4DGSA

The crystals structure of dehydrogenase from rhizobium meliloti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
307
structure length
277
Chain Sequence
LLLVEPMMPFVMDELQRNYSVHRLYQAADRPALEAALPSIRAVATGGGAGLSNEWMEKLPSLGIIAINGVGTDKVDLARARRRNIDVTTTPGVLADDVADLGIALMLAVLRRVGDGDRLVREGRWPLGHSPKGKRIGVLGLGQIGRALASRAEAFGMSVRYWNRSTLSGVDWIAHQSPVDLARDSDVLAVCVDASLLQALGPEGIVVNVARGGTIAGAGLDVFVNEPAIRSEFHTTPNTVLMPHQGSATVETRMAMGKLVLANLAAHFAGEKAPNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dehydrogenase
publication title The crystals structure of dehydrogenase from Rhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
total genus 73
structure length 277
sequence length 307
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dgsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dgsA01
2RIRA 2B4RO 3FCOA 3LT1A 4YWJA 4H3VA 5A03A 4IDEA 1GYQA 3PDJA 4GVLA 1J6UA 3DZIA 3WGZA 4Q3AA 5ENVA 5IXSA 1UZLA 1LSJA 3M6IA 3H2ZA 1LLQA 1DDOA 1P74A 2O50A 3UKOA 3ZHBA 1HF3A 2YHIB 4JLWA 2B5VA 4HNGA 4CUKA 4YRAA 1QRRA 3I83A 1EMDA 5C7OO 4X54A 2YQ5A 1LNQA 4AJ4A 3H65A 2X9GA 1ONOA 1I2BA 4EJ6A 2X7HA 4C7JA 1ISIA 1I3KA 4FR5A 3WTCA 1ZBQA 3RAJA 3ETEA 5T5QA 3H4VA 4JJFA 4EEZA 2HUNA 2Z95A 3IS3A 5L7YA 4AJ2A 4U8GA 3PJFA 1LC3A 3QP9A 5A5FA 1HEUA 2JHFA 4YXFA 2TMDA 4Y9DA 2PV7A 3I9JA 1XR3A 4UVGA 3RVDA 4GKBA 5JLAA 4LRTB 2DFVA 3RCBA 2BGKA 3GDFA 1E7RA 4BIIA 4CLRA 4K9DA 2A35A 4UVHA 3HZZA 3TN7A 3ZDFA 4NIMA 5KJCA 4J7UA 4P4LA 3ZW9A 1GZ3A 3EYWA 5CPFA 4DIFA 3VZRA 2QRJA 5A9RA 2BFMA 3JQDA 3DONA 4FPXA 3Q1LA 1H2HA 1UXGA 2EGHA 2HAEA 1KEUA 4R1TA 2EW2A 2VZ9A 3BMNA 4KWHA 4CMEC 4PLZA 3VTFA 1PQPA 3AJRA 5KVVA 1IL0A 2ZB7A 1AUPA 1BW9A 2PKQO 3STHA 4YJGB 1YB1A 1BXZA 1D3AA 4JN6B 4R54A 3WMXA 2GGSA 2AEFA 1I3MA 1XU9A 2PA3A 4KQXA 4D43A 1AXEA 4TZKA 2J3JA 1E1NA 4LISA 1HYGA 5H81A 2VTEA 4GX1A 4OGWA 5ICSA 4YAEA 5CEFA 3BAZA 3QVWA 3COSA 2JFFA 3K96A 4PCVA 5KVSA 2BI7A 4EI2A 1KETA 2CDBA 5COQA 3TDKA 1NR7A 3W4KA 5G0VA 3D3EA 1MB4A 2CUKA 1E3IA 4BGEA 5AQ1A 2C0CA 1Q2XA 3JQBA 4BNHA 4CM6A 5T57A 1O89A 5IZCC 1WDKA 4KTVE 3W8EA 1JKFA 1ZMTA 1ZNQO 1OZAA 2WSBA 2GYYA 2HLPA 4ZVVA 4YACA 5CDSA 5ER9A 4OSPA 1DLIA 4MP6A 2P2SA 3TRIA 1NPDA 1Q7BA 3JQ7B 2CSUA 4TVBA 1U2DA 1SCUA 4MP3A 5JDIC 2OL4A 1HT0A 4DWVA 3DMTC 3UCXA 4NDNE 1A72A 3TNLA 3ZWYA 4Z9XA 3EY4A 1NVGA 3ZH2A 1D8AA 3H5NA 4IBOA 4TRRA 3V2HA 3C1TA 1AE1A 3IC5A 4NU5A 1WDMA 1SNYA 2X9NA 4A10A 2JFHA 1BDMA 1EBUA 1HDXA 3AY7A 1XU7A 1GEEA 1ZK4A 4ZD6A 1YBVA 1PJCA 1VJTA 5MGBA 5LDHA 2GF2A 1PZGA 1YL6A 2YJZA 3UICA 1PL7A 3T4XA 2DBQA 1WWKA 4ROSA 3CIFA 4CQMA 4MINA 5DOVA 2XXBA 3ENNA 3TWOA 1GFSA 5JO0A 1GQYA 3VH3A 3IJRA 4ALLA 5COBA 4FOSA 5AXAA 2QG4A 1P77A 1O94A 2GZ2A 3DAPA 3ANMA 1LLUA 4J1QA 1T2CA 4BO6A 2Q50A 4E4YA 3I9OA 4E13A 4DXHA 1P45A 1Y8RA 2VN8A 4ZQHA 1X7DA 1UXKA 2PKRA 4GKVA 1C0IA 2NM0A 3GR6A 3H5RA 3LLSA 1NHGA 3HJAA 2VYVD 5T8KC 3QHAA 3TZKA 5DCWA 1T2DA 4MVJD 4WLUA 1R0LA 1EFKA 3HSKA 4GLLA 4RVUA 1GUFA 1C1XB 2NADA 4J4TA 4XJSA 2O2SA 3L4BC 1JAXA 3DZBA 5F5LA 4U0JA 4Z9YA 4WASA 3VTZA 1HE3A 4J4BA 3X2FA 3QSGA 2ZJ1A 3PWZA 1DPGA 4KP7A 3WGIA 1BG6A 4BNLA 1DJNA 1V3TA 1C3VA 3HFSA 1LDBA 5TLSA 1SO8A 1YWGO 1M2WA 2Q46A 1JAYA 2Q2QA 2JFGA 4HKTA 1XQ6A 3W6UA 2GPTA 1WXDA 4IQ8A 4LSMA 2DVMA 3G49A 1MFZA 5JCXA 3JQAD 3JQEA 3OIGA 4K28A 1BSVA 3H8VA 3KUXA 5FF9A 1Y8QA 3L77A 2D59A 5JY1A 4Z6KA 1ZXLA 2X23A 3OICA 3VZQA 1HDCA 2AMFA 5ER6A 3B20A 1F14A 3BMCA 2UV8A 1PR9A 2JCVA 2ZK7A 2Z1NA 3SBOA 3WWZA 2Z1MA 4MJLA 5TF4A 3FN4A 2I67A 3FPLA 3MJTA 4WEQA 1UDBA 4RCVA 3ROKA 5CEJA 3GGGA 3U4CA 1HYHA 3DTYA 2ZTLA 4J4HA 3W1VA 1XCBA 3VKUA 2O2YA 3I5MA 3I6QA 3KYDA 4HFMA 2IXBA 1ZUD1 1NHWA 3RC1A 2W2KA 2WE7A 4Q39A 4BNVA 2BRUA 4RQTA 1RPNA 4O0LA 5CFZA 1LRLA 4M8SA 3RASA 2VZ0A 3GVIA 2AG5A 3I23A 1LSSA 3ST7A 5ITWA 3C24A 5TJ9A 2D4AA 1E3LA 1Q0HA 4Z0TA 4XB2A 2D1YA 1QV7A 5KVQA 5FI5A 1ISFA 1PU2A 4RVFA 1PJ3A 1PGJA 3I6IA 2BLLA 4W9NC 1YJ8A 4RLHA 5ENDA 4BVAA 4IQGA 1DFIA 2Y1FA 5L45A 4E5MA 3WNQA 3I4CA 5MDHA 1JWBB 5BNTA 1P9LA 4RPJA 4P4GA 3HWRA 1VI2A 2WYVA 1NWHA 4PLTA 4TKLA 4WGGA 2HMTA 2NU7A 1HZZA 1QYDA 3ITKA 2A92A 2O7QA 3F3SA 3NUGA 4R5HA 5JE8A 1E7MA 5I7VA 1EBFA 3GF4A 3L4SO 5DBIA 1HDRA 4JIGA 5DZSA 5F5NA 3DDNA 3GEDA 1EUDA 3K6JA 3RBXA 4N5LA 8LDHA 2DTEA 3NAQA 1ZO8A 2DAPA 4BKRA 3DBRA 3ZU2A 4DPLA 4J1SA 1T1SA 4YAKA 2Q4EA 4J0EA 4IIVA 3H9JA 3VH4A 1WNTA 1LSOA 3JQAB 3MOIA 4PG7A 3UCFA 4ND4A 2BFPA 2PGLA 3P5SA 4DYVA 5I9LA 4R01A 2HKIA 2O4CA 1R15A 4F6CA 4IY1A 2VWPA 2R6JA 4P4NA 3OQ1A 3DO5A 4JK3A 4J2OA 2D3TA 3QV1A 2A9FA 2AQIA 1ZCJA 4W7IA 4JP2A 2BH9A 3DC2A 1Q1NA 4FD3A 5FI3A 4YR9A 4TVOA 2GSDA 1UXIA 1YE3A 4DBZA 4NBUA 4NZ9A 1IY8A 2W90A 3VAZA 1XWFA 4YJHA 4BNJA 2R2GA 2PH5A 4J7XA 3GVHA 3LT0A 1PJBA 2H63A 3LT2A 4FFLA 1JKJA 3ONDA 1HE4A 1U28A 4IDDA 4J6FA 4DPMA 4KDEA 4NBRA 3K9QO 2QZZA 5CDYA 4UULA 5KKCA 4E2WA 1R6DA 3PJEA 1TVEA 4NJMA 2VZ8A 3C7AA 3ETDA 2P4HX 4UAGA 3PQFA 1PS9A 2VHVA 3GK3A 3RFXA 2WWRA 3M1AA 1P1KA 3O03A 3QQPA 3ZW8A 3B1FA 1NX6A 3M2PA 3Q2IA 5GMOA 3E9NA 2WYWA 1CWUA 4B79A 1LXCA 4CV1A 4PLFA 2C82A 2XF8A 3DFZA 3AUAA 4IM7A 5ILGA 2QZ9A 1Z74A 3GZNA 1KC1A 3DHYA 4XQ9A 1JLLA 3BIOA 3ICCA 5KWEA 1LU9A 4UVDA 1PWXA 2Y05A 3FWZA 3EC7A 1CQJA 1ZSNA 