1NXXA

Micarec ph 5.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
114
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords DNA-binding response regulator
publication title MicArec pH 5.5
rcsb
source organism Streptococcus pneumoniae
total genus 40
structure length 114
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxxA00
4Q6WA 4YS6A 2JB9A 4W5NA 4MR7B 3C3MA 3I09A 1GUBA 4Q6BA 3I42A 4NICA 1RZRA 1CEYA 5GOTA 2FMHA 1PEYA 4ETNA 4EYOA 3TMYA 2WJWA 3LUKA 3UK0A 1U0SY 4MYRA 1ZH4A 2VUIB 4N0QA 1APBA 5KC9A 4IF4A 1QKKA 5TPZD 4G0MA 4MAAA 4JP1A 3HEBA 2JRLA 5JS2A 4IMIB 5JNRA 1ZITA 4E7PA 2MYPA 1QQAA 3GL9A 1JYFA 3RVPA 1JFSA 5EWLB 3M6MD 2FQYA 3QLUC 4UHJA 4RY8A 4YWHA 4MQEB 3IP5A 3G85A 4RK0A 5TE9A 2FMFA 1M5TA 4RY0A 3RQIA 4LE1A 3RVLA 1ZDMA 5DLEA 2MYNA 3C3KA 4KV7A 3C6QA 1UDRA 1WETA 3O2SB 2L2QA 4XARA 1JBEA 3CS3A 3HDGA 2PUCA 1AB5A 2N9UA 1E6LA 4RWEA 2CWDA 4HNQA 5FBHA 3GV0A 5CNKA 1ZY2A 2FSPA 7ABPA 1ISSA 1L5YA 2WB4A 3HSYA 3Q7RA 3JVDA 9ABPA 3QX8A 4MR7A 2FVYA 3RVNA 5C5CA 3NHMA 4WXMA 3HV2A 1XHFA 3OLYA 5IEBA 3HCWA 4Z4CA 1KMIY 4Z9AA 5B3JA 4S04A 1U2QA 3IP6A 2WJAA 4Z0NA 4MS1B 2IPLA 1PUXA 5KWSA 1OXKB 3H5VA 2ID7A 4L85A 5ABPA 2V0NA 2M1ZA 1DJMA 2FEPA 3KYJB 4OTZA 4QYMA 3OLZA 5F64A 3OLWA 3CU5A 1MIHA 4KPYA 1DG9A 4Z99A 1CYEA 4P1ZA 4Z4EA 5BRAA 4H3HB 1Y1LA 1JH9A 4JASB 1B00A 2HSGA 4LZLA 5T3YA 2L18A 1YMVA 2A9OA 2FLWA 5EWLA 4N76A 1JX6A 1YMUA 4MQEA 3HXMA 1XWWA 4YO7A 5TQ0B 2GWRA 1TM2A 2A9PA 3OO0A 4CBVA 1D1PA 1BA2A 3HVRA 3MYYA 4G97A 4D74A 2R4QA 4EY3A 2E4VA 3S99A 3SQNA 3TB6A 2PMCA 1IIBA 4XFKA 5KQGA 2R25B 1I3CA 2L17A 4F06A 4ETMA 2MYTA 4OG2A 4ZMRA 1C4WA 4Z4IA 3FFWA 3FMVA 1TMYA 3K4HA 3M9WA 4MR9B 3MM4A 3VNBA 1QO0A 3CLKA 3RVKA 1FSPA 2E4WA 2JVJA 3OQNA 1M5UA 4MS1A 4RS3A 4ZPJA 3ROFA 2E4ZA 5EWMB 3H1FA 4YLEA 4W5OA 2H3HA 2OQRA 1QP0A 1OXBB 4MR8B 5GQSA 1LBHA 3CRNA 4JA2A 4KQCA 3RVMA 4NCBA 5CNMA 3IP9A 4JB2A 3OQOA 1SXIA 2YHAA 1W9HA 3O1IC 4LE2A 3C3WA 1LJUA 2FQXA 3EAFA 3H1GA 4MLDA 3T38A 5JS1A 5JNWA 1CHNA 1NXSA 5DTEA 4YRZA 4EUKA 1F4VA 1D4ZA 5IUNC 4RV5A 5TQ0A 3W9SA 3L49A 2L19A 1ABFA 2HQBA 2ZAYA 1D1QA 3KHTA 3LUJA 3MA0A 4EYKA 2E4UA 4FB4A 4JB0A 1PEAA 3EQZA 2PUBA 4LDZA 1D2AA 4RXMA 2PE5A 3SM9A 4EYQA 2HPHA 3NHZA 1YTUA 3HK2A 1DBQA 1LK0A 1ZGZA 2IKSA 4TLLB 1SXHA 3M9XA 3KKEA 3HUUA 3O75A 2DRIA 2WWVD 5B3JC 5FWYB 4G0OA 5IEJA 5ED4A 2NT3A 1D5WA 2E4XA 4MR9A 3I45A 3O74A 2CHEA 4WUTA 1EHCA 2LP4Y 1U04A 4TLMB 5C5EA 5IULC 2QSJA 1QPZA 1GCAA 3E3MA 5EWMA 5CHYA 2P4UA 1BDJA 2PAFA 3N0XA 2GKGA 2ID9A 4MR8A 3OM0A 3DGEC 1AB6A 4RY9A 3CFYA 1QNLA 3L6UA 3ROTA 1QO0D 1DZ3A 4RZSA 3UKJA 1NXPA 3DGFC 2XDYA 4KMRA 1P8AA 4OBBA 4B09A 5KQLA 2I6FA 4FE4A 4DN6A 2AYZA 2JBAB 2F8TA 3OQMA 1ZH2A 5KQMA 4DADA 1GCGA 2FMKA 2IDMA 3IPCA 3K9CA 3URMA 4YR7A 1Z13A 3BRQA 3Q9SA 3OMWA 4ZMSA 1E2BA 1Z16A 3N53A 4WWHA 2MYUA 3RVJA 2HJ9A 2P9HA 2R47A 3FFXA 1NATA 1SD5A 3LMKA 3LUFA 4IGAA 3RVRA 3DLHA 1QP7A 3HDVA 2FXIA 1J56A 1E6KA 4F3TA 2QVCA 4W5QA 4RK1A 3QELB 4XASA 4YCSA 4KZKA 1A0OA 3CZCA 4G0QA 5FWYA 1DC8A 1FFSA 3F6CA 3KLNA 1T34A 4Y9TA 4N41A 4RK4A 1FFWA 1K68A 2QW1A 2A9QA 3Q7TA 2IOYA 2FMIA 3DLBA 1NXTA 3H5TA 1VPWA 2IYNA 4HNRA 4Z4GA 1PHRA 4MS4B 2QVGA 2FLKA 5DCLA 3T95A 4S05A 4XLTA 5HQJA 4N47A 2NZVG 3KLOA 1Z2EA 1L5ZA 3QEMB 4ML3A 1E6MA 4MRMB 1BDIA 4N0PA 1H9CA 1TJYA 4NV3A 1MVOA 3KG2A 4OLAA 5JNVA 4Z4HA 2M98A 2JBAA 3LOPA 4LX8A 4NCAA 2MSKA 3TX6A 3CTPA 5TQ2B 4G0ZA 4RDCA 2JK1A 3LUHA 3CKMA 4L4UA 3MQ4A 4PEVA 3H1EA 2NZUG 3QLVA 4F8JA 2OENG 2QR3A 1DC7A 4H3KB 3IPAA 2GBPA 4E7OA 2VUHB 3EQ2A 2WRZA 3QELA 2HQRA 3BILA 3ILHA 3KJXA 3T6KA 3TO5A 3H6HA 4PICA 1GLGA 4O1HA 2YHBA 4Q7EA 3HZHA 1ZGGA 1VLZA 4YGXB 2RJOA 3F7NA 2F8SA 3O2JA 4RXUA 5I4CA 3GBPA 1URPA 3VNAA 3LUDA 3FDFA 1JDPA 4QICA 1FFGA 5T7BA 2E4YA 5HSGA 3GBVA 3CNBA 1YS7A 3LUCA 2Q5CA 1USIA 4MS3B 4MS4A 4RU1A 2PUAA 2PUDA 2IPMA 3HO1A 3QLTA 2O20A 1SXGA 3HUTA 1K66A 4KK4A 4D6YA 3LFTA 4MQFB 3F73A 1YK1A 3JS5A 3QEMA 1EFAA 2AYXA 3JTEA 3UUGA 1ZVVA 3O1HB 3F6PA 4LDAA 3RH0A 2ZWMA 4MRMA 3N6VA 2JVIA 2NUBA 3A10A 4LRQA 6ABPA 2LPMA 3H5WA 4D6XA 2RJNA 3EJWA 1YS6A 1P2FA 2FN8A 1M2EA 5D2CA 4GNRA 2FW0A 2WMYA 3E61A 3OO1A 1BVHA 1DBPA 5TQ2A 2PL9A 1KRWA 1Z26A 2W42A 3O1JC 4PZ0A 4EGSA 1PNTA 3I5AA 5BQ3A 4P98A 4DQDA 1NXVA 1DP4A 3RVSA 4WXEA 2PKXA 1YK0A 1S8NA 3SAJA 1ZAYA 4WT7A 5BRJA 1PNRA 1RXIA 1DBWA 1VKRA 4KQ9A 1EAYA 4UHKA 5FWXB 4XXHA 3KCNA 3OM1A 3GYBA 5DKFA 2PL1A 2JCGA 1Z2DA 4EVRA 5CNIA 3GRCA 4Z9BA 3KYIB 4IRXA 2LBPA 3LKBA 4QYWA 3SNKA 4TN5A 2KYRA 3H6GA 3QK7A 4IMJB 3H5LA 5EWJB 5TPWB 2A9RA 3Q41A 3MMNA 4OATA 2VK2A 1A04A 4G86A 2PLNA 8ABPA 2LUOA 4Z4FA 3B2NA 2VYCA 3IDOA 4KRFA 4G0YA 1TLFA 4MS3A 3H75A 3NNSA 5IC5A 3OMXA 4KVFA 2TMYA 3JVIA 3O21A 3HM9A 3FGZA 4MQFA 4OLBA 1ZESA 1P6QA 3A0UA 4TMYA 3GT7A 4RKQA 1KGSA 1JHZA 1Z12A 4F12A 4KNYA 4XAQA 4W5RA 1MAVA 1VRVA 2GI4A 4RSMA 3LTEA 2MSWA 4MLCA 4MPTA 2FQWA 3QLVC 1F51E 1KRXA 2FTKE 3GWGA 4LE0A 2GX6A 3EDCA 2HQOA 2QXYA 4N03A 3T8YA 1DRKA 2PUGA 3BRSA 1TVMA 1Z17A 5FWXA 3RVQA 1ISRA 3SY8A 4EVQA 4O1IA 4RXTA 4G0PA 4RKRA 1EWVA 1Z15A 3QX9A 1MB0A 3MIZA 5EWJA 5KQPA 5CNJA 5TPWA 4MGEA 2J48A 1LBIA 5IX8A 2NT4A 4NQRA 1HEYA 3JY6A 3RVOA 1RPJA 