1ZN7A

Human adenine phosphoribosyltransferase complexed with prpp, ade and r5p
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
178
Chain Sequence
DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine phosphoribosyltransferase
publication title Structural Complexes of Human Adenine Phosphoribosyltransferase Reveal Novel Features of the APRT Catalytic Mechanism
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zn7A00
1OROA 4PFQA 1I14A 1D6NA 3M3HA 1XZ8A 1U9YA 1G2QA 5HIAA 3DMPA 4QYIA 4P84A 1HGXA 3OZGA 1BD4A 4PAWA 1G9TA 1HMPA 1ZN9A 4KN6A 5HKLA 1Y0BA 3DAHA 1V9SA 4P82A 4Z1OA 2WNSA 1QCCA 1UFRA 3GGJA 4TWBA 4P83A 1QB8A 1NULA 3OHPA 2DY0A 4P80A 1W30A 1R3UA 1ZN7A 2JBHA 1Z7GA 3ACBA 2VFAA 1PZMA 3H83A 4X45A 3OZFA 5JV5A 4RAQA 5JSQA 3GGCA 1STOA 3LRTA 5IPFA 1GRVA 1P17A 4JLSA 1WD5A 2C4KA 2XBUA 4M0UA 4LYYA 2AEEA 3ACDA 1QK3A 1TC1A 1XTVA 4QRIA 4RV4A 2GEBA 1DQPA 1DBRA 1VCHA 4RQAA 1P4AA 2PS1A 1DKRA 1QK4A 1ECBA 5BQPA 1OPRA 5ESWA 1VSTA 1I5EA 1BD3A 1L1RA 4RAOA 1O5OA 3KB8A 1QB7A 1O57A 1U9ZA 4S2UA 4RABA 4RHYA 1A3CA 4RANA 2PRZA 2PRYA 5KAPA 3N2LA 4RACA 1L1QA 4LYGA 1QCDA 1IBSA 1UPFA 1G9SA 4P81A 5E38A 3DEZA 3LPNA 4LZOA 4F8EA 4JITA 4RHTA 1LH0A 1A95A 1I0LA 2IGBA 5ESXA 1OREA 4IJQA 3O7MA 2JI4A 1A98A 3S5JA 1XTTA 2P1ZA 4LZAA 1TC2A 4WMLA 3G6WA 1JLRA 1A4XA 1G2PA 5KAMA 2E55A 4LZNA 4P86A 4WN3A 3EFHA 1A97A 4QYIB 2YZKA 4RHXA 4RQBA 4P3KA 4RADA 1I13A 2FXVA 1ECCA 1DQNA 4M0KA 1CJBA 5BQOA 3ACCA 4RHUA 1JLSA 1J7JA 1P18A 3QW4B 1AO0A 1MZVA 5EUCA 5K51A 1QK5A 2H07A 1GPH1 5IAOA 4ZFNA 1ECFA 2EHJA 2JKZA 1I0IA 3HVUA 4M0PA 1ECJA 1NONA 1ZN8A 1DKUA 4X44A 1XZNA 1VDMA 3MBIA 4FYMA 5BSKA 1FSGA 3MJDA 2H08A 4MB6A 2JKYA 4OHCA 5BRNA 3NAGA 1ECGA 1XTUA 1A96A 1BZYA 2HCRA 1P19A 1UPUA 1YFZA 2H06A 3GEPA
chains in the Genus database with same CATH superfamily
1SHUX 2B5OA 2VEDA 3M3HA 1HE2A 4YGXB 1Q20A 4PS1A 1QX4A 1E2HA 4MI3A 1TRKA 2FWPA 3VNQA 2OC4A 2GZDA 3MVEA 2G17A 3BD9A 1DO2A 1KU6A 1CY8A 3AFHA 1BS1A 3KL4A 2C7OA 2BFNA 5ULLA 1GY8A 3JR3A 1U4SA 2BGKA 3ZQ4A 4MVJG 3ISVA 1O97D 4CIXA 4V03A 1YA6A 4BXOB 4U3JA 5IK2D 4RVSA 2AFIE 3HKEB 3LVFO 1YBVA 2XCTB 5C5CA 5HUQA 2ZRBA 1DXYA 2N0SA 3PPIA 4B46A 4V3CA 4B2PA 5KU1A 5CYOA 2RIRA 2HRBA 4CDNA 4TMFA 4Q5IA 5CX4A 5CDUA 1P2UA 2BGTA 3EISA 4Q9JA 2G83A 3GRFA 1E1KA 3FG9A 4O3FA 4H7EA 5JYBA 5I9TA 1T3TA 1EK5A 4HAWA 3RFVA 4EGSA 4JSRA 4KV9A 5HRCA 1BTOA 4N48A 1KVTA 2CHGA 4LBYA 3TQCA 3U26A 3HBAA 5ALTA 5CA0B 2V6FA 2HQSA 1S3FA 2HH9A 4BE4A 1CUHA 1SZDA 2PMBA 1M34B 3QOFA 5B57C 3GDGA 3LJKA 3PNMA 4DKXA 5LMZA 3CUTA 1GTZA 3ET4A 4HFRA 1Y7LA 2G08A 4QUIA 4Q9HA 1FJ2A 2AEJA 3L6RA 4MLPA 5AKEA 3GLGE 3ZR4B 1BNCA 1MTOA 3RK0A 1NZFA 4DCPA 3DDSA 1L5NA 1UC9A 1WSAA 1E1DA 1TIKA 3E9DA 3J81k 2B6NA 5C8YF 2I7TA 1QGUA 3SJCA 3ICQB 4ZCLA 1WHTB 1Z45A 3V3TA 2WBLC 4C88A 4RLHA 3AEUB 5HBRA 4KO8A 5I9SA 2IFTA 4UHJA 3P9CA 2XZDA 1A7AA 1HXHA 3LC2O 3RTBA 2IP2A 3OE1A 4P7JA 5G3YA 1KFBB 2ID4A 3AQ4A 3D3JA 3D3WB 3PT5A 4GXQA 1CULC 4RESA 5HRUA 1OWPA 1U3TA 5JDIC 3QNMA 2GVDC 3UWPA 1A97A 5AW4A 1J8FA 1E2LA 4DLRA 3BXFA 4YTEA 2RHLA 5HVNA 1Y6QA 3FPCA 5J2UA 4JLJA 2G9VA 4G65A 5U4XA 4OF4A 4EA7A 1SXPA 4MWGA 1X2BA 2BY4A 3IXLA 1TPYA 4QLAA 4CQMA 3B3JA 4Y6PA 3GU3A 5IEJA 3GLFA 4JP5A 5EHXA 4DR5B 3ELDA 4CM1A 3MSCA 2VDVE 2CVPA 3ZW8A 1SNYA 3SS9X 4IOKA 4EB6A 3NDBB 3VPSA 1B3RA 1FL9A 3CX6A 3E0XA 1V4BA 3MZ0A 3X43A 3FCYA 4B87A 2WJZB 3MXOA 5LYYA 3SFZA 3H1FA 1DOZA 3GLHB 3W6UA 1R6AA 1SHZA 2C54A 2X4DA 3D4IA 4UXHA 2OFWA 2J4DA 1LPSA 2R9VA 3H9EO 2E49A 1XF9A 4JS0A 3CTMA 1GZ6A 2VZ8A 1JMKC 2O0KA 2EZ8A 4ENQA 1PLKA 4FCTA 1IK6A 2G4VA 3PNSA 4OH1A 2OFOA 3ZHBA 3A9TA 4BVFA 3UV3A 3TKLA 3P0RA 1E62A 3B38A 1U8XX 2EXXA 2Q6TA 1U90A 2YHIB 1VMDA 2JHCA 3IOMA 4NBLA 3C1UA 3T4PA 4BX9A 3U5TA 1PVDA 3TFOA 3ROQA 5KPJA 1MB4A 1Z0ZA 4UHEA 1WMSA 1GR0A 2WZBA 5A5FA 2M6RA 5A04A 5LYJA 4MS4A 5LOVB 2XADA 3QE9Y 5ICGA 2Y2VA 2IEBA 3BCUA 4ZI3A 3CT4A 3DBHA 5IJZA 3IUNA 3OF3A 3SHTA 2PE5A 3KTDA 2EZUA 1OQAA 2P41A 4C04A 5K8UA 5DYTA 1TQHA 2VCYA 3F6YA 4IIJF 4LVNA 2R6CA 5G0UA 5J5AA 2AW5A 5J4VA 1OLOA 4MW7A 1QONA 2LTAA 3GUYA 3LT4A 2DY0A 4DUPA 4GLBA 4NV3A 4CKEA 3DOUA 3WI7A 4XB2A 4TVSA 1VJ1A 2LD4A 2W6ZA 3C87A 1UUFA 4DIEA 3ORYA 3QUBA 1ZA1A 2OCGA 1T2NA 4EO9A 2VDKB 1RYHA 2EP5A 1Z5VA 1E8MA 2EVWX 3M3DA 4M37A 3SMVA 3H5VA 3LLVA 1K2VN 2QSJA 2YZ7A 4TL8A 3CVOA 4Y2SA 1GZ7A 1MX5A 2WABA 1AN9A 4CIWA 5F23A 1PL7A 5L4LA 2J7PD 4FK8A 1Y34E 1SU6A 3A6EA 4J9VA 2WNHA 3FUXA 2AI2A 1T5BA 2CCKA 3BWXA 3C7DB 2H6EA 2FR8C 1PX0A 4F93B 4OP2A 3EIWA 2YN2A 5EUBA 3RRJA 1HT2E 1FQOA 2ISQA 2Q3DA 3ILXA 4GWLA 1IM5A 1V16A 3UFXB 1IVNA 1N8SA 3N3BC 1BE8A 2AJCA 4K88A 4JEHA 2OHVA 2OYCA 5TEWA 3TOZA 4L5IA 2WM2A 1W8IA 2ZJ5A 1OXVA 2SNIE 2OR3A 2QUAA 1TMYA 5J5VA 1KZ4A 1V4VA 4MDEA 3ZWXA 3N0XA 1Z8HA 3GFGA 3WGIA 2PGOA 3T5MA 3WLNA 4B6QA 3GEDA 3HWRA 3P27A 4W1QA 2X0JA 3KQSA 1B6RA 3H4IA 3KXIA 3QBEA 2HLDD 1NVGA 2YZKA 4M1WA 4D1YA 5C1OA 1GPBA 1NJGA 1JDJA 2YHSA 2HDOA 2ZWPA 1ZCZA 4HXEB 3TQFA 3AXSA 2BFBB 3ZHQA 3MK31 4Y9SA 4W99A 4ZO8A 4DB4A 1PTJA 2B3DA 2BRUC 2EEPA 4B4UA 3KYCA 3RUDA 1E20A 2VDLB 2ZCJA 4ZT6A 1E1NA 1SVNA 3BD8A 4L6CA 3RRXA 2JA1A 5H59A 2JC3A 1G4AE 