4DGSA

The crystals structure of dehydrogenase from rhizobium meliloti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
307
structure length
277
Chain Sequence
LLLVEPMMPFVMDELQRNYSVHRLYQAADRPALEAALPSIRAVATGGGAGLSNEWMEKLPSLGIIAINGVGTDKVDLARARRRNIDVTTTPGVLADDVADLGIALMLAVLRRVGDGDRLVREGRWPLGHSPKGKRIGVLGLGQIGRALASRAEAFGMSVRYWNRSTLSGVDWIAHQSPVDLARDSDVLAVCVDASLLQALGPEGIVVNVARGGTIAGAGLDVFVNEPAIRSEFHTTPNTVLMPHQGSATVETRMAMGKLVLANLAAHFAGEKAPNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase
publication title The crystals structure of dehydrogenase from Rhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 73
structure length 277
sequence length 307
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dgsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dgsA01
3C7CB 3RBVA 1NWHA 4L73A 1XIVA 2NTJA 4OOFA 4BNHA 1Q0QA 1QXSA 3T4XA 4Y9DA 3LSYA 4FJ0A 2YHIA 1KEUA 2RH8A 4P4NA 1YQGA 4CQLA 4A03A 4HKTA 5A4DA 2O48X 3VPGA 2QRJA 4Z9XA 4Z3KA 3WJAA 3AM4A 5IZ4A 4FC7A 3OQ6A 4PLGA 3R0IA 3KRTA 5L4NA 5EQDA 1EVIA 4PZCA 5EINA 5CDUA 4XQGA 4LCJA 1TA4A 5EESA 4FSHA 3HQ4O 4QT0A 5TF4A 3GT0A 1XHLA 4UVGA 3RFTA 3FD8A 2FOIA 1DJQA 3RUAA 2VHZA 2I67A 1EE9A 5B12A 5LDGA 3RBZA 4DQXA 5BR7A 3CIFA 1G1AA 2VYNA 1LSOA 1SBYA 3TDKA 4P8RA 1KVRA 3HDHA 2VUTA 2A35A 4FFMA 3T7EA 1GQQA 4RLSA 4IXTA 1OFGA 3K5PA 3WQRA 3EVNA 4M86A 5DCYA 2WE7A 3GF4A 4J4TA 3MJCA 1PJ4A 2D2IA 3H3FA 4MVJI 2WE8A 3AOEC 1DOHA 5L95A 4D41A 4E6PA 3ZHZA 1BDMA 1QKIA 2VTEA 3KO8A 4GWKA 5F1PA 4MP8A 1LA2A 4M8SA 1F12A 4KDFA 3CTMA 4URFA 2PFGA 1ENPA 1GY8A 1B16A 4IDEA 1Z7EA 3BMQA 1Z75A 3VDQA 5TQVA 1GV1A 2VWGA 3MTGA 3KOUA 3LF1A 3G49A 5U9CA 2BFMA 4LSWA 5COQA 5FF9A 2DBZA 4LRSB 1GEGA 3JQ8B 3WWZA 5G0TA 4CMBA 3EZYA 5TSDA 4CMKA 2J5QA 2RAFA 2I9PA 1RM3A 2H5LA 4LVCA 3H8VA 4ZQBA 5CPFA 1VM6A 3QVOA 1DIHA 2NNLD 3GEMA 3WGHA 4CM9D 5DBGA 3ZWYA 1YE3A 2Y1EA 4DPLA 3GGOA 1E3WA 3TOXA 4PRKA 1FDTA 3ANNA 3WS7A 3DOJA 4D42A 2RH4A 5DOZA 4B4WA 3W8EA 3V1TC 1IB6A 5IAAA 1SAYA 1XA0A 4ND1A 1XQ6A 5F3RA 2DC1A 3I9KA 4JJGA 2V65A 4NFYA 1ZSNA 2O3UA 4WLNA 4AJIA 3FHLA 4R41A 4IDGA 2EJVA 2GF2A 4AJNA 1RM4A 3GEDA 4BVAA 2PWZA 4Q3DA 5A03A 1YRLA 4ZGWA 5JDIC 3D3EA 4M87A 4TQGA 5AYVA 5CFZA 5LCXA 4IS2A 2Z1NA 4FC6A 1G0OA 1R4MA 1M6WA 4GX0A 3T4EA 4TVOA 3DHNA 4YVFA 3C1OA 1OC2A 2WSBA 4I5DA 1W8DA 3QWBA 3GH3A 4IJUA 4BGEA 5BSGA 1UH5A 4UEJA 4YPOA 2PNFA 2P4QA 2UAGA 3GG9A 3LQFA 3WQSB 5KVVA 4DWVA 5U4QA 1VKOA 4EZBA 1HDCA 1YS4A 2Z5LA 4FJ1A 2CF6A 1I2BA 4CM1A 4R1TA 4IDBA 1SO8A 5JAQA 4BO7A 3NT5A 2P9CA 2E49A 3AUSA 3VVBA 2WDZA 5A02A 2EXXA 3H4VA 5CDSA 3WGIA 1U2GA 1HE3A 4DQUA 4FFOA 4KP7A 4S1VA 3WLFA 4HBGA 3WGOA 1SB8A 4E2XA 3FTPA 4R9SA 3E9NA 1EE2A 3D5QA 2AEJA 3HN7A 4FOSA 5ER9A 2Y0EA 1RM5A 5DT9A 1B8VA 3PHLA 4IJWA 4TRMA 4CM7A 1GZ3A 2C29D 4L0QA 3IKVA 2OMEA 5B1YA 4TRNA 4E5KA 4XA8A 4E5PA 1BXZA 3JQGB 4QO7A 4KQXA 1ZW1A 2UVDA 3F1KA 4ZQEA 4L4RA 3PIIA 1E5LA 1HYGA 4QTZA 1HDYA 1Y5RA 3ZV5A 4J91A 1FF9A 3K2BA 3OECA 4P22A 5THQA 1Q1NA 1P9LA 3BTSA 1O5IA 2F00A 1JKIA 2NSDA 1DIGA 2X22A 3IQDB 4ND4A 4DL9A 2QZ9A 4O6VA 2PD3A 1GL3A 2PZKA 3FI9A 2G1UA 4DBVO 3B1KA 1A9ZA 1IZ0A 3KB6A 3AWDA 2PK3A 2Y1GA 1DEHA 1JDJA 2ET6A 3UN1A 3I52A 4OKIA 4ILKA 1P31A 3ETEA 3CKYA 4E4YA 2WYWA 2Y1CA 3GNQA 1ZK0A 1Y1PA 4OQZA 4BO8A 3QWAA 4A7PA 3C85A 1LLCA 3Q3CA 3ENNA 4YQZA 3CMMA 5DN9A 5DULA 1N7GA 3GDGA 4BB6A 5LC1A 4HNGA 5AQ1A 1PR3A 5I8ZA 4BNNA 3HZZA 3ONDA 4A5OA 1P1IA 3OFSA 3ZNQA 3DMTA 3ITDA 4UEKA 4BO5A 1MLDA 4M89A 1B7GO 1E7QA 1IHXA 4CLOB 3GRKA 4BIIA 3GNTA 4MVJD 3DBLB 4QECA 4FD3A 3KLMX 1LBEA 4CM9A 2BH9A 2UV8A 4RZHA 3PXXA 3WXBA 2AE2A 4E30A 1R0KA 1G6KA 1L7EA 4K28A 4XYGA 1ZK4A 2QIOA 2OP1A 4EGFA 1U28A 1WP4A 3WMXA 3TNLA 3ULKA 3F6YA 1YB1A 3S2IA 2GPTA 3DAPA 3SX2A 1TI7A 2YDXA 3BTVA 4RPGA 2EIHA 2CVZA 4CMAA 2UUPA 4IMPA 3U3XA 2FN7A 3WIEA 4PZEA 4Q3AA 3IL2A 4YYZA 4AVYA 4JJIA 3FRJA 4YCAA 5A9TA 3ZW9A 3GN1A 3G17A 2C5EA 5A05A 3ZWOA 2WJPA 3HDYA 3F5QA 3AY3A 4PLZA 3L77A 4Z0HO 4D3SA 2IXAA 1E1LA 1R16A 3PRJA 2VOEA 2I76A 3ZHXA 2EWMA 3ON5A 2BMAA 3JQ8A 3JD3A 1R4NB 2D4AA 3PVZA 1WDLA 2JHGA 3W4KA 3GC6A 3ZU4A 2EKLA 3AUUA 2E6UX 5EJ2A 1NPTO 1JW9B 1I3MA 4TMFA 3VKVA 1YXMA 5JO9A 3TWOA 4BKPA 2GCGA 3UAGA 4BB5A 2Q50A 3VZPA 1MXHA 5GZ3A 