1T35A

Crystal structure of a hypothetical protein yvdd- a putative lysine decarboxylase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
179
Chain Sequence
MKTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSRVGLMGTIADAIMENGGTAIGVMPSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCWAQIGIHQKPIGLYNVNGYFEPMMKMVKYSIQEGFSNESHLKLIHSSSRPDELIEQMQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
publication title Crystal Structure of a Hypothetical Protein Yvdd - Putative Lysine Decarboxylase
rcsb
source organism Bacillus subtilis
total genus 45
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.18: Lysine decarboxylase.
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t35A00
1PFKA 3O8OB 3OPYB 4JEMA 1S2LA 4MEJA 4OHRA 1S2IA 1F8YA 1ZXXA 1S3FA 2NX2A 2A33A 2PFKA 4JENA 1YDHA 3O8OA 4LJRA 1S2GA 5AJTA 2F48A 2F67A 3O8NA 1WEKA 4I36A 4JELA 4KXLA 4MCJA 3UQZA 2F2TA 6PFKA 4A3SA 5AJUA 3QUAA 2Q4DA 3IMKA 4I4IA 4U1RA 1RCUA 2PMBA 3OPYA 2F62A 4PFKA 3F5MA 3GH1A 3K2QA 3PFKA 3HNOA 3O8LA 4LJKA 2KHZA 4P5EA 4FYIA 4P5DA 4NPAA 1F8XA 2F64A 4LJLA 2A0KA 3EHDA 3U39A 4FYHA 5ITSA 2IZ7A 1S2DA 3SBXA 3BQ9A 4KXNA 4HX9A 4RH3A 4OHBA 1KZHA 4I7EA 2IZ6A 1T35A 2Q4OA 2KLHA 1WEHA 4KXMA 1MTOA 2IZ5A 3MAJA 4WL0A 2HIGA 4FYKA
chains in the Genus database with same CATH superfamily
1QANA 3QV2A 4K3UA 1RJEA 3W3AD 3IBFA 1JNXX 3DMHA 5KINB 1TEZA 5DLYA 2J0EA 4FWBA 3TECE 2W2PA 3KR0A 2H1FA 1X7XA 4B5KA 2GD0A 2IXEA 1JU4A 3TLKA 2OZKA 3DDWA 1RABA 3KRTA 1IG3A 3EFOA 3ULKA 5DTJA 2PX3A 4RDHA 1YS9A 4CMBA 3FDFA 1YQ9A 3HRKA 3OLZA 3ASYA 4PYRA 5JPDA 5CM8B 1ZUIA 5A3RA 3FCEA 4B9AA 2OVFA 3A1SA 3E8XA 5ANRB 5BR4A 3AL3A 5D3KA 1I2MA 1XLTA 1NL3A 4WKCA 4GM1A 2G09A 3GO4A 2ILVA 2FQYA 3NEAA 3AHCA 4BWGA 4FI3C 4DWJA 4JP1A 3T3PB 4E7OA 3JQ9A 1BWPA 2QN6A 3DAFA 1QR6A 4IPTA 4WX2B 1RI1A 2ZB3A 2Z0MA 3W9YA 1QZUA 2Z2JA 2JFOA 4EARA 5K5EA 4PQGA 1Q20A 3KETA 2Z6QA 2X86A 4FGSA 1Q19A 4G5FA 4UZEA 4ZU1X 2FW6A 3COJA 1X9IA 4CT0A 3PHHA 4QUHA 3TNDA 1Q1ZA 1QF9A 2UXBB 3L8YA 4MCJA 5FAXA 1SUWA 3NX4A 1XVAA 4B4OA 4BVLA 1WW2A 4C7JA 3EVDA 4QYTA 3PUXA 1LZLA 1VSUA 4IS3A 1E3EA 2DPHA 3E2IA 4YXWD 3D5TA 4R8KA 4AP6A 1OLXB 3V34A 5JZOA 4RE6A 5HX7A 3JWIA 3UT6A 4YCBA 5GVSA 3V97A 1A8PA 2WTBA 5EMJA 3PHLA 4TS1A 1NGSA 4TLBA 4NEHB 4YRTA 4FR2A 5GPBA 2EJCA 2VK4A 2O8EB 3NR2A 1YZ3A 1H6DA 1A8SA 1Y5IA 5JYEA 1VE6A 4RORA 1E9BA 1JEEA 4FX2A 1JR3E 1U7ZA 1U7PA 2MR6A 3UH0A 2ZE5A 1KSFX 1J8YF 3PC6A 4MQBA 3KQOA 2EGGA 5DM60 1VMDA 4R01A 1DJLA 1VIAA 5JAZA 2R8YA 1W4BA 4UBOA 2JCBA 1SKAA 1VG1A 5LN1A 1FX1A 1XZMA 1Z63A 4EPWA 1FEZA 1J8MF 2LGJA 1RFGE 1XIVA 3TZ6A 3MTEA 1B8UA 3IGFA 4BQQA 4CWAA 4DBZA 4LOHA 2OV1A 2ASVA 2HFKA 3EAFA 1QTRA 2B0JA 5CNJA 5CCEA 5IDWA 4ZOLB 4LJ8A 4IHJF 3T7RA 3RUDA 5JFOA 1TKAA 1Y3CE 2ID7A 1RE1A 3U7EB 2HMSA 3UV7A 4DXHA 3VNRA 3FE2A 2VTBA 4EMBA 2FETA 4HTFA 1XD8A 2RH5A 3EE6A 4NZNA 1RWOA 3O8CA 4H17A 3MK31 3ITNA 2M2IA 2Q1WA 1G5RA 2GZ2A 2WYVA 3HO1A 2H31A 1R6DA 2ZRIA 3O26A 4REOA 3RPEA 1BDIA 2XNCA 3BKXA 3QKRA 3CWQA 5LPNA 3OUZA 4NYMQ 2DG2A 2C5SA 5FFMA 2NVUA 5A3JA 1R8JA 3FETA 4DUZB 4LZJA 1DQRA 1RHKA 3VPFA 3KWLA 1DGQA 3T5CA 4MQFA 2JA2A 3E58A 3S8MA 1EYZA 3EXFB 1HEYA 1A96A 2DU8A 1EAYA 3WLOA 4LY0A 1NVXQ 1Y5RA 1R9GA 2HXYA 3KDSE 4B3CA 1VLLA 4BL5A 4I1OA 2OORC 1W5AA 2FSHA 1LQUA 2QM8A 3E4CA 3FNBA 3MWDA 3K8ZA 4UUNA 1IVNA 4MHSA 2LW7A 4ZO7A 4ZV9A 5KX5B 1XZEA 4AJKA 1JIKA 3FFAA 2DH5A 4CM4B 5J4YA 2AXEA 5FYDA 3GP8A 2H9IA 2EZ9A 5BQPA 2A0UA 2ISCA 1KRHA 1E4EA 1XA4A 3EFEA 5FLYA 4EMUA 3GIDA 4ER6A 4JXXA 3ZU4A 1N2XA 1X2BA 5BW5A 4D1YA 3WVNA 4LHEA 1HF3A 2F4NA 4DA9A 1IXRC 4MUNA 1FNCA 1K6EA 1FC0A 1N1DA 3GZNB 3L6EA 5HBRA 1NOJA 2A2ZA 3GVIA 1RWBA 3GFTA 1CJVC 3IDAA 2GTPA 4LJRA 3LYUA 3KALA 3AJEA 5FI1B 2QVZX 2NO9A 4WXHA 3G89A 2PGAA 2YVUA 2ZIAA 4LVOA 3EEOA 4IO0A 5KUTA 1KDRA 2GX6A 4INZA 3IDFA 5CBPA 4JOBA 2EX1A 3JD4A 4J0GA 5AW6A 2B35A 4NTZA 4WZBE 3GJXC 2EKBA 3EW7A 3QYPA 3BCSA 3Q7EA 3DZJA 4GKAA 1L4UA 1MCZA 1QCYA 1W8IA 2IYWA 4W1QA 3NAMA 1H0KA 2CLCX 3KTOA 4UNNA 1PGJA 2C3UA 2QTFA 1G8KA 4JYZA 3WRYA 5IYZA 4B85A 1POXA 4HXEB 2PLAA 1QMGA 4BMSA 1N6LA 3EIFA 4C5BA 1UC8A 1IBMB 3LC2O 5I7SA 5B7NA 5CYFA 3W5AA 4ABYA 1VC2A 2FFRA 1EE9A 3WTCA 4Z7QB 1DKNA 2V7BA 3EAGA 3F6SA 1H2BA 1EZ1A 3HA2A 3KBBA 3PXAA 5FIUA 1YMUA 2Z3WA 4NXMB 3GG9A 5CVCA 1TFUA 2VCEA 2YMMA 2DHRA 3QW4B 4OU4A 5GONA 3V2IA 1S2NA 3A1FA 1V9SA 4FTWA 2I4MA 2FPPA 2PLWA 2QZ4A 1B43A 2WFLA 2Y3IA 1TNDA 5AI0A 3U1BA 1ZKDA 2OXRA 1T8TA 4ZK2A 2J9ZB 3VSAA 4RK7A 4TYYA 3R4VA 3BGDA 2PVCA 4IRMA 5FV7A 1KEEB 2VKTA 5IJAA 4IH1A 3RSHA 1O96B 3CUEF 4RV4A 2E55A 1YB2A 4C4TA 4LBYA 1AJEA 1D8AA 4OK5A 2CJXA 4IV5A 4GZ5A 4KWTA 3C43A 4ZJPA 4KLRA 1E2QA 1LKZA 3CZQA 4P54A 4MKIA 2GI4A 4EY3A 3NBQA 4B3SB 4D79A 1GT6A 2X41A 1JLRA 1H6AA 2Q9UA 2OWEA 3SGLA 2VUHB 1CEYA 4R2KA 2DPYA 1EPUA 1R9JA 5A7HA 3ZCTA 2AFHB 2OKGA 4HVAA 4QBFA 2G0TA 1WS6A 1V6AA 1XU4A 4D8UA 4I50F 3LY8A 4U2GA 3HGMA 1VHJA 3TNFA 1VHTA 3HKDB 4PX9A 3OCWA 1ZIYA 4MR7A 1B2RA 5FNVF 3VDNB 3FTEA 5IPFA 1LRJA 1LSOA 3H2IA 4Y0AA 3OTHA 2GN8A 4GBGA 1I5RA 2ZQYA 4NFLA 5K8UA 1B6GA 1KO1A 1GUYA 1M2VA 1IE3A 3DD1A 3LVRE 1KYXA 4CR8A 5K0SA 1S2LA 1X8KA 5EJFA 1E9FA 3I72A 3PE3A 