3FWYA 1WUHS 3VH4A 4YRSA 3L7OA 3YASA 5EVCA 3U3XA 4B3HA 1KO5A 1VSVA 2GKSA 1XQXA 3IT1A 1JA9A 2IXBA 3WFZA 1UBGA 3RQSA 4ND6A 2QVBA 4FYWA 3G2KA 2IP1A 2FPXA 3LX6A 5D3MB 5FHRA 4BB0A 4BCDA 2XCSB 1WBDA 1N2CE 1U7ZA 2PXAA 4ZP1A 4M6WB 1QH0A 1L4NA 1ZI9A 4CG0A 1TTPB 2IIPA 2V9CA 4NECA 3LFTA 5DTEA 5IMBA 4PSAA 2A7XA 4BMNA 2KMLA 5JJLA 1SPBS 4GMDA 1R0KA 1XCGB 5JCXA 1ZIYA 5CHYA 4RTKA 4P22A 3RSZA 3URMA 1VPEA 3K5IA 1LBIA 3V48A 1K7CA 4ZU6X 1O9HA 3AH8A 1J2EA 2VDUE 4FJ2A 3R74A 1ZD5A 3I9V6 1E32A 5F76A 1Y8AA 2JIBA 3TNYA 4BECA 1VYUA 1YJQA 2XMZA 5D7NA 3WSVA 4EG5A 5KNCA 4AJJA 3FUVA 4PTLA 1JNXX 3UJPA 4EG8A 1VE9A 4OGLA 2CEKA 4PAQA 2NPFA 5J59A 5G3ZA 1T2VA 2H8GA 3H9GA 4PLYA 3B78A 4DBVO 5DW3A 1QTNA 1VMIA 3C85A 3DMHA 3KQTA 3SHFA 1VE5A 1T91A 1BGXT 2A1TR 3JZMA 3WL7A 2ZAGA 3LVQE 4EJSB 2JH9A 3TD6A 3K9GA 4G0XA 2WKRA 2G5GX 5D85A 3OMXA 4D2IA 4NDZA 4OAQA 1Z7GA 3FD8A 3HU1A 2PKCA 1DKNA 2VJMA 1QJ4A 2C84A 5ALFA 2LV8A 2FV8A 4NMXB 2WIDA 1GN9A 4X45A 2PGDA 1COWA 1RHKA 4RQTA 2BFDA 4C7JA 4E5MA 3BKWA 3IDAA 1Y1QA 2FPUA 2Q2QA 2UYYA 3DLCA 2JLXA 3F5QA 1YZKA 2GEBA 3GG2A 2EEZA 4QBGB 4RA6A 4YT8A 3N2IA 3BK2A 4GKBA 4BBZA 6ABPA 3FN4A 3R7WA 1GJRA 1MCZA 4QLOA 4KXYA 4TWZA 4A23A 1MQAA 2OORC 2ADMA 2OENG 3PE6A 5K20A 2HA2A 3KETA 1DBPA 2GGSA 1Z4KA 1P0CA 2X0KA 3MGGA 1UJBA 4TSRA 1MRZA 1Z7BA 2WYVA 1PR4A 3ZS8A 2HEGA 1G9SA 4ROSA 1Z4JA 1QH8B 1ZGBA 1ULUA 3IMKA 3M6MD 4JLNA 1NJ8A 1IOZA 2WQZA 2VJLA 4RFLA 2YJ3A 1XHLA 2PY6A 3FJ1A 3IQXA 4RSHA 2F43A 3LUCA 1MVNA 3R7FA 4EARA 3DAOA 1DWPA 2LCFA 4QT0A 3UTDA 4BN5A 1VLHA 3D1JA 3D6NB 2IUYA 3G5UA 3KKOA 3L7IA 3UT0A 4W8GA 3M34A 4MQEA 6YASA 4DNQA 4YRRA 3ZD9A 4QJIA 2WWRA 2HTEA 3MWGA 2XE4A 1TW3A 1L7MA 3EVNA 3SFVA 4KPGA 1YS7A 5E6SA 2X6TA 2PGAA 3EY4A 4NG4A 5DX0A 5KKAA 3L6DA 5DHAA 5BN3A 4UZSA 2I7VA 2A1UA 4K9MA 1NM5C 2PPVA 3D4BA 2QI9C 3MJ4A 1L5VA 3OLWA 1Y9ZA 3RHZA 5BWMA 3Q0TA 4N18A 4N7BA 1K5GA 2R47A 4X95A 3DHEA 4XE5A 1LPNA 2AJLI 3T34A 2X7XA 1NUUA 2A94A 1T2AA 2IK8A 1YL6A 3LBIA 2P4QA 1G55A 2EW8A 2XRYA 4U8HA 3WYFA 3ZZ0A 3U44A 4K0RA 4ZVPA 4NBWA 4M0LA 4CMJA 1YUNA 2ZT5A 2BISA 4J6FA 2DKNA 3EPKA 4W7IA 3EIHA 3PXUA 1HR0B 1S02A 2QKYA 2I7CA 5E7IA 2GWRA 3OWOA 3QLEA 4P32A 5KJFA 1SCUA 3MSXA 1BFDA 1JLKA 4XD7A 5ALIA 4A8HA 4YCCA 1CVRA 1G6Q1 1V45E 3R6LA 5HJ5A 1QIKA 3IDQA 1P19A 2IT1A 2VWQA 4DQKA 5JO0A 5HUHA 2XZLA 1LA2A 4F0JA 4LRYA 4H3VA 4NENB 4CG1A 2JLWA 1E3SA 1AF7A 1H0SA 2J31A 2RH5A 4ZVMA 3AINA 4LMAA 1B0UA 3KRTA 2IWHA 5KC8A 5K01A 2NO5A 4NPAA 4YRCA 2NSHA 4JT4A 3OP1A 3RI3A 4AMZA 1GLNA 4HQ0A 2GEVA 1NVXQ 1L8XA 2MT9A 3FDFA 4WADA 2W2XA 1H0HA 2EG9A 3M9WA 4TV9F 2ZYIA 3EC2A 1ZQ1A 4DCGA 1M66A 1MPXA 2UXCB 3N9IA 4P83A 2YS7A 1G21A 2OO3A 3PFBA 5DNVA 4NBRA 2RHOA 5GOTA 4CMEC 3RQIA 5JD6A 4LKRA 3BEOA 2R00C 2FDXA 2UUBB 5EPOA 1TE2A 3QXJA 2A0WA 1W30A 4OXQA 5JSFA 3I0NA 4QAQA 5K4AA 3ZU4A 3FYDA 4YDRA 2BFMA 1ID1A 4EBFA 1UXJA 5JPCA 4GH5A 4ZAVA 2O2JA 4XX0A 2JHGA 1EWKA 2MINB 1GRVA 3C5CA 1TKCA 4B3RB 3WO0A 1PFVA 1F8UA 1QK3A 3QSYA 1VFNA 3T7DA 1LBSA 3DO5A 1KJ8A 1U3FA 3G8BA 1ZI8A 3CMCO 1MAHA 3MTQA 5C8ZA 2IS1A 1F6BA 2HCFA 1QR2A 3MOGA 5KYUA 5CJJA 1NZJA 2FNAA 3I5AA 5L3SA 4A5SA 2Y2UA 4Y67A 1H2ZA 5G4KA 2C5SA 5IDXA 2B5VA 1HDRA 5LP6A 2YN0A 4AKHA 5D6OA 2EBWA 4V0QA 3TEMA 1V71A 2P0AA 4ZC8A 3DQZA 3AWIA 3PC6A 1UWCA 1MB9A 1XF1A 2AOTA 1EG7A 3DOEA 3V4PB 3LT5A 2QLJA 1JE0A 1XBTA 4WCDA 4BFUA 4CTJA 1NN3A 1PVOA 1I1OA 1TQDA 1WF6A 1Q17A 1U1GA 4HDAA 1SCJA 1C2TA 3GRUA 1NSTA 3OPXA 4LFCB 3VI4B 2XKBA 3F1KA 4RORA 1K9VF 1JHAA 3H2YA 3WLTA 2GBIA 4NQRA 4RK0A 5ALWA 2AI3A 3ZTTA 2QNBA 5ALRA 4XPIB 4CYMA 2OV3A 2X4LA 4MHTA 5IAEA 2Y76A 2R1ZA 1AKYA 2XT0A 3OPYA 2VXBA 1OI4A 3FKSA 1M33A 2H57A 3EASA 3OLQA 3TRIA 4BNIA 5CXQA 2R6DA 3BXHA 2X9QA 4G84A 1TKRA 2ZIGA 1N2HA 1FJGB 2PU7A 3GFFA 2H07A 1GPH1 4MYSA 4YWJA 3UUGA 2OD7A 3G2LA 2X19A 1NN1A 5A4KA 3CNNA 3DVLA 5TF0A 1KSJA 3UV7A 3BXXA 4ASUD 2QUZA 1EUCA 2Q5CA 4PONA 5AUOB 1WHSA 2UYHA 2BFAA 5AJZA 5FPSA 3TPCA 2XMBA 4HUJA 1O3YA 3TF5A 2VQFB 3EOZA 3DBRA 1T1IA 5TS3A 1Q1GA 4YJDA 1TIBA 2G71A 3HB0A 3PA8A 1U1FA 1PBNA 2H08A 2H5JA 4MEJA 1JG3A 1QO7A 2NYUA 2A0KA 3KNZA 4GZ6A 2IS4A 2QXYA 5JZSA 1W2WB 2HJRA 5EMHA 4DXHA 5JUWA 2H06A 1EFAA 3GA0A 2ALJA 2CE7A 3THYA 1Z63A 2RGAA 4B3IA 1HUQA 1N2IA 1Z08A 1DUIA 5ERXA 1IQRA 3FROA 2GCNA 2VAVA 2WVGA 2WK1A 4OXIA 1ZGCA 2XCIA 3NYQA 5G53C 2FW8A 4UDXX 3SQLA 4DR1B 2Q8PA 2GLTA 3AZOA 1FP4B 1DPFA 1LFAA 3HCWA 3KCQA 3MMPA 1UFRA 2QTVB 2R87A 3FZQA 2WF6A 1BJTA 4V39A 3O8CA 2I8AA 2GB4A 4I3HA 1BS9A 3GGJA 5E2AA 5DN6D 2HWWA 3KKKA 4R2HA 4DIBA 4DHWA 1DU4A 4KBGA 3COJA 4D9CA 1D9XA 3T35A 4AURA 3STWA 2A9VA 4C3UA 1YJCA 1SA0B 3W04A 4OQYA 1UMDB 2FPGA 1ZIXA 3EIXA 4R1QA 2IH2A 1LWOA 3UEOA 4JI0B 2QA5A 3DCYA 4TYYA 3EF0A 2J1LA 3G88A 2EFCB 5KJCA 2WWGA 4LGMA 4R3UC 4C9BA 2JEYA 3ZE2B 4L75A 3JVVA 5GGYA 2VTBB 1XKTA 1YQTA 4FDMA 3AKCA 2B7CA 3T38A 3RYHA 4CT4B 1F2UB 4C0LA 2XQJA 2IZ6A 3F71A 4FT4A 4OQFA 4GO1A 1XNHA 5CH8A 1YO6A 1P5FA 4J0GA 4REQB 4IILA 4CUZA 2ZWAA 1Y4UA 1UAGA 3V7YA 1YL5A 4AL4A 3VDMA 1OGYA 1L4KA 2PX6A 3UB3A 5KDDA 2A6PA 2BEUB 1R15A 3G8CA 3EGWA 2CJWA 3GVHA 5CBPB 5KSYA 5BSVA 1A3CA 1NBOA 3AUJB 3B60A 4X7PA 3TZCA 1RR6A 3VSCA 5IMSA 3PJEA 1UKZA 