1ULSA 4PLHA 1C0IA 4UVIA 4CLDA 3GFBA 3H9JA 3PTZA 4AJOA 5DP1A 2Q3EA 1ONOA 2PLAA 4BQRA 1A4IA 2VHYA 4BS9A 2JCVA 4CMHA 1YDEA 4GLLA 4WE3A 4OXNA 4O0LA 3DXFA 2VRBA 4UVEA 4WEQA 4OOEA 4A26A 1ZEMA 4GX2A 4N54A 3K6JA 1GEEA 1SZJG 2I5PO 3W4IA 4FCCA 1X13A 4DTIA 4M54A 5IG2A 5G0UA 2ZYDA 2EKPA 1NTOA 4DMLA 1XWFA 3CUKA 5FFFA 4J1QA 1UAGA 4GX1A 2PH5A 2YYYA 3WB9A 4FR5A 1QRRA 5L45A 3FWZA 1ZEJA 3LYLA 1YBAA 5BT9A 3SJ7A 1HYHA 3A1NA 2HK9A 3OIDA 2OBYA 1NX6A 4AJ2A 3OP4A 3QJ5A 1VKNA 2FP4A 4Z6KA 5L7WA 1KEPA 2HCTA 4J7XA 1AXEA 4R9RA 4E33A 3VPSA 4CQMB 3JQCA 5TIIA 1PJLA 1XQ1A 5FEUA 4JBHA 3L4SO 2EG9A 1HWYA 4PLPA 2HDHA 2C20A 2V6GA 4TVBA 1JAYA 3RAJA 2VT3A 2B83A 4Q3BA 1QR6A 4Y98A 1K0UA 2OL4A 4E21A 3VOSA 3JSAA 2CNBA 1KC1A 4BNMA 4R5MA 4OO3A 3DAGA 4BNLA 3AM5A 3MJEA 3SLGA 1VL8A 1XGKA 3PYLA 1GUFA 4JROA 5KKCA 2FMUA 4MVJA 2X23A 4F6CA 1X14A 1ID1A 3S55A 1LLQA 3U4HA 3O03A 2LDBA 5KKAA 3QV1A 3D1LA 3PDUA 1ZCJA 1K2WA 2CDAA 2J8ZA 3FBTA 4XR9A 3WBBA 1KVSA 1ZXBA 3JQAB 5JMPA 3U4CA 3PWSA 3PZRA 4I1IA 4XIYA 4MJLA 3A28A 1B2LA 3U9LA 4XGKA 4P4LA 4DPMA 4TRJA 3LDHA 4CM4A 4B8ZA 4CQMD 1JN0A 3BYZA 2X86A 3ENKA 1GZ4A 3HFSA 3P2OA 3WR5A 4FOOA 1V3UA 1KERA 1GAEO 1P1HA 3FBGA 4WECA 3GY0A 3L4BC 4IZHA 2X7HA 4KOAA 1FDSA 2CF5A 5TT0A 2HLPA 3NTOA 4HV4A 1QYXA 1H6AA 3TZ6A 1U3UA 3L6OO 3TQHA 4L75A 1A71A 1KC3A 3ZU5A 1X7GA 3UVEA 2O50A 3L07A 3FNFA 4BO4A 1Y7TA 2ZKLA 4Z0TA 3GA0A 4HNHA 3TL3A 1WZIA 4CLOA 3DBLA 3I9MA 3RIHA 2BHLA 2DFDA 2X5KO 1N9GB 2E4AA 4WOKA 3VZQA 5A06A 3TJRA 5KVCA 3OQ1A 4AJLA 2OORA 5JC8A 3TF5A 4CMEC 3WGZA 2B69A 2I65A 1JVBA 2HMTA 3JQAD 5BNFA 5HS4A 3WYBA 3PJDA 1BW9B 1U4SA 1BXKA 4MKXA 5G2OA 2Q4EA 4YBZA 3PHGA 1J0XO 4BO9A 4HFNA 5K6AA 2NACA 1O6ZA 4CMCA 1EVYA 1HEUA 3QW2A 1KY5A 4R1SA 3EHEA 3PDJA 1DBVO 3G3EA 4F3YA 3MEQA 2Q1TA 4M1QA 4FFNA 3LU1A 4J7UA 3PHHA 2O4CA 5JW6A 2ZK7A 3PI7A 4XYEA 1FMCA 4DLBA 2IZ1A 1H6CA 2BFOA 2AEFA 3TN7A 1CETA 1YBVA 4NJMA 3OM9A 4I08A 3EMKA 4IGEA 4O1MA 4RO0A 3RU7A 4D45A 4XJTA 3ONEA 1Q7CA 8LDHA 4RVSA 3ITKA 1HE4A 5FI5A 1R4NA 5MGBA 3DQPA 4UEOA 4A10A 3KYBA 4EI2A 5IF3A 2NTVA 1HKUA 2WYUA 5THKA 3O4RA 4E5NA 4N5LA 4R4JA 1D7OA 5F1KA 4WK6A 3I6IA 1PX0A 2J3HA 9LDTA 4WLUA 1GD1O 2QYTA 3TRIA 2X8LA 1PTJA 1O9BA 1U4OA 3PFWO 2UDPA 1QSGA 1UP7A 4MP6A 1SNYA 1BDBA 1PS8A 2QZZA 4OHUA 3LT0A 2XOXA 4ONEA 4J43A 3CPSA 3A14A 5KVSA 5T8KC 2NU6A 3JQFC 3VVCA 1B3BA 3FPCA 5DBIA 1B26A 3S2GA 5L53A 4DIOA 1YQDA 3CSDA 2E37A 2HK7A 2GZ3A 3M1AA 3PGJA 3O9ZA 4WUVA 4U0JA 5KNLA 1SOVA 1F8FA 3QE3A 1WPQA 3R1IA 3GZNA 2JFGA 1NFQA 2POQX 3ZWNA 1EUZA 3GQVA 1AHIA 3DZJA 3ZWAA 3RC2A 2X0NA 4OH1A 1QLHA 3DEYX 2FY8A 4FFLA 4KZPA 3Q2KA 4HUJA 4PLCA 4PIVA 2EW8A 3QSGA 5HRUA 3T7CA 4CQMA 3ZV4A 1F17A 2AQHA 2XF8A 4IIUA 3AI2A 2BF7A 4XR4A 4E2ZA 5KOIA 1DFHA 2ZB4A 1UJMA 1AHHA 3FTNA 2W98A 3PWKA 3QLJA 4QFCA 4WKGA 3LC7O 4YJHB 3GHHA 2JFFA 1PGPA 1TT7A 2I99A 3INRA 2AQIA 4FGWA 1HZJA 2W8ZA 1DLIA 3OF2A 3NDRA 3QWHA 3L0DA 2ZCVA 1LUAA 3COSA 5JDCC 2H63A 3EVTA 2OBNA 2W4QA 3BMCA 4W82A 5KCZA 4L8VA 1GV0A 4N18A 4CLXA 1QV6A 2BI7A 2O3SA 3QVTA 2FPIA 3HDJA 5H83A 3WNVA 1DIBA 4AL4A 4IDAA 2H9IA 1N1GA 4FPXA 3OJ0A 3PLRA 4RVUA 4BNWA 2WYVA 1M67A 3U5TA 5C5IA 4BNJA 4EEXA 5I9MA 4DREA 1NQTA 5L7YA 1MV8A 2QHXA 1YB5A 1E7WA 1ZMOA 4OMUA 3NRCA 3WFJA 4LGVA 1NVMB 4CL3A 3JQAA 4FFPA 3ABIA 1KVTA 5FYDA 4HXYA 4XCVA 1GQ2A 2GYYA 2WD7B 5L3ZA 4WASA 3DMYA 4MKRA 1H5QA 2GSDA 3VDRA 4OXKA 4YT2A 4W6ZA 4BO1A 4Y6SA 3W8DA 5FI3A 1CRWG 4RF5A 1SOWA 2DAPA 2E48A 2VHXA 4J2OA 3DWFA 4DYVA 4L74A 2OZPA 2DTEA 1SEPA 2DBQA 5HA5A 1Z82A 1JKFA 5CDTA 4CR7A 4B7UA 1ZUD1 1KVQA 1Z6ZA 3WSVA 4S3MA 3JQEA 1DC3A 2VQ3A 3JD0A 3ORFA 1YVEI 2V7PA 3ZWMA 2UYYA 1Y9EA 3D5TA 3ZH2A 1DHTA 2EGGA 3K92A 1DHRA 1SPXA 1HZZA 2PGJA 4ND3A 5LDHA 4EUFA 5CEEA 4BUCA 5EQFA 3MJTA 3ZWVA 3JQ9A 4BNUA 3U4DA 2B4QA 4CMIB 1MB4A 1DC5A 1NWCA 2HSDA 4RVGA 1QYCA 3FNGA 5TS3A 1N9GA 3H9UA 3HUDA 1UUFA 3PJGA 1YBMA 4FGSA 3GR6A 3WTBA 1W4ZA 4LSMA 1ADFA 3LLVA 3F1LA 4PCVA 4W7HA 2BLLA 1E3LA 1D8AA 2FPGA 1I5RA 2ZTUA 4YACA 2I3GA 2YFHA 4D7AA 4ZJUA 4ALNA 3AU8A 4RVFA 5U1PA 1BW9A 1TEHA 2P5UA 4OL9A 4WCFC 1PR9A 4IDFA 1PEDA 3PHJA 1EUDA 1EEHA 1EVJA 3I6QA 4Z3DA 4YT8A 2QQ5A 3TFOA 4BKUA 5A3JA 1JA9A 1ZXLA 3L9XA 3LF2A 1E6WA 1T4DA 4GGOA 4NG5A 4UVDA 2QRLA 2QRKA 1HDOA 