1Y5NA 1Y3FE 5AHXA 5T8KC 2ZE6A 3N28A 3F9RA 3LC0A 3R6GA 5T5QA 4Q3LA 1IOVA 1PQWA 3LDGA 3SAJA 2JFUA 3HP1A 4ETWA 2PH1A 4YMSA 5TQ2A 3B3FA 3QPDA 1M1YB 2VHCA 2JJ2D 2IJGX 3HCDA 1APBA 1EAMA 1QO7A 1T4CB 4N12A 1X19A 5DTQA 2B4RO 3N2YA 4O2AA 1HWYA 8OHMA 2D2VA 1FU7A 5KMGA 3FB4A 4DWWA 3U09A 2WM3A 3NUQA 3T5AA 1RWKA 4O2LA 2YFHA 1X7WB 3A70A 2R3SA 3WYAA 3RS7A 4QJIA 4Q24A 1YZKA 2R7LA 4Y6PA 4YRCA 3UKOA 3ROZA 1QWOA 2IXDA 2X4DA 3U4IA 2PEZA 2XY4A 2QX9A 4DB2A 4KAXA 2FMFA 2O7VA 1E7QA 4TZTA 2ORYA 4QG3A 5I4CA 2JGKA 5IK2D 3W7AA 1CZKA 3OOJA 1LF5A 3V1NA 4CQLB 1UDAA 1CFJA 2OP1A 4RFSB 3TSOA 3F73A 3PFHA 4B87A 1RYMA 3OM8A 4PNPA 4TV8B 4L6AA 4KGVA 5ALOA 3IIIA 5F76A 3H8VA 2I1WA 4LSGA 4TKUB 3M9WA 4NOMA 5TPWB 3K09C 4JL5A 1I2ZA 1KI8A 4TVKA 4RZQA 1JSCA 3WB9A 4NLLA 2CYAA 1FFXA 5C18A 4ABTA 1FSFA 2D0OB 4JCOA 4MKHA 1NW7A 2H7YA 2XCIA 3MINB 1KOGA 5G53C 1ENPA 1SUCA 1XYGA 3EQ7A 4JP3A 5BSEA 2CY0A 4QLBA 2BFFA 2IS6A 4ZT4A 1RQ2A 4QAQA 5AESA 5LU9A 3AEKA 2P6MA 3IUSA 3SLGA 1V1MA 4ZK6A 4KLAA 1QE0A 1K7YA 2HJ9A 4X6UA 1FQJA 1VMAA 3V8NA 2EHDA 4R1OA 5BMVF 4NXNB 3K4QA 2BFEA 2O7RA 1XAJA 4DJ5X 2QP4A 2Z2ZA 3TXYA 4HVCA 1U8AA 1H22A 1FSPA 2AFIE 3EG9B 3U3JA 1KEVA 1ZSVA 4FB5A 5JQGA 1GG9A 2IOQA 3DVLA 4W7HA 2CNKA 1N0VC 1USGA 4HQRA 3UMGA 3HFJA 1PD1A 4INJA 4MJXA 5AKGA 4CI0B 5LQKA 2WYUA 4C08A 3M5WA 2REOA 1DDIA 2FXVA 1CQIA 2JGLA 2YW9A 3AFMA 3EA0A 4BVJA 4PGFA 3LQYA 2PWZA 2X1MA 4P98A 3L6DA 4WA7A 1KEUA 5DNUA 1J0CA 1XE3A 3N7AA 3U0VA 2OBLA 2VUSA 5E2IA 1TUGA 1ADJA 1NUUA 5B1YA 1E1QA 2P7IA 2FRDC 3QHQA 2PKXA 3VUEA 3PTAA 2HOQA 1L7PA 1TXGA 2WNIA 4HEA6 4JB0A 4L78A 1G7RA 2D2FA 1X13A 2UAGA 5C31A 1CJCA 2QJTA 4POOA 3GMSA 4BGUA 3VA7A 1GV0A 4HK4A 4IIGA 1JIXA 2QTZA 4KXQA 2QD1A 3WLNA 1QP7A 1C30B 2R6R1 3KL4A 5ILGA 2VPPA 2WFAA 5E3IA 1QGUB 3SKYA 3KYJB 1KVRA 2XX3A 3P4XA 1T5LA 1UP4A 2VIIA 4BDSA 3ZGYA 2NW6A 3RC3A 1DXYA 5KQSA 4C4OA 3MGGA 1TM2A 3NAQA 2XNHA 3GBVA 3GPBA 3JVVA 3N07A 3V1TC 3QU4A 1JHXA 4D92A 1JN0A 4URYR 4DQVA 4OYYA 3EOZA 1XZHA 4A8TA 1L5SA 4AT1A 3K8OE 4MWSA 3UV6A 5AUPB 1UBHS 5SZIA 1N8SA 3AF6A 1UBJS 3PNMA 1T5TA 1TGVA 2MINB 4LF7B 5ADHA 2VHWA 3P0IA 1M76A 3P19A 3RS2A 5TS3A 4URWR 1XOIA 5EXEA 3C4VA 4CV2A 4EG3A 2Z4SA 3QVMA 3UK2A 1UDXA 4DYVA 1ZU4A 1TF2A 1XFDA 3H05A 3I3SR 4R83A 5HBGA 1A9RA 1RXIA 4ME6A 5KYKA 3SZUA 2VP9A 3H8SA 1WEKA 3KWJA 1XA3A 1X70A 5HRUA 3FOZA 2YMQA 4F97A 3P8ZA 3TLAA 3FZQA 3DO8A 3KTDA 5EZ6B 1MFPA 5C1OA 1V1JA 4HWRA 1M66A 3T54A 1NC1A 3DHYA 3QPVA 3RARA 4ZI7A 1V5GA 3WWCA 4X45A 1FJGB 2NVWA 2WIJA 2JANA 2NZJA 2UZ4A 4Q3KA 4L85A 4EG4A 3NVMB 4XH9B 2OGTA 3H2HA 5JG7A 3U80A 3ZUPA 4IDCA 2J7PA 3OX2A 1SIOA 1Y3BE 1EBBA 2JHGA 1F38A 1Y8AA 1FU8A 1AT1A 5ALPA 3UFXA 3H2GA 3NI2A 1N2ZA 1ENYA 2AK2A 2GBLC 3PKIA 1V4NA 2Q4EA 4QTXA 4WJKB 1D6MA 1PT5A 2D1RA 2FK8A 4ZPXA 4ZZ2A 4DIEA 3ZDCA 1XTJA 1SAYA 3JQ8A 4RV9A 4HR7A 3UK7A 2C7VA 3ZHYA 3WGIA 4FE3A 3RF7A 3S2UA 1ESEA 2FW0A 1E0SA 3KZ1E 5T3YA 3R0XA 4N5NA 4A2PA 4BZWA 4L16A 3JR7A 2FW9A 1NVTA 1JG3A 2X5JO 2MCFA 3Q7PA 4BLUA 4EJ0A 2LZ0A 3K8YA 4KN6A 1UK7A 1SVWA 2LR0A 3SKVA 3U26A 3GDHA 1T1EA 1D09A 3TPFA 3IEMA 4A5SA 1MOPA 1X3LA 4XI9A 4IW3B 1JWAB 2V6GA 3A1UA 1UMKA 1P0MA 3NHSA 2JJ1A 4BQEA 2TMGA 2Y6VA 1OTHA 4RMIA 3CZ4A 3NVDA 1HDYA 3FSGA 4CF4A 2BONA 3IQGX 3LW7A 4KL8S 1R0YA 4BNUA 3IC5A 3TTYA 3IEXA 1PR2A 2C96A 4U00A 1U2SA 1HRKA 2D4HA 4K8OA 1T34A 4CT5A 4ZYTA 3ZDRA 3IOBA 5CT6A 1GFIA 2ZRMA 2A57A 1VPWA 3IOMA 4M7WA 4X61A 2ZZNA 5IJ9A 1OWMA 1JX6A 2WSLA 3ST7A 3DKIA 3ZZTA 3DZIA 2V6JA 3V1MA 1ZMRA 3V46A 3AR8A 3PUIA 4IWYA 1ZGCA 4P2BA 3RIHA 1YNOA 3WGJA 2BGNA 3CXRA 2V58A 3KFLA 3EK2A 4PIMA 2RAUA 2IS4A 5CG1A 2FR0A 2QRGA 4L4UA 3QY9A 4DLTA 1LPPA 2X42A 4HYTA 4QFMA 3W1VA 1LDGA 4EK9A 3K70C 1CQWA 4P3XA 2BJVA 1N6IA 2R6AA 2BZ0A 1DIGA 4MARA 4R6XA 5TC4A 3V4FA 1UUFA 1IY8A 4HWSA 4YCAA 3E03A 5FL3A 4EAAA 4LFAB 1D2CA 2OORA 4GI2A 1OB2A 3CCBA 2P0YA 2QZ9A 2ZSKA 3EXIA 2J8ZA 4RULA 1JG6A 1LV7A 2R6ZA 2FW1A 5H9WA 2G9VA 2H65A 1TM5E 3Q6MA 4EWLA 4F96A 1G17A 4CF7A 4ZI3A 1Z22A 3IAM1 4YJDA 3MELA 3BZUA 4MQMA 1WWKA 2Q1SA 2G6TA 3BXGA 5LBUA 1B4DA 1O97C 1VZ3A 3PX3A 2WF6A 4HPJB 3ZEAA 4D9JA 1EVKA 2ZTSA 3SR3A 5C53B 4YFVA 4ZJYA 3JALA 3RVMA 4AK9A 2XYPA 4IJ5A 3L3BA 2QENA 3D3WB 1YQXA 3DKRA 5JADA 2K7FA 2CYBA 4TL7A 3W34A 3DE0X 3F9IA 4NBVA 4F0JA 5KEIA 4DIDA 3U5TA 3IUBA 4MS3B 3IILA 3R76A 3RVNA 5EQJB 5B6JA 3UN1A 2G4CA 1Y9AA 2C2YA 2PBZA 4JUIA 1A1SA 1CBUA 4NQZA 9MHTA 2PLNA 1VCOA 3N1UA 3RSSA 2BZ1A 4BMNA 1ZK2A 3WC4A 4ZO4A 5DRTA 3V9AA 2VPIA 2EFYA 4B31A 10MHA 4B3XA 2JNWA 1HL7A 3NATA 5EPOA 4ZV7A 1BCRB 1G66A 2QVYX 2YQ5A 3PPIA 3PXDA 1L5KA 5CDSA 1ZMXA 3KE9A 1E58A 4Y2GA 2AT1A 2HRBA 1UXIA 3OOEA 1DWQA 4QEDA 2IVZA 4IIJB 1C3EA 1RJ9A 1L5ZA 2V03A 1SVSA 1CPYA 3BM5A 3DEZA 4PNEA 1K68A 4ND4A 4BAUA 5CD9A 5LOVB 4JBGA 1UXGA 1YVPA 1ZNYA 1XRQA 3LBYA 4YJ3A 4U7DA 4Z0PA 2Y92A 3AYXB 1BOOA 2C7BA 3BF7A 2GCNA 3H6HA 4WDRA 4WZ6A 1CP2A 2R9VA 1GTL1 3REQB 3T7AA 4KPGA 4UBMA 1OLXA 1UADA 4YQYA 3L40A 3I5XA 4P22A 1ZK4A 3W5HA 5JBIA 1LVUA 2Q2VA 4ENVA 2R751 1XCMA 2ID9A 2VPZA 3BWBA 4E88A 3HRIA 1MX9A 4N3BA 4ZQGA 3EY9A 2DEUA 2QL6A 4FHDA 2GPBA 4G1BA 1EZ4A 4GOXA 4Q05A 4E4TA 3CURA 3ZHOA 5B4TA 2X5NA 4MI3A 4XFDA 4NDZA 2O8EA 1W59A 3IKJA 2JJQA 4FFNA 