3IP7A 1DCKA 3EGCA 2WY2D 4GPAA 2PUEA 3DBIA 4O5AA 1BAPA 4PYRA 3G1WA 3LUAA 5IBQA 3N75A 5TQJA 2H0AA 4RK5A 3GA5A 3FFTA 1EWTA 3BREA 4M88A 1A2OA 5BR1A 1USGA 3EODA 3JPWA 4HNSA 4FE7A 1JLKA 4QPJC 3HJFA 1QMPA 3CG0A 1JYEA 1U2PA 4YP9A 5IUKC 3N8IA 1BDHA 1RZRD 3NNNA 2CD7A 5JNUA 2R48A 2BGGA 3P9YA 5DGCA 2QU7A 1ZN2A 3KSMA 3QLUA 1JWLA 1YIOA 3ILYA 4KFCA 4KK3A 2X7XA 3LKVA 2IPAB 4ZJPA 2QV0A 2B4AA 1QQBA 2CHFA 5KC8A 1M2FA 1NXOA 3EULA 3MF4A 3O2QB 4PE5B 3D02A 1NY5A 1JL3A 2RDMA 2RGYA 3CHYA 3N0WA 4RK6A 4F11A 3JPYA 3NNDA 3SG0A 3A0RB 1QP4A 4ZYLA 2FEKA 3N0RA 4JAVC 1JDNA 1R8JA 4IILA 2QZJA 4G0XA 3HS3A 5TPZA 1JF8A 1YVUA 1JFTA 6CHYA 1JFVA 1DRJA 2JVKA 5HKOA 4WZZA 4YV7A 5KI6A 1W25A 3BBLA 1DCFA 1SRRA 1ABEA 2MSLA 3TD9A 1XHEA 1GUDA 1Z18A 4RK7A 1NTRA 2FN9A 3A3KA 2PJUA 3KTOA 2IPNA 5E3JA 4KREA 5IUJC 3C97A 4H60A 1P6UA 1ZHHA 3NBMA 3R0JA 1EWKA 4W5TA 2LIVA 2FEWB 1NXWA 3H5IA 3OLXA 5JNSA 1C0EA 4JOQA 5JNTA 1RNLA 4HYEA 1U8TA 3CG4A 2FKAA 1DCMA 3D8UA 3DZDA 5PNTA 5HM6A 1FQWA 3Q15C 3KS9A 4EYGA 3QEKA 3CZ5A 1LJLA 3LUGA 1RXEA 4EVSA 3H5OA 3Q7SA 1NXXA 3OLVA 1MB3A 1Z25A 4ETIA 5FBKA 2PUFA 1USKA 2B1JA
chains in the Genus database with same CATH superfamily
3GVCA 4GYJA 1TYEB 2H08A 3H42B 4MR7B 5D00A 5GV8A 1QGYA 4Q6BA 4MH0R 3I6QA 1G5RA 1UFKA 1VLJA 4U8HA 1O03A 4JL6A 2PX3A 2FMHA 1KYVA 1YR2A 4HVTA 3LQ1A 3KQWA 2R8YA 4PZ9A 5AW8A 2HDOA 3QIAA 3QPAA 1YB7A 1OWNA 4XB6B 3U7JA 3I5XA 3E84A 2FG5A 2OBLA 1VCOA 2C96A 3PFKA 1KP9A 3UG6A 3VPXA 3X3HA 1LSUA 1GYRA 5IF9A 5BW5A 4NFLA 4DC9A 3BC1A 1U0LA 4M60A 3HY3A 4TTTS 2AJCA 3GRZA 3PNLA 1ECLA 1RQGA 3WGVA 5ISMA 2EKPA 3GAFA 2P2DA 4O5OA 3QHQA 2BJHA 3EXIA 3OHSX 3ED1A 1SG9A 1Y9AA 4UHBA 3J81k 3GVIA 2IY8A 4YJDA 4RY8A 1XJWA 3KO8A 1JHVA 4EF5A 2V6FA 5EGSA 5L4NA 1K08A 3EMBA 4LE1A 2ZZMA 4PO9A 2R2GA 1QR2A 1XJQA 2IEZA 4B4DA 2AOUA 4IHAA 4IOLA 3OIGA 2C5LA 1I30A 1I7QB 2C7PA 1G8FA 1E1DA 3HPQA 3WYEA 1DBSA 3RVBA 4IEFB 3HJNA 4ZEVA 2ZYDA 3FFBA 3LPNA 4XQGA 2QQEA 2VRNA 4PSUA 2VQEB 1WF6A 2ZJ4A 5EIBD 3OZ7A 4CM4A 2FVYA 3TFOA 5LLDA 3LRPA 1AK1A 1NVTA 5IFLA 5AM2A 4JBNA 1MA0A 1KMIY 1QPGA 4UVHA 1GAJA 5KTPA 4OKIA 3L1VA 1XCMA 5ALWA 5BQOA 4EJSB 4EUNA 4BU1A 1T2VA 2XGGA 4UBJA 4XYBA 5L4LA 1Z3IX 3ROZA 5K3EA 4RABA 3RTGA 2VTBA 3WGGA 3EVNA 2I03A 1PJZA 1YNSA 2GD0A 3FM9A 4RF4A 5TY0A 3IOYA 1AA9A 3OLQA 3I4FA 3R3XA 3KB8A 4Z99A 3PXGA 4KXNA 4I0WB 3W7VA 1X9IA 4LXGA 2J9FB 4NNOA 5I48A 4XRRA 3IIIA 4D4KA 4ZFNA 5HOEA 2QTCA 3TOCA 2I2XB 2A9OA 4KGVA 2JHGA 3IAEA 4KPUB 4Q24A 3CVWA 3PR2B 1B7GO 1E1RD 4JN6B 4M8KA 4EKEA 4F46A 4M36A 4R5HA 4BMXA 4UARA 3MJHA 1QU2A 2ZRDA 3DDNA 3AEKB 3UKDA 1GGEA 1F06A 4M1KA 5FTKA 5KOHB 2X0KA 4JJ7A 3W4JA 2VI5A 3HB9A 5D6OA 3OUUA 1EZ4A 3UMYA 2GK7A 3VR6H 4KPFC 1A2KC 5CR9A 1DO0A 4BNDA 4W9MC 4XWYA 4GSYA 2OG1A 4JI5B 3CPHA 4PV7A 3DAHA 3JALB 2WQ6A 3BT7A 3JD2A 4RSGA 3RIXA 3NM6B 4F06A 1EUDB 4W6ZA 4UJ5A 5CVDA 3VHXB 1PWYE 4BWVA 3N76A 5AMXA 5AUPB 3LSTA 1IB0A 3SKXA 3LRXA 4UFNA 1TAUA 3KHSA 4KFSA 1NC1A 1SVMA 3HA2A 5AVOA 3KTDA 2EC5A 1F8XA 3OUZA 4LC9A 4YJGA 4R8KA 3V4LA 4ZTZB 1AD2A 2OLJA 1QVWA 3X1DA 4C43A 1JQBA 4QOJA 1YRAA 5G0WA 4FFOA 2ENUA 4L02A 5CT6A 5FOXA 1QP0A 1CFJA 4GLOA 3L2OB 4KQCA 5D1NA 3MLAA 2OAGA 4DNFA 2C5AA 3OQOA 3GP3A 4NECA 2BJVA 2ZSEA 4NCJA 3ZJ5A 1LJUA 2GBLC 4ZZ1A 1UXHA 2BN4A 1N6PA 1ZEMA 2ZI7A 3K9BA 3M4YA 5TQ0A 1YKGA 3W9SA 4RMJA 1RP7A 3IQDB 1N2GA 1N6NA 3GJ4A 3PDIB 5EEGA 4AZ0A 2UXBB 4A6EA 1OA0A 2JGJA 3LUJA 2JAPA 3MA0A 3GDOA 3MQFA 1Q0QA 3BN3A 1JLRA 1QLHA 1YAJA 3RNLA 4MI1A 4POOA 3M1IA 4YLGA 4WKNA 3KQOA 2B8TA 3Q72A 4TYWA 2H65A 5IPFA 4AY5A 2D2VA 2PX0A 5HM8A 2BHNA 1M1XB 2WUFA 1V95A 1Y7IA 5FX2A 1TDJA 2QUHA 3O38A 4NZMA 3VOTA 1NI3A 3FCYA 2V7TA 3AP2A 1D5WA 1ICIA 2C88A 4BZZA 1GGNA 4GI3A 3WDLA 4EB0A 2D5BA 4KE6A 3JQPA 4OK6A 3H5AA 1JHRA 5A04A 5IULC 1IUPA 4PZEA 4Q16A 1RSZA 2PV7A 1MO4A 2QMUA 4I5DA 5AT1A 5C5EA 1Q7GA 1GCAA 2OBFA 1OX4B 4KLAA 1IPEA 5E7JA 4EB3A 3IO5A 3M9LA 2IEAA 2QX7A 1NNLA 5J2UB 1W8IA 5AW3A 4Q05A 1DKRA 1TZJA 2AI1A 3ESBA 1QO0D 3GNQA 4GI7A 3M49A 3W1EA 2NTYC 2W6OA 3QKWA 3QPVA 3QZUA 2XZPA 2CLDX 5FFFA 4JT2A 3TXYA 3ZW9A 4BO3A 1FNNA 2JBAB 4DG8A 2H3EA 2HGZA 1YI0A 5DTIA 1DADA 3T1TA 3IERA 3EDMA 3IPCA 4KXVA 4GZ3A 1N2CE 1UP7A 2Z8XA 3LYHA 4O4IB 2WW8A 4WWHA 3ZV3A 4HF7A 4FN5A 2YXLA 3KKQA 4IGAA 4TSKA 4LBZA 1NJ2A 4X1OA 1VI2A 2O07A 4JJKA 5JQGB 4KAAA 3FTFA 3DVRX 5LC1A 1T3GA 4RK1A 4ESVA 3ONEA 3ROMA 2JI9A 3OQBA 2BFCB 1KI3A 1YQUA 2EFDB 2OHHA 4IHQA 3UJHA 3RF6A 2QMQA 3U26A 4GZ6A 4XYLA 2O2YA 4DCCA 5JLAA 2FI1A 4QGFA 3TJZA 4B3TB 1F14A 1FFWA 1MQAA 2A9QA 2ZSUA 2HMYB 3H16A 3IXMA 1W5BA 3PQEA 5JAOA 3A26A 3BH6A 1M1NB 1T5BA 1FFAA 1NP7A 1J49A 4JC5A 4O2AB 1ID8A 1D3AA 2DLDA 3QTTA 1W36D 1L9XA 1NW6A 3VO2A 2WJJA 1EX7A 4LAFA 3DLTA 4N47A 4G4IA 4GRDA 4C2BA 1XEXB 4CR8A 1T8WA 3O5AA 2JC3A 4BC0A 4Q02A 2H4ZA 3CLUD 1EINA 1R0XA 1E6MA 1BDIA 2ZS8A 3N8KA 2WC1A 5DMXA 3GUHA 1L8XA 1V9CA 3CLSC 1OV6A 4WZAA 3TVYA 1Y1PA 2DFVA 3C39A 4FYXA 2X3YA 3T4UA 1ES9A 1H1LA 2IK8A 2ZIZA 3MWKA 3HYRA 5IJXA 3CR7A 2D62A 2VJPA 3AQ4A 3CONA 2J3LA 4URFA 2X77A 3QOYA 1S5PA 4QGHA 4RGBA 4OKSA 4DYVA 1N7IA 1H6CA 1KAHA 1HYBA 3VYSB 4E03A 1WXWA 1TT7A 2DG2A 1P0IA 3IT0A 4EG8A 2CJFA 