3AM3A 3G17A 3DB2A 1N9GB 1Z82A 4J0FA 2FPPA 3GA0A 1MUUA 4IJWA 4WOJA 3AM4A 3C85A 5C7LO 4E2XA 2CDAA 3KYBA 1KBZA 1YRLA 2PZLA 3U4IA 3UAGA 4ZGWA 2OBYA 3KLPX 4INAA 1YB4A 1IYZA 3JD1A 4OXKA 4YT2A 4CM5A 1HDYA 2AQ8A 1J4AA 2BELA 3I1JA 5L40A 2NTJA 2CDCA 1DRUA 1GDHA 1EE9A 1YKFA 2C59A 2RBEA 3AY6A 1XLTA 5TX7A 4RORA 4AJIA 2D2IA 2NLOA 1GUZA 3GDOA 1MX3A 4YQZA 4HFNA 4E5NA 4RGBA 1M67A 3D7LA 4J49A 5LCXA 3DHEA 1PJ2A 3QWFA 5KKAA 3OM9A 3ENKA 4CUJA 3G3EA 1B8UA 2NQTA 4DYDA 2EERA 2O3TA 2PGDA 1VM6A 3NDIA 3WQSB 4GGPA 3NDJA 3AOEC 1X7GA 2GRAA 4XKJA 4NH4A 4DL9A 1H9BA 1E5LA 1R4MA 1HLPA 4HFRA 1ISGA 1OAAA 3NYWA 2O48X 1ZFNA 1NQ5A 4Y6RA 1N92A 4JJGA 3IUPA 1EVIA 1JKIA 3ZWNA 4KOAA 1VL8A 4NFSA 1GU7A 3PYXA 3P7MA 3LF2A 1E77A 5JBIA 3S2FA 1HL3A 1FXSA 2PTGA 1QSGA 2NVWA 3E6AA 4PRLA 3OIFA 1B3BA 4JXKA 3QWAA 3P2YA 3Q3CA 3NKLA 2NVUB 4LVCA 3KVOA 2X5KO 3SVTA 2CZCA 3CPSA 4WK6A 4DPKA 1A4IA 1O9BA 2DTXA 4MVJH 1ADGA 1VC2A 3VKVA 1SMKA 3DBLA 1XIVA 2WD7A 1CJCA 1QORA 2HJSA 2I99A 4RPHA 4FN4A 3RIHA 3TJRA 5HRUA 1PQUA 2O3RA 4CM9D 1KVRA 3CMMA 3RFVA 4FOOA 4ID9A 4NK4A 4B4UA 1H6BA 1WZEA 3NT5A 1YQGA 1P1JA 2ZCVA 5L4LA 2HK9A 4CM7A 4EBFA 8ADHA 1GEGA 2E48A 4WCFC 4YT4A 3OHSX 3SLKA 1PGPA 3JQFC 2E4AA 5AXCA 4CMCA 1SZJG 1F17A 1ONNA 2A94A 4KMSA 2G17A 2ET6A 3LC7O 3TL3A 1V0JA 2UYYA 2VWHA 1Z73A 1SOWA 1YO6A 4GX0A 4DUPA 3PLNA 2OBNA 4GI2A 4R3NA 2Y93A 1E7YA 4A26A 2UUPA 1NFRA 2CD9A 5CAEA 1IB6A 4PG6A 1LRJA 4PZDA 4Y6SA 4IJUA 3ZWWA 4OH1A 4U6SA 4ZA2A 4H16A 1YJQA 1GTMA 3UVEA 4IJVA 4AJ1A 4J90A 3HDYA 1OFGA 3RUEA 3PEFA 4RF2A 1NNUA 3EVNA 4RF3A 3DZJA 3UCEA 2IE0A 2UVDA 5IN4A 4S3MA 3T4EA 1X15A 4CM9A 4S1VA 3W6ZA 2G0TA 3MJ4A 5U9CA 1X1EA 3JQ8A 1YDWA 2W8ZA 3WSWA 3JYLA 1YL7A 3GHYA 1NP3A 3FBTA 2ZQYA 4XQGA 1SBYA 4CV3A 3LQFA 4EUEA 1E92A 1B0AA 2GASA 1B14A 4GAEA 4D3SA 3HUDA 1C0LA 3NV9A 1Q7GA 5HS6A 1UP4A 4PLCA 3GHHA 3F4BA 4Y8VA 4RL6A 1QLHA 1NAIA 1RWBA 2PD4A 5I8ZA 1MA0A 3IKTA 1IZ0A 1XDWA 2QYSA 3SC4A 1WVGA 2IEBA 1LA2A 4BO3A 2G76A 1M6WA 1KVTA 3OP4A 4ALKA 4B4VA 1KC3A 3ITDA 4R51A 3WYCA 2G1UA 2X8LA 3RC7A 2YFQA 5GZ6A 3NTRA 3R3SA 2GN4A 2SCUA 2HK7A 1ENOA 4E32A 1W4ZA 3E9QA 1C1DA 1NVTA 3D1LA 1XG5A 2YZ7A 3ONFA 3BHIA 4L9RA 4J1TA 4K26A 3AOEA 2F1KA 1AHIA 1L7EA 2RHRA 3GDGA 4FFPA 3BMQB 4OXNA 3OJEA 3ZWMA 5G4LA 4QFDA 4QXMA 3RSHA 5IZ4A 1RM3A 1XGKA 1YQXA 4J9VA 4J9UE 4UEJA 3JQ9A 3GFBA 2B4TO 5B37A 1H5QA 4BHTA 1G1AA 3OJ0A 2IZZA 3I4FA 2F00A 4M86A 4I08A 2YHIA 3DXFA 2EG9A 1PIWA 3E03A 1XKQA 4R16A 4WKGA 1K5HA 2FP4A 4C4OA 3HADA 3FNFA 3OIDA 2EW8A 4XZ3A 3D4OA 5I9NA 4CL8A 4XDYA 2EKQA 4CMGA 4ZRMA 3WSVA 4YRDA 1TI7A 1ENPA 2EEZA 4QTZA 5I9MA 3ADPA 4MVJP 4RPKA 4IXWA 3JQGB 1RKXA 2NSDA 2X0IA 3S55A 1G0OA 1YH3A 3V2GA 1T1RA 3PQDA 4CMIB 5EJ2A 5A3JA 1S7CA 4NNJA 3WBBA 3VPSA 1P44A 1B3RA 3RC2A 3GGOA 4FJ0A 1UDCA 3IMFA 2CVZA 2PZKA 4Q3EA 4P22A 3QRWA 4Y67A 3FI9A 1X0VA 3B6ZA 4IMRA 4I5EA 3WIDA 4WNCA 3C7DB 1LEHA 2OUIA 2IXAA 3TZQA 4BKOA 4E12A 2BFOA 2XAAA 5AYVA 1BVUA 3BA1A 1KS9A 4C7KA 3RJ9A 1IPEA 4J7CA 3WBFA 3B1KA 2O23A 3E8XA 1GUYA 2BD0A 2YDXA 1M76A 3LK7A 3PIDA 4CLEA 2OORA 1X1TA 1QG6A 4N5NA 4D45A 5HM8A 5BSGA 4FQ8A 1ZMOA 4OHUA 2AE2A 4WLNA 3KB6A 3A1NA 1MXHA 4UUMA 4YJGA 4OJNA 2VUSA 4OL9A 4Q9NA 2FR8A 4F3YA 4FC7A 3SC6A 3BHMA 3QE3A 2TMGA 3FD8A 3D4NA 3PIIA 4WCFB 4RPGA 3D4PA 4Y6PA 2AW5A 2V6MA 3HDHA 5U4QA 4ZJUA 3FRJA 2CFCA 4RF5A 3GG9A 1PZFA 3TOXA 4IS3A 4BV9A 2PWZA 2GN8A 1J49A 3DZKA 2Q3EA 1AGNA 4XQEA 4P8RA 2ILTA 1TA4A 3VH1A 4UREA 3TL2A 4F46A 1O8CA 3DL2A 3IDSA 3WB9A 4ONEA 3UN1A 1QV6A 4B3IA 5GZ3A 5KJ6A 4EJ0A 4FCCA 3WXBA 2IRWA 2PKQP 3JQ6A 1XEAA 1ZEMA 4JCOA 1X14A 1TEHA 2JD2A 4NU6A 4RLSA 3VOSA 1GAEO 3KSZO 2VRCD 3SXPA 4XGIA 3UGKA 1OI7A 3UW3A 5KCZA 3ZWBA 4YRBA 1A27A 3JQ7A 2BGLA 3AUUA 3CTMA 1AN9A 2ZQZA 5IAAA 5EL0A 1T2FA 1DAOA 4EDFA 1MP0A 3WDSA 1TT5B 3WGHA 2B69A 3GZ4A 4LMRA 3PVZA 1F06A 2QIOA 3L07A 4RQUA 2WE8A 3U0BA 4YJDA 1LLDA 3H3JA 3WGOA 4WOKA 3RKRA 2J5QA 5COAA 1R0SA 1K3TA 1MLDA 1Q7CA 1SEPA 2FPIA 3RBVA 5ITVA 3ZNQA 2AQKA 3K92A 5JDCA 2B0JA 3HN7A 4NMHA 3GG2A 1FDUA 2VNSA 4A7PA 1NR1A 3WJ7A 1UH5A 3FWNA 1WMAA 4D0RA 4AJLA 1CERA 3F1LA 4CM1A 3X2EA 3CZRA 3PPIA 3KLMX 1DFHA 4DBVO 1VE9A 1ZK2A 3CE6A 4Q3NA 1E3SA 2GN6A 1GR0A 1PS0A 1R4NB 4I5GA 4QO8A 2P9CA 2B5WA 5GZ1A 5G0SA 4FB5A 3ZNPA 2VRCA 5H82A 3L9XA 1K6XA 3CINA 1U4SA 4IDCA 5TT0A 3WWYA 2I66A 1UAGA 3JYQA 3RUIA 5I8WA 3N58A 3PXXA 1ULSA 3ZWXA 4J3FA 4CR6A 1G6KA 1E1KA 2JD1A 3LSYA 3LZ6A 1C1XA 4AJNA 2IZ0A 3Q9NA 1ZZEA 4JJIA 1T4BA 3V2UA 3ZCXA 1UXJA 4BNTA 5KJFA 2Y66A 3HFGA 4OMUA 1GQQA 4H7PA 2FY8A 2B35A 3KETA 2FZEA 3E5MA 4Q3BA 2EP5A 4L4SA 4DVJA 1EK6A 4AFNA 2IDZA 1KERA 4HXYA 1HDZA 5DCYA 3DBHB 4PLPA 4BKPA 3N74A 4QX6A 4ALIA 3OETA 4GVXA 2C5EA 2NNLD 2O3QA 2QHXA 3K2EA 2WTBA 3KXDA 2C54A 1UAYA 5DOZA 1F0YA 1OC2A 1O0SA 4QUKA 4J91A 3NRCA 1RM5A 1B16A 1NVMB 1LLCA 4XX0A 2UUOA 3VPHA 4KUGA 2V6GA 1U4OA 1PWZA 2FZWA 2H1SA 1I5RA 2I3AA 4GH5A 3ZV5A 4ALMA 3N7UA 1Z75A 4IDBA 1SAYA 4LVUA 4TMFA 4TRNA 4AJEA 2ZTVA 2LDXA 3GFGA 4W7HA 3TZHA 4JX8A 3OEYA 1EE2A 4ND1A 3BZUA 3ZHXA 4RPLA 5JSFA 2G82A 2XOXA 3PI7A 3FTPA 3ASVA 2V65A 1HDGO 1U3UA 1V35A 2YYYA 3AU8A 1T2AA 3JSAA 2DU8A 4RO0A 4BMSA 4CMEA 5JYDA 4J2HA 4CMJA 4IXTA 2Q1UA 5EESA 4XDZA 4XRGA 4UUPA 4O59O 3RUDA 