4MDHA 1EVZA 1AXGA 2JL1A 4CR6A 5CEJA 5I9LA 4OM8A 3ASVA 2NADA 4BMSA 3LC2O 1ISGA 3RKUA 5IJZA 5AXAA 5CDGA 3M2TA 3BTUA 1YB4A 4JX8A 1A7KA 2ZYGA 5C7IO 2QX7A 5CG1A 2IE0A 1ENYA 1QP8A 1VLLA 3UH1A 1ZKMA 3Q1LA 4BO0A 5L9AA 3GG2A 3DAFA 4WOJA 1UDBA 1AUPA 1MFPA 3QA9A 4GBJA 4CM8B 3HDQA 1VPDA 1T24A 3JQ7A 3NJ8A 3NX4A 1NM5A 4KUHA 4MOWA 4RPKA 3VPHA 2B37A 3IOYA 3NDIA 4WGGA 4YAEA 5ES3A 4EUEA 3V2GA 2EHDA 3S2EA 1P1FA 1LSJA 2A94A 3QVSA 1ML3A 1TT5B 3U4IA 5EPOA 4ZRMA 3MOIA 4J49A 2V6BA 4KDEA 2H6EA 5I8WA 1PJCA 4DLLA 2DQ4A 5CPBA 3TZHA 3RQSA 3RC1A 3PHIA 4O63O 3JYNA 4TZKA 4ZD6A 1T2AA 4CM6A 3EW7A 3ETDA 2RHCA 3K30A 3FCOA 4IJKA 4XD2A 4CLRB 4RF4A 2Q1UA 1PQUA 1UXHA 2C2YA 2I3AA 1DLJA 1X1EA 4E5YA 3EUWA 4NFHA 3KV3O 2AW5A 2F1KA 1Z7BA 3JQBC 3MOGA 1ZFNA 2HRBA 2O4UX 2A4KA 2R00A 3GEGA 3MJSA 3KEQA 1PGJA 2PZMA 2TMGA 4E32A 3O8QB 4JJFA 4XRGA 4ALIA 3WBFA 1VRWA 3LT2A 4RJTA 4R3NA 1MA0A 3M2PA 1EFLA 1PQPA 3PQEA 3OIFA 4Z9FA 4XYLA 2OUIA 5KJFA 2EJWA 3I9LA 4TWRA 3NV9A 4PLFA 3SLKA 5JE8A 4J0FA 4RPHA 1CIVA 1XKQA 3RJ9A 4MIOA 5CHEA 4ZA2A 5GZ1A 1IYZA 1Y5MA 4TKLA 1H6DA 2VT2A 4YJHA 1DRUA 4J16A 2EV9A 1HE2A 3VZSA 3HJAA 4CLHA 3MWDB 5JYDA 1FDWA 4DYDA 5IDWA 4JN6B 3G1UA 1UDCA 4UAGA 2X0RA 4JGBA 5JXWA 1O89A 1V35A 3CMCO 4NQZA 4FB5A 1ADGA 2FSSA 1E3EA 4GMGA 1OAAA 2D1YA 2P91A 3OMLA 3NEPX 3WX0A 2E82A 4J0EA 3AM3A 4Y8VA 1WW8A 1IPEA 4BO6A 3SBOA 4LISA 3DFUA 3EZLA 1VC2A 3F4BA 4N5MA 1UZMA 2NLOA 1H2HA 2D5AA 1UXJA 1IUKA 3VTZA 4NJOA 3CZMA 2YV1A 3RKRA 4EJ6A 1FK8A 1PJBA 2FSVA 2BGKA 2PV7A 2XXBA 4Z9YA 4YAIA 2WD7A 1E6UA 1NQ5A 3O38A 4KMSA 4CUZA 5KIAA 4ALJA 2O3JA 3LLSA 1IOLA 1LRLA 1PZEA 3AK4A 4PLWA 4QSMA 1DSSG 2YY7A 1RKXA 2Q1SA 3V2UA 2OHXA 1XG5A 4L4XA 1T1SA 1PIWA 4BKRA 3I3OA 3E9MA 2DTXA 2FZWA 1I24A 1NAIA 4U8GA 3DL2A 4OJNA 1RYDA 2D3TA 2P5YA 5JSFA 3D3WB 2W2KB 4B3IA 3ROQA 4CPDA 4JCOA 4NBRA 1DAPA 1WDMA 4WEOA 1GADO 3UKOA 3PIDA 4B7XA 5CDYA 2XAAA 4YT5A 1RJWA 4C7JA 1LNQA 3N58A 3UXYA 1E3JA 3AU9A 3NT2A 1JWBB 1MUUA 4BNGA 4FQ8A 1LSUA 4CM5A 4ND2A 4U6SA 4EITA 5JPIA 1LDGA 3B1FA 1YOVB 3W6UA 3NUGA 2CD9A 1UXGA 1ISIA 1GFSA 1NR1A 1D4FA 4J9VA 1YONA 4B8WA 3TPCA 5G0SA 3ZU2A 1WVGA 4K6FA 3QVXA 1MFZA 4BV8A 3H5RA 1R37A 3DHYA 3I9NA 3SC6A 4J4HA 3KYDB 2HKIA 2GN4A 1DB3A 4J9UE 2O2YA 4ESOA 5HM8A 4PFJA 1R66A 4MVJE 3BHJA 3BIOA 4R1NA 3R6DA 1Y8QB 4RVHA 1KYQA 2ZIZA 3X2EA 5JY1A 2Z1MA 2VUUA 4BNTA 4BV9A 4IDDA 3GVIA 3NDJA 4F45A 2NU7A 4IJVA 3HSKA 4P4GA 4D3DA 2J3JA 1GPDG 3HB5X 3RC9A 4RGBA 1VI2A 1U5AA 2VHVA 2C54A 4I8XA 4QO8A 3CZRA 3RUCA 3IJPA 4NNJA 4KWIA 2HQ1A 3DZFA 4ALMA 1C0LA 1U5CA 3G1TA 4BGUA 3JTMA 1HTBA 1CYDA 3RUIA 5IXYA 3Q2IA 5H81A 3H7AA 3GHYA 4J1NA 1TT5A 3UCXA 4CODB 2J5RA 4A0SA 1TVEA 2ZTVA 5JO0A 1EQ2A 2ZB3A 3KZVA 1TB4A 1X7DA 4D3FA 4E12A 4YRDA 4W9NA 5DOVA 1KY4A 4OYRA 1C1DB 4GKVA 1B15A 1N5DA 3E82A 1UAYA 1D1SA 5BQFA 4HP8A 4FBGA 5BNIA 1X15A 2JKVA 2G17A 4G65A 1X0XA 4CLRA 1BTOA 2NU8A 5ER6A 1E92A 2EEZA 4AJHA 1JAXA 3F9IA 4FFRA 2DKNA 1EFKA 3KUXA 3GMSA 4YJFB 2FR0A 1SB9A 3OSUA 2FHSA 3TZCA 1X7HA 1Q2XA 4YR9A 2AQKA 3OQBA 2Q45A 3SC4A 1ZIDA 4EYEA 2IODA 3AUTA 3UOGA 3ZW8A 3DZIA 3O8QA 1DIRA 3ZWPA 1P1JA 4K26A 4R68A 4AJ1A 2WWRA 4BNVA 2B4RO 2YV2A 5T67A 4I5GA 1YO6A 1T2EA 1FJHA 2OOSA 4W7IA 2JAPA 4IQGA 4IQ8A 5HS6A 3HN2A 4II3A 3AW9A 4KUEA 4MIEA 3H5NA 3H9GA 3HE3A 4ZU3A 3VH3A 1ZO8A 4CV2A 4U0KA 3CINA 1EQUA 4IPTA 2DM6A 3PZBA 3WYCA 1Q7GA 3WGQA 3DB2A 1GYRA 3GAZA 5HWSA 2GASA 4DBZA 2AA3A 1KETA 1PL7A 2AMFA 4IINA 1JKJA 4BNKA 4QX6A 4BMNA 5JCXA 1ADBA 3AFMA 4MIYA 2OP0A 5CAEA 4E2WA 5CP8A 5EIOA 4A27A 5ITWA 3I23A 2YFQA 3GVHA 5KTKA 2ZQYA 4TRRA 3ZI0A 4B4OA 3RUEA 1YL7A 1P3DA 2QYSA 4OAQA 3GAFA 4ZN6A 5I7VA 3PK0A 3WJ7A 4I9UA 4RV9A 4Q9NA 1XR3A 4GAEA 1C0KA 3DFZA 1Y8RB 3JQGA 1C0PA 3NKLA 3OJLA 4OIMA 1VJ0A 2GZ2A 1LTHR 2X9NA 5JMWA 3PEFA 3DZBA 3PGXA 3K73O 2DBRA 4JBGA 3WGYA 2HMSA 3EGOA 4DC1A 3VZRA 5AOVA 3CE6A 1D3AA 5TNXA 4L4SA 5B4VA 4IIVA 1I01A 5TJHA 3JD2A 1GYQA 1ZNQO 4AJPA 3BA1A 3WMWA 3NTQA 1EMDA 4CUJA 2EF1A 4FN4A 2Y99A 1EBFA 4RDIA 2W2KA 1LJ8A 3K8ZA 4BGIA 4TSKA 1JVSA 2ZTMA 4YQYA 2IYPA 1LC0A 3H65A 1PGNA 5I7FA 3RASA 4YWJA 3INTA 1DFIA 1ULUA 2JD2A 3DMTC 4E31A 1D1TA 1N2SA 4J1SA 3VH2A 1LXCA 2GUGA 1M2WA 3FNEA 4R3WA 1O8CA 3OA2A 3BMOB 5T6BA 4WLVA 4C7KA 3ZNPA 1YOVA 2VWQA 4XQCA 