1NXXA

Micarec ph 5.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
114
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title MicArec pH 5.5
rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 40
structure length 114
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxxA00
1ZH2A 3LUCA 2NUBA 1QQAA 2GX6A 3DBIA 3ILYA 4W5RA 3A3KA 4XASA 5EWMA 3OQNA 5CHYA 4EUKA 5JNTA 3OQMA 2PLNA 3MA0A 4UHKA 4HNQA 5TQJA 1NXSA 1LK0A 4UHJA 2QZJA 3CLKA 2RGYA 4MR8A 4QICA 4QYMA 4Z4CA 1LJLA 3H1FA 1FFWA 2KYRA 4OLBA 1USIA 3CG0A 3H5TA 1JYFA 2L19A 1YS6A 4TLMB 4DADA 1ZGZA 4NICA 3HO1A 1EWVA 2YHBA 2AYZA 3HM9A 5BRJA 3T95A 3CFYA 1JDPA 4XFKA 2IOYA 1USGA 3KKEA 4Q6WA 3MIZA 3O1IC 3NBMA 4PICA 4WT7A 4Z4EA 3EULA 3IP9A 3GBVA 5FBHA 4EYOA 1QP0A 3LTEA 2FQXA 2JK1A 3H75A 5IUKC 4Z99A 2LBPA 3O74A 4G86A 4Q6BA 4N47A 1QP7A 1C4WA 4EVSA 3MQ4A 3FFTA 2FEPA 1J56A 1TMYA 2ID9A 4PZ0A 3DZDA 5FWXB 4N76A 3OQOA 2LUOA 3KLNA 3KLOA 4YGXB 5TQ0A 1U8TA 1Z13A 4JAVC 2JVKA 1P2FA 3L6UA 4G0OA 3GBPA 3VNAA 4HYEA 2M98A 4OTZA 4YCSA 1C0EA 3HDGA 1ISRA 2MYNA 1LBHA 3HS3A 1JFTA 1W9HA 1DZ3A 3QEMB 1Y1LA 2PUAA 3BRQA 1JL3A 5IUNC 5IEJA 5EWLB 1JFSA 3M6MD 1DJMA 2I6FA 1AB6A 4FB4A 2GBPA 3O2QB 2E4YA 3HUUA 4YS6A 3BREA 1D4ZA 2FMIA 5DCLA 2XDYA 5JNUA 3C3MA 3EJWA 2FN9A 1E6MA 1NXTA 2OENG 3CG4A 2IYNA 2IPMA 4FE4A 1SXHA 4RY9A 1BA2A 3KCNA 3RH0A 3EQZA 2P4UA 2IPNA 3URMA 4EYQA 3OM0A 5TPWB 4TLLB 1U0SY 2NZVG 4IMJB 4CBVA 4ZJPA 3LMKA 5IULC 4WWHA 3JVDA 4RY0A 2WRZA 2NT3A 2MSLA 5EWLA 2VUHB 3CTPA 1JDNA 3LOPA 1KRXA 3KTOA 3UUGA 4PEVA 1RNLA 4ETMA 1ZN2A 2QW1A 4F11A 5DGCA 2PUDA 4LZLA 5T7BA 3FDFA 2NZUG 3TB6A 1QMPA 1ZHHA 4KQ9A 2HQBA 3G1WA 4F3TA 5GQSA 4GNRA 3IP6A 3O1HB 4H60A 3R0JA 3NNSA 3IPCA 1CEYA 1K68A 1Z17A 4YWHA 3ROTA 4ZPJA 3I5AA 4MQFB 5PNTA 5JNVA 2PJUA 3Q9SA 1P6UA 4MYRA 5TPWA 3LUDA 2B4AA 5KQLA 1E6KA 2E4VA 1Z16A 2MSWA 4RDCA 2Q5CA 1KRWA 3C3WA 2LIVA 3Q7SA 3BRSA 3G85A 3M9XA 4IMIB 4D74A 2E4XA 3O1JC 1U04A 3HCWA 4N03A 4RWEA 5F64A 4EGSA 4KQCA 3SAJA 1TJYA 5KQMA 3IP7A 5EWJB 4RXUA 1NTRA 3EODA 5KI6A 1EWTA 3FGZA 4ZMRA 3W9SA 5BR1A 1B00A 1UDRA 2RJNA 3HVRA 2FW0A 1RZRA 2QU7A 5TQ2B 4RXMA 4XXHA 4Z4IA 4MR9A 4MQFA 4KK3A 5E3JA 1ABFA 2F8SA 2FVYA 3LUGA 2HJ9A 2ZAYA 1VKRA 5IX8A 1U2QA 3D8UA 1YVUA 4L4UA 3VNBA 2RDMA 4KRFA 1GCAA 3CHYA 4HNSA 1OXKB 1RXIA 5CNKA 1VRVA 1NATA 3HDVA 1ZITA 3IP5A 4F12A 5HSGA 3H5VA 4S05A 4QPJC 2FMFA 3RVPA 3HXMA 1URPA 4DN6A 2RJOA 7ABPA 5KC9A 4L85A 1DP4A 2FTKE 3T8YA 3KSMA 4IILA 2BGGA 3LFTA 2CHEA 2PE5A 3UKJA 2JCGA 1DCFA 1W25A 3O2JA 4IF4A 3GYBA 4JOQA 4RK7A 4MQEB 5C5EA 3MMNA 2E4WA 4W5QA 4RKRA 3SNKA 2QVGA 5DTEA 3FMVA 3HK2A 2JBAB 4JP1A 4DQDA 3A0RB 1RXEA 4EVQA 1XWWA 2PUCA 5IC5A 1JBEA 4IGAA 3IPAA 2FQYA 1YK1A 3H1GA 1QQBA 4RSMA 4LE0A 4YR7A 4O5AA 1JLKA 4RK4A 3ROFA 1SXGA 2FMKA 4LDZA 3N0RA 3L49A 1VPWA 3O75A 2ZWMA 1QO0D 4MR7B 3RQIA 2PAFA 2E4ZA 3LUKA 2FEWB 1DRJA 4FE7A 3T38A 1DBQA 3SG0A 1DBWA 1QPZA 4YP9A 2W42A 4XLTA 2JBAA 2OQRA 1KGSA 1JF8A 2FN8A 4ETIA 3LUHA 5JS1A 1Z2EA 2GI4A 4NQRA 4MAAA 2IPLA 4WXMA 1DC8A 3OM1A 4LX8A 2PUFA 2JRLA 3OLZA 4G0ZA 1LJUA 2WB4A 2WJAA 4MRMB 1DRKA 4RS3A 1D1PA 1DCMA 1QO0A 1APBA 3DGEC 4F06A 4MS3B 5FWXA 3QELB 2FKAA 4WXEA 3SM9A 4HNRA 4RK1A 3CNBA 5I4CA 3TMYA 2HQRA 3D02A 5CNJA 1QKKA 3CRNA 3NHZA 4Z4GA 3QX8A 1FFGA 3I09A 3JPWA 2H0AA 1YMVA 3OLXA 3QLVA 1PHRA 3QX9A 1RPJA 1M5TA 3EDCA 3QEMA 3CS3A 3N75A 3CZ5A 2H3HA 1M2EA 6ABPA 5KQPA 1WETA 3HUTA 4KV7A 3QLVC 2GWRA 2NT4A 5JNWA 5JNSA 4KFCA 2R47A 5KQGA 2PL1A 1NXPA 2QR3A 4G0YA 4P1ZA 4QYWA 3C6QA 4MS3A 4Z0NA 4TMYA 1Z18A 4Y9TA 3QELA 2CD7A 1HEYA 2HSGA 3JPYA 5DLEA 4E7PA 1ZVVA 4KPYA 1EFAA 1ZGGA 2MYUA 1JFVA 1KMIY 1Z12A 5TE9A 3KYIB 1GUDA 1TVMA 2QV0A 2P9HA 3IDOA 3N0WA 1DBPA 4N0QA 3P9YA 2MSKA 3FFWA 4IRXA 8ABPA 2O20A 2IDMA 3S99A 2A9RA 2TMYA 4F8JA 1Z2DA 4YV7A 9ABPA 1YTUA 2VK2A 1M5UA 2LPMA 1A2OA 2MYTA 4NCAA 1YS7A 1Z25A 1BAPA 3GL9A 1S8NA 4RKQA 1FSPA 1YIOA 2VYCA 2QVCA 3OMXA 4Z9AA 5D2CA 1ZAYA 2HQOA 2FQWA 3KS9A 2AYXA 1F51E 1NXVA 3TO5A 4ML3A 2VUIB 4ETNA 5ED4A 1MAVA 4M88A 4EYGA 4RK5A 3C97A 3LUAA 3NNDA 1GUBA 2FEKA 3HSYA 3KHTA 4G0PA 4MS4B 4RU1A 2DRIA 4D6XA 1L5ZA 1PNTA 3I45A 3N6VA 4EYKA 4RXTA 3F7NA 4LRQA 4MR8B 4W5NA 5B3JA 2MYPA 4NV3A 5JS2A 3GWGA 3HJFA 4RK0A 4JB2A 1USKA 4YO7A 1XHEA 1P8AA 5B3JC 1D1QA 4G97A 4G0XA 5EWJA 4Z4FA 2N9UA 3H6GA 1CHNA 3RVQA 5CNMA 1IIBA 3Q7RA 3H6HA 3Q7TA 5FWYB 1OXBB 1BDIA 4ZMSA 5ABPA 2JVJA 4JASB 5TQ2A 1ZH4A 2FMHA 2E4UA 3GV0A 4MS1B 4O1IA 3TX6A 2PUEA 1XHFA 2J48A 4MS4A 3E61A 3QLUA 3LUJA 4RY8A 3H5OA 3LKBA 1QNLA 1K66A 2HPHA 4OLAA 4KVFA 1DCKA 5IUJC 1E6LA 3QLUC 4KNYA 5TPZD 5FBKA 5JNRA 3CU5A 3KG2A 3MM4A 4G0MA 2M1ZA 2IKSA 3EAFA 4OATA 4OBBA 2L17A 4Z9BA 3RVNA 2QSJA 3RVSA 3N0XA 1I3CA 1ISSA 5FWYA 4H3KB 2PUBA 3GT7A 2JB9A 2FXIA 5TQ0B 2PUGA 4OG2A 3K9CA 1SXIA 4NCBA 2FLKA 3H1EA 3SQNA 4MS1A 3JTEA 3OO1A 1JHZA 4JB0A 1A0OA 4KMRA 4MQEA 5CNIA 5TPZA 4ZYLA 3OLYA 5KC8A 4XAQA 4D6YA 5HKOA 3KYJB 1BDHA 1EWKA 5T3YA 2CHFA 1ZESA 4LDAA 2X7XA 4W5OA 1CYEA 3KJXA 3JY6A 1FFSA 1H9CA 1F4VA 2JVIA 1YK0A 2GKGA 3EGCA 3NNNA 4TN5A 3Q41A 1FQWA 3A0UA 4MGEA 4P98A 5HM6A 3OLWA 3OO0A 2L2QA 4H3HB 4LE1A 3DLHA 4MR7A 2A9QA 2WY2D 2PMCA 