Y6QA 4MLCA 5F12A 2HA3A 2VHTA 3KZXA 1FDRA 1SU7A 4CZ2A 4Y2QA 1E1KA 3DOUA 1QV7A 1U6JA 2H7CA 4ENUA 4JVMA 4O2BA 2OOSA 4U6QA 3QFSA 3G8CA 3HM2A 4URYR 5F2OA 1JA9A 3N0TA 3CHYA 3W5UA 4C6SA 2I3GA 3U2QA 1MV8A 1ZMBA 2ZRFA 3D4LA 1G8HA 5TV2A 1GPUA 1CFZA 3D6UA 2GEJA 1ZWKA 3I5MA 4X20A 3LPAA 4MW5A 4C2AA 1TZJA 1Q11A 1YOBA 2GD2A 2H4XA 2BEVA 1F8FA 1IDN1 1AKTA 4ENVA 2NAFA 1YHNA 1KYIA 3Q2OA 2AW5A 4URHA 4GRDA 4R69A 5JFTA 2QVXX 5GZ1A 1YR8A 2ZR8A 2KX7A 1E7SA 2PZEA 5JXHA 4G4JA 4C4SA 1C50A 1W6RA 2AMJA 2WJ4A 2ZJZA 2IWHA 3GPDG 4EFLA 1KMMA 1KJJA 3L8GA 4BZWA 3BN3A 1OWMA 4CKXA 3HYRA 3WRXC 2JS7A 2YHBA 4RS4A 4KPGA 1GZ5A 3WO1A 1M2OB 4EQ6A 4POOA 2LTAA 2GILA 4NAVA 1MOSA 2JAOA 2HC9A 2QS9A 2JI4A 3DF9A 3M2PA 4ZCSA 4AZ0A 4ICIA 4HP8A 3CZMA 1BQEA 1FNCA 2GK4A 1ZMTA 2XTZA 3B5JA 3HN2A 4FNGA 4LJ5A 1CJMA 5EEGA 2R0QC 1M6NA 4A73A 4CFSA 2B4RO 5G40A 3M1LA 1J33A 1RXVA 3FYHA 2B6NA 2AOUA 2E3JA 4DUZB 1XNRB 2QTMA 3FOAA 3OUUA 2Q4TA 1NU8A 2KYRA 4RF5A 3U0BA 3PT9A 5JSQA 2NG1A 3PRHA 4MQEA 4X7PA 1R8XA 5AW2A 1NY5A 4ONEA 1FFHA 3HSSA 4Q3DA 3KLMX 3RUDA 3UANA 1E1LA 3P7MA 3LK7A 2QUZA 4E2YA 1D8AA 2OCIA 2BFFB 3T9DA 1XCJA 4DLLA 2BDEA 1HL7A 1BN7A 2BGTA 3JQCA 3LHDA 4MR8A 3EUAA 7ABPA 3RRBA 3ZU5A 5L95A 1WW2A 3SJBA 1AUPA 1OI3A 2IZOA 4J90A 5BSVA 1ZSVA 2O2IA 4HAIA 1QGUB 3E70C 4XR4A 5KTYA 1EJ6A 5DULA 3E23A 1G6KA 2B94A 3GDWA 3JWGA 3MUOA 3HKBA 2NUTB 4J76A 4LYEA 4OXKA 1M2JA 5EXTA 4EMBA 1NOIA 4RCVA 3NYIA 1T1JA 4GL2A 2VXOA 1VI5A 1O0BA 1RJDA 1E7RA 3LZ6A 3AR8A 3QKUA 1ZINA 3PUXA 5EYPA 4F6RB 5I7VA 1E3JA 3BHJA 1N2CB 2YBEA 4K6FA 3RVKA 1CUWA 1UBOS 2EQBA 3FH0A 5K3DA 2Z2XA 1FTSA 4EEXA 1FNSA 3SYRA 3IBFA 4HDRA 4CM6A 2RARA 1G18A 1DUVG 2SCUA 3IQFA 3MFYA 2P1ZA 3EDYA 4DYVA 5A2QA 3UT5B 1BRTA 3GVXA 5L3ZA 4MWBA 1J7JA 1JA0A 4IDQA 1BU5A 4BLPA 2A1IA 2EBFX 4CV1A 2OYCA 3UWDA 2J9XB 3IO5A 1FXWF 4HDMB 4IL5A 4O2BF 4D5EA 4MR7B 1IXZA 1XKLA 4FT2A 4I1IA 4I8DA 4YH1A 3ENZA 3U3OA 1YVEI 2VJKA 4E11A 2E4ZA 4W7IA 1S3GA 1MU0A 3HKBB 2NUTA 1XMPA 3DOHA 4TKVB 5EY5B 2PSJA 4BNFA 5ALLA 4PC2A 4WX2B 1IOZA 2PJZA 3PHCA 2Y9PB 4PLFA 3Q85A 2G9RA 1AGNA 4C4TA 2ETVA 4QHTA 3EODA 8ADHA 3V80A 3DM5A 5GIOE 3OLYA 5EYPB 3GFVA 2HO5A 3QPCA 2RGWA 4E1BA 4DV6B 3AFOA 4LHZA 4YQYA 1PZXA 4LJYA 3TX6A 4J4HA 3MWKA 3WDMA 1F2TA 1U5CA 4RKQA 5I5GA 4J29A 2QV7A 4PZLA 2E37A 4BMYA 1JSLA 1M8JA 3CA8A 1TM2A 1SUWA 4EUFA 1VGQA 1E7YA 5KNBD 1QIMA 4K1XA 1H3NA 1EM8A 1XZIA 3BRWA 2W93A 1CUXA 1JX6A 3ZQ6A 1RADA 5FV7A 1BW9B 4BGIA 4NFSA 4HF7A 4YUYA 3QE9Y 3K4PA 1N33B 5AR1A 2WWHA 2GFHA 2VYFA 3VVMA 4RSRA 5A9SA 3R09A 1O1YA 1F8GA 2IV3A 1I24A 3EIOA 3IT1A 3HJNA 4XSHA 4MUFA 5ELLA 5EP4A 2QT1A 1YQGA 4FDVA 1DKLA 1DWUA 4KWCA 1V4BA 4MZXA 2JJ2A 3IHTA 1JS1X 1RFLA 2I1QA 3UV3A 1KDRA 4P0QB 1GTZA 4GPD1 3WTBA 4UOQA 4U5XA 5JALA 3VRHA 1YS6A 2O4UX 2JHFA 5EJEA 3ADKA 3BHIA 4JVNA 1SKBA 2DTDA 1LFAA 3L1HA 4YRQA 1SNYA 1VJ5A 3E5NA 3HVIA 4CW7A 3FVTA 4UAJA 2FHSA 1T1IA 4MV0A 4WXRA 3TQRA 5FWNA 5DOVA 3QX7A 3ZKWB 1LBQA 2QDXA 2W11A 2J0QA 1SZDA 4JDPA 5HRCA 3WSVA 1G8SA 1HK7A 5FTMA 5I7OA 5JT1A 4M6WB 4O8ZA 4MOWA 2G06A 5F3DA 4DRYA 1W4ZA 1HH4A 4A8HA 1IQPA 4C08A