4Q82A 5IBQA 2H5IA 1L5LA 1NBIA 1KARA 1NV9A 3SMQA 1CVLA 1DCMA 4KWEA 3O84A 1YB5A 2LNDA 2GHTA 2VF4X 2YWJA 3F49S 4AC9A 4QOHA 3RC2A 8GPBA 1D2AA 3MF4A 1SCAA 3QVUA 1T3SA 1H2ZA 4YT4A 3U81A 3ZV7A 3KDAA 1DBIA 3CEAA 2IOFA 3L1IA 4AECA 2QQ0A 3CKLA 3BWYA 5T7BA 4HEQA 3V7YA 4G85A 3AHDA 4R68A 4KV7A 5A7GA 3RHFA 3SR4A 4CTKA 2BYTA 3I09A 4KQ6A 4WLFA 2E5WA 4ZOLA 1NYRA 3RS4A 1O8BA 3G5AA 5E6RB 4ZODA 5AJZA 3IB6A 4XTRA 1U8EA 3H5NA 4NEGA 4EKEA 4IHAA 4H2DA 4R1PA 2J67A 4URHA 3A05A 3NZEA 1EZZA 1GZHB 1UIRA 1ZFNA 3SEZA 3SKXA 5LZ2A 5GZ6A 2PANA 5AUOB 1XZNA 3CEHA 3HB9A 5IBPA 1BG6A 2ZCJA 4U7TB 5IASA 2REQB 4DLVA 2P5UA 3PL1A 4KK4A 2OBMA 1I7PA 1NUQA 2XT6A 4Q3CA 4XJXA 3SXPA 5T8KA 4DYDA 3HY6A 1FFHA 2EDAA 1EFRA 3H5VA 4EJSB 4RWZA 4OO3A 2RAPA 2OCPA 4ZRNA 4ED9A 3PIRA 1R8YA 3CR3C 1KFJB 2GZ3A 4ZVOA 3D2LA 4BBZA 2QSZA 3GRZA 2C2KA 3OD5A 3EXFA 4R1NA 3OQMA 1CR0A 5ALYA 1DHTA 1CQXA 4RE5A 1UFOA 4RIFA 2D5LA 2X23A 3LX6A 4X6XA 3UAVA 4HY3A 1CY6A 3D3EA 3OJWA 1KAOA 1AZTA 1B16A 3GWZA 3NYRA 4FNOA 4Y2HA 5JLAA 1C14A 1L4BA 5KX5A 4IY1A 2BAGA 2TS1A 2HF2A 3A9SA 1GITA 2UYQA 2B4KA 4ALLA 4WPGA 3LCRA 3SBOA 3OJFA 1G8PA 3GX1A 1RU3A 2PX5A 1GR1A 5KYNA 2GM4A 4FLFA 4RSGA 1J9EA 3VZCA 3TCNA 4A6EA 2EKDA 1P4RA 4F72A 4I55F 1SPXA 3M49A 4FILA 4JHXA 5BSRA 2IFTA 3PDWA 3W8FA 3WDMA 2GKGA 3IP5A 1VKJA 1N3YA 2DJ5A 3H19A 1V8OA 1U0JA 5DGDA 5HOEA 2JGNA 2QUHA 3B5EA 4FJ2A 3W5CA 4YGYA 3PV0A 4LA4A 4YMGA 3K09A 3MJTA 4UDYX 3TR6A 1RYDA 1KQNA 4C7XA 4IZOA 4QUGA 1ZX1A 1XZFA 3HNRA 2AYYA 3AH8A 1GGFA 5HZHA 4MW1A 2IBTA 1CV2A 1A77A 1HDXA 1WMSA 3BYZA 4FDUA 2AW3A 4QPZA 5JZSA 1FX0B 1MTZA 3W2FA 4X7PA 1GQOA 2G80A 4PPNA 1FNMA 5DT9A 2B5WA 4J94A 1LPOA 1AQUA 2VJAA 2Q9BA 4KQJA 5GWXA 1TW2A 4CKCA 1ILEA 4ND7A 5LXTF 4MI9A 5KYWA 3S81A 1ZAYA 2GK7A 2A84A 2BFOA 4NYIQ 5EVCA 1VHWA 1F9EA 3A1WA 3QFFA 4IKOA 2J0UB 4HAOA 4K9KA 4UQPA 2I7VA 4JYPA 5F3DA 3V5NA 3W9BA 4EQ6B 4L8WB 4EA9A 3Q6NA 1NMQA 2FPIB 5J4KA 1E9VA 1TAGA 2WIGA 3MMPA 1E2GA 2CD9A 3DWEX 5AVTA 2BBOA 2E3JA 4MB6A 4DV7B 4IJQA 3CRRA 3KTAB 3R7LA 2AYZA 3MTGA 2KSQA 3BGOS 1KH2A 3EGXB 5CLHA 1HQDA 3WGQA 4YCDA 3B9BA 3DWFA 3K7EA 4KXNA 1JF8A 1KI3A 2D2XA 3K1TA 4IVQA 4LQCA 1SVIA 3L18A 3V9PA 5CFLA 3ZH9B 1KEEA 4S3MA 5DSZA 4DIKA 1QHEA 1BNCA 1O5IA 3E05A 3RNLA 5LJIA 1O96A 4R5HA 1SKYE 4Y9RA 4AO7A 1ZN7A 2JIRA 4WBNB 4KNYA 3PUWA 1GPH1 3AUXA 3BQMB 4P38A 3EWAA 1QZXA 3RVOA 4C0JA 1W29A 1YASA 2JPDA 3FUVA 1CD5A 3JVUA 4MGEA 2FVYA 2MSNA 2FN4A 4G36A 3DEHA 3VZDA 1E3LA 5DLPA 1ARZA 1YOBA 1PJ2A 2QU7A 2ZAMA 2C84A 2ZSFA 3DP9A 2P4EA 3FDZA 3ILXA 4HQFA 2C29D 3FY4A 3AVUA 3PD1A 4OMDA 4TVBA 2AFHA 4A8JA 2IEYA 3A3PA 1N8NA 3JQQA 4HF7A 5EC8A 5B53A 1YJ8A 3HCPA 3NOOA 3M4XA 3STXA 3F6YA 1DOHA 3TCXB 4EG6A 3UHJA 5CA0B 2I8AA 3HKDA 2A5GA 3ZZ1A 4X8LA 1JTFA 2CT8A 4EPVA 2H00A 2VSQA 3C85A 2RG1A 4PHHA 2PNJA 4EY5A 4ZRMA 1YL7A 3TXAA 3VDRA 3E18A 3JR3A 2R5NA 4Q19A 3FKSA 4LZNA 3HJFA 1RJFA 1QWSA 1EWQA 2OHFA 5JNUA 4RVOA 3O38A 1JFTA 5AXCA 1N5JA 2DQ4A 2OESA 2VC2B 2YDXA 3CT4A 3FTPA 1DMRA 4FZJA 4LIPD 5C7YA 3G1WA 2XXAB 1XDSA 2XPCA 3OFSA 2WMYA 4NZ9A 1LK7A 4HNHA 4AZSA 1THTA 5AYVA 3QE9Y 3DZCA 1SBTA 2VOJA 3HJUA 1J2YA 4EJSC 1LC3A 4Z6KA 3FPGA 4UTOA 4AY3A 2JFBA 1Y4SA 3MLAA 4YP1A 4G84A 2UZ1B 5C51B 3CBGA 4RA6B 4KQ2A 5JBNA 4OQDA 1ZSYA 1GQRA 2QJOA 1PDOA 1U31A 5AP9A 2XKKA 3W8RA 1J21A 1T4CA 1T5DX 7REQB 1YR1A 1QP8A 3TIFA 4XVHA 5KJ1A 4G1UC 1OOEA 1H8EA 4M0FA 2JL1A 3VU1A 2QJFA 2Y4OA 5AJUA 5HMLA 2JD0A 4Y2PA 2ZREA 3D0KA 5D6OA 4FGZA 1X7WA 4X6LA 5K3CA 2I99A 2CFRA 5I9SA 3W1WA 3WXBA 2HWYA 3H0KA 1WNTA 2BT4A 4DA8A 5I7OA 3SVTA 3H65A 4E5SA 4UFPA 5BWNA 4HXGA 4ND6A 3UK0A 2YJ5A 1HT2E 4ZREA 4GIBA 4S24A 5EQFA 1K5HA 3W4JA 4XDZA 1QYIA 3UJNA 1IWBB 3FRHA 3IUEA 2D5BA 4M49A 5BUCA 2Y05A 2AB0A 3T35A 2J45A 5ES4B 2AIRA 4UZFA 1JEDA 3A4NA 4TKUA 4EDHA 5TPWA 4E08A 2WDZA 3W04A 3BXPA 1R0WA 1CY4A 3ETHA 1RLTA 1XP5A 3QOFA 2DF8A 1YRBA 1D4FA 2IU6A 2Q5QA 3L7CA 1ZIOA 1PU2A 2V55B 1L7XA 5FOUA 1NVUQ 5I7WA 3SYLA 1DBSA 1O6ZA 2HRRA 3MINA 5EJ6A 2OC9A 2P8JA 2ZU6A 5HHTA 4Q3AA 3VOAA 1TCAA 1R2QA 5JJKA 2XKBA 4MAFA 3R40A 5JXHA 1GRVA 1HKUA 1D07A 1EE1A 1WBJB 4MEAA 2OC4A 1GGVA 4PQYA 2YFYA 3L7JA 4QULA 4DXDA 4FFWA 1P7ZA 1T91A 1HYQA 2POCA 2XRFA 1O0BA 4KQ9A 5C0OE 1H9BA 4KO8A 4ASUD 4RTMA 1DAMA 2CWWA 4MGIR 3G68A 3N7UA 4R0MA 1THZA 2BMWA 2PLFA 2TMKA 1Y5MA 3QKIA 4X90A 4EAQA 3EG9A 4B6QA 4LG1A 1W1WA 1J0XO 2SICE 2XI4A 4AMGA 4BGVA 3S55A 1X1AA 4EUHA 5LYYA 4OA8A 1E96A 3TLYA 4LC1A 5FUMA 5HIJA 4FXPA 1WMBA 1QFYA 4TV9F 1N4DA 2RGEA 5D5HA 3FFBA 5JZ9A 1EVLA 1RXCA 4IMRA 4HQNA 1BC5A 1KWKA 5E7QA 5BT8A 5ICCA 2ZYSA 3KVRA 4MMZB 3QEMA 4OSOA 2HIMA 3NS7A 1YE3A 3U4DA 3CVOA 3DDSA 4JIMA 4UM5A 3AIIA 4B3FX 4NCAA 5L53A 1EUDA 1KYYA 3QLTA 2VZ9A 2FG6C 3WL6A 1L5MA 3R0ZA 3TOZA 5CVTA 1B00A 2H1IA 4WNYA 4IDDA 2BF4A 2HA3A 1Y33E 4HGNA 3WGNA 3AI3A 1ZXXA 5E4TA 3CEJA 1GAQA 2WLTA 1KAEA 4IVNA 4JXKA 1KL7A 2X15A 2ZLBA 5AH0A 1SQGA 1C30A 2AZMA 3AUYA 5I8WA 4AY2A 5KSZA 1QGUA 2CXQA 2AR0A 1QPGA 4BPRA 2KJQA 3CONA 4QRIA 2H85A 5F12A 5JJIA 3VZBA 4BFZA 2XQIA 1NUTA 4R9VA 1QCCA 4Z9BA 4XA8A 1DBVO 1EGMB 1U0NA 4JEIA 5HJ5A 3UCXA 4W1PA 3BJIC 3QI2A 4KP7A 4OHZA 3VPBA 1CIVA 1W34A 1NR5A 1TLFA 4Y6SA 1Y4DE 2BDUA 2W4MA 2XOKD 4XLTA 4M1EA 2Q0SA 5B1HA 