3RVMA 3QK7A 4G0QA 1PEYA 4W5TA 3CZCA 6CHYA 1EAYA 2F8TA 1TLFA 3B2NA 5KWSA 2FSPA 2QXYA 1EHCA 3UK0A 3O21A 2R4QA 4Q7EA 4RV5A 4YLEA 4EY3A 3H5WA 4LE2A 3LKVA 1PNRA 3T6KA 1PEAA 5GOTA 3RVRA 4GPAA 4JA2A 4MRMA 1MVOA 1GCGA 3H5IA 2ID7A 3JVIA 3DGFC 2WJWA 3RVJA 2IPAB 2PKXA 1NY5A 3MYYA 1T34A 3N53A 3BILA 3QEKA 1LBIA 3K4HA 1R8JA 1NXWA 2WMYA 5HQJA 4MPTA 5C5CA 2B1JA 3RVLA 4B09A 1ABEA 5DKFA 1Z15A 4PE5B 1TM2A 2R48A 3GA5A 1BDJA 3RVOA 4YRZA 1U2PA 2A9OA 3TD9A 3FFXA 4N41A 4KREA 1E2BA 3CKMA 2PL9A 1JX6A 1D5WA 1DG9A 3BBLA 3EQ2A 3ILHA 1Z26A 2FLWA 3NHMA 3OLVA 3HEBA 3QLTA 2LP4Y 2L18A 4N0PA 4O1HA 3F73A 4MLCA 4XARA 3SY8A 1JH9A 3DLBA 3MF4A 1MB3A 1SD5A 1MB0A 4RZSA 3A10A 1A04A 1AB5A 4KK4A 4Z4HA 1BVHA 1GLGA 4WZZA 3I42A 3JS5A 4MLDA 4MR9B 4PYRA 5IEBA 2A9PA 1JWLA 2CWDA 5EWMB 3H5LA 3E3MA 1RZRD 1QP4A 5BRAA 1M2FA 3Q15C 4S04A 3HZHA 3OMWA 1DC7A 2R25B 1NXOA 3C3KA 3LUFA 3O2SB 4RK6A 4WUTA 4E7OA 1L5YA 1P6QA 2WWVD 3F6CA 1D2AA 5BQ3A 1SRRA 4KZKA 3HV2A 4EVRA 1NXXA 1ZY2A 2V0NA 5IBQA 1JYEA 1PUXA 1VLZA 3N8IA 3F6PA 3RVKA 1YMUA 2YHAA 1MIHA 3M9WA 3GRCA 1ZDMA
chains in the Genus database with same CATH superfamily
4MW9A 2MSNA 2P40A 3VKVA 2FSUA 4F04A 3ZE6A 1NAHA 1OFTA 3H17A 1EUZA 5CHYA 2D0IA 1X2BA 1KAMA 5C0OE 4ALNA 2I4OA 4C01A 1R15A 5CCDA 1DELA 3K0FA 4TYWA 4FSXA 5CA0F 3FMGA 2CVZA 2X15A 3GLVA 4MR8A 4E3WA 4CF5A 1VHLA 3ZCVA 2ZJ3A 1YJAA 2F48A 4KLNA 2E2WA 2KYRA 3LX6A 2H4YA 2PUJA 4HN9A 1USIA 4L8YA 1SC6A 1T9AA 2PGXA 4PC6A 1M76A 3R3JA 2I1QA 3RIHA 1E9SA 5J4HA 5GVRA 1AS3A 1RKUA 4QIHA 4TV8B 1JJFA 3NHBA 3MT9A 1L8LA 3LZDA 2BEJA 4ZVQA 1JIXA 5CFMA 2DEUA 1WV1A 4BTLA 4XOUA 1OBOA 2IP4A 4Q82A 5I7RA 1DS6A 1XZMA 4GRAA 4Z4QA 1N6NA 2IXAA 2OOSA 2NYVA 3N0TA 1EGAA 4CL8A 4BJ6A 4CMBA 4M55A 1THGA 4E46A 4M38A 2D0OB 2PBFA 5F1KA 3C7KA 1EFPB 1UH5A 2QDKA 5GV8A 3A70A 3ZD8A 4CWAA 1XRSB 1JRLA 1TM5E 2RGCA 3R0VA 1I1QB 5SY6A 5KTRA 3K5WA 2GRUA 1AMUA 4XUGB 1FNBA 4N47A 1HDYA 1FSSA 1J7KA 2XW6A 1GKUB 4Q6BA 4P9NA 2CXPA 2PNJA 3R7BA 3KOZA 1GKYA 1NIJA 2PRJA 3DPIA 4P4SA 2KM1A 4XR9A 1HLDA 5BNZA 5JC8A 1ZFNA 5T6MA 3GLHA 5AW0A 5CB4F 1N5DA 3M6UA 1NNEA 1N0IA 1Y1QA 4ZHQF 1OUMA 3ESDA 1IZ0A 3DZDA 5FWXB 2I6XA 1HE5A 2ODTX 2JGJA 1U8TA 4UU7A 2ONJA 3A1NA 3FYCA 4L0QA 1O5TA 2RCNA 3PRHA 3RRBA 1GVHA 4W8GA 4QPPA 4DIDA 4RJ2A 4FFVA 5CDTA 3PUZA 3ZWDA 1N2JA 1KPHA 1NM5A 5FULA 1P17A 1Z4MA 2EZ4A 1DV1A 4MW7A 3AETB 3HS3A 1XALA 2XCOA 3GEMA 4EG4A 2PUAA 1X0VA 2F3UA 1R4ZA 1KY5A 2Q6VA 4ALLA 4EKNB 1WRBA 1MJNA 2AFHB 2GD1O 4YAKA 3PLRA 4JELA 1Y8QA 4LNHA 2ZRKA 1C1DB 4ZQCB 4YUXA 2E4YA 2CLFB 4XPZA 2XVYA 3PEVA 3PHLA 2WWGA 4CIWA 2Q6OA 3NEPX 2QJTA 4BLRA 1EUCB 3RJ9A 3GLFA 1EVKA 3FOCA 2EX4A 4LJ7A 1RDFA 2C5AA 4DPLA 1E6WA 3RH0A 3DLIA 4LI3X 2GS9A 4KR7A 2ZG6A 4JGBA 4II2A 4L73A 3SYKA 4LPKA 2Z4RA 3R6DA 4MPRA 1DAPA 3TX2A 3KKZA 1N9KA 2BFWA 2ZUUA 4NDNE 3LWDA 1ESZA 3ZV6A 1UBNA 1POWA 4JQCA 1HR0B 4F4FA 5EWLA 1Z88A 2CJPA 2B4RO 2J9YB 5BWCA 1LQTA 1RBZA 4WK2B 4ARVA 3Q2OA 5H81A 2AX3A 2FG6C 2WJYA 4JV5B 1L4HA 1U0BB 2WKRA 3CSUA 4U5QA 2H06A 3OQHA 1V7PC 1A7JA 3L0BA 4LZLA 1M2KA 3T5AA 4QE3A 2R8YA 2HQBA 2QB5A 1KJJA 5B4VA 3L7AA 3OT4A 3O1HB 4NPHA 1MT0A 3R0JA 4BNTA 1WB4A 1YGYA 1ENYA 5CVCA 3ZIAD 3ETHA 4D4LA 1G4HA 3SBXA 2QRJA 1RZVA 1AKEA 2NSJA 3AHDA 4HTFA 3E22B 4XSGA 2FG7C 2R4UA 5CB8A 2FR8A 2R8BA 4MW4A 4DLWA 1CZOA 3JSAA 4RELA 2XB2A 1DC6A 3IXLA 2ES4A 2C42A 1SGWA 2MSWA 1L2TA 4QYTA 4ENPA 4O2LA 1UT5A 2B78A 2Q3JA 2LIVA 2FEMA 1D8AA 3G85A 3HGTA 3M3PA 1TM3E 2GZMA 4JI6B 3O1JC 4HDAA 4RWEA 1LBSA 5IVHA 2BGKA 1S5PA 2ZYGA 2A33A 5LD2B 3C87A 1UK9A 3WDMA 2XMSA 3DOEA 5ICFA 1FMFA 1NTRA 2QTTA 1X1CA 4IHJF 5LUAA 2JLSA 4ZMRA 5FBRB 1QANA 1MO3A 3BC1A 3SS8A 2Z8YM 1KEEA 4K7JA 2DC1A 1ZJJA 2FPOA 2H7XA 2Y67A 3PB3A 4V03A 1WF6A 1ZH0A 5AM2A 1VJ0A 1HSOA 1A76A 5EY5B 1VKRA 5KQRA 2V7QD 3EZLA 3FDXA 2ZJBA 3UJ6A 2C78A 2PN1A 2WDPA 3DWFA 3CN7A 1B8UA 3T1NA 5I9NA 3L43A 5A4KA 1PKXA 3E7XA 2HO4A 2JARA 2NQTA 2R44A 3UT6A 5A2GA 4GOOD 4NU5A 3KAJA 5DNDA 2O8FA 3O4IA 4EEKA 3FKSD 1WVIA 3M6AA 3I8OA 4MICA 1HE3A 3DEFA 4G65A 1EEXB 4UHCA 1B76A 4IGKA 4WADA 3IS3A 1VHWA 3CVUA 1GAXA 4DNQA 3N28A 4HYYA 4PY2A 2WF8A 5JROA 5F9HA 1KJZA 1DCFA 5CA1B 2AOUA 4RD2A 1IM5A 2O7SA 3K0AA 4RK7A 4E11A 1IDN1 1U4SA 2BDTA 4JSYA 3JZIA 4W5QA 3G6WA 2P78A 5KSOA 5KMGB 1POXA 1QG0A 4UM8B 2Q5FA 3BWBA 4CQJA 1ZRSA 3BULA 1OLUB 2X4IA 3WJ1A 1LU9A 2GK4A 2YIJA 4EVQA 2CSXA 4PF1A 1RACA 1AKUA 3MCZA 1RHMA 1R3UA 2FFBA 2OHGA 2ZRFA 1HH4A 3JXEA 3D8NA 3ZN2A 4DTCA 2P5TB 2MJLA 4RSMA 5AW2A 1KQ3A 1UXKA 2CVFA 2Q21A 3KFLA 1KFCB 4Z3KA 3OETA 2XMZA 1GYQA 4YP5A 2O5CA 1MABA 3RHZA 2HF8A 3U3DA 3VSEA 2FZLA 1CS0A 3GJ6A 3HLTA 1UKVY 1YAJA 2E4ZA 1SCKA 3ZE8A 1OF1A 4OHXA 4FGUA 5J47A 4UXHA 2JI9A 3ZKAA 2C83A 2QTCA 2LIPA 621PA 2YV5A 3MQ2A 4JP3A 2BBSA 3MIIA 5KYNA 2GBCA 3QQ5A 5CYOA 4BAZA 5FQOA 2PZAA 2OBYA 4Y6QA 5SYAA 1IXYA 3F5DA 3KD3A 3AY6A 1EQ2A 4RMGA 3T3MB 5IFLA 3EPPA 3OJCA 2DU8A 2G04A 2VWQA 4K6OA 2JRLA 5TJ9A 1O9BA 5DH9A 1UCFA 2PKCA 3KC2A 2EZ9A 2PZKA 4Y6PA 4Q7LA 5BN1A 1SD1A 3I23A 4I1UA 3BIFA 3GBSA 3X1JA 1NR1A 2FKAA 3QE0A 4RAOA 4RKFA 2R60A 3R41A 3L84A 1E79D 1YZQA 5BV0A 3L0IB 3CXRA 3PR3A 4WEOA 1G20B 4MKIA 3ZEAA 4KN6A 