1Q7CA 2GA8A 4RMIA 4U2BA 5HZHA 3QELA 1JJFA 3R75A 3VR5H 1U2DA 3ILHA 3FCSB 4RQBA 3V2HA 2PAAA 4FFWA 4G8DA 1B16A 1FFCA 1JHMA 2Z58A 3GLFB 1ELOA 4HEQA 2D7DA 4FGLA 4JOSA 3OE7A 2AQIA 4Q1VA 1EEHA 1OFHA 3LQ2A 1M1YE 1JNXX 1R8YA 1WMDA 4U2FA 3VXKA 3W2GA 4MGZR 1Z2NX 4LOJA 4ZVOA 3HU5A 3EDRA 3FTDA 1QDEA 1ZUNA 3K5HA 4LWQA 1LLDA 1OFIA 1O6ZA 1IN5A 1RZUA 3FSGD 4CW7A 1XRSB 3KT8A 2GK4A 3L8MA 3ABIA 5LDDC 5BURA 2JVIA 4BQEA 5I9IA 1N8NA 1WWKA 2C98A 5DNDA 2RJNA 3ETHA 3V33A 1IXSB 2OP0A 2HWXA 4BGEA 1G2OA 1QVZA 2AHRA 2V3CC 2GH1A 1CRQA 3FNBA 3DO8A 3V55A 4IVRA 5FJIA 2NPOA 1AGPA 2QJRA 1F7VA 1D2MA 1F2UB 4G6ZA 5CU7A 2DH5A 2ZYIA 1AQLA 4UU0A 3H4MA 4GSKA 3LXXA 4WXEA 5G4KA 4ZDJA 1JR3A 3GT0A 3HBLA 1ECFA 3VPBA 4DZTA 1JWAB 4E46A 2P9FA 3COSA 3HDQA 3UMBA 5IT0A 5FWXB 4GZMA 3HLKA 3ZH9B 1ZICA 1XTIA 3R3ZA 3WBKA 2J67A 2JK0A 4Z9BA 2J5QA 4EGFA 4RPKA 4C1BA 4HSEA 3SNKA 4QIHA 2R6GA 2C99A 5F7ZA 1XMOB 1XA3A 8GPBA 3WKCA 3FMOB 4LEIA 2VDPB 3OFNA 3U7EB 4DLKA 4UZEA 3EOZA 3QWAA 2ZK7A 2GD2A 1ZN9A 3OIFA 8ABPA 2CWWA 5DE3A 3E23A 3QVSA 2GPWA 3OPQA 2EIHA 4F93B 1AQYA 1HFWA 2F8MA 3UJPA 1IG0A 2AW3A 2QUAA 2V1XA 3KJIA 4C07A 1S2DA 2CVQA 3E4CA 2XF8A 2V59A 3HHEA 1YL7A 1LLFA 4M38A 4LKOA 2G88A 1J8VA 1M1ZA 1TM7E 2P9GA 2WUEA 2XJ9A 4TRMA 1JHZA 1LSJA 4KFUA 1RLOA 4LV8B 1XKLA 3P9QA 4UOEA 2Q21A 5FO1A 3CNNA 4JGBA 2GBIA 2G8LA 3RD5A 2LTAA 1J8MF 1PTJC 3S5UA 3ZKWA 1SBNE 4RKEA 3TR0A 3A1NA 4Q3NA 4IXWA 1JJVA 3TTXA 2BZSA 5EL0A 2VZ9A 4B71A 1F51E 3L8ZA 1VLLA 5CBPA 3TUZC 1YQDA 3PC8A 1I8TA 2B6NA 1PYOA 3PSAA 1PJLA 3O4RA 4WVLA 5CT9A 4Y2GA 1KOFA 2TMGA 3F6SA 4NJMB 4B34A 1ZJWA 1G20B 2G72A 4BFSA 4KRXA 4ND5A 4YMIA 3ZJUA 3ZLUA 1E2KA 5ENZA 2R6R1 1Z15A 5HKLA 3OJOA 2XWBF 4Q9LA 5AKEA 2QAJA 5KYKA 2Z8YM 2VBFA 3NRBA 4ROTA 4AY3A 5JROA 1NVVR 2IZ5A 2WYIA 2Y0PA 2QNRA 3BF7A 3H3FA 4MGEA 4R8MA 4BNFA 2BR5A 4Y9RA 3FZGA 3N2IA 4DJTA 4YI3A 2X8JA 1NM5A 1M2OB 4GPAA 3NTLA 4AO8A 1B74A 1QRAA 1NQTA 5JW6A 3ROPA 2X15A 2O8FB 4F3YA 4IGFA 2R8ZA 2Q0XA 2FRVA 5B36A 3GFTA 1UBFA 1BFDA 3LC0A 2PWAA 2YXDA 1FVXA 2YXNA 1B1CA 3FDIA 3R0ZA 1TXGA 2DC1A 3H9QA 4AC9A 3AB7A 2D1FA 2D74A 3KQHA 3ZY2A 5F5NA 1K7XB 4HX9A 1Z7GA 4IFEA 1U2PA 3U3JA 5ES4B 3RS8A 1LGYA 2P7HA 2YHUA 4QARA 1A76A 3NOQA 1IE3A 5CK5A 3ZGNA 4OXIA 5HZGA 1SXQA 4EGAA 5DGCA 3RIYA 2HA6A 3KSMA 3T7TA 4F2WA 1WXXA 4NMHA 4ZRDA 3EXG1 2XRYA 1KYQA 1Y8QA 2R8PA 2O8BA 4F3NA 1VL5A 3ZCPA 1G66A 2VK1A 4IQ4A 3MWFA 2VH1A 1SIUA 3OOJA 1GL9B 3AG5A 2MR6A 1JJBA 1LI5A 2O6LA 1BHSA 2J5BA 2ZT7A 2BFPA 5KB3A 4HWKA 3GLIA 4CYMA 1KS2A 2EG5A 5K0ZA 2ZKIA 1E60A 2CK3D 1XZDA 2Z95A 4HN4B 5F23A 2RDMA 3CSDA 3IV6A 4FQ5A 2X8AA 3HDHA 4QU9A 1KOJA 4QQRA 3WJ1A 1YJAA 2HZ7A 2EJUA 3FWNA 1MJGA 1FSFA 4PC6A 3SQLA 3FH0A 5K8CA 3G13A 1I10A 1TK2A 1LVHA 1QFSA 1XZPA 4MHTA 4EA6A 3PB3A 4AKTA 3RKSA 3VISA 4POAA 1JFVA 3P9PA 4MYHA 3VR0A 1EVLA 1I14A 2I3GA 1XEAA 3Q3HA 4PU0A 1A4XA 4Q1DA 2C94A 2WUDA 1P7WA 3BBLA 1DCFA 3AONB 1KQOA 1MDFA 2P9ZA 1H2RS 3M5WA 1A5TA 1ABEA 1FUEA 1AKRA 1NAIA 1EUCA 1PWEA 3BWCA 3MCTA 4ZVUA 5KAMA 5BMVA 4JX8A 1RC8A 1RM3A 3M5DA 3TBKA 3LV8A 1RBZA 1TKAA 4GEKA 3B2EA 2IKQA 4IFIA 3RSLA 3C97A 1QYIA 4X84A 4RELA 5MFZA 5H59A 3S40A 4MVJG 2NV0A 1XOIA 3TQRA 1QHEA 2B98A 4MVWA 4CHTA 3U61B 4M46A 4KSCA 1VSUA 1JEYB 3DYIA 2G9UA 5HIIA 5DZSA 1Y3DE 1O95A 1YBMA 4H15A 1QO9A 1KSGA 5A9RA 3K7EA 4CPDA 1UDCA 3FETA 1U7UA 3SBOA 5FI0B 4H7EA 1UPUA 4V0KA 5BSMA 3EXFB 4EFKA 3HXLA 1RPZA 4AJPA 4BNHA 4ENQA 3UK1A 4AB1A 3UCFA 1P0MA 2JCVA 3RRXA 3NLLA 4E2XA 3OQHA 4JT4A 4YS6A 3O4HA 4I66A 5FWAA 5BN3B 1FS6A 1YKSA 2B4TO 3IT1A 3I09A 2X42A 3A7EA 4QUJA 3I42A 2FVXA 3P9CA 4FFSA 4PLWA 4AWXA 1CYDA 2JIQA 2QRVB 4XFDA 3WP1B 4KQMA 3J81A 4W5JA 2K6GA 1U0OC 1YHZA 2G63A 4JNKA 4QSHA 3CX8A 4RGVA 4HJRA 5D5QA 4WUVA 1ZYUA 3DT6A 1M2VA 3A6EA 5AW9A 3VPAA 4E31A 2FCAA 2O8DA 3A31A 2XHEA 3V80A 4L2IB 2IZ1A 3BGSA 3D43A 4MMXB 2B4RO 3I53A 4R0NA 3HM2A 5IC6A 5AVYA 4E7PA 3PQ6A 4CFZA 3AP3A 3T7EA 1QQAA 3TL6A 3KKZA 2GPJA 1TCUA 1KKMA 2G4LA 3PITA 5K3FA 3QLUC 1KSJA 4XCQA 4XIIA 4C3VA 1N5DA 4GGMX 3WP0A 4F45A 3GRAA 3DVAA 3ZD9A 3ZU3A 3BK7A 1GAEO 4X54A 4RE6A 2VLIA 4PIVA 5COBA 1DKNA 1XN1A 1EDDA 4HGYA 4JI6B 2EWWA 2NO6A 1UDRA 2Q3DA 4BWFB 1WETA 3O2SB 2E21A 5ALNA 2MSDB 2QG9A 4I6JA 5ECWA 1E6LA 2QRZA 3KL2A 5LNK6 2UV8A 4RWEA 3GT4A 4W99A 3VYRB 3SZGA 4QJ3A 1M2GA 1UFRA 2FHPA 1SCUA 1S96A 2O0JA 1TUBA 2PKCA 3WGYA 4YV2A 4RTSA 4GD3Q 1LRJA 4IFBA 3G89A 3REOA 3EW9A 3ZZMA 1G291 3BXXA 5D3MA 1W52X 5EMKA 2HR1A 2A0YA 5B3JA 3HJAA 4TPKA 1W4AA 3BMCA 1OT3A 3U48A 4CM3A 4TLAA 2A5LA 3IXLA 5KUTA 1FZTA 3WV4A 5FNZA 2EFCB 4E6EA 1EA5A 2A2ZA 3HKCA 3ORYA 4H31A 1PV4A 1XJ5A 2RGEA 3SJUA 4C0XA 5IYZF 4JC0A 4HMPA 2BFFA 1XZIA 1NIPA 1E79A 2G7MC 2HV9A 4UVIA 3RRJA 1E6UA 3SCZA 1DG9A 1J9ZA 2DSNA 4R6XA 4OI1A 5EP1A 1O9HA 5M3BA 2HTFA 2GYUA 2RGWA 1RQ2A 4GPZA 2F1RA 3KOOA 1EYZA 4N76A 3L3BA 3IEKA 1UKVY 1DAHA 1OBOA 4PAQA 4WE3A 4HDKA 2OXTA 3RC1A 3R6GA 3U19A 1UWLA 1TM2A 2QRPA 4G9BA 1PJ4A 3INTA 5AR1A 4OGLA 5FL3A 4UCXA 3OTHA 3ID6C 1AUXA 1EA7A 4DA6A 4QOHA 5KU1A 2NWQA 3MILA 1T36A 1TPZA 3UPDA 1AKVA 4ZVRA 3KQNA 4DXDA 1KBZA 4M1SA 2VN8A 3ZLTA 3QJYA 3VFDA 4XFKA 2OB1A 2R25B 1YC2A 4BN0A 3ZD6A 4C06A 4AVYA 1DG3A 