3VH2A 3OZAA 4EA7A 5LD2B 4HLCA 4KXLA 1VOTA 3UC9A 2BMJA 3TJZA 1YHNA 1ZU5A 4QYWA 2DWOA 2BZSA 4ENQA 4HQKA 2J85A 3QQ5A 4WZAE 4M54A 1N2OA 2WF8A 5EHNA 4BQOA 3VX4A 5BSVA 5KTRA 1LDEA 3OQ1A 3ME5A 4HTAA 2JAQA 1FXUA 2P2SA 1S4MA 3BXZA 4U8GA 5HILA 2JLWA 1IAQA 1BWQA 1J90A 1P45A 3FR8A 3GQVA 3MGCA 4CKBB 4KFUA 2P7HA 4GBJA 1RVDA 5AW9A 1UL1X 3FCOA 4MUHA 1EG7A 2IY8A 4KHZA 1N3BA 1XDZA 1JEJA 2ZJ5A 4KKVA 4N6OA 4LZWA 2I65A 2XUOA 3HR7A 4MRAA 4KR0A 3KG2A 4IQ0A 4BAZA 4IQ4A 2OZVA 4M37A 1X6VA 1NLYA 3OCYA 4ZQFA 2W6MA 2O8CB 1MKYA 2QD5A 4X1IB 2YYZA 4EW6A 3NJ4A 3OFKA 5HG0A 4XE5A 1TMGE 1RAHA 1FFYA 1XYVA 3PNSA 1K08A 1U8XX 2IDMA 3EZLA 4TUYF 3VR4A 4HLDA 1M2WA 1MAAA 1W88B 2PWAA 4TWZA 3VTKA 2E49A 3ZY5A 5AW1A 1P4GA 3ERCA 1MRSA 1SXJE 1WKCA 3S8YA 1ODKA 5EAIA 4EL5A 2ZATA 3W6ZA 2WU3A 1BHO1 1A9PA 1E5XA 2I4RA 2YIVX 1DTEA 3LY5A 4Q3EA 3ZNPA 2UYCA 3VR5A 1MBZA 2DHDA 3HFRA 2I2AA 1F2UB 2I4OA 4LHYA 2Q6KA 3OX4A 4ND8B 4PAOA 3TS1A 5JE8A 1GN8A 3IVRA 3G5UA 3QWHA 2ZEJA 1LX6A 1P7PA 1XEXB 4GBED 4QFCA 2J3EA 1W0KD 2NGRA 3K5WA 1F5SA 4MW6A 3SJZA 1LK5A 4CCYA 4YRPA 3UBTA 4YLEA 5F98A 4PYKA 4OHKA 3ZGZA 1NQVA 1HTTA 5DJ5A 4QUAA 3PQDA 5H68A 4DREA 1QF6A 2D0PB 2WK1A 3FTFA 4PBTA 2O8BB 5FOWA 3LQ2A 4B4DA 3ROPA 4Y1FA 1GPUA 3I9MA 3W5DA 2X22A 3QWAA 1OQAA 3G5LA 4RIHA 2QT0A 1JAHA 1GCUA 4YJFB 1BH6A 5AVOA 3V1KA 5JLJA 1GZ5A 3JQAD 3C6XA 1E5LA 1LV8A 1NVVR 2A86A 2PX6A 3T1YB 3WLRA 2X4IA 1ORWA 3I04M 1OYWA 4YJ2F 821PA 2Y6UA 4P3YA 4PYJA 1G5HA 1PJ3A 3O03A 5FI0B 1JQ5A 3CEPB 2ORVA 2ZRPA 1V26A 2DBVO 4NWIA 4RO0A 2F8TA 1PT8A 1XGKA 1JHZA 1Z56C 1W35A 5B4VA 4L9SA 1E59A 3MUFA 2BUBA 2QGFA 1F1BA 3DVAB 3OKPA 2ZBFA 1H94A 1IM8A 1B1AA 2J31A 1OI3A 1YKSA 5F9MA 1KYWA 5FRDA 3RANA 5JH7F 5DGIA 1JMYA 4F5YA 1FRZA 5K05A 1SGWA 4QAJA 4LI3X 4L4ZA 4J0EA 4EYOA 1S2GA 1R0KA 3QNUA 1KKLA 3OLYA 1ZH0A 3WB2A 1GIAA 4RFLA 1YNSA 4P34A 5JY6A 3HDHA 2EP7A 4TTVA 1P73A 1P0CA 4F8EA 1EIZA 4C29A 1TT7A 1GA1A 1DO2A 3GVXA 3PHGA 1VJGA 3OU7A 4DMCA 5K8VA 2CLMB 2DCUA 4CIXA 1I0ZA 2COUA 4G65A 1TEHA 2Q5CA 2IELA 3C6MA 3EYWA 4GXNA 4Y2YA 3A28A 1D5WA 3WAJA 3WL4A 1RYEA 3PT9A 4DM4A 5IU6A 2CLIB 1Z0FA 4M0LA 3LXUX 5ERGB 1NX9A 3FMOB 1T1JA 1A1VA 4DC0A 2R60A 3DR5A 4I9FA 5CCXA 1KEKA 2EATA 3VGPA 4ZOBA 1ZO8A 1UJBA 3V8PA 4EI8A 4G0PA 1NJ2A 4IMJB 1DFIA 2WZDA 4FMBB 3PCTA 3WSWA 1JPUA 2J5BA 3E3LA 2Z5FA 5LD2C 1QJ4A 3JPYA 4MVJA 1SUFA 1US8B 4I0WB 5CT4A 2VATA 3ZDXB 2EJTA 1EWKA 2BM9A 3GH1A 2RHMA 3T5MA 3HE3A 4BJHB 1HZZC 1E98A 4QYSA 3MWKA 2IYSA 1AG9A 1WB4A 2YNMD 1X0VA 3RVKA 1BCRA 3BKWA 1T4BA 1Q5PA 2OP0A 4HDKB 3RVJA 1FTQA 2GZDA 4HEHA 4DC9A 5BWOA 3AVQA 4IIJA 3W78A 1J9GA 1UQRA 2WJJA 4ZEWA 3ETDA 4A0GA 4BVBA 4UFOA 1TJ4A 2JFHA 4F2PA 1ECFA 3TMAA 1TRKA 2WF5A 4QQKA 5D85A 4YONB 3DR3A 4EO7A 4PYOA 5JC1A 4ZOEA 1X42A 4ZAXA 4DUGD 1L7AA 3KZVA 1RQNA 3BERA 1C81A 2PR7A 4HGOA 3REQA 3SBXA 5LYJF 3C1AA 3EMDA 4EGCB 2AQHA 3O1JC 2DUMA 1YZUA 2A7QA 1TUBA 3O3MB 1P62B 2D5AA 2VJDA 3R6LA 4YDSA 3LBHA 2XCUA 3MTJA 3UPDA 1YULA 3CJQA 4MPRA 1PR4A 2NZWA 1DCTA 2Y0EA 1W19A 2FSUA 4LXYA 4EY6A 4QT4A 2EZ8A 3BL6A 5FUQA 4PLCA 3ICQB 2O8FB 4NABA 4UCQA 1DC5A 4BFYA 5A04A 3NGXA 1KVTA 2DBRA 2G82A 2EFEB 2NUTB 3M0EA 4AG3A 2HXGA 3I9FA 4BLVA 1Z28A 1MA3A 1D2MA 4YREA 2WJPA 2HN9A 1BMDA 2FUEA 3GFQA 4A0RA 5J3JA 4RIIA 1E66A 3GUHA 1Y6QA 4QDKA 3THYB 2AWNA 2M6LA 3K1AA 3A6HA 3VNVA 4P33A 3TFQA 4TL9A 2XSZA 2FR8C 1KQOA 1NSTA 2DUWA 3H86A 3I9LA 4HDMB 2QRNA 2HC9A 2QRVB 2XITA 2PJDA 3H9BA 1OLUB 2B9EA 1GNVA 2XTMA 4OQFA 5CEFA 3F5FA 1DV2A 5HMMA 3VO8A 4KR2A 2XHZA 1HEUA 5EEHA 3W6PA 2IUSA 5E6RA 4C78A 2I9KA 2CZGA 3D6FA 2GUWA 3WGVA 1YR2A 1HNXB 1NJ1A 4MYTA 2YMLA 4JC0A 3PNVA 4QUEA 5CHEA 2I87A 1S3FA 1U6KA 3EGOA 1GILA 3G8BA 1MV8A 3BRWD 3NPMA 4J16C 4M1KA 3ZLJA 1J1UA 1TYDE 3FMIA 3HZHA 4II2A 4QXPA 1VL0A 1N8KA 2REQA 3GD5A 2BFWA 2J6BA 4FPXA 3UWPA 3L7MA 2VCHA 3CPEA 4Q7KA 4UXIA 4KKXB 4EJSA 1E4YA 1FNDA 3WTBA 1C2YA 2AG6A 1N0HA 4MPTA 5IKXA 4O4IF 4U9IS 1V5WA 4OB7A 3DD5A 4IIHA 1R9MA 4BRZA 5HFJA 1Z7WA 2G08A 3U4QB 2CXTA 4RV5A 4UPVA 4CMCA 1QH8A 3MLBA 1YJAA 2O23A 2WVJA 4K28A 1AC5A 2XB2A 3OCVA 5LQAA 1XF9A 2BIFA 1DQZA 3E9MA 1E5DA 4RZ3A 3D6TB 4DNOA 4EB0A 4FFLA 4XX1A 1J97A 3LXXA 1DKQA 2A0FA 5JYDA 3K2BA 4CFYA 3LQRA 3TAUA 5FBRB 1H5QA 1JPNA 4EX6A 5AWFC 4MQEB 1U2EA 1E3MA 4WIAA 2C5GA 1BHSA 4F2HA 3ML1A 3AF3A 1HRDA 2IHJA 2OO3A 3DW1X 2A94A 3EC7A 3HB7A 4UVHA 2ZJFA 3QXCA 1SVKA 1JHMA 3ONWA 4IH4A 1RWMA 1UWKA 1LPSA 1Y9JA 2A9OA 4GX0A 4MYHA 3UMSA 3ZLUA 2F9MA 2O5EA 3PGMA 4JSYA 1ZXBA 3ZHBA 3I42A 4RHYA 3TTSA 2PA0A 3ZHTA 1E0KA 4GW3A 3OZUA 3ZCPA 4AG5A 3IDZA 3FNEA 3KEGA 3STYA 3VXKA 3UUFA 2IU4A 4N0PA 1ZNXA 4ND2A 3OQIA 4YH1A 3WGZA 2JFVA 4MRRA 2HX1A 2VT6A 3TQHA 4CM8B 5AOAA 4MVJG 4V1CI 3ETEA 1HNWB 1KFBB 4FD3A 1F60A 4UEKA 1RZ3A 3QOWA 5ENVA 3SYRA 1KKMA 2JKVA 1GTRA 1P4AA 4FFPA 5AI6A 5A5EA 1IOLA 2PS3A 1FX0A 5JJCA 3NHJA 1JU9A 1U0BB 4W6QA 2DFPA 1U4NA 1VLQA 2EP8A 2WJWA 4NK5A 1YMQA 4LOJA 1OYOA 4R2WA 4Z53A 4OLBA 1ETHA 1HUQA 4EPTA 5AHOA 2C95A 1RQRA 1Z06A 1TO1E 2ZJAA 3HI6A 4L28A 2WYOA 4DG5A 4BPBA 3QKSB 3QXSA 5D6NA 3C7TA 4EQ6A 5DHAA 1SEVA 5HUJA 3U6BA 1GUZA 1SN7A 2FPIA 5JT1A 1GA4A 4MWCA 2ZYWX 1DI0A 4M8SA 4AMYA 1RJWA 3KTAA 1V11B 4UREA 3CGGA 4C22A 3EGXA 5L7YA 3O9VA 