3TSCA 1FDVA 4UEKA 4YJFB 2EXXA 3RBZA 3R3JA 2AEMA 1QYXA 4HNHA 1ZK1A 2GCGA 4CM8B 3HNPA 3EZYA 5THKA 1CIVA 3OQ6A 5CG2A 2VYVA 4M55A 3VZSA 3K2BA 2VHYA 4DRYA 4MVJA 3V8BA 3G1TA 1LQTA 3OMLA 1ZVMA 5KNLA 3WGGA 3FF4A 2O3JA 5AOVA 1LDEA 1QP8A 3QW2A 2AQHA 2BF7A 2RHCA 1I3NA 5KTKA 1BGVA 3P2OA 1IHYA 1QKIA 4IDAA 4O1MA 4M89A 4MVJF 2X4GA 1DAPA 3PYMA 3Q2KA 3PLRA 2C2XA 5IZCA 3EMKA 3ZHZA 1HSZA 1KY4A 1CF2O 4UUNA 1P31A 1LI4A 1QXSA 4ND5A 1N8KA 3FNEA 5TS3A 3R1IA 3JQAA 3PWSA 3MWDB 4XWYA 2VHXA 5JDIA 3F47A 3D5QA 5TGDA 4RJTA 3DMTA 1ZJYA 3KEOA 3S2GA 3I9NA 5EINA 3INRA 5CDGA 2ZIZA 1M75A 1P1HA 1Q0QA 1I8TA 1ULUA 4HV4A 4HWKA 5IDXA 4AICA 4B8ZA 5K6AC 3LT4A 2GNAA 3GUCA 4QT0A 1EVJA 1P33A 1OOEA 2EF1A 4E0BA 4R41A 5A05A 4ZICA 2CNBA 4IPTA 1PZEA 3MWEB 3GRPA 1I24A 2Q1TA 2Y0CA 3O38A 2JD0A 4D44A 2EHDA 2EP7A 3A28A 3VDRA 1U9JA 4FJ1A 1ZEJA 3RU7A 4ZN6A 1DC3A 3INGA 1L1FA 1R0KA 3E1KA 1FDSA 4DREA 4M1QA 3H7AA 1LDNA 1P1FA 1VRWA 4KWIA 2WEKA 1E5QA 4E33A 1ZXBA 1BVRA 3OJOA 5A9TA 4DTIA 4OYRA 2GD1O 4ZRNA 4WUVA 3ZV3A 4DIOA 2HMSA 2PD3A 3L6EA 5T8KA 4AL4A 1ZH8A 5JXWA 4WLOA 1HZJA 4OIMA 4JGBA 1V6AA 3WG9A 3L4BA 1EEHA 3AI1A 2VOJA 3GEMA 3IP1A 5JAQA 4R4JA 4MVJG 2WMDA 3TFQA 4ALNA 2P4QA 4ND2A 4BO8A 2YFHA 3RUHA 1N9GA 3G1UA 2EGGA 3TF5A 1ZK3A 4OO3A 4W4TA 1TT7A 2J8ZA 3CUKA 5L4SA 4GPD1 3BHJA 1BWSA 3U49A 2C7GA 3NTOA 4LGVA 3GUYA 1U3WA 1ZIDA 3A14A 4FS3A 4DMMA 4RDHA 4AVYA 3WIEA 1H9AA 3Q6IA 1Y9AA 1QR6A 1TB4A 1JU9A 1UZMA 3I9MA 3PFWO 5C3MA 3RROA 1N2SA 3SX2A 3BXXA 5HA5A 5DP1A 1GADO 3DMYA 3EZLA 4BB6A 3UOGA 5A1TA 3SEFA 4QFCA 1JTVA 1ENYA 2GDZA 4B3JA 3VPXA 3EHEA 4BNFA 1C0KA 4KUEA 3RUAA 5ILOA 4TRJA 3ZI0A 3GOHA 1PL6A 1F8GA 4WLEA 5JY6A 3ETGA 4XIYA 3EW7A 3H9EO 4FSHA 4IDFA 2PLAA 4KZPA 4UEOA 4PRKA 3ZWAA 4NG5A 5TT1A 4MVJI 4E2YA 5JC1A 4UVEA 3ZWVA 2FWMX 3DOCA 4BNZA 3MJVA 3OA2A 3S2EA 2VUTA 2AA3A 2OP1A 1U8XX 4OOFA 1M6HA 1KVUA 3RKUA 5JMWA 2EWMA 3IAHA 5JMPA 3RI3A 1VJ0A 3HDQA 4DQVA 2VT2A 3ROMA 3EVTA 3FR7A 4OKNA 5EERA 4HFJA 2JJYA 4NQZA 4XB1A 4BO9A 4W9NA 2CVOA 1E7QA 4DLBA 5BSHA 2GR9A 1K89A 2NVUA 3F1KA 5IDQA 1AXGA 1LUAA 2ZB3A 4MVJE 3OF2A 4YEDA 3VH2A 5IDYA 1A5ZA 2Y67A 1DBVO 2I65A 1KEWA 4R69A 1YOVB 3ANLA 1GZ6A 1MG0A 5TSDA 2NTVA 1V8BA 4CMAA 2BI8A 2FR1A 3WFIA 4E5PA 4OAQA 4M87A 3F9IA 5JAIA 3ZN2A 3JYPA 1ISMA 1MXFA 3CXRA 2BGMA 4Z0HO 4ESOA 1NTOA 3KOUA 1W8DA 4MP8A 1H6CA 3U4HA 1DIAA 3E82A 4BQPA 4BL5A 4RVHA 1JA9A 1E7SA 2EJWA 1LBEA 1E6UA 4CLXA 3K73O 4WLFA 2J3KA 2DBVO 2C20A 4W82A 2QX7A 2RH8A 5JAZA 2W98A 4U5QA 3I52A 5CG1A 4PLWA 3JQCA 3BMOB 2V7PA 2OFPA 1K0UA 2O4UX 1OMOA 5F1PA 1M66A 4ILKA 3PHGA 4DQUA 4YCAA 5JW6A 4XYLA 4HP8A 1B26A 4BO7A 4E21A 4CLDA 4I9HA 1PQWA 4EITA 1RJWA 3EDMA 5JCJD 4O6VA 2HSDA 1SC6A 3FNGA 4PLYA 3KHUA 1P0FA 4PVCA 3RU9A 2AHRA 4ITUA 4RF4A 2A4KA 2D8AA 5L9AA 4TSKA 2X5OA 4D46A 4NK5A 3PJDA 3GY0A 3MCVA 2Q1SA 3AM5A 3QVOA 2HRBA 4HBGA 5AXDA 5GY7A 3PGXA 1S6YA 1HKUA 5HTOA 3INTA 4Z9FA 5F1KA 3WS7A 1ZJZA 5CDTA 4CLHA 1V3UA 1SEVA 3EK2A 1IE3A 4B8WA 3ZWOA 5TNXA 4FFOA 1HWYA 5ES3A 4IMPA 2EIHA 1QLJA 2VYND 3PHHA 2XXJA 5HS4A 2CY0A 1J5PA 4LW8A 4WEOA 1ADFA 3ADOA 4GSLA 4GBJA 4HADA 3B70A 3VPFA 4ALJA 3A4VA 3BTOA 3QA9A 2FHSA 2X22A 2UDPA 1R37A 3U4DA 3GVXA 2OXIA 1NPTO 3FR8A 3GAFA 2J6IA 1IZ9A 1A7KA 3UXYA 1WZIA 1DSSG 5C5IA 3JD3A 4XGNA 2NU6A 2I6TA 1BXGB 3QIVA 1D7OA 4FFNA 2VWGA 4L75A 4BO2A 3F6YA 3B1JA 2O3SA 2DQ4A 1MFPA 3I9LA 4OXYA 2AE1A 1DIHA 5IN5A 1A4UA 1R16A 2PZJA 4BKUA 1DRWA 4PGFA 5KIAA 3WFJA 4UUOA 2POQX 3NDRA 3ZHYA 1BHSA 5G4KB 4DC1A 4Z3KA 2ZATA 3GAZA 1GPJA 2Y1CA 3ICPA 3KEQA 5KJ1A 1FJHA 3KSUA 5IFLA 1YDEA 1YBMA 5L95A 3BMQA 2PGJA 1UUFA 3QLJA 2VHZA 2OMEA 3TZCA 1D1TA 3IIEA 5CDUA 1QYVA 3A06A 1G0NA 3JYOA 4RVGA 1U7TA 1YGYA 2PFGA 3KV3O 4CODB 4D7AA 4KDFA 1E7WA 1PGNA 2JAPA 4CM4B 4TQGA 3BTUA 5H83A 4WECA 4QECA 3QY9A 4YYZA 2VYNA 3Q0EA 3SJUA 1DLJA 5DCUA 5K9ZA 2HMWA 1E3WB 2G5CA 4O63O 3RUCA 1W0CA 4OQZA 3GN2A 3M2TA 4MOWA 3NJ8A 5JYEA 1NWCA 3HB4X 4BNYA 1KOLA 4CV0A 2X0JA 4MDHA 1VL6A 1PS8A 2PK3A 2Y99A 3LC1O 2VT3A 1GD1O 2HO5A 5BNFA 2RH4A 4CLOB 3JQGA 2X5JO 4W99A 3W8FA 3O8QB 3MJEA 1QMGA 2AEJA 2PR2A 5DBFA 3A9WA 4JQCA 1B8PA 3O4RA 4FFRA 4CMIA 1E6EA 1WW8A 3RUFA 2HMVA 5T6BA 3H3FA 5A9SB 4U7WA 1H0KA 3KTDA 1ZW1A 3JQBC 2HCTA 2Q49A 1UP6A 4R5MA 5B1YA 4E30A 5T64A 2YQ4A 3PJGA 1E3JA 1U5AA 1NFFA 1O5IA 1N1EA 1P0CA 1NM5A 4GMGA 4OKIA 3DBVO 1Y5RA 4XA8A 1PTJA 3DR3A 2GZ3A 3DWFA 4GGOA 3NGLA 5LC1A 1WPQA 1J0XO 2NU9A 4L74A 4N5MA 5CHEA 3HB5X 4IS2A 3AK4A 3JD2A 4AJOA 4B7CA 2RCYA 1MV8A 3ZWCA 2I76A 3KYCB 3WGYA 3PYLA 1VKOA 2Q99A 3MJSA 4M54A 4XEHA 1DIRA 2D0IA 4BO0A 4RZHA 1DJQA 3MZ0A 5DDIP 4CJXA 3NJ4A 1Y1PA 4A73A 1Z6ZA 2HK8A 4FW8A 4WCFA 4EGFA 5JS6A 4AJPA 4I8XA 1O6ZA 2PD6A 3JQFA 4TWRA 4L0QA 3GMSA 4O5OA 1KYQA 2Z5LA 4PLGA 3VVCA 2J5RA 3PZRA 3AU9A 2ZCUA 3WMWA 5ICMA 4CM3A 2WDZA 4NR0A 1PEDA 1NAHA 2BHLA 4CQLB 3PGJA 4KQWA 3RD5A 4N18A 3W8DA 5J23A 2JKVA 1RYDA 1EUZA 2X9VA 1CQIA 4XR4A 3QVTA 1IOLA 2NUAA 3GN1A 4XD2A 2IYOA 2DBZA 1I30A 4RZIA 4CR8A 4ZHSA 1IHXA 2DM6A 1NYTA 4IDGA 4E6PA 1C0PA 3QVSA 5IDWA 2WM3A 4WJZA 4EJMA 4DA9A 2X1HA 1Y81A 1P1RA 1AHHA 2VQ3A 1KEVA 4I1IA 1RYEA 2Q1WA 2EJVA 4EZBA 3IJPA 3PDUA 4M49A 5I7EA 1Y9EA 1LDYA 4LN1A 3H9QA 1D1SA 1DRVA 4FC6A 1TT5A 3WLFA 5FWNA 7ADHA 