2Y05A 5I9NA 4AG3A 3BHIA 4R16A 2EKQA 5EERA 3MZ0A 1PJQA 1LQUA 1QV7A 5CG2A 3W6ZA 3UW3A 5IFLA 3OJFA 2NWQA 2X1HA 4DMMA 2PA3A 5IZCA 4INAA 3U62A 1ZZEA 3FF4A 3KYDA 4U7WA 3QQPA 2YHIB 1E1NA 1C14A 1AE1A 3CXRA 4CQLB 3ASUA 3CH6A 4XB2A 4CMJA 3W4JA 3GGPA 4UREA 1LC3A 4NZ9A 5A5EA 1DRVA 2EP7A 4HX5A 4YB8A 1U8FO 4RPLA 1FXSA 1SMKA 2WEKA 3HWRA 2YUTA 5IN4A 5JFOA 5JBIA 2VNSA 1J49A 3V2HA 2EERA 1DXYA 2I66A 4WPGA 1HDZA 1EDOA 4WLFA 3RFXA 4DXHA 1R12A 1ENZA 3PJEA 3OETA 1CQJA 2G82A 5T5QA 3H2SA 5K6AC 1K6XA 2WD8A 3TOZA 1P33A 1PGQA 4YRBA 5BSHA 4I5EA 3GN2A 3DZGA 4BL5A 1UXKA 1WMBA 1Q7BA 1DC4A 5TX7A 4DLAA 1H93A 1W0CA 1I10A 3QWIA 1KEVA 2NM0A 1VJ1A 3DBRB 4DA9A 4GGPA 5JS6A 4Y6RA 5G0VA 5GMOA 1QORA 4RQUA 1C1DA 3RBXA 4NBWA 3M1LA 4AJ4A 5JLAA 6LDHA 5AXDA 1QYWA 3RU9A 3RI3A 3AOEA 1PL6A 1H2BA 3H3JA 3K9QO 4HFJA 1OMOA 4RPJA 2CVQA 5COBA 4YJFA 4OGWA 3D4NA 3HB4X 3PWZA 4HFMA 4NH4A 1HSZA 4PG8A 3ETGA 2FRDA 3DOCA 1A5ZA 2JAHA 3KTDA 5L51A 1QG6A 4NBVA 1S7CA 2B4TO 3KXDA 2C59A 4MINA 4ZQGA 4NU5A 3U09A 4D43A 1DDOA 2Z95A 3C7AA 3KEOA 3NT4A 2AG5A 2FR1A 2BGMA 1K89A 2HMVA 1QYDA 4GVXA 4YDRA 4ZHSA 4RQTA 4EEZA 1KVUA 5EL0A 5G4LA 1YL5A 1SCUA 2DPGA 1HETA 4OKNA 4DRYA 1XU9A 1GU7A 2DVMA 3BMNB 2PR2A 3DTYA 3LZ6A 3OA0A 1NBOA 5ITVA 3AY7A 2BD0A 4BGVA 2YW9A 3AI3A 3E8XA 5A04A 5ICMA 1O0SA 2J6IA 1ZSVA 4RLHA 1BVRA 3BAZA 2X9VA 3WGTA 1PJ3A 5JDIA 4BQPA 5MDHA 4XDYA 1K5HA 3B20A 1RWBA 4O59O 5BSFA 2VZ8A 5F21A 3ICPA 1HE5A 3DONA 2CUKA 2PH3A 3ZGYA 1EDZA 5A5FA 4J1TA 1LRJA 3IJRA 2BELA 4ID9A 3ZWXA 3RD5A 5BNTA 3HHPA 5TGDA 4K1LA 4PG6A 4DIBA 4IBOA 1LDYA 1Y8RA 4FS3A 2GERA 2IEBA 1P77A 1U7TA 2C5AA 2EW2A 3NGLA 4QQRA 5DNAA 1EK6A 4E5MA 1A9YA 4QEDA 2PKRA 3UFXA 3ANLA 4PG5A 4XJSA 1A72A 1E1MA 2CMDA 2YZ7A 4BNZA 4GLOA 4CV3A 2A92A 3AFNA 3ZHYA 3I1JA 3H9EO 1FDVA 1P45A 3D64A 1PJ2A 4KTVE 3QVWA 1PS9A 1DPGA 4IDCA 1MP0A 2OGUA 1ISFA 1R6DA 4NDNE 2J5KA 1V3TA 1WLYA 5K9ZA 3O26A 3RUHA 3IUSA 4PG7A 3UF0A 4BNFA 3R3JA 1PZHA 1NFFA 5B37A 3DR3A 2HMWA 3G79A 4YJGB 5JY6A 5IDXA 3E48A 3JYQA 2G5CA 1I36A 4N7RA 4HWKA 4DPKA 3I9OA 3P2YA 1BG6A 3JCZA 3NAQA 3BMOA 1B14A 3UHAA 4UUMA 5J23A 1Y6JA 2IXBA 4BKOA 1LU9A 4KTTE 1H0KA 1GUYA 2VN8A 3JD4A 2FPPA 1TLTA 3PQDA 3GUYA 1PU2A 4L9RA 1NYTA 1N8KA 4WJZA 4KQWA 3ZNOA 4TROA 2NQ8A 4MVJP 1O94A 5EMHA 4NI5A 4NU6A 3C8MA 3DZKA 3NTRA 4TKMA 1PQWA 1Z73A 2G0TA 4NPCA 4XQEA 1YWGO 3X2FA 3F46A 2CSUA 2J3KA 1E1KA 2YDYA 4JQCA 5JCJD 1NQOA 1ZH8A 4XDZA 1B8PA 2FZEA 4TZTA 3ROMA 3L6EA 3WWYA 1H9AA 5B4UA 3P19A 1JTVA 1PS0A 1OZAA 2YJZA 3FWNA 1MX3A 3PPIA 3K31A 4UUNA 4DQVA 5TJ9A 3IKTA 1I2CA 3W1VA 1I8TA 5TLSA 3PYMA 2HMUA 1M66A 2G76A 1XELA 2FR8A 7MDHA 4JK3A 5H82A 3BZUA 4XRRA 2AEMA 4GPD1 1NHWA 1KEWA 4QXMA 4E3ZA 2B35A 4EW6A 1MC5A 4F46A 1JQBA 4ZQFA 3Q0EA 3MJVA 2D8AA 1NPYA 1F14A 1G0NA 1NPDA 5A9SB 4R5HA 3DBRA 2W90A 3IP3A 4YAGA 5DDIP 4XB1A 2ZQZA 1ISJA 1I33A 3ONFA 2Y67A 3D4OA 4IS3A 1CWUA 5ILOA 3Q11A 2JJYA 4B79A 2IZZA 4J90A 4BMVA 2BI8A 1IY8A 4XYMA 1CJCA 2HU2A 3QP9A 5JAZA 3ZN2A 4G2NA 3G0OA 4WLOA 4YJDA 5EN4A 4CMGA 1I3KA 3VHRA 9LDBA 2IRWA 3WFIA 4W99A 3KBOA 4R51A 2VCYA 2A9FA 4GSLA 2GN8A 3GMDA 2X0JA 4MVJH 3INGA 3HNPA 1M76A 1I3LA 4I9HA 4J4BA 3MTJA 3H5AA 1PWZA 1T26A 1J6UA 1QMGA 1XYGA 3PLNA 1Y81A 1B3RA 3ZU3A 1J4AA 1GR0A 4J7CA 3RC7A 1MC4A 2VZ9A 1GUZA 3WNQA 5GZ6A 5GY7A 1ORRA 2TMDA 3DOOA 3WLEA 5L4LA 3KETA 3WOHA 2IYOA 3ZCXA 2O3RA 3V5NA 2C7VA 2X5OA 1ENOA 1U1IA 3AY6A 1U8XX 3FPLA 4YAJA 4EBFA 3U49A 4BNXA 1E7RA 1PL8A 4ND5A 3SJUA 3UICA 1SEVA 4LK3A 3E9QA 2P2SA 2DU8A 5KJCA 1GCUA 3JYOA 1LLUA 4PGFA 3BMNA 4II2A 1Y9AA 4DC0A 4G81A 4LRTB 3KSDO 1YDWA 1NVTA 4FDAA 1T25A 4XGNA 3E03A 2EGHA 3OJOA 4CLEA 1JLLA 3WICA 3SXPA 1P1RA 3UCEA 3FR7A 5AVOA 3ZHBA 2ZJ0A 4GI2A 1BVUA 2Y68A 3GDFA 4J3FA 2VTDA 3V8BA 1PZFA 4OQYA 2VOJA 3IP1A 2YQ5A 2AE1A 1I32A 3DO5A 4P38A 3TZQA 5IZCC 4ITUA 3SVTA 5ENVA 2Y66A 4R01A 3WTCA 4WCDA 3I5MA 3DBVO 3RFVA 1XCBA 1LDMA 5HTOA 1DFGA 1DJNA 3ADPA 4ALKA 2PZLA 2VZ0A 2VYVD 4AICA 2VWHA 4CV1A 1U3TA 1NASA 2J3IA 1TXGA 2HJRA 3Q9NA 3PYXA 1M75A 4ZICA 4XQ9A 1BRMA 3VTFA 5COAA 2V6MA 2BRUA 4Q3NA 5JCJA 3OIGA 4XKJA 1ARZA 5KJ6A 4PLVA 4IM7A 2OO5A 1LQTA 3F47A 4RF2A 1V0JA 2D5CA 3P7MA 3VH4A 1HRDA 2PKQO 1LI4A 1WDKA 3F5SA 3IAHA 3KYCB 3C1AA 2PGLA 2RBEA 3OEYA 3PJFA 5G0WA 