1R5OA 3WRYC 4E4TA 2OHOA 1L5RA 4I5IA 4XD7A 3UC5A 4N3GA 4K2AA 1DQSA 3JPWA 4OMCA 3V2HA 1Z37A 2X9GA 2QP9X 3J81A 2ZIUB 4HPWA 1UQUA 5EJEA 4CU5A 1P81A 5JAOA 4GXRA 2XVXA 2VQ3A 4QPNA 6ABPA 1M2EA 3C14C 1D2GA 1KK1A 5BUCA 3PDIB 1Y63A 3SJZA 1H6CA 1JSLA 1FA9A 4F6RB 5AQ1A 3NALA 2DETA 1L1RA 4FC7A 2BMJA 1PJSA 2Q5EA 3N6RA 4C7JA 3LIIA 1M7GA 1Z18A 2PPVA 3GH3A 4DCOA 5IDWA 4PLYA 1I7SB 4L3WA 4D42A 1RBQA 4P32A 1S9DA 1KMIY 5LP6B 1S89A 3PKJA 1EGQA 5KJFA 2J85A 2WICA 2GCGA 5FL7A 4OKNA 4ZVLA 1JIVA 1ULZA 5IJXA 5JJBA 4OQMA 5A5EA 3S5UA 2DBVO 4N0QA 3P9YA 1AGPA 1H93A 3G0HA 4GI1A 3R7WB 1X7YB 4GOXA 2C29D 1G8AA 1QCYA 1TJNA 1QV9A 4J6FA 1KMMA 9ABPA 1YTUA 1NP3A 1V5WA 4LVCA 2ILTA 2MYTA 3FB1A 1FTNA 4OB7A 2C2ZA 3SC2B 4EA6A 4DJFC 4L9WA 4BWVA 1YDGA 2CVOA 3GAMA 4BRWA 2CMGA 4S3MA 2GD0A 4DLYA 4M9ZA 3A9WA 1JZQA 2VDKB 4K6CA 4UQOA 1RU3A 4CCAA 1NXVA 2IUSA 3LPAA 1JR6A 2EJTA 3QXSA 4P53A 3PDWA 3GA0A 4L50A 4UJ5A 1R2QA 2FN3A 2X76A 2B8JA 3GRKA 4CQMD 4RU1A 1TYEB 2DRIA 3IUPA 1LC0A 3F1KA 3L8YA 4JYCA 2PMWB 4BFYA 5ITZB 1OH7A 4DR6B 1S2NA 1W2WB 2XBUA 3R40A 2EVWX 2JLRA 4HAZA 5DOZA 1OVMA 3GNSA 1UBTS 3ZWPA 3ICWA 3TLKA 3TPFA 1PT9A 4RK0A 2JRCA 1CS4C 4GQAA 5FR2A 2XUDA 3D3NA 3KT3A 4EA8A 4G97A 4YR9A 1ZRHA 3SM3A 3AFHA 4D9JA 2KBEA 4FHZA 1U2GC 2EU8A 5H80A 4FD2A 3KSAC 4XM2A 3RVQA 3TDNA 5F51A 1IIBA 3VJMA 3H6HA 4G67A 3LXMA 3USCS 4ZMSA 2WNHA 2JVJA 3MELA 5TQ2A 1Z07A 2JFNA 3G2NA 3KJIA 2AHOA 2PX6A 2H52A 4GX0A 1UKYA 2E0IA 2VDWA 3MUOA 1CDDA 4UNQA 3NHFA 3SJAA 1Y3BE 1A5AB 4Q39A 4KVFA 4B2IA 4XSHA 4DLBA 3U39A 3GG9A 3BK1A 4TN1A 3VVCA 1U1FA 1P7WA 4FGWA 3QLUC 4G0UA 3EIOA 1PYDA 5FBKA 5H9WA 2DERA 2VK1A 3MM4A 4ZT4A 2ZJFA 5ALZA 4QOHA 3L7IA 1ZKDA 2IUFA 4E2YA 4P7KA 4OHYA 2NOAA 4C03A 2F00A 4BIMA 4BU0A 2QL7A 2XE8A 4R4JA 3V3KA 2O5EA 1JZSA 4H3KB 2JHFA 1Y8AA 3F97A 1NKVA 3LGSA 4QECA 5IAKA 4BV9A 4KO1S 5TQ0B 5ALIA 4F97A 1M2WA 1OU0A 1V8ZA 4WASA 1ST2A 2BT4A 2G4VA 3DBLB 2FFHA 3LDAA 5DHSA 1GU0A 1W5BA 1FY2A 5CVUA 4H16A 4E1AA 1MHPA 3AEKA 4CETA 1RLTA 4PO8A 4DBZA 4IZHA 4B3JA 1QIGA 3VKGA 3SE7A 4MVWA 3VYTB 1L5HA 3I9KA 2Q9CA 5GAJA 3BRWA 4A0FA 3KD2A 2GXQA 4PCLA 4P33A 1EFUA 1FDWA 3HCAA 2AOTB 4LISA 2WAAA 3HB4X 3RYFB 3FVWA 4D8XA 1OLOA 5K6AC 2GM9A 4PZYA 1DQNA 3TMKA 4BLTA 3AR9A 2O50A 3F6EX 4QYIA 4BBAA 5LLTA 4JU8A 1Z5ZA 1RFLA 1MRZA 1N2OA 1FUYB 3O4HA 1B16A 2ZJ7A 4B3DA 1A82A 1NLUA 2NPOA 2QNBA 3CBQA 3IHWA 4LQCA 3S2FA 2W11A 4GBJA 5KHAA 3SICE 4GZLA 4JBWA 1VE6A 1MC4A 1WHTA 2WQZA 3KEFA 1R6BX 2ZIXB 1Z2CA 1U3DA 1FDRA 3H9UA 4QSHA 2QU8A 3AF5A 5DHPA 2I9PA 4ZZIA 4U7TB 4JXXA 2CE2X 3FHCB 3VU3A 4UOZA 3I62A 1Y9DA 5EP2A 3JQCA 1C7FA 1Q16A 4CI0B 1H22A 2Q3CA 2PSJA 3LKVA 5IMBA 4CYMA 3WZLA 3EWNA 4H31A 2PLWA 4P3KA 1VG9B 2ZYWX 2PJZA 4MVJG 1E77A 3Q0IA 4MAMA 4PX5A 1CRWG 4NZYA 2ZWAA 3DGFC 5LLDA 2PMKA 2PR2A 4MKRA 5CTAA 3WISA 1VSBA 2QAJA 4MGIR 4NU0A 1M2JA 5BVHA 3RC2A 7ADHA 2V3CC 1Y1PA 3B3AA 4X64B 1CUJA 4LK2A 4GX1A 4ZP1A 2I2XB 3LUBA 2QS9A 4KAFA 2J08A 2Z6QA 3AUUA 2GO1A 1ABEA 2QROA 2VF7A 1N2CE 4DILA 2WF6A 1EQAA 3RVOA 1QP8A 3ZDAA 1UIRA 1SWWA 2QG6A 1X7ZA 4R3NA 4E0BA 4OU5A 1A2BA 1EVLA 3EC2A 1X1DA 1KI7A 2ZVDA 5FTJA 4S35A 3RIGA 2LP4Y 3HUEA 2POCA 3N2IA 5A3VA 2X22A 3PEFA 3ZHBA 4A4DA 1GAQA 2OZLA 1NN3A 3MF4A 1MB0A 3TJRA 3D7RA 5JCJA 2FPGB 1USWA 4NY1A 2F8MA 3NAZA 1YDFA 3IEIA 1TAQA 4LVNA 1M2NA 5C3MA 2FSVC 5C34B 5AUNB 3AV3A 1GIAA 5DBIA 2RGGA 1JDSA 5CDUA 2HLDD 3LCRA 1N6KA 2Q4TA 1I24A 1QP4A 1D2CA 2BM1A 3PZRA 3T7TA 3CRW1 1W88A 2DUNA 1W1UA 1P2DA 3IT3A 5TEVA 3QFSA 3VZQA 3OFND 4JP8A 2WKSA 5ED0A 2C4MA 2EGHA 1D0VA 2X8JB 5DWQA 4QVGA 5KVCA 1P91A 1H5NA 1OASA 1OVGA 1S2MA 1E4VA 4LJ9A 4XLLA 2SKEA 3R75A 2NMVA 1ZXBA 2WC1A 4K6HA 4M36A 3IV7A 4KR6A 2VJMA 3PJRA 2WP8J 3F6PA 4GSYA 4YRRA 4F93B 1WZ2A 3I2HA 1MIHA 1V47A 2DJ5A 2RFLA 2HMYB 4MV8A 5CM2Z 4JVOA 1GNQA 1YQEA 4ESHA 3JQFC 2DBRA 1PJ3A 5G4KA 1P2GA 3MA0A 3WIVA 3IAEA 2E18A 4KE7A 5TQJA 3U4MA 3RF6A 4A6DA 4CIVA 2IOFK 2NYAA 3VQTA 3IMKA 3C74A 4JT9A 2FOLA 2R6CA 3UK2A 4O1MA 5BSKA 4MRVA 3FWYA 3A8TA 2ONYA 5SICE 2BI7A 5LZ4A 2EW8A 4Q4HB 3NDJA 5T3UA 4Q37A 1N0UA 1YFZA 1TC2A 3MSCA 1SZJG 2C9ZA 3RABA 3ZI4A 4XFKA 4BMPB 1FFCA 1FXSA 4L1KA 1JIKA 1T36A 2YBEA 5IASA 3KETA 1V71A 3RKUA 3K73O 2WHPB 2W2LD 3SLKA 2BR4A 4E15A 3IUBA 4I36A 4LW8A 1JEDA 2GARA 3H0CA 3IP9A 4M1WA 4TXLA 4Z1MD 2X23A 4JUIA 2HY7A 2I87A 1ACJA 3CH4B 3I05A 4P08A 3TI7A 1A96A 4WFQA 4ZYUA 1VRWA 3HP1A 1GP2A 4U6QA 1Y9AA 2PVCA 4ZQFA 4LSWA 1YR2A 1QHNA 3EXAA 3KL4A 2EFHB 5EJIA 2I99A 2O8NA 1U7DA 2CDCA 2JI7A 2P2DA 2GWHA 3LECA 3OOEA 1XMOB 3FWKA 4KIWA 1AUVA 2YICA 1JR3D 3TZKA 3WGTA 4MVYA 4B6QA 2D5CA 3CW9A 1MT3A 2LUOA 4RF2A 4TKVB 1R3DA 1T9GS 4RZUA 4BUCA 2CBXA 2F7SA 2NUPA 2I4RA 5KSWB 1CK4A 4TV9A 3L5KA 3USES 1RXWA 3DE6X 4ZXPA 1KMQA 2JLVA 2ZBDA 2IE8A 1XYGA 2FCAA 3EVBA 1J9GA 4Z1OA 1E1MA 2BUBA 3CZRA 3I9FA 3ND5A 3WL3A 2XX3A 1ZOIA 3C1AA 1J24A 2O57A 4G9EA 4C6RA 4M60A 3D4NA 1X7WA 1ONOA 4L8FA 1DFGA 1Y33E 2A14A 3DLTA 3PE3A 4B71A 2ZBEA 2FSHA 5ECYA 4YXWA 3U44B 4K1XA 4YUWA 4ENRA 1ZJYA 2GBPA 2GPJA 1N3YA 2JJYA 2P68A 2R84A 2UYGA 2WDZA 1JGTA 2YWDA 3H99A 1GA4A 1OWMA 1QIFA 3IXQA 2IIBA 4YS6A 4IKOA 1NP6A 4ZD6A 3N8KA 5H68A 4FP9A 4BMXA 3I4CA 