3GVCA 1ADCA 1TXGA 4YPOA 7MDHA 5B4VA 4DIBA 5F1OA 5JPIA 5AXBA 3WQRA 4IGEA 3TQHA 1JN0A 4YBZA 5IJZA 2FSSA 2ZYDA 3WOHA 4BMVA 3C1AA 3TFOA 3PK0A 1VSUA 4XYEA 1VPDA 4YT8A 3FBGA 4I5FA 2Y1EA 1HSOA 1HE2A 1FMCA 2DUUA 2JHGA 4BUCA 5B12A 5TC4A 2DBRA 3OJFA 2E6UX 3WLEA 3I3OA 3WNVA 5FFFA 2WD8A 4YT5A 3VPGA 4F6LA 1UJMA 3PWKA 4ZQBA 1BXKA 3ORFA 4J16A 4L73A 1HTBA 1Y7TA 3TOZA 4D42A 2DFDA 3AFMA 4G65A 4OOEA 4FDAA 4CLRB 4PN3A 4IINA 3KM0A 4XCVA 1ZKMA 2VRBA 2B4QA 1LX6A 1BDBA 2E82A 1HDOA 1R4NA 3R0IA 4WLVA 3FTNA 1U3VA 3ZNNA 4I9NA 1UDAA 4YDRA 1XA0A 3VHRA 3BTVA 1WDLA 3DAFA 4R9SA 2C2YA 1R66A 4N54A 4BB5A 1A71A 4EYEA 1L7DA 3DOOA 4NBVA 1T26A 1W73A 3KZVA 4WE3A 4ZQFA 3VVBA 5ADHA 2EV9A 4CV2A 4IUYA 1LJ8A 3BMNB 1Z7EA 2GLXA 3V1YA 4CQMD 2J5KA 1NQOA 4IJKA 2FSVA 1E1LA 4GMFA 1BW9B 1BTOA 4AJHA 5A02A 4N7RA 1HXHA 4IGFA 2O7SA 3ABIA 3DZHA 2DPGA 1NASA 3DBHA 1PJ4A 1PL8A 1WMBA 2ZTMA 2AXQA 3GNQA 4XYMA 4YAJA 3WICA 4YVFA 4CMBA 1KVQA 4G81A 2Y1DA 1IULA 1Y5MA 1DC5A 5BSFA 4BO1A 1HE5A 1U7HA 1H6DA 4FIZA 4BNMA 3W4JA 3JV7A 2GERA 4D3FA 2Y68A 3E18A 4PVDA 1EZ4A 3ZZNA 4IZIA 2NU8A 1WAMA 4EW6A 4RVDA 5BR7A 1GPDG 2CF5A 1JVSA 1P1IA 1YXMA 1LQUA 2J3IA 4BGIA 2GUGA 2X6TA 3DQPA 4B7XA 1VLLA 3SJ7A 1JWAB 1LSUA 3OBBA 2ZKLA 3NGXA 4LCJA 1I0ZA 3PTZA 4DLAA 4FBGA 3R6DA 1PJQA 4QEDA 3CZMA 3NT2A 4AJKA 2H6EA 2PY6A 3GMDA 1A7AA 5CP8A 1SB8A 2C29D 2V6BA 4MIEA 3UUWA 1SPXA 2NQ8A 2OO5A 1KIFA 4B7UA 1NXQA 4W6ZA 4AG3A 4L4RA 3S1LA 1HRDA 1T25A 2CMDA 4PG4A 1YL5A 5EQDA 4TROA 1ISHA 1U8FO 2VWQA 3AWDA 4KUHA 3DZFA 3VZPA 5HWSA 2JCXA 3FSRA 4I9UA 3IKVA 2H9IA 2PZMA 2UAGA 4YJFA 1EDOA 2BFAA 2ZYGA 1RM4A 2HDHA 1B8VA 1QYCA 3GEGA 4XJTA 4XRRA 1EVZA 3LVFO 4CM8A 1SB9A 5F21A 2VOEA 3QJ5A 2ZTUA 3GVPA 3OH8A 1CDOA 1ENZA 3IL2A 4NJOA 1DEHA 1ID1A 2DT5A 2P91A 5DULA 4PIVA 4YQYA 4CQMB 4E31A 1EUCA 4B4WA 4L4XA 1DC4A 1E6WA 1Z45A 1Y6JA 4MKZA 3OJLA 2E49A 1DO8A 3ZU5A 2RAFA 1T24A 3VDQA 1X13A 1VL0A 4WCDA 3PHIA 5K0ZA 3ZGYA 4JP3A 4XYBA 2Q4BA 2JAHA 1Y8RB 2C7VA 3QWIA 5JO9A 4FJ2A 4NPCA 1PJLA 3HG7A 5JNLA 3GT0A 4PLHA 3IOYA 2W4QA 2VCYA 3C7CB 3JTMA 4YAIA 1XSEA 1MC5A 3UH1A 3KBOA 3ASUA 3WGTA 4CL3A 4LRSB 1I2ZA 4HUJA 4II2A 3V1TC 1B7GO 2DTDA 5DP2A 2HRZA 4OQYA 3ZV4A 5BNIA 1PZHA 4D79A 5EN4A 3NTQA 1PJSA 3L0DA 4ND3A 1I36A 2YW9A 5THQA 3F5QA 3GQVA 3LLVA 3Q9UA 4YTEA 3UHAA 3GRKA 4OM8A 2CVQA 4AJJA 1ISJA 2J3HA 1LTHR 3PZBA 4LK3A 5DNAA 1DHRA 1NQTA 2P5UA 3CMCO 1WP4A 5CPBA 3H9GA 9LDTA 1NBOA 3EGOA 5A5EA 1DOHA 3EAGA 1JVBA 4E5KA 1DIBA 4QQRA 3HE3A 1FF9A 3VC7A 4CR7A 2Q45A 3T7EA 1I10A 1I3LA 4B3HA 4XYGA 3LYLA 4EUFA 3K8ZA 3WTBA 3D5TA 3GH3A 1LC0A 1R12A 1Y8QB 1ZSYA 3AUSA 5EQFA 3ON5A 1C14A 5KJEA 4EUHA 5B4UA 3BMCB 2Y1OA 2FN7A 4II3A 4BNWA 2B83A 4E3ZA 1F12A 3PP8A 3M1LA 3QWBA 2BMAA 3U3XA 1GCOA 2ZJ0A 3RC9A 3GPIA 1U5CA 2DPHA 4Y98A 4U6QA 2FR0A 5TQVA 3U62A 3C3XA 3TZ6A 1EDZA 4BNGA 1PSDA 3KYDB 3U9LA 4Z0PA 5LDGA 2VUUA 2W2KB 4CMHA 1XYGA 5EPOA 4MIOA 4BQRA 1IUKA 3GC6A 3FHLA 4XR9A 4CPDA 4PG8A 1I32A 2Y0DA 3F4LA 1IPFA 1D4FA 5L3ZA 4R68A 2E37A 2Y1GA 2W2LD 3DTTA 4FGWA 3AI3A 3HDJA 2R00C 5I7FA 3GNTA 1H6AA 1K2WA 4PG5A 3DHNA 3T7CA 3UF0A 3KO8A 1ZSVA 4E5YA 6ADHA 2FRDA 3WJAA 4BV8A 4LSWA 3OQBA 3WR5A 3D0OA 4L76A 3BTSA 4WNIA 2EKLA 4Q3DA 4JNKA 1GYPA 2GO1A 4KTTE 2DKNA 1ML3A 2FMUA 3ULKA 4BNUA 4F45A 1T2EA 3ROPA 3DEYX 3LF1A 3RJ5A 1E0DA 3DBRB 2YUTA 2YDYA 4A0SA 4D41A 4BO5A 1F8FA 5KOIA 2AG8A 4H15A 3LC2O 5IXYA 1EFLA 3H5AA 3PRJA 2HJRA 4JROA 4ZQEA 4CMKA 4CUZA 5EIOA 1ARZA 2HMUA 1GQ2A 1N7GA 3JD4A 4GX5A 1B2LA 3WYBA 2EKPA 4J43A 3ZU4A 4D3DA 1LDMA 1YB5A 1N5DA 3KRTA 3U09A 2YV2A 3H6KA 1OC4A 5L53A 5U1PA 5G0UA 2OP0A 5IF3A 4GX2A 1LRKA 5FYDA 2W2LA 1KY5A 2DC1A 3SLGA 4BNKA 2ZB8A 2LDBA 2PNFA 4K6CA 2P9EA 4PZEA 4NBWA 1WLYA 5G0TA 1UZNA 1E3EA 1PR3A 4RVSA 5JC8A 5IG2A 1U1IA 2OHXA 4K6FA 5TIIA 1OBFO 1UP7A 3JD0A 4YJHB 3ZNOA 1VJ1A 1GV0A 1YOVA 3F5SA 4U0KA 5KVCA 2O3UA 5JAMA 3OSUA 4PZCA 1K6IA 5BQFA 1PJTA 1ORRA 1SOVA 4P38A 2I9PA 4NJMB 5AVOA 2H5LA 3OEWA 5TJHA 1EQUA 1U2GA 3ZU3A 4LMPA 4NBTA 4URFA 4BNXA 3CSDA 2P5YA 3MTGA 3BYZA 3I9KA 3PFFA 1XHLA 4MVJM 1GZ4A 2QW8A 1KEPA 2YY7A 4HY3A 5A06A 1EK5A 3IP3A 4IQ0A 4PLVA 2YHUA 3MOGA 3WYEA 3OA0A 2Q2WA 2OZPA 1BRMA 3E48A 3GZNB 3IUSA 5A4DA 4A2CA 3BMOA 5A04A 2IODA 1BMDA 3H9UA 2ZB4A 5JFOA 1PGQA 1GCUA 3G0OA 4R1NA 3WX0A 2X0RA 3D3WA 2I3GA 5K6AA 2OGUA 5B4TA 2WYUA 3UFXA 3NX4A 1NPYA 3OECA 4LCEA 4OSOA 1DB3A 3AUTA 5C37A 4NFHA 1GL3A 1GV1A 3S2IA 1YBAA 3K31A 1HYEA 1X7HA 3ANNA 5FEUA 1KVSA 1PX0A 3OFSA 1A9YA 5A3VA 3O26A 2QYTA 1YQDA 2NTNA 2VTDA 3RFTA 3JCZA 2BKAA 3JQ9C 4BKQA 3QWHA 2P68A 1EQ2A 3ROQA 4A27A 1MGOA 1A9ZA 2CF6A 4DMLA 3E5RA 3S8MA 3D3WB 1B15A 4PFJA 2R00A 2YV1A 3PQEA 4MIYA 4R9RA 4QSMA 5DBGA 3NEPX 4ZQGA 3MTJA 3H2SA 5EMHA 2D5AA 3AI2A 3HQ4O 4BGUA 1O95A 2OOSA 5DN9A 1UXHA 4TZTA 4A5OA 4K1LA 2VNAA 3AW9A 4QO7A 5TRTA 1R4MB 4NI5A 2Y0EA 4NHEA 5HBRA 3ONEA 4JBIA 1ONPA 1ZK0A 4UVIA 1BXGA 3RQSA 4D0SA 3LDHA 5BT9A 1HLDA 3HN2A 4HX5A 4MPDA 5I7SA 1EVYA 2QQ5A 2NWQA 1P3DA 3FPCA 1Q0LA 3LU1A 4R1SA 2B37A 2I5PO 5G4KA 4RV9A 1XELA 4TRMA 1U3TA 1GYRA 1YONA 5BSEA 6LDHA 4A03A 5L4NA 2QRLA 3DBLB 2WD7B 1V3VA 4BGVA 5L51A 5CEEA 2IZ1A 2X58A 4GL4A 1TLTA 1QYWA 3G79A 4R1UA 1VKNA 4Q3CA 4CM4A 3L9WA 4DLLA 3E9MA 3HHPA 3RWBA 3GGPA 