1G8JA 2AJLI 1W36B 2DQ4A 2FWPA 4KNWA 2NUAA 4NATA 2C3UA 2QT9A 2AW5A 1U7WA 5ICMA 1M0EA 3QUSA 1C9DB 1K9VF 3FB4A 1MVLA 5FAKA 5LVAA 3TSZA 2I8LA 2UYHA 4RF5A 1A9QA 4I9HA 4C7JA 3MK31 1G38A 4OIFA 5H81A 4D0NA 3EIHA 1ONSA 1LX6A 2YIVX 3DMDA 4BDTA 4F4DA 1NLMA 3KD3A 4U4AA 5JJBA 5EJ8A 1NBIA 2AH5A 1K4MA 3QIVA 4H6XA 1EP3B 3Q5DA 4WZBA 4RL6A 3S1SA 2D1RA 4RORA 3C4VA 3TL2A 4B6PA 1VRCA 9MHTA 4TQ9A 1MENA 1SHKA 1TO6A 1V3QE 2EEZA 1CUIA 2PWPA 2Z4TA 5TQVA 4C4AA 4BLSA 1ZOOA 3CXUA 5IUNC 1BTOA 2BUBA 3UK2A 2X5OA 2XA2A 1UH5A 1N2CB 2N46A 3FLEA 3NZEA 4G4JA 4DM3A 5BW4A 5IK2D 4GP7A 1RYMA 2Q9BA 3PGKA 4E1VA 1A5AB 3GFRA 3A2KA 3CN9A 1BROA 1IBMB 2JFPA 1O94A 4GIBA 3GZNA 4W7IA 3ZNPA 2FHSA 2WKPA 4WLEA 3E7WA 1GAXA 1YB4A 2C9ZA 4UQLA 4FOLA 4WRRA 3K1YA 3ZU6A 2DZDA 5ICEA 1I1QB 1XEWY 3M9XA 2JGFA 2OCBA 3ZHQA 3HUUA 3PDUA 4E1AA 1Z5OA 1UM8A 3B3FA 1MAUA 4OJYA 4B3IA 2E4XA 2EJTA 4DIKA 4IIJB 4FZJA 2IZOA 4I6EA 2H1LA 4P8RA 5B2EA 4L57A 3UC9A 5CJJA 3AHCA 4ZOLF 5T57A 3E3MA 1KDTA 4KKXB 2P4UA 2VQ6A 2NOAA 2I66A 3NHPA 4DWWA 2FW7A 2J31A 1C8VB 1G18A 3DGEC 3PNYA 5TLSA 3WAGA 2DJ5A 1CETA 5HCIA 2MWMA 3PXBA 3LBNA 2ZWOA 3D7KA 2QT1A 3UKJA 4F9EA 4FX2A 2VBGA 2PVSA 1DELA 4TRNA 2O14A 1X0XA 2AMFA 1CC1S 2O0KA 4HATA 3W6UA 5A3VA 4IDPA 3CZ4A 4MB2A 1UMBB 3ZHVA 3RU3A 4JI2B 3FPKA 2FR8A 1XZAA 1DUIA 3GLKA 2WOJA 1JB9A 1PZFA 2HPZA 1RKQA 1EIZA 3BEOA 1ZVJA 2HWYA 2R6JA 3O8QB 3PRKE 4HDRB 1PT6A 1SD5A 3LMKA 2XT9A 3EE6A 1QP7A 4AN1A 2BSQA 4UD2A 3KQYA 1XZHA 2JEZA 1U98A 1U63A 2YVAA 4AJHA 2ZRNA 2JANA 3D8TA 4OI2A 4R7ZA 1GU0A 2BRUC 4XASA 3T9AA 1UZNA 3VU9B 1M1YB 2WQ7A 2HK8A 1W1WA 4XWWA 3I39X 5FPPA 2YCLA 2IYRA 5CVEA 4AQDA 2PH1A 4UC0A 1JTFA 1N0IA 4QLBA 2WU3A 3E7DA 1OWOA 1TECE 2B2NA 1O97C 3TXAA 3U17A 4YXFA 5IDQA 4GC5A 1PR6A 3S8EA 2O3TA 1IVSA 4GYYA 1FRNA 2OO3A 1ZOIA 3WIUA 4CT0A 1NMEA 5CA1F 2FLKA 2XQIA 1NT2A 2Z5GA 3JAWB 4XLTA 4Z0HO 3ZVKA 1SKMA 3OWXA 4QUIA 1RRCA 1L5ZA 4G0UA 1C5KA 2OV8A 1FU4A 3FCCA 2B69A 1H5QA 2ACWA 4ML3A 3OFJA 4UUQA 4ZANA 1UAAA 3FVTA 3HL4A 3F7MA 1BMFA 4HRYA 3RO7A 1RYEA 1U2EA 3LY8A 4CI0B 3LGAA 3NPAA 5CXUA 2ZTHA 3L7IA 3LYLA 4R0VA 3U49A 2Z30A 3STVA 4TQGA 4YMWA 4AJJA 10MHA 2OA0A 2CXUA 2ON6A 1SG6A 1BG6A 1GDHA 1U9IA 4GR9A 2J5RA 4IGIA 1CJKC 3CNOA 1PNOA 2OMEA 2H5JA 2NZUG 2V9CA 3DWIA 5HNKA 4ZOCA 4I4IA 3AM5A 5C7LO 4H3KB 2VDMB 1HQDA 4MUAA 3RB8A 1IBKB 1Z6TA 1E1MA 1GG2A 2G1KA 2R4TA 2V54A 4TWBA 1QH0A 3KUUA 2MMCA 1CR0A 3L6BA 4OQPA 2PIAA 5AI5A 4YGXB 3VKHA 1Z8FA 5D5PA 1KDZA 5LKRA 221PA 3WQBA 3LZDA 3QI2A 5A02A 2HMAA 1NYQA 2W2LA 4G1BA 5KAPA 3VNAA 3ILVA 2VSOA 3QEOA 3ADOA 2JAQA 4A2QA 4PPFA 9LDBA 2BL4A 2BFEA 2PD4A 2CHQA 2YMQA 1CT9A 2D5LA 2Q9CA 2ZCVA 4IJUA 3W2TA 4AZWA 1VG0B 5FTMA 4IR7A 2JI4A 5FR1A 3SC6A 5HUJA 3TBFA 3HO1A 1K66A 1V48A 2YJ5A 1CDOA 4HYTA 3H7AA 2ZYVX 4P3NA 4LHXA 2BEJA 2JH9A 2POCA 4K6FA 3RSZA 3U3XA 4WACA 3EGDB 5ADUS 3A10A 2CBZA 2HA2A 3D31A 1RYDA 1DC3A 4ZTUB 2P35A 1UJMA 2QT0A 4UZFA 1JEOA 1VZ3A 3M6WA 4AJ9A 3Q3IA 4K81B 5DYWA 1BVHA 2NW6A 2PL9A 1MRSA 3V9PA 3MS2A 3UUFA 4QXOA 4AIIA 5REQB 1OFTA 3D81A 2YTZA 4DARA 5J3JA 2I67A 4M53A 1I6LA 4QHTA 3ELYA 2GM4A 2G1UA 5EXTA 2VA8A 3LO5A 3ND5A 4WT7A 1PW5A 5T6BA 5IBPA 5BRJA 2A9JA 2VWHA 3MJVA 4UHKA 4E5SA 1OYWA 3LP5A 1MZPA 3LY9A 5F1YA 1XAIA 4NBNA 5K45A 4F4HA 3U60B 1K8QA 4PGAA 3IMEA 2IEGA 4DHWA 4BDSA 4TM8A 3NYWA 1RWNA 2XTAA 1N32B 1ULAA 2PFKA 3H5LA 1JBKA 2A9RA 2W2KB 4FE3A 1J20A 1HBJA 1ZONA 1SQ5A 4IXTA 4L9RA 4PZLA 4BVEA 3RJTA 4ZGWA 4ZODA 1D04A 1YZNA 5E9AA 3Q3EA 4QC2A 4MS3A 3R7NA 1JYSA 4OQNA 4DTIA 1IL0A 1IAVA 2GFQA 1L7PA 1Y4ZA 3TZ6A 4D3XA 4Y2VA 2ZJ6A 1RQLA 1E9RA 3I3OA 4N18A 3ULKA 1OZAA 1AN9A 3ZVLA 4J9UE 5IBRA 1P6QA 3WGUA 4EMSA 2VF4X 3H2YA 4KH0A 1XI2A 1QIKA 3DBVO 2PLWA 3LX4A 3BMOB 2X7HA 1LZLA 3AHIA 3QF4A 3RS4A 1JQKA 1D4AA 1V26A 4J1NA 5T4HA 3GEIA 4IL5A 1UWVA 4J0CA 1E92A 4DV1B 1X74A 2A9VA 1YJQA 4HTAA 3E1KA 3SDBA 2XDWA 4LXYA 4BP1A 1Z7WA 3LT5A 2VP6A 4KIWA 1QHFA 2H1RA 3PPVA 4EABA 4DKXA 1UBMS 2BELA 3IQGX 2Y1CA 1DKLA 2HBQA 2IZ0A 1T13A 2PUHA 3E9RA 3H1TA 4FNOA 3S2EA 1YRQA 1JU4A 2FX2A 2YMMA 2HFKA 1O4WA 4ALNA 2C82A 4N6GA 2N47A 1NJGA 2AG1A 2VDOB 1C8BA 2Z1MA 3MTAA 3WYGA 3TQQA 1WPQA 1HYGA 1X19A 1MB0A 1PV1A 3FSGA 1JT2A 4TT8A 5IWCA 1HK7A 3ZGYA 3BG5A 2X6TA 2GN1A 4RA9A 2AOTB 4DE5A 4NZPA 3DHWC 4FGJA 4L0CA 4L8LA 1RW4A 4FGSA 4IP0A 4X9XA 2XITA 1YIAA 4MV8A 3DBIA 3K96A 2FFRA 3AF3A 2V03A 2JF0A 3OAAA 2XBLA 3WIOA 4U9IS 4KV9A 1XWFA 2OFFA 2YWBA 3GA5A 5AVJA 2PU7A 3T7DA 3ZE8A 1OKKD 3A4TA 4UBMA 4Q9JA 3WJAA 1W4BA 4Q9IA 1PTKA 2P6MA 3DLIA 1TADA 5C37A 5KYXB 5C1OA 1YE8A 3EX7C 3BWEA 3QLEA 4M1QA 2CUNA 1U7PA 3EY9A 3W8DA 4B6FA 3OP1A 1POWA 1TEHA 2XUGA 3NNNA 3REGA 5CYOA 4B3BA 4QLOA 3KQUA 1ULHA 1ZBQA 4BPRA 2KPOA 4PF1A 4PPQA 4E21A 4ZZ2A 1W85B 3LDFA 1N2SA 1PV2A 3KEFA 2BGGA 1WW8A 4BBZA 1T8UA 1NKVA 1VSTA 4ZYVA 3F46A 1G3UA 2CMHA 3PGLA 3S8YA 3SHQA 2NTVA 2Q41A 1NG9A 3U1TA 5C2JB 1U0HC 2QV0A 1R0BA 2XX3A 3DR5A 2NMVA 1U02A 2YN4A 4ZV9A 3NUZA 3VZRA 2RCYA 3KNZA 4OP3A 1TT5B 1AGYA 3LX5A 4FONA 3I72A 3M34A 3Q8MA 1CSEE 1YQEA 3JPYA 3CNHA 4KTVE 1EVYA 3NOOA 2RCNA 5KYTA 1C3JA 4MHOA 4Q9KA 5E4YA 1L5VA 2B78A 2CDNA 4RA6B 1KY3A 3G17A 6CHYA 3FNIA 3JWGA 4LA4A 