3RWMB 1GTVA 4WKGA 1WQ1R 3DNFA 1A4RA 1C7JA 2FF7A 3WQBA 2AK3A 3LQKA 1JIVA 5G3ZA 3TI9A 3URKA 4Z3KA 2ZAYA 1XHFA 3F3KA 3SOZA 1S2OA 4LCEA 2BHLA 5CBKA 2IPXA 3W77A 3MAAC 1TTPB 2H1HA 3VZRA 3COWA 3WIBA 4K9SA 2Q27A 2ZIXB 4TTRA 2WEKA 1L5RA 3DL7A 4BFVA 4NZZA 1OFTA 3H84A 1B6RA 1KO5A 2Q45A 1RBMA 3P0EA 4IMIB 3I0ZA 4JNCA 4KSYA 5BYJA 3NYIA 1WVIA 3D8HA 1W5EA 9GPBA 3DE4X 5KVVA 1TCVA 1I2DA 3MFQA 3K15A 3O4IA 4X84A 2CE2X 3ANLA 3MHPA 4KGXA 4RL4A 4XUEA 2PM8A 1GZSA 2N75A 4M4SA 3Q7QA 3DCNA 1GHTA 1DHRA 1Y8QB 2HA4A 3GFSA 2C4VA 4LGMA 5G0VA 4YYZA 3ZHSA 2Q7OE 3OHSX 3R9XA 3OT5A 3E15A 3LA8A 2QRHA 3T34A 3OHMA 1F2TB 4UE3S 5GZ3A 1IHYA 1UKVY 1CHDA 1UH5A 1R6UA 2WHYA 3SSNA 3RJMA 1OZHA 1Q11A 4ACAA 4XRGA 1OZFA 1QIMA 3FSJX 3VKGA 4ZJZA 4AKGA 2VZ8A 4HAVA 5CA0A 1Y6GA 2GJ9A 3NHBA 1MDFA 1EX6A 4R2HA 1Q0UA 1WXFA 3M1YA 2B82A 2JDIA 1DC4A 1XAHA 1EWVA 3JU3A 2P1RA 1CY7A 2XMBA 3IAM6 3L8DA 4G24A 5D7NA 3H3JA 4UTVA 4ZMSA 3KSUA 1KO8A 4HXYA 1G5QA 2JIOA 3BTSA 2P69A 3DKPA 1QB8A 2P65A 2PV7A 5FA5A 3V2GA 4DSZA 5JYBA 2K4MA 2XXAA 4CNQA 1BVYF 3I9V1 5IX8A 3DJYA 1TQ6A 4EPYA 3PEWA 3A04A 4NFHA 2FEXA 4ZU3A 1JHDA 2QD2A 3B7GA 3GCGA 1KK0A 4PZPA 1L4FA 3VI3B 1QGZA 5ALZA 2PMBA 1I1HA 4JGBA 3REOA 5FT9A 4U2CA 1IM2A 3DQZA 2UZ1A 4RZHA 1ZOLA 3DF7A 3GPIA 3MB5A 5GAJA 4RA6A 3GF4A 2A0WA 4QBIA 4NICA 1ZICA 4RXUA 1FS6A 4ZDIA 4KPEC 2JAUA 3F90A 4UJ3A 4H31A 2PT5A 7REQA 1Z74A 1E6UA 5J9FA 4X91A 4C0HA 2RHOA 3NKLA 3SIRA 4LDRA 1E6CA 4XWGA 3MUOA 2PU7A 2KHZA 4HYQA 3WRVA 4MITA 3ENQA 3G7SA 3K0CC 4TTIA 2ZRDA 1BMQA 3A6ZA 3PX7A 2GEVA 1EVIA 1NBME 3BWEA 5ALWA 2NTJA 3LLUA 1KYVA 1HLPA 2BFNA 4WUTA 3U39A 3CG0A 1YR6A 2FMIA 1QAMA 2GCIA 2BFBB 3UMVA 3AEXA 4NCBA 1T43A 3DXYA 4NOJA 4X0EA 1J8FA 1JHVA 3NIWA 4EFNA 2QOEA 3O2JA 2BRUA 3HXMA 1J33A 3KCQA 2OO5A 2Y27A 1ZUNA 4H27A 4E0BA 4YAKA 5LVAA 1MENA 1D6SA 4UASA 1MC1A 4CDMA 4DCJA 4MQLA 2EEZA 1EJ0A 1FJHA 2J46A 4JC5A 3QG5A 4XSGA 3ND8A 4M1MA 4BKRA 2Q07A 5LZ8A 2Y93A 3EDOA 3MCTA 4FC7A 5HFNA 1KJNA 4FT2A 1DC7A 1KQPA 1W4RA 3PNOA 2ODWA 4TT8A 5KTYA 5LKRA 3DXXA 1UWCA 3PHIA 2XYHA 3N2NA 4QO8A 3K8QA 2OV4A 3W7VA 1J8VA 1K06A 1RHUA 1YU6A 4JDUA 5GIOE 5IANA 3K70D 1SC3A 4BTLA 4MDEA 3ZHVA 5DXFA 3S5UA 4LJ9A 1ZA2A 3L9XA 1H0HA 3ZCRA 2JLVA 2ATVA 2AUTA 1YA8A 2V7UA 3IAFA 4P35A 5C4IA 1MABB 5H81A 3VYWA 1FBTA 3TYXA 3VH3A 4GI3A 3K9FC 1FDVA 4KFSA 4L5BA 2OECA 2WT4A 1SXHA 2VRNA 2ZKIA 3TJMA 5G1PA 5M29A 3ENWA 4RKEA 2YS6A 2GHIA 3CNNA 2GZ1A 5FJJA 3UH1A 4NCNA 5E2BA 5H83A 3ER9A 3RAEC 3NBFA 1O97D 1CF2O 2H18A 2HUNA 3O75A 5CA1B 4FYPA 3HDQA 3R3UA 3SMVA 1MDBA 2VP5A 3NPAA 3ORRA 3PC3A 1RLJA 1WV0A 2P9TA 2Y1EA 2ZKLA 4G4GA 3TE6A 4MICA 3DG9A 1KI1A 2F59A 2YN2A 2YJ4A 4JV5B 4NG4A 3KQLA 1L8LA 3CNOA 3PNPA 3L6CA 4G1CA 4BKUA 2CLLB 2G36A 1N6KA 4XUGB 1FLAA 1BXRA 3OZBA 2FMHA 2AOVA 3CWCA 3FZNA 3CVJA 1CUWA 4HGQA 2M98A 4I4TF 4IAOA 4NBSA 1YS7A 3RS8A 1NVWQ 1PZFA 1XNQB 2EW2A 4MDHA 1QIKA 4RHFA 1KY5A 4JJ8A 1SJ9A 4XIYA 5G1NA 2DBZA 1P81A 3TE7A 3V7NA 3PNKA 2XWSA 1GLNA 3K6SB 3PVSA 4TLDA 2GF0A 2GJAA 4N5MA 4U6SA 5A2QA 4UDNA 1MT0A 4XYBA 5LIRA 4OJMX 1H65A 4ZCRA 2JGJA 1YA6A 1CUDA 1UXHA 2WJYA 2X0NA 2OCBA 2VOEA 1VRVA 1TM1E 4F21A 1MXHA 1OJ7A 2ZPAA 1E3DA 2ZTHA 1OGYA 3V7UA 3RIYA 2WJVA 3AERB 3PCRB 1D7OA 2VBCA 4IJUA 1IK6A 3GGSA 4XVRA 1G4UR 2WOJA 1D1PA 1R5OA 2V6FA 3MOGA 3ZDZB 2JATA 1C0PA 4AJHA 1J5EB 1U1IA 2DR3A 3ROXA 1Z0KA 1WM1A 5JR3A 4KRGA 4MYCA 3WNZA 1WTCA 4I4CA 5EGSA 3ROEA 3SS8A 3HCRA 2RK3A 3RRBA 1RW4A 1PEKE 6NULA 2FPGB 4W6ZA 5CVEA 3V1YA 4DWOA 4K2HA 4FINA 2AJ8A 4M83A 4N0MA 2HLHA 4S1VA 9ATCA 1IM5A 3IEPA 4ZCMA 4EGQA 3NNNA 1FDIA 4CKBA 2FUG1 2ACVA 3KHSA 3Q72A 4I1UA 3T9EA 3PC2A 1BYUA 1ORTA 4OX9Y 1G41A 5KDLA 3A9VA 3N2IA 5C34B 3KOUA 4UQLA 1TD9A 3MG9A 2E4XA 3SN6A 3TKYA 3V4PB 2O8CA 3DDHA 4D4HA 2ZU0C 2FN3A 3A9UA 3B13B 1OFVA 4X1IA 4BB5A 4F5EA 1ZUD1 5TLSA 4D02A 1WXGA 3UHOA 2H3EA 2BISA 3OZVA 2IHYA 3GJZA 3PX2A 4MI6A 3OWXA 4KSCA 5AKHA 2FZGA 4PVCA 2SHKA 3B20A 3RGWS 1W88A 3S1LA 3QIAA 2CDBA 3TVDA 2R2AA 1NZFA 2GPYA 3T5PA 4IDHA 1CCWA 4JODA 1OILA 3TUIC 1YB7A 3FJ1A 1AXGA 3DFUA 3C5CA 1Q83A 3GCWA 4AI6A 1F2UA 3PWZA 4HJRA 1ZJWA 4ND8A 4MNTA 3AP1A 3N6XA 4Q1FA 1IZ7A 2ZJ1A 4XWWA 1NN0A 2H2FA 1RM5A 3GAZA 4AKEA 4LK2A 1XEXA 4A0HA 2NM0A 4OP1A 2DQYA 4ZT3A 2HEGA 2OV2A 5AQ1A 3RU3A 1YZQA 4OQNA 4YDQA 1SCQA 2PLRA 1DC8A 3N75A 1GP2A 1PEYA 1Z5VA 2JLAA 5G2OA 5LJLA 1GJRA 3TH5A 3ZJYA 2RCNA 4AO8A 3Q2IA 5KJ6A 4QG7A 2O8BA 2IF0A 1FFGA 4BWFB 1KI7A 3RIGA 1PLJA 3GLUA 1WP4A 3DULA 4KXWA 4DLPA 3OKAA 3KOYA 1LA2A 1JLSA 3A2MA 4KQGA 4O4LF 3RUEA 3LECA 1J5XA 2XV1A 3A6DA 2PJUA 3KZXA 4J16A 2WA1A 5A4MS 4YJFA 1J06A 4GICA 5HK9A 1HT1E 2GHQA 3DWIA 3H7AA 2PKEA 3C0KA 2JCVA 3N7TA 1IB0A 3WLPA 3PSAA 2PMFA 2AZDA 1TW3A 4XB6B 1TFRA 3CX6A 5CTJA 1GRRA 4C2TA 2I0FA 3F1LA 4UBIA 1N7JA 4JI6B 1KYTA 2AFVA 1AXRA 1G21E 1KKUA 1T8YA 1ZDMA 2LE0A 3AR9A 3BZWA 3PUVA 4U6QA 4I3HA 4B1FA 5L6MB 3U49A 4TROA 3DHWC 2ZIWB 4QFDA 1T0PA 2C9DA 2VHQA 3IRUA 3MILA 4TS9A 3UB2A 4CF5A 3DVAA 5AKLA 1U3UA 3UC5A 3WJAA 1VDMA 4KPYA 4J75A 3N8DA 4NMHA 3VO2A 4DLKA 3WY9A 4ARZB 1DKUA 3VNQA 5HDBB 1U80A 3AVPA 5KOIA 2FOXA 4E11A 2WJHA 2DR2A 1P4JA 1FRFS 4E2WA 2ANBA 4BOYA 5EI5A 2E4AA 2HV9A 3IJ5A 1HA3A 1Z4MA 3HR4A 4X60A 4Y9TA 3RSOA 5IVDA 