4UULA 1P0FA 4LCEA 5F5NA 1Q0HA 1OOEA 2QW8A 4XGIA 4EJ0A 1A27A 1HF3A 4YJGA 2NVWA 5JAIA 1OC4A 3IMFA 4GH5A 3CEAA 5DZSA 4MKZA 3JQ9C 4IXWA 4MO2A 2RCYA 4MVJF 1L7DA 3M6IA 5JNLA 3KSUA 1BGVA 1HLPA 2O3QA 4CM4B 4CMIA 2EP5A 3AUAA 1BHSA 3E5RA 1HDRA 3JQDA 2ZB7A 3GPDG 4LMRA 4OXYA 1ZK3A 2PZJA 3ZNNA 1XDWA 3RCBA 3RSHA 1GQYA 4B4UA 4JIGA 3DHEA 4Y6PA 3E18A 1OBFO 1MXFA 1XLTA 3DBHB 5G4KB 2JD0A 1HLDA 1PJSA 4IY1A 3TSCA 3N7UA 3L4BA 2R2GA 4Q3EA 4JBIA 3ZWCA 5JC1A 3GOHA 2R6JA 4ROSA 3AJRA 3BTOA 2ZB8A 1IZ9A 2Q2VA 5DF1A 1OI7A 4B3HA 3ZV6A 1HXHA 4XIJA 2PD4A 2CDBA 4I9NA 4QFDA 2CFCA 1YGYA 2VWPA 4WLEA 3LK7A 3N74A 5ILGA 5KWEA 1UZLA 2VUSA 1UDAA 3K96A 2Y0DA 2HO5A 3B70A 3Q6IA 4GWGA 4HFRA 2AHRA 2SCUA 5IXSA 3PP8A 1RM0A 1Q0LA 2NUAA 5C7OO 3R3SA 1NHGA 4FIZA 4LMPA 3GUCA 1K3TA 1VL6A 2PY6A 2Q46A 2NQTA 3TFQA 3BHMA 3KM0A 4CM8A 3EC7A 1ADCA 1YJQA 1NFRA 4YA6A 4CMEA 4EDFA 2WTBA 4Q39A 3JQ6A 4WCFB 1CDOA 3WIDA 5A9SA 2HJSA 3WSWA 3QY9A 1U2DA 1T2CA 2VHWA 5A1TA 4U6QA 1UP4A 1VL0A 3VPFA 2NVBA 3D0OA 1JU9A 4H16A 4CL8A 3OBBA 2GDZA 1ZJYA 1IPFA 3LT1A 4NBTA 2DLDA 5I7EA 2GN6A 4H7PA 4K6CA 4NFSA 4YEDA 5BSEA 3VAZA 4IGFA 5FWNA 3K2EA 2GLXA 1F8GA 2O23A 4NJMB 1GTMA 2X5JO 1M6HA 1WMAA 3DC2A 1ZJZA 3H9QA 3MCVA 2PGDA 3AI1A 1E7SA 3S1LA 2Y1OA 2R00C 3GK3A 1ZK2A 3L6DA 2Q2WA 3MJ4A 3DTTA 4PLYA 2XXJA 2C82A 4UVHA 3ROPA 3A06A 3RVDA 4RL6A 3FN4A 1VJTA 3RWBA 1DRWA 3PFFA 2X4GA 2VYVA 4ALLA 2BGLA 4IUYA 4W4TA 2OFPA 1F06A 4NIMA 1XU7A 3RROA 2VRCD 1PGOA 3I4CA 5DBFA 4F6LA 4E2YA 3GNSA 1UXIA 3WDSA 1EUCA 4GKBA 3QHAA 1P0CA 2ILTA 1B8UA 4D0RA 1YJ8A 2UUOA 4FJ2A 4Y67A 1KIFA 1NXQA 1IULA 2Q49A 2P9GA 5T8KA 3JQFA 4LVUA 2LDXA 2H1SA 5IN5A 1LSSA 4WNIA 1ISMA 3GPIA 2P68A 4XX0A 4BO3A 2GN9A 1J5PA 3GZNB 4YTEA 3NYWA 1QLJA 3W8FA 4KWHA 3C3XA 3OEWA 4E0BA 1LDBA 1T4BA 2ZCUA 4GVLA 3TL2A 1Z74A 1A4UA 3JYLA 3ADOA 5C7LO 1MGOA 1ZMTA 1EK5A 2JD1A 4NHEA 4C4OA 4RDHA 3EDMA 4GX5A 4A73A 1YL6A 2PTGA 3KSZO 4DVJA 3E5MA 1K6JA 3JYPA 4R54A 5ICSA 1E5QA 1A7AA 3F3SA 3ZWWA 2YHUA 4A2CA 1O95A 5A9RA 4U5QA 2NV6A 1T1RA 2X58A 3V1YA 4G5HA 2GO1A 4RVDA 1W73A 4RCVA 1ZK1A 7ADHA 3DZHA 3GVPA 4CR8A 4CV0A 3A9WA 2DTDA 1K6IA 1NR7A 3B6ZA 3BMCB 1CEQA 4H3VA 3C7DB 3DDNA 4D46A 3EAGA 3S8MA 2JCYA 5F5LA 1WZEA 1CERA 4PG4A 2JHFA 5JDCA 1N92A 3P5SA 1BXGB 1RYEA 4M55A 3WYEA 3KYCA 4DGSA 3KVOA 1X1TA 2W2LD 2ZATA 4BNIA 3IIEA 4AFNA 4IMRA 4BKQA 3UCFA 3I9JA 2D0IA 4PLTA 1HYEA 4GMFA 3D3WA 1KOLA 2GZ1A 4B4VA 4BHTA 1N7HA 1PZGA 4CUKA 4D0SA 3AOGA 1V6AA 4JP3A 4WNCA 1MG5A 4AJKA 3ANMA 3QIVA 4XWYA 1DAOA 3OJEA 3EYWA 1E7MA 3LVFO 3ZWBA 2NVUB 1U9JA 1I0ZA 2Y1FA 1C1XB 1DC6A 1DO8A 2D59A 3L9WA 3GDOA 1ONPA 1WAMA 1PSDA 2CDCA 4R69A 4YAKA 2BKAA 2CVOA 5KJEA 3PQFA 3GZ4A 4YT4A 4AJEA 1IE3A 1ONNA 4Q3CA 2GGSA 4ZRNA 2YV3A 1HSOA 4NR0A 4YRAA 1LDEA 2Q2QA 3DBHA 4MVJG 5G4KA 3A4VA 4R1UA 1F0YA 2WM3A 5IDYA 1AGNA 5DP2A 4AJJA 2AG8A 5T57A 3U0BA 5C37A 1BWSA 2JFHA 2Y93A 3I83A 4Z0PA 5T64A 1UP6A 3VC7A 2Y1DA 5B4TA 3GFGA 1KS9A 5KVQA 2AXQA 3NGXA 4PVDA 1Y8QA 2BFPA 3WGGA 1CQIA 1VE9A 4RZIA 1W6UA 4DUPA 3C1TA 4JXKA 4X54A 3JV7A 4N5NA 3E1KA 1E7YA 3EK2A 2RIRA 4MP3A 5TC4A 3ROKA 3GGGA 2VRCA 3KLPX 2B5WA 2DT5A 2BFAA 2HUNA 3B1JA 3FSRA 3IUPA 1PJTA 2C2XA 5CEFA 1BSVA 2HAEA 3JD1A 4H15A 4IQ0A 4JNKA 3I4FA 3UUWA 1ZSYA 2GNAA 2O7SA 4NK4A 1V8BA 4PZDA 3TZKA 4WCFA 2B0JA 3FNHA 4GSKA 2WMDA 3RJ5A 8ADHA 4W9NC 1H94A 1L1FA 1IHYA 1B0AA 2CY0A 1UR5A 4JLWA 1LX6A 3BXXA 3OICA 4L76A 1I2ZA 1LRKA 4MPDA 1FDUA 1I30A 3IDSA 5L7TA 1UZNA 4XEHA 2DUUA 2V6FA 5A3VA 2ZYAA 2P9EA 3RUDA 1RPNA 1SC6A 2Q99A 1YH3A 4M49A 3HG7A 1HL3A 5IDQA 3BMQB 3JQ7B 1Z45A 2QG4A 2ZJ1A 2XPCA 4D44A 3ZDFA 1KBZA 5ENDA 4O5OA 1WWKA 2HRZA 3NJ4A 2DPHA 1GZ6A 1EBUA 2Q4BA 5AXBA 5AXCA 2OXIA 1ZBQA 5JYEA 3S2FA 4D79A 4YXFA 3OHSX 1E3IA 1P44A 3ICCA 1DIAA 2Q1WA 3RUFA 1EZ4A 1I3NA 1E3SA 2GR9A 4RORA 3VKUA 1YKFA 2X0IA 2GD1O 2YQ4A 4HADA 1E3WB 1ISHA 1T2FA 2HK8A 2O3TA 2VYND 2FWMX 4QUKA 1R0SA 2VNAA 2RHRA 3HADA 4K9DA 1V9LA 1QYVA 3D4PA 5TRTA 2I6TA 2B36A 1YQXA 1AN9A 2W2LA 1JWAB 4EJMA 5K0ZA 1HDXA 1S6YA 5DCWA 2ZTLA 4BOYA 4I5FA 1NVGA 4HY3A 2PKQP 1WXDA 5L40A 3EY4A 4GQAA 4MVJM 1U3WA 3H6KA 3LC1O 1P74A 4NK5A 3IC5A 1E6EA 3JQBA 2B5VA 4FW8A 4EUHA 4B7CA 2IZ0A 3HFGA 1LLDA 4XZ3A 3GLQA 3ZZNA 2AQ8A 4CJXA 1R4MB 1X0VA 4PVCA 1R15A 