3W4IA 4TKMA 5L7TA 5JCJA 2WJPA 3WGQA 2QRKA 1XQ1A 1Z7BA 1E3WA 2NVBA 3C1OA 1W6UA 1H2BA 3MJCA 1K6JA 2IYPA 1JDJA 1JW9B 1E1MA 4GWKA 3EUWA 4Z3DA 1LDGA 3KSDO 3DAGA 4JBHA 1FDWA 3L6DA 5G0WA 1MG5A 1HETA 2JL1A 4DGSA 4R3WA 4B4OA 2PH3A 4CLOA 2D5CA 5T67A 3O8QA 2GZ1A 4BS9A 4YAGA 1DFGA 4JBGA 3V1UA 4XQCA 2HQ1A 3L6OO 1GY8A 2FOIA 2XPCA 5G2OA 3NT4A 5A9SA 1CYDA 1V9LA 3U5TA 3GNSA 2NACA 2C07A 2P9GA 1NFQA 3DOJA 4IZHA 1FK8A 4BOYA 2V6FA 4GLOA 5DF1A 3K30A 4BO4A 5L7WA 4RDIA 4BNIA 4G2NA 3O9ZA 1N1GA 4GSKA 1X0XA 4FGSA 1H94A 2YV3A 3AOGA 4YB8A 4G5HA 5C7IO 4WPGA 5DT9A 1YS4A 4GQAA 1DC6A 3PHJA 1CEQA 2FPGA 4MKRA 4ZU3A 3GPDG 4XGKA 3JQ8B 1VSVA 3D64A 1RM0A 3F46A 1DXYA 4I5DA 3CEAA 3TPCA 4J1NA 3GLQA 2NV6A 4IIUA 1I33A 4XIJA 2VHWA 3KYCA 1FDTA 3DFUA 1JQBA 2X0NA 1N7HA 4DQXA 3AFNA 3CH6A 3K5PA 3ZV6A 2Q2VA 4FFMA 1I2CA 3FNHA 3PHLA 4BMNA 4EEXA 2HU2A 4GWGA 5JDCC 4BNNA 2C5AA 4E2ZA 4YA6A 3P19A 9LDBA 3DZGA 5F3RA 2X86A 3ZWPA 2ZYAA 3IQDB 3QVXA 4CQLA 1T4DA 1CRWG 4MO2A 1CETA 1H93A 4MKXA 2B36A 2JCYA 4DC0A 3MEQA 2DUWA 1MC4A 3V5NA 1YVEI 1DIGA 2GN9A 3JYNA 3AY3A 1PGOA 3C8MA 4L8VA 1I01A 1C1DB 4NFYA 3CKYA 1NQAO 1ADBA 1UR5A 2DLDA 3Q11A 3WQQA 2IEDA 1DHTA
chains in the Genus database with same CATH superfamily
5P21A 4KKVA 1PR0A 2QNBA 4EIWA 2RKBA 3FCOA 3LT1A 2YQZA 4LA4A 2R84A 2X3FA 4G5QA 3C6BA 1Z0SA 1GYQA 2J46A 3NXSA 3PDJA 1J6UA 3DZIA 4FDMA 4GRDA 4GYJA 4NWIA 4P32A 4DN6A 3ONNA 3DD5A 2CJYA 4DJEC 1OYYA 2Q1YA 3FMIA 5IXSA 1OTXA 2V45A 3RW9A 3M6IA 5FD8A 3H2ZA 1QS0A 2O50A 1A9QA 2YHIB 3K32A 3K53A 3ZHBA 2B5VA 4HNGA 3EFOA 4JJZA 4D97A 1M34E 3HR7A 2YQ5A 1AV7A 2HD4A 1O94C 3H65A 1ONOA 1NRJB 3QUQA 3WKCA 4EJ6A 4LBZA 5C81A 2RC5A 4OLHA 1ZL0A 3T3HA 1FFCA 1WUTA 4FR5A 1AF4A 3WTCA 2CXUA 1XAHA 3GI1A 1TKCA 4EEZA 2YIJA 4LOHA 4I19A 3IS3A 5EIBD 5L7YA 1UC8A 4N0DA 4BLPA 2QTAA 4COOA 5AVWA 3QI2A 1Q77A 1YA8A 4HTAA 2RHJA 5EY5B 2FWBA 4XPZA 4DNOA 3ZDYB 1CU1A 2TMDA 1RHUA 2PV7A 2AOVA 1CVIA 4UVGA 3R09A 4MHSA 3RVDA 1MZPA 1QH1A 3L6UA 4GPAA 1PT7A 4Q9KA 3TW4A 3N2ZB 4CLRA 3VOAA 4MLPA 5GV8A 3KAJA 4EW1A 4G89A 1FSGA 2A35A 3CBQA 1PG5A 3HKEB 4M7OA 4OY3A 1YR7A 3AXSA 4OG2A 1BWQA 5K99A 5KJCA 4KR7A 3AY0A 1XPUA 4TWZA 2WWIA 1GZ3A 1XXHE 2QVXX 3OTHA 1EK0A 4H4DA 1EFRD 3WKAA 1XU4A 3FAZA 1BDJA 4G0NA 2CW5A 5D8DA 1RLMA 3DLBA 3RG2A 2A7QA 4Y7CA 3Q1LA 3UWDA 4DVGA 4YRGA 4RBNA 1V8OA 3O92A 1H2HA 1RC1A 2PZ8A 5EWJA 2C9CA 1PRYA 1CFJA 2E85A 1RMTA 4ZAGA 1SXJD 1G9XA 1GR1A 1IY2A 1P2FA 1W9HA 1PQPA 5FPTA 3S5JA 4IOLA 2PKQO 1FS4A 1SUCA 1K5PA 2ZUUA 1YB1A 1QVRA 4JEMA 4RS4A 4RK7A 4BGDA 2BFNA 1UZUA 3QYAA 4QUJA 2CLIB 3T6KA 5EA2A 2PA3A 1JHMA 1VL2A 1YZGA 2IHJA 1K7YA 4D43A 4LISA 1HYGA 3PCRB 3ZQ4A 5H81A 2VTEA 1RRKA 4OUDA 3MQ4A 4TL9A 2PR7A 3L7DA 4FBMA 2QT0A 4HQNA 4X00A 1JFRA 4HZIA 2FEXA 3FPEA 4PCVA 3QU9A 1KR5A 2ZJAA 3F2VA 5ICEA 1ZGHA 2KM1A 2OXEA 1J97A 2QG6A 5COQA 3UPUA 4IH9A 4QDTA 1ZRMA 3E9CA 4TQ9A 2CUKA 1E3IA 3D8BA 4RKFA 4BGEA 1GA6A 3EIWA 1R5NA 3JQBA 4HB4A 4XVRA 1E79A 3N2KA 2FW8A 1GCGA 3KJXA 4FKMA 4G5RA 3QU4A 5T57A 1NMEA 1IATA 4C2TA 1M8JA 5IZCC 3NBXX 1ZMTA 2B99A 1XRPA 4X90A 4YACA 5CDSA 5IJWA 3VKWA 4B6QA 4H6VA 3PNOA 4OSPA 2OKCA 3S44A 1NPDA 3JQ7B 1WIWA 4WZZA 4TVBA 4G8CA 2WF9A 3OCYA 3WIOA 5JDIC 2OL4A 1RI3A 2PX3A 2WJAA 4HAOA 1KJYA 1B6RA 2MINA 4JB8A 1E32A 1RLUA 4NDNE 3RLFA 2IHNA 4Y6OA 4O2AB 5DYGA 1T1EA 3PXGA 2YWBA 1Q1AA 4D9GA 2Q7DA 1FUIA 1PYOA 4TRRA 3V2HA 1OIVA 1U3FA 4NU5A 1TAGA 1WXIA 1YR8A 4ZDWA 1Y98A 1E9BA 4KB5A 2W6JA 4NYMQ 4ZV9A 2O1XA 3R6TA 4ZD6A 4UHCA 3P0IA 4RFVA 2MCFA 4YUVA 3W2GA 1KMCA 4E5UA 5B2FA 1ZCBA 1I4OA 2M6SA 5EXDA 2JZNA 5ALWA 1UADA 2YJZA 2YC2C 5AOAA 4CI9A 1ZGZA 2AYZA 4DNXA 2DBQA 3T5CA 3MS7A 1XCJA 1WWKA 2QRPA 1OAKA 2ODNA 3QPCA 1DKLA 1DINA 1IOVA 4UHFA 5T3YA 1L5SA 3IEPA 3WL8A 2Q62A 3DMPA 1TX4B 4FYIA 4JKOA 1RAFA 4JLMA 1GFSA 4MICA 5DOVA 4N48A 1GKYA 1TUEA 3IJRA 3U37A 1A9PA 4FOSA 3TGWA 5JH7A 4D2IA 1O94A 1QVZA 1KFBB 2VNJA 1Z28A 4IIJA 4E22A 2GCPA 3FIUA 4W5TA 2WJWA 3HU1A 3CSSA 4G0VA 4LX0A 1X7DA 3AR6A 2HLNA 1FUKA 1WB6A 3MINA 4LMBA 4R98A 5F98A 1PFUA 3H5RA 5JH7F 3AKCA 4PNPA 4IIJF 3FCCA 3BRSA 3QHAA 5C1IA 1L0BA 2A59A 1K7EB 2O05A 5DCWA 4EHBA 1Z4LA 2FZ4A 2PWPA 4MVJD 3VYSB 4WLUA 4PAWA 4RVUA 3WGMA 1QOZA 3EHDA 1GUFA 4XJSA 3C3JA 2F67A 2REQB 3PITA 3T95A 4Q7MB 5CR9A 2ZJ2A 4JASB 3ENWA 1TEZA 4Z9YA 1YB2A 4MV5A 3VTZA 3RK4A 4BLQA 1HE3A 3IDAA 1C50A 2ZJ1A 1OT3A 3B1VA 4HNAB 4MRMB 4CKZA 1OV6A 3WLHA 2G9VA 1DPGA 3UPDA 1BG6A 2JHPA 3DCJA 4BP9A 2FJPA 3LXXA 1SY7A 1YE8A 1M33A 2HXYA 1W93A 2HXGA 3KCNA 1UWCA 1O5TA 1T5TA 3HJNA 4P98A 3ZG6A 4KR6A 4EB6A 2JFGA 2C99A 1P8JA 2A5JA 2LIVA 1WXDA 4LSMA 2WYIA 4IVRA 3G49A 3H2IA 4BJHB 1MFZA 5KDOA 2XMSA 5DGTA 4Z9AA 5BUSA 2HUPA 5J40A 3ZLUA 4KPEC 4GIBA 1ZD9A 3U3ZA 2C95A 3GRVA 2A1IA 5JY1A 2GHTA 1R88A 4Z6KA 2X23A 1XBTA 1A1VA 2GM5A 1PT8A 1HDCA 2H1RA 5ER6A 2A5GA 2OG2A 1F5NA 1DCFA 5FP0A 4ASUD 1Z25A 3TI7A 1QNFA 3IOBA 2ZK7A 2D13A 2H06A 3EVDA 2P1DA 3FN4A 4MWCA 2YJ4A 3W7AA 1HQYE 2I67A 2ZAMA 2O07A 1FFBA 3GGGA 4UCFA 1JZTA 1HYHA 3U4CA 2ZTLA 1GUDA 1YZHA 4WBSA 4YCDA 3BWYA 4X6XA 3ZJUA 4R8KA 3I6QA 2ZZKA 1TPYA 2Z09A 5ECDA 3RIEA 2IXBA 2VHJA 1NHWA 3RC1A 1W8IA 4PC3A 2W2KA 4HG2A 4Q39A 4BNVA 4DXDA 2NZYA 4PR0A 4F6RB 3I2IA 2A4MA 4O0LA 