1NXXA

Micarec ph 5.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
114
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title MicArec pH 5.5
rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 40
structure length 114
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxxA00
4Z9AA 1TVMA 3LUCA 1XHEA 3VNAA 2FXIA 1AB6A 4TLLB 3DLHA 4ZPJA 4RKQA 2DRIA 3RVPA 1NXSA 4JB2A 2R48A 3OLYA 4RY9A 4E7OA 3DBIA 5BQ3A 4Z4EA 2E4WA 3K9CA 1Y1LA 1Z16A 4WXEA 2MYPA 5F64A 2H3HA 3JY6A 4MQFB 1RNLA 2PUDA 5FBKA 2FEKA 4MS4B 3LTEA 5HKOA 3RVSA 4YS6A 4MAAA 4KK4A 4RXUA 1P6QA 1USIA 1JX6A 3MMNA 1Z12A 5BR1A 1DCKA 4PE5B 4RK1A 4W5TA 3GWGA 5KI6A 2LBPA 3I42A 3DGEC 3QEMA 2PUBA 3GA5A 5JNVA 3SY8A 4MR8A 4XASA 4ETNA 5GOTA 1LBHA 5IEBA 5EWJA 3T6KA 3H1GA 5T7BA 2FQXA 5IBQA 2L2QA 2CHFA 3HS3A 5JS2A 4EYKA 1JWLA 1L5YA 3KCNA 1RPJA 1RZRD 1NXWA 1U2QA 4G86A 2FEPA 9ABPA 2M98A 4FE7A 4XFKA 1EFAA 3FFTA 1CHNA 2WJWA 3H6HA 4JP1A 3RVQA 3CG0A 3FFXA 3HUTA 3KLNA 2MSKA 2B4AA 2HJ9A 4GPAA 3HDVA 4MQFA 4O1IA 4H3KB 4HNRA 4LZLA 5CNKA 3HXMA 1DRKA 2IYNA 4YP9A 4MR7B 1E6LA 1W25A 1BVHA 4MS4A 4MPTA 1ZGZA 3EULA 3O2SB 4YCSA 4MGEA 1R8JA 5TPWB 3LUKA 5GQSA 3I45A 1RZRA 2L19A 1EWVA 5ED4A 5JNWA 1W9HA 4ZJPA 4Q6BA 4IRXA 4WT7A 1DBWA 5KQLA 3W9SA 4Z4CA 4MS3A 4YLEA 2YHBA 3LOPA 4RK6A 3OQNA 3QLVC 2FLWA 2FQYA 2WMYA 3KYJB 4N0QA 5I4CA 4NV3A 4Z4GA 3EAFA 3LFTA 3P9YA 4KREA 2XDYA 1OXBB 2VUHB 2BGGA 3O74A 3URMA 5TPZA 3ROTA 1MB0A 3CG4A 3H75A 3OLWA 1F4VA 5TQ2B 4KFCA 4TMYA 4F06A 3QEKA 4W5QA 4ZMRA 4IILA 2PUEA 2HSGA 4Z4FA 1MAVA 5DLEA 3FDFA 4MR7A 4WXMA 4IMJB 5HM6A 1RXEA 1DC8A 1GLGA 4KK3A 4H60A 1P8AA 5TE9A 2LP4Y 2PLNA 3HVRA 1DBQA 5TPWA 3GV0A 3CZCA 2OQRA 2JBAB 1Z18A 1E2BA 3RVJA 1E6KA 4KVFA 1C4WA 4EVRA 2IKSA 4P1ZA 4YO7A 1JYEA 4P98A 2E4VA 4TN5A 4MRMB 3RVNA 1JHZA 4W5RA 1NXTA 1ZHHA 1ZITA 3QLUA 1JH9A 1DRJA 4M88A 4XLTA 3TMYA 1M2EA 4JA2A 1ZESA 5IUJC 2L17A 3FFWA 1DZ3A 3HZHA 3CU5A 1GUBA 3IPAA 4LRQA 2OENG 3RH0A 4LDZA 3QX9A 1D2AA 1M5UA 1VLZA 5TQ2A 1CYEA 2FLKA 2JVKA 3O75A 1M2FA 3CTPA 1BDHA 5EWMB 4HNSA 4L4UA 4L85A 1QPZA 2F8TA 1OXKB 3A0UA 1JFVA 2JCGA 2ID7A 2JVIA 1APBA 3QELA 4OLBA 4H3HB 1USGA 3MF4A 3NHMA 5KQPA 2JBAA 3C3MA 3MIZA 3CFYA 3NNSA 4KZKA 3H5LA 2A9RA 1DG9A 5BRJA 5ABPA 4MR9B 3H5IA 3N0WA 4DADA 5DTEA 4MRMA 2PL9A 3KJXA 3O1IC 1ZDMA 3K4HA 4MYRA 1KRXA 3H5VA 4RK7A 2PAFA 2GI4A 2MYUA 5PNTA 2MSWA 3IP5A 4EVSA 3RQIA 2H0AA 1S8NA 1PNRA 4G0YA 4F3TA 2PKXA 1D4ZA 2E4ZA 3RVMA 1ZY2A 4DN6A 1Z13A 2FTKE 1LBIA 2QV0A 4Z99A 2RJOA 1K66A 3N6VA 4KRFA 4HNQA 1ZAYA 4MS1B 1BA2A 2RGYA 2L18A 2P4UA 5EWMA 3KG2A 2NUBA 4RWEA 2I6FA 5D2CA 5DGCA 3EQ2A 4Q6WA 1MB3A 3OLZA 4G0ZA 3N8IA 1Z2EA 4ETMA 3HM9A 4QYWA 1P2FA 2IPAB 2X7XA 4KNYA 4G0MA 1SXIA 4Z0NA 4KPYA 1H9CA 2PUGA 5JNSA 1DC7A 4MR9A 5IC5A 1DP4A 4S05A 2RDMA 2TMYA 3NNDA 3F6CA 3F73A 3QX8A 3T8YA 2CWDA 4F11A 1DCMA 3LUGA 1JL3A 3KKEA 4QPJC 3OQOA 2ZWMA 2KYRA 1MVOA 3OO0A 2QZJA 1U0SY 2VUIB 2PUAA 4O1HA 4G0PA 3GL9A 1LK0A 1NXOA 1MIHA 3LUJA 3A3KA 3H1EA 1EWKA 2PJUA 3OM1A 1DJMA 5DKFA 3CKMA 2PE5A 3SG0A 3CLKA 1U8TA 4G0QA 4RZSA 1NTRA 1C0EA 2MSLA 4MLDA 1E6MA 4N0PA 2JRLA 4MLCA 4QICA 5CNJA 2QR3A 1YS7A 1JFTA 2CD7A 1ZN2A 2R47A 1AB5A 3CHYA 1TM2A 1QP0A 4TLMB 5JS1A 1QNLA 1A2OA 3E61A 1U04A 5IUNC 5DCLA 1P6UA 4LE2A 1NXVA 1QO0D 4RK0A 1WETA 4S04A 3A10A 2IOYA 4F8JA 3JVIA 5FWYB 2LIVA 3BBLA 3TO5A 1QKKA 3T38A 2P9HA 1GCGA 3RVRA 4Z9BA 3MA0A 4XAQA 3E3MA 4KQCA 4PICA 5HQJA 4D6XA 1J56A 4OTZA 3Q7RA 4KV7A 1DCFA 3RVOA 3C3KA 1F51E 3KYIB 1QP4A 3GRCA 1ABFA 2QU7A 3R0JA 1URPA 3O2QB 1IIBA 3H1FA 1USKA 1JDNA 1QO0A 1YK1A 4ZMSA 4JOQA 5C5EA 4Y9TA 1BDIA 4LE1A 5JNUA 1A04A 4YWHA 1SXGA 1YIOA 3C97A 1M5TA 1UDRA 3UK0A 4N76A 4JASB 5IX8A 3M6MD 1LJUA 3N53A 5B3JC 5FWXB 2NT3A 4EUKA 4EY3A 1A0OA 1DBPA 3LUAA 4MQEB 3CZ5A 5EWLB 4IGAA 1JBEA 2HQRA 5FWYA 2MYTA 1KRWA 3MYYA 1JDPA 3BRQA 1XHFA 1YS6A 3Q7SA 1ZVVA 3SQNA 3S99A 1D1PA 3HEBA 4O5AA 3TX6A 2ZAYA 2WY2D 1PEYA 3N0RA 3A0RB 2J48A 5TQJA 5FBHA 3CRNA 3JTEA 1XWWA 3ILYA 2FMKA 2M1ZA 3HCWA 3FMVA 4D74A 1Z17A 3D8UA 3M9XA 4LDAA 2PUCA 2WRZA 4N47A 3H5OA 3QLUC 3T95A 2HQBA 5HSGA 2JB9A 1QQAA 2PUFA 3DGFC 3OQMA 4F12A 3GYBA 4WZZA 4ZYLA 3UKJA 4FB4A 2FEWB 1VKRA 3NBMA 1FSPA 5FWXA 2FW0A 2NT4A 3I09A 1FFSA 4RKRA 1PNTA 3D02A 3GT7A 3L6UA 3HUUA 2V0NA 5EWLA 5C5CA 4Z4HA 4RK5A 4MR8B 1SXHA 3SNKA 1EHCA 1FFWA 4W5OA 4GNRA 4IF4A 1I3CA 2GWRA 1GUDA 1K68A 1ZH2A 2FSPA 3QLTA 4RXMA 1LJLA 2Q5CA 3Q41A 1TLFA 3LKVA 3EQZA 3SM9A 5KQMA 3JPYA 3IDOA 3L49A 4RXTA 5IULC 1D5WA 5CNIA 5KWSA 4RSMA 2R4QA 2WB4A 4OATA 2WWVD 3OLVA 3GBPA 3OMXA 1VPWA 2N9UA 3TB6A 4YR7A 4RS3A 4IMIB 4N41A 1EWTA 2HQOA 2IPMA 2AYXA 1CEYA 2HPHA 2FN8A 3I5AA 4RY8A 2FMFA 4UHKA 3JVDA 4FE4A 4NCAA 5CNMA 2QSJA 5CHYA 4JB0A 4DQDA 3GBVA 2GBPA 3Q7TA 1FQWA 2IPLA 4YRZA 4RDCA 1NATA 4HYEA 1RXIA 3HJFA 1ZH4A 4MS3B 3KSMA 2GKGA 1KGSA 5KC9A 4WUTA 4NQRA 4UHJA 4OBBA 4XARA 3LUHA 4PEVA 5KQGA 5T3YA 4MS1A 3KHTA 3NNNA 1Z25A 4W5NA 2E4XA 2FN9A 3QLVA 1TMYA 4OG2A 1JYFA 3M9WA 1NXPA 3HV2A 1YMVA 2IPNA 3QK7A 1D1QA 1QP7A 3LKBA 3RVLA 3HK2A 4ML3A 7ABPA 2NZVG 4D6YA 2A9PA 3F6PA 2W42A 3F7NA 3IP9A 3TD9A 3ROFA 2E4UA 2IDMA 2CHEA 2WJAA 4RV5A 4PZ0A 1JLKA 4RY0A 