5J2UA 4R41A 3QF4A 4KHPB 1VTKA 3NBXX 2Z95A 3E70C 4J1TA 4FE4A 1NYRA 1SXHA 1YU9A 4YQZA 4XIFA 4IV5A 3GPDG 3HUFA 2NXNA 2F1HA 1CYDA 4G89A 5AJZA 1XYYA 1YZKA 3AP2A 4CBVA 4PYJA 1UAAA 1TIBA 2IY7A 2G4CA 3E3OA 3O7MA 1U3TA 3W6PA 1B23P 3ETCA 2HTEA 3SIXA 2IXDA 2HK8A 1IONA 1PFKA 1QKJA 3CEAA 2IWRA 1P80A 2PHZA 3K32A 3KZXA 4AX4A 3ZJVA 4PO9A 3MERA 5JQGB 2ZE6A 4ACBA 4TTJA 2R65A 5AVVA 1ILEA 4P3YA 2PMDA 3FUXA 2YTZA 4OXYA 3QEAZ 1Q0TA 3V55A 2JLXA 5EYPA 1ZG3A 3FJOA 3G9TA 4JH0A 2FLVA 1P0IA 3P2YA 3W8FA 3GI1A 1X1QA 3F9IA 5ICEA 2W2VA 1QS0B 4HKTA 2E5LB 1SQ6A 1MJGA 4XB2A 5TPWA 1SHTX 2A92A 1AV7A 2PX8A 4BB0A 2G77B 1OI7A 2QIPA 1O95A 1W9MA 3TS1A 1AS2A 4QHTA 1YQDA 3BDIA 5JANA 1NBWB 1PEKE 3A9UA 4JLNA 3NIDB 1XQYA 1ORVA 2WIFA 3PX7A 4LF6B 1NFQA 4EGSA 2V6FA 3ZWXA 2X58A 3IP7A 3A1CA 3PGMA 1NUAA 2ZBVA 4OAQA 3B6MA 1F3OA 3OX2A 5KI6A 4RCVA 4NG5A 4P5EA 1LNQA 4HBGA 4MYUA 4O8ZA 1WDLA 3ZE7A 1T43A 4B35A 4B80A 2FDCA 1EUYA 4O3MA 1ZK1A 5G02A 3N2LA 4OK5A 3AG6A 3M4JA 3H19A 2VG8A 4KK3A 5T4FA 2ZE8A 5C8YF 1T4CA 2AUTA 4WNAB 4CMCA 4UULA 1QYIA 3WZ2A 5BWBA 1HDZA 1J2JA 2HCFA 4MUEA 5CFQA 1ZK4A 3QXGA 3ZCQA 4XGRA 3PFBA 3TE6A 1AKWA 1I6MA 4POAA 3ZQ6A 4FEYA 1DKUA 3UMJA 1NVBA 4CLOB 1JHDA 2O7NA 4AU1A 1HKHA 1D2NA 2GTIA 3H83A 2CMDA 4GPIB 5AJHA 3ZH9B 1PL6A 3RK0A 5DM60 4NBSA 2MSDB 1E1KA 3KM0A 1MC5A 2P35A 4C14A 1TE2A 3FMIA 3C3YA 1TQDA 2CMFA 1AK1A 1RXYA 3KCQA 1WVMA 1EP9A 2FMXA 5J9FA 2N47A 4HB0A 4JMLA 1XAIA 1W30A 2Z56A 1ZR2A 3I39X 2PE5A 5BN4A 2VT6A 3UKJA 4EB8A 4PC7A 1JS1X 3FDZA 5AVUA 1AOXA 2TS1A 3CISA 3QKIA 5FO1A 3KB8A 1ZP6A 1G8GA 1ZGCA 3QKWA 4Q5IA 5F35A 3MMNA 5HPYB 4Q3KA 1VYVA 2I9KA 3OTGA 2OB2A 2PSSA 1OKKA 3EXHA 1BQ3A 5DTEA 4DCTA 3UWOA 2HXSA 2PO5A 5LDGA 5LFAA 2J3IA 3Q40A 2NGRA 3RTGA 3TTYA 4BV2A 2ZJ4A 3R9KA 1YRYE 3P9PA 3FCUB 1W93A 3KTAA 1GA6A 2XCSB 5BR8B 1L4NA 2GM5A 1OJ7A 1QZXA 4JYAB 3WKAA 1LQUA 1RYHA 2JCSA 3JAWB 1M34E 3BH0A 1HT2E 5I7VA 3V8VA 2BISA 2Y66A 4TMKA 2VSQA 3D4BA 4NNJA 3V7UA 2AKAB 2AJCA 2UZIR 3B2QA 3JYQA 5AI6A 3L49A 4JOSA 4AAYA 5A6VA 3M5WA 3CWQA 3PP8A 1WQ4A 1CR1A 1THMA 1Z33A 4C0QC 3DS8A 3TW4A 5FOQA 2HCTA 4MYTA 3NGLA 4ALJA 2QKYA 3OU6A 3K6RA 3H3FA 1YZFA 1DBWA 2H2AA 4D9IA 4YP9A 2WABA 3F90A 5JZ9A 5K20A 2XKJE 1XJ5A 2H2DA 2IPOA 3L4BA 3TDKA 4LHSA 3O90A 2WFLB 5CRIA 3R7NA 3AI1A 4Y67A 1JF8A 1R50A 5IM5A 3RRMA 4BO3A 4UE3S 4Z2AA 3M1IA 2ESRA 4A8TA 4YIHA 1WU8A 5D6OA 1DC8A 2Z9CA 3Q87B 5F4BA 2PUFA 3S55A 4UQLA 2YWBA 1OA1A 1XCOA 2WJAA 4QYSA 2P41A 3EG9A 3O3OB 2XE7A 2EX1A 4GE3A 2JFFA 3AKCA 4BJ1A 3WLHA 4OJTA 1HRKA 1P39A 3LYHA 1NJGA 3ELWA 2DPYA 1CY7A 1L0BA 2FDRA 3GDOA 3MWDA 3KWFA 5CCXA 1V6AA 1DADA 4QU9A 4WL0A 4IRMA 4WKBA 7MDHA 3D2AA 5AM4A 1UOPA 4I81A 1KI4A 1Q1ZA 4N7RA 1GG9A 5F5XA 1BIFA 3IAS6 4PLHA 3N75A 3GQVA 3HU1A 2AZTA 4HAOA 1L3BA 3WGQA 4DUPA 3LT0A 5A5VA 1VBMA 1XMJA 3FCOA 1E2NA 4MB6A 4IDHA 3NIWA 1SZDA 4INPA 3GFVA 4BNNA 5EJ4A 5DLEA 2HSGA 3JPYA 2WZCA 2WAXA 4EENA 3M6XA 3OM9A 2GFIA 2FI1A 5F9FA 2F6RA 4PSKA 2O2IA 1C9KA 3NXSA 1Y7IA 3KEMA 4G07A 1YVPA 3L6EA 1WKCA 3IDOA 4X24A 3EOBI 4QQ8A 2FP4B 3EWIA 4XGNA 2QTVB 3EA4A 1JAZA 1UZUA 1T0UA 4Q01A 1KHTA 1V3UA 4YDRA 2P0YA 3GFPA 2B8NA 5E7JA 3VVMA 3IEVA 4BECA 5C35A 3MD0A 1XCBA 2IDMA 4EPTA 2G06A 1KZYC 2BCEA 3UMVA 1JXQA 3RNOA 3VR4H 2D0PB 1VPDA 1E3IA 1WV0A 2Y0EA 4IJQA 3U7QB 4ZJYA 4DBLC 4Y2VA 4M37A 4YQFA 1ISGA 2XTNA 3IERA 4AJPA 4C0JA 1KDVA 1BDBA 5C1OA 1CUDA 2Q4DA 4BYGA 4DLTA 3OAAD 2EIXA 4X8LA 3N2YA 5JXWA 2CKMA 4YMSA 3PEYA 1AN9A 3CH5A 3N9IA 5HKLA 3I6IA 3UW1A 1Y9EA 3QJGA 2JGLA 1T0BA 4PBTA 4XPIB 2ENUA 3FH0A 3TLCA 5DHRA 1ZVJA 3AUFA 5AVKA 4TLEA 4CMEA 1U0FA 2CLHB 4WV3A 5TEWA 1G2PA 1KVSA 2G70A 3V4ZA 4A5SA 4AI6A 4UBNA 3E0XA 1DL5A 1X15A 3DHYA 4I55B 2OC9A 5JHGB 2X8BA 3MPOA 3REQB 1YCGA 3PCRB 1NW3A 2QSYA 1OSNA 5I7FA 4LWQA 5IZ4A 1AUPA 1QIHA 3ASVA 4G0XA 4KQJA 1CU1A 5YASA 1G3IA 4G41A 2IKQA 2PFSA 3ZXXA 5HF9A 1TGYA 1FFXA 2PXCA 2WJZB 4KH1A 5GZ3A 4WIAA 4MW5A 2O8EB 2F1OA 2Q4BA 2AMJA 2GEDA 2YOGA 2ZI7A 3ASUA 4RHFA 4WCFB 5AXBA 3TCKA 1ZH4A 2C1ZA 2E4UA 2FMHA 2FKNA 1CRZA 4IQ4A 4DCGA 3ET4A 4BNKA 3MW8A 4K5QA 3AVOA 1L5KA 2BR3A 2EWMA 3U60B 1YB5A 4AP9A 2ZE5A 4MIEA 1TTTA 2C54A 1H4VB 2FZGA 2EDCA 1Q21A 5DEOA 1XN1A 2FYTA 2NU6A 3RRXA 4CRWB 4OIMA 1M72A 4ZA2A 5TPZD 4WACA 4Q3BA 2YMLA 1CV2A 2M1ZA 4CIYA 5FA5A 3UQZA 4IVQA 3IKVA 1T9BA 3H4VA 4H08A 6LDHA 2C7BA 1UBEA 4Z9BA 3A1DA 1QIEA 1NJ6A 3E1KA 1I3NA 5JEDA 2NV0A 1GLVA 5KTSA 1O03A 1IY1A 2PUGA 3NQ41 3CLTC 4G0WA 4D4KA 4RHEA 3ACDA 5LMCA 4IY1A 4L5IA 3WA7A 4DAEA 1W8DA 3ZTWA 4EG1A 1FYXA 2KHZA 5CNIA 1T9CA 1ZOPA 2R8PA 4QJIA 3W5AA 4TS9A 5DGHA 5DT9A 1H3FA 2A5FA 2W2KB 2VBCA 2GXAA 1BXRB 4RA6B 3IQZA 4FWBA 5AKHA 4F96A 3VZCA 2FWRA 1HI9A 1N7JA 1WEKA 1DUSA 1GVNB 1QSGA 1RLUA 1S96A 2UUCB 3U13A 3QBVA 5AKYA 2INGX 4HJRA 4HSGA 3VR5D 1ODTC 5DCUA 1P4GA 2P27A 4NAUA 4KL8S 3ETJA 1WSAA 2Z4SA 3C5HA 3I64A 2XADA 3LRXA 4EQ6B 4P3OA 4GC5A 3VR0A 1W0KA 2BC9A 4W8HA 4EEZA 4BC0A 1V1MB 3BMXA 4Y2SA 3QX7A 3VKUA 2WY2D 1TEZA 3DLHA 1ORHA 2H08A 1CTQA 3T9FA 1NFFA 4XQGA 3ZJ5A 4J2TA 2AIRA 1WMFA 3RU9A 2HWXA 4WTOA 5T64A 1JBKA 4CUZA 1EFCA 3ZJYA 2O2GA 4O63O 3QUTA 4MQBA 2JANA 1C81A 1EIWA 3KQUA 4M22A 1D2EA 3GCDA 3LP8A 