4IGKA 3RFCA 3V1UA 1LZKA 5JMTA 2INGX 1W2GA 4E5UA 1YVEI 2XUKA 3RYHB 3UMMA 1MD9A 2HR1A 1O54A 1QYXA 3KKMA 5FR2A 5TMBA 2OA0A 3MMSA 3S5JA 4CG1A 4GXQA 3LUAA 4GQIA 1CETA 3EPKA 4X7MA 3N3BC 2VHZA 4MS4B 4PONA 5DKFA 2YKGA 4PZYA 5EUQB 4DOMA 3AOEC 1CRLA 2YIDA 3HU5A 3LSYA 3WIEA 2ETXA 5CITA 3QVGB 3JATA 4PSDA 4PFJA 4R9NA 5B37A 5LU8A 1GQSA 1ZY2A 3D6NB 2HB6A 2HM7A 2JI9A 4GNKA 4JKOA 2AGVA 3KELA 3LLVA 4DQKA 3AEUB 1US8A 3K73O 3TSYA 3I5YA 4AICA 2WPNA 1D2NA 1TA4A 2ZUVA 4E22A 1HDRA 2I6TA 3IPXA 1DADA 4FKZA 4YRBA 4P2GA 2A1UB 4ZYLA 5D1NA 3ENZA 1NOKA 2ZWVA 3C6ZA 1R0LA 2O8DB 4QUBA 4IOMA 4A03A 4D45A 4L6CA 2CN1A 1PQ4A 2JAOA 5CFRA 4HDKA 4GKBA 1B73A 5B5SA 1QP0A 5AXDA 4PLZA 2C7RA 4WJZA 1ZM4A 2FOIA 4CVNA 2FSGA 3HWSA 4DSUA 3JARA 3CXUA 3VHXA 4NZYA 1WCXA 1CQZA 2EGHA 4FYMA 2H1VA 3BPSA 3K9NA 3QLVC 1TGYA 1DEHA 2GR9A 2GOYA 1YZHA 5HFAA 2Y1KA 5JROA 4Y2SA 1ESZA 4R41A 3L93A 4JI5B 1N4AA 3D7SA 4GL2A 5KVAA 1VCNA 3JWPA 1E63A 3I8OA 3IR7A 3PFBA 2Z6UA 2X7XA 5AJHA 2C88A 5B1EA 1L5HB 5JSQA 1TU3A 5EWLB 4DYHA 4Q3DA 1W2WB 3I39X 3RT7A 5HUQA 3NDIA 1GL6A 1BS1A 1TVEA 3P97A 4U2EA 3W9SA 2KI5A 4G5RA 4NOKA 3IX7A 4OHCA 4YUVA 3RUCA 3T1NA 4BUJA 5K4GA 2PPLA 2PWPA 2NUTA 1MGOA 1U0GA 1QVRA 2EOAA 4HN4B 4RJLA 4UHJA 1XN4A 5AVJA 2ZRGA 2EQAA 4K6KA 4G0QA 1YB1A 2ZAOA 5J59A 3BIFA 1IHOA 1U5AA 4B2PA 5H0IA 3WJ2A 3THYA 4GRIA 5FTKA 2N47A 2HCRA 5K9ZA 3AEZA 4JS0A 1EDOA 1P0QA 3ZKWA 1B41A 4HDMA 5A1JA 5IT0A 3C3PA 4DT1B 1Q84A 2FWAA 2QRVA 1I3NA 3IHLA 1OLUA 2H57A 2JLUA 3GFPA 4RHXA 1KQ3A 2HRCA 2HIAA 5DB4A 2UYHA 2VVTA 4G37A 4MP8A 5DW3A 2WB4A 1BVUA 4FW9A 2OB2A 1P6QA 4RK5A 2AWOA 1C1XB 2ZYTX 2X9LA 1BRMA 3LS2A 1Z7YA 4BB9A 4HFMA 1B8OA 1TYEB 1Y3DE 5L40A 2QY6A 1CUXA 1A9SA 2UUBB 4Q7JB 2JEOA 2Y1OA 4QXAA 4HH3C 1PS8A 3ADPA 2CNOA 3PENA 4B0OA 4CFSA 3ND9A 1ABEA 2MOKA 3HDYA 2AJBA 5A1TA 3U4QA 2CSXA 1CJMA 1G8HA 2GBCA 4Z86A 3WZLA 3GNTA 4BN4A 3FHTA 1X1SA 4GDMA 5CW2A 3FVRA 2WE7A 3SG0A 3G85A 1Y81A 4IRXA 1M0TA 2X9GA 3IMFA 2WFMA 3Q7IA 1P8JA 1E3IA 3QTTA 4KACA 4J9VA 4EB6B 1NUSA 4O0LA 1PR9A 2WWYA 2ZUSA 4US0R 1FUYB 2YOGA 3T8YA 4ITRC 5C4GB 3L82B 1Y8ZA 3ZD6A 2WT9A 1T0HB 2G1PA 5DXJA 2XZDA 5EE3A 3VPCA 1WDTA 3G2OA 2VSNA 5FP0A 5ALNA 3TVTA 5JHGB 1SUEA 2BEUB 2LWIA 2JIQA 5FL7D 1E6MA 4J0KA 5KZMB 4DCVA 3TNJA 1I33A 2QMZA 1WW8A 1Q7TA 4UHBA 4PPGA 4P3OA 2I7XA 2YZNA 2EU8A 1AF7A 4MIEA 2UVQA 2M1ZA 4EM6A 2BGMA 4CM8A 4EFLA 4B7CA 3DE5X 3I1IA 3VR4H 1NW5A 2D8AA 1CXZA 3OJCA 3HYLA 2X6QA 4XASA 4ECEA 4ERNA 2D0IA 2GYVA 3DC7A 2AMJA 4X66B 3M1LA 4I3FA 4PU0A 4YPVA 3I6BA 5AJVB 4D57A 1BE8A 1A88A 1SZCA 1UJ6A 2I3BA 3G2MA 4J2OA 3ZWQA 3UW1A 1SC6A 3EF3A 5TGTA 2AS0A 3VR5H 3W8NA 3SF8B 4UVIA 1DKMA 4EW3A 4OGWA 5D00A 3WLEA 3LWNA 1EFPA 1L7NA 4QBGB 4AN4A 2NXNA 2NTEA 3QKSA 5DX0A 1H1TA 3NIFB 2A0YA 1OZ0A 3ZHZA 2JFQA 1JA9A 1W93A 3SM3A 2OHVA 2P2DA 3N0WA 1JDJA 1DX9A 4M0KA 4Y2VA 1IBLB 1I8TA 1SUBA 1MAVA 4ZOAA 2E5LB 1XCLA 1T8WA 1A7KA 1V11A 5AVQA 4DHEA 4LX8A 5JVDF 3EPPA 4MW0A 4IIUA 4L8LA 1GY8A 4Y9SA 4AKSA 4RZXA 5BNIA 5HRCA 1Q7EA 2C1XA 5EMNA 1MMFB 4AIRA 4JQSA 13PKA 3F1KA 1ULUA 3NCTA 4RGBA 4YQFA 1JPJA 4XVUA 5L3SB 3ZG6A 4RGYA 2FR1A 1V47A 2NU6B 4JENA 3WMXA 1ZZEA 2JAXA 3TKAA 4G0VA 3SQDA 2I1VB 3QBJA 4BE7B 5HKAA 5CB0A 4GI1A 2VDKB 3IVMA 2HQRA 2W6ZA 4ARCA 5AJTA 2O48X 2NUAB 1QHXA 3EQ9A 2ZT6A 2DFKB 3AJRA 3QMWA 2ZYVX 5IN4A 3OEHA 1WB9A 1UBLS 2GRUA 2FG7C 4I5FA 4LHVA 2YVLA 4RWEA 4A6PA 5DCWA 2CF6A 2YRWA 1XTRA 3AV0B 5FOTA 1Y8QA 1E5QA 1X7DA 4DBLC 3NBUA 4QASA 1AV6A 1W0KA 2X9QA 4PY2A 1BU5A 2JFPA 5FBLB 1IIBA 1KE2A 3ZHQA 4OGLA 1RM3A 3L4KA 1L5QA 3H99A 4EG0A 5BUSA 2CL6X 4P0PB 1NM5C 4IM7A 1Y34E 1ZJJA 2W2LA 3JZFA 4FVTA 2VDVE 4Q3BA 4GYKA 1IEXA 1PQPA 4TLMB 4LJ4A 1IY2A 4D0GA 1AN9A 1GGNA 1PUJA 5D5PA 5EKSA 1AUVA 3OZSA 1LJLA 4D0LB 1XMVA 1JXQA 2GM3A 3D7MA 3DB1A 4RY9A 3LZDA 1IN6A 3QM1A 2YZMA 4IHJB 4BS9A 1WP9A 1XTTA 3HJRA 3USCS 2GWRA 3JQAA 3NIGB 3PK0A 4K3VA 3UT5B 2C2BA 3NTOA 1Q1QA 1UZUA 1I01A 2A58A 3SWWA 1GTSA 3LUBA 4TN5A 2RJNA 5TY0A 1MAUA 1XDWA 4ZT5A 3MTQA 4HPXB 4RLQA 5A0FA 3RRXA 2NVBA 3C6KA 3RU9A 4GWGA 2AJDA 1Z5OA 3IP1A 3RF6A 2JLSA 4W7IA 1F8XA 3CVYA 2K2WA 2WUGA 2HMUA 1S1CA 2ZWAA 2O1WA 2I1LA 3KSZO 4RQUA 3RT1A 3S0JA 1BIFA 5C37A 2ZJ7A 4H1WA 1FTSA 4ETIA 3I2IA 3C87A 1OT3A 4MVJH 1T24A 4ZVPA 2ODEA 3RO7A 3M6WA 4YPFA 2ZQZA 1DINA 3V8VA 1HE1C 1GZ7A 4TKVB 5JSZB 1G16A 4JGGA 1HLFA 3A9TA 4GFDA 1DXQA 1NNSA 1ZD2P 4QOSA 4JFAA 5AIAA 3SD7A 1AKMA 3J81k 4DR3B 3AJAA 2PX0A 1P75A 2XAAA 3E3AA 3B1FA 4Y1GA 1ORRA 2IIBA 1KDZA 5T6MA 3W5SA 2WHXA 2E0IA 2HHAA 3DCIA 4LYEA 3ZJTA 5A6SB 2FN8A 3F6CA 1XZBA 4R9UC 4PZ0A 4M7OA 2JAPA 1TMYA 3CZ9A 1XU9A 1Q21A 4KQKA 3CLHA 4GVPA 2Z1DA 4QDUA 2BFBA 1LRKA 3LUPA 1WXWA 1BE1A 1KJ9A 2FSVC 3U3RA 1WUHS 2VHUA 5M7EA 1QHIA 3ABRB 2WJIA 2ZJOA 1IQUA 3ZY2A 2IZ5A 4WCFB 1V25A 1P2TA 2W2QA 5K51A 4AWAA 5K3DA 3OQPA 4JYBA 7ADHA 3LBFA 3LUDA 4M1ZA 1T3LA 1RJDA 1QLWA 3D31A 3P71T 4RKWA 3ZD9A 2CHQA 3RWBA 1M6HA 5JISA 3BXOA 2HPAA 4K9QA 5I4KA 4FMCB 2DBQA 2OM2A 3GLVA 4NMWA 5CT9A 1F8GA 4DIOA 1NG9A 1SQ0A 1R0CA 1HEIA 3AKCA 5B3LA 2RBGA 3UYKA 2ZCVA 3ZHCA 5HM8A 4ZD6A 1SU7A 3EGVA 3ZWWA 5K3AA 2BF7A 1AMOA 1YR7A 4BN5A 1T15A 2B36A 1MABA 1UBNA 1NDHA 3A9CA 4ZVRA 2RMKA 1IUNA 1RBYA 2WSIA 3N53A 1JHAA 