5BRAA 4Z4IA 3C6QA 4G0OA 3SAJA 3BILA 5E3JA 5TPZD 3IPCA 4N03A 1PUXA 3H6GA 3O1JC 4XXHA 4G97A 2VK2A 3O1HB 4EYGA 4E7PA 2F8SA 2QVGA 1L5ZA 3LMKA 4QYMA 1NXXA 1EAYA 3G85A 2A9QA 4KMRA 2VYCA 5KC8A 2PMCA 5JNRA 3HSYA 1ISRA 4YGXB 2AYZA 3HO1A 4Q7EA 3O2JA 2QVCA 1ABEA 8ABPA 1Z15A 1HEYA 2B1JA 3Q15C 3HDGA 2FQWA 3KTOA 4YV7A 5B3JA 1SD5A 2NZUG 1Z2DA 1B00A 3EJWA 2QXYA 3RVKA 3MQ4A 3OM0A 4CBVA 4KQ9A 1PEAA 4NICA 4WWHA 3N0XA 4PYRA 3MM4A 3N75A 4RK4A 5IEJA 1GCAA 1Z26A 1YTUA 2FKAA 2JVJA 3FGZA 3DZDA 1YMUA 2FMHA 2RJNA 1PHRA 2YHAA 1BAPA 3C3WA 3EDCA 1U2PA 3LUFA 4EVQA 3EGCA 3UUGA 5IUKC 3QELB 4JAVC 4RU1A 2R25B 5TQ0B 2MYNA 1KMIY 2FMIA 3CNBA 4LX8A 4B09A 3EODA 3OO1A 4G0XA 3ILHA 2A9OA 2E4YA 3BREA 3Q9SA 6CHYA 3OLXA 3BRSA 3KS9A 2O20A 2ID9A 3IP6A 2PL1A 2QW1A 2JK1A 1VRVA 1YK0A 3CS3A 4EGSA 3DLBA 3KLOA 4ETIA 4OLAA 1QQBA 1QMPA 2FVYA 5JNTA 4EYQA 1BDJA 1ZGGA 6ABPA 3O21A 3VNBA 2LUOA 3B2NA 3JPWA 4LE0A 3IP7A 1FFGA 3OMWA 1NY5A 1SRRA 4MQEA 4EYOA 1TJYA 3H5TA 1T34A 3QEMB 1ISSA 3JS5A 3G1WA 1JFSA 1YVUA 1JF8A 2LPMA 5EWJB 5TQ0A 3H5WA 3NHZA 3LUDA 2GX6A 4NCBA
chains in the Genus database with same CATH superfamily
1ECJA 4QDUA 3CZMA 4ISCA 5CYPA 1N7JA 1XZIA 2B4YA 2LCQA 2PLFA 3OLYA 4Z0TA 4AY3A 1VHJA 1AK1A 3OG9A 4GH5A 1KJIA 4B31A 4TLBA 1RRMA 1XZPA 4TVKA 2SCUB 3AX6A 4C76A 1KZGB 3QKRB 2NZ8A 1DJLA 1P4JA 1T3SA 5F64A 5FO1A 2H3HA 2PTGA 3WAKA 2C42A 3LSTA 1DJQA 1XZMA 3COYA 5JFOA 1RLUA 4I66A 4C05A 3PD7A 3PYLA 2FEKA 3JYNA 4JP3A 3R8FA 2IE0A 1KOFA 3ND7A 1EUQA 1D4FA 2CB9A 2Z2IA 3CF2A 3GYGA 1N5OX 2V5UA 2H4JA 1Q7RA 1OILA 3H1PA 4CTNA 2ZE8A 3PUVA 5CXXA 3CT4A 1Z12A 1J2EA 2BFBB 2HV9A 4UASA 3RS8A 4TOIA 1JECA 4AULA 5B12A 2FWRA 5IKXA 1SKAA 1ZEJA 2IYTA 2JAXA 3QEMA 4Q3LA 4M98A 3H2YA 5KJEA 2DH6A 4B6SA 4DLUA 1QR6A 3SY8A 7ADHA 3PFKA 1O03A 5LP6F 1V7QA 5K0FA 1K8YB 4UZEA 2PYDA 1PP4A 3UJNA 1EQ2A 3NAZA 3HS3A 4P3NA 4ZCIA 1IQPA 2XCUA 4WK6A 5G3ZA 4ER5A 4HDSB 1EVLA 4BMNA 4MV7A 5EKDA 4R1OA 3IJPA 1U2QA 4CCYB 4R7ZA 3H8WA 4E2FA 5CD1A 1EFAA 3FFTA 2I7VA 3Q12A 4TT3D 1WHTA 3W5IA 3INRA 4KQWA 1G5QA 2IELA 2YV3A 1E2DA 1JR3D 2XMRA 3EWSA 2CL6X 2P5UA 1JG7A 1N8TA 4F3YA 1CEXA 1N8NA 2NXCA 4I2NA 4TRJA 4IIBA 3QVMA 5AW7A 4YP9A 3TUIC 3RKUA 1W25A 3W05A 3MJ4A 5CJJA 4MS4A 4CEIB 3DWIA 4MB6A 3UJ7A 5H4GA 4BFTA 3P26A 1MZPA 1CJTC 3PVZA 2P9TA 4TKUA 5GQSA 1KQGA 1NVXQ 2XQIA 3LF2A 4YAJA 4BNWA 2OUIA 4LSZA 1B16A 4S0ZA 2A30A 1OROA 3L46A 4R2WA 3UWOA 2DFVA 5CEFA 1CQJB 5LQMA 1FTQA 3DT6A 4UUPA 4EPXA 3TTUA 2JFGA 4BZXA 3EDMA 2OQIA 5A4IS 5DO9A 3T7IA 2GN4A 1XMXA 2BFAA 3E05A 3F3SA 2XNKA 3H2BA 2GRUA 3IE0A 3SCZA 2AG5A 4KZPA 2A8YA 4AECA 1PW7A 1M2WA 1A72A 3WL7A 2XUGA 3KEMA 4G9BA 4HPXB 5ALUA 4GXRA 1NU6A 1EFKA 3MT7A 1JPVA 1XVAA 2JA2A 2Z9BA 3DV0A 3KJEA 3WADA 5ALGA 2GSWA 4CDRA 2IKQA 1DV2A 3N2GB 5HIAA 1Z0DA 3D4OA 5ALPA 1F48A 1JR3E 5K0BA 4F5EA 1MAVA 5E1OA 1D4OA 2VAVA 5EIBC 1SZCA 3IALA 3SDZA 3BSYA 4A91A 5CITA 1EFPA 5JCOC 5LVAA 1T36B 3ITEA 1F20A 5TE9A 1J1UA 2P6NA 4XWTA 1X7XA 2Q9AA 1SHUX 1EP1B 3I9JA 1KHTA 1SB8A 3IQEA 1OD6A 4CRWB 1E2BA 4IUCS 1E66A 5FIUA 4C4ZA 4JUCA 1XQWA 4DCNA 2WWWA 1PV1A 4ETWA 4XWKA 4XEHA 2OQ2A 1V4BA 3QV1A 3NW9A 3BWXA 2HLDD 5A6SB 1WTCA 1DRVA 3L7YA 3HUFA 3NBZC 1B8UA 1MGPA 1THTA 1J1IA 1DEHA 3JR7A 3QLUA 3R5JA 1QWSA 4JT4A 4MZXA 1CZRA 2QMEA 5TXGA 3DFZA 4LDQA 3QVTA 4PX2A 5K5EA 3HPRA 5E8JA 1Z3IX 3PPXA 1XWIA 4QQ8A 2PHZA 3NKLA 5ESXA 2QUHA 3KSZO 1ZU4A 4Z54A 1XVVA 3MTAA 5B6PA 1BXZA 2I3ZA 4LGMA 1RRKA 4CUZA 4FFBA 3CTPA 3NBAA 3JAWB 3PEFA 4UBMA 5C4IA 1JQKA 3AF2A 1WB9A 3LPNA 3ZIAD 3A05A 4ESHA 3RU2A 2DKOA 2AC7A 1PQWA 4WNAB 4CKBA 2IS1A 2GBLA 2GR9A 1N0UA 1BXRA 5HDQA 5EJ6A 3PU6A 2ZANA 1O77A 3QVKA 3RU3A 1WXXA 4MR9B 3N0WA 5EUQB 4N6OA 4DVGA 2OM6A 4LMPA 1TM4E 4I55A 1WSDA 4RH0A 3TAXA 4E1BA 5JIBA 3RUEA 2IXFA 4KSBA 4R54A 3FVVA 4LY6A 1JHAA 4J7AA 4BJ3A 1R4ZA 4P6VF 4BV8A 4I8DA 3V42A 1NQVA 2IUTA 2HRBA 2ZR7A 1XF9A 2G1JA 3ITDA 5CAEA 4FDVA 4PSDA 2AZTA 3RRXA 4NEHB 5BQOA 3A4IA 4FOOA 2NXEA 4DRXB 4DN6A 2GZHA 5IF9A 4XOIA 1XN4A 4JSRA 2R62A 2RJOA 4TTRA 2Q1UA 4XWWA 1XTKA 4CTJA 1HORA 2ZYVX 1N6IA 3VO1A 2XGJA 3ICQB 3SC4A 3BK2A 3H9QA 2JJ1A 5AXDA 4G0ZA 4G26A 2EATA 1K2WA 5DGIA 4R8KA 3DSRA 5EZ5A 2B3DA 3TL2A 3AVYA 2J07A 4KWCA 2CE7A 3S70A 4JYZA 1T3GA 3K8OE 1V4VA 3G0BA 2FNAA 5BO5A 4KPYA 2VSYA 3K0FB 3NHRA 2EZ9A 3L02A 3CE6A 4Q9IA 3HJBA 2RDMA 4DMHA 3F73A 1C3VA 1P0QA 3BFVA 2PGIA 3FNFA 3TLBA 2PCJA 2AJLI 3G0HA 1DCMA 2NP6A 3RTDA 3GCWA 1TU3A 2HIAA 2BTOA 2ZDQA 2I7TA 1CS0B 1O95A 1ZC3A 3L6RA 3CJTA 2E5LB 4D0NA 1LK0A 1I7NA 4IHAA 1F8YA 4HXEB 1M74A 4HAXA 3PP8A 2ZUTA 2PSHA 1EWKA 4TXNA 1H3NA 1OC4A 1RKQA 2WP0A 1I3MA 3DL4A 3GDGA 4M54A 2PR7A 3L8EA 3NRBA 3QA9A 3SMQA 5ICCA 2P6RA 1YDHA 3WK8A 5KPDA 1UOPA 1ZYUA 4U2GA 3JZDA 2ISCA 1SCIA 2TYSB 4IVRA 3FVQA 1UFOA 2X4IA 4PZUA 4IUDS 4BNLA 1YZTA 3K3PA 1TE2A 2GPNA 2R84A 3D43A 3OA2A 4DV3B 4I4LA 2XNDD 2YN4A 3UBTA 2C7QA 1JJAA 1PV2A 1JSZA 1ULSA 2GD6A 3C15C 4YV1A 5AVWA 4X00A 2CK3A 1JKIA 3HO8A 3PENA 4URHA 4BGDA 1M1NA 3VKGA 1Q0UA 1E7YA 3NALA 4JJEA 2FSUA 4X64B 4NMHA 3Q3JB 1C8KA 3DPSA 5J5AA 1P6UA 1CP3A 1EDDA 5D3QA 3NMUF 4RK0A 4EA9A 5CVJA 2IOYA 3KOYA 3KYCB 4K6HA 2PJZA 2C07A 4DSZA 1HY3A 