4HGQA 3WWOA 1E60A 1TQHA 1TF5A 4D9KA 3TLEA 3U5TA 4YLEA 1JQ3A 5LMNB 1D0IA 3STYA 2X0RA 1Q7CA 2YS6A 2EFEB 3TPCA 2YN4A 5JT1A 3H9CA 3HRHA 5KNLA 1I9GA 3HCDA 2H0QA 4GI5A 4E88A 3MRXA 1JH8A 1W85A 4LN1A 4COOA 1II0A 3EB9A 3EH1A 1YZYA 3E5HA 2VR1A 3K1JA 4IHQA 4LGYA 1NVEA 1PI3A 1XXHE 3DJYA 4L75A 3UV3A 3RYIA 3ZV4A 4KGVA 1QOZA 4G2TA 2PT9A 4KX3A 3K4HA 3G7UA 4M1SA 5EJ9A 2YZ7A 3X2EA 3DP7A 1T5OA 2AC7A 3W9UA 3TF5A 1J33A 4JLAA 2B1JA 3E2IA 5G4LA 3U7JA 4RVOA 1PUIA 1K7CA 2GYWA 2YHSA 4N8EA 4EG7A 4WGFA 1ECFA 1DC4A 1DUIA 1XZCA 5KDOA 4GICA 5EHNA 2DJIA 3E7DA 5LUBA 2PL9A 3FHJA 4QUBA 3QLTA 3NHMA 3G0OA 4HLCA 4BNYA 1QPBA 2BEVA 3ZNPA 5ALNA 1V9CA 2H11A 3AHGA 4X71A 3PNMA 3C6KA 3HVJA 1B1CA 2QT0A 4YALA 4AZ0B 5DASA 4ND1A 2HSWA 4LEIA 2YFKA 1QFJA 4IXMA 5L3SA 1N57A 2CKDA 3FBGA 3UO8B 4ALKA 4CNQA 3H1TA 1J5XA 2GESA 2BZ1A 3HDJA 1Z2NX 4TKMA 4P92A 4YI3A 1XPUA 5C37A 4I1PA 1PQ4A 3RHTA 2RHGB 1A9OA 4D0NA 3KJGA 2BTEA 3D1VA 5H5JA 1DC7A 1NXOA 2P8JA 2P5UA 2CNDA 3ADOA 3MT7A 4QJBA 3TZHA 4GNKA 3W2GA 4YAFA 4KZKA 5F7JA 3GWZA 1M6NA 3HV2A 4BWFB 3N7AA 3AKDA 1XQWA 1PJCA 4RSRA 3TNDA 4UBJA 1J07A 3CLVA 3NDIA 1ELOA 2QTMA 2PH3A 3AMVA 1ZI8A 3NCHA 4CMIA 3K1ZA 3ORHA 4URZR 2HRCA 1G8SA 3I9OA 4M9UA 5LU8A 1H23A 4K9QA 1A88A 1PD1A 1V96A 4OB6A 1K3TA 4J7UA 1YKGA 4XE5A 4ZTUB 3K70B 1ICIA 4FN5A 2ZUVA 1CX9B 4KYTA 3I72A 4QGSA 1RQ2A 1TCCA 3W6UA 1BGXT 5FTKA 3RTBA 5JMPA 5BQFA 3IULA 3CKYA 1KK0A 2D7JA 4K28A 3OZCA 1EIZA 4P4SB 4I66A 1PFGA 2W2QA 3FYUC 3SZRA 3V1YA 5IMSA 4MP6A 2H1RA 1K8XB 2BJWA 2GMWA 3BGDA 5EP3A 1BE1A 1IHXA 4O25A 4J1QA 1MD9A 2D74A 2D1TA 1H2YA 3IAM6 4KCGA 5ILGA 2GJKA 4NDAA 5D5PA 3FOZA 3W9BA 3KQOA 4R68A 3OT1A 4EPWA 1H69A 1LA2A 1TKRA 2IZ5A 3TQFA 3DVSX 1RR6A 4EYSA 3WS7A 2VT3A 4YAIA 2RKBA 1JFRA 5T67A 3MGCA 1UL1X 2IGTA 3BICA 3C7CB 1JG7A 4ND5A 1GSAA 3RS8A 4BNJA 2WUGA 3DKRA 5KYGA 2QY9A 4AFNA 2QRKA 3C6MA 3PTLA 1EPUA 5JNLA 1U3FA 1C80A 1NW9B 4RULA 1E3DA 1GQYA 3NORA 1TQ6A 1EM6A 4IVPA 2F9FA 4F9FA 3O8NA 1J56A 2IHYA 1TJ3A 3K53A 1Q0LA 3OQOA 3M49A 1AKQA 1P5JA 3H2JA 4JJKA 1UP7A 3GLFB 1IUKA 4LJ8A 3MTIA 3HEMA 3OTWA 3TLMA 3IPYA 4HYEA 2P2CA 3G8AA 5DM1A 1J09A 1CVIA 3WQSB 2QQEA 4QQFA 2GLTA 3ODPA 2EW2A 4MEJA 3A11A 3CF4G 4WECA 4HGOA 1ZCFA 2OM6A 1P1RA 3CWCA 1JFTA 3OX4A 3H86A 1J90A 1FUIA 4I5DA 4BZZA 5J2TB 4GL2A 2XMBA 3FUUA 1HDCA 3PQ4A 5EWLB 4O2RA 1WP9A 3KZVA 2R5WA 4HEA6 2JLQA 3N2NA 4YRQA 1CZUA 2WSSD 3BF8A 2JS7A 4FB4A 4II7A 5B64A 3HUUA 3GC6A 2EZUA 2XWJI 1F0KA 2M6LA 3ZV3A 2B1QA 5MFZA 1ZNWA 1HQDA 4BEJA 3KSDO 2IL1A 3C3MA 1IQ0A 3PSAA 4E4YA 1HDXA 3DE1X 2IYNA 3T4UA 3D1JA 1DT5A 2HFJA 2GHRA 5EZ5A 3T4EA 3COYA 1KEVA 3TTSA 1SB8A 3H5RA 1BW9B 5LN1A 1MO6A 2Q6KA 3OPMA 2CFIA 4JX8A 4RZHA 2XYGA 1K92A 1FSFA 1AZTA 1QCDA 5KYXA 4PIPA 5IM4A 2BE7A 1TLTA 2BW0A 2I5PO 4FS3A 4ZICA 2CHVA 2ZQZA 3E05A 3LPCA 2G8LA 3IA2A 3OEED 3EHEA 4IIDA 4JUAA 5HF8A 5HNKA 3SYNA 1X1SA 1TVKA 1C3EA 1RQRA 1SHKA 3FFBA 4U2CA 4ETMA 4J07A 3X1DA 1EBBA 1NUHA 2IZOA 4K9MA 2WD7A 4F11A 2K2WA 3WMXA 1EGVB 2GBLC 3CT4A 5T7BA 2NZUG 4EH1A 2WYUA 4G01B 3CW2A 2AOVA 4I9NA 4K40A 4M9RA 4MW0A 5C4GB 1PO7A 3QFRA 1F38A 2V7TA 3IPCA 1CEYA 1LVHA 1LH0A 4Y1FA 3RC7A 2XPCA 4B73A 2XMRA 2DFDA 3O38A 2OZPA 3BJIC 1A9QA 3GGSA 4L15A 4CV1A 1GR1A 4MYRA 1V1JA 5COQA 1CR4A 1NZJA 4IJ6A 3DBHB 4HADA 3I9MA 2XMCA 2VPIA 2PD3A 4WW0A 2Q5CA 3L0SA 4I1SA 1EM8B 1Z8FA 3BFVA 1FQJA 3M9XA 1IXSB 4IMIB 2K5UA 2VUSA 4CMHA 2AUMA 2WTNA 3CF2A 4DEXA 2O8FB 1RMYA 3TXAA 3SAJA 1Z4NA 5A9SA 1N6RA 1R6AA 4DA9A 2PAAA 1UKAA 2PH7A 2UV8A 3G2MA 3K8YA 3G2OA 3QVMA 4IDGA 5DNWA 4CTNA 2YR0A 2RJNA 4OQEA 1XNHA 2XXBA 1YIAA 3GFGA 4JHLA 2AOUB 4K9OA 3BL6A 4MQFA 1ABFA 4MB0A 3LUGA 4KO4S 4OK3A 3HFSA 4C9BA 4BN4A 2ASEA 2O5RA 2Q28A 5EGNA 3QWBA 2PT5A 1VJGA 3B60A 1T9GR 2BEWA 3I32A 4REQA 1PQPA 3KUKA 1VMKA 3ZV5A 3TLYA 3GFBA 4BVKA 3CLSD 4A6EA 5HSGA 1FFDA 3RQSA 2DUWA 5FD8A 1KDYA 2A0YA 3DM5A 5J4LA 3OIWA 1SUSA 1BVHA 6AT1A 2YNMC 3IALA 1AH2A 4PYNA 1SVSA 3GFOA 2WPDD 4JEHA 3TGLA 3DP9A 5EXDA 3ME5A 4OMFG 4PPNA 4CKXA 1RM0A 1JHMA 4BEWA 3J80A 2AFIB 3DLPX 1UPUA 1MABB 2G1AA 3MWJA 1G2QA 1CS0B 4GSLA 1AKYA 1UKBA 1WMSA 1Q2UA 3SC6A 4Q24A 1EKXA 2G4LA 2PGLA 1ULUA 2NV2B 5ARDA 4FYYA 3GN1A 3L93A 2FPIA 4N5LA 1HZJA 2QVGA 3KJQA 3LS2A 2AR0A 4O2AB 3PC4A 4PYIA 5IS2A 4S1PA 4D26A 3DFMA 3W2EA 5K2MA 2ACWA 3WKDA 4CQNA 1VHTA 1VOTA 1YL6A 3CPEA 4CEHA 1RI1A 2VNSA 2JJ2D 4IGAA 4C06A 4LOIA 3G17A 3M33A 3UHJA 1JJIA 3U3ZA 2HA0A 1X1RA 4JL5A 3AJ9A 3CLRD 3AY0A 2PZEA 4O5AA 3AB7A 2WLSA 2BHTA 1J39A 2I7CA 4DZTA 3MCVA 5EI5A 3N2ZB 3Q7IA 1EK6A 3J7AC 2PAFA 3TR5A 1F8YA 4DG9A 3HM2A 2XMDA 1EVZA 4M9SA 5K4GA 1A8HA 3IIKA 2R4TA 5FUQA 1F7UA 1CP3A 2W2MA 2Y0PA 3PITA 4Q03A 3CZ9A 3B5IA 2EIHA 3PUVA 1G4UR 5CXXA 4B0PA 4FMDB 5HUJA 1CSEE 2XY4A 3MTAA 4AQDA 4K0RA 5HILA 3VHQA 4F9EA 4DR4B 5H1YA 1GO2A 4DC1A 1WS6A 1ICEA 3LQYA 1FCJA 1IFXA 3DAOA 1VKZA 4RVUA 5FJIA 2AN4A 2AJTA 2IS4A 4B3TB 1L8XA 3DZFA 1M8JA 4PXAA 3H1BA 2C96A 4LJYA 3D43A 3INNA 3MUFA 1APBA 5K8UA 3T3EA 4ZOQI 3DGEC 3TH5A 3UJ3X 1FDVA 4JUBA 3E8SA 4PPQA 3TXYA 4E2WA 4WJLA 4XX0A 3I1JA 5HCNA 3DQPA 2FPPA 4R31A 4WK0B 1E9FA 2PUWA 2XODA 5ERXA 421PA 3W1VA 3ZQUA 3PLAE 3BD6A 1R0XA 4IIFA 2QG9A 