5CG2A 2YMLA 4O4JA 4XGRA 2B4AA 1P3JA 2PZBA 2I6SA 2VBGA 1LNQA 2X6QA 4QDXA 5BVHA 3BFPA 2G9ZA 1AMOA 3W5JA 4IKEA 1NIJA 5C5DA 1MUUA 2K6GA 1Z4IA 3PP8A 2DPLA 4YB8A 5E9AA 1TZJA 1U2TA 3DV2A 3RV3A 4Z4GA 1REQA 2GD2A 2ZAOA 1EP3B 4KNWA 3R2JA 2L17A 3DDZX 1FS6A 5FOWA 5HSGA 4JYCA 4IOJA 4D0SA 2WDPA 1YJ8A 3C3BA 1U1DA 2WC1A 5FPQA 3TB4A 3VNAA 3UT5A 4XWTA 1J56A 4P7KA 3ZJUA 2ETVA 2PYIA 1EJ2A 2A9QA 3RODA 3W2HA 4DOMA 1ZJYA 1H2YA 3QUQA 4JOCA 3A6PC 2XVMA 3GEBA 3THOA 2C1ZA 5K0SA 1B6SA 1PJZA 1T26A 1UEXC 2IE8A 3KLPX 1E59A 5EZYF 4ARUA 1XMIA 2F8TA 3JQGB 1GG5A 1G8HA 1MZVA 1CIJA 2FLVA 5FOVA 3BRSA 4JXJA 1ZUNB 4YQYA 4C30A 4D4GA 1N78A 2Z9CA 3LTEA 2PWYA 1T0UA 3VPBA 4MUJA 3EZFA 3T7RA 5BQ5A 1E5TA 5E1BA 5TGDA 4OXRA 2ZUFA 3MBIA 4XARA 4YI3A 1IHUA 4A0RA 1U0GA 2H1IA 4L5YA 4HN9A 1FRZA 2FFBA 1W59A 1QH1A 3OZWA 3OCUA 3KXPA 3K6SB 1AKUA 1R6TA 3JALB 3RBXA 3ZVNA 5KB3A 3AF5A 1C7JA 2Y1KA 5TQ0B 1IY1A 3TDMA 3BILA 5T3YA 2OAEA 3B6JA 1L3IA 4FCWA 4EWLA 2SECE 4E1VA 4E94A 1P7VA 1ICIA 1AIPA 1IHYA 2H8KA 1YQUA 3OESA 3VVMA 4IS2A 3E23A 4M9XA 2B30A 2JGJA 3EWAA 1C30A 1U0EA 2AK3A 4MPPA 1G8GA 2CEAA 4RA9B 4RGVA 2ZYAA 1V9SA 2J5BA 1AZLA 1A5TA 1OD6A 3B85A 3K2EA 2UYQA 3DTVD 4L78A 1P0FA 2JK0A 3RVLA 1SN7A 1JDNA 1M2OA 2CHQA 4PR0A 4A0SA 2QRZA 3K8ZA 1IRXA 3BF8A 4GMFA 4TYWA 1WWKA 3SR0A 4MVJH 1S3SA 4PBSA 1ETHA 4I14A 3E0QA 5I4CA 2I34A 3EDQA 1C29B 5IH3A 4ZI7B 1WOMA 1R3UA 2D59A 3L1KA 3ONFA 3QU4A 2NU7B 4JR0A 4BC1A 3D0QA 5E8JA 3ROFA 4DA4A 4S12A 5BWBA 1ENZA 3NIDB 4YIHA 5JV5A 1A82A 2EG5A 1N0WA 4Y9UA 3O5AA 1E7RA 1GUAA 3ZZMA 2QR5A 1ZBQA 4AX4A 1GT6A 4YUAA 1QLHA 2JANA 5I4IA 3MCAA 2BBOA 1N6NA 3I2KA 4ROTA 1WQ3A 1DKLA 4CLOB 4OO3A 1EH5A 3S2GA 1TUIA 2IBTA 1K3TA 1PJCA 5C3MA 3GV0A 1JPNA 4FPXA 1O0BA 1QFMA 2A0FA 1P0IA 2GM9A 2XR1A 1PFKA 3KDPA 4HNHA 3ZS9A 1SFRA 4EQ6A 2CL0X 1K7SN 3HA3A 4IG4A 4YUYA 1OVMA 1F0NA 3PD1A 1Z0DA 3QKSB 5IH7A 3OQMA 2XSZA 2PGLA 3B6ZA 3SZRA 2PN1A 2Q1TA 2B20A 3CW2A 2QTTA 1RYYA 4U7WA 1QGOA 4US2R 3CJRA 1Z6XA 2K7FA 3A2MA 1LU9A 1I3OA 2QSUA 2XEXA 3M1YA 4RHTA 2BMDA 2BDTA 4H27A 1YJBA 3GZ4A 1U7WA 4CQLA 4MV8A 1JLRA 2HAEA 2H9AA 3L7BA 1V47A 2CLMB 1F2VA 3PG5A 1MU0A 3DPSA 3QVMA 4G0OA 3TN7A 1O8CA 2BI8A 3LS2A 2PM8A 1SC3A 2IBSA 1BC5A 3AHDA 2BI7A 4AG6A 5ALZA 1HQKA 4L15A 5SYAA 2QRUA 2QJTA 1DRVA 1G66A 1EHIA 2FPRA 3OJXA 1B42A 3CH4B 4HFNA 4HQ6A 4MEAA 1ZWKA 2C94A 1DIAA 3JZAA 2RGXA 5KSOA 3HYCA 2HIGA 1MORA 2KSQA 3ZHSA 3OPMA 1KKUA 3TIFA 1UBLS 4LA4A 1AS2A 4WVLA 4AJ2A 2DJ5A 3DCJA 5I5EA 4YRKA 4RPIA 5AXCA 4IO0A 3CLTD 3EODA 3G0IA 1G7SA 4TS4A 4PG5A 2Q1XA 1BDIA 1HEIA 2X8AA 2JGDB 2ZI5A 3E9YA 4TN1A 2WUWE 2H00A 4BTLA 2YXPX 4N0PA 4OGKA 3CRVA 4WNAB 4HVCA 1EZ1A 1I5RA 2ZIAA 4DYHA 5L45A 1ZJJA 5B4UA 3MJDA 1XEXA 1F1BA 4MQMA 2VQ3A 1HZZC 4V02A 2O8BB 5HIIA 4JJGA 2ZRAA 1HDEA 3LX5A 4X0EA 4OK3A 4C0QC 1GDTA 1MC8A 1Z5ZA 3TUJC 4CM4A 1KETA 2P30A 1LPOA 1VIMA 3NHUA 3NANA 1PWEA 4KXLA 1WW2A 4WK4B 5LQAA 3CE9A 1KERA 2CXTA 2B69A 4F3YA 2O7QA 4ALKA 4O4HF 4B5LA 3FWZA 4S1OA 5CA1A 1KI6B 1U28A 2PIAA 3TLBA 1BWSA 1R6UA 5B1IA 1QFYA 2CFRA 2VPXA 2GAAA 3I37X 2MSEB 3OMWA 5BSFA 1VCIA 1FFAA 4RVDA 5FLEX 1OX5A 1YB6A 1UJ5A 1RIIA 2HQBA 2YOFA 4YAIA 2ANBA 3BGWA 1ENYA 3THRA 2IHBA 4KVFA 2XB9A 1UIMA 3WHPA 4ZO4A 3RASA 3VR0A 3NV7A 4RIIA 2I54A 2P2LA 3ZNOA 3HWSA 3TGLA 2ZVQX 2GA8A 4QYWA 3OLZA 3WLKX 3ZZUA 1XJCA 5EGSA 1F5SA 1R8QA 1NLUA 4PPFA 3ZWKA 1DE0A 2Y77A 1P45A 1ZM7A 1UM8A 1ZL2A 4RKRA 1EP2B 4HWSA 3OFSA 1VYVA 4E5PA 1PDVA 3OKAA 5HF6A 3T9DA 1AKWA 2PYZA 2N75A 3K0FB 1RJFA 3QPAA 1LTHR 4M1OA 4P54A 3CZ9A 3Q7EA 4M1ZA 2PH1A 3OUUA 1JR3D 2KYRA 5T7BA 1B7GO 3CCBA 1M34E 2BGNA 3VR4D 1BYUA 5HHTA 2CT8A 3M6VA 2P11A 3PKIA 3COWA 1RNLA 2EKZA 2WG1A 3CLRD 3IJRA 4NU6A 3RF7A 4C7VA 1KWGA 1J8QA 3F7MA 5E4JA 1AUPA 2WYOA 1S2DA 5DHTA 5HDBB 2ECQA 3KSZO 3MJSA 1ZM9A 2A84A 1IZ9A 3FUTA 2X0IA 4IPTA 3QQ5A 1Y7HA 2FX2A 2TECE 1Q0LA 4W5QA 4W5NA 2UZ1B 1Q19A 2XUZA 1KJJA 4CW7A 3S6JA 1CNEA 3H13A 5LIPA 2ATCA 4DDKA 2AKYA 2Z58A 3H7IA 1R66A 1XZDA 2DCUA 4S0ZA 1RLOA 4CCSA 5EC8A 3RYIB 4PY2A 1A4XA 2EKDA 2GETA 3NMUF 4XDHA 3VQTA 2QV7A 4HV4A 1VQ1A 4KVGA 1XEWX 4IIYA 3SQNA 1CP3A 2WF7A 5CVTA 3G8YA 1XLTC 1PR1A 4Y6RA 3S1SA 1BQEA 1EWRA 1G8KA 1S8OA 1Y98A 4NYJQ 3Q15C 1TCBA 2QVLA 4NDAA 1G6KA 3VUFA 1J9ZA 4ND3A 2BF4A 2V45A 1KAOA 1UJ4A 3RVRA 3TL2A 5FA8A 3VBCA 3SYLA 4ZCQA 3WYAA 3HE3A 5A3RA 4LZLA 3QSGA 1G2OA 3ONDA 1NLYA 3PDCA 4G8JA 1W85B 3EZXA 4XW2A 1R1DA 4RF4A 1I6MA 1PFGA 3T9BA 4WBNF 5B2EA 1W35A 1SRQA 4JELA 2PFGA 1ODJA 5B30A 3ZHVA 3NHLA 2QBYB 1YCHA 2WWVD 2P0YA 2GPWA 4LRUA 1NONA 2RBKA 1GUZA 4E12A 2D0OB 2CMDA 2IIVA 4DZRA 5TF4A 3I1IA 2ILVA 2AUTA 3GLHE 1LDNA 4GICA 1JBQA 4LTNA 3ONNA 1A9XA 4JJ6A 1UADA 4DN6A 4IZHA 1BH2A 3JWGA 1UKBA 4OHCA 5TQVA 2CDCA 2OVFA 4HGRA 1IM8A 1KZYC 2PGJA 1E0DA 3ZHYA 1C4WA 1TJYA 2C7PA 1CDEA 3TRFA 2P0EA 1D8AA 4F3RA 3LCJA 5DYNA 5LNK1 1J0XO 1ZXLA 2CUKA 2YBEA 5PNTA 3HXLA 5AWFC 3PFFA 4KYIB 1JB1A 3E8MA 5CURA 1QR6A 3EXFB 4MNTA 5BPFA 4R1MA 4UBNA 4X3OA 3W8DA 5MGBA 1FTYA 4FOTA 3MLAA 1E9BA 3QU7A 4E5NA 2E87A 1NNI1 2R1VB 1TX4B 2ZTLA 3QZUA 3MS4A 3MIZA 3VYWA 1QQ7A 2H17A 2INGX 3ETDA 4Q82A 5DRYA 3BORA 4BQFA 5DT2A 4KQMA 1GUFA 1R16A 3SC2A 2HV8A 3FMFA 