4UUPA 1WNTA 1NP3A 2C07A 3ZV3A 4PN3A 4XYBA 2PD6A 3E6AA 1V3VA 4OSOA 1U7HA 4DIFA 2CZCA 4OSPA 1PWXA 1GCOA 3WG9A 4BO2A 1GDHA 3QWFA 3LT4A 3D7LA 5F1OA 5DCUA 5L4SA 3H2ZA 3ST7A 1HDGO 4ZVVA 1T2DA 2GRAA 1XSEA 4LW8A 2NU9A 1LDNA 4B3JA 3STHA 5C3MA 2X9GA 1GYPA 1U3VA 3V1UA 3GVXA 3IS3A 3SEFA 1NAHA 1N1EA 1GPJA 1VSUA 1NQAO 1HT0A 1NNUA 5JAMA 4J2HA 1VSVA 3GRPA 2NTNA 2X6TA 3UGKA 1BXGA 2DUWA 5ADHA 2IEDA 2DBVO 2Y0CA 4IZIA 4CM3A 3MWEB 3OH8A 2JCXA 1IL0A 1ZVMA 4NBUA 3VH1A 4E13A 3KHUA 3C24A 4LN1A 5HBRA 3WQQA 1E77A 1LEHA 4J6FA 4BNYA 4GL4A 2C0CA 4NMHA 4ZQHA 3VPXA 6ADHA 4JP2A 4PRLA 5I7SA 1MG0A 1R0LA 2IDZA 2NVUA 1P1KA 2P4HX 1H9BA 1XEAA 1CF2O 1C1XA 1H6BA 1BMDA 5TT1A 3GVCA 1E0DA 4RF3A 5KJ1A 3Q9UA 2DFVA 1C3VA 3QRWA 3F4LA 3FR8A 4UUOA 2C7GA 2O2SA 2O7QA 4KUGA
chains in the Genus database with same CATH superfamily
1N6NA 2AD1A 2OV3A 3RBVA 1V5EA 3PNPA 4P54A 1FPMA 4L73A 1NJSA 4QHYA 2NTJA 1G3QA 2IOQA 3AP2A 1QOQB 3ZVLA 5GJBA 3D9QX 1S8FA 1X8LA 4FZ5A 3TSYA 4BVKA 5DYYA 5BURA 1GTL1 4FJ0A 5B7GA 5DFAA 4QU5A 3QVGB 5M7EA 4YQFA 4HNUA 5M3BA 2RH8A 3MCUA 3C6XA 1A4XA 4CQLA 5JQGF 1E2EA 2Q28A 3BCUA 2HZBA 2O48X 3HACA 1UFKA 3VPGA 5KHLB 4MS4A 1TZBA 4Z9XA 1Q0TA 2QAIA 2C31A 1T34A 3AM4A 4FC7A 5B1HA 2D3WA 5L4NA 2PFKA 5TV2A 3PUZA 5ABPA 1NW7A 1JMKC 1L4HA 3CSSA 3IOMA 3AQ4A 4LOHA 3FX2A 1A9XA 2D54A 3HSSA 1RTKA 2W6CX 4D4KA 5IC4A 3HQ4O 2FEWB 4QT0A 1Q77A 1KI6B 2FTKE 3O8CA 4BEVA 3NAGA 1GCGA 3W2GA 1OIVA 3G8CA 3CIFA 1KTVA 2VYNA 2D13A 2VEOA 3D2BA 4ZK6A 4B32A 2FF7A 2OB2A 1KVRA 1SIOA 3TJZA 3CC8A 2ATEA 3HNOA 4GHWA 1YJXA 2FJPA 4ZVOA 4QNNA 5IAEA 1SG0A 1VZ3A 1JEQA 1SC9A 2HH9A 4IXTA 2HR1A 2O8FA 1A1SA 1JHUA 3K5PA 2VBCA 3ZIUA 3GUVA 4UARA 3COWA 4M86A 4I4IA 3WQRA 4Q18A 4J4TA 3MJCA 1XZIA 4BJ6A 3QXHA 2QGZA 3H3FA 2XUZA 4MVJI 3PEYA 2ZSJA 5E6UB 4DV0B 3LKVA 2WVGA 3HXLA 4D41A 4E6PA 3ZHZA 1UKZA 3CY6A 5H1YA 1BDMA 1G63A 4GWKA 2GESA 1BFUA 4TTTS 3E2IA 4MP8A 1LA2A 2Z4RA 3D43A 2HA7A 2M1XA 1KWGA 1GNVA 1L1QA 2IOFA 2EX1A 3UZUA 3AXTA 4A8JA 1KQFA 3TUZC 3ZQKA 5TQVA 2QP9X 4I6GA 4KO2S 4YYEA 3RAGA 3Q85A 4YK7A 3KOUA 3LF1A 3G49A 4LSWA 1MQ8B 3H2HA 2DBZA 4G56A 5H70A 5B7NA 3STYA 3EZYA 5M2QA 3D8SA 1Z26A 2J5QA 2RAFA 1I4OA 2I9PA 2C96A 4R71A 3H8VA 3ZLJA 4RE5A 4X8LA 2J6BA 1MCZA 3GT7A 4JQOA 4M99A 3LY7A 3VNRA 3DE0X 4QJ4A 1F0PA 3ZTTA 3CRMA 2X5NA 1E3WA 4QULA 3TOXA 4PRKA 5DE3A 3DM9B 3K5WA 4R7TA 3WKBA 1DV2A 1QC5B 4YIKA 3DD1A 3ZGZA 1B23P 4L5BA 2RH4A 2QTGA 4QGBA 2VPXA 3ESCA 4BVBA 5J4KA 3X1ZA 3AB7A 2EFDB 1X7XB 1WB9A 1SAYA 2FUKA 2WU1A 4Q9JA 1U9CA 3L7MA 5D51S 3F7TA 3FB1A 5T3UA 4EFKA 4X95A 1TKBA 3UJ9A 4H7JA 4O25A 2FGKA 3LUGA 3FYUB 4WXHA 1SUCA 4XPZA 3U7QB 4KPUB 1C2TA 2OC9A 2O3UA 4WLNA 4U8HA 4R41A 1M2JA 4OUDB 3F90A 4IO0A 5AJZA 4YP1A 4Q3DA 1KK3A 1M6EX 2FU5C 2H59A 4NSNA 4QUJA 3SDBA 1D09A 1DAGA 5JXIA 3I2KA 3PR3A 2PX4A 2V9PA 3LKBA 3G82C 2HLDA 2QTLA 3AV3A 3E81A 4CF7A 1G0OA 1GSAA 1TD9A 2GD0A 3A70A 3T4EA 1UKVY 4U9IS 3W7AA 3GLHE 3C1OA 2WSBA 2VVTA 3MK31 2XRYA 4BGEA 4IJUA 1YR9A 4INOA 1YCFA 4HDMA 1OH7A 2PL5A 3EX7C 3PFIA 1OX5A 4YUVA 1BDHA 3L43A 2VJMB 4KIGA 2ADFA 2Z58A 3LQFA 3V00A 3AHJA 5U4QA 1VKOA 3ZCUA 1G64A 1JV2B 1YS4A 2X9QA 3TM5A 2VXOA 2CF6A 3EVEA 3GEBA 4JI5B 2XGSA 2ARKA 3O91A 4NABA 3NT5A 2MIIA 2P9CA 4PNHA 2GEDA 2XVYA 4RMJA 5CA0A 3K0EA 4RIGA 3NVDA 5JWHA 4BMYA 5A02A 4MW2A 1D8TA 1OA1A 3TAXA 4KP7A 3T54A 4IR7A 4S1VA 4UNPA 3PA8A 3ET4A 2VDVE 4H18A 4HBGA 5CVUA 2ERXA 3MAGA 5LZ8A 3TH5A 2PV0A 4WHMA 3WGOA 1KBQA 4MQ6A 3FJOA 4QZVA 4DMCA 1AKRA 5BW4A 2XB6A 3DTVA 1RTTA 3MWEA 3UWMA 3KKMA 2AEJA 3HBNA 4IVNA 1J7KA 4EFMA 1W96A 2ETVA 2NUTB 1KI3A 5DT9A 4TRMA 1EJBA 3KOMA 4EBBA 2FX2A 4GUDA 4K03A 1OVMA 1RKBA 1HUQA 2HX1A 2OMEA 2YYSA 5CA1B 3USZA 2K2WA 4TRNA 2MR5A 3H86A 3UO8B 2Y0BA 3TW8B 3TXAA 4ETNA 1BXZA 5BMVB 1USUA 1Y4DE 4KQXA 1XCGB 4ZQEA 5JATA 4S1NA 2JGLA 1Y5RA 2ZKIA 1FF9A 3OECA 1U1EA 2XZTA 5K09A 1P9LA 1A04A 2VXBA 1JKIA 1L4FA 1EVEA 1DIGA 2AN5A 2P4UA 2PPVA 2DWOA 2QUJA 5C4MA 5CA1F 2QZ9A 3I58A 4O6VA 5KTMA 3U5ZB 2PD3A 1ONSA 1GL3A 4EY8A 5BYKA 2PZKA 3FI9A 2VDRB 1OXUA 4H4CA 1ZVVA 1NJ1A 4KMMA 5DI3B 3RLIA 4DHEA 1CCWA 1LV7A 2EQAA 3H5VA 4QEZA 2AC2A 4BCCA 1IUNA 1JDJA 1MT3A 1L3IA 2PIDA 3KYIB 4I2NA 4OKIA 4E4YA 2HCFA 3OAAD 4K3UA 4QUIA 5D5PA 1JFVA 1KMNA 4KYTA 