2J6BA 4V38A 1S02A 1NBHA 2PEYA 4WXYB 4MKHA 5L7TA 3VX3A 3UBTA 2C03A 2WKPA 3D6UA 4LS3A 3A4IA 1DAKA 1C3OA 2DWQA 4GVLA 4N5MA 4NYIR 4NS4A 4CM8B 3ZY2A 1K6IA 1L7QA 4KPGA 3NC1C 4TKZA 4IV0A 4QOEA 3UKOA 5BW8A 1DT3A 3GIDA 3DEYX 3WV4A 1TCUA 1WW3A 4C3UA 4K9KA 1TM1E 2Q5HA 4GE0A 4R6XA 3V5NA 5KQGA 1UJ4A 3P0FA 5JC1A 3KQYA 3OE7D 3CR8A 2F3QA 4FDMA 4QRDA 1O3YA 2QMOA 3NHAA 3UXYA 2W9XA 4C20A 4RLSA 3SDBA 3ER8A 2CXSA 4EHFA 5A4IS 1IOZA 4A5OA 2E3JA 3OPYI 4GI3A 4UUAA 1JFVA 3GLTA 3QU7A 4JLKA 2P91A 1NPDA 3EXG1 5BPHA 1MQAA 1NC1A 5JD6A 4MV4A 1KK3A 3IJ5A 4XJVA 3QFCA 4EHKA 5LZ7A 2REXB 4HEHA 4LNAA 4GPBA 2VJAA 5JZSA 2TMYA 1XD9A 2J46A 4BX8A 1FYFA 2KI5A 2B4YA 3T12A 4B0OA 2GF9A 1C5KA 5HDBB 3GL9A 1E99A 5JJ5A 3R4VA 2HC9A 2VHJA 4GMFA 1QIMA 3SYMA 1N1DA 2HGSA 3KWLA 3OZTA 2XE6A 4HATA 4D9FA 2O07A 1L5WA 3KS9A 2R7AA 4F1WA 2Q99A 2XOEA 2C9MA 3PQ8A 3ND8A 4JB3A 3QX3A 4F0JA 1AM4D 2J3DA 1GUBA 3NIGB 4L8LA 4M8SA 5HZMA 2KLHA 1Z4JA 1Y7LA 1R0KA 4IICA 1EE2A 1L7RA 1P0PA 1KVUA 1YDWA 1YIDA 2VDWB 2K7ZA 2PGJA 2X0KA 2XHZA 3AUSA 3M0EA 1NBAA 4FYHA 3T34A 3UA4A 4R83A 4X20A 1MF7A 3GD7A 4YCMA 2VPWA 3OZ7A 2G67A 1DBSA 4RF4A 5CLLA 4RX1A 4DV4B 5DWVA 5A4FS 3KR0A 4JNCA 3M82A 4CODB 5K8TA 3FB4A 4YO7A 1XHEA 4DXDA 1D1QA 3FCSB 4AO8A 2FZ5A 1OT3A 3A32A 4Z4FA 5C3UA 3HDQA 1NVXQ 1LK7A 3PVSA 4US2R 1X39A 1ECLA 1XZPA 5L6MB 3EGEA 2P9GA 3W5DA 5C53B 2XZOA 1ZSYA 1LW6E 3EYWA 4R2MA 2ZI5A 3LO8A 5EKDA 5LMZA 1F2UA 3T7DA 3NTRA 1NPTO 2VK8A 3AEKB 3H5OA 3TBHA 1RIFA 1ULHA 2OHHA 3HUDA 4P0QB 4FT4A 3FIUA 1L5HB 1R6XA 3V4VB 5KUTA 1N77A 1KQPA 1SG0A 1GNSA 4U9UA 2JD2A 1ZD9A 2BUCA 3L7CA 2X5NA 3V7YA 5BN3A 1HPLA 3PI7A 4HQLA 2IKSA 3EEOA 5C4IA 2P5YA 1E3WA 1YUNA 3GPIA 4Z3DA 1UKEA 1A4XA 2YFYA 1Y4DE 3CB4A 1DJQA 1YR8A 2OD2A 1SHJA 4QYIB 3OZSA 4R1QA 4S1WA 3UOGA 4L3OA 4PBRA 1I0LA 2DQ4A 3UWSA 4OUDB 4G4GA 1LSSA 3KALA 1D2MA 3GZTB 2UZ4A 2H6EA 3N59A 2P90A 1JEYB 1F5SA 4IX1A 3HJBA 1TUEA 1AGXA 4WI1A 4D8UA 2AXNA 2W48A 3DEKA 2W2PA 3BWMA 1LNZA 2ZBFA 1WHTB 3L46A 3TCNA 3REGA 3OLYA 4B4WA 2XRZA 1UPBA 1E1QA 2GAJA 3IFSA 4XAQA 5K9ZA 3LT5A 1P60A 3JQAA 1AKTA 2J4CA 5AHWA 1ZD5A 5AFSA 1ZESA 5KOJA 3EMVA 1K6EA 5F2NA 1CEQA 3SQLA 5EVCA 4OJYA 5FPSA 3KOWA 3QVVA 4H1VA 1WTAA 1CY4A 3AFNA 1ZYUA 3NC4A 4QG7A 4JZYA 3HXQA 4QWWA 4YRPA 2VSXA 1G5QA 2D4AA 3CH6A 3E4CA 2WNIA 1PUJA 2DX7A 3SMQA 5BVHB 1K4YA 2FRVA 1YRBA 1JDUA 4G0QA 3ZV7A 1IJEA 1D5CA 1QVAA 3O4JA 1M6WA 2XWPA 3HABA 2C4KA 1ZN7A 1E8MA 3A1WA 5CEJA 2V9ZA 4NE7A 4EW6A 4L8GA 2WSIA 4NJEA 4C5BA 2OZKA 1UMKA 5TNXA 3QE2A 4BU1A 2EX0A 5ALTA 1X7ZB 3KEOA 3NPMA 4IWYA 3T6KA 2ENWA 5LB2A 3V8PA 3JQAD 3CM0A 3OWXA 4ZK2A 3J81k 1CJMA 3AVVA 2I3BA 3TIGA 4DHWA 4XI9A 1M1ZA 2DHCA 4HMQA 5HHTA 3A1TA 5CK4A 4ZVMA 3S27A 5I6DA 5A6SA 4QREA 3LT4A 2ZDGA 1NDUA 1UM9A 3COSA 2D1QA 3E9ZA 1XZNA 4HLQB 4NYMR 1QH0A 1R9JA 2RCYA 3F98A 4WA8A 4HDKA 5JAIA 3THOA 3QU2A 1NJFA 4US1R 1NG9A 5F5NA 4OQQA 3QRWA 1CJBA 5ALQA 3M83A 1W88B 3RVLA 2ZIGA 1SXJA 5F52A 1LI7A 1FDTA 4D4MA 2V7GA 3C7AA 2OGTA 4LZAA 4U4AA 4F38A 1UBUS 2GZAA 3ABZA 3INTA 4XWOA 1Z7WA 4DNFA 4X66B 2VH2A 5JS6A 1V1RA 2GZHA 2QPAA 3PD7A 4M87A 4Q9HA 1YOVA 3EN0A 1K5GA 2XT0A 3OF3A 2ZM6B 1P33A 4LXIA 1MB3A 4C6TA 2VJMB 2EV9A 2R00A 2R2GA 3WLTA 1KI6A 3NT5A 4ZVOA 2NP6A 4M2LA 2F67A 3EVEA 2GSWA 4NCJA 5IEBA 4AF8A 5K01A 3CIOA 2A9PA 2Z4TA 3EGOA 3PXCX 2PA3A 2QM0A 1RLMA 3K6JA 2HJHA 5G4KB 1W34A 4JLMA 3CEJA 3NBKA 4DLRA 5L7WA 4DDUA 3LRTA 1UQTA 1EB9A 3KB2A 4XRRA 4S04A 1S01A 2PNFA 4BYMA 5KHOC 2GEBA 4ED9A 1PJAA 2D2FA 1F0PA 3NKLA 2HJVA 3FKJA 3ECAA 5EC8A 5EMJA 1STOA 3W2IA 3NR2A 2DT8A 4DZRA 5CFOA 2J8ZA 4MVJF 1A71A 5ESRA 4KSBA 9LDTA 3CUWA 3KUUA 1ISJA 1XQXA 2EDAA 3JYPA 1C9YA 4RGQA 5EQDA 3T3IA 4AZ3B 4BZXA 1MQSA 1NT2A 1E96A 2JZOA 2O1SA 5SYMA 4GR4A 1E7YA 3LUCA 4ZT7A 3L7MA 3TBFA 2J3HA 1T36B 1PIWA 2OP1A 1VSUA 3WZMA 1OYWA 2F8LA 4BKUA 4TT3A 3BTSA 3RB8A 1EG2A 4EUKA 1V11A 3NEJA 4Y9DA 3LBHA 1NXSA 1UJBA 4GM1A 1LLQA 2F9MA 2Q62A 5EJ7A 3UEOA 4ZQBA 4Z4CA 4RVNA 5F4ZA 2RG7A 4WBNF 1N75A 3K70D 4W7HA 4ETWA 4MDEA 2DPXA 4BKMA 1ORRA 2EWWA 3CC8A 3B1KA 3L0PA 4XH9B 4IOJA 5D8DA 3UENA 1QB7A 2BELA 5A2QA 4KNWA 2G80A 2PQ6A 3EEIA 3EWAA 3ZLVA 5KNDA 4KN5A 5HJEA 4QSMA 3PFIA 1KNXA 1NWCA 2QX7A 3SI7A 1Q50A 1YQTA 5EZYA 3A7DA 4C30A 4EJ6A 1E4EA 5JWRA 1NVWQ 4P0TA 4Z8XA 2V5UA 4TV9B 4KV9A 2AZDA 2PZ8A 1AA6A 5HGJA 2Q45A 3JZMA 5F2OA 5TJHA 1DQRA 2VATA 3JD1A 1MV5A 5DBGA 2JCVA 1Q1EA 4Q4CA 4HZIA 3O26A 2OXCA 3OG9A 4RD3A 1DIRA 3QXJA 4H77A 1JFLA 4UVGA 5FRDA 1AHNA 1JHYA 1X7WB 1SC4A 4Q3LA 1KVRA 1FFEA 3HI6A 3WQQA 2ZRDA 5JTUA 3ML1A 1G5RA 3OFVA 1P1HA 1MVNA 2J6HA 2QZPA 1JA0A 3HXLA 1PZEA 3PE6A 4NCKA 2GHQA 5KIAA 1GTZA 2M6SA 3PEWA 5I51A 1M3SA 2FOXA 1Z6AA 4YMGA 3W0LB 1GN8A 1RCUA 2HWUA 4F4HA 3OWOA 1PX2A 5J2UB 4E13A 3QF4B 4JAVC 2C04A 3GBPA 4IQGA 4O4JB 4I3GA 5T4BA 3CX6A 2M98A 2W8ZA 2IUUA 1C0EA 1L7NA 5FHQA 1HV8A 2ZR7A 4CF7A 2ZXUA 2IVFA 2Q3LA 1P72A 2ZSIA 4LOAA 5K8JB 3V8EA 3QE3A 3COVA 3IE2A 3FNIA 5CPBA 1EVQA 3MAAC 2VXYA 1NZFA 4QD3A 2OFFA 4L5CA 1OWPA 1NBME 2IEDA 1CUYA 1JW9B 5ADVA 4A16A 1AUXA 2AVNA 4IO0A 3Q3IA 5AXCA 5TX7A 4ISBA 1K98A 5EYPB 1A9SA 3QPVA 1U9ZA 3C5VA 1T2EA 1N7HA 1NXTA 4NBRA 4L08A 4UTOA 1NVVR 4XM1A 