1EWYA 5FHQA 3MUFA 4KO8A 4M8SA 1DKUA 1XLTC 2FH5B 2I87A 3OZDA 3SNKA 2AG5A 2HL6A 3I23A 3QXHA 2B3TA 3PT5A 5JBNA 3CCCA 4YMTA 5K3AA 5ITWA 3CUYA 4Q03A 5IWAB 1HNXB 3GCWA 4FYPA 4XB2A 4Z0TA 4XVHA 5KVQA 5DSXA 5EWLB 5FI5A 3RVRA 1ISFA 3T52A 1CUFA 2ID9A 1NVEA 1PGJA 1PJ3A 2I7DA 2V5VA 3ABQB 3MPUA 3OO0A 1W87A 1YJ8A 2H1VA 4RLHA 5DSZA 5FA5A 1DFIA 1J2TA 1R8SA 2I80A 3ZLBA 1TRHA 4TVSA 3WNQA 4OP3A 5MDHA 1AB6A 1KYTA 4M22A 2WHPB 3AEQB 1NDUA 5EE3A 2GK4A 3D6HA 3GJYA 1CQPA 3OUTA 4IEEA 4P4GA 4G5OA 4RPJA 2SKDA 4C6HA 3UMFA 3G8CA 1KTIA 4TKLA 2ZAGA 3SSAA 2GZRA 2HMTA 3JY6A 1HZZA 5CCBA 1N34B 2PZBA 2WVAA 2H7CA 3PGA1 5JE8A 1QHFA 4D92A 4FONA 1E7MA 2ZIAA 5FLKA 2ZS8A 4RHXA 1N2IA 3OPMA 2QM7A 3CNLA 1X7XA 5FNZA 4BVLA 5L3QA 2VJNA 1SIWA 3OWOA 3DDZX 4ZO8A 4BJ5A 5HUQA 3M6AA 3NAQA 4MS3B 1JR4A 1JU3A 2Y6VA 4F4UA 2YHSA 4ZI7A 5EJGA 3SLRA 4AZ3A 1CJVC 4QJ5A 1DG3A 3R4VA 4YECA 1SRQA 5B30A 4YAKA 4WOBA 1F60A 1Z6AA 5DHFA 4J0EA 4HDNA 3W77A 1KOJA 4PX2A 4PIPA 1K68A 3H9JA 1NIPA 4BATA 3JQAB 3PPXA 4URZR 5GAJA 2WFAA 3CZCA 1QZUA 4ZI7F 1KHTA 3BRQA 4MK4A 2R66A 2BR4A 5HF9A 3R9XA 3IPCA 4YI3A 4R01A 2HKIA 1E59A 4R0MA 4CEJB 2JASA 2OA0A 3LY5A 4JK3A 4J2OA 3N5KA 3JQQA 1H0SA 1E2NA 1S2NA 1ZCJA 2A9FA 2AQIA 3KHKA 4MRSA 5A7HA 1U7XA 4WXEA 2OSVA 5BW8A 4HXGA 4YR9A 1Y6FA 1Y6ZA 3CPHA 1FDIA 4EFLA 1UXIA 4ZCSA 5D3MA 1CZRA 1XTKA 2IYVA 4C6TA 1L4BA 1O97C 2Z9CA 4NZ9A 3AIMA 1ZOLA 2W90A 1XWFA 4RHFA 2OCIA 1DX6A 4BNJA 1MN6A 2UZ3A 4J7XA 3IAXA 4Y6LA 1PJBA 2H63A 4HD8A 4AQYB 1JKJA 2E1PA 1J33A 3ONDA 4LJ9A 5A62A 1MAUA 1U28A 2QAGC 2VSYA 3IUBA 4M8KA 4FVTA 1ODIA 4NOMA 4WY8A 3SS9X 3SIPA 3K9QO 2X41A 4DZRA 3O4VA 3KQWA 2RC6A 2Z2IA 3ETNA 5DYNA 2C4MA 2IP1A 1TVEA 2YYZA 1SVIA 2VZ8A 4UAGA 3H9CA 4WZAE 4CL2A 5FX2A 1AZLA 1BDIA 4V0ME 2OFFA 3GK3A 4XUEA 3RFXA 4JI1B 3ZW8A 3C4JA 4KIUA 3Q2IA 5C5CA 3PC7A 2WFLA 3E9NA 5DXAA 1E2QA 4B79A 5BXQC 2OVFA 5LNK1 2C82A 2XF8A 1XL1A 3DFZA 5AM2A 1ICEA 3CRNA 1WMDA 2RHHA 3OTOB 5K01A 1NVBA 2C77A 3LK6A 3MTAA 1JLLA 3ICCA 5KWEA 2WRZA 4LV5B 3UWOA 1QPBA 4F2DA 4UVDA 2X2FA 2XGGA 4D4JA 3V3TA 1YF3A 3DMGA 5CB4A 5JRDS 1U3GA 1ZNZA 3EC7A 3UV3A 4NZNA 4N76A 3OTGA 2PT9A 2ZS7A 1H2WA 2PV0A 3LPCA 3OCWA 4IUDS 3DB2A 3OZGA 4EUNA 2IX3A 1L4EA 2FPPA 1L7OA 1MUUA 1SVMA 3GA0A 3IPYA 4GR4A 4IJWA 4JB2A 4K1XA 4RCYA 5FWAA 1RPTA 3KYBA 2J85A 3U4IA 3UAGA 1Z2OX 1ECJA 4HH1A 5AKZA 2FJ0A 4ZGWA 2C2OA 1NW6A 3R20A 5CB4F 4FZVA 1FTQA 3LCMA 4UOZA 4OXKA 3P94A 4RD1A 1DL5A 3AY6A 3VX3A 1XLTA 4LZAA 1C9EA 5B7GA 4RORA 1BXRA 1M0WA 5L6MB 3R0JA 4NKRA 1GUZA 3KSMA 5EPEA 4ZPJA 1ZQ9A 1MX3A 5BYJA 1AGPA 2ERYA 4GMKA 4RGBA 1G16A 2IK8A 2XUAA 3HR8A 4OB6A 1MJ5A 3MQ2A 4NPHA 5AI0A 2PVSA 5LCXA 4JNCA 1PJ2A 4MWEA 1RYHA 2P2NA 4DIMA 3VI4B 1T1IA 1P72A 4HNUA 2N75A 5DGIA 2CHVA 3R3YA 1QKKA 4J3NA 1XTUA 1FYVA 1TECE 2DUNA 2NQTA 4DV3B 4BP1A 4HUQB 5NLLA 4OI2A 1QTQA 3HCOA 2O3TA 3SHVA 1VM6A 1TKAA 2PQMA 1OA1A 4U2KA 1NIJA 3NDJA 5IT0A 2IS1A 5T4FA 4BE7B 4J1TC 1M5RA 3AOEC 3EMBA 4KLAA 1KQOA 5YASA 5BWBA 4WBXC 4Z4EA 1H9BA 2PDAA 2IP4A 3EF1A 1UM9A 2DEUA 4HFRA 4RE6A 3UAOA 5BWNA 1FJGB 2NUPB 2WKRA 1BHJA 5K0BA 3GWZA 4Q82A 2OCLA 4Y1RA 4NVRA 2CLLB 3G13A 1P8AA 1JKIA 3ZWNA 4R7ZA 3G2MA 1J06A 2HWUA 1VL8A 2O1SA 2XECA 4NFSA 4ND8B 5FR2A 3TE6A 3W3AH 3WDMA 3I61A 1IQ0A 3H0EA 3P7MA 5CLIA 5F2OA 4GZMA 1E5TA 4GNKA 4EG1A 2JLUA 3ICQB 1FXSA 1XVTA 2PTGA 4FUTA 3DLAA 1B3BA 2R25B 2HT6A 3OIFA 4JXKA 2ECOA 3P2YA 2NVUB 1JQ3A 3NKLA 2WB4A 4ME6A 1YCGA 2CZCA 2ORYA 3SHOA 3M70A 4YR7A 3AG5A 4MVJH 1ILEA 3DBLA 1UKAA 2HJSA 2J5XA 1PW7A 4MSUA 3RIHA 1KZYC 3K16A 3TJRA 1MJHA 1OW3B 2ZBGA 3RV3A 1F7VA 2EFGA 2CLEB 5DYWA 4V0NA 16PKA 2VNIA 4P7FA 3CMMA 3K9CA 3LRTA 4CM9D 5BN4A 3AVPA 4FOOA 3S8EA 3R9WA 3O9MA 4I50B 1OI2A 4LFAB 4QUGA 1ABEA 1U0FA 1WZEA 4G1EB 3ES9A 3GLHB 4Y2VA 3ER6A 1YQGA 2R62A 1F8XA 1DAEA 4QLBA 1JG7A 4L3OA 3C3YA 1W85B 3Q4GA 5JSUA 3DCNA 8ADHA 4F9GA 2W93A 2XQGA 2XMRA 4YT4A 4J0DA 1QNLA 3ADDA 4IXNA 1UBGA 2E4AA 3AR2A 3EYAA 3ODPA 4UBOA 4CMCA 2CSXA 4F60A 2YMQA 1ONNA 1PFVA 2A94A 1VBKA 1GFWA 4P0PB 3FHTA 3IODA 3QIAA 3GCGA 4I1YA 1NJSA 3P2KA 4MAFA 5GGYA 1E64A 3CG0A 5UKDA 4DCUA 5HKAA 2VWHA 1Z73A 1JIIA 1QHEA 3LCCA 1QO7A 2HNBA 2OBNA 4GI2A 5FTJA 5KOHB 2QK4A 3AUFA 2BKLA 3NBAA 1UKEA 3MWKA 4A26A 4EYOA 5CAEA 1QTNA 1RJFA 4BQSA 5JPDA 5IJAA 3I32A 3GXBA 5AK3A 3HHEA 4PZDA 3W6OA 3I6ZA 3QF7A 2FU5C 3AGQA 4KO1S 4H16A 4Q1AA 3ZXSA 3WBKA 2Y0BA 1S2DA 4FCVA 4LDRA 3UNXA 2XQIA 1KEZA 1HG1A 4XLLA 2FR8C 2FZ5A 1XVVA 2V4ZA 3PF8A 3R40A 1W5FA 3FGPA 3PEFA 3RUEA 3TRJA 5D5QA 3SP1A 3EVNA 4RF3A 3SF8B 1BCSA 2OV8A 4AS2A 2IE0A 2V3VA 5H68A 5IC4A 4X8MA 1HNNA 1XDDA 2UVDA 3MC1A 4V2IA 1IXZA 4OQ4A 1X15A 4MRAA 2C98A 4S1VA 2QAGB 4IIXA 4GXNA 1X1EA 3JQ8A 1YDWA 3NP9A 2GA9A 5F73A 2HR1A 1YL7A 3GHYA 5ALKA 5JZOA 2HM7A 1PFKA 3NEJA 2C2KA 3AZOA 4QU9A 5P8WA 3AP2A 5E3JA 4CV3A 3FW1A 4FB4A 5FH9A 3W7BA 2GASA 3CLUD 3HC7A 3O3MB 4IV0A 4M0DA 3V42A 4BFSA 1ZN9A 2VXBA 5AVXA 4GAEA 5K8CA 2BBOA 5J3JA 2Z3WA 4D3SA 1P4SA 5DU2A 3R7LA 4UBNA 2QR2A 1Q7GA 2DHQA 3NV9A 1UP4A 4JGIA 5HS6A 4XGRA 3WWCA 1H4TA 1MH1A 4ECEA 5E4JA 1KZ9A 1CY4A 1QLHA 3HLKA 3KQOA 2J3MA 5AUNB 5I8ZA 4XWKA 1DOAA 1RXYA 3BN3A 1HNWB 1PNVA 1IZ0A 1RXSA 1SC4A 3SG0A 3V8RA 1TCVA 2IPOA 3WLIA 4FEGA 3CO5A 4MQLA 3DVSX 2G76A 