2G1PA 4FXOA 2O2IA 5TPWA 1S2NA 4RV9A 5B7PA 4CGZA 5K9ZA 5T8KC 3JQDA 2R7LA 5JVDB 1J7KA 1JAYA 4FMDF 5CRIA 5B36A 1F7VA 1KMIY 1XXHE 2FE1A 3RM3A 1PD0A 4WKNA 2ACWA 2IU3A 3ZY2A 1U65A 1U5AA 4XQ9A 1WR8A 2H16A 2FLKA 2XYQA 3K8OE 3DONA 1YDEA 3ND8A 3PPWA 4HR7A 4NS1A 1CR0A 5AI4A 1IEVA 3GJRA 4TMVA 4TXHA 3W5VA 5JCOC 4A0HA 2GPSA 3TLGB 3UGTA 2OOKA 4RMNA 3TXXA 4LBZA 4IIBA 1P2FA 3M7IA 4RK1A 3GIDA 4NEQA 4ZV7A 3V5NA 3BN3A 1TT5B 4JVSB 1KJZA 2I1LA 3W78A 1XU9A 2AQ8A 3H5AA 4LJAA 3S27A 5E7JA 5B1EA 4Q6BA 1IH8A 1USUA 2G0AA 3RS3A 4UQLA 4KQFA 2RGYA 3I42A 5CAEA 5ICFA 5JMPA 5BR7A 5KX5B 3JQ7A 4AJ9A 1E6WA 2VR1A 4OHFA 5KC9A 4ILKA 3BJZA 4P81A 3IA7A 2B3TA 3DNPA 4NCHA 1Z62A 3H2ZA 2B7BA 2NM0A 4YMWA 5FT9A 4BUJA 3D31A 3WHIA 1KVSA 2VDNB 3QKRB 2JJYA 3RC1A 4AJHA 3JYPA 1OIWA 4NSNA 4YJ3B 4I9UA 4WLVA 3U80A 5FLXA 4TMWA 2QD4A 4OHUA 2IYYA 1E96A 1SELA 1RP7A 4I6JA 1OOEA 1CYDA 1KYQA 4EFNA 1YI8A 5KOIA 3WGLA 1XG5A 3H99A 2FXVA 2VF7A 3JRWA 1Z0IA 2Q4BA 2YMMA 3M1AA 1GDDA 3O9ZA 1JI0A 1WLYA 3G0OA 4MR8B 5B6JA 4DS3A 1AC5A 3ILVA 4QPJC 1M74A 5K2MA 1PVVA 1CQJA 1FFBA 1U3GA 2NO9A 4N54A 4WFJA 2WAOA 5IKPA 1WW8A 1BKYA 2O1XA 2ZE6A 3E9NA 3HADA 3P2YA 3GP5A 4Q4DA 4U6SA 2ZCVA 2AWNA 3G7NA 1Z38A 1O4WA 3TTTA 1K66A 3JS5A 3KR0A 3AF2A 3U1TA 5LLTA 4ZRDA 5J9FA 2FEKA 5BW8A 3ZWVA 4HDNB 1WDMA 2WT9A 3AOEC 1W47A 3RSQA 1RYEA 2HLPA 1SHLA 1CK4A 4IV0A 3BIJA 5K0LA 3RG2A 3Q1KA 1VMEA 2KPOA 4OYRA 2GCOA 5A1JA 4MAFA 4O0LA 2H2IA 1C9EA 3OE7A 5T67A 5JRZA 2DUMA 3HSYA 5ALPA 3FGNA 3MXTA 2JJ8A 3S1AA 5K5EA 5GJWC 3ASZA 1PKEA 4QYMA 4I9NA 1ZXBA 3VOAA 1J8MF 1JVSA 5F21A 4RTLA 5EJ7A 5JXIA 1T0HB 3OURA 2ERXA 4KQHA 4LNUB 1QPBA 1GQQA 1V3UA 3NV9A 5FUYA 1MJNA 1D4FA 4IW3B 5ERGB 4NH0A 5JNSA 3ZHZA 1ZEJA 4LGCA 2XNDA 2XXBA 5EJ4A 4NZZA 2O7VA 2OCPA 3MCZA 2J3EA 1SVIA 1P31A 1XVLA 2F64A 1XR3A 4OQEA 5IN5A 4AUNA 5EKXA 1VI2A 2IUUA 4OLAA 1X38A 1IUOA 4BAGA 4EMBA 1OR8A 3M8KA 1YFJA 3VHXA 4NXNB 3PWTA 4J07A 1OB2A 4QXQA 1Z6GA 2QLNA 3SIXA 2QZJA 3B51X 3CB4A 3HYLA 2FSPA 3GNQA 1PCXA 5EJGA 1ZR4A 3KTOA 2QRVB 4TQGA 5EZ6B 5BWOA 2X1VA 2E1PA 3E61A 4DABA 3AEQA 1R7RA 1N3LA 2ZSUA 5IBQA 4B7UA 4DV7B 1SCBA 5DWQA 1NNEA 1FEZA 3RKSA 4P4SB 3KV1A 5FWDA 1PDOA 4B7XA 1X1TA 3N0RA 4B3JA 1X1EA 1U8FO 3R23A 1N2EA 4C07A 2NXCA 3GIWA 1FW6A 1I7QB 4C21A 1OZHA 3UV6A 1L5GB 4GOND 1NU8A 1QFZA 3VX3A 2J3JA 1TVKA 2GA9A 1N9KA 2ZRHA 3IP6A 2ZRIA 3TZEA 4BB6A 1WTCA 2X1MA 3DEYX 3DHVA 2YYYA 1BCSB 1M1XB 2IYNA 4K6CA 1L6RA 4K6FA 2QXUA 3V1KA 1SH7A 3TQHA 2QYHA 4N49A 3AUSA 3TEFA 5K3FB 4BLTA 2F62A 2IW1A 3DH0A 3KTAA 4LXTA 3PX3A 4OI1A 3ANLA 1I4WA 2EFDB 1BHJA 1WSWA 3DMDA 4CKXA 2VLIA 3O4JA 5ETJA 5DHRA 2WU3A 1R4NB 2OM2A 1DX4A 2P6MA 3I01M 3JRNA 3OPNA 4G07A 3K5PA 4K9SA 1SXIA 1H4QA 5GV7A 1IFXA 5HA5A 3W5SA 1CUZA 3DQPA 1YVEI 4I55F 4O5OA 2GWHA 3FETA 3KOXA 1P1HA 2W6CX 2MYTA 2OBXA 2V74B 1QBGA 2GN9A 3ORQA 4MYTA 3WIUA 3GRAA 3EFEA 5T5QA 1KK3A 3W5IA 2WD8A 4YAJA 2I2XB 2H1HA 4AW9A 5KZMB 4DJ5X 2FFQA 2B0JA 3HXMA 4MROA 3W1VA 3WLRA 1HLPA 3ED1A 1WEHA 4MKXA 1MC5A 3C6YA 4QTYA 3EG9B 2D4HA 2CYCA 2HF2A 4B6RA 4WK6A 1WMBA 2HA6A 1J7JA 1RQLA 2Y05A 3PUJA 3E5RA 1EEXB 4CCYB 1NPYA 1Z15A 3PLRA 1E77A 2PNFA 4I3GA 4EG3A 1SM4A 4Q3LA 5EUCA 2UVPA 1WDTA 5FIUA 1WPXA 2V8OA 2XCRB 5EXDA 2QTFA 1IQUA 3ZXYA 1KZ9A 1LPMA 3WKAA 4RO0A 5T3UA 2B82A 4YRPA 2YVLA 4KU4A 2AXEA 4PO9A 1JJ7A 3WBFA 5JYDA 4DNFA 2AOWA 4JT9A 1GPKA 3LY5A 2OGTA 1Y82A 2G88A 2P8JA 2XWJI 2AGVA 1HNXB 2YZGA 1AH2A 4A8JB 4MIYA 2O2ZA 1A8PA 2A30A 2F55A 2QMZA 2XHZA 4Q6WA 1V8ZA 1GL9B 3KUDA 2FSUA 1ZH2A 4RQUA 3EMKA 2C3YA 5FPKA 1B41A 1VZ3A 1VL8A 1JU4A 3BJRA 3IT0A 1L7DA 3DDCA 1U7DA 3CA8A 4GOKA 4IIDA 2QUIA 3LNCA 4G0PA 2B94A 1MD9A 2BIFA 4M8SA 2ZE8A 4KSBA 3SQWA 4DL9A 5JW6A 2AA3A 2LW7A 3G2HA 1ZW6A 2YWBA 1RLUA 1AKTA 3NBZC 3SNHA 1XQ6A 3IBFA 3PFGA 1FXWA 3NORA 4EA6A 3NR2A 4P5PA 5SZIA 2YDXA 1XTJA 4TYMA 1EFHA 4K40A 3R5KA 4EA9A 1YV9A 2WMNB 3H9JA 3NUQA 4ISBA 1K8RA 2WILA 3BFVA 3HKBB 4QFDA 3RFUA 2GN2A 3T0FA 4OSOA 5A3QA 1B6GA 1Q91A 3IRVA 1BDBA 4RXTA 3IFSA 4O4LA 4MW1A 3AHCA 1PFWA 4FHGA 3V1TC 1Y1LA 1PO7A 3SCZA 2AMYA 3R0ZA 1HYBA 2B92A 1EKXA 3RJ5A 3JD2A 5EQJB 1ZD1A 3TJMA 1RHMA 1WD5A 4Z7NB 1HYQA 1SQFA 2H5LA 2WKQA 4FDAA 1V6AA 4KO3S 5CYGA 1GNVA 1XCLA 4KFUA 3FGOA 3S8MA 1XN4A 2D8MA 3AR9A 4MKZA 3IQFA 3IUSA 4TS1A 5JCJA 4RTOA 2ISCA 3GFPA 3QELA 4DIUA 2GXAA 1MOPA 3K2BA 1P4AA 2QTZA 1BROA 1YCDA 4Z53A 1E5QA 3DWFA 4PSUA 5TNXA 3PGLA 1I5EA 3VTAA 1R5BA 2O0MA 3RIMA 1XMXA 4OATA 1O5OA 3WSWA 4CV2A 2AC7A 3OOWA 3O92A 3BD7A 3VKUA 2HW8A 2VA8A 5AM0A 1T8SA 1L5YA 1GV0A 1A9QA 3LO8A 4PGHA 2BCEA 2I6XA 3CNLA 4TRNA 1J0EA 1C7EA 4ZOBA 3IX7A 2F1JA 1YIOA 3CNEA 3EXIA 3G6KA 3O0TA 1CJSA 1EIWA 3KB6A 2ADOA 2H59A 3VC1A 1CUSA 4ZDIA 5BYKA 4MO9A 2N42A 3OC0A 1UC8A 4H9GA 1OLSA 4W6QA 5FPHA 1Q11A 3PE3A 4D9IA 5D51S 3PRYA 3L40A 1QVAA 2O07A 4KUGA 2CV0A 2RIPA 1QU3A 2ZFUA 1KIFA 2OG1A 2H2AA 3K0CA 3RVPA 1CDZA 2JL1A 5EPEA 3VZCA 4XVRA 1DG1G 1GNPA 2WVHA 3MUFA 4L7QA 2IEDA 3OT5A 3JAWA 4M1TA 2PL9A 2OL4A 1G4UR 4GD3Q 1EK2A 4M9SA 3D7NA 1JYEA 1OJLA 4P93A 5EWLB 1GZUA 4NG5A 3ST7A 5EJFA 1LXCA 2APJA 2R2GA 1FUKA 1Z37A 1VC2A 1IIBA 4Y1RA 2FRXA 4CLHA 1R8SA 1MX3A 3COPA 4IQ4A 4WZAA 3SKVA 5CFQA 3VPFA 1XO1A 