5AOCA 3EMVA 2W00A 3RSCA 3TTYA 3HYCA 2DQKA 2NG1A 3JQQA 3Q7RA 1Y5LA 1Z2CA 1NX9A 4G8CA 3TNFA 4A5SA 1XCMA 3BC1A 1E5TA 4PLVA 1M5RA 1XQ6A 1XG5A 2IHUA 4S35A 2PH5A 5K8UA 1AQ6A 4EMSA 5JVDB 3ETNA 5F7ZA 2V0GA 1Q3HA 3H1FA 1P2DA 5ALFA 4P80A 1FQJA 1QO0A 1AZTA 1WW2A 4JLAA 3AFIA 2OCAA 1GIAA 2RGAA 2HRZA 3USCS 1FQOA 3LQKA 5JD3A 4D4HA 2YHIA 3LF1A 4G09A 1CJCA 3GJQA 3MTQA 3GFOA 5AXAA 3PFGA 1Z4LA 1GKUB 2NT3A 4A6PA 3MBIA 2R8OA 1K7EB 4MHSA 3UMVA 1H4QA 1H2EA 3WGHA 3ELUA 1QHHA 2CNBA 1UM9A 2G9RA 1N2GA 2DBVO 3LP5A 4TS1A 1GT91 4Q9HA 1XMJA 3O8DA 1LSJA 4BBPA 4JUIA 1GQRA 1XHFA 1YOVA 4NENB 4PCUA 4Q4JA 1N3LA 1RQGA 2BMEA 2J09A 1OASA 2FZWA 1NHGA 1ONNA 2OPBA 3CR7A 1R0LA 1ZXXA 4MVJF 1Z33A 5DP2A 4D6PA 3OY2A 2EIHA 1HUQA 2C00A 2QL7A 1IIRA 4MLPA 1C8VB 3ZU5A 2X86A 3A0RB 1T2FA 3PDCA 4P35A 1SU6A 3CRNA 4Q0MA 1W5AA 3P0HA 4NI5A 1D09A 5FBHA 1JB1A 2BDTA 2WR8A 4LBZA 1ATZA 2V7PA 4L0CA 1T9CA 1SURA 2NO0A 3IEIA 2E9SA 3L40A 4OK6A 4GDFA 4HGQA 2EJWA 4G1CA 5CYOA 3WO0A 5KYVA 5J2TF 5D3MA 3AR6A 3EVNA 1GQSA 4URZR 1EESA 2ODBA 2LKDA 2VT6A 1E6WA 4HQOA 4PINA 1I7DA 2WFLA 1SPBS 3OKPA 1O96A 2BJVA 5AIAA 4CU5A 3QOFA 4F12A 4FB4A 6YASA 2QIPA 2XXJA 1N57A 3AESB 3I4LA 2G5PA 2QTFA 1HFJA 3I23A 3GQVA 4QDOA 4WCFA 3LLUA 4K81B 4UQOA 5SICE 3T9BA 5HUHA 5CR9A 3W1VA 4RZXA 1GL7A 2JBHA 4Q9JA 1X80A 5CFNA 3BB1A 2VYND 3IEMA 1NJ1A 2JI9A 4R0NA 3ILVA 3A28A 2J3JA 2HA0A 3IQDB 3NHBA 3C3JA 4ZICA 5AI8A 3GB9A 3K92A 3DXFA 3ZHTA 3T5AA 4BO9A 4XYEA 1SQSA 4EG4A 1Y7TA 3L49A 1QH1B 4ZO9A 1T4MA 4KBGA 5SZKB 1TCUA 2DBZA 2KJQA 1ENZA 1XC7A 4GX0A 4U63A 4EF5A 4F3CA 2JLVA 1ZINA 3HEAA 1Z0SA 1BXGB 1NDQA 1JQ5A 1LRLA 3QY0A 4PF1A 3RSLA 2AMFA 2ILTA 2X8JB 2Y4NA 3DMHA 3DNFA 3QXJA 4FIDA 4RS3A 3TB6A 4Q7QA 1SUCA 1L5SA 2WQ6A 4FYVA 1TYAE 2X2EA 1ZUHA 4XZ3A 1L7RA 2DFDA 3F5SA 2GEVA 1U3FA 2ROQA 2ZAIA 3EDQA 4JUAA 4B4VA 4BWYA 1TMKA 3HZRA 2ZRQA 4D5GA 1U0RA 1RXUA 3BULA 1B76A 2OBMA 4LI3X 4RFSA 1T15A 3NPAA 1AM4D 2B1QA 2NTJA 4UNRA 3WKCA 1C1DA 1DJOA 2W4MA 4HWRA 3H99A 4LECA 1PL8A 2MWMA 4EKGA 3KZOA 5EHNA 1NQXA 1E1DA 3CX7A 1VL8A 3X1KA 4PS0A 1NM5C 1L1FA 2XNHA 3IMEA 1SG9A 1CUIA 1AKWA 1Q1EA 4OMUA 5JPIA 1NNSA 5KINB 5IYZF 2I66A 3GEIA 1CVRA 4HRVA 3RD5A 3ER9A 1OKKD 3LOQA 2D2VA 2H7YA 3P2OA 4YMUA 1PZEA 1NI5A 3CRMA 3EPPA 2JFPA 5BRAA 5CDGA 1Y8ZA 3MTJA 1JH8A 3SZGA 1UDWA 4IHKA 3PK0A 2G9ZA 3BCHA 4M8LA 4ZEOA 1WV0A 2UUPA 3EXHC 1ORTA 4A82A 2HCJB 3TINA 1UPTA 2WWXA 5AK4A 4QYMA 1GLVA 1KYXA 2QMZA 5F2KA 1L5QA 1Y4SA 5IHXA 2PPLA 4PC3A 3DZKA 4LWPA 4V02A 5DBGA 2FG6C 1QYVA 2BIFA 1H1TA 1I2BA 1PLLA 4QZVA 3HO1A 1FRQA 1J2YA 1ABEA 1YQ9A 2WWRA 4RVHA 3KRTA 2DR0A 1Q83A 3L6DA 4HDKA 5THKA 1I3KA 4E94A 3EGDB 4OA5A 5EKXA 3JZMA 3GFGA 1QV9A 2GCEA 3D8HA 2PT9A 3RVKA 2PZKA 4F71A 1B2LA 5E6SB 1AVTA 3AU8A 1RCUA 1WA5A 4XYLA 1EFVB 4LC1A 1Z26A 1V8DA 3RTGA 3T99A 1BCRA 2RCNA 3UCFA 1SNYA 4AF8A 1NRWA 2VDLB 2FMHA 4QIHA 2BGNA 4AXBA 3P2MA 4GR9A 2B6NA 4G2NA 4OQNA 4UUBA 1JDJA 1K5PA 2BEUA 1IJKA 2H1FA 2XCTB 2RSLA 5JSZB 3OX1A 4CTOA 3DAHA 3FTQA 5DXAA 3ZUGA 1NIJA 5JCJD 5K01A 2QZPA 1AT1A 3N6RA 2K6GA 3DHVA 4ATNA 1CD5A 3UAVA 1MT3A 5DNAA 1QZTA 1K89A 2E4YA 3A1DA 4ALJA 1RBQA 1FLDA 1ZM7A 4Q4CA 5K6TA 1X70A 4LEIA 2PL1A 4RIGA 2BSXA 5KTNA 2RGRA 2VQSA 3I39X 1I2MA 5DW0A 2RG1A 1U1CA 3D7LA 4GLFA 3BIOA 3GVXA 4AJ1A 4EOGA 5IK2D 4Y6QA 4DLXA 3AJRA 3A36A 3Q9NA 3U80A 5GGYA 3ZE8A 3THOA 3JVUA 5TLSA 2ZZMA 4DNQA 1KFBB 1A4XA 5CBKA 1U0LA 4C4AA 2QMHA 1RJEA 3KU1A 3PD0A 3QPWA 4DIFA 2AS0A 1IEXA 1XTZA 1NQAO 3L1VA 4J29A 3RW9A 2AGVA 4HAOA 1WF3A 4OHUA 1KYYA 3C48A 3O7MA 4OGGA 1E9BA 3FMIA 3ZE1B 2PZ8A 3JQ6A 4CLDA 3TQFA 2EQAA 5EWJB 5TQ0A 3VSBA 2VDWA 3PI6A 5EESA 2A3RA 3TW6A 1YF3A 3G9TA 4CI9A 1R4MB 2ERYA 3K72B 1REQA 1TVMA 4OP3A 4J07A 5GVSA 2HMVA 2PFGA 4JJKA 3RO7A 1NXQA 5A5VA 3RRZA 3VV3A 3HLKA 3UIEA 3TKYA 4RKEA 3NP7A 1DDIA 2G08A 4OP1A 1IEWA 3WR5A 2XYGA 2FN3A 3QIVA 1FX0B 1G8SA 4AW9A 1C29B 2VR1A 1RLTA 3D7KA 4F4IA 4KR7A 5CFPA 2FH5B 2ODAA 3ELDA 1E3TA 2OP1A 3F8SA 3RKSA 1HO3A 1JDVA 1U0FA 1KJJA 1COZA 2IYXA 3RQSA 4LSMA 4U2EA 1Y82A 3C3CA 2AJTA 3EXEA 1UMBB 1Z6TA 3R9WA 1NVTA 2XMQA 1UIMA 1EE9A 4DDVA 5EKTA 3TR5A 3PFCA 4KLCA 2GAAA 1HOTA 4J0GA 3VNRA 4GGPA 1XZKA 2ATIA 4MH0R 1A8UA 2C4HA 4XASA 5EPUA 1RYYA 2FUG6 5T7BA 1G38A 3NFRA 4PAWA 4RLHA 3P9QA 1ZD1A 2B5OA 4H0NA 4MX8A 5ENDA 4D1YA 2HC9A 1Z2NX 4WNIA 3WLAA 4HDMB 3KCNA 1Z2OX 3Q4GA 4C7XA 1QE0A 4GIBA 5JFTA 1ZGCA 3EIQA 3AR7A 1XNGA 4RFLA 1NQOA 3WV5A 1IZ0A 5K6AC 3KOOA 1G3IA 3RVQA 3CLTD 1GILA 5DSXA 2FPPA 1CZNA 2C3UA 1L7MA 2BRUC 1E18A 1TM5E 3AY7A 1WABA 2NTYC 1UP4A 1SVLA 2VYFA 2R11A 1VLQA 3CX8A 3MPOA 3OWHA 4KBYA 1QNFA 5CNKA 2IYNA 3SEFA 2WG1A 3OVMA 1ZD4A 4QDKA 4QJ4A 4WNYA 1YNSA 1VMDA 1LZKA 3L05A 2HMTA 4XWGA 1K0UA 1THMA 5H59A 3J81A 2HRDA 1R8YA 4NG4A 4KQXA 1KR5A 5AVZA 2I8AA 2Y1FA 1ML4A 3GJ8A 2IYWA 4NNJA 1L4GA 4TT3A 3K5PA 4QLOA 4L5JA 1KZ6A 2EJUA 2P90A 5A4MS 2GARA 4RO0A 3GR6A 4M83A 5T3UA 2P1DA 3IVMA 1JR3A 5HFAA 2HBRA 2GK3A 3IT3A 2CDRA 4O59O 2YQ5A 4ENRA 1C3XA 1ZD5A 2QTAA 4FCVA 1NQTA 4RA9B 4TRNA 3PUHA 2QTTA 4LJKA 3FUUA 3WL5A 4B6FA 2QM3A 1DLIA 4ACBA 4CL8A 1ZMTA 1RPZA 3ZGNA 3QNMA 4BLOA 2V58A 2C7VA 4MYDA 3B6ZA 4JELA 2ENUA 5LR6A 1WXGA 3DHEA 