2VBIA 3MIIA 3OP4A 1A3CA 4RH1A 4UAJA 3TL6A 3DEZA 4I4CA 1KC3A 1SC3A 4PANA 2NU6B 1J8MF 3LKVA 2WF8A 1TMYA 4Y3UA 2RI0A 2VFAA 3GPLA 2R1TB 2HK7A 2SCUA 3EXFA 4ZYWA 3W78A 3Q8XB 1T6YA 3A10A 1M1UA 1X80B 3P0FA 4HAZA 1NVTA 5G1OA 1XG5A 2AXPA 2HF7A 3LA8A 4OA8A 5I4IA 2ACWA 3CKMA 3BHIA 4N3GA 5A6SA 4NAUA 4L9RA 2YMLA 4AKSA 4J1TA 1H3FA 3HUUA 2FZCA 3AOEA 1REQB 2CNLA 3OPXA 4LBVA 5AW5A 3ZVRA 4EUSA 1SHZA 3GDGA 4KIJA 4Z7JA 5DCLA 4AX4A 5G4LA 1W19A 4GOXA 4QXMA 1Y7HA 2IPLA 2BKXA 3RSHA 1NUAA 1NKTA 2QMUA 5I45A 5JATA 1YQXA 2AX3A 1KORA 1N8SA 4DDMA 1DPFA 4UEJA 2PU5A 2QY6A 3L06A 3QPDA 2ZJ5A 4BHTA 1E1QD 3OEED 3F7OA 4X3CA 3OJ0A 5CVTA 3H5TA 5HHTA 3W5DA 1FNNA 3OC6A 4M86A 5IDVA 3DXFA 3E03A 5KPDA 2XCTB 1KYIA 2JVIA 3I73A 4QU8A 2LZ0A 3ROXA 3AEUA 3FCEA 1DAGA 1XKQA 4M36A 4R16A 2IYTA 4XW2A 4LKOA 4ZJZA 1WDTA 2ZWPA 3FNFA 5BV8A 1Z6GA 3LUCA 3FMVA 2P7IA 2XCLA 2CMKA 2FKAA 5EE5B 2PMEA 3IUEA 4CL8A 4XDYA 3QOWA 4MUMA 2F3SA 1TI7A 3HYNA 3S28A 3KE9A 1JG4A 2QTFA 3G5TA 3TECE 1N8TA 3C39A 2IJGX 1G21B 4B6PA 3NOOA 3I2JA 2X0IA 3S55A 5HCUA 1YH3A 2VHQA 3V2GA 1P6UA 3PQDA 4O4JB 4CCYB 4EJSA 4QGSA 3QEBZ 4CMIB 4LPSA 4URYR 1KO5A 4IW3B 3T0GA 4PHHA 3KQHA 4EQ6B 3BDAA 3VDNB 5F9FA 1PDVA 3H18A 1DZ3A 3G6KA 3FSGD 1USWA 1B3RA 3L43A 4KYUA 1W6RA 5DLDA 1Z36A 4LDAA 3WVNA 5AO9A 1QHYA 4FJ0A 4MWGA 1SZCA 3SJZA 4DXAA 5EMJA 4CEHB 1M73E 2PZKA 1TFRA 4UU0A 4QGHA 3H05A 5LD2B 3KJHA 1SBNE 3FTFA 4MQUA 2FPUA 4Y67A 3LPDA 2HQSA 3CTPA 4IMRA 4O25A 4I5EA 3WIDA 1JPVA 2WJYA 2OUIA 2PCJA 4B34A 2AFIE 1IZ8A 3M6LA 2UYQA 1AHPA 2XAAA 3F6EX 2O8DA 1RNLA 2V7TA 4ZQCB 4FYMA 4ZAXA 3WWDA 3HZRA 1Q16A 2EFDB 2O23A 3B1KA 4CLEA 1GUYA 2BD0A 2HH9A 2KYRA 4G0WA 2OORA 2HA3A 1QG6A 4N5NA 4M7RA 1L4YA 2FTKE 2QTNA 3ZE0B 2AE2A 3FVWA 4NP6A 2A9KA 4QICA 1EHCA 4UMDA 1ZMRA 1EA5A 1JR3D 2DHEA 1Q1GA 4IIDA 4JZYA 4MVCA 2FR8A 2XZPA 4FC7A 4OHYA 3PB3A 3SC6A 3QLUC 1BHO1 2ZREA 3OPVA 4FFBA 5CM2Z 3D4PA 4D4IA 5I48A 3K70D 4C2BA 5LOVB 3O2NA 3V9AA 4I8DA 3GG9A 4MGKR 4RZSA 4N7MA 3TOXA 2GPBA 2ETXA 4TSFD 3RLIA 3DZKA 4OA5A 4XQEA 1U9YA 4P8RA 1XTRA 4QXAA 3MT9A 1YDFA 4IYJA 3UKJA 3N6XA 4AQDA 4UREA 2JGMA 1WCV1 4TT3D 2I62A 1O8CA 5ALJA 3TL2A 3V7UA 3IDSA 3ZKWA 3RIXA 1AZWA 3I1YA 1W48A 4MX8A 4RQBA 5GONA 1LD3A 4IGKA 4EMUA 3HK2A 1AF7A 4EJ0A 1VJGA 4P0TA 3DCYA 2IRWA 4HOYA 1DBSA 2ZS9A 1ZEMA 3AQ4A 3GP5A 2WUVA 1O8BA 3NKVA 4NC9A 3GUUA 1X14A 2WDPA 4M0LA 2JIQA 3TRKA 2D2EA 3B5JA 1CEYA 1JF8A 3IO5A 2QRVA 1CCWA 5GONF 1NMXA 1TMGE 4PM4A 4X20A 4ARAA 1O4VA 4A2PA 2BM9A 2VRCD 4RJKA 3TIXB 3LP5A 4YRBA 3WA7A 4BAZA 4BMDA 3U7QB 2WTEA 4G5XA 4E11A 3EA4A 1ZZGA 4EL0A 2XBLA 1T2FA 1N5MA 2WD9A 2K2WA 1AS3A 3L7IA 4KJZA 4P58A 1P17A 2JBAB 1FLDA 4DUGD 3RRFA 2B69A 1F06A 1GVHA 2V58A 2PIDA 3MD9A 4GMXA 4WTOA 4BRZA 1QUEA 1WABA 2WE8A 4YJDA 1AQUA 3J81k 1OE0A 3QEJA 3DTVD 4Y0NA 3BJEA 4K9SA 3UTDA 1LPOA 1V8ZA 3GH1A 3GW8A 4K6OA 1IXRC 3L84A 2Q0HA 1K0FA 3RKRA 4JFAA 4JI5B 1LJUA 3R8XA 1SEPA 2VJDA 3UMBA 1JG6A 3ZNQA 4AQ7A 1O54A 3C8ZA 1EFVA 5FCDA 5AK5A 2HO4A 4NMHA 1B1CA 2IL1A 2P9JA 2PLNA 3FWYA 4QUBA 4DAEA 3L4KA 3NIWA 2P0EA 1GA4A 4O29A 4XI9A 3DMRA 3FWNA 1XVUA 4QDKA 4ZT5A 1FVHA 2YBDA 1FSZA 1NNEA 3DPUA 3PRHA 1ZCFA 2CFOA 2P9BA 4QPJC 1J2EA 4QDUA 1WZNA 3CZRA 3PPIA 2SECE 3HFJA 5EHIA 3X1YA 3EPPA 3JALA 3FZGA 2VPXA 4DYHA 1VBMA 1W52X 3MLEA 2MYUA 3CE6A 4Q3NA 1E3SA 3PFHA 1GR0A 2I3ZA 4DCNA 4MUFA 3OJXA 2YHBA 1O96A 2B5WA 1J1IA 1Y4DE 1RLJA 3LDGA 5AK4A 5LZ8A 4BTEA 4YMWA 4F04A 2H59A 2FUNB 4M9CA 3L9XA 4O8ZA 4CKWB 4K9OA 2O0KA 4R05A 4MUEA 1ITZA 2RGEA 3ESDA 4XTCS 1CJSA 1R0CA 1ULSA 2RHLA 3B8EA 2RB4A 3JPWA 1A69A 4GQBA 4L6AA 2BBSA 1VE3A 3LZ6A 1SBTA 4D96A 4OQXA 1S3GA 2WAXA 2PO7A 3Q9NA 4HEA1 4DABA 1T4BA 3A4TA 5B58C 1JE1A 2C3PA 2LCIA 4OFZA 1DMSA 1UJ2A 2JCSA 2Z2YA 1GQQA 4LYAA 3REOA 3VOBA 1VHLA 1EGVB 1Z5WA 2AFHB 2B35A 2BJHA 1GILA 2PCLA 2XD4A 1NXVA 2XEXA 4Q3BA 4QNMA 4B6RA 1EUYA 1N4AA 1GSOA 2FMKA 3NWEA 1EK6A 4AFNA 5C8DA 5KBYA 2K6GA 5DCYA 1G3IA 4PLPA 4P3NA 3N74A 5LZ5A 4ALIA 2QU7A 1P0PA 2R8XA 2WY2D 2JK0A 4FE4A 1IAVA 2NNLD 3PC3A 5A5GA 4LOAA 3PWTA 3PRKE 2C54A 2VF5X 1G8GA 6ABPA 5LSAA 1DDIA 3ILVA 5CURA 1ES9A 2HWYA 1YUNA 2VJAA 3NRCA 1ETUA 4XX0A 2W48A 2UUOA 3BWXA 1QOQB 3VPHA 1X1QA 4X9XA 2PRZA 4A0GA 2V6GA 3E5HA 1MCZA 3N8IA 2FEOA 2H1SA 3JARB 2I3AA 4LZJA 4MYRA 4RMJA 5AJYA 4KV9A 2KMLA 3N7UA 1WULS 2HWKA 3UAZA 1L7AA 1Z34A 4AJEA 1LBQA 2LDXA 1F2TB 3GFGA 2NU8B 5DM60 2YNMC 1ZR4A 1U9CA 3QLUA 2IUEA 3IPAA 4TKVB 4NCNA 2OBLA 2VZLA 2ZZMA 1T0BA 5K0FA 3OUUA 4MKIA 5JSFA 3T94A 4ZODA 5AVQA 1PTKA 2XOXA 2J3DA 2B6HA 3BJZA 4NOKA 1YAHA 1G1MA 1NE2A 1SUBA 1UCFA 3FTPA 5CITA 1Z4QA 2MDTA 3DKPA 3ML1A 4ZYLA 1U1DA 1HDGO 1E99A 2XB2A 4AMUA 1U3UA 3K5IA 3HRIA 2YYYA 2H54A 4G5SA 4H4CA 3WKBA 3AU8A 1IBSA 1K27A 1XZGA 4B35A 1XI2A 4RO0A 4BNDA 2PYZA 2Y3IA 3LNCA 2ZVJA 1XXLA 4XRGA 4UUPA 1T29A 5GTDA 1YR9A 4WKCA 2BM0A 3F3MA 2ADFA 2EXXA 3RBZA 4I3HA 1I13A 1TUBA 2NZXA 1IK6A 2XZDA 2WA2A 1XE3A 4IIYA 2W6CX 1VA5A 1CIVA 4B3TB 1V1JA 3K2BA 4XCQA 5ALRA 4IG4A 2FUCA 1M2VB 5KNLA 1ZVMA 3G0DA 3FF4A 4ZVOA 3CWZA 1CRQA 2O3JA 3MUEA 5PNTA 5DIFA 2QRHA 1LDEA 1DUSA 1QP8A 3K9WA 5LXTA 2QGZA 4JXJA 2AQHA 3GRFA 1SCJA 3ZW7A 2J59A 1I3NA 2ILVA 3TBHA 3FUWA 3U1TA 4QPZA 3VGJA 4B9AA 1P5HA 2D2VA 1G4AE 1IHYA 