3WRVA 4EHLA 1VGVA 2AT1A 4OTZA 2O14A 3Q7PA 1KBQA 3BULA 4OSPA 1TUBB 3ZHOA 1YAHA 2GARA 2HK6A 2OD2A 1YR6A 3DT8A 3QYJA 3TZQA 3BDIA 4FX5A 4MVJI 2QN9A 3AHEA 5E7QA 3WZLA 4U2FA 1IBCA 3GVPA 1Q16A 1WXWA 2BW0A 2PDAA 4MV6A 3T95A 4YV2A 1NTOA 1CQZA 3PHCA 1ISHA 1X3LA 3DFUA 3V9AA 5MFPA 5A6VA 5CB4A 1P91A 1ZPDA 4OQQA 5MHTA 1JKMA 1TAGA 3QXXA 4K9KA 4MMYB 4R7GA 4C7BA 2QLTA 1MXFA 4Q1BA 4UCFA 5DHSA 4BO3A 2AQIA 2UZ4A 4WOPA 1I14A 1KBZA 4HJRA 4P3PA 5HMLA 2DFDA 2FUKA 4Z7JA 3WMWA 5L4SA 4HEA1 4L72A 1CJCA 2YIMA 2YNMD 4ZZ2A 1D4AA 3I39X 4K9PA 3ABQB 5FOXA 4EZEA 4YJGB 3QMMA 4M49A 3NJ8A 1YNOA 1NT2A 3GMSA 4IINA 1B4DA 2ZJ2A 1YL7A 1QHHB 3H9QA 3QFRA 1SWVA 1D6SA 1OYWA 4I7EA 1R88A 3IEIA 3JASB 4MKHA 4CXMA 4WZ6A 5GJVC 4C05A 3ZJ5A 1VHDA 3PC8A 1YR7A 1XK7A 1QB8A 4IYRA 1UBNA 1AKMA 3E81A 3FYUA 2Q4TA 3T7TA 5C8YB 5CCDA 2CC2A 2GSWA 2VRCA 3FNGA 2OB1A 4K9DA 5BR4A 5DM70 3ADCA 3U7EB 3IS3A 3L92A 3GGSA 1XT6A 1EGAA 1FCJA 3O84A 5DF1A 1I1QB 1PT8A 4RL6A 5AOAA 4NMLA 4IVQA 3ZOKA 3NIGB 5BSWA 3DVSX 2W90A 2VH1A 2FWMX 1F20A 2I80A 1FTSA 1E7YA 2XXAB 1NRJB 1BXRA 3NWOA 3MQ2A 5EQDA 3T7SA 3VR5A 1DQPA 4L27A 4DCSA 4M83A 1A9SA 2J6HA 3UJ6A 4MR9B 1JHZA 1DQSA 3P0IA 4MW9A 5LQUA 4F5ZA 3RD5A 5FDFA 4BE7B 4NCXA 4OH7A 4RAOA 1SKYB 3U49A 5EJMA 3Q5GA 5F78A 5DX1A 4IKOA 2OGSA 1EG2A 4I4TA 3RC9A 3UW1A 4B80A 2JGRA 4RACA 3JD1A 2X76A 3B20A 3NHAA 4EDHA 1UPFA 1X70A 4K6HA 1SBZA 3UMJA 2XDAA 1MMFB 3OHMA 4JHLA 3TDKA 1BCRB 1SEVA 1O9BA 1ZK0A 4X84A 5FBWB 3REOA 4I5IA 4ZKEA 5I7SA 1TJ3A 5A5EA 4GBGA 2MR5A 1I0LA 2Q6VA 2GN6A 2YVUA 3NT5A 4ZD6A 1ZNWA 2MTBA 1QFJA 5ALKA 4OHBA 2JI4A 2CD9A 3AEZA 1KORA 3KSDO 5TMEA 4HGNA 3EFBA 3VC3A 4EHIA 4WZBB 2HSJA 2JZNA 3A9VA 5JYEA 1FFDA 3IODA 2EDAA 3LMKA 1VLJA 1Q1QA 2FQXA 4KXFB 1XQVA 4NOKA 4RLFA 5A7HA 5TT1A 5EP1A 4FEGA 4P3KA 3ZY5A 3AU9A 1NP7A 2PH7A 1L7BA 3A25A 1ESEA 3NP7A 1NXQA 1K7XB 3M82A 2VKQA 4WA8A 1SZCA 2QMEA 1OYVA 2DFPA 4CLRA 4DC9A 5KYKA 2BSQA 1Z6QA 9ABPA 2R8OA 2YMQA 5KVVA 3CMMA 3IAS6 1OGJA 4Z7OB 7ABPA 7ADHA 5DNCA 5GINE 3DOCA 5IHPA 2Q21A 3LRXA 3I58A 3NFYA 4NICA 4FUTA 2M32A 5JY6A 5EIXA 3IKMB 2R1TA 4IRUB 4K86A 1Z6AA 1DELA 1IWOA 1FLNA 3D5QA 3S55A 2HSDA 3BFXA 1GU1A 3GA5A 3HEBA 3HYRA 1EEHA 4W9RA 5E6UB 1OILA 2YVQA 2C82A 4X94A 2BONA 3DBIA 3ANTA 5DHUA 2XRMA 3I6MA 3SAJA 1PGOA 2XMGA 2CW5A 1HWYA 5JH7F 3GRPA 1DI0A 1PJ2A 3VV3A 1XTUA 2G76A 3V1YA 5HR5A 3CZCA 3IULA 1LVGA 3EEYA 4FFWA 4ZANA 4BFLA 4C6SA 4BRSA 1SUPA 1U9IC 3O3CA 5JSYA 2HOQA 5KEIA 5IG2A 4LQDA 1J4AA 3EZ9A 3E7FA 4KRGA 1CJTC 3EUAA 5DK6A 4RM3A 4YAEA 4RK6A 4EHDA 3UYKA 1FQKA 1YVDA 1NXSA 4A8TA 1TO1E 2GFQA 1C0EA 4JBWA 1XMSA 1JDPA 3SFTA 2W5UA 4PHFA 3FTNA 3ESYA 4L5BA 4RTNA 4S1TA 1BOOA 3RE1A 4DYDA 5KWVA 3L9XA 2P6RA 4OG2A 2O2SA 3L43A 4M7PA 1TCAA 4OGWA 4AKTA 4FFPA 2OCLA 1R0SA 3DDHA 1SKUA 4OYYA 3ZLTA 4GLJA 4M2LA 4RVFA 4KREA 2BM8A 4U7GA 3OEEA 2BHSA 4G67A 4KEAA 3EGEA 1IPFA 2OCKA 3A3PA 1CR2A 4F2PA 1RADA 4KAXA 4LDPA 1G0NA 3EXHA 5HW0A 3F96A 2ZT6A 4LXIA 5IPFA 3FPGA 1PS8A 3NLLA 2Q2NA 3DTTA 3H04A 4AMUA 1GGNA 4HEQA 2O1EA 3SZOA 1II9A 3GAZA 4GLLA 3A32A 5F73A 5T64A 1C3OB 1D7OA 1F2TB 2VNJA 2YH2A 3I04M 3TLMA 1MG5A 2XDQB 5F52A 4CDRA 3OH8A 1BDHA 3PSHA 4XSGA 2JVKA 2RSLA 4NOJA 4ZPXA 3HUDA 1YACA 5BYAA 3T06B 1UZNA 4UBKA 4BNJA 2J3QA 2CXPA 3Q3VA 3BRWA 1JHUA 2CNKA 2N3ZA 1MABB 4DLXA 2H2HA 2Y67A 3Q0IA 4BB9A 2FSGA 4MQFB 1IWBB 1QC5B 1WW3A 3JYLA 4QBTA 2XUFA 2I2WA 1SHKA 1JEEA 1Z18A 2I6QA 2ZJ6A 3GLQA 2GX6A 4CN8A 1N2OA 2RK3A 3CHYA 2P27A 2FK7A 1RKXA 2RDMA 5D3QA 4C2TA 3A6JA 1AZWA 3PUKA 5F5NA 3IDSA 2V4MA 3KQVA 3EQ8A 4C7KA 1P77A 4XVUA 2ZUEA 3WRYA 1HE5A 2ID8A 1U3WA 3TZHA 1CVLA 2C31A 2ORYA 3UKDA 1XGKA 3NKLA 3TS1A 5LL6P 2F1KA 1BXKA 3DZCA 3CZ4A 4CE6A 3VUEA 1NMEA 1GTSA 4MUNA 5FWAA 1KYXA 3JVUA 3RVSA 4X5OA 1AO0A 4YREA 4G5YA 5DNDA 2PUJA 1DZIA 5GAJA 3S81A 4Q4HB 3PDUA 5DCLA 1EUDB 1PEKE 1XPRA 3HU3A 4ENUA 4OUDB 1PJAA 3LQ4A 2NNWB 3IALA 1UCFA 3A6FA 1ZUWA 1V39A 2P2YA 2QP9X 4OJYA 1Q7EA 5D86A 1E3QA 1Z12A 4KN5A 3L6OO 2PHZA 2VJBA 4LRXA 4UM9B 1ZMTA 4UTNA 2E5LB 4LVOA 1JE1A 1EJ0A 4KXWA 1W4ZA 3KB2A 4V3BA 5BRNA 4R9VA 5BV1A 1SCKA 4BV9A 3W2EA 2NTNA 2HR1A 2C58A 1GHTA 5EE1A 4TMZA 1ZJWA 1BS2A 4JBHA 2ZR7A 1N1DA 3W9YA 5CK4A 4JJEA 4ZIRB 4CMIA 5CEJA 2IS2A 3OT1B 4WEOA 3GEIA 4AT1A 2UVQA 4NI5A 2VRWA 3PA6A 4R2XA 2JLVA 5KNDD 4IDAA 1PL0A 4JB3A 5EIWA 3B36A 1W6UA 2PS3A 4UZFA 621PA 4FEAA 3JQBA 1IMOA 1T8YA 4JB0A 1RYFA 5KQRA 4R40A 3OA0A 1UL1X 2GXUA 1FDOA 3LSYA 5JWOA 3RYFB 4BMSA 1EZ4A 2H4ZA 3I34X 3LXMA 4K9QA 2OV1A 1DTWA 3BWBA 5D1HA 1E92A 1Z13A 2ZK7A 1WIWA 2MSKA 2A1IA 3OQPA 5LNK6 1OSNA 4OBEA 3RSGA 4OHYA 2HXGA 1PDWA 3IVXA 1PZGA 1VJDA 1ONNA 3OBIA 4HP8A 1JFLA 4RS3A 2HWXA 1ISGA 2I4NA 4XWAA 1I7DA 1K9SA 1T2FA 4NU5A 3AY6A 1E2QA 1RCTE 2B21A 3W8FA 3RJMA 1B0AA 1EXWA 5IAGA 1PK9A 2QQGA 1SAYA 3C7CB 1CNMA 1LJLA 2RHHA 2REOA 2XTAA 5EMMA 3PWZA 2GBGA 4HNSA 4MVJM 1GGMA 2GXSA 1E66A 2JCYA 2JIMA 4LS3A 5LYJF 3CF6R 4MXDA 4U7PB 4E2YA 1XRQA 4ID3A 1J25A 2AD5A 4MGYR 1LZLA 5ER6A 3WLFA 3GT0A 2PX8A 2C3UA 1GA4A 2R86A 3IBCA 3MPOA 4TKUB 5DDIP 5TMBA 4E51A 3IV6A 4EAQA 2VBIA 3GLIB 4UEKA 2LGJA 2F3RA 4PLCA 1MJHA 1JDVA 5CLIA 1Y6RA 2WV7A 3EJ6A 3F90A 1QO0A 4H7KA 1WKBA 5JHGB 