4UATA 5D7BA 3BBPA 5IW8A 1T0JB 1VHQA 4L02A 1QAQA 4YONB 1SUPA 1ZGBA 5TT1A 3QE9Y 1JAHA 1DGQA 2EFYA 5TPWB 3A25A 1XK6A 1L1EA 2OWDA 1USUA 3ONEA 4QFMA 2V03A 1EZ4A 4AJOA 3CMCO 1KYQA 3AVQA 5E4FA 4FLEA 5KBYA 1OV6A 1KJQA 2MSLA 2XOKA 4KACA 1G0OA 1JKIA 1WPGA 4IIHA 4N8DA 2ZANA 3W5IA 1JDNA 1HZZC 1GNPA 5EQFA 3QOWA 3NBAA 1XRMA 3HGMA 1UWCA 5FIUA 1ATZA 5C52B 5DGCA 1NLMA 1LK5A 1WQ3A 1O94C 4DNPA 1CQWA 4R8MA 3PX3A 4RF5A 3TVDA 1T10A 4DNOA 1DO2A 3ZWNA 5AKIA 2I22A 4U9IS 1IN5A 1B1AA 2C9BA 4RS4A 1NE2A 3ROTA 4EM6A 5KHLB 5DLPA 4B6SA 1E2HA 1R5JA 3EDYA 1RE1A 1RKVA 1NLZA 4MWEA 5PGMA 1FVFA 4LSGA 1M1YA 1T4CB 3GARA 5G40A 2OILA 3WFZA 3LUDA 4LCBA 3U81A 4WINA 1SUWA 2AXEA 1O8BA 1VJ1A 4RDCA 1GTRA 3OTHA 3DZGA 3MJ4A 1DWQA 2A0FA 4RJTA 5EAIA 3HB0A 5CLFA 1JEAA 2WUEA 2E4XA 2W70A 4C87A 2I65A 3ORFA 4HV4A 1XE3A 3E3LA 2W6JA 3LM8A 2VPPA 1E61A 2XQJA 2XWBF 4GO1A 4GPD1 4KYVA 1FRQA 4Y2QA 2ORVA 2PUVA 1KA9H 1RWXA 1VPLA 1VYTA 2QX4A 2X7HA 5DULA 3OIDA 3OLCX 2ZIWB 5I7EA 1GYPA 3A3NA 4CKYA 1HQCA 4CT4B 1W1WA 2QIOA 2QVBA 4FFMA 2I2CA 2RIRA 2QU7A 3RLFA 1M34A 2ZS9A 4DLPA 2HI0A 4DA8A 1EB8A 3O9ZA 4RH1A 1LXCA 2QXTA 3L1HA 1LX7A 1OZGA 1G8YA 2C4UA 2YXDA 3KV1A 1FFHA 1P7CA 1U5AA 1K0FA 1XP5A 2GAIA 3EXHB 2JIPA 5IH7A 3DEJA 1SA0B 2ZBPA 1HNXB 1L9KA 3MS7A 3P27A 3DMHA 5DLDA 5MN6A 4IIYA 3HXMA 1HO3A 4JBGA 3KTAB 1CY0A 2WTAA 4QTYA 1O9GA 2OLKA 3ICCA 3BJRA 4L85A 4DA6A 1TJ4A 5TS2A 3HO6A 4B6PA 5J4KA 3T61A 3I8XA 1YTLA 4BFUA 2QRNA 4Y9RA 4PTZA 4CGYA 1JEEA 3PFCA 3G2LA 3LFTA 2CWWA 4WOBA 4XZ3A 3LHSA 3ORYA 4BB5A 5HR5A 4Q4AB 2JCGA 3W4JA 3MBOA 2ABWA 2W8BA 3P2IA 1IZZA 3I5MA 3PYMA 3TG2A 4U02A 5DJ5A 1M75A 3KWJA 1PZXA 2OXEA 1DDOA 1QTNA 3JU3A 4TOIA 4RKRA 1JUDA 1ZMRA 3DL2A 1FFYA 3E9CA 4UASA 5LWHA 4C6SA 1ORWA 3EPLA 3M5PA 4LI0A 1TA9A 3ZWMA 4LOHA 1FQKA 3WVNA 4M9XA 1BMFA 3GEIA 1ZM2A 3T3DA 1FP1D 1OBHA 3E81A 1KBOA 3VAAA 1SVMA 4AC9A 2BBTA 13PKA 3RS2A 4MWGA 4TYYA 2ZWMA 2ZTSA 1SUCA 4DAOA 4G1EB 4NK4A 1JU9A 3VR3A 4X9XA 4B6JA 1JKJA 3DMGA 1AU9A 4X1YA 3SG0A 3DZCA 3MWDB 2WWFA 4XYGA 2WV9A 1YFKA 4BVGA 4C4YA 4E08A 4EG3A 2VJQA 3EFEA 4ZARA 4ZCLA 2JBAA 4WNCA 5AOAA 5C1IA 2QWXA 3BJEA 5HIMA 4BGUA 4ZYVA 4JUDX 1P8JA 3RTCA 1GL9B 1EFRA 5DDIP 5FOSA 4H7KA 4QBHA 4BE4A 2G08A 2N42A 4BO1A 4YP0A 4QU0A 4EGCB 4MMXB 3SHWA 3SR0A 3QU9A 1KXJA 3ZCPA 1QCZA 1RJWA 4XVQA 2PUHA 2YZKA 4H59A 5TGZA 2Q5LA 4X7BA 3TOXA 2Q7XA 1N2IA 1IHDA 4J9VA 4KE6A 3WRYA 4CM5A 1RKXA 4PVDA 3ZW7A 3MWKA 4DSZA 3B7WA 2AKEA 1KU6A 1JHAA 1EA7A 3P9XA 2ZSBA 4E3ZA 2Z5VA 1T8TA 3DHEA 2DWCA 1FP2A 1XJCA 4HDCA 3O8QB 4RM2A 3P2KA 1I0IA 3U3XA 4URYR 4B4KA 5AVRA 1YQUA 1FX1A 2B82A 4JEMA 3FTEA 1BWPA 1LF5A 2VRCD 2VZEA 2WI8A 2XECA 4I50A 5SZIA 4BZWA 4P80A 4CLDA 4DGSA 4DCUA 4F2WA 1J23A 1UKCA 2BKEA 5IKMA 2BM9A 5CM8B 3R8XA 4PGFA 3RSLA 1ZK2A 2ID4A 3U0VA 4UE2A 2ZUDA 1VIDA 4OA5A 1JDBB 5F1OA 3THYB 3OLQA 3NBFA 3D6FA 1HSZA 4ND2A 2X9VA 1KI2A 4LVUA 2EZTA 1GSIA 3MAJA 2AXPA 1GPNA 3B51X 1UZNA 3PJEA 1Z47A 2XYRA 4TQ9A 9MHTA 1PLKA 1EX9A 3TTVA 1DBPA 1G64A 2QRLA 2X13A 3HU3A 3VJRA 3IEXA 4QOFA 5I9TA 3RODA 1KEZA 3FFWA 3LCVB 3VR6A 3WWEA 5HZHA 3JALB 1U7OA 1BWSA 2LCFA 1N2XA 2P6NA 3AIOA 1N2SA 4G56A 4NKRA 3UAVA 1B26A 3W5HA 2NPIA 5DBEX 1S3FA 1I2MA 5IBPA 2LPMA 4UHEA 1QLWA 3ENNA 5FBQB 4NCAA 4EJMA 2PBRA 5A7FA 1X42A 2IYRA 2GCPA 1PZNA 4RKQA 1ZU4A 1T2CA 1WDWB 3PXGA 1DHRA 4P22A 4MHSA 3CO0S 1FFXB 2PX5A 2ZB7A 3AF6A 4FCWA 4M0EA 4ZQIA 4BNMA 3OOSA 3PICA 1E7MA 4K03A 4L4RA 4QAJA 5E1MA 3IIEA 4PAQA 2AEEA 4XW2A 3EPJA 3DMRA 4G0PA 1L5ZA 4PHCA 3CTMA 1ZGAA 4C7KA 3AP3A 2W0SA 1YR9A 2ARKA 5JQGA 2YBDA 1Y6GA 3VI4B 5IP5A 4MVJM 2C84A 3OSZA 2BRUC 1U2GA 1OTYA 1X1AA 2CLLB 1HOXA 1T4MA 3I9V1 3S40A 2ATVA 2XNDA 4F7DA 1KQGA 1RFGE 2QQGA 3EW7A 4DIBA 2BH2A 4IYJA 2FUNB 3Q7EA 4C78A 2H4FA 1ZSVA 5CA0A 1NL3A 2N9UA 4GVPA 5CNMA 1WSBA 2FWJA 2GZ2A 3MWLA 2BHNA 3WWPA 2I91A 4Q1DA 3GFTA 2GCNA 2CL7X 4JASB 1DBIA 3OCWA 3TX6A 3IT0A 1J9ZA 1ZJ4A 5ALMA 4GQBA 2HMAA 4IFBA 5AOVA 4LZJA 3GOQA 1VL5A 3QLUA 3ZWCA 1H1TA 3G3EA 4XGQA 1JMYA 1S2LA 1HWYA 2AD5A 5FV7A 2HMVA 2C2KA 2HXYA 4LNUB 1UAGA 2RMKA 1E9RA 1LBEA 2QR2A 4FDUA 2FPUA 5C80A 5LIPA 4QBIA 3C7DB 3TEJA 1XL1A 2R0QC 2A94A 1UBMS 4PHHA 3DDOA 5ES4B 4HAXA 2E37A 1GZSA 3SIPA 1DIAA 2FSGA 1OIXA 3PHHA 4JL6A 3HJTA 2FSFA 2P0AA 3LC2O 2PTGA 4IG9A 1Z38A 2QP3A 1H2ZA 1T25A 3H42B 3INYA 3RO7A 4V2UA 4D5GA 3RS3A 4H15A 1X14A 5E9JA 3UV7A 4EGAA 2UYCA 2FLKA 1X80A 2R8OA 2QI9F 1YULA 2NO6A 3ELDA 5A3JA 1S4QA 3VH1A 5CB4A 2JLWA 2XA2A 4ZHQA 1A9RA 1ARZA 1V7ZA 4IDCA 1NJ1A 5TMEA 1JB1A 1TFUA 3B3JA 2IU3A 1VMDA 4ZDJA 2Q1YA 5HKOA 4PQFA 3DSRA 3QVOA 2LDBA 3OI7A 2V45A 3FYHA 2W4IA 1K8QA 3EF0A 3ZUPA 4QDJA 4EKYA 5EUMA 3O8RA 3CRMA 3RAGA 4INOA 1W85B 1I33A 4UHBA 5SY9A 2GF2A 4EATA 1GPMA 1G18A 2RAVA 3LT1A 1T2DA 3JQDA 2QPOA 1E1NA 4RE6A 3UKDA 4YRMA 5H4GA 1YV9A 3RYIB 4HLDA 1PNOA 3F3YA 3FBTA 5IRCD 1ZLXA 1X7HA 5AW5A 5CIYA 4OSEA 1DKPA 1C14A 1E8NA 1T8PA 1TEHA 1EAYA 4LYFA 1JE1A 4LJRA 5FTWA 2QRUA 1VPEA 1YOBA 2A88A 1XEXA 2DFVA 2H18A 1Z35A 3EPRA 2FGKA 1SIOA 3K15A 4G36A 5ALPA 2CLEB 4E5SA 1DIGA 4WCDA 3P20A 1HE8B 3R6GA 5AI5A 4EJ0A 1R4NB 4X1KA 2X9NA 3FRIA 4LY3A 521PA 5L4SA 2ZB8A 3K3PA 1TU0A 2PIAA 3NEYA 