4V0RA 3UW1A 2WPDD 2G36A 4WZZA 1JAXA 1KDPA 2GEDA 1O5IA 2CXSA 2H4HA 1IHDA 2VOEA 1AUVA 1HKUA 3OZRA 2PNJA 1ML4A 4DM4A 4BQIA 4IZIA 1WXHA 3ZD8A 4KITB 3WK9A 1CF2O 4EW6A 4HR7A 4JCCA 4F5DA 3LT4A 4AZ3B 1J25A 2JS7A 1Z18A 2PJUA 3DDZX 3Q7PA 5BYAA 3SX0A 1JQAA 4NU5A 2YZMA 2UYCA 4BN4A 2ZR9A 4H60A 3LVFO 3PUXA 5AHXA 3W5SA 1PJ2A 1UBNA 3NBMA 4KVZA 4MUBA 3R0JA 4Q4DA 5EMLA 3OCUA 1T9DA 2E85A 1FLNA 1H6BA 2PU5A 1CXZA 3K1AB 1G42A 4DL9A 5AM5A 3R4CA 2NVUA 4IO1A 2IWHA 4IXMA 3SZRA 1EM6A 4IH9A 2EFEB 3OZTA 3PDHA 2CXXA 5AHWA 1KFBB 3RWMB 2IDKA 2IU6A 4J76A 4S1TA 4FLFA 3A6FA 2P6UA 3VOBA 4BFCA 2PQ2A 2XVMA 3K73O 1FXUA 2FWNA 3KWFA 4B80A 1NXXA 4H4CA 3BK2A 2FE4A 3C5VA 3NYQA 3S2FA 4PTZA 3D7NA 4COKA 4W5NA 2ZQZA 5IJ9B 1IY1A 3ZBUA 3CWQA 3NJ8A 3D0OA 1THTA 3DZIA 4F86A 3PX2A 4NICA 2RGXA 5IJ0B 1I4OA 3GXBA 2PEZA 1NW5A 3I1FA 4IUDS 1DQSA 1W29A 3P0HA 4DEXA 1E5VA 1TJPB 2GEVA 3EHEA 4IYJA 3RYCB 4FC6A 2HNKA 4Y1GA 1KKLA 1VA4A 2M2IA 4AUMA 2PWZA 6Q21A 1ZH4A 5D01A 2VO1A 3MRVA 2H63A 2VUIB 5SY4A 4DSOA 2JZNA 2R96A 4M37A 2PJDA 4MQLA 1QJ4A 3L0OA 1QKKA 4MDFA 1JPUA 3GJRA 3G2MA 1OT5A 4OSPA 2OHIA 4AYXA 1GPKA 4LHEA 4QU0A 5HPYB 2JGLA 2SHKA 1R9JA 1NHWA 3BE5A 4CF4A 4CEIA 4DTCA 4REQA 4F04A 2G83A 1GAQA 3HXTA 1DQYA 3G0IA 3TLJA 3D5QA 3O8LA 4WBXC 2ZYHA 4O3MA 3KPUA 1E2HA 1Q11A 4FOOA 3EVCA 3NQ41 4PR3A 5B57C 1KKUA 2C4TA 2G06A 2W2PA 3CIFA 3KOYA 3E05A 2VWPA 4Q4CA 3E4DA 4K40A 1GUAA 1HY3A 3HXKA 1T5HX 4EARA 4TTQA 4D9BA 2HIMA 4H1VA 3W2EA 1TA4A 3NT2A 5CW2A 4I4LA 2VQSA 2IV3A 4V3CA 2N75A 3DB2A 3P9KA 1YDHA 3H97A 5L4SA 1BKDR 3S7TA 4UMFA 5KNDH 1A97A 5DCYA 5LMCA 2VAWA 2ZYAA 1DUVG 1BQEA 1JU3A 1THZA 2IEDA 4JDPA 2F62A 1SFRA 1H6DA 1I9GA 1ODFA 2Y4OA 1OXXK 1EXNA 1MJFA 3MWEB 3OETA 1G8YA 4L08A 3NEJA 2YHSA 3NHSA 4MUGA 3IVRA 2PS9A 2JHPA 2C61A 4P80A 4Q93A 5BQPA 3RTCA 2DUMA 1UP6A 4H7IA 1Y5LA 5EC8A 3Q5GA 3UT5B 1KYTA 3SWWA 1E59A 2ZWPA 1RYYA 2C95A 1YZYA 4MS1B 5BNZA 2FEMA 1DJPA 4W4TA 3H99A 1OI4A 1ZI8A 3H3JA 1Z28A 3KQKA 1RTKA 3IOMA 1F48A 3OLZA 1YZQA 4DDMA 3AVVA 2F64A 1H5UA 3WLQA 3TX2A 4EPXA 5G53C 5AW5A 4HH1A 1REQA 3LBHA 1VFNA 3PPXA 4JASB 1B23P 4GOOD 4Q15A 1NPYA 4F2HA 3ZOKA 4M7PA 5BV1A 4BFZA 3DVLA 1T5TA 4QFDA 3MZ0A 1FNMA 1UUFA 2AJBA 5D3KA 5FAXA 1A5SB 1B8OA 1HDEA 1X8LA 1TVKB 2QUZA 2QY9A 4UE3S 3WLNA 3F5FA 2FQ1A 3MTIA 4BJ5A 1HUQA 4GR4A 4D74A 3CUKA 1L7QA 2R6ZA 1G0OA 3IVMA 4CF5A 1HDXA 1YKFA 2H1WA 1Q95A 2SKCA 1QDUA 1TF7A 1YL5A 2GJ9A 3BQ9A 3C45A 4YJ2F 2BH9A 1P7YA 5HIMA 2DUWA 1OLXB 1BHO1 1CF9A 2P5YA 4PW0A 3CY6A 4ZMRA 1QBKC 3FAKA 5KZMB 3M9WA 1TMYA 3L6DA 1I51A 1UXKA 3ONFA 3P0RA 1WZEA 2D8MA 4ALKA 5I9LA 3AXTA 1JEJA 1W94A 3ES9A 4JKOA 3NVKI 2GO1A 4D8UA 2BOVA 1P5FA 1GEGA 3F7OA 4MVJA 4U6SA 4QL3A 3GLRA 2OO5C 3H1FA 3MHPA 5EWMB 3WWOA 4D56A 3MUOA 1ESMA 4RH0A 1KNXA 1SUSA 3DPSA 3I92A 2CVHA 4AZSA 4P9NA 2WTUA 2Z2KA 3L06A 1YGYA 4HKTA 1R4MB 5D87A 3VAZA 3B78A 5JC1A 2P40A 2W6QA 3M7IA 1QC5A 1GG8A 1Y3CE 1UBOS 1WKVA 4QBKA 2CLSA 4X5OA 4ARZA 3TCKA 5GVSA 1MBZA 1TZKA 3EAFA 5JS1A 3T12A 1WXIA 4YXWA 3SYTA 3VOAA 3JAKA 2IOFA 3U7QA 2GKSA 1VSVA 3V9AA 1RQNA 3QVGA 1N6HA 3FYUB 1D4ZA 3ILXA 1PK7A 1M66A 3MXTA 3FCEA 4I50B 3HP1A 4ZI5A 2P0EA 3AO0B 3EEFA 1L3BA 5AKGA 3VNSA 2AT1A 2JGRA 4YRTA 1BWRA 1FUIA 3A1DA 4I8DA 4D9FA 4YB8A 1E6WA 4I55B 4ZQBA 1LY1A 1NVBA 4G5GA 2OZKA 4YDSA 4LF9B 2BWJA 3A9SA 3R7LA 3AUUA 1PBTA 4BLRA 2L42A 2HADA 2R7NA 3O75A 3WICA 2Y9PB 3R3JA 3U9SA 1Q14A 1AN0A 4P4NA 1M72A 3JRNA 4RL4A 2ZJAA 4RMNA 1LDGA 4B7XA 1EGAA 3R7WA 2FP3A 1ZNXA 1TJ3A 1Q1EA 1Z5WA 1BEEA 3HBNA 3I45A 1IULA 2WTBA 3NC1C 2CHEA 2J9XB 3PENA 4X1KB 4Y1FA 3VU0A 4LVUA 2FEAA 4RVHA 3QUQA 5TMEA 5GZ3A 3AF1A 1NJ1A 4HLUA 1BXZA 3JR3A 3CZPA 3ELDA 1YCGA 2NIPA 4OAOA 3TZEA 1NUQA 4OQXA 2G70A 1DTWA 2I3ZA 2WT9A 4LNUB 4MR8A 2R7KA 1YC5A 1ZVMA 2HMSA 2XA1A 1OXTA 2VRBA 2WTEA 2YH2A 1DZ3A 3LBAA 2I8AA 3LGXA 5AVRA 3HYNA 4CLHA 1PVDA 3MCUA 4BXOB 2CL6X 3L1UA 5A5FA 5L6LB 1SD2A 1VJ0A 1ZD2P 2W4IA 3GLTA 5CYFA 1FFBA 4MWOA 5F4ZA 3SN6A 3ST7A 3TLBA 3WOHA 3BWVA 4Z8XA 4B09A 4CT5A 2RHBA 4C88A 2AYZA 2P4EA 3X1WA 3DW3X 1EDBA 1XD8A 3QE9Y 1VTKA 3AF4A 3CRVA 4H2DA 3HKBB 4KN5A 4CHGA 4F4CA 3AR6A 3L7DA 2V7UA 1X1CA 1E77A 3IBFA 3RG2A 5AKZA 3KVYA 5JASA 3U4MA 1SBQA 4EPWA 4UM9B 2BDTA 3HDVA 3LHIA 3MTDA 5B1HA 4C0SA 5BOSB 3I6ZA 1Q7TA 3ASZA 2C4HA 3PEFA 2C4NA 3KR1A 5G02A 3SEFA 1PFQA 3FXAA 3SKYA 4UQOA 2ZPTX 3LDUA 2RH8A 3UN1A 1AH2A 3A7DA 1DC8A 3F6CA 2WJYA 1DDIA 3KLNA 4MW4A 4QFBA 4YMGA 5BVGB 3FKQA 4S35A 1A8SA 1WU8A 1K68A 3P4XA 4CMIB 4HEA1 2Y2VA 3U3MA 2C7QA 2FSHA 2VYQA 3H5TA 5AIBA 1MT3A 5CM2Z 2C9DA 2Y77A 3ZI7A 2OFXA 4CNBA 4F3RA 1V25A 4Q4AB 2HCTA 2I4LA 4EF6A 4JBLA 3AZOA 3IT2A 1XZQA 4RMGA 3KLOA 1G7TA 2EARA 2PRIA 4U2GA 1R7RA 2AUNA 3G2IA 4CUKA 5ER9A 1EK1A 4LN1A 1XRQA 4HPJB 1H9CA 2H2IA 3PC7A 1GM5A 1Z29A 3DEFA 2E5LB 2X4GA 3MAGA 4NV3A 3GRRA 4XOUA 4R8RA 3KSDO 2BI8A 1E63A 1PF7E 1Q92A 1D0SA 1KS9A 1VSQA 1XUOA 1Y9ZA 3P94A 4G0ZA 4RDCA 4OREX 3PHIA 5CB0A 4CG0A 1BXRA 4BZWA 2FSVA 1U0JA 2AZ4A 2OCPA 3OKAA 2QBYB 1J5PA 2OCIA 3DJFA 3EWIA 3GZ4A 4RVUA 3DBLB 4A16A 2YASA 3EIEA 1ZCFA 3UCEA 4PBRA 2IS4A 4O4LB 4X0EA 2EF0A 4PICA 4YI5A 2E87A 1H2XA 3EA5A 4Q9NA 3ZDBA 4ZCLA 1KORA 5I4CA 3PX7A 1VG9B 