5LQCA 2H1OA 1M10A 2E21A 3LPDA 3TNFA 2I3GA 3N59A 5BYBA 4MWEA 4P0PB 4WFKA 2FI1A 1N9GB 3TWOA 1EX9A 1UBKS 4TUYA 4H0CA 3VNUA 2WB4A 5KNCD 4QDZA 1AXGA 1TLLA 4LJ5A 2J9ZB 1MA0A 4JI1B 1DRKA 1S2OA 2G3YA 4F06A 3L8HA 3TLJA 5CVEA 1SOUA 2IYQA 3CW8X 4FB5A 4RZXA 3WICA 4HWPA 4MLCA 1NVMB 2QJRA 3E35A 5MF6A 3H0CA 5TPZD 1U7OA 5IANA 3R7AA 2IXTA 3WV5A 4WT7A 4CFZA 2IYAA 3D4NA 5ELMA 4AFNA 1NR7A 4K3UA 1QHNA 1SBTA 4G23A 3L49A 4INOA 4I5FA 3WX0A 3WZMA 3DE3X 3A14A 3FSEA 2CNDA 2VYFA 4MWTA 5T4FA 3ZV6A 3WKBA 4CLDA 1DT3A 2YS6A 2ZKIA 1P1FA 2ZVDA 1DKQA 3A7EA 3O03A 4KFRA 4MYHA 2EJUA 2IOQA 3ABRB 4WESA 5I48A 2A88A 2AOUB 4WPGA 2EERA 1T4CA 4M1YA 1VJCA 2NOAA 4JLPA 4WZZA 3SG0A 2MSNA 3COSA 4O8CA 1C3JA 1EWQA 5AOCA 1YZYA 4LC1A 1Y7IA 3O83A 3BG5A 4TTAA 5ENVA 2GF0A 2LKDA 4XYMA 2AR7A 2EGUA 3JQ6A 4TV9B 5C53B 1ZUIA 4GPIB 4IDPA 1KDYA 4LRSB 3N8HA 4KNVA 4RK5A 2PWAA 4X1IA 3Q4GA 3IT2A 3OBBA 3NHKA 1W36D 2FSVA 1MGPA 2ZR9A 4Y1GA 4HX5A 1K08A 4LF5B 3PYXA 3OOYA 1KZHA 4R2KA 3B3FA 1VA5A 1RJ9A 1QRAA 2JJ2A 4HWKA 4CEHA 1UBOS 2WJVA 3PC4A 3G49A 2MSWA 3OFNA 4P98A 2OYSA 5L8VA 3LZ6A 3FVWA 4RZUA 5ENDA 4QULA 4MQ4A 3JQRA 2FPMA 4W1SA 3TB6A 3U48A 3WK7A 1W76A 2WEKA 2B34A 4FHCA 4KWCA 1SZPA 3VR2D 1QYVA 1SVKA 4YH1A 3MMXA 1CUDA 1SB9A 1K6IA 3S3TA 1A72A 3VZBA 4HNVA 2XJ9A 4MDFA 1JI3A 1T1GA 3QKTA 2E89A 1JHOA 1RPZA 3GP8A 3MMZA 2OO5C 3EZ6A 3KQWA 5DBGA 3HDVA 2ZVJA 3KSBC 3PC3A 2AK2A 2C2MA 2J0UB 4QUGA 5JEEA 2CNWA 4WA7A 5AQEA 2HXSA 3GLRA 4TZKA 5CLHA 5I7AA 4GM4A 1FU7A 4GSKA 2OM6A 3WIDA 2A4MA 1U8EA 3S0JA 4DBLC 3SJAA 4NZ9A 1DGQA 4E15A 3VR4H 3W6ZA 3ZWBA 3FCCA 1M6VB 1V1MA 4DJEC 3PWSA 1CU1A 3Q41A 1XZHA 4EYOA 1XMJA 3JQ8A 2W6JA 4S0XA 1UM9B 2DHDA 4GKVA 2JK1A 3LIPA 3ETHA 3MWDA 4RXMA 2CVZA 4QPPA 3T1TA 3E70C 2DBQA 4L8GA 4UNNA 1DC3A 2V7TA 2DBZA 3HWWA 4M7RA 4C4RA 4RZ3A 4TKMA 5JFOA 4XD7D 1QG2A 2OP1A 2Y99A 1N6KA 4EHBA 1N7JA 4C2BA 1F8YA 4QXAA 1W5EA 1PJRA 5I4BA 2DE0X 1HETA 1EWYA 1T10A 1Z5GA 1Q0HA 2J3MA 3LFUA 1GCOA 2EX4A 1FNSA 2FH5B 2H4FA 2JAOA 1S3IA 1UXIA 3T54A 1T1JA 3UK2A 1CXZA 3V6LA 5AW6A 1IQPA 5IAAA 3UGJA 4YMTA 4EPYA 3T1YB 3L05A 5K99A 2GPNA 3O1IC 3UO8B 1RMTA 2P6OA 1EP9A 2H0AA 2LWIA 3GAAA 4EUFA 4LMRA 2O19A 1DJMA 2CXRA 2G0TA 4ND5A 4EPTA 4JWTA 1FDUA 5CT8A 4BX2A 2C4TA 2Q45A 2RI1A 3BSYA 2Y1EA 5JD3A 3N58A 4IBOA 4D43A 1UWVA 4HDSB 3WOHA 3ESRA 3BE5A 3QM1A 3WNBA 1LLQA 2AFRA 5KS2A 1XAJA 4B3SB 1D5CA 1FYEA 1X3SA 2FWBA 3D4PA 1JEAA 4OSEA 3U3DA 4AY3A 4M88A 4PAOA 4DQLA 4YJ2F 2DPMA 3OLXA 3ZQJA 3K05A 3MJRA 2NYAA 4JIMA 5EXPA 2XQVA 1JQDA 3IEPA 1POXA 1BMFA 2WE7A 3TW8B 4UAVA 2DEUA 2OKGA 4LZNA 4X8HA 4EUEA 2P1RA 2CLFB 1KOJA 3Q9NA 1EVQA 1JJVA 2C9CA 2GLXA 1LC3A 2W43A 2X5JO 2XWPA 3SZ3A 1UR5A 5AXAA 4WXRA 3D5EA 4BO5A 4BFTA 2R6HA 1Z07A 3VZSA 5DTRA 5LQDA 1P4JA 2JARA 3KHUA 1GEEA 4TTSA 4U7TB 3TD2A 5F7OA 2IS6A 4MB0A 2ZM5A 3LQYA 5GVSA 4P5DA 1NI4A 1KI8A 1NVWQ 3MELA 1P73A 4NRDA 3VYVA 4AO6A 4COKA 3K71B 2UYOA 3QA3E 4MUEA 4Q3DA 2XUIA 2HNAA 5DJ5A 3RYIA 3F5MA 5EKUA 5FTNA 4B4KA 1M9NA 1J70A 2ZDHA 4KUHA 5HIMA 2XA9A 2JLBA 2Q29A 3C8ZA 4G5XA 4K05A 2BRUA 2ZCUA 3A0UA 4Q12A 5EXEA 4DWVA 3EVEA 1Y3CE 3ZBQA 1GZSA 2QVZX 1SZJG 3FVTA 2JCXA 4QFBA 5EZSA 1IHXA 4N3NA 3PNBA 1U1IA 2PBFA 3V1MA 4O6VA 5LD2B 2NTVA 1GNTA 5EMKA 1A8SA 1JDBC 1O4VA 2P35A 1E7QA 2VHZA 121PA 2XQKA 3H86A 2ATEA 1KI3A 4W8HA 4BEJA 4BU0A 4C5BA 3BDVA 2ZU0C 3HLKA 3ZQKA 2MYPA 2Q07A 4OHXA 4H6PA 4X3PA 4D4KA 3HJHA 4HAZA 4PNHA 1HTBA 1T2EA 2H1SA 1T5TA 3VOTA 5BRJA 2AZDA 5DSZA 1WZUA 4YRGA 1G20A 3Q40A 1NOIA 4DGQA 1Q0QA 3GFQA 2Y8EA 3KHTA 4FE4A 3BREA 3DOFA 2I6GA 4JL6A 4F7WA 3O4RA 2O0JA 2QMQA 3CINA 3ROTA 1Q0TA 2P2DA 4LZWA 1V95A 1NC1A 2FOIA 4PAGA 4DJDC 1SO8A 2JFXA 4C76A 3J7TA 4TSFA 4Z1MD 3W3AA 1EBUA 1IAVA 2ZYWX 4R0MA 4AY5A 4G0VA 1Y1PA 4B3DA 4L2IB 3TIGA 2AMFA 4A03A 3AR4A 4WLNA 3W9BA 4Y2HA 2QAGC 1GKKA 3D2LA 3EW7A 1JSCA 4H6WA 1HOTA 3UJBA 4N3CA 3WNCA 3E3NA 4DMFA 3PGKA 4EG1A 5GZ1A 1QCYA 2JEOA 3WMFA 4BQEA 1BE0A 1VHJA 2QVYX 5HK9A 1A76A 2J5QA 4YXWD 2R48A 5KCZA 1XK6A 1C1XA 5A4JA 5K09A 2LIVA 3WYDA 2N46A 3H0KA 1RZRD 1RFLA 1BWQA 4H3HB 3EPRA 2OWDA 1I2DA 5EMNA 1KS2A 2GN4A 4AS2A 5EZYB 1VSUA 1T2UA 1XNJA 1CE8A 2JFQA 4IQ0A 2H4HA 2RHMA 1ODTC 3G0BA 5KOJB 3EXG1 3OIGA 1KAGA 4KK4A 3VC2A 4U5QA 3AM4A 4AP9A 1LV8A 3ILYA 4UBLA 4C5AA 3MUOA 1AOXA 4G97A 1L4GA 4YCMA 1VMKA 4NHOA 4FNOA 2DT8A 3WGOA 1JUDA 3H2HA 6ADHA 5K2OA 2NZUG 1OXSC 5CFRA 2OORA 4TOIA 4B79A 4F2DA 1BDJA 1SXGA 1W4BA 1KC1A 2P8SA 1MC1A 2IEAA 2NT3A 4WASA 3JVIA 4E2FA 5JAUA 2H4XA 3UKJA 1ULBA 1IHPA 4D4HA 4U4AA 2ZAIA 2IU6A 1JU3A 4EATA 1BG6A 4R6XA 5JSHA 4BX3A 1L5FA 4TXJA 3VPDA 5LP6F 1Q6ZA 2V7EA 1O96B 3D4LA 4XUGB 4OI0A 3SYKA 4HAXA 5CTJA 1G8MA 1NV9A 1CR6A 1N1EA 1NASA 3DHWC 1CY0A 3NOVA 4O29A 2WR8A 1V8BA 2ODQA 4I99A 2XRFA 1UDWA 3I52A 5AKZA 4D9FA 4EYQA 4LEIA 3SC3A 3K72B 3AR6A 1TVMA 1QV9A 1XKLA 3H84A 4HNRA 4ZMSA 2CZGA 2H2GA 1I6LA 3RWMB 4J03A 4CF6A 2XGGA 4HG2A 3QX3A 3FNEA 4C7OA 4QU5A 1NM5A 2D5CA 4RVGA 3KKPA 3RVQA 1NXOA 2VTDA 4S35A 4MUYA 3X44A 1TMOA 1OTXA 3THWA 3QU5A 1RPNA 2O2HA 2OCDA 4PZUA 5AM1A 4P9NA 3HKDB 3L1JA 4HK4A 2HJSA 2PL1A 3IOCA 1B26A 2SCUB 4I1PA 1PGNA 2VOEA 2O8FB 2EYUA 1V25A 2NVWA 3UANA 2AX3A 3ZH9B 3TRJA 1Z06A 