1QGYA 3DV2A 1UKZA 4WOCA 1G6Q1 1SCAA 1J7JA 2G25A 5D5HA 5H7XA 2PUEA 2BZSA 3F1LA 1IC6A 4L5YA 5G1PA 4OX9B 4P7JA 3WIOA 2BMVA 2XOEA 4I3GA 4LMAA 5KDLA 1R6VA 2YV1A 1J2UA 1D7AA 3GHYA 3QLEA 2IUSA 3UA3A 5JY1A 1WXDA 1N6RA 1M75A 1EX1A 2A1TS 2C4TA 3G2MA 2ZSFA 2DHRA 4G4SP 4PWYA 3VX4A 3BFPA 1K9VF 1Y6FA 4UAJA 1UBEA 3LY9A 4YO7A 2X7HA 5AM1A 2O8NA 4NE7A 4TLCA 4ARZA 1RXYA 2H92A 2QI9C 2ZYTX 3K9BA 4ZEVA 5KSZA 1B93A 1FTSA 3CKYA 1E3WA 4EIWA 4DLWA 2G80A 1LC0A 1X7WA 5JZOA 1U8EA 1OZ0A 3FB1A 4ZVVA 5C3MA 1YRHA 3QF7A 5DLYA 3E2IA 1DZ3A 3MJFA 1ZGHA 1GCOA 4BP3A 3K09A 4LRQA 3ZV3A 5CDYA 1ISGA 4FM9A 1XXHA 2C4VA 3PX3A 1P1FA 3UFXB 4CYMA 4YJFB 4V24A 2AOUB 3S0JA 4BFXA 1PS8A 4BCBA 1PKEA 1QORA 2NO1A 2GJKA 5FEMA 3T61A 2OCBA 3D0QA 1U98A 2YBEA 4YK7A 1G3QA 3IJRA 1FNCA 2PV7A 2W48A 1SB9A 3Q6NA 4HS9A 4L15A 1Q84A 3WB1A 2ID7A 3P5BA 3I1JA 4WFKA 5B3JC 3DE7X 3C85A 4TS4A 4KFSA 3LP8A 1QS0A 1HTTA 2A9RA 2CE2X 2E6KA 3E70C 5DTRA 4GRAA 4AQDA 3B1XA 1CYDA 5J40A 1BRTA 5CX1B 4GMDA 3THYA 3KQOA 2NAFA 1JTVA 3MRTA 4MP6A 4NYJR 3DB2A 3C3YA 5CXQA 3O31A 1TKCA 2OV2A 1BWSA 1PW5A 2O57A 3MCVA 4KR9A 3LAWA 3W5SA 2WMNB 4FHEA 4LBVA 4ENWA 1RAGA 2P4EA 3PHJA 2MYUA 1PR4A 2C5EA 2ZB8A 3I9MA 4DMGA 2WAAA 5A1JA 2H0AA 2C92A 5A4DA 2VYVD 2PKXA 2WPNA 2PXHA 4M8IA 3EW7A 4HB4A 2D2XA 5AKHA 5BUQA 1FP1D 4HUJA 4BC1A 2HM7A 3CNLA 3WICA 2D06A 4NOLA 3E2PA 5EWMA 3ANYB 5I9BA 3W8EA 4O4IA 3REOA 2GXSA 4Q6WA 5FBWB 1NE7A 1NBIA 3BGOS 1PQYA 2OFWA 1CY0A 5FO0A 1FZQA 3QVJA 3E03A 4HNAB 4HFMA 4KAXA 4Y18A 2XTAA 3ETLA 3MVEA 5JWHA 2E48A 3G0DA 4OAPA 3WA7A 2VVTA 3NC4A 4HZUB 4UPVA 5JWRA 1QTRA 1FLVA 3LQYA 2AFIE 1ENOA 4IV0A 2IX3A 3PR1A 2HRRA 3QX8A 1G7SA 5KSOA 1NLUA 5THXA 2XXAB 1P62B 1PUJA 4HR7A 4IIYA 2E55A 3ED1A 1FMCA 1SQFA 4EPWA 3FB4A 1HE8B 3HXLA 3VZQA 1JA1A 3SBOA 5AD1A 1KH2A 3R3HA 1UZNA 4D9KA 2GYVA 3H1EA 3BA1A 5D6NA 3NCTA 4B6QA 1HMYA 3THWA 4QFDA 1L8QA 2PJUA 2YASA 3NAMA 2QORA 3PNLA 4KJXA 5KNCH 2FPOA 4RULA 5LB4A 3FR8A 2ZRIA 3FBWA 4D4IA 1T4CB 3PD1A 4H1TA 1II8B 2EFYA 2NWQA 4WJZA 5DWVA 2C8LA 5I7EA 4I9GA 3R20A 4NOKA 2QBYB 2J3KA 1C4OA 3KEFA 5C2JB 2WT8A 4GSKA 4EPVA 1U7DA 4RPJA 3E35A 4PLGA 5DULA 5B7QA 4ZZ0A 3SDSA 4JXJA 2R96A 5A9SB 3VPGA 4NBSA 1NVEA 4TTQA 1BMDA 1V11A 5I3ZA 4ZCLA 4DBVO 2V4MA 1V16B 3HHPA 3ZHQA 3DUWA 1MMFB 2I6GA 2ZYWX 4FN4A 4JEHA 4L8VA 2J46A 5CA1A 5CB8A 1WETA 4FYYA 1JHQA 1GXSA 1F06A 1O89A 1SN7A 4DIKA 1FTYA 4QUAA 2O2EA 1VLLA 3GAZA 3FVRA 4GOOD 1N2HA 3V4OA 3AZPA 4BVFA 1V7PC 2ZB2A 1OLUA 3LDAA 4PXSA 1GY8A 1M8GA 2PANA 1QP4A 5CCDA 4LHZA 3VKFA 2G7ZA 2QW0X 1LLQA 2EP8A 3WL6A 3H1BA 3K0BA 5HQTA 3I61A 2OCKA 3ENQA 3PIDA 4WLNA 5IS2A 3CKKA 1OV6A 2FPWA 3MJEA 3RREA 1GU0A 3C0KA 1DADA 3CPEA 3OCJA 3AI7A 1Y33E 2SKCA 3HWRA 4LNUA 4ALIA 4M4SA 2I76A 5I7SA 1NMZA 2GF9A 5E1BA 2JDIA 4UKDA 4BCCA 1R8XA 4GYYA 4QQNA 5T6BA 3VI4B 4FZ3A 1PWYE 1JDUA 2O3JA 5EVJA 4B85A 1J0DA 1K75A 5C46F 1YJAA 3Q72A 2FZKA 3U4HA 3R9XA 3D0KA 2GFIA 4FQ7A 4RBNA 2GERA 3D4IA 3LUAA 4Q4DA 4WFJA 1YUBA 4E11A 3L0PA 3E5RA 2X8BA 1IXSB 3R77A 3UGQA 5HK9A 3V8VA 4BVJA 2R8EA 1QSGA 1NUQA 3BRQA 2QRNA 3W6ZA 1PR0A 3LVRE 5ITSA 5JYEA 2QRMA 2UAGA 2F67A 3FN4A 3SHTA 1JEYB 1I2CA 3FLBA 3DTVB 2JGFA 3NT4A 3KVNA 4G5QA 4NRDA 4P2BA 5AJHA 7AT1A 4FGUA 1RQXA 2O2DA 3K5IA 1AU9A 2P27A 3FROA 3ND9A 3KSDO 4B74A 1HK7A 5BSUA 4LDAA 4X63A 5HBRA 1TU0A 4OO3A 4RLFA 1JEEA 4RTRA 4HPWA 4ND5A 1PFKA 1L3BA 3ES9A 1D8AA 4TL7A 1OB2A 1GPH1 2JW5A 1M2KA 1P60A 1P5HA 1FK8A 3BZWA 4BEJA 4FONA 3J7AC 4OFZA 1QBKC 3P2EA 4AZ3A 2H2AA 4NC9A 4F60A 2CZQA 3G2IA 3T0IA 4F56A 2VL7A 3EZ6A 5E95A 3ZCQA 3HUUA 1V3QE 4ZZ1A 1EWRA 4BVAA 4GYKA 1XTJA 2QTVA 4UE6A 2ATXA 2OCPA 4DYVA 4JJ7A 3ZBTA 1K68A 5ALHA 2OO5C 4ER3A 1W1UA 5GZ1A 1Y5IA 2GBGA 1L4FA 3CMMA 1FX1A 4FOPA 5EZ6B 1TCVA 1FDVA 5A3QA 3AM4A 1M7BA 4KC0A 3JPYA 1NW3A 4NEQA 3H9CA 4MDEA 2BHNA 3T12A 1XRQA 3GQBB 2WB4A 2BHSA 2UZ0A 1I0ZA 4G1FA 3VSAA 3GLIB 3D6MA 2I0FA 3HBAA 4IHJB 5D3KA 1BD4A 4HRXA 3WMWA 3ZEAA 4D45A 1Q0TA 5ENVA 1RXVA 5CH3A 1KI6A 2PMWB 2ZB4A 3TLAA 4GF5A 3SF0A 2O2IA 2XE7A 3EGXA 4ISBA 1U7OA 1DKPA 1RMYA 3TQIA 1UBGA 5BN5B 3QPCA 3B85A 4FE4A 3VC2A 2V6FA 4UBNA 2P8SA 5CNMA 5CHYA 5I4KA 2CL0X 2AJDA 5EAIA 2ODNA 1WF6A 2H4FA 2H0QA 2RG7A 1OF1A 4I14A 3SHFA 3HJFA 1XEXA 1QTNA 3Q8MA 3QFFA 4YXFA 2IFTA 1YAJA 3LLMA 1PJRA 2QD4A 4PEVA 1DJPA 4L4XA 3ROXA 2WTBA 1LPAB 3LQ2A 3DBOB 3F3KA 1RYNA 2PQ2A 1UJ5A 1S3GA 5JDCA 3DAPA 3R0QA 1JHVA 1AF4A 1SXJD 2E4XA 2C8VA 4OG2A 4RVDA 5JS8A 3WYGA 1SQ6A 1WCV1 3CUSA 5IC6A 3GEDA 3RF6A 4R3WA 2C2HA 3BWMA 3U4DA 4GYJA 4M76B 1WOYA 4OU5A 3R7NA 1V8ZA 3BEOA 3P96A 4J4HA 4FHZA 4KGDA 5ERYA 3X44A 4DC0A 2VWPA 4QHTA 1R9GA 5ER6A 1TYBE 1W2GA 1XTVA 1P29A 3ZWXA 3AF4A 2E4UA 4YHBA 3ZC3A 4IIJF 3W4KA 2NU6B 1SRQA 3N39C 4GBMA 3ROKA 3RYTC 1ILEA 5E7QA 2HYIC 5F2OA 2P6UA 1PJSA 4ZALA 3WJAA 1Y8RB 2WYOA 1ZIDA 3IPCA 4QOJA 4RCZA 5EHIA 2IQIA 4UNPA 3ADOA 1FFYA 3LQRA 3PJRA 3TDKA 3STXA 2X77A 4EGCB 1L5ZA 5FOXA 3K0SA 1ULAA 1EAYA 2J0UA 2A9QA 2VHJA 3G85A 2VYCA 5DYYA 4UU1A 3EEBA 5IKPA 4DEXA 4Y6PA 1MW8X 1ZGAA 4ZCTA 5JNRA 5LP6B 4FZJA 3WBFA 4YGXB 4ZV4A 1ZMOA 3ENNA 2EU8A 1OKKA 4MI1A 4RYLA 3PI7A 5E6UB 3WYEA 1BU5A 1QGUB 5AM0A 1PFUA 3B3FA 3GCDA 2C3PA 3Q15C 