1ZGAA 4WLNA 4R98A 1E99A 4RV9A 5ALQA 3RS9A 6PFKA 3UY4A 3OKCA 2EP8A 4NV0A 5E9QA 3RJ9A 3GBVA 5FLYA 3AJDA 3JWIA 5JOQA 4J6EA 1BE8A 2X5NA 4DVGA 5C4MA 2Q62A 2HPVA 3C14C 2XWQA 3HVJA 2YXPX 4W9NC 3C3AA 3HXPA 3UIEA 1N9KA 3TUIC 4YRFA 1OC4A 1X70A 1LTQA 3LY5A 3F71A 1HDCA 1L6RA 3GN1A 4NDZA 3G2KA 5HCNA 3S28A 1O96A 4UMDA 2F67A 2NUBA 3QOWA 3UBTA 3NGXA 2YC2C 3ABRB 4RDXA 4WN9B 2L82A 3EJWA 1Z45A 4L9AA 3ZU5A 5EXXA 2CEAA 3G02A 2WMYA 2HKIA 3E61A 2WIGA 1I2CA 3L9XA 1KA9H 2DTEA 1AE1A 2H06A 1BKSB 4BVKA 3AEQA 1PZGA 4E4YA 1PGPA 1COZA 1Z2OX 2V4ZA 3JZMA 4IMRA 4XJVA 1HETA 1TI7A 1VBKA 4OQFA 1PL7A 4V0NA 6NULA 1V7CA 4Z7OB 3HU3A 4ZZ3A 2BGNA 3EGWA 1T0JB 2R8RA 2V4UA 2Y9MB 1IC6A 1QVAA 1PDOA 3OOHA 3TPFA 4ASUA 4WSOA 3ZHTA 1L5SA 4PS0A 5CNIA 1EK2A 4K6MA 4FS8A 5EP2A 4MJ3A 2P2CA 1Z0SA 4ARIA 1NVWQ 3F8WA 2BGTA 2GRAA 5J2UF 1TW2A 2RAPA 3GCZA 3KKOA 3P27A 2QNIA 2WTMA 4RIFA 2AF3C 2ENWA 2JCXA 3AU9A 3QJ5A 5FFMA 3C8UA 1K7EB 2GJAA 2JJ8A 2PRYA 3ETLA 1SKQA 4XX0A 1L1QA 4OHCA 4ZYYA 3SDSA 1FK8A 3AERB 4GNKA 4KVFA 1Z22A 3L43A 4EY4A 5KNBA 1VXRA 2TMYA 4YRJA 5EVCA 2ZITA 3GUCA 1E0KA 3OCJA 2A8YA 3HR8A 3R0XA 4MQFA 1ZFNA 2OXIA 2X23A 4JMLA 2B0CA 1IOZA 1EJ6A 1GSOA 4IV5A 2JATA 4WY5A 1K4YA 3GT7A 3ML1A 4OU4A 1ZXXA 4ZEWA 1KWGA 2HNBA 3EH1A 1RACA 1LC3A 1PWXA 2FK7A 3TD2A 1DU4A 2CFCA 1L4FA 4Q9AA 4W5RA 4O2BB 1KEUA 4X6XA 3ZCTA 4FHGA 5EHZA 4ZCTA 5DT9A 2VNHA 1QK3A 4NCKA 4YT5A 4XWAA 5C1IA 4D3DA 5JQGF 4YUVA 3AX6A 2X9VA 3I0MA 4WVFA 4ZAZA 3ZE7A 2A5YB 2CLLB 3CVUA 3QLVC 1FDIA 3I9NA 4LE0A 1Z0UA 4L27A 1C0IA 4TT3D 3I9V6 3TLAA 3LPCA 3DNFA 3GFFA 3DQZA 2PT6A 2EJWA 5I7SA 1TMKA 3SF8A 1KYIA 5DXFA 3RGWS 2BEUA 4RXTA 3ZGLA 4ZT6A 3QVVA 3TIXB 4S12A 3TH5A 3H8WA 3L02A 4D2IA 3VJRA 1B3RA 1HTBA 1OAOC 3EEYA 3PTLA 2QG4A 4MEAA 3DBRA 3GLSA 2G1AA 2IVFA 5AM0A 3LPDA 1KMCA 2HDHA 2ZUFA 2WY2D 1EXMA 1QG0A 3QSGA 3TRKA 1RBYA 4FFBA 3KM0A 3LUAA 5IBQA 1RI2A 2CLMB 4J0EA 3ZHBA 4IHJF 1ESDA 1G21B 1Q1BA 3M2TA 5SYMA 5DX1A 3I30X 2QLLA 5EMHA 4EQ6A 4QGBA 2FZ4A 3WLOA 1JU9A 4PFQA 4R4JA 3INYA 3V1TC 2ZQYA 4C21A 1TTTA 1K6MA 2JARA 4ATNA 3DTVA 5FI1B 4AJNA 1JIVA 1GL7A 4FE7A 4KWEA 1LS6A 4MCAA 2XUOA 1RM4A 3MMPA 1W4ZA 4RD3A 1YB6A 2B7CA 4Q3OA 4WFQA 3N8IA 3JYHA 2JAUA 5AK0A 4FYJA 3ZHRA 1L5HA 2TMKA 3G5MA 1BVUA 4PONA 4K0KB 1MB9A 1E9VA 4L8GA 3RAFC 1WX1A 1RJDA 1Z38A 1QP8A 2GXUA 3W3AH 5KJ6A 5C51B 2XBMA 2GMWA 4G5FA 2QTBA 2GFIA 5KTNA 2K2QB 5LP1A 2C5EA 5CFOA 1ULSA 2HDWA 2I5PO 4IIUA 5TNXA 2DFLA 5IZCA 1GNLA 1H4TA 2WSLA 1Q84A 2XE4A 2QE7D 2YW9A 3PJGA 1C2YA 3UAGA 3TAXA 5JYBA 4EO7A 1QZ3A 2BPOA 1WSAA 3FWYA 3PNSA 3E3AA 4GOJA 3HWRA 4PE5B 1WLYA 3RHTA 4J6FA 3W9BA 4CV2A 5DVZA 3UWSA 1FMLA 2IVZA 1LDNA 2RGCA 4RK6A 2D0OB 4RTMA 5ICFA 2B5VA 2XRZA 3BKWA 1DMRA 3L40A 1PUIA 4C0JA 2FEKA 3X1YA 1JDNA 4IY1A 2Q27A 1BRMA 4IIDA 4K9MA 4OFZA 2QXUA 5TPZA 2HX1A 1YCDA 2GYWA 2OC4A 3EOAI 4BATA 3EUWA 4PNHA 3CV3A 3JQFA 4O4JA 2VDQB 2EX4A 1UBEA 5DI3A 1E5QA 4PGHA 3JQEA 3F4LA 5AQEA 5KVQA 4BX9A 4DV7B 2P2GA 1DL5A 3PHCA 4HWSA 5HK9A 2I4IA 3FZQA 3OECA 4P4LA 3H4IA 3SLRA 5I9NA 1Z7YA 2WF9A 1KJQA 2XR1A 2W43A 3U4IA 1NTRA 5E3JA 4BNIA 1EWQA 3J7TA 3DWGA 4Q1CA 2IEIA 2JEYA 1MG5A 1SULA 3BCHA 4AD8A 4OOEA 1FUYB 1U3WA 3FVVA 2WT8A 3HMKA 4YFVA 3RRZA 1J2EA 1I2AA 2LIVA 5B7NA 1L7MA 1MU0A 4ZO4A 4JJZA 2I22A 1E5XA 3R5JA 4LX0A 2Q7DA 2RARA 1XAGA 1XU7A 5SZIA 3TLGA 3U37A 3L7NA 3SVZA 1JVBA 2BW0A 4C04A 2GEUA 2XQFA 1M2WA 4NXMB 1RXEA 2EZ9A 1JG4A 1MB3A 3OA0A 4FR0A 4HDCA 3AV0B 1USKA 3RTAA 3ZWCA 3ND7A 4UU7A 4ENTA 1JFRA 4UDOA 4BNJA 1MJHA 3W5CA 1AHHA 3HXQA 1JEEA 1CUHA 4J07A 2O19A 4RANA 5CCXA 3LS2A 5BV7A 4L8WB 2H7VA 4OY3A 2QZ9A 4WK0B 3W6ZA 5ADHA 4QXQA 4F5EA 1GCUA 2CDCA 4WOCA 4WNAB 4B4VA 1E0DA 2TECE 4WOPA 4ETNA 3QWHA 4F97A 3CX3A 4RHYA 4ICIA 1F7UA 1MD9A 1TKRA 4NYMQ 3A1TA 5A2QA 1OF1A 1S8OA 4E22A 4G0VA 4MWDA 3W5VA 1QGZA 2FA9A 3N2KB 4K88A 3U3ZA 4CM9A 1SQSA 1ZIDA 4TMZA 1XFDA 1NQUA 1FFXB 1DLIA 3E5HA 1P4AA 4AS3A 3RUIA 4JODA 3ZUPA 4COOA 4RZHA 4RLHA 1AMUA 4A92A 3T7JA 1TUEA 4UVEA 1LPAB 4ZVPA 4ZYZA 4U7TB 2DWUA 2XWPA 3CVJA 2HB6A 2DPGA 3INNA 3AK4A 2FMFA 2W48A 1RCTE 2PO7A 2C42A 3G2OA 3KVVA 5K4HA 1HLGA 2VF2A 4FBLA 5CPBA 4NJEB 5LXTB 1TTQB 3B1ZA 1UZAA 2NQ8A 3CWZA 1R50A 5K6RA 4BYMA 3GCWA 2DWOA 2QVYX 1CZRA 4FYVA 1CUDA 1GZ7A 3BXOA 4N48A 5FBQB 1IHXA 2BD0A 5EUMA 2ZUCA 3RC2A 2ZE8A 4B1FA 1E4EA 1Y7PA 3E2MA 1N77A 3SLGA 1YE3A 1M67A 1XCGB 3JVDA 3CLSD 4OXNA 2B92A 4JVMA 4TOIA 4KEAA 3W1WA 3FGNA 2F43A 3WG9A 2R6CA 4PLCA 1WCXA 4E07A 1W0CA 3P2YA 5ADVA 1E7MA 1C4KA 1MW8X 4C2TA 2FW1A 3HLYA 4I1UA 3S1AA 1CY6A 2VNSA 3PWTA 2WYHA 4WL0A 3W05A 5BMVB 3U9TA 2OGTA 3D54D 2CEKA 1YDEA 2VLBA 4KH1A 2EYQA 2IHVA 1V1RB 3BXHA 3OTGA 2Z1NA 1NBEA 4H3VA 4J2TA 4W1SA 5CVVA 5DIFA 3EJ6A 1HQYE 5IMBA 5KO2A 4IOKA 4YROA 4A8JB 1R4NA 5HXAA 1D7OA 1DKPA 2WG2A 2BBSA 2ZS7A 1M0WA 1PLLA 5FOTA 3CUWA 4LZLA 2GYYA 1C50A 1QCDA 2HWWA 4URUR 3LCCA 4YALA 2GO7A 1H0SA 1N8KA 3ZDXB 3O90A 2B2CA 2V7PA 4FLEA 3LX6A 1X7HA 2A9PA 5KTSA 5H7XA 3NVMB 5DTMA 1VBNA 4HNTA 5CIYA 5GGYA 4FIDA 3WL7A 2B1QA 3ZUGA 4EY3A 2RHOA 1GGVA 1QANA 3G7NA 3L92A 1AUOA 4P7BA 2JHCA 2WVHA 4BEVA 3QKRA 3VC7A 3IBYA 4U2CA 1J8YF 2R1VB 2HHLA 1V8DA 4LGVA 2JFHA 4L4SA 1F6BA 4GS5A 