3B1FA 4EUNA 1F8GA 1RP1A 1XMQB 4NCKA 2YWDA 5TS2A 4F91B 1N0HA 1U8UA 1IOWA 3IUJA 1KEKA 4EVSA 4YAWA 5JXHA 4ENSA 3QLVC 5EI5A 1T35A 3FW1A 4MIOA 1T9AA 2Q9UA 2ZOSA 3DUFB 3NAQA 4LRTB 5T4HA 2V96A 1T4BA 1R64A 4QDTA 4BZWA 2GZHA 4J3JA 1ZONA 2BGLA 3P45A 1ZGGA 4IS3A 5DGTA 4EY8A 4XWOA 2AEFA 3DZIA 4MI6A 3DR3A 3I9KA 2RG1A 4PZPA 5IS2A 1O54A 3QKWA 2EFEB 5AFSA 4L4YA 2BCJQ 1H3EA 3ZLBA 3N7UA 2W0SA 3BK1A 3AFGA 1SIOA 1UKCA 3ZWPA 1QIIA 2WSBA 3Q6MA 3HO8A 1H65A 2M1ZA 1F48A 3LBNA 3H11A 1J0AA 4WJZA 3DCIA 4M0DA 2VSNA 3DWEX 3PITA 5F5LA 5IM4F 1N2XA 2CFCA 4JSTA 4PEVA 3G2OA 1YQGA 1U9JA 2Z8XA 3R9XB 3VSBA 2FEMA 4HUTA 4CMEA 2KBFA 4RM2A 5HZMA 4QO7A 3ZPXA 5HKKA 4F21A 1UFKA 2IOYA 3FTDA 1CUJA 4UU8A 3HO1A 3WK9A 2IV7A 3LWNA 3G68A 5J3JA 4B33A 5FNVB 4WTOA 3HR7A 2VWGA 3MC1A 1VBKA 1SXJA 4DILA 3OZEA 1YQDA 3IV9A 4HZUB 1GGKA 2IUFA 3EXG2 4NMHA 4FXPA 2GTPA 3GF4A 3LCRA 2WTEA 2PMFA 4YP6A 3RB8A 3ABIA 3I8SA 1ST2A 4IV8A 1L1QA 5TY0A 1G0OA 4LRWA 1QIGA 1FDIA 3QKUA 4F04A 3VH1A 4OKIA 1DS6A 1G7RA 3QVGB 4Q1CA 4F38A 3FBWA 1LK7A 3R3HA 4CQJA 1I51A 4D8TA 4EHHA 1YASA 2XVZA 3AVWA 2WIFA 3CEJA 1RM0A 4L50A 3PRJA 4DMUB 6REQA 1E0AA 4JN6B 2BFEA 1GPJA 4UDOA 5CVVA 1TFUA 2B9VA 2R79A 5HCIA 1YUMA 1R6VA 1AU9A 3PK0A 4WMLA 1BQ3A 1UJ6A 2PKEA 2EWWA 2YV3A 1CD5A 5CVCA 5AJXA 4C89A 1BEUB 4PLPA 3DC2A 1U2ZA 4QA9A 4KKXB 1T9KA 5AHXA 4UDYX 1NG9A 4R81A 2Q4RA 5FL3A 2FKNA 2GZSA 2HF7A 5LP1A 3C3CA 2O3UA 3OIVA 5CLFA 1KMMA 2BBSA 2E4WA 2PD3A 3K1YA 1X39A 4O4HB 3RYCB 2ZSKA 4YV0A 1SCQA 5LC1A 3E3OA 4FFRA 2XNKA 1X8LA 4KGXA 1TF7A 3OZDA 1IN4A 3KZVA 4EJ6A 4J0IA 1UBTS 4ZQIA 4RD1A 4N5LA 5HILA 1U9CA 3ZE9A 4BGVA 3UMGA 1VIVA 2QRMA 1TQ8A 4BO0A 5JFGA 1S2LA 4IQFA 1O77A 3GJSA 3CUUA 2QYSA 2Y6UA 1N0VC 3HA7A 4Q7EA 3QLUC 4UREA 2ZQYA 3H1PA 3Q3HA 3DFIA 1P6XA 5B3AA 2H1WA 1CVIA 5DBEX 2CFTA 3LKVA 4UUAA 1EQUA 3AHIA 1YFZA 3AIIA 3T0GA 4XWKA 4F96A 2BPOA 4EUHA 1O9GA 4GXRA 4OFWA 4EB8A 3I2JA 4WKGA 2QXTA 2RI0A 3TH5A 1UBEA 4U02A 1GQRA 3OI7A 4G9BA 4B4VA 3OZGA 2ZIXA 5KYWB 2A9KA 4CM5A 5JSZB 1MDBA 4FJ0A 4QEZA 2QG9A 3ER9A 2LDBA 2P7HA 4F60A 4AI6A 4ALLA 5FEMA 1JSRA 1DUVG 1N2BA 1AKRA 2PRJA 4B2LA 1JLHA 3AEYA 3VO8A 2PKYX 3BL6A 1YE3A 1DMSA 3I5MA 3M6WA 3NKFA 1ELOA 3RUPA 1UK8A 2HPAA 3HJBA 2QRKA 3ANMA 3JPYA 4E33A 3PHGA 1V5GA 3KQYA 1Q57A 3C5EA 4ZTUB 1X1CA 3STXA 3AJRA 3WHLA 4IWYA 4JUDX 4EELA 2DSNA 1V5FA 3NC4A 4G1FA 1EUYA 2I4IA 2VHEA 1LTKA 1O95D 1I6WA 1QJCA 2BEKA 4X8OA 2C2XA 4XJXA 1ODKA 5AW8A 1ZISA 3B9QA 2UZIR 4WAUA 3OF5A 4F4UA 4CKCB 5DMXA 1FE8A 2O2YA 3QBTA 5EIOA 2VDOB 3PQ8A 1E89A 4R8KA 3SBDA 2B8TA 2Y0BA 4KSCA 1GL6A 4FMPA 3FHTA 4EKGA 5HEKA 3MRSA 5ALEA 3NASA 2JJ1D 3EGXB 3FZEA 1B23P 1L1RA 3HLTA 3ZD8A 1O57A 4L0QA 1T5DX 2FOLA 3Q7TA 5JY1A 2EDCA 1P9NA 5CNJA 4FE3A 4J16A 1SKYE 3I4LA 4KDCA 2PRYA 1JJAA 4WBNB 1E61A 2DG2A 1BU8A 2I1VB 4CFYA 4AJNA 4PCUA 2ZXUA 3WLQA 4JROA 4MV9A 4ZVOA 5LU8A 2P4SA 4BXOA 5BW5A 1TM2A 1E98A 3WB0A 1E4EB 1PIWA 1IZ0A 3LF1A 1TEXA 5CGQB 1E6UA 4DV1B 1GARA 1XU7A 4Y9DA 3GH1A 4FU0A 4J2TA 3KDSE 4MEBA 1XC7A 1KXJA 1H8EA 3AB7A 2XZOA 3FE2A 3Q98A 2XE7A 4FFLA 1XKXA 4RC9A 4WZBE 5EIBD 5HBGA 1RC0A 4DWWA 2WVJA 1J20A 3S29A 3ELBA 1DJPA 1TM3E 1JYSA 1SQ0A 2HGZA 2OZPA 4N9QA 5JLAA 2RKOA 5IJWA 5JAIA 2OHIA 1Y1SA 1BGWA 5FFNA 1AJEA 2AFVA 3FXAA 4NCNA 1CIVA 2P40A 4ND7A 3IESA 1MNAA 4Q9NA 1VKHA 4PG7A 1KDVA 3V4FA 3PNLA 3PDIB 4OOEA 3WNVA 2E5FA 2W4MA 4ZKDA 5BNWA 1M0SA 3DMYA 5HQJA 4BNWA 2ONCA 3NGXA 4H1HA 4D3YA 2J9RA 4FTWA 4E5YA 2ZPUA 4FBLA 3BSSA 3GN2A 4ZGWA 3ZHRA 3RSSA 1OWOA 4XR9A 4MULA 3JATA 3LK7A 1C50A 2I55A 4IIGA 2VDWB 2P3QA 3BSFA 4G0ZA 4FMDB 4MZDA 1KE1A 4DDMA 1J33A 3IKJA 1T6YA 3ZCSA 3DLHA 1A4RA 2IQ5A 2J9FA 5K45A 4H4DA 5CYFA 1HL3A 5EUQB 3HBNA 1JFVA 1VJ5A 2WYIA 2EKQA 2UV8A 3VHQA 1KO7A 1W0JA 4J7XA 4URFA 3ZYCA 2YFYA 3D3WA 2B5WA 3UWMA 5MN5A 3VU3A 5AI0A 2PH5A 5F33A 4GFDA 3QWAA 4Q66C 1DDOA 4WY2A 4O8ZA 4M8IA 2C77A 5JC1A 1RC1A 3LBAA 2IW3A 2ZYGA 4P33A 3F6BX 4X1KB 3N7AA 3NWEA 5D01A 5FB3A 3C97A 2ST1A 4Y2QA 3WGTA 1JEYB 4UCWA 1QM5A 3CVVA 1T29A 3IMEA 3RR2A 1PEDA 2TRSB 4E5SA 1UBCA 4JNKA 1I30A 5BMOA 3O8QB 5DFAA 3U4AA 5EPUA 1PJQA 3IHWA 4Q9IA 2R44A 2C4NA 3ANYB 4JUIA 2VJPA 4HH3C 1FYVA 2WUGA 3LE8A 1CCWA 2D1SA 4PNPA 4ZZIA 5AVOA 1Y3HA 2AUMA 1HA3A 3HVHA 4WGFA 4KO2S 1KO1A 3UXEA 4JY7A 3TQIA 2NN3C 2Q3FA 1UZAA 3HCBA 4GQAA 1PR5A 4Q7MB 1RKVA 1WABA 4EYKA 2L0XA 1ADFA 2G67A 5JS8A 3KQHA 1OFHA 1PE0A 5FUQA 3ZDXB 3TSAA 3T5BA 4CHGA 1O0CA 1N8KA 5DYYA 3VU9A 3JPWA 5JC8A 4HDRB 5AVXA 3LQ2A 4ZYLA 3C48A 2PSFA 2YHIA 4GVPA 1WCIB 3RO7A 3PDHA 3U7HB 5CNIA 1MH9A 3GMIA 1K1EA 1V8PA 2G63A 1OPRA 2NU9B 3I12A 4OBBA 4XEUA 2DWQA 1J42A 1IDN1 3RJ9A 1MW9X 3V4LA 5LOVA 4JYZA 3ZHTA 2FQYA 2B1GA 3OZ7A 1YR2A 1RABA 5GVRA 1X2EA 2W4QA 2G0NA 3RSOA 3AGPA 3FZNA 1M2HA 2JAXA 5I7OA 3ENQA 1UBFA 2O4UX 1IBSA 4LJYA 1NNSA 3CH7A 3FUWA 2B0CA 3F6SA 2DJIA 3WC4A 3EVZA 4XSVA 4NJOA 2G6BA 4LZOA 1EFPB 9MHTA 1N5IA 3T7AA 1JIJA 4GRIA 1EX7A 1PI3A 2CLLB 2DPYA 2XV1A 2G9RA 3GEEA 5FLKA 3ABSB 2IYUA 1P1RA 4LWOA 4OUKX 3RAEC 3PGMA 4FFBB 2XTNA 4YRQA 4JYAB 1F14A 2Q1UA 3TOCA 1YCGA 1IG0A 4DNPA 3CLVA 4YAKA 1GRCA 4BWGA 3DA8A 1CR4A 2WSYB 5KTMA 3KC2A 5LXTA 1A2KC 4AY4A 2IX9A 3IDFA 2FPIB 3PYLA 