1DCTA 2IHVA 4JA2A 3KEGA 4YBRA 4YNBA 2Z5FA 4UDOA 4YJGB 3AR6A 3NLLA 3DB1A 1A4RA 1QGZA 3PI6A 2BFCB 4BVBA 4YRFA 1M73E 5BSGA 3NM5A 4FINA 4W6QA 2FRDC 3RAFC 5BRNA 1G6HA 1N6PA 5L3SB 1E4YA 2AQKA 1F3LA 4LSZA 1EEHA 1LBIA 1N2HA 5FHRA 1FNSA 2WMYA 4NPAA 3SEAA 1LFDB 1DXQA 1YH3A 2QJWA 3ZOKA 5ADUS 3MMZA 1N2ZA 5EA2A 4FN4A 3GGJA 5JWHA 1ECGA 1F0NA 1PRYA 2V4UA 1B0UA 3ABIA 4Q7JB 4ZU6X 2JDID 5KJEA 1TM4E 2NZ2A 5EPUA 2B37A 2UUPA 3V2GA 1YHNA 3ONFA 4ZTZB 1YKFA 1L7DA 1KJNA 3U37A 2GN8A 4I1YA 2FSVA 2BLNA 3X2FA 1LLUA 3SZLA 3TKYA 2XYQA 1O1YA 4H9GA 1NBEA 1LV7A 3B3QA 4JJ6A 4OQZA 2ID8A 1Z8DA 2YJ3A 3C3CA 1DTWA 1GA1A 2RHHA 3LC0A 4JLOA 4RZSA 4BMZA 1IJFA 4QTXA 3F5MA 5MHTA 1CNMA 4MR9B 3BCSA 3O7WA 2RGWA 2UZAA 5JVDF 3EGDA 3JVVA 2JLUA 3SFTA 1BCSA 2X6TA 3LF1A 3ZHVA 4L4SA 4WFKA 4ER3A 2ZUEA 3CEMA 3D6TB 2FR8C 5GJCA 3RE1A 1I94B 3UOAB 2ZE7A 3O2SB 5HKKD 1N9GA 1XQ6A 2EQBA 5LM3A 1KY3A 1DKQA 1SRRA 1BEUB 3IQDB 1KZGB 3J7TA 3PDHA 2YDYA 1WXXA 1AF7A 1KKMA 1ZJZA 1H05A 1VLZA 4WZBA 5CHEA 4EG6A 4KWIA 1DOZA 1WP4A 4UPVA 4P81A 1A9PA 1AXEA 2GX6A 3RC9A 5EJMA 4BO6A 4X60A 1ZCAA 1S2OA 4U0JA 2V97A 4WMLA 2PH1A 2ZB2A 5FKJA 2XUKA 1VE7A 3H9JA 1R12A 2Y76A 4D56A 2RI6A 3LVFO 2HSEA 1JNYA 2D8MA 4DKJA 1Y8CA 1FFWA 2O8CA 3RTDA 2ODWA 3PE4A 4J0HA 1Z9BA 1A95A 1YB4A 4L5BA 3M2PA 3AFOA 4P7JA 4US0R 1JYFA 3N58A 5DXJA 2EKDA 2A4KA 3I0NA 4RMJA 1Y1SA 1OE0A 5D85A 4HZUA 3I6MA 3ZS9A 4LSMA 4DHEA 3DUWA 3CFYA 2JPDA 3AR3A 2YDXA 2PZJA 4QM7A 5FUMA 2R6JA 3G8BA 5BUSA 1JR4A 1JILA 3GVHA 1W5AA 1K7FB 3K2QA 3KQVA 1RADA 1ZOSA 2G1KA 3COWA 4XGKA 1E1RA 1IAQA 1BE0A 1JHVA 3FCXA 4JP5A 2OR3A 3ANLA 5FNVB 1J5EB 2WTXA 3P19A 1TUBA 3PJGA 3H75A 1XXLA 4ZVKA 3R74A 3I1IA 3Q3EA 1N6IA 4BBZA 1OC4A 2YZGA 3ITEA 5TC4A 3X0DA 1KO1A 1EHIA 4Q3AA 2B94A 1Y4SA 2Y93A 4PCVA 4MEAA 2P1RA 4MRAA 4DC9A 4BX0A 1U1CA 2RK6A 4BZPA 5IVPA 2BSXA 3CNOA 4JDPA 2IP2A 2BIFA 4U7DA 3OD5A 4BY9E 2CYBA 4XD2A 5IHPA 2WYVA 5C46F 3VUFA 3CVJA 4XEHA 3MOSA 3FLMA 3D1LA 4EAQA 3A6JA 1JR2A 1FXUA 1JLHA 4W1QA 2PWZA 1RXVA 1B0AA 2DTEA 1RZUA 4B3HA 4ZHSA 3ONNA 2ZQYA 3VR5H 2FH5B 3JSXA 4GD3Q 1LBHA 4LJ6A 3VZSA 2C8LA 1TB4A 2C59A 5FNZA 1M10A 3B36A 3BRQA 5IAOA 2C99A 5IEJA 2VP0A 3CZ4A 2B92A 2HCJB 2AN3A 3AXSA 3P96A 5ISMA 1AB6A 3VXKA 1C7IA 1MB2A 4DMCA 2WD7B 1K06A 4YC7A 3BREA 5AW9A 2NVUB 5B12A 5ILOA 3AUKA 3IDSA 2OV4A 5AHRA 2HA7A 4UUMA 4A15A 1REQA 3MOIA 4FLFA 2FN9A 1I5OA 1E6MA 3OF5A 5BT9A 3SYLA 3ZD9A 4ZZ1A 4CIBA 1Q5PA 3B6ZA 2GGSA 4DB2A 1BA2A 5DYWA 3EQZA 1K4KA 4ZT6A 3UAZA 2DPGA 4M0MA 4EZEA 1UMDA 2QTNA 1FL9A 1ZA1A 4KQEA 5KVAA 3JWJA 1TTPB 2WSMA 3LMKA 1W29A 4O33A 1G5HA 2XMQA 1XZHA 2F1IA 2QLJA 5I5EA 5KOIA 1J2TA 1SC3A 4R5HA 2BGJA 1ULBA 2R751 5TMPA 3CTPA 1O95D 4KQXA 1SWVA 5F9MA 1NQAO 4P6VF 4GGPA 1FMLA 3ZZUA 5A9SB 5EHXA 1I2ZA 1IPHA 3ASYA 2TMGA 4FPXA 1ZHHA 1N5RA 3HJNA 1B3BA 1K08A 2CBGA 3IOCA 2H4XA 1MBZA 3V6LA 3VH4A 4ALIA 5CH8A 4WZAA 2VPZA 3GUZA 3PKIA 4MX8A 1V43A 2F59A 4HQ0A 4R1MA 4YWHA 4DF3A 4M7WA 4MQFB 3ABRB 3QQPA 2Z6AA 1TZKA 4HF7A 2CW5A 2DFNA 3OCUA 1D4OA 2WJ3A 4NP6A 3K72B 3P32A 4N48A 3LQ4A 4Q18A 4CR6A 3PRJA 2I6QA 4REQB 1SKQA 2Z5GA 3P9KA 3P4XA 3C3WA 2YMMA 4NEQA 1O2DA 1YE8A 3KB6A 4QUDA 5BNIA 2GYYA 4D74A 3T1QA 5IWCA 2WU0A 3HCWA 5H82A 3LQ1A 4DYDA 5F2KA 2RI1A 2BCGY 3EJ6A 1EK0A 1PN3A 3KRTA 2ZSEA 3R5XA 4FHDA 1QNFA 4R2IA 2Z2JA 3WL7A 3H9QA 3IT2A 5ICGA 3UH0A 1IN7A 2FW0A 4QNRA 1P4HA 4X85A 4OLFA 3DV2A 2MU1A 1PTJA 3Q8LA 3CBGA 2ORYA 5CLGA 1SVNA 2CLKB 3WGZA 4X7MA 1GPLA 1FDIA 4RPIA 4TZ6A 3VH3A 3M6IA 1SRQA 2FPIB 3IIIA 4IS2A 3I4FA 1DRWA 3W79A 3RCBA 1QGED 3HBJA 3NVMB 3AHCA 1E2QA 1PKEA 3HDVA 5M29A 1W48A 4OGKA 2FZEA 3F0TA 3LQFA 1OKKD 1BE8A 3QHAA 5AIBA 4YHBA 1QRAA 3B1ZA 2RJOA 3SCZA 3MEQA 5ENVA 3OEYA 4QELA 1KFBB 4W99A 1YNSA 1AZWA 1Z22A 4A7PA 4MWTA 5L3VA 4IGEA 5JISA 3OCJA 3CUKA 1B6GA 2V96A 3ULKA 2H48A 3AJAA 4D0RA 5FUYA 1GADO 4DGQA 2YRWA 3T3OA 4M8KA 3ND7A 4J0EA 2GJ9A 4GZ3A 5EESA 4EHDA 1EK5A 4RPJA 5JSFA 5K0JA 1YBAA 1UPTA 4Z86A 4F5EA 4EF6A 1SBZA 3GMTA 5LLSA 3HY3A 1G7CA 4WNYA 4CN8A 4E5KA 4ZO4A 3SNKA 4R9NA 4BQNA 3LDGA 1U0JA 5G0UA 2YCLA 3U4CA 5LJIA 1W94A 1D8TA 3A0RB 4MARA 4PHTA 4BL5A 4P4GA 2BONA 3OVMA 4OQDA 2ISSD 4UMVA 5MN4A 2O4UX 1U7PA 2W71A 3KV3O 1BMDA 2QI9C 5GGXA 2H1HA 1JLKA 1TD9A 1X2EA 3ROFA 2IEZA 5LA6B 4J9UE 1U0HC 3MK31 3O0TA 5JH7A 1FW8A 3R77A 5ALYA 1IUPA 1TMOA 3I34X 3KKNA 3R3HA 1WZCA 4DDHA 4YX9A 1FB5A 4JJZA 3AKZA 5DLQC 2J32A 4G5OA 1XDSA 3F8SA 1ONNA 2ZWVA 1EBFA 1EMDA 2VSFA 1MZVA 1UPFA 1F14A 1Z2AA 1C3OB 3HACA 1JG2A 4MQMA 2BKLA 3D31A 1T6BY 3KIPA 4TXHA 2H1FA 2P77A 3KZNA 5GJVC 2F64A 2F3RA 3NW9A 3DVLA 3WJAA 2D2IA 4NMLA 4MKZA 2P2ZA 2I4NA 1PFVA 2NN3C 3OIGA 2P7HA 3CSSA 3H2BA 2CZGA 3K09C 4IIJA 5KX5A 1IULA 1ZIXA 1CQPA 1H66A 1OOEA 2AX4A 2BBWA 4ECEA 5TGDA 3TSCA 5HZKA 4KXYA 3KXLA 2VXCA 3ZE1B 1UMBB 4KVGA 2HQRA 3D02A 4IM7A 1QKKA 3D2CA 2NO9A 3QX8A 1QZUA 4LYJA 4F3KA 4PNZA 2OVBA 1YF3A 4RA9A 1HYBA 1PHRA 4R2JA 4TZ0A 4G3XA 1ECCA 3LX4A 4O6VA 1K75A 1Z6QA 3E0QA 2ZI3A 1KOFA 4P3XA 2MCFA 1M0EA 5AKXA 2GBGA 2ADMA 2R47A 3H9EO 5E4TA 2OO5C 3AGQA 1V8BA 3BXFA 3E5MA 5DXFA 4KXXA 3U7RA 5CBKA 1AMNA 4P1ZA 3JQBA 3ZDFA 2GEKA 4BX3A 4E1VA 2O2EA 5LKAA 4E7PA 3MCTA 1LTHR