1TQ4A 3P2OA 4O1MA 2ZBFA 1NLFA 4EHAA 3VM6A 1WF6A 3KPVA 3UJ9A 4GOOD 4E46A 4X3OA 3NVDA 4L3VA 3WRVA 3BGWA 3Q2KA 5LXTF 3KWMA 2ID8A 4FEYA 1JZSA 1PJZA 1U2GC 4OLFA 3RS0A 4BE9A 4IIGA 2XT0A 4RZXA 4GPEA 1N8NA 1UZAA 4GZLA 4YAOA 3P0EA 5ECGC 1P31A 1QXSA 4BDSA 5KDDA 4MMYB 2YXEA 1R0ZA 1CB0A 1XMIA 3JATA 1SUIA 4U7JA 1GL9B 3R1IA 3PPWA 4OHRA 5LL6P 1X77A 3MWDB 4Z1OA 1SD5A 3TX6A 3BD9A 3V7WA 3F47A 3S3TA 3D5QA 2HZBA 3DMTA 4BEJA 3SYRA 2DR2A 3F8TA 4PYMA 5EINA 3ZZMA 3EGXB 1MRSA 3KBBA 5CDGA 4OX9B 3LUBA 2VHTA 1P1HA 4D9KA 5LB4A 1I8TA 1ULUA 3WNDA 2HWXA 1O9HA 2AIRA 1KH3A 3EPRA 4HSEA 4K2AA 5EAIA 3D4IA 2HEGA 3DDUA 4AICA 1W36D 5FNVB 4QT0A 1EVJA 4KPFC 4S05A 3LTNC 2EF1A 1TCCA 4M7PA 3IAM1 3AJ8A 3LSTA 4ZICA 2FMFA 1PEAA 1XCLA 2WTAA 3K20A 4IPTA 3GRPA 3Q0TA 1VE5A 1AUOA 2Q1TA 2XYRA 2XT6A 5E8RA 1Z08A 1KL7A 3WGLA 3ZZ1A 3IE2A 4D44A 4XASA 3A28A 3P32A 1U9JA 3OZWA 1J0CA 2XUFA 3SE7A 2QE7A 2J9RA 4JLAA 4PSUA 4M9SA 4DB4A 1L1FA 4YMGA 1R0KA 3A8TA 3K2IA 2QRQA 1NL3A 1YRYE 4N7JA 4XCXA 3QEMB 1LDNA 2NO5A 2XDAA 4K7JA 3LYAA 5IMSA 1Z06A 5B36A 2BKEA 2Z6QA 1VI5A 1E5QA 1YK0A 4F96A 4IG9A 3NIGB 1VHJA 3A1SA 4URWR 4O2BA 4D3XA 1DJPA 5A9TA 4L02A 5H0IA 2QF7A 2QN3A 5LQKA 1XA3A 5T8KA 1IBMB 1OHHA 3EOBI 4UDYX 3RYCA 1YMUA 5TMEA 1FNSA 4OBEA 5HG0A 4WLOA 4OIFA 1EI9A 1JEAA 1V6AA 2NZ8A 2C4NA 3L4BA 1NRIA 3B9RA 4ZREA 4ZVUA 2QX4A 1QDLB 2R6FA 1A50B 2WM8A 3AI1A 3GEMA 4Q4JB 1CY1A 1LFAA 5JAQA 3SQWA 1YB6A 3TD9A 3TFQA 3V1NA 3GJ8A 3Q7IA 1XZHA 2Q5IA 1G55A 2YNMA 1EG2A 3SY8A 3SS7X 2CWWA 1N9GA 1OQAA 1QU2A 4C7VA 1ZK3A 3MS4A 3T7TA 2GTPA 3CUKA 2P9ZA 2Z4RA 5MHTA 3WIVA 1LVHA 3BHJA 1FLAA 1M5UA 1P7WA 1Z5UA 2QQEA 1MNQA 4NZMA 4QOJA 4A0QA 3ZJYA 1B43A 2ECPA 1RWPA 4JL6A 4QQKA 2FUKA 2PBFA 2C4HA 3TEMA 1A96A 1ZH0A 2ZIXA 4RDHA 1A8IA 4LF7B 1SG6A 2VR1A 4AP9A 1QR6A 2MMCA 3QLVC 1DADA 1QJCA 5G1PA 5K51A 1N2SA 1LI5A 1Y42X 5BR1A 1VLVA 4QHSA 4BB6A 4GM4A 3HB1A 4Q9LA 2MR5A 2IXEA 4L72A 2P6NA 5A1TA 2R751 2NOAA 1T8PA 3GPBA 4QFCA 4RNCA 5HIMA 3UGJA 1W88B 4RDCA 1ENYA 1ZGGA 3DE3X 3K4HA 3VPXA 5DK4A 5HX7A 3HCAA 1C0KA 3BL5A 2COEA 1L4HA 3GQBB 1RRGA 2ZKIA 3H99A 3JQPA 3K0HA 4KE8A 1FP4B 4LDJA 1F8GA 2ODQA 5U4XA 4HTFA 2HHCA 1T91A 4EA6A 2KI5A 4FSHA 4IDFA 4KZPA 4OQDA 3NWPA 4UEOA 2VDNB 5K3SA 3T12A 2XVYA 4EG3A 3PQ3A 5TQ2A 2QN6A 3GGSA 4I1UA 3ZWVA 4MUGA 3I2FA 1SA0B 4BNZA 1XZFA 2AA3A 1LV7A 2Q0SA 2YJ5A 2C2MA 4OOFA 5C2JB 3BF8A 3ZXYA 3HV2A 1XD8A 3FPKA 1U0RA 3IAHA 3L7NA 4BN0A 3HDQA 2NSLA 1K97A 3BX1A 1CR4A 4MA0A 3M9XA 2HC9A 3D6MA 3WE7A 1NBIA 4IQ4A 1EKXA 4XB1A 3G8BA 3BL6A 4JEHA 4BO9A 4YONB 3VGPA 3K0SA 1O2DA 2CVOA 1E7QA 3IPXA 1UMDA 3UJPA 5LYJB 1K89A 1S8NA 5DLYA 2GPAA 2XHZA 4I4TB 4KQFA 2I4IA 1TU3A 3TLXA 3ZXXA 5IDQA 5J59A 3QGMA 3U13A 5J4LA 2IYRA 4LE1A 1E8MA 2WUGA 2I65A 1JFVA 2HLDD 1KEWA 4KRXA 4ENUA 4PXSA 3A26A 2EZUA 3ZBTA 5TSDA 2NTVA 1V8BA 3H4TA 1MDFA 5J4HA 2FR1A 2Z9BA 4E5PA 4O1HA 2OYCA 4M87A 1QIMA 3VNRA 2F1OA 2Q5HA 1C9MA 2O6HA 3G2PA 4M1SA 4F5ZA 3JYPA 2DGDA 2BGMA 1YQUA 4EF6A 4B5LA 1II9A 5JJKA 2YYAA 3LY8A 4IIFA 4ESOA 3IDZA 3ZS8A 1APBA 1QU3A 1G7SA 1W8DA 2WJZB 1EZ1A 2MHCA 3U7JA 3DZ8A 1BGXT 3Q7QA 4BQPA 3NBZC 1IVYA 3OLYA 1UJ5A 5I9SA 2X5XA 3CRQA 1OX4B 3B52X 4B74A 3K73O 1E61A 1SVNA 2DBVO 3MRXA 4P80A 2H2FA 2QX7A 5DW0A 3CF0A 2RH8A 3SPXA 3OFJA 4YCCA 4OI0A 2ZPTX 3EXAA 1TYZA 3H5VA 5CG1A 1QF6A 3A70A 1U2QA 5EJ5A 1PTJC 3BBLA 4GI3A 4C3ZA 1YI1A 2Q3HA 3S70A 1OWMA 4F12A 4YCAA 1T15A 4P6VF 4XYLA 4YX9A 5KTOA 1T3HA 5F1YA 1JXAA 2PLFA 3JZDA 2VJPA 3DVAB 4BO7A 3WLJA 1E4EB 4EITA 1RJWA 2FWNA 4O6VA 3QXCA 5IKPA 1FYFA 1D2CA 2O7RA 4PLYA 5KNCA 1GTJ1 1JB9A 2I7XA 1OIXA 4PVCA 5I7AA 1I9CA 2AHRA 2Y1XA 1J8VA 4PHGA 5KYTA 2X5OA 2B4AA 2YXPX 4MYTA 4GWLA 1NZFA 2HBQA 1Q3TA 3GY0A 2BCEA 3PJDA 1R10A 3QVOA 3CO0S 4PONA 3QM1A 2OV4A 3DLHA 2HBYA 5GY7A 2I2FA 4KPUB 1S6YA 4O4IB 1Z8NA 3IVGA 3UK1A 5HTOA 1JWLA 5HOEA 2A3NA 3KR1A 1SHUX 5EKTA 3F9CA 4EENA 2VSQA 3TOVA 3TRFA 3A3NA 3TRHA 5CDTA 2G04A 2OLKA 1KZ1A 3QKUA 4BX9A 1SEVA 3EK2A 3FCAA 2BDTA 4U7HA 4UARA 5I7OA 4F97A 2O2GA 1ADJA 5FB3A 1Y4UA 3T3PB 3UXMA 4B5KA 1QQBA 5ES3A 1GJRA 1HWYA 2YV4A 2H18A 4IMPA 4KXLA 1XJCA 2EIHA 4CL0A 5AUQA 3W3ZB 2F1JA 4L57A 1G5TA 2WTMA 4MULA 4Q4AB 1MB0A 4AI6A 3CEMA 1CUVA 1G7CA 2CY0A 1CRPA 1FVFA 4LW8A 2C03A 3PR3A 1UFKA 4HADA 4GSLA 2XVXA 4GBJA 4KK4A 2B8WA 4YFYA 4ALJA 4A2QA 1LK7A 1DEKA 1A82A 3FMGA 3GFSA 5FOXA 3A4VA 2JIZD 1KZGB 3QA9A 3AETA 3VX4A 5ES4B 2X22A 1LF5A 1R37A 1ZD1A 3PUHA 4KSCA 4MHOA 4MWTA 1U63A 2EJCA 1Y4ZA 1WZIA 3FFBA 3FOAA 5EZQA 5KYWA 2PZAA 2ATEA 1VPLA 4XARA 3I5XA 4DV2B 5K1ZA 2VF8A 4E1VA 1MAWA 2O8BB 5LFAA 3Q8LA 1O87A 3EWIA 2OBMA 421PA 2IOHA 5TEWA 4WXYB 3IJ5A 1QRDA 5IN5A 2Q0QA 1RHQA 1M0SA 1R16A 4BKUA 4GOLD 1DRWA 2C1ZA 5KIAA 1Y3IA 2XJ4A 4LQDA 2BMJA 5KB3A 5DIZA 4F71A 2POQX 3L5OA 4IAOA 1BHSA 1YC2A 3ZHYA 1HFEL 1TKBA 2ZATA 1EG7A 4Z3KA 3UJHA 3GAZA 1GPJA 4MUHA 1TCBA 3R0QA 3IT1A 3M9WA 3GDHA 3BMQA 3O5AA 4D9BA 4P0QB 2ZVPX 4B6JA 2OMEA 3KQPA 3TZCA 1D1TA 5CDUA 1NW5A 2AR0A 1QIKA 4RVGA 2B1RA 1YGYA 3QVKA 5A71A 4CODB 5E7JA 1PGNA 2JAPA 2FWAA 5FOVA 1RLTA 2QTMA 2H29A 3COZA 2FW6A 4OV6B 5H83A 3UY4A 1NP6A 3ISJA 1T3ZA 2AN1A 5TMPA 1V1MB 5E9JA 3SJUA 3CNEA 2WG2A 4I1OA 1CY0A 1TK2A 1ZGAA 2HMWA 3OKAA 4AWXA 2G5CA 5K03A 1EEXB