1Y1PA 3SEQA 1L5HB 3RYIA 3Q5DA 1V8OA 4GI1A 3AG5A 3QWAA 2EFCB 1WS6A 2I6XA 3Q3CA 4G4GA 4YQZA 3VU0A 5DN9A 4OQQA 4FKMA 4DV6B 3GDGA 4BB6A 2G07A 1CY7A 2X3UA 1CX9B 3ROGA 3WLKX 1SXPA 3KXKA 3IBCA 1AGXA 4RZ2A 4BNNA 1JQJC 1TO6A 1JKXA 1A8HA 1ZD2P 3OFSA 2RC6A 1UKYA 2A1UA 3B7WA 3DMTA 2SHKA 4UEKA 3UC9A 1B7GO 3GRKA 4INZA 3RWOA 1I0IA 1QKJA 4MVJD 4MHSA 2W93A 4QDXA 3KZXA 3AWIA 5C1DA 2CFRA 2P9YA 2BH9A 4BVFA 4CM9A 2IPAB 2FR8C 4H31A 2WZQA 1BNCA 3DQQA 3FFXA 4QUGA 4A6PA 4EHJA 4DFDA 4E30A 3ICQB 2CUTA 2XYGA 2FXIA 2CVPA 4BFXA 1ZP6A 4N3AA 1ZUIA 3SG0A 5LR6A 1RHMA 4NDZA 2V7GA 5EP2A 4LY9A 2JDID 1WP4A 4XOIA 1CLUA 4ENSA 4RFSA 3MQFA 1FFSA 4Z4GA 3S2IA 3EVDA 1RI4A 1Z5ZA 1TKAA 2YDXA 4RPGA 2QM7A 1AC5A 2CVZA 2N1BA 1DUVG 4I1YA 4CMAA 1PYGA 2UUPA 1KH3A 3EISA 3NXSA 3WIEA 2HYIC 2J32A 4PZEA 3FSGA 2HWYA 2ZR8A 4JJIA 1XKTA 3FRJA 3G8AA 3DAOA 5A9TA 3L49A 5LXTB 3ZW9A 1VRCA 4L5JA 4OX9B 3ZBUA 3FPFA 3KKNA 3GN1A 5ELXA 1BVHA 3V4PB 1QUEA 1DBQA 4C5AA 1V9CA 2G1JA 4N5DA 4DV3B 4Y1RA 4C0XA 3WOVA 3L77A 3HFRA 2QN7A 3GBSA 1GPUA 2VOEA 4Q9KA 3H8WA 5DBOA 1I7PA 1BE0A 4JHLA 2JGKA 4QYWA 4Y7DA 4B5KA 5LXTF 3HCRA 2QRNA 3ZBQA 4KQ2A 3AB3A 2BKVA 2D4AA 4FMDB 5EXEA 3W4KA 4XWOA 4QDOA 3GC6A 4WWHA 2EKLA 3AUUA 2KB0A 3KWJA 1L4UA 4WBSA 5JLJA 1M54A 1M10A 3OPYB 1I3MA 4ZU1X 3HL4A 1RJ9A 3D4BA 4MQUA 4BKPA 3R7FA 4ACBA 4JA0A 4TVKA 4BB5A 4C3OB 3W04A 3F5MA 5AW8A 2FWRA 1GP2A 1K4MA 1T4GA 2W48A 2PL3A 3TLCA 4O2LA 4HYTA 3H9JA 1YQUA 4RADA 1H0HA 4UM7A 2IGTA 3T5DA 3PQCA 4FMDF 2IV2X 5FOVA 1U7OA 3OU6A 1U2RA 1YDEA 1MJHA 3RABA 4IDNA 4DSUA 2AL7A 4UVEA 1PEKE 4H2DA 2DWQA 2DB3A 4WEQA 3V8QA 1ZEMA 2FSGA 3FJYA 3K6JA 4XAQA 4KQHA 5DSXA 4DNXA 2Y77A 5EJFA 4DCVA 1GEEA 3HU3A 1H05A 1UF9A 1X13A 2BN4A 4JL6A 5CTJA 4GDMA 5ERYA 1YUNA 4GLJA 1XWFA 4QJBA 3CUKA 5DMHA 2VG8A 4U7PB 3A2KA 3WB9A 4HWPA 1QRRA 4WESA 3T9DA 2V45A 3FWZA 1YCGA 3LYLA 3GBVA 3A1NA 2WJGA 4EYKA 5EQTA 4C3UA 4WY8A 1UPFA 3AB8A 5JXJA 1QDUA 3S2ZA 2I2BA 3UT6A 1AV6A 2CVFA 1KEPA 1PJRA 4IYJA 4Q16A 3B38A 2Z2KA 3DVAA 4H3KB 5E0OA 3VPSA 3ZVRA 1PJLA 3AVXA 1IMOA 3JALA 2XUOA 5FEUA 1K7FB 4NJEA 3KQKA 1IN4A 2PBZA 3NBQA 2F1OA 5I4CA 2FPKA 5TQ2B 4QBFA 3TBHA 2FEXA 3RAJA 3DL0A 1R10A 4IOJA 4RH3A 4ND6A 5SYMA 3S29A 2Z3WA 2YS6A 2WTAA 3OTQA 4Q3BA 5JD4A 4QDUA 5A4MS 4JUDX 4NMLA 1EAYA 1KGSA 3JSAA 3PSAA 1F2VA 4Z0NA 2CNBA 5A4IS 3EAFA 1KC1A 5BQ5A 1QFZA 3H9CA 4JU9A 2Q5IA 3TTXA 1JPNA 4OHKA 1A50B 3ZE9A 1ITZA 4BNLA 3AM5A 4WXPA 3V4RA 1PT7A 2G8NA 4K9KA 1XGKA 5H59A 2V7BA 1DAKA 1RXCA 2EZ4A 3PYLA 4JROA 5G53C 4DLZA 2C5BA 3K0AA 1F2UA 3S40A 2ZUEA 5DLYA 1X14A 1WNFA 2DPMA 3TQIA 3VJKA 5B53A 3B7GA 1ID1A 4OQEA 2LWIA 3OX4A 3CA8A 3BFKA 2IXFA 1DQNA 3VYUB 1I4WA 3ORQA 4QWMA 1FSSA 2LDBA 4Q9AA 1E3MA 1W1UA 4OHCA 4L5YA 1LPPA 1ZCJA 4LE1A 1L5NA 3H42B 2J8ZA 1L8QA 3H1TA 4XR9A 1RYHA 4YCSA 1SD5A 1FJGB 3JQAB 3KJNA 5AJXA 5JMPA 3U4CA 3SKXA 3LQ2A 3W2TA 4F8YA 2JJMA 4MJLA 3K70C 1FVOA 4NTZA 3IR7A 1OLSB 1TW2A 3OIYA 1PNRA 2PRYA 1NJ6A 5AHOA 1NULA 1XZ8A 1YA4A 4HLQB 5BQXA 3M5CA 4N9QA 4HEHA 3LWNA 4DUZB 1ZCAA 1LBQA 3CTPA 1QCCA 4J2TA 4X8OA 4CM4A 5KC9A 1JN0A 4AO7A 3WJ2A 4G0QA 1FDIA 5JUWA 3MOSA 3NETA 1GZ4A 1T2UA 1XLTC 5CVVA 4R2HA 5HFAA 2Z08A 3WMRA 3GEPA 4RETA 1KERA 4Q4JB 1TIBA 4Z8YA 1P1HA 2Q5LA 1LKZA 4IZHA 2JW5A 1SUIA 2WUEA 4OIFA 3T3MB 2N47A 5FWXA 2DCMA 3EXG2 4QA9A 1BS9A 1J8FA 1N1MA 1QYXA 5C8YB 4CKWA 2IBSA 5BN4B 3FHTA 2X2PA 2W6ZA 2XUPA 3B6KA 3KHTA 1ZWKA 2OVFA 3ZDEA 3ZU5A 5C4IA 2D2FA 2BTQB 3DNFA 3GFVA 5J2TA 1W36B 1BS1A 4AY4A 4NCHA 1VYTA 2QN3A 1Y7TA 5GINE 3CF2A 4Z0TA 4M0EA 3TL3A 1ZR4A 2IP2A 3AVQA 1QVWA 1KDPA 3GLUA 5C8YF 2QR2A 1SCAA 3AONB 3KJXA 3S2UA 3RIHA 5AMXA 4ASUD 4BATA 3KQHA 3T0IA 1N9GB 1NLFA 1FS5A 4XQ0A 2DX7A 3D8HA 3VZQA 1S9HA 2CCKA 4JC0A 1UKEA 3MWJA 1K3UB 3PU6A 2ZYTX 4AJLA 5JC8A 4TLLB 4CMEC 1REQB 2FPGB 5EP1A 2W6IA 2AKAB 2I65A 1RJEA 1Z0IA 1IBSA 2K5UA 4H3HB 4DCTA 4ZFNA 3QEMA 4RTMA 4HH3C 1BW9B 2AG1A 2ZE5A 1SU6A 1FBTA 4OI1A 3HBAA 4MKXA 8GPBA 5G2OA 4MRAA 2ZREA 3PHGA 3V2IA 4CEJB 1KRXA 2YHBA 2HF8A 1N5IA 1NUPA 5J4HA 2FFBA 2NXNA 3LCVB 5TQ0B 3Q3HA 4C5BA 2H16A 2QXUA 3DMPA 1WUJS 3EHEA 4R1SA 5AKEA 1H66A 2OCLA 3GFOA 1TJ5A 4NE2A 3RIGA 2JS7A 3PR2B 3HN6A 3QE0A 3IUMA 1E32A 1ZBDA 3JRWA 4XYEA 4F1JA 2R85A 2W2TA 2WJIA 3CUYA 4CRWB 2HWXA 