2VCYA 3QEBZ 1KMQA 1D6JA 2BMFA 2VJMB 3HWWA 3ROGA 3KOZA 2NAPA 5LA6F 1T26A 1SXJE 3EPLA 2F6RA 2IYOA 1BC5A 3UEOA 4RTPA 2PS0A 2C7PA 4LYDA 2CLHB 4S1NA 4EY5A 3K9NA 2CGEA 1YBFA 2PZAA 4B83A 4RVUA 2AQKA 2Y0EA 1ZIXA 4AY6A 2AHOA 2X0IA 2Y76A 4H7IA 2ZSIA 1U9CA 1BKDR 1ZK2A 4I6GA 2I65A 5IANA 1EZ4A 3C3WA 2B7CA 4GPIB 5HHTA 1M0EA 2ZQ5A 4JX9A 4EVQA 3ZKWA 3PHBE 3V4ZA 3TCKA 3NDIA 3QELB 5F9MA 1BQ3A 1K3FA 2V6GA 3ET4A 1ZCFA 2D2EA 2VNIA 4UFNA 5BSEA 2HHHB 3SSNA 4JLMA 5EZYB 4I4TF 1DBVO 1PYDA 1RI5A 3WLKX 3D6TB 4AMUA 1ZC4A 4WBXC 5KBYA 1U8XX 4D8XA 1JLHA 2ZSHA 3KXDA 1TIBA 2RAFA 6CHYA 1MO4A 1LWOA 1QX4A 3EZGA 4UD6A 1IHXA 2YW9A 1AUOA 4JGGA 1M54A 4LG1A 4R01A 4YV2A 3FSRA 4POOA 2H8KA 1PGNA 3UV6A 1KPIA 4FLEA 2ZYRA 3JZIA 5K3CA 4L07A 3AUFA 4MWGA 3TN7A 2V7QD 1L7NA 3BAZA 1E4EA 5EUBA 1MOQA 4KVAA 5JNTA 5JCJA 1SHJA 3I2KA 1LS1A 1PSZA 2Q46A 1JT9A 1M1ZA 1KOGA 1GZVA 3LX6A 4PNZA 1L9XA 1OSNA 5LXTF 3V2GA 4BO5A 3W5JA 4BZWA 4XVCA 3CVWA 3C5EA 2GHIA 3B2NA 1SZPA 4IDDA 4RMHA 1JEDA 4ZDIA 3M8KA 3OMWA 4Z0PA 4EI9A 4F3NA 5JJIA 1O8CA 3G1WA 4M49A 5IJ9A 2YV2A 3CF4A 1Y5RA 3SFVA 4X41A 1A7JA 1Y9ZA 1PK9A 3D4PA 3LM8A 1G2PA 3UMCA 2JG3A 1H5UA 1Q7EA 1BYUA 4TVSA 5IK2A 1IY0A 4LXYA 4NMWA 2VT3A 3AEZA 5BQ3A 3NVKI 2QY9A 3DWFA 3L43A 2QNIA 1GKLA 3I9NA 4UM9B 4NCAA 1L7BA 5JAMA 1T6BY 3PEYA 3L7AA 1CB0A 1X94A 2BEWA 4F6RB 5EOVA 2Q2NA 1HPLA 3GJXC 4MQFB 3T0FA 2G7MC 2A58A 1MD9A 3L06A 4DHEA 1VIMA 1SVUA 3EXHB 2GETA 1XZAA 2UVQA 5MFZA 1RW4A 2NUTA 1RAHA 2AOTB 5EINA 3ICOA 4YV0A 3IUSA 1FNDA 1NBWB 4GM4A 1EP2B 3FPBA 4YPVA 4PE5B 3RSSA 4QOIA 4IYJA 2O05A 5B58T 2QTNA 3NVMB 3OHMA 4U7TB 3UK6A 3GWGA 2QRKA 3DVQX 1ZW6A 4DR7B 1TVCA 3T1OA 4BNXA 4NXNB 2AC4A 1VHWA 2FF5A 1XN1A 3AB8A 2GUWA 2PPVA 3A1WA 4BLPA 1M7HA 3E3NA 4M60A 4M0EA 4WNCA 1QF6A 1W36C 4WN3A 3R3XA 3EWNA 4XGKA 3A1CA 2AH5A 2PU7A 3GGSA 4G36A 2W6NA 3U3ZA 3M70A 3IVRA 1RJFA 2BFEB 4PSKA 1YQUA 1YFLA 4XLZA 4FNMA 3AFNA 3VR4H 1KIAA 1BSVA 2BGIA 1HA3A 2RHWA 3GLVA 4Z8YA 3FFXA 2JNWA 3P2YA 3HDVA 3AETA 1NFQA 4JC8A 4C3UA 3L01A 3EY9A 1ESMA 1YVDA 4LZLA 2GN9A 3AERB 2RK4A 5DASA 2XDAA 2H2WA 3ODGA 1TZBA 2BE7A 3DE6X 5IAKA 1XLVA 2FPRA 1P2TA 2QR2A 2IHBA 4M8NE 5KAMA 4RJTA 5C8ZA 4F6CA 1GSIA 2FWNA 1U7UA 4PZDA 2I4LA 2Q8PA 3COZA 2C99A 4IRXA 3IUMA 4AMZA 1CLUA 4C2BA 1A8SA 3KLBA 3AHEA 3T7AA 5IJZA 4MS3A 1JVSA 4YLEA 5JECA 3K6RA 1JJFA 1VXRA 1THZA 1JLSA 4E03A 3COVA 4PG4A 4NV0A 2WMYA 2YXBA 4R40A 2H18A 2UVDA 3KUCA 3PE3A 4LZAA 1DC6A 5REQA 16PKA 1LVHA 5BVGA 3HCPA 2BGGA 3G2QA 3IDAA 2OV8A 1JHOA 3U7QB 4ENVA 1TA4A 1L5LA 2C3YA 4HGYA 4MJ7A 5AQ1A 2DERA 1CUYA 5TQ2B 3M3HA 1SEPA 4JOBA 3VTZA 4KPUB 4IOJA 2JAUA 3WGYA 2PJRA 5AW3A 3QEKA 1ORRA 5FL7D 4ZYZA 3PQ4A 1M34B 1LRJA 5FPTA 1CUJA 4JROA 3HCBA 1QUEA 2QM8A 5CLHA 2EKBA 2IYYA 3KKOA 3ZV7A 3L84A 2I55A 3KXIA 1VJTA 1KVUA 4IINA 1DC8A 2GVNA 1EUDA 2A3NA 3OLQA 1K8ZB 3LCVB 4K8OA 1GDTA 3C7KA 3WKBA 1ACJA 2CVFA 1UH5A 5AQEA 3ZE6A 3U5ZB 5KKNB 1GYQA 2JBAB 4G9GA 5BNIA 1PEDA 1E6KA 1W46A 2FZGA 1POWA 2VZ8A 3K4QA 4JJIA 5DGTA 3A37A 2PDAA 5DHTA 4EB6A 3A6GA 4C3VA 3GI1A 1YXMA 2CF5A 1CP2A 2NUPB 3FKSD 1KFJB 1UBOS 3LD9A 2OQVA 4AY5A 5JW6A 2YYSA 4RPKA 2GFQA 2JI6A 5DGXA 1M2EA 3LRTA 1ZESA 3QPDA 2AQIA 1SVSA 1SY7A 1UOOA 1JWAB 2GLXA 2ONZA 5EMNA 4ZVQA 2A5YB 1J21A 4QM7A 3QKIA 5YASA 3DFKA 4ALMA 3JQAD 2ZT8A 2FFBA 3F74A 3E3OA 1YZNA 3GJ0A 3ZBPA 2B1RA 2HJSA 4ZXFA 1C1XA 1QGAA 4L95C 4PONA 1F0KA 1OT5A 4G4GA 4MYTA 1HQKA 4WJLA 1WUYA 3SWWA 1ZR4A 1OXKB 2BISA 4MGZR 1JFVA 3ST7A 3WGZA 5BN1A 1VKJA 3GH3A 3ENVA 1APBA 1RM3A 1UJCA 2G4CA 4N9WA 2QX7A 4N0DA 3EF3A 3CFYA 1Q0QA 1KU6A 1JEQA 2Q1WA 2B0CA 3JQ8A 1XZBA 3SC2B 4CIXA 5I4BA 1YR1A 2J67A 3F97A 1XA4A 1G6HA 3VR4D 2GEFA 1C30A 3ZY2A 3FRHA 3HKCA 2VRCD 3KE8A 3OQBA 3KBBA 4NMXB 3A3YA 4QO8A 5HEKA 4Z3DA 2YFYA 4JBIA 3EX7C 2ZBUA 4H6WA 4TYPA 4XLLA 4MMYB 4EKNB 1ISIA 3LHKA 4ZEXA 4DMLA 5JC1A 4B3FX 2YS6A 3IV9A 4F3TA 5AMXA 1IN1A 4CTKA 3GXOA 3QVGB 4LGYA 3FPEA 5BOSA 2ESRA 1KDTA 5CEEA 3G23A 4BKQA 3OEWA 4NBUA 4KBFA 3N6VA 4HAZA 1X3SA 1OA1A 3RHSA 1FYVA 3SHQA 4WH0A 2L18A 5T8KC 1TRKA 1SCQA 3F6YA 4MIEA 2I6FA 1MB3A 2JAOA 4ETMA 5L40A 1VZ2A 1C0IA 2E1RA 1EVIA 1OR8A 3KKQA 3S68A 2QVLA 2P77A 3H3XA 2G8NA 4HDAA 4CEJA 5C0OE 4OHFA 2Z9CA 3P0RA 4ZQCB 5FOUA 2UYGA 4IDBA 4P2GA 3VC7A 5J4HA 1DC7A 2VYVA 3PQ2A 4H0FA 5J2TB 4YRRA 1F6BA 3HY3A 4UEWA 2B25A 1PR9A 2Q41A 5KOHB 3TD6A 3ZW7A 5K0SA 2X19A 3WL4A 3SR3A 4JLSA 4R8RA 1GM5A 4K6FA 3T4PA 5WRFA 4OXXA 4HDRA 3ZQ4A 4QREA 4KSYA 5K9ZA 2P0EA 4KJZA 1FFXA 4N12A 3AY0A 4I5DA 2ID4A 1L5NA 2ZSUA 4R7TA 4ZI3A 4PO3X 1SA0A 3ABIA 2X2PA 1QYIA 2AZ4A 3O73A 5AI4A 3PNSA 4GXNA 3D7NA 3DZJA 4OYYA 4XTRA 1X6VA 2IVZA 4OXIA 3UXHA 3WGGA 4JR1A 4CKCB 5LQNA 4AI6A 3CRW1 5HJ5A 2IYSA 3H84A 1E2JA 4HAIA 4G0QA 1UKYA 3UAXA 3I5UA 3HH8A 5DYGA 5B64A 5IFLA 2BKVA 4G37A 5KTKA 1AHIA 2JS7A 6NULA 1XFDA 1M2GA 1SCUB 3D6UA 1L5HB 3UKDA 2QN2A 4I55F 1XTIA 2X9GA 4X54A 3VU9A 2VF2A 4MW6A 1I36A 3NC0C 2ZP1A 4AZTA 2QLMA 1MUUA 2XYQA 3HR7A 1GSOA 2IC5A 1QP0A 3MC1A 4BLVA 1XELA 2IHNA 2E4AA 1DS6A 2HA4A 1RXCA 2J33A 4GM1A 1ZQ9A 4XX0B 3QU5A 4LE2A 3M5DA 1WNTA 2AX3A 1WMDA 3A10A 3BIJA 4GQAA 2RKWA 3BBLA 4JT9A 2IOQA 3GJ5A 1RI3A 1CFZA 1L4UA 