1GL6A 4KGZA 5GGXA 2FN4A 3AF2A 3EC2A 3K0BA 1QR6A 1JG7A 1F1JA 4JUFA 4RS4A 2WHQA 4G5HA 1S02A 3KP1A 1V8OA 2Q9UA 3RABA 2LE0A 3F7TA 4UNRA 2DECA 2NO5A 4EM6A 3QEAZ 4HGZA 4YQFA 1NKSA 2QMZA 1CQWA 4TKMA 4NOLA 5CP8A 4OHYA 2A4MA 1YI8A 5DSZA 1QHIA 1JIUA 2VDWB 1KY4A 4GVPA 2Y0DA 4C9BA 1ZI6A 2Q45A 2WLTA 3QU5A 5ALFA 3S2ZA 4NCBA 5JD3A 3TK1A 1B0ZA 2QB5A 4ZHQA 1UJNA 3STTA 3O9MA 1AK9A 1FOEB 3R76A 3E53A 2A5FA 2E9SA 4I99A 3U7FB 4P3XA 4GX0A 2XECA 4RJTA 3NKLA 1EM8A 2Z6VA 3HCAA 3ZE1B 5EJ6A 1SXJC 1TAHA 3A06A 2B1RA 1ABFA 2ZAYA 3L7YA 4NONA 1BVYF 1IZZA 4I1IA 4EG1A 2Y27A 3GJ5A 2XRMA 4YMUA 3CUTA 3STHA 1TZCA 4F1KA 2AUMA 4H18A 3EQ8A 1WDKA 3PQCA 5EJIA 4MGKR 1Y5RA 1LK0A 3AR2A 3CZAA 2ADFA 3VBCA 1QKJA 1ITZA 4X3PA 5KOJA 2DWPA 2IW3A 4YJ3A 4F1WA 1P0FA 1N6IA 2C2BA 2DRIA 5C0OE 1HV8A 3B5JA 2Q1YA 1USVA 3I8SA 1INLA 4ZI7B 1AC5A 2ZXFA 4MR9A 4X92A 3AGPA 3P5SA 5ELXA 2PRZA 4CEHB 1RAIA 1A8UA 4OLJA 5GIOE 3HI6A 2QI9C 2CV0A 3E03A 3CRZA 2ZIXA 5IS2A 2BV3A 2UVDA 3ZEAA 4DDTA 3I2IA 4LOHA 4EFNA 2PZLA 3E9QA 1QPZA 4N5NA 3PC2A 1PG2A 3ZV5A 2PAFA 1Z4MA 5KKNB 2B7BA 3VNVA 1Q7BA 1GQOA 2OLEA 3KVNA 4RY9A 2JJQA 4FW8A 4GR5A 3I64A 4BTVA 4IH4A 1QHHA 1RC0A 1Y5NA 1DOZA 5JS7A 5E9JA 5DGTA 4G5XA 3IEIA 4LXIA 3I62A 2JZOA 5I3CA 1XZMA 3PKJA 1M8KA 4IKPA 4EI2A 5IKPA 2IF2A 2ZIVB 4AQYB 1KETA 3FMFA 2F4NA 3PI6A 3TYXA 4B0PA 5DLYA 4C7OB 4MDHA 3HNRA 4QKQA 1TAGA 1T36B 2BFAA 5K0TA 2YYAA 4II2A 3URMA 3IUEA 1GRNA 4MEBA 2D59A 1YWGO 4NZYA 5WRFA 1VLVA 3CE9A 4BPBA 4YRKA 3VR5A 1NPDA 3DLHA 3I1JA 1YOVA 2G6BA 4ZD6A 2FPSA 2YVKA 3K6SB 4KR2A 2CC2A 2YWFA 3C3EA 4DV3B 3LQRA 5LQCA 4GW3A 3DE6X 2XUFA 3TWOA 3KYCB 4URVR 3P20A 2DCUA 1O6GA 4DRXB 4EJSC 3LPLA 1QZTA 4PIMA 4G3XA 3CW8X 5EJFA 2QVXX 3L8EA 1ONOA 1T25A 3ZE0B 1VOTA 3BH0A 3JD1A 2UKDA 3NI2A 2ZSBA 2EGUA 2P0YA 5AOVA 5EQDA 3V6LA 4BO0A 4CG3A 2HW8A 4YUXA 1L4MA 1TO1E 1X42A 2WKQA 1DJQA 3CF0A 1ZM9A 2Z09A 4Z2AA 3SEZA 5HVNA 5AVUA 2NZVG 1COWA 1Z2EA 2CBGA 3JQQA 3KJQA 3QEMB 1NA5A 1DC5A 2CXNA 2FUEA 3OIUA 2IGTA 1DI0A 2XH8A 5A71A 2WMOB 3THWB 1ZWKA 1Z2CA 2AZMA 2XGOA 4KE8A 1FF9A 1ONPA 1YR1A 1HX7A 4DV4B 3KG2A 1CQZA 4N3AA 5JNVA 3VA7A 3O0DA 2OCGA 3KVOA 4BN5A 4LSMA 4NF2A 3BGWA 2FOXA 2GZ3A 3TX6A 3CTPA 4AG6A 3B60A 3EIXA 4HRAA 2Y71A 2ABWA 1UAGA 2WJ3A 3QENA 2CVOA 5C7IO 1P2DA 5HP4A 5KTMA 3C43A 4BP9A 1QTQA 1BE6A 2HDNB 1A4UA 2OHGA 3DV2A 3FNHA 3M83A 3K9QO 1C7ZA 4PR0A 4X6YA 5G1NA 3X2EA 1IXZA 1M74A 3IPAA 2W6JA 4Q66C 3RS0A 4BLQA 4XWGA 4CTMA 5LQKA 1X39A 2I4NA 4IWNA 1H8ED 3T6KA 1JEAA 3JZDA 4TTVA 4Q7EA 3KZVA 2W6IA 5KJEA 1UDAA 3R3HA 4N65A 5LQNA 1HNXB 1T3HA 1ZOPA 3FUXA 4M1OA 3F7NA 5E1OA 2F8SA 1E89A 1P1BA 1PQPA 3CBQA 1PW7A 3TTUA 3V7WA 3O1LA 4PS1A 4G37A 3D3WA 2Q5IA 5BT8A 4CMAA 1GL3A 3NIFB 3E70C 3FDZA 4ZT4A 4U2EA 1HZZC 4NMLA 3K9FC 2JA1A 1M34E 3ICCA 3WAKA 3GPLA 3FPBA 3HCRA 1KVRA 6ADHA 4A6DA 4NH0A 5JO9A 4Y7CA 2P1ZA 4DC0A 2PMBA 3AVPA 2GZMA 3JTEA 2FP4B 1H1TA 4EHHA 4LDAA 3G2QA 3T5MA 2QYHA 4YLYA 4W82A 1DV2A 1EJ2A 2FRDA 2I2BA 3PQ7A 4B7ZA 3AJAA 5B1DA 1DQPA 3UJ6A 3IAS1 1YS6A 2F3RA 1T4DA 3IELA 2ZAGA 3OE1A 1TMOA 4Z0PA 4CKWB 3R6TA 4LYFA 1YBFA 3MGKA 4GUAA 1I3OA 2ATVA 1QV6A 2WV7A 4PG5A 3SU8A 4KP7A 2HK7A 3V6MA 2VP2A 5E6RB 3OEED 1NXVA 1RXUA 5JZOA 1XRMA 4DT1A 4HL6A 2IZ7A 1S8FA 5HF6A 3AOEC 4IIJF 4JOBA 1PUJA 2Z6UA 3DQPA 1SBIA 3KOXA 4BRUA 1P0CA 3PIDA 2JCGA 2MMGA 2XCOA 1X1BA 3BZBA 2ZWIA 3BHMA 3GRCA 4RC9A 4EVRA 4B32A 5HZMA 3WNDA 2FV8A 1MDBA 3JASB 3NHJA 3ZHXA 2X9QA 2RG7A 2FU5C 3OQIB 1KDOA 5A5GA 3JQGB 2VK2A 1ODLA 3THXB 4KR6A 1P31A 4V0SA 1U2TA 1FMCA 2IP1A 5ILOA 1L6IA 3B2NA 2VYCA 4G0YA 1PJTA 2JLRA 3IRVA 1J7JA 2P1RA 5GJBA 1D2CA 2DGDA 3C87A 4LYYA 4BO5A 4BYGA 3MUEA 2A3NA 1WBDA 1ODJA 4EVIA 1LDYA 1JSZA 1Q17A 2LKCA 1ORDA 1OI3A 5CCBA 2XVXA 1OX5A 1B6RA 1JALA 4GPIB 4JR0A 3O3CA 1YI1A 4MV6A 4OPMA 1KGSA 3HO6A 2O1XA 1ZL2A 4HGPA 5K3BA 5FTNA 4BQPA 1YDFA 4I36A 4XAQA 4BMNA 1ESNA 3MMSA 4PX5A 1S0UA 3A6HA 5A7FA 4EFMA 3OBBA 4G26A 2VJYA 2XEXA 2DSTA 2J33A 1QKIA 3LIIA 4MPTA 1L7BA 2Q3MA 4KODA 1JEQA 4X85A 4DA4A 1X8XA 1DINA 5AKHA 4UQPA 4IH1A 5COAA 3DMTC 4X71A 3T7AA 1G6KA 2ZRGA 4QTYA 5F12A 3QFTA 3SY8A 3L6OO 3F0TA 3SJ7A 2HD4A 5AP9A 521PA 3WQSB 3RCBA 1GHTA 3DD1A 4ZDIA 1HGXA 2R87A 2XUDA 4XVUA 5IASA 4CEJB 1WKCA 1KFJB 1VCHA 5E2AA 1P1IA 2QF7A 5TPWA 3W5HA 1PLJA 4X97A 1UT8A 1RABA 2HJVA 2J48A 2W8BB 4LV5B 2DCMA 2YNMD 3GFSA 4K9PA 1HEYA 1VHLA 2QD4A 8ATCA 2WJPA 3B6EA 1NDUA 3COVA 1W5FA 4NNPA 4BRZA 5BWNA 4X93A 3QW4B 5CLQA 4B84A 4A4DA 2QLMA 2PXXA 1W76A 4N49A 3AINA 4QOSA 3P2OA 1X7XB 2O06A 4PO1A 1VM6A 3D5TA 1U8ZA 2HC9A 1AHNA 4R1MA 5KSPA 2UUBB 3RRFA 3S2UA 2XGJA 4NP6A 5AVSA 2PGAA 2FW8A 1G8KA 1PFKA 2JIPA 2QM7A 4RY2A 4YEDA 1CRPA 4AG5A 2QE6A 3UAYA 1JRLA 2BM1A 1BDHA 2OHJA 2WD7A 9ATCA 3GX1A 5JNUA 5L8VA 1C30B 1T8YA 4M4SA 3K0FA 4BC1A 3ECAA 4CUZA 4JXKA 1UWCA 1S4QA 1HNZB 5EAIA 1U81A 4GLLA 2PXCA 1SC4A 3EFOB 5J2TB 3JQ7A 1P9LA 2J0UB 2QMEA 3H0EA 4KGDA 4LFBB 4HDMA 1Q1GA 5G4LA 4AS1A 3PR1A 1B2LA 2P5UA 4KO4S 4R1UA 4U7PB 5KC8A 4RETA 1UEIA 2CSUA 2FPUA 3OPNA 5BWMA 1AGXA 2PX4A 1DBVO 4X60A 4UHFA 4MV9A 4HRVA 5KCZA 1NI4A 2H4WA 4HXGA 1X3SA 4OHWA 4QTUB 1YRHA 1NVFA 3TW0A 4OQLA 5KWIA 3I6MA 2WPNA 4K6CA 2MSEB 