2P9EA 3F3SA 1H2EA 4YRDA 3QTLA 1YIOA 4KK3A 3O94A 3QSGA 3DLIA 4GR5A 4ES6A 1SPBS 1AVTA 1GQFA 1NRJB 2EW1A 2FEWB 3HMQA 4E15A 1Y1KE 1QYRA 2JGMA 3PYXA 4L7QA 4KC0A 3CW9A 3EZYA 5CA1A 1L3IA 2CLOB 1GKKA 2YBDA 1XKQA 2VH5R 4BO6A 1YACA 5EMLA 5AK4A 1YBAA 2LCFA 5EHZA 3LHKA 3NC4A 4XR9A 5LWQA 1OKKA 1L4HA 1UXOA 2FSPA 2IYAA 4JLSA 4WI1A 2VHJA 1AXEA 3T5BA 5JS1A 2RK6A 3NH6A 4TKLA 2CDAA 3QE3A 3KVOA 1IUKA 3I01M 4K87A 4KH0A 3S2ZA 4A1OA 1W47A 2FZCA 3P27A 4XZ3A 5BUZA 4FE7A 3HADA 4OH1A 4KWHA 4NNJA 1F2VA 3GYGA 2IYLD 4QM7A 5ALVA 1E2DA 2OYSA 4FQ8A 1RYBA 4ICIA 1SO8A 3SVLA 1W0JD 5FORA 2HCTA 2QNRA 4WLEA 1V43A 4RQTA 1UBSB 4BBAA 4KITB 4W5NA 3KKZA 1R66A 1QYCA 5E9QA 3NV7A 3IRVA 3K6SA 4PV7A 4I6JA 1M8FA 2FZVA 2YVAA 1Z3CA 1G5FA 1TQHA 3QX8A 1PZHA 2J9XB 2BGRA 1S7CA 3O4HA 4FYIA 1M34B 3B6ZA 4GZLA 4JP2A 4WMLA 4PEVA 4CKZA 1WW3A 5IVIA 5L3VA 1GUFA 1D5CA 2BI8A 1PZNA 4I50B 1QIHA 3AERA 2P0AA 2VT2A 1FVXA 3AR4A 4FZRA 3N0RA 2AN5A 3HCAA 4IXNA 5JFTA 2HRZA 4Z3OA 3E23A 5DE3A 3WSTA 3WBBA 1A5SB 1KP9A 1TK9A 4HOYA 4FWTA 2CUKA 5FYQA 4OLHA 3WFZA 3Q3JB 2R8EA 4ZXFA 3E81A 1ZHHA 3EXEB 3O3OB 1AIPA 1RBZA 3PHJA 2PBFA 2P3SA 1GAXA 1MOSA 2FPGA 3M5PA 3R3SA 1U7HA 3UAGA 5GINE 4UBNA 4DV2B 2R1TB 2ZRCA 4NY1A 4P0TA 1F12A 1M2HA 4PGMA 2IZ6A 2OCDA 2JGDB 1MPTA 3PG5A 3MJEA 4NMLA 1ZJZA 1XVLA 1H1DA 2XGMA 2P1ZA 3GJ0A 3K5IA 3P45A 3QLVA 4JR2A 1W85B 4WY2A 3H04A 2TECE 2BH2A 1YJCA 4B81A 5I7FA 4LKRA 4J2HA 2WYHA 1YI8A 3JWGA 4K6HA 3FVTA 3IEUA 3MAJA 1KI4A 4XWTA 2XT0A 2OBNA 4O02B 4FN4A 4C7VA 3G1TA 4BKPA 1TUEA 1XAGA 3PQ2A 4FYVA 5HK8A 4PN3A 4Q4CA 3SLRA 3NHPA 1Y7LA 3UWDA 2BBTA 5EE0A 3AI1A 2F1RA 1AZSC 3E5HA 3NOVA 3O8OB 4X92A 1GZ6A 1ZL0A 4BO5A 3L8MA 3ZU3A 2D1TA 1DBWA 1TJ3A 1YE8A 3EVFA 4ZT6A 3Q11A 4ZYWA 5KJCA 1C4WA 4AP5A 4AUKA 4G8BA 1X87A 1Z4NA 4MTLA 3UWKA 3PGA1 2WHQA 4BLTA 3EPRA 5EJ7A 3A06A 1RI2A 4FYWA 4HFJA 1Y9DA 4CV0A 4AS1A 2ZVDA 5BSHA 2UXCB 2H2IA 1UQUA 4WCFC 1U81A 1ZBDA 1X2EA 1EFDN 3UKJA 3FLEA 4HQ0A 4PCVA 3FYSA 2J5QA 4JSRA 1YKGA 1F6WA 3A26A 1Z2OX 5THQA 5FNZA 1UZLA 3BMNB 3IUJA 2E1PA 3CZAA 4N9QA 3GJ7A 2W6ID 4NBTA 5B58T 3VR6A 1HMPA 5CFOA 4FOPA 1LSSA 3TL2A 2RHRA 1JHRA 9ABPA 4PHTA 5L8VA 3QBVA 2FTKE 1RVV1 1RAIA 1YFJA 1GAJA 1JYFA 2XIJA 5DH9A 3ZQ4A 4UJ5A 4EIWA 4JA2A 4RZSA 5JJLA 1GZ3A 4PXAA 4X3OA 4YPOA 4HCJA 3Q4GA 2OY0A 2IA5A 5KQGA 1U5CA 4H60A 1GPYA 4IIBA 3MCZA 2FDRA 5GMOA 4DLXA 4P3NA 1L4MA 3JX9A 4J0HA 4JVSB 5CTAA 4C04A 4OFWA 1WE2A 3OM0A 1II9A 3NC1C 4WN3A 2JZNA 2AQKA 3SJBA 4QDJA 1ZH2A 3C6QA 4A1FA 4IIEA 1T5BA 3LXRA 1FA9A 3LCJA 5SICE 2PCJA 1FXWA 4RK6A 1E1MA 1UC4B 3MT9A 5KNDA 4FQ5A 2V3CC 5EKTA 5CPFA 3OJXA 4ARZA 1JIIA 3IPRA 3U6KA 1TCUA 4U2FA 4HS9A 3ZZ0A 1O0SA 2KLBA 1GPAA 2PWYA 4Q4JB 1UM9B 2JHPA 3L6BA 3NIDB 1PT9A 1JQKA 4X00A 4X65B 3HP4A 1L4YA 3I9V6 3O9ZA 1JJBA 4LHXA 3TZHA 3NFRA 4G0MA 2Z8XA 2WJ3A 1PBNA 1PZGA 2QZJA 3QU2A 3DDUA 3S2EA 3VU9B 3RYHA 2YXDA 3WWOA 1BS2A 1MB2A 1FSZA 1RAAA 4LEIA 4Q1VA 1BAPA 1GCAA 4D9BA 5KHOC 2C31A 3OOHA 3BBPA 5KTTA 3BXHA 4IH9A 4MS4A 1FW8A 4L9WA 1H4QA 3X1YA 5EKXA 2IV2X 4DUPA 3ORYA 2G07A 4IR7A 3QVGA 3GFRA 3RLIA 5BWBA 1XKLA 3F4KA 4L7VA 5DZSA 1Y1QA 3QWIA 2WMOB 4JOQA 4EEXA 2P27A 4NCXA 2CUNA 2ZUFA 1G60A 2BDEA 4N40A 4CM3A 5TEVA 2V6BA 1RLUA 3WISA 5ECGC 4ZYUA 5TPZD 4KWCA 2B34A 4N49A 4EGAA 4WXMA 1OC4A 3SC3A 2OFPA 1YL5A 3NBMA 1JLLB 4FOTA 1AUOA 2A1UA 3U1TA 2HGZA 4DARA 1U90A 4PWYA 2Q28A 1O58A 2ILTA 3KZNA 3KU1A 1X1CA 3A1EA 1GGKA 4PZLA 1GG2A 5AKZA 1PFGA 3AR5A 5ALXA 4JLJA 3HXKA 3PFFA 3W6UA 1RHRA 3M6IA 3U16A 1OB5A 1E6LA 2V74B 1L1QA 3BRSA 4L6IA 4MTCA 2G0AA 4JB2A 5DSTA 1U3VA 3GRAA 1NF3A 3LJKA 1ZRSA 1XD2B 5DTIA 3IPYA 2BFDB 5EWMB 3U3DA 1Q0PA 4F45A 4NPHA 1K7FB 4BP1A 3UYLA 4CKWB 1JJVA 5LM3A 3L84A 4LXXA 1Z7EA 3MC1A 3EZ6A 2A59A 2VZLA 1JB1A 2Y67A 5AUQA 3VZPA 4BDTA 3DMTA 2ZBPA 4RZ2A 1VKHA 2V7QD 1L5HA 5EWLA 3ORQA 1O94C 2QE7A 3EBPA 2IZZA 1LI7A 1Z7GA 1MOZA 4CMGA 4MCIA 5EFZA 1XQXA 1OGIA 1NQUA 5AM1A 4EYGA 1HDZA 4IV8A 3ETLA 3EUEA 3PNYA 1C8VB 4ZWNA 2JFWA 2JFNA 2O1SA 2HZBA 1ECBA 2CMGA 3RT9A 3MNFA 4E4YA 1NDQA 4FYYA 1J5PA 4PG6A 2WAYA 2QVGA 5BOSB 1L7OA 4AJPA 4UUBA 3ZC3A 3C3DA 1U02A 4XYEA 4BLQA 2WWWA 5B2EA 1NM5A 1A8HA 3JZIA 3M83A 4E21A 3GVHA 5K8TA 1DAHA 3H5AA 3R5JA 4DT1A 2C3MA 2W6JD 3F6RA 4G01B 4D4MA 4AW9A 3KYCB 4IXTA 2CHVA 3LDFA 4M9SA 4P6VF 1H8HA 4LNAA 5D3ZA 2WB2A 2XA2A 1EA7A 3N58A 3H2JA 3AFNA 3RRYA 4TN1A 5DTMA 3VVLA 1C1XA 3WHPA 4DM3A 1CJTC 3GHHA 3KQSA 4XSVA 1SVLA 5L3ZA 3U3OA 1C9EA 1R6VA 2PZGA 3EHEA 4GHWA 1FP6A 3P9SA 5EZQA 3IE1A 4XPIB 2WKWA 2ZIUB 3R7AA 3KAJA 1D3AA 4MA5A 2Q29A 5D3QA 1Q0LA 2QVLA 2AN1A 1ZN2A 3O83A 1P1CA 3MT7A 4K9LA 3LBNA 2O2DA 3WB0A 4PTLA 1H6BA 1VDZA 5G02A 4G5HA 1U0TA 3T95A 3QUCA 2RGAA 2J9FB 3BGWA 4MW9A 3NMUF 3O7MA 5T4BA 4HBGA 4HFNA 5K0ZA 3MCUA 3R2JA 4IF4A 5EWJB 1N5OX 4BGIA 2P9HA 3NTLA 3H18A 1Q14A 4W9NC 3ZDBA 4BQRA 4TTQA 3WBKA 4C5CA 3W5BA 1V7ZA 4GPBA 2ZBUA 1T0UA 3ZQ6A 3B1VA 4CKYA 4C88A 1P1HA 2VJMB 1UDCA 4B32A 4FSDA 2ORED 2PAAA 3OY7A 4FZ5A 4EB6A 2I2FA 3COPA 1S02A 1KK1A 3RBXA 2PN1A 3WKBA 1BS9A 3GJ5A 2X14A 1COWD 4JKIA 1F17A 1R3UA 2VF8A 1P1JA 2Q5IA 1PT7A 2VEOA 3GLQA 4I7EA 4G0OA 3R5SA 4N7BA 2R79A 4GOND 2IIVA 3NM4A 2BEUA 3G0HA 5HKLA 3HBLA 2FSVA 1SXGA 2O52A 2V3VA 3H9JA 