3AF0A 1VLVA 3RFTA 3ZN2A 2EBUA 5JSQA 1UAAA 3U4QA 1VJRA 3D7MA 5J1TB 1TKAA 4OFXA 4GG1A 4QUEA 3V34A 3W90A 3ZDAA 3OC6A 1Z2PX 2B8EA 4B33A 4PXAA 2AWNA 2A78A 1B8NA 1R37A 1URPA 1KVQA 3VOBA 3SYKA 2BUCA 2CJXA 3IBTA 2WU0A 1FMLA 1RHJA 1ADYA 1BJKA 2OTCA 1T8TA 2JKYA 1AKNA 2Y1LA 4KN8A 4UVIA 3PR2B 1LI7A 2V1UA 3AIIA 1NVGA 2YOFA 4TWBA 5BT9A 3LHFA 4OHBA 5F9HA 2JC3A 5F4ZA 3GPIA 3WK7A 5IYZB 1OJLA 1IUOA 5B7GA 3OCYA 4JB8A 4PZPA 3ADDA 3L7LA 2O8CA 3T5DA 3CUVA 2ZJAA 1HQYE 2C5FA 4F92B 3RIHA 5EJEA 2IDZA 3HN2A 2YRWA 3VXKA 1JHRA 3U4IA 5HZGA 1O0CA 5I51A 4D3ZA 2HWYA 2WWFA 1HTWA 1IDOA 1NOKA 2I4RA 3PCTA 4WFIA 2OBLA 1U0BB 1AH2A 4L8GA 3TAUA 5L3QA 2WHPA 4G6ZA 1S9DA 1W4LA 2HJHA 2OD2A 2WYUA 4WXPA 4BMYA 1LY1A 3IAFA 2RAVA 2Z9DA 4IDCA 1AQIA 2WOJA 1BHO1 1IB6A 2EG5A 1NQ5A 3VQTA 3O6VA 4HV4A 4UNQA 1N7GA 3VVCA 2HOQA 3H8SA 3NJRA 2PZJA 4GO1A 4XQEA 1AJEA 1K6EA 1E2KA 3C6YA 3KB6A 5A02A 4U8GA 3T5PA 3IXMA 1T9BA 3FSEA 4FR5A 4W9MC 4JBNA 2VF7A 2XMZA 4LHWA 2GILA 4CV1A 2D8MA 4BX3A 3ZTWA 3C2QA 2GKOA 5BYJA 3UF0A 4MHOA 4A8JC 2DY0A 2I2XB 5C53B 2IY7A 2CLIB 4Q12A 5H83A 4X8LA 4W5OA 1USVA 1X3LA 2Y67A 4NBVA 2PO7A 1NIPA 1N2XA 4LV6A 2FSPA 5IP5A 2WABA 4P7KA 2W0SA 2Q5CA 3ZDFA 1NGSA 3KSRA 4DPMA 4JENA 3I4CA 4M8KA 1QKJA 3EQZA 3IDOA 3O92A 5EZQA 1Z6AA 4GOLD 2FPIA 10MHA 2OHXA 4OHVA 1EK0A 3HP1A 1CIVA 1UF9A 2R4QA 4ALNA 4E15A 1HDZA 2WV7A 3B12A 1XPUA 1YU9A 4GBED 4JIGA 2CUKA 3VC3A 2NTVA 4NCNA 3X2EA 4DLKA 1EEXB 2J87A 2QSUA 4HGZA 4WBSA 2Q28A 3IQIX 4HEJA 3L9WA 4TLDA 5BSKA 1G19A 1RJDA 4NPAA 3NS7A 1SC1A 2NYUA 5FBQB 2I4OA 1J5XA 4L73A 1IL0A 1DWOA 2DKFA 4LYGA 2QN3A 3EIWA 4UHCA 1GTZA 1IAQA 2XVXA 4N40A 4TTIA 4CT4B 1EGQA 4XQ0A 1OMOA 4GNKA 4R2IA 4Z49A 2I1WA 1OH7A 1Q0SA 4EY6A 3WRWA 2R1UA 1L7XA 4G8DA 3IR6A 1O58A 1AD2A 2OG1A 1VHQA 3K16A 4J0DA 5DBIA 4P3KA 5AM4A 4P4UA 5T3YA 121PA 3GZTB 1PJ4A 3B1ZA 4YPOA 2RI6A 4JYAB 1O97D 5FUBA 3QSGA 2NQTA 1B41A 5LZ5A 3W8FA 2ZUWA 1VQ1A 4ND7A 3UUEA 2FG5A 4MQUA 2O7NA 4R2XA 4D6YA 3UWSA 3B78A 1IMOA 1U2DA 2ZR0A 2NXNA 4DLAA 2VJNA 3O8NA 3CR8A 1DIBA 5I8WA 1UMDA 3BQ9A 2EKQA 3N3AC 4ILEA 4MICA 1TAQA 4QD3A 1ML3A 4IDGA 3HRKA 3FBGA 5CD9A 1SXJA 5AHXA 2EIXA 3BSFA 4PFSA 4R2HA 3RSFA 3TZEA 4Z8XA 3I6IA 4RV9A 3ZY5A 4I50A 3FCCA 4W6QA 5DTMA 4CKWB 3KQHA 3IS3A 4JVMA 3CSDA 3HXQA 3D3QA 1JFFA 3QW2A 4G1MB 2IXAA 2WW8A 5ALSA 2IF2A 5IG2A 5A05A 1IOLA 3ZXYA 3C14C 1H5QA 2H57A 4M1TA 3ZCVA 3AG6A 4EDHA 2XV1A 4FDUA 1VB3A 5HFJA 2RHBA 3HDGA 2A1UB 4CQLA 1BE0A 1G5HA 2FDRA 3ICCA 4BVGA 4FBMA 4K2AA 4O8CA 5HNKA 2ZU6A 2RGNA 4MVJI 4NICA 3BX1A 4QFBA 1OI4A 2B94A 5AOVA 3V7WA 4ARUA 4RQUA 4DIMA 2RMKA 4RTMA 1QUFA 2B0JA 2Q4EA 2XLCA 3M81A 3U19A 1HL3A 3EGCA 1QDEA 1P44A 2VXOA 3O8LA 4M0FA 1EVKA 1U2RA 4V0SA 2OB1A 5LQDA 4FHGA 3QQPA 4NYMQ 1AS2A 4GRDA 4HNGA 4DMFA 1UPUA 2VAMA 1UC5B 3AHDA 2MR5A 4DILA 4N5LA 1Z4IA 1B0AA 1JAYA 2C5AA 4D9IA 4EYSA 3PX7A 1YZVA 2GN2A 3KIPA 1T6NA 1HWYA 3OO1A 2PMBA 4BLTA 2XMCA 4NZ9A 3UT5A 3AKEA 4N8EA 4R1PA 3E23A 4HDNB 4A4DA 1OLXB 1YI0A 5FTMA 3PEWA 1MHPA 1PL0A 1JQDA 2C2MA 5IAOA 3ZK9A 2V7BA 1EP3B 2O8DA 5I47A 3P5SA 4HUQB 3TI7A 1R0CA 3L8ZA 5CU7A 1YAHA 3NI2A 3LPCA 1Q44A 1JYSA 2AXNA 3A2LA 3I3OA 4TMTA 3ZYCA 4ZYWA 1W93A 4LIPD 1DO0A 1ZK3A 1N2CA 4FC6A 4WKPA 3WDMA 1VBNA 4BO2A 4LX0A 4BMOB 2H4YA 5BORA 4X8OA 4WDRA 1EXNA 2HKIA 1E9DA 3HP7A 1QRDA 2HMUA 3S81A 1P5ZB 2CW5A 2W2TA 1RQ7A 3OUUA 1P7PA 1FZTA 3JZAA 4OGKA 2BR3A 4ZAZA 3T34A 4D9HA 1CIJA 2FF7A 1ORDA 1LB1B 3DTNA 3IB6A 1IJEA 4K3UA 3K9QO 5EHXA 1SEVA 1SHKA 1DZIA 1UK8A 2F43A 2X22A 3WZMA 3HFJA 4YRCA 3ZU2A 2VRNA 4KI0A 4NTZA 4A92A 1NE2A 4EYKA 5B4TA 2E1PA 1WDLA 3C7AA 4JT8A 5EJAA 3GRZA 1J0AA 5HF5A 2J32A 1MQSA 3IIIA 5B1IA 2XI4A 4M1KA 4KFRA 2V9CA 4XA8A 4NWIA 5IBRA 2NGRA 4EY4A 1TUBA 2REQB 2VCHA 4KACA 1R27A 3SX0A 1C7RA 1B26A 4KMOA 1KNXA 1N8KA 4IJQA 3VYWA 3E5NA 5CB4B 1LQTA 3JQEA 1R6UA 2ZIUB 5CP8A 2G76A 4IAOA 3O82A 3VBCA 3GDWA 4HUTA 2OBNA 3S1AA 3PLRA 3ABRB 4MUXA 4QTXA 1B73A 2BGTA 4RXUA 1H8HA 3A58B 1M1XB 1CJUC 2UUAB 1JRLA 4FFWA 1FYWA 3CTMA 4JOCA 4H3VA 1QG0A 5JUWA 4TVOA 1ZN8A 1AS3A 1HKUA 1OLOA 1SJ9A 2GH1A 4CQNA 4Q7LA 3GA5A 5JXJA 4FOLA 1KF0A 1GNRA 4FMDF 1NSTA 3HL4A 4HLUA 3RI3A 2Y77A 3OQIB 1ZNXA 2AG1A 2FW8A 4NZPA 4PVDA 3MMPA 1UKAA 1S2NA 2Y6VA 5FFMA 1FFAA 5BN3A 4Y2VA 2JGLA 1XVIA 3X1MA 1WPGA 4CMHA 3GW8A 1MIOB 4DG5A 4G9EA 2FPUA 1U65A 2ZW9A 4M7WA 2P5TB 2AJBA 4LC0A 1J6UA 4OQEA 4Q1BA 2YCBA 4J0EA 5K0ZA 3TVTA 4Y2JA 1BMFD 5DN9A 2Y2VA 4J3JA 5TS3A 3BWVA 2A0UA 1X7DA 2RGDA 1BZYA 3QENA 4GMFA 4P4LA 1O95C 1T0BA 2PVPA 2J4CA 4MPDA 5TPWB 2L19A 1KSGA 4RD4A 3TL3A 1EWVA 5JEDA 2A14A 2OBBA 3FCYA 3KX2A 1M8JA 3OEEA 4I9HA 3VUFA 1NVVR 5IM4A 4YRTA 1NLYA 2CXTA 2PLRA 4BJ5A 3MGKA 4C0QC 3OQNA 4RACA 3ESXA 2FEXA 2AMLA 1FBNA 1GA4A 4MW9A 3B5JA 4QBTA 1EFLA 1G5FA 1PX2A 3WDKA 3P97A 4KREA 2WIFA 2Q27A 5FNVA 4AS3A 4IR7A 1P33A 1YCHA 4BKOA 4YY3B 5IDQA 1ZSYA 1BRMA 4AN0A 1PU2A 2QRUA 2BGMA 1DWPA 1GAJA 1GTL1 4X3OA 4ZDWA 3HCNA 1KEVA 3MB5A 2GYYA 3DOIA 4XQ9A 4YJHA 1E1RD 5DZSA 4KKVA 5K0LA 1YDEA 3ZLJA 2I7XA 2IYFA 1W0JA 2GRJA 1GQYA 3EEIA 3FGOA 3IQWA 3E53A 3SYNA 3UJDA 4KK3A 4H60A 6PFKA 2AFHB 2D1TA 4C7KA 1MV5A 3LBFA 3JVEA 2YJ6A 4ZVOA 2DVMA 2G77B 3FWKA 