3KTAA 4GBMA 4FYHA 1IJFA 1LRKA 3B7GA 1QM5A 3KZMA 3DDUA 2FSSA 2JBWA 3ADKA 3JSAA 1G6OA 2OBMA 4OGWA 5A7GA 3U40A 2VUSA 3UH0A 4IRUB 4A9AA 3L7AA 2VPWA 4ZZIA 1GPUA 2GVZC 3UA3A 3DOCA 4DA9A 4AG3A 2DP4E 2GAJA 3WE7A 3GK3A 3DT8A 2BBOA 4TT3A 3IUMA 2BZGA 2NN3C 2MSLA 5FPTA 1E1CA 2XDQA 4UTZA 1RCUA 1XDWA 3CJTA 2ADOA 2WQZA 3CA8A 1BMQA 3OKPA 4QOGA 3TQOA 3MBOA 2V7XA 3JX9A 5TEVA 4RZUA 3KTOA 3AJ9A 3WL4A 2IPNA 2R1TA 4OHFA 4B3SB 3G8YA 2NPIA 2AG5A 4LOAA 1XSEA 2HA5A 1EWKA 2FH5B 1TYBE 1V5EA 2HLNA 3A27A 2FZCA 1AQJA 1XK6A 1ODKA 1C0EA 2WK1A 1CKEA 3K1JA 5L45A 1PGOA 4KCGA 3IXQA 3SNHA 4A91A 1M5RA 4F5WA 5A3SA 2X2OA 1HE5A 2QL6A 1E3DA 2H2DA 2ZRBA 2ZRKA 1PZNA 2FPWA 4FYIA 4X44A 3F8SA 1MORA 1V11A 2E0IA 3QU9A 4GF5A 4KWHA 4LS3A 2WD8A 3GFBA 4RPHA 3VO8A 4DLTA 4EELA 3UMRA 1I4TD 3IBSA 1L7VC 2WVGA 1KK1A 4XB1A 2RGAA 1RZ3A 3BSFA 1TC1A 3H65A 3Q7IA 4Q3DA 4BX0A 4L95C 2REOA 1P80A 4MZXA 2JB9A 4M6WB 4N0MA 4NDAA 4LV6A 4V03A 3L9WA 4JFAA 3QXHA 4D4GA 2SKDA 5FOQA 1Y9DA 3EA4A 3FOCA 1SCJA 3C3BA 4TSFD 3COJA 5I4IA 4WK2B 1MCZA 1R3UA 3IA2A 4EKYA 3ICOA 1V71A 3QYAA 5FLXA 1PEYA 1UR5A 3N1UA 5IAGA 5JANA 2C7OA 2W2NA 4L22A 1CQIA 3PQ3A 2RHJA 1MG0A 3UJ9A 8AT1A 1X80A 3UK0A 4JXJA 5F1OA 1JJAA 1PLKA 1ZK4A 2AJTA 5C32A 4DB2A 2WDPA 3FPEA 4OMDA 4YAOA 2NZJA 5DFAA 1APBA 4B6JA 3TSAA 2IX9A 4X66B 5B7GA 3LC2O 2QE7A 1A71A 3Q6MA 3T0IA 4NG5A 4B3RB 3Q1LA 2QXTA 1DOHA 2IXAA 3SHVA 3UC5A 1P74A 1LDEA 1R64A 2YZ2A 3AR5A 1GG9A 2HXYA 3B9BA 3CE6A 1Q77A 4RK0A 4LGYA 1OBHA 1X7YB 4GWGA 2G9NA 2Z5VA 4URHA 2J08A 2XUZA 4E4TA 1ZIXA 3UTCA 3GLGE 3K09C 2H1CA 4PNZA 4B6RA 3DP9A 3BMNA 5ERYA 3F5DA 3CS3A 3A3NA 3OJLA 3QOXA 4NS4A 1YJ8A 4ZO6A 1QYVA 4MWEA 4DGSA 1FDTA 4M87A 5JCPA 2QWXA 4PWYA 4NOMA 1ISSA 2WB4A 5BVHA 1BMDA 2RSLA 4O6VA 5K8JB 3KZ1E 3UFXA 2ZB7A 1AS2A 3PGMA 1KDRA 3HJTA 4ZU1X 3ZG6A 4DLBA 1JLMA 4X8LA 5LQDA 1KQ3A 1YB1A 3A6DA 3IV7A 5D84A 2KS6A 2CHUA 3B3QA 4QBGB 4U7GA 2HJSA 4ODIA 1WXFA 4LG1A 3R8CA 1Z5ZA 1U8CB 4FYPA 3D3EA 1DWUA 3STWA 1HA3A 1PZMA 4DLUA 4GRIA 2EEPA 3ENZA 2ZBVA 3WB0A 4HY3A 5AJXA 3N39C 4H3HB 4JOCA 3MMXA 5CDSA 1SB8A 2YY6A 3K72B 4TTPA 5B3AA 3ACBA 1HH4A 4CLXA 4ZGBA 1SHZA 4AXBA 3FBWA 4ZYXA 2Q28A 4EHJA 2BISA 3R5FA 4YO7A 4DMCA 2HRCA 4P6VF 5EIBC 4NAHA 1UAYA 1D1PA 2Y76A 2PUTA 4I4CA 2WAOA 3G9XA 2JFXA 5JCJA 5K9ZA 3NWOA 3PS9A 4G0NA 3KWMA 3GAZA 1TD9A 1R6XA 3TG2A 3B3AA 1VHQA 3AKDA 3BIWA 2A3RA 3M33A 1TM4E 1UC4B 3DZJA 4ZOBA 2PMCA 2VTDA 1N0WA 3EFEA 3PYMA 1PDWA 1UMDB 4GYKA 4TV8A 4QQNA 2RBKA 2IRWA 1N1EA 4UM7A 1WPGA 3RE1A 3SJZA 2VZ8A 1E8DA 4JLNA 3O4JA 5DNEA 3KKNA 5E6UB 1G4AE 2QM8A 4MAFA 2ZCJA 4ESHA 1PT9A 5SZJA 4CCAA 2XCLA 4B6GA 1VIVA 1EGQA 4NBKA 2DPXA 2IBSA 3L8GA 1CQJA 2BC9A 2LD4A 2OVBA 4ARAA 2MHCA 1JFFB 1AQIA 4HFMA 3VU8A 3ZU2A 3FOFC 1QYRA 1AG9A 1O5OA 1MABB 1TUGA 1ZZEA 2J6HA 2OORC 4RD1A 2VNJA 1ESZA 1ZMTA 2WTNA 3PUWA 1XLUA 4IEEA 3HJRA 4FCCA 3IOEA 3M6IA 2CXOA 2HT6A 3RI3A 4DSZA 3O2NA 1N6RA 3EGOA 3NKVA 3O1IC 3QE3A 1GZ6A 1CIJA 1LZKA 4MLDA 1BKYA 1QHXA 4R2IA 4RSHA 2I87A 5JNWA 2YV4A 3QUAA 3TZQA 1AT1A 5DGIA 5AK4A 4G4GA 4N39A 4X94A 3P71T 4PRZA 2I9PA 3T3DA 3AKCA 4V0LA 4MI3A 3HTXA 1TM1E 4IYRA 4E13A 3UHOA 3ONWA 3QX3A 1E2JA 4OI0A 4E14A 3HKEA 1FX0B 2VEOA 1KI6A 2Q6LA 2ZIEA 2ZYRA 3QFRA 3TOVA 4Y9SA 2ZKLA 3VTKA 2H29A 3H83A 4ED9A 3UFBA 2QQ5A 2HPHA 5DHPA 1JLSA 1N0HA 2WNSA 3IX7A 2EV9A 1OR8A 1QYCA 1SXHA 5EFOA 3KKEA 4CQLA 2Q6OA 1CUBA 1PVVA 3A4MA 3AEYA 3E22B 5CRIA 1ZC3A 3NONA 1Y8RB 2WSMA 4AUNA 4BNMA 1B8NA 4DFDA 1U80A 2FCRA 2Z2IA 4HBZA 5IEJA 1MFZA 4E2ZA 1J42A 5TR9A 4OL9A 5CD9A 3PEVA 1PWHA 4JQZA 2XLBA 5IKOA 1US8A 4I5GA 3ETJA 3BAZA 3UOAB 1WOMA 1EHCA 2LP4Y 3CF2A 2AVDA 4CL8A 1E7QA 1NMQA 1YBHA 2O4CA 2PBZA 5DISB 3RNOA 3W8EA 5EJAA 2REQA 1JNYA 1QYXA 4WASA 4OQZA 5C3MA 3N0XA 1U11A 4L4XA 3TMKA 1E2LA 3G2JA 4NYMR 1RXCA 4RVNA 4IV0A 1SWWA 3I76A 4M8IA 4XDGA 5ESRA 5ARCA 3ZJTA 3S0JA 4EEXA 1V5WA 4JGGA 1V9SA 3QFHA 3E9MA 1Z4KA 2J3QA 1XVUA 2GPYA 3PHJA 4MIKA 4FDMA 4YC7A 2P8SA 3L1KA 3ROGA 2VJMB 1FTGA 2DHQA 2GZRA 2PHZA 3G7UA 1AQ6A 4XQCA 2VWGA 4OA5A 1F8GA 2MDTA 3RAGA 3GMIA 3M70A 5EJ7A 3GQBB 5KQMA 2J8ZA 4OYYA 5KSOA 3QFSA 3GCDA 1JXMA 3QUTA 3TEFA 2KBEA 2WTXA 5BPHA 2G0AA 1SK8A 4LF6B 2XZTA 3OMWA 4YJHB 5ALVA 1BJTA 1B76A 3F74A 1L4BA 1NATA 4WIAA 4IJKA 4JI7B 1BOFA 1U99A 2FXIA 3DL7A 1GPLA 1K6EA 4XEHA 3AVXA 1R10A 5IT9A 4LYGA 3DMNA 3OZCA 5GONB 1FS5A 3VSAA 1ISFA 1OFVA 4KZKA 1A0OA 4G8BA 2YW2A 2PMEA 2GRJA 5TIIA 1DO2A 3D6VA 1N5KA 1AF7A 1JDJA 1G5PA 1LC0A 1M34B 1QV7A 1TVCA 2G80A 1JKJA 2FPIA 3OF5A 4KQ6A 4Y9TA 2BKAA 2XQKA 3A9VA 3TLCA 3CCFA 4X61A 1Z73A 3AM4A 3GH3A 1CY1A 2XJ4A 2FF7A 4QRDA 1V41E 5HJ7A 5JFTA 3CEPB 2LKDA 2JAHA 5I3ZA 3AJ8A 3T95A 1N3LA 1C7FA 4IDBA 1TRKA 4C01A 1F17A 3AL2A 1WZ2A 2X58A 4C2UA 3I9JA 1X1QA 1WBBA 1T8RA 2OCYC 1N5RA 3U7QB 1IYZA 1EVZA 1DFHA 1UMCB 3QLJA 4LSZA 4BMOB 3GRKA 2IUEA 2PBFA 4UEOA 4JZYA 1ZGJA 3LXUX 2Q7XA 2IYOA 5ESXA 4Z4HA 1EFLA 4AIRA 1SA0A 2PD6A 3LOPA 3VPDA 3HRKA 2NAPA 2HCFA 4XJSA 3ZCVA 1D6JA 1OBFO 1PTJA 3PPWA 3M82A 4V1CI 3BB3A 3GUZA 4ACAA 3AR4A 1KIAA 1RI1A 3F5QA 2WEKA 1YJ5A 2QU8A 4FCVA 2DQYA 4CQJA 2R7AA 2HLDA 2RGDA 1EVEA 1ZK0A 2QR3A 2GJSA 3DEAA 3FSJX 2OUKA 3H5RA 1M0SA 3OEHD 4ILEA