4NJEB 3FLMA 1I1HA 2R8EA 3R6WA 3VMMA 4BZXA 4ARBA 4RHUA 2ENUA 2X8JB 1L5RA 1MPTA 2VCEA 4G09A 2J8ZA 3KLMX 2MCFA 2FMFA 4B6FA 1VPTA 3G2QA 3EVGA 2VHWA 1O0SA 1JU9A 3VV2A 3UMSA 1U0LA 2IYZA 3HR4A 3WR5A 3D8HA 2VKTA 4EX6A 1NDQA 2EZ9A 3PXAA 3QEMB 1GL7A 1HURA 2WYWA 2XWQA 1ZMBA 4HWTA 3HP1A 4R1LA 1M6EX 3UFXA 3TJRA 5FO1A 2P9TA 2X7JA 3E9ZA 3EZNA 5EJ2A 1JIUA 2MR6A 3OTIA 4IHKA 5GZ6A 1QP4A 1M5RA 3P20A 4HH1A 1B76A 2DHEA 2FPWA 1C9NA 2R7NA 1GR1A 1KFJB 1YE8A 2V6IA 4KMSA 5FUMA 1Y89A 3DP9A 5J1TB 1VPVA 3MYRA 3PPXA 1GTG1 3C3AA 1GPDG 1M2NA 2NNLD 3T52A 3NM5A 4ZALA 1G2QA 5E2BA 1QIFA 3WGJA 1KAEA 3GRZA 1H3NA 3D54D 1U0TA 4G63A 1LCIA 1F5NA 2WLSA 2DM6A 2JDIA 2BFBA 4UEQA 4M21A 4B6EA 2OXIA 1YK1A 1ZD8A 2I33A 3PQFA 4YCDA 4BMXA 4K2HA 1E6LA 4MKIA 5KX5A 1MFZA 4Y1FA 2PUTA 1WKVA 3RRYA 4JP3A 3IQZA 3NNDA 2AYXA 4BAUA 4EG6A 4J3NA 2FQWA 1ZVJA 3OCXA 2EKPA 3B48A 1S0UA 2R8RA 3P26A 4W5JA 4YY3B 2YICA 1P7ZA 2AVDA 2BTOA 4L74A 4DMCA 4DSUA 2PMWB 4H1WA 3AY3A 1NV8A 1C1YA 1E94E 1PLJA 3GJ6A 2EV9A 1I9GA 1QG4A 2CK3D 4KBFA 4UNPA 5AYVA 1OC2A 4I55B 4URHA 4Y0AA 2IBMA 3SNKA 1SVOA 2NO4A 1NVDA 3PL5A 2MSLA 3JRXA 4P08A 1DLJA 2NW6A 4D9NA 4L22A 4GGPA 4EVQA 1E9VA 4JI2B 3GO4A 5FWYA 1YQXA 4GKJB 1ZGZA 4V2UA 4YA6A 5L6LB 3GLIE 2BH2A 2NVBA 3RVOA 2WY2D 1EHCA 1Q7TA 3UMBA 7MDHA 5P21A 5A6SA 5C51B 3PCTA 2NUPA 2VRBA 2X7HA 2DTDA 3TKYA 3D6TB 5EYPB 2LRHA 2R8YA 3X1YA 1Z5WA 2XNDD 3L3BA 1Y9AA 2QORA 1FMFA 2JFYA 3KXKA 2IUEA 3GCZA 1XDBA 3GCGA 1W5AA 4XYGA 3CPJB 2H1RA 2ZUWA 1XROA 4GWKA 2HNBA 1I3NA 3D59A 4B1FA 3Q3GE 1JZSA 1LPAB 4EAAA 1E2IA 3O8LA 3OJLA 4IJ6A 4QE3A 3R44A 3U1BA 2ZRLA 3N8GA 4K1LA 3B1XA 4KFSA 2WWTA 4PSKA 5E3JA 4BVKA 4I1IA 3AEKB 1SKAA 1PNRA 3FF1A 1L5MA 3V8VA 2VF4X 1W93A 3DFFA 3ODGA 5EZQA 4YQFA 3W6OA 3UPTA 2VHXA 3D0OA 1LJ8A 6CHYA 2G5CA 2QGFA 1H1LA 4KI0A 3ZEIA 1ZY2A 1A9RA 2QQ0A 4UMFA 4B71A 3QFCA 2Q5LA 5KI6A 3F8SA 3NHBA 3PZRA 4GR9A 5LFAA 3O8OB 1I3LA 4A73A 1LVUA 3FTEA 4IUDS 1WMFA 3O75A 5BV7A 2PS0A 3OQIB 1DEAA 3AL3A 3AHGA 5A9TA 4MUGA 2WSSA 4JC4A 2Q1WA 2VK4A 1PG2A 5KNDH 3AVVA 3ZX5A 1LDMA 2GJ8A 3NCTA 1N2SA 4URZR 3LUGA 3SHVA 3IJPA 5REQB 1YRHA 1L4LA 3AP3A 4RHCA 4F2WA 2V7QA 1VG1A 3I4FA 4CMHA 1VHQA 1YB4A 4JYMA 4V1CB 1LPBB 3DL4A 2J3KA 4UTOA 1U11A 5F51A 1ES9A 2WIBA 2OBMA 3PEEA 3OWXA 4XDYA 2OAGA 2VO1A 1ZP6A 5LCXA 5EJEA 5AKHA 1B16A 5CB8A 4XGIA 2IA5A 4NULA 5F77A 1KPHA 3P5BA 4YIKA 3CEAA 3K1TA 3O82A 4MKFA 4MRMB 2I9KA 3V2GA 4AN1A 2XE8A 4HD8A 4ZICA 1E5VA 1NXPA 2OCIA 2WU4A 3MTEA 3OEWA 1M7GA 1HC7A 3IQWA 3SF8B 1Z0JA 1ZD9A 2GAJA 4CODB 3D7KA 1FRVA 1VG0B 2AG5A 4HHEA 2AZXA 3DF9A 2QD1A 4A6PA 3TLAA 1N4AA 4UXIA 1DL5A 1T36A 1FC0A 2IODA 3TQQA 5C7OO 1P5ZB 1B6TA 2I6TA 2UYCA 3VAZA 4HX9A 4E3WA 4Z6KA 1FTNA 2BMWA 2MU1A 3UH0A 3DULA 3WQSB 5ELXA 4UNSA 3A1TA 4YJKA 5C80A 2YIJA 1YONA 1WZIA 3R5TA 4WECA 3OHPA 5JRDS 1PKXA 3LOUA 1IUPA 4U63A 1YD7A 2DR0A 1KEEB 1U7UA 2C98A 2PD4A 4GM0A 2OQVA 4F46A 4N0DA 2RARA 3CISA 5ED0A 1PYOA 2QDKA 4ZVSA 5A71A 4JV5B 3DCNA 1TKAA 5LA6F 1DBSA 4FYVA 1AE1A 2V3VA 2X86A 5E9JA 3TBHA 1WMDA 4LSZA 1NKTA 2E85A 4KE6A 2YWEA 3E7XA 3H1GA 2GBCA 1S8NA 4HWRA 5KHAA 3KWFA 1KOLA 4D74A 3OZAA 4ZOEA 1YVRA 1G8YA 4NENA 1VSQA 1JG1A 1QMPA 1EVYA 2E82A 2BKXA 4MGEA 4F6RB 1GZ5A 1T13A 1XZLA 4XDZA 5JS2A 5JXWA 2R5NA 3ETNA 4A2QA 1ZYUA 3IPLA 5D7BA 1NOJA 3WKCA 1NVVQ 3QUCA 3ONVA 1MJGM 1Q7RA 3KOMA 4FIDA 2WTNA 3KKZA 4V0MA 3STYA 4ETNA 3TQTA 3TI7A 1GCIA 4MGHA 2D5IA 2R5FA 4AJOA 1S96A 3HCOA 1K68A 3PKZA 3BAFA 1LS6A 1WLSA 4CDMA 4IIVA 1JQKA 2DLNA 3C5VA 2Y1FA 3JQCA 1PWXA 1SUBA 2ID9A 1WTAA 5A1TA 3HCPA 3M2TA 4ZJYA 1BO6A 3P2OA 3TDNA 5AIAA 1XSEA 3BIOA 2A9JA 2ZYRA 2EQAA 4JHXA 4RTQA 5AK5A 1PT9A 1QH9A 2EIHA 2YDYA 3VDRA 1KP2A 4JVLA 4OLBA 3OOHA 2QROA 2Q5OA 4KQEA 1FX0B 4AULA 3QQPA 2HK7A 1ZVVA 4KAJA 2HIMA 3R75A 3K32A 3OU7A 3WRWA 4Z9YA 3UBTA 1QZ3A 1Y5RA 3DW1X 2AXPA 3DDUA 1NN5A 2OCAA 4LISA 4D26A 1CNFA 4BN0A 2VPTA 5E4FA 1YC2A 4QNNA 2I65A 3EH1A 5LQMA 4QU0A 4EIWA 5JATA 5JCZA 1UBUS 3J7AC 2ZZMA 4PCVA 2F00A 1ZIPA 4I9HA 2ONYA 1AT1A 3EAGA 3ZV5A 5JNUA 2HLNA 3RK4A 1W88B 1YDMA 2FWIA 1BE6A 3B6IA 3A3KA 3KVNA 3MOIA 2Z2KA 1FFGA 1R18A 1UQUA 1YHZA 2JLCA 4R83A 2Q4OA 4OJMX 5DI3B 4ENRA 2VK2A 3RKUA 1RM3A 1AV6A 3Q8WA 5H7XA 1Z88A 3EXEB 2GAOA 1JZTA 1CG6A 2DX7A 4QQ8A 1UMCA 1YOVA 1C9YA 4E07A 3HNRA 2O5EA 1G6HA 3EDCA 1J8YF 1DHTA 1NQVA 4JZYA 2P2ZA 1CZKA 3BEDA 5D3KA 4JXZA 2L69A 4K0KB 4PTZA 1VI6A 3FJYA 3KFXA 4GX0A 4E88A 3F8WA 5DK4A 1JNYA 3AOEA 4B40A 5DGDA 4IWXA 3OSUA 3U60B 3PR3A 2JCBA 1ZOOA 4LI0A 1AK1A 2Q0XA 3KP1A 3VJMA 4BNXA 3BICA 3VBEA 3WLOA 1OX4B 1JXAA 2AH5A 1JDTA 4E6PA 1J23A 2C5GA 2F8LA 1EB9A 4NZPA 3U4GA 2NQTA 3USES 1G8FA 1TDJA 1RWOA 1M3SA 1N5MA 2Q62A 3K8QA 1IUNA 4I6EA 4C4XA 4C6TA 2FZGA 4UMDA 5CH5A 4O0MA 4DM4A 1OLUB 1PQYA 2FFRA 3KK0A 1ZL0A 3WNDA 1GZVA 1CR1A 1QQTA 5CNMA 4ZCMA 1YZFA 1CUYA 4OB7A 1OT5A 4ZT5A 1OZFA 1RYDA 3OKCA 2F48A 2D0DA 4U7DA 2K87A 3IIMA 4V2IA 3VVLA 4TQAA 2JPDA 3AJEA 1K6JA 2NTJA 1I1NA 1LI7A 3L0CA 3VR6D 3DAYA 4BVGA 5IC5A 4ENVA 1X13A 4MW5A 2NP7A 4KPUB 2AOVA 3C3DA 4QPDA 4AF6A 3R6GA 1FXWF 3I0ZA 1NE7A 3OAAA 1QS0A 4TT3A 1W46A 4D9KA 3BZWA 4UM5A 4OHPA 3D1LA 1RKBA 3PX2A 1N6LA 1GA6A 4MPRA 5FADA 3RU9A 1XTZA