4ZCQA 2GFHA 4M53A 5CVCA 2J5QA 4X6LA 2QUJA 1Y1KE 3OE5A 5FUXA 4EHIA 4RY2A 4JR2A 2X41A 4MRMB 1RM4A 4G4JA 3DA8A 5FL7A 1W87A 1NBHA 2CCGA 1NLZA 1CRWG 1IG0A 2XTMA 4FBGA 4NJMA 4E70A 1X74A 2XEXA 1MC5A 1OWLA 2I67A 3L1JA 1X1BA 1EXVA 4M0LA 1FDIA 2X3YA 1YB1A 2LRHA 3WIEA 4GICA 2QROA 3R0XA 1TYDE 4BMZA 3IPAA 4WV3A 4CVNA 1YT5A 4P4GA 3GGGA 1C2YA 4FMPA 4MQ4A 1XIVA 1VBFA 1Z36A 4NEGA 2UZ1B 4I5GA 1Y4ZA 2CSXA 4OH7A 2B83A 2PSJA 1L4KA 3AB7A 1ISHA 4YO8A 5FOTA 3Q87B 1UC4B 3WA6A 2HREA 4TWAA 2WVAA 4DG9A 1D03A 2H9AA 2HWXA 1P2UA 3O9VA 1G42A 4H7JA 5LDDC 2JA1A 3DVAA 1R4NA 1U7PA 3FKSA 4L9AA 3LO8A 8ATCA 1KL7A 2VHXA 1IPHA 1VYVA 1PS9A 3OU6A 3ZCTA 3HCDA 1G9SA 4C0BA 5JXHA 1LX7A 4BKRA 1MDFA 3EVTA 5E6RB 4BB9A 1AUQA 4X1YB 3EZ2A 1B43A 2Y1CA 2A0XA 5FQNA 1LVUA 3PGVA 3UMFA 3D31A 1OBFO 3JQAA 2R751 5E4FA 5F33A 1PSDA 2AN3A 3GEMA 1H85A 5L4LA 2R7LA 5AJWA 4LF9B 1O6CA 2E89A 2FLVA 5JAQA 2RGBA 3DEHA 1JXOA 4F3KA 4N3AA 3AUYA 4XYGA 4PBRA 1U9YA 4EFLA 3N2ZB 1QLHA 1PL7A 4OA8A 1OAOA 3LY5A 3X2SA 2PZEA 2BFNA 4G2TA 4Y2GA 4C6TA 3ISTA 4FVTA 2QV0A 1JFLA 2FOIA 1LSUA 2GASA 5HZHA 1TECE 1K66A 4QUHA 3THXB 5E1DA 2RB5A 5FOQA 3J81k 3CR3C 4Y6OA 1GPJA 1P0MA 4M37A 1P0CA 1W8DA 3NHWA 3VR4A 4BZPA 2OCLA 1V8PA 3CT6A 3MGAA 3UKOA 2BR5A 3WIUA 2VRCA 4MVXA 1P7VA 4O2AB 4TMKA 3NHFA 4IL5A 3TR6A 2YKGA 4P0PB 1U94A 1DT5A 1PFYA 3WLFA 3EB9A 3MWEB 3MIIA 4XE5A 2F3SA 2X7XA 2XCOA 3FYDA 4ROTA 5LZ2A 1LK7A 1VLHA 2J3QA 4ODIA 3SJUA 4U9IS 2Z6VA 2NO9A 2FR1A 3CWCA 1MLDA 2ACWA 3INTA 5B4UA 1P3DA 1I7QB 3NNDA 4FBLA 4EFNA 1JSRA 2HBQA 4EWLA 4Z3OA 2CWDA 2A5DA 3QBEA 5ENZA 1TM7E 1DQZA 3W0LB 3DW1X 2PEYA 3OFSA 2YWDA 4AJHA 4B7ZA 5IVDA 2YVLA 4REQB 4F7DA 3T7RA 3CLUD 2PT6A 2G36A 3CN7A 3DMGA 4GL2A 1HNWB 3C7TA 5L4NA 2EWMA 3S28A 3KR0A 2DGDA 3AP1A 2QRVB 1XZQA 1CY2A 3CY6A 5DKFA 1A9TA 3VR5H 2WICA 1OFVA 2I22A 2O4UX 5AHOA 1C0PA 3FYTA 4B8YA 4UBOA 2GAOA 2I6XA 3D6NB 2AE1A 2RARA 1FXWA 3AUSA 3F9RA 2B92A 2YS7A 4JOSA 4JI6B 4BX0A 5B5SA 5AVVA 2B30A 1HZZC 3FRJA 1FJGB 1CJMA 1X2BA 4YMVA 2BWJA 3OJLA 3FAKA 5BPHA 1JFTA 2OGZA 2HF2A 1AB5A 2WZCA 3O91A 1BEUB 1SM4A 2GK6A 2Y92A 4P38A 5ALJA 2IIBA 3O3OB 5CLLA 1EG2A 4URYR 2IDKA 1OXTA 1XPJA 1CR6A 2FRXA 3HDQA 4HTFA 3F5FA 1JQJC 1V1MB 1WCWA 2V6JA 3JVIA 3TO5A 3C3XA 3GO4A 3R6DA 5C81A 3T38A 2FDCA 2J3LA 1XRSB 1U5CA 1F8FA 1GV0A 4XAQA 4B2LA 3HZOA 1NBMA 1X1TA 4OVKA 4OTZA 4O4IF 1NMYA 1LTQA 2Z57A 1NKTA 2G9VA 3N87A 1MX1A 1SD1A 4P5DA 2OGWA 4HOYA 4D99A 1WL8A 4JLPA 4EL5A 1E3DA 2ZSBA 5IVKA 1I5EA 4RTSA 5JJLA 2XIQA 1VE9A 5IN4A 2JHGA 1JDNA 3F3MA 5EYPA 3ZGYA 4O63O 5AFSA 3G59A 5C5EA 2BFCB 1FP2A 3IODA 4LJAA 3OKAA 5DNDA 5C34B 3V8MA 4EB8A 3ZDCA 5ARCA 1WVIA 3RROA 1HC7A 1G21B 4GOJA 1IZ9A 1E7RA 3G9QA 3UJ9A 5ADVA 1WXQA 1Q0RA 4IIJB 8GPBA 3CZ5A 1GYPA 4UZFA 1JBEA 5IMSA 3IIKA 3KJHA 1P31A 2VJOA 4N7JA 4LV5B 5B36A 4O29A 5MF6A 5FJJA 2HYDA 4DDMA 1R3UA 3T5CA 1YS6A 5DN6D 1CQXA 4QL3A 2A33A 3ESBA 3HEBA 2BTQA 4KPGA 2CDNA 5AM3A 3DO5A 3H11A 2Q5FA 3HFSA 4I46A 2A67A 4RVNA 1R0RE 2CVHA 4NECA 3CF0A 3DT9A 3LYHA 5CX4A 4Z9FA 4CCAA 4DUPA 1XWWA 5MN6A 3C4VA 3MJCA 4X20B 4A2CA 3I6YA 1NNUA 5DOVA 2Q3CA 2QJWA 2ZJ5A 1D3AA 4YJGB 2IXTA 4LZNA 5CK5A 5GV8A 4Q1CA 1GZHB 4F6LA 5KWEA 4G1BA 1YTLA 2AHRA 1PJAA 2WTMA 4YQEA 5LA6B 4Q4HB 4PR3A 4V2UA 4P31A 1PT6A 5B53A 4CQMA 5CA1F 5LPNA 1H65A 3LTNC 3KJQA 3GA7A 2DBYA 2WZDA 3NTOA 2ECKA 3MWYW 3V5NA 4MINA 4OJTA 1RI4A 1E8NA 1VKRA 3S44A 1Z8HA 3WBBA 2VDUE 4DLRA 2VPIA 1R6XA 2PKQP 4RA6A 5BVGB 1KZ4A 1P7CA 1VG9B 3JWHA 3S8MA 3O0TA 3U44B 4WJKB 3HKBA 5DISB 4PS1A 4RZQA 5CFQA 2XBLA 4OI2A 3UVEA 4JEMA 1HLFA 2WKPA 3WQSB 3RK1A 4QHSA 3L7JA 4P0QB 1E59A 4BC0A 4BMSA 1J49A 2B21A 2XODA 2YYAA 4RIEA 2A84A 2XZOA 2YWFA 3K1ZA 2Z6UA 5JATA 1XBTA 1JB9A 1J0CA 1TLFA 1W1IA 1XMVA 4TYNA 3QLJA 1NRXA 3WY9A 4E22A 1OH8A 2C4WA 1Z4QA 3CNNA 2H4HA 3GEBA 4GGOA 4S2EA 2IQ5A 2WTXA 5TARA 2CC2A 3T3GA 3AEUB 1OLSA 1YUNA 3JQPA 3WP0A 2HX1A 3OMXA 1OXUA 1XDBA 1EYZA 4XPZA 4A1OA 1Y7IA 3TE7A 3HKDB 3S2UA 5IPFA 3KVRA 3GMTA 1AMNA 2CCKA 4WEOA 1X0VA 4UUMA 1ZIYA 2NTNA 2VWHA 3LCJA 1ST3A 2FKNA 1ZICA 3P7MA 4UU7A 3KT3A 1DQSA 4JB0A 3ZX5A 5C37A 1DIAA 1JILA 2PL3A 2BM9A 3N05A 3Q3VA 4Z1OA 3ZDBA 1A9OA 3WMRA 1SIUA 1ZH4A 2VK1A 2ZI4A 4E21A 1X7YA 2ZWVA 3DDSA 4X94A 4CG1A 2NU9A 4BAGA 1XNRB 1RACA 3DF7A 1KJ9A 1H3FA 3KHTA 1DAMA 1W35A 2JCYA 2Q3BA 3LI2A 3N70A 3NJ4A 4QWMA 5IH3A 1S1CA 3ZCRA 3RADC 3EY4A 3OZEA 4H0CA 4V0ME 1JYFA 1CRZA 4TV8B 2ZI5A 5DBEX 3OU2A 1A71A 1T4DA 1SPXA 4OAOA 3TOCA 5CA0A 3F7MA 4S1PA 2FW1A 4BL5A 4KQJA 5B7PA 5I9NA 1N8SA 3RYHB 5BW8A 4H27A 1YA6A 1DDOA 1TT7A 1VSTA 4XIJA 4PZ0A 4NYIQ 5LWHA 3UMJA 2P11A 5GONA 3I9OA 4CODB 3WIDA 3AEQA 4PPNA 5GZ3A 3QPAA 2PQ0A 5JOQA 5DHAA 2FXVA 3CGWA 4K9OA 2VK2A 3GAAA 4FSDA 3VYTB 1HFKA 3AU9A 4MLZA 4KITB 5ADUS 5B6JA 3FWNA 1E1QD 2R87A 1MXFA 2PM8A 1QK3A 2XKKA 4R1NA 4QPNA 1EFRA 2GEJA 4Q7EA 1BHJA 1Z73A 2P4QA 1DXYA 1EA7A 1NFRA 1I6KA 4ASUA 1WIWA 3IBGA 1XQ9A 3L7NA 4DTCA 4X7BA 3LHIA 1IWOA 3GXBA 5CMLA 1PTKA 3OZCA 4IS3A 2QXYA 2GYUA 2PUTA 2GKSA 4P22A 1CF9A 4RLSA 3TXXA 4DQUA 3AMVA 5CCEA 1PG5A 3EXIA 3WLTA 6REQA 5KMGA 5KVCA 3VA7A 2FKAA 3G17A 3LH5A 3MINB 1OAAA 3DZDA 1VJCA 3PUZA 3P4XA 3T9AA 2M2IA 