3M3DA 1EGAA 2ZJBA 3D3JA 4GOMD 3IJPA 1Y1PA 2WSMA 1NXVA 1GSIA 1KAQA 3HJNA 4BV9A 4UAUA 4CLHA 5HIIA 1ZC3A 4ZANA 1NVKA 1OAOA 3QUSA 1Z8DA 4NK4A 2NZUG 4CKEB 2DPXA 1EGQA 3H1PA 5HUHA 4PO8A 1BGXT 1XUOA 3EAQA 3SHQA 2PMEA 4HYYA 5K3OA 5HP4A 4DQDA 2BGJA 1PG5A 3MJFA 3VGJA 3CNQS 4A16A 1EEHA 1SOMA 4IVPA 3ONFA 4BV3A 1FDSA 2O0MA 2W90A 3QXHA 3AUTA 2C3OA 1VA4A 3SF8A 1VKRA 3NEYA 3OLVA 4A27A 2FPWA 5C35A 4TMWA 1EP9A 3LP6A 3H9CA 4DQ0A 1SOUA 2RI0A 3HEBA 4GO1A 5TDHA 5A5VA 1WF3A 4V0RA 1EXVA 2WWHA 4OOFA 3HB0A 5I8ZA 2WICA 2EIHA 2WIFA 4W5JA 4MPDA 5K3FB 2I6GA 4V03A 1CG6A 4D9EA 3OIFA 3FOBA 2GCOB 4R2MA 4PG5A 3ZX4A 5F78A 4F8JA 3KEOA 1LF0A 4NNPA 4PBRA 2XA9A 4UW9A 5LKAA 1CR6A 3ZJ4A 2ZRKA 1VSBA 3ZOKA 3UBMA 1GZDA 3QU5A 4GMKA 3KOMA 2Q62A 4Y0NA 5L3SA 3TLBA 3QFRA 1PYDA 3G6WA 4FMDB 1BN7A 2FRXA 1EFVB 2C9OA 2NU6A 3DA8A 3WBJA 4JQYA 4AY5A 1ICIA 2D7JA 4B3RB 1ENOA 3I1FA 3KVVA 2CBZA 4JI2B 5ECDA 2W2TA 4RTPA 1U8TA 5A2GA 2NUAA 4HDQB 1XNGA 3FBTA 2W70A 1EDEA 3LO8A 1H2YA 1LDYA 3DCYA 3VPHA 1T25A 2IU3A 5DHUA 1QH9A 4QGHA 4N41A 1FOEB 1GPJA 2XUPA 3L04A 4TMXA 3INYA 3O90A 1W73A 2GAFA 3GFVA 2G83A 3UXHA 1MG0A 1HKHA 2H51A 4RD1A 3SBDA 5IRCD 2OK8A 1L6IA 1O95D 2RSLA 1RSZA 4YVFA 5IEBA 5E9JA 1XCOA 5E0KB 5TMPA 1H85A 1N6OA 3HB4X 4HX2A 3TBHA 3ZGOA 1LLQA 2O8NA 3DLCA 3QHAA 2A5LA 4OKIA 2VPTA 1W5FA 3IODA 2Y68A 3IR5A 1UFRA 3ADBA 1G2OA 1SG9A 4L72A 5BNTA 1WCWA 4IHJA 4O5AA 1AKYA 4BQSA 5MN4A 3H5RA 2PT7A 2GS9A 3SSOA 4RELA 2HU2A 4C7MA 2RI6A 1A9QA 2H2WA 1M8GA 3UT5A 3S1AB 5FV4A 3KLPX 4O08A 4YS6A 3WRWA 1GGJA 3T3IA 1B3BA 1ORHA 1PEAA 3KUKA 5KB3A 1GRNA 1R6AA 2ZB4A 5IP5A 4MPPA 2DHEA 2FGJA 4GYYA 4PF1A 4YRZA 4A26A 3MRXA 2XVYA 4QGBA 2GA8A 5KTNA 1VJDA 3EQ8A 3P2IA 3B2EA 5EIEA 3LY7A 2VS1A 1Z62A 4GOKA 3GLIB 2C2HA 3GROA 5T6BA 4KOAA 3WLKX 3S29A 3MXTA 4AG6A 4EZBA 2DLNA 3N5KA 1I7QB 4V0LA 4RUKA 2R4UA 2DMRA 3BEDA 2QRLA 3H1AA 3GGCA 4TKVA 5JSZA 4UBKA 2VYNA 1KIMA 3SJUA 5GV7A 4PSUA 2JVJA 4JX9A 4KV9A 2HIGA 5A6SA 1Z12A 1ZISA 4B3IA 4LCJA 1C0EA 4WK4B 4K40A 3RAJA 4BNMA 3IQZA 4ZVQA 2Z6AA 1FTYA 2G28A 3E2MA 4I1YA 2GNAA 4H15A 4PG7A 3WFJA 2BKAA 1VL5A 3DLHA 1Y8RB 1AMNA 2C42A 1VIVA 4MLPA 4H3KB 4X54A 4RD0A 4E33A 1QYDA 2ZT7A 3O2QB 4WCFA 3HB5X 4M0CA 1PVOA 2BMEA 3GT3A 4IOJA 3NBYC 1N9ZA 3R7NA 2BPOA 3DWGA 4YK7A 5HIKA 5HA5A 5EJ9A 1YDHA 5G3YA 4B0PA 2ZCUA 1XZCA 2GN2A 2XQFA 721PA 1WPQA 4JI4B 3JTMA 3FNRA 1QVZA 9LDTA 3C5HA 4IIXA 5CDFA 1SVNA 4EB3A 5KNCD 5CNKA 4R1TA 4OGKA 3RTDA 2OLEA 4N3NA 4QJ5A 2YXBA 3PA8A 1PJAA 4JAVC 4URUR 1TZMA 1GEEA 3IP9A 4DCNA 2HK6A 3FRIA 4KYUA 1O87A 1BVHA 1FRNA 2NSYA 5LXTB 4HDAA 1G5TA 4PHCA 3Q0IA 5KVCA 3UT0A 1DPGA 1CUGA 5F5NA 4DL9A 3ZWDA 1Z5WA 4F06A 1TYZA 1CRWG 1IXZA 5DBOA 2ZYAA 1VSTA 1UPTA 2HMVA 3KPUA 4GKVA 3TR5A 4M46A 2QN3A 3DXZA 4I4LA 4PICA 2VRCA 2ZI5A 4NH4A 2VJLA 1E79A 4ZT2A 2NTNA 2QTTA 3COVA 3JAWB 2QP9X 5FEMA 1U2TA 1U1FA 1W5TA 3KJIA 4FHZA 2QAIA 4DA7A 2Z5LA 1I7SB 4ALMA 3CA8A 1PV4A 3HTXA 4KEAA 1U99A 1L5OA 1CW2B 2ASEA 2WA2A 3B3QA 4JLAA 2NZYA 3CIOA 2NV2B 4OA5A 2O3QA 2DBYA 3OFVA 1NR1A 3B6EA 2XJ4A 5FPHA 5IF3A 1H4SA 4BLOA 4B2YA 1N2CB 4KLNA 1NNLA 1RXEA 4MUGA 4C6HA 5C8VA 2TSYB 5HYVA 2NZVG 1M1YE 3ZWNA 4D3ZA 3VVMA 2GO1A 4H77A 3CQ9A 2CUZA 3TZQA 2GFHA 1CEXA 2B8TA 4G56A 1Z38A 3C7KA 4TWRA 3EGDB 2G4VA 3R6DA 5EA2A 3P0HA 5JSYA 5B7GA 3TFOA 1IVSA 5KI6A 2PL5A 1PW7A 3IS3A 3U37A 3QSYA 1K7CA 5FPSA 3IP7A 1K7SN 3FH0A 2YXLA 2QTMA 4CR7A 5ARCA 1A5AB 4INOA 1UPFA 1TLLA 3RSFA 3ANXA 1LLFA 2ZWOA 4GZ6A 4M6WB 4UC0A 1NKTA 4XKJA 1QG2A 1M34A 4H18A 1FUEA 1B3RA 3A27A 1MQSA 1MH1A 3K4PA 1GUDA 5F64A 5JDCC 4I50A 1KMHB 1HH4A 1M2NA 3F7TA 2WRZA 2PQMA 1XROA 2ZTMA 3P2YA 4H0FA 3GP5A 1D04A 1M8KA 1X7HA 4QXOA 1UPUA 5PGMA 3C3WA 4KXMA 2QL5A 1LBQA 1OH5A 4DKJA 5KQMA 3QYJA 4LX0A 2A67A 3EXEA 5TJHA 3GT4A 3SEAA 3DB2A 4H6PA 3CSSA 4C07A 2RIRA 2RD2A 2RHHA 2VDQB 3CZMA 1RLMA 4DJJA 5H5JA 1LDMA 1VE7A 3ZHRA 5IUNC 4P4NA 2UXDB 2R1TA 3WNCA 4E09A 4FU0A 3MD9A 1FYWA 1IFXA 3QVLA 1WNFA 2H29A 1J0BA 4Q15A 2WWRA 5FHRA 2ANCA 4MWBA 3HJTA 1W85A 1UAGA 3NH9A 4M1OA 5J1TB 1A4IA 2NSHA 2XMGA 4OL9A 3D3QA 4TXLA 2Y66A 1FUUA 4JK3A 5EUBA 5FTNA 3A2LA 4HN2A 1C3LA 4IQ8A 4WK6A 4G5SA 4J90A 4YN3A 4OATA 2C8LA 3ZBUA 3AHHA 4KWIA 2B7BA 421PA 4MWGA 3FDXA 3ZS9A 1O94A 3QE2A 4IDBA 2CL7X 1T26A 3O8OA 4L4XA 5JNWA 1K0FA 3GGOA 4K03A 4F7DA 3WNDA 1P17A 1XA0A 3QLUC 1CVRA 2YV5A 3KT0A 4BB0A 2B8JA 3H83A 2LCIA 4RADA 2ZRBA 3UAOA 4CJXA 4YGXB 3OF2A 3BIWA 4BWYA 4DXAA 4ZEVA 1NV8A 2O20A 2VNAA 2XNKA 1Z2EA 4P93A 5J40A 3DHNA 3GXBA 3BXXA 1ZGHA 2OPBA 2VDUE 3DKVA 4MEBA 3PWKA 4TQGA 2XUAA 4EATA 2QPOA 2O0LA 3S44A 2X58A 4BBJA 1PSDA 3IMGA 5A0VA 2VQ6A 1RKUA 3KKEA 1IPEA 3OLXA 4QPPA 2JIZA 3BMNA 1EJ6A 4MROA 2AV6A 2F1OA 4QU5A 3TL6A 1CJSA 2OAEA 3IMKA 2RAFA 5AUNB 1I94B 3HKCB 1SBNE 2FGKA 2W22A 3G7UA 3BWDD 3CISA 3KT3A 3QJGA 5EQDA 3U4HA 3UMRA 2R6GA 2IEDA 2PBRA 2QYTA 3LT5A 4MA4A 4FB4A 5DASA 1S01A 3IBYA 4HLUC 4MAMA 1OXTA 5ES3A 3DC2A 4HB2A 2BHRA 5LQMA 1G3QA 4L73A 1RNLA 4S1PA 3IEIA 2I33A 4JROA 4U5XA 4ZVSA 3U4MA 3AF5A 3UUEA 3G2PA 1MA0A 2P5YA 4US1R 5IAGA 2JGEA 2HHLA 1YK1A 1YIDA 2VDMB 4I9HA 3PICA 4DDMA 1QQBA 4HAIA 2KW5A 3C8DA 4CLRB 5BRAA 4BCDA 4GPEA 1U28A 3VR3A 3HUDA 3R5HA 3WKAA 1HYGA 3EH2A 3AFHA 3HPRA 4W9NA