4JY7A 4I8IA 3TYXA 1F17A 2GXUA 2H1SA 3K6JA 4UDNA 1ZD3A 4FI3F 1MENA 2B37A 5J63A 1Z5OA 1MJGA 1LDNA 2Y3IA 5F1PA 3TQCA 4D80A 2RGGA 5CVEA 2QS9A 5AWFC 3MHTA 1OFGA 2M6SA 3CNBA 5EY5B 1FRFS 1X1CA 4FT2A 3TKLA 5C1OA 1V8BA 3TRFA 2OL4A 4F04A 4WQMA 1ZRSA 3ILHA 1V96A 2ZCVA 1E94E 4NP6A 4J90A 1J1ZA 5KYXB 4WD3A 1XMOB 4CKZA 1KYVA 4C3OB 3DULA 3M6WA 3N6XA 5H81A 4UTOA 2HZBA 5B1HA 3JALA 1GPNA 1TJ3A 1BVYF 1FS5A 1HEUA 1Z4PX 2CLKB 2PMEA 3QMVA 1Y8CA 1D6NA 5D7NA 4MRNA 3ZDQA 3M2TA 5AK0A 1GR1A 3ESQA 2Q0QA 1FE8A 5H0IA 3O21A 2J08A 4KAFA 4G84A 3THSA 3QX3A 4XVUA 1MB2A 2GLTA 1M2NA 1UXHA 2FPKA 2PZBA 3PQEA 3ZJTA 3LC2O 4BO3A 5KTPA 3LIIA 1JAHA 5BRNA 5ELLA 5JZMA 4YLYA 2O4CA 3QEMB 5FDFA 2FSIA 2NTEA 3W2HA 4K7JA 4EECA 1A7UA 4Q00A 4PZEA 4LRXA 1YFJA 2CUNA 2NPOA 3GOHA 2H1HA 3PQDA 5BNFA 2Y27A 2O7VA 4GZ5A 2WM8A 1ODSA 2PUVA 4JB2A 5TMDA 3K9CA 4BO6A 5C4MA 3OT5A 1WHTB 4HQ0A 1Z16A 5JD6A 2VHQA 4F46A 5A7GA 4YJ3A 1TQHA 1Y3HA 2ZLBA 2XOKD 3WYDA 4YP5A 4B3XA 5BNWA 2OHHA 3NV7A 4MRPA 3C4JA 1JQEA 4P3OA 1DE0A 3WMEA 1Y4UA 3TLGB 2P9GA 3H5NA 1R88A 3HKEA 3OP1A 4CR8A 3PUIA 4MS4B 4AKGA 4AG6A 3NUQA 3VDMA 5BOVA 2V54A 3OQJA 2WTEA 3PTLA 5DSTA 1OREA 2PVCA 3LQQA 3NOOA 1YE5A 4OQZA 1USIA 4M1ZA 1Y98A 4RK1A 4PIPA 3ZI7A 1MV8A 1E7SA 3I5YA 3TRJA 3E1SA 2F3UA 3GFFA 5AI0A 3AR8A 4YROA 4ETNA 2Q2WA 4G5YA 4E88A 1GPBA 3FCSB 3FHOA 4FJ2A 1UKCA 4TN1A 1NZJA 2YWJA 3SU8A 2IXGA 2D4AA 1O5TA 1EX7A 1U3UA 2E87A 4I1OA 4KQMA 5SY6A 3V97A 3EGOA 1RPJA 4YUZA 5LKRA 1NXWA 1WU8A 4LNAA 3H6HA 3O8CA 1ODKA 3DV0B 3HSSA 3JX9A 3PDIB 3CVOA 3JWJA 2Q5LA 2AD1A 4DV5B 1NOIA 4G5FA 2YZKA 2F1RA 1UCFA 1WHSA 1R16A 4OL9A 1GLNA 3LDHA 2XB9A 1P45A 2ZVDA 4DR1B 5AJXA 3NUZA 3ZHOA 1QH9A 4MEJA 3B1KA 4PFQA 1WB6A 3AVPA 4XH9B 5BWOA 3G5UA 1QPGA 1TF7A 4WLFA 1X7XB 2DCMA 4DTIA 2F59A 3LLVA 4MMZB 5B6IA 1R74A 1FLNA 2FRDC 2C59A 2QPAA 5HKAA 5JNWA 4BPBA 3P9ZA 2DMRA 1EG7A 2HMAA 4LKRA 1TGVA 1Z35A 4XDHA 2BBWA 2VBGA 3LOUA 4KAAA 1ZM4A 4MMXB 5AVRA 2AI3A 3CIOA 2IWHA 4UBJA 1AA6A 2O8BA 1OUMA 2CL7X 1NLMA 1AKYA 2QL6A 1RJ9A 2Q1SA 4IVNA 3ZGLA 4EZEA 5CDTA 1XCJA 2B8TA 3F8TA 4RTQA 5DCWA 3I6QA 4B48A 1BMFA 3DE2X 1CZKA 2RJ3A 3L92A 4KOEC 3RTBA 3E15A 1KBOA 4MKXA 3LFTA 3O4HA 4B4UA 4HKTA 3DLAA 3S1LA 1C1YA 4YMTA 4DV7B 1PDWA 1SC6A 1R50A 2I6QA 3KK0A 2DUWA 2HDWA 5TPZA 4MVJE 4DUGA 4CM9A 4KFCA 4D81A 2QW8A 4RF4A 3DM5A 1T13A 3I92A 1MX3A 3K0EA 5ALOA 3C1OA 4FFBB 4DA8A 3WGMA 1T1JA 2IYQA 2VDRB 4WGGA 3TQRA 2SKEA 4IMJB 4HLDA 1Z6ZA 1T9GR 3I12A 2YFKA 4R3NA 3GARA 4UCQA 3FVTA 2COKA 3PFHA 3G0CA 4CKBB 1DBQA 1KK2A 3GV0A 3ASUA 3ZE7A 2ZI6A 5HM8A 5JYDA 2VOEA 1CIPA 1BXRB 3A6DA 1XLUA 4GMXA 3VR3A 1L4NA 1O0BA 3WGQA 5J5CA 1R7RA 2AUTA 4LJ6A 4Q34A 4IOLA 2OYRA 5IT4A 5EQTA 1RQNA 5DMHA 4I55B 4U7PB 4MPRA 1CJKC 3OH8A 1L1RA 1DFGA 1TX4B 3R0ZA 3RABA 4E08A 1JH9A 1QFXA 3WK9A 4Y1RB 3VR6H 2YX1A 3PXBA 4HX5A 3NETA 1GUBA 1ZOSA 4IMRA 3N0VA 1NI4A 4K26A 4OBEA 2I6TA 3DMFA 4IZ6A 4C7OA 1D2AA 3R5XA 4IXMA 3ZU6A 1T8WA 4WLUA 3C6BA 3A2MA 4AUKA 4QUIA 3D1LA 2P30A 1NI3A 1UM8A 2YJ5A 3CUYA 3MAJA 4GX1A 4HYYA 5A9TA 1XDDA 4WZAA 2IU0A 4ENPA 5K8LA 4U8HA 1FLAA 4AKIA 4B3HA 2YWRA 1MTZA 1UR5A 4FGJA 3E22A 4W5WA 2A88A 1SG0A 4YUAA 3D2BA 3LP6A 3DMTA 1EEHA 2FB9A 3BJIC 3NNSA 3NTQA 2AOXA 3O4RA 4J0IA 4LCBA 2WK1A 1N4AA 3I83A 3TXYA 5EIFA 5FAKA 4JXZA 1XLTC 3H42B 2VNAA 2D1YA 1IQRA 1X7GA 2NU7A 3CZPA 3AR4A 2HDOA 3ACBA 4F86A 2PL9A 1NUAA 1LGYA 1YZHA 5F12A 3MJHA 3HVKA 3DLCA 4I36A 5AXBA 5IHPA 4PGGA 2ASVA 1Y6QA 2FQQA 3CYFA 3E58A 4LQCA 1FU7A 4PC1A 4BBJA 1IB0A 3DDWA 2WHQA 3RAJA 4BWGA 3ZWDA 1XJCA 2R7AA 3B9QA 2PGXA 1N9GA 4I9FA 3T3EA 4YT2A 3ABZA 2Q2VA 4C4XA 1CULC 3HYNA 1ZAYA 3LDGA 4MS1B 3NEYA 3PQ5A 4JLKA 4EHFA 1E4YA 3UK2A 4BVLA 2ZE6A 5FOWA 2JJ2D 4K9QA 4MCHA 1T9KA 4YN3A 4AN4A 1PV4A 2YVQA 2C31A 4NCIA 4KRGA 5JC8A 1TZ2A 1SXIA 3TX2A 1ESDA 1VA4A 3DEIA 3LCRA 5D6OA 1YKSA 5JAZA 4CEHA 3BIFA 2OSVA 4IH1A 4B34A 1OY1A 1ZNWA 1D04A 1DP4A 4MAMA 4AJEA 2NZXA 1Y1PA 3I72A 4NCJA 1TJ5A 1XTBA 4R6XA 1U3CA 2HU2A 3V8RA 2ZWMA 2CBXA 4ZHQA 2QUBA 1FVHA 5ITVA 4EW2A 5CEJA 2FGKA 1SELA 3H86A 3TNJA 2B7BA 2FUKA 4OIFA 2HUNA 2N75A 2P3QA 4MUFA 2FX5A 5KNBD 5TIIA 2C7RA 4CR7A 1CUUA 4D96A 4FFDA 1D8TA 3Q9LA 1FP7A 3CIFA 1XQVA 4NE2A 2DWPA 3EDYA 4FUTA 1JT2A 1UOQA 3PVCA 4RNDB 4ZV7A 5KDDA 4FI3C 4JS0A 3GRAA 5CIWA 4BNKA 3I4FA 3RS5A 5E3HA 1G8PA 4CU2A 4L02A 1ORVA 5AKKA 3NYRA 4RD3A 4RZSA 3BD9A 4RPHA 3V1KA 4C5BA 5AKXA 5HDBB 5HP4A 4AMVA 1LDGA 4B80A 3ZWBA 2OBYA 4YJ2A 3K70D 5JDCC 2LZ0A 4IKOA 2YHIB 4FJ0A 4TSFA 4OM8A 2Q3HA 1E3EA 5D84A 2HW8A 4NK5A 3CHYA 4HLNA 2GZ1A 3DZIA 2VDNB 4QLAA 3VR6D 1V7CA 2E21A 2PBLA 2CFTA 2Z2XA 4MDFA 1SBIA 3M5CA 2O2XA 4B87A 2VHCA 3TW4A 1QHHB 1UM9B 2GHQA 4HMOA 1C9YA 2VJQA 2HH9A 3ZV4A 4RZUA 1WSBA 4L72A 3FMFA 1M6YA 1UKEA 1YOVB 3OTHA 3OUZA 1RBMA 1B74A 4Q4JB 5AK6A 4WY5A 3EIFA 5FUWA 1BIFA 2PA3A 1TQ4A 4BVEA 4FQ5A 4LW8A 4C89A 3D81A 3OIYA 4BZZA 4R7GA 4KL8S 2VSQA 4JLJA 2X0DA 3V4FA 4CQMB 3B6IA 4RYDA 1Z06A 1M10A 2JFZA 4S1VA 4DV4B 1G6OA 2XUZA 1GQ2A 3N8GA 4TUYA 1DHRA 1VCMA 3EVFA 3EXAA 3QJYA 4L22A 4WE3A 4ZGWA 5D3MB 1CEQA 1J2JA 1Z6PA 4XPIA 4XD7D 1VL1A 5ERGB 4INAA 5EG5A 3KWJA 2C78A 2ZIVB 3CZ9A 4KDCA 2WFLB 4WKGA 4N76A 1O96B