4CI0B 5AVXA 5B57C 2JKZA 3W3AH 5BWCA 2BFOA 5JISA 3I5XA 1WSAA 1L5FA 1YBVA 5FOSA 1DT5A 1DCKA 4CU2A 4CKEA 5LZ9A 4D45A 3BILA 3EMKA 4IGEA 3U1BA 1E3DA 1XCOA 4BJ5A 4FR2A 1VHJA 3ITKA 4ACAA 4RHYA 4CWAA 3HXMA 4B6OA 1XU4A 3DOUA 2BCGY 4JC4A 2PKWA 1R4NA 1RQ7A 3DQPA 4MUJA 4NYMR 1MRSA 2AOWA 1Z29A 4MPTA 3CLUD 4UEOA 4A10A 3LXRA 2H0AA 3O4RA 3S0JA 4E5NA 2IHUA 4H0NA 3U3DA 3CEHA 1Z4PX 2WM8A 1M2VA 4IH9A 4KACA 4WLUA 4F5DA 1GD1O 4ZJPA 1U4OA 1P0QA 1NUUA 1AQ6A 2JK1A 2FMKA 2O8DA 1I13A 4ENPA 3OVMA 2QZ4A 2IIVA 1RAGA 1U2QA 1R4ZA 3IEVA 3LT0A 4D4GA 1H5NA 2WFZA 2XRFA 3CPSA 1NLMA 1KOJA 2J31A 1KRWA 4GECA 3JQFC 3VVCA 1TEZA 1F9AA 2Q3BA 4B6EA 1EB8A 4PX9A 1LQ2A 3SIXA 1UIMA 5ELLA 1T9KA 3UJCA 5L53A 4DIOA 4OQLA 2UYCA 2GXUA 1NU6A 5JYCA 1RXIA 3OC6A 3HXQA 3M1AA 1ECJA 1XKLA 4P2GA 4U0JA 4CIDA 3FVTA 1EP9A 3ZOKA 2X0FA 2X0KA 1WPQA 3ZWNA 1GN8A 1NFQA 1Q1EA 4JVNA 2PQ6A 3DEZA 5YASA 1EUZA 3DXYA 4RELA 1IBMB 1WXHA 4ZYTA 4UU7A 3ZWAA 2X0NA 2PUHA 1QLHA 4OH1A 3OU2A 3DEYX 4FINA 3W5SA 4FFLA 5IYZA 1M6NA 3KKKA 4HUJA 4PIVA 3AHGA 2WM9B 4QD3A 1FU8A 2VF5X 3T7CA 1NSYA 1SOMA 3EVGA 2ZTSA 4TS3A 3SOPA 2XF8A 3AHIA 5AHXA 4WJLA 4AQ7A 3TQTA 4E2ZA 2EFHB 4B3BA 1FNBA 2XUJA 3DDWA 5KOIA 3GLFA 1RJGA 1KK0A 4P0TA 1A69A 3PWKA 5FRDA 1QNFA 3ZZTA 3QLJA 5F12A 2JFNA 1HKHA 4X62B 5AKKA 4EEKA 5B58C 2XF2A 4G0YA 6CHYA 3AKDA 2R0QC 1KDYA 2I99A 3INRA 2Y6UA 4FGWA 5LQDA 1QHHB 3QWHA 2CMFA 4RKRA 4K9QA 4POAA 1LUAA 2E55A 4Z4IA 3IILA 5FUXA 4MS1A 3BFVA 4KQFA 4BWYA 2OC4A 3JAKB 1S8OA 4S1PA 4LNUA 5KCZA 2GF9A 1P0PA 1WSDA 5HKKA 1KMHA 3CHYA 4EH1A 3K1TA 1U2EA 2XCLA 4H6XA 4J0HA 5H83A 4M22A 4KZKA 5F2KA 3N59A 2QI9C 4P1ZA 3EXIA 4AL4A 1V71A 4FPXA 3N8NA 3CH4B 3DV0B 4RVUA 4YREA 1M67A 4ER5A 3ZYCA 3OF3A 5ALLA 4EEXA 1NQTA 3TLEA 1ND6A 2BZSA 2PSSA 5GJCA 5CFOA 1ES9A 2X2EA 3BSSA 4KO4S 2ASEA 1U6JA 4I1SA 4LGVA 2ZRBA 1O1YA 1E9BA 1H2YA 1WPRA 1XZAA 1JB1A 4EGAA 3CCFA 3OPQA 1L8AA 3I1FA 4HXYA 5FHQA 1GQ2A 2D0DA 1RQGA 3DMYA 4N65A 4ADSG 4PQYA 1IQUA 3OOHA 4GP7A 2VDWB 1EIZA 4MKRA 3LXXA 4JOCA 2WOOA 1QZUA 4XLZA 4OB8A 1JE0A 3EPHA 1NBEA 2C78A 3EZ7A 3ZEAA 1SOWA 2F3UA 2SNIE 4EDHA 4Y1EA 2DEUA 4KGZA 2C83A 4DYVA 4TMYA 1YU6A 4UBIA 1BD3A 3F3YA 5AKZA 3DBOB 4BWGA 4QHSA 4F97A 1Q21A 3A1TA 1SEPA 1NXOA 2DBQA 1Z82A 1Z68A 4L8GA 3TNDA 4BVEA 7MHTA 1WUYA 1ZUD1 1RP1A 3WSVA 4OHXA 2GXSA 4UUAA 3MXTA 1DC3A 3CW9A 4R6WA 4EENA 2E4XA 4QICA 2P3QA 3OTOB 4N39A 3NIFB 3ZWMA 4XE5A 3KQLA 1RRCA 2NXEA 2LIVA 2JG3A 2BDEA 4X61A 4NZMA 1I6MA 1PFQA 4YCLA 1SPXA 2J6HA 5K0JA 1Z25A 2H31A 1QIHA 4EUFA 5CEEA 2ABWA 4AZ0B 1JAHA 3L8HA 3ZWVA 3JQ9A 3J7TA 4PV7A 5FTNA 2ZUCA 1DC5A 4RVGA 5EIEA 2C4WA 1QYCA 2PXHA 3LQQA 5FLEX 2B94A 3H9UA 4RTPA 1ID8A 4FGSA 3GR6A 2PFSA 5SY6A 1WLSA 1W4ZA 3SHTA 5KQPA 4J0IA 1E3LA 3HCNA 4Y6QA 4BRWA 2RGDA 1IK6A 2I3GA 2YFHA 4MR7A 5FPHA 4LFBB 1DJPA 2LCFA 3TD6A 5U1PA 2C58A 1XDBA 4OEHA 4DT1B 2P5UA 3ROTA 3TCNA 4IDFA 1WUIS 2VJLA 2G77B 4P33A 1WZNA 3PHJA 2C8JA 1AT1A 3DB1A 1G20A 1SXJD 3JAWA 2WU8A 3EPPA 3LNCA 1T36A 1T1GA 3AUKA 3AW8A 2GWRA 4G1BA 4GR9A 3UA4A 4BKUA 1ISSA 3ZIDA 3HK2A 1RWQA 4GGOA 1L7NA 1DI0A 3I5AA 2JL1A 5JXGA 4CDGA 3QNMA 3ASVA 2NADA 5HE9A 3LC2O 2QTTA 1LPMA 3KPVA 1NF3A 5AXAA 3M2TA 4X7BA 4MW4A 2OEPA 1P2BA 1UMCB 2IXEA 2ZYGA 3LYHA 4JLOA 4WMLA 2IE0A 3BD7A 2ZULA 4IFIA 1GG8A 3OZUA 2V7XA 1ZKMA 3Q1LA 4IIXA 1BYIA 1V5GA 2Z5GA 1JPUA 3FROA 2BW0A 4YO7A 1G5IA 1J20A 4CM8B 3HDQA 1SA0A 1TAHA 2JRLA 1P6QA 4YRKA 4ZCIA 2BUBA 4FYWA 3IVAA 1BIFA 1H85A 4HWSA 5DGIA 2FW0A 4ZXPA 2IPLA 3IOYA 2YRFA 4I8DA 4ZVKA 2Q2OA 3TR6A 4EUEA 5F7OA 1OTXA 2FUG6 4PIPA 5F4BA 4HB2A 2QTHA 2PKEA 1QM5A 5IK2D 2JGMA 1IZ8A 4JJAA 5EPOA 1H2FA 1ULTA 1C4KA 5KQSA 4KQ1A 4PONA 5AESA 5BV1A 1KP3A 1IN8A 1CUWA 2WTXA 1IPHA 1C3XA 1Z5OA 4E5DA 3RQSA 4C01A 2YBEA 5HIKA 4GRDA 2I2DA 2PR7A 4IHJB 3RRJA 3STVA 4PYLA 3WZLA 5INTA 1VMKA 2LUOA 2G9QA 3EW7A 5EWMA 3ETDA 1WKCA 1JJFA 2RHCA 3QKSA 4JLPA 3FCOA 2A0XA 4I1OA 1RWWA 4K87A 4OTZA 4CLRB 2NU8B 1AM4D 1UBLS 1XEXB 2Y1KA 3OCJA 4J3JA 2I3AA 3UFBA 1X1EA 3EUWA 4FYKA 3AF3A 3KV3O 2NAFA 5K45A 2AW5A 2QLFA 3EIWA 3IEKA 2Q6LA 1N33B 3T94A 3F9CA 2ZS9A 2ZRKA 3OM1A 1UEIA 4IHJF 4X00A 3CQ9A 3AVPA 3A2NA 4YXWD 4A15A 5IM4A 4G01B 2E4YA 3G5UA 5BN5B 5K3FB 3D0RA 2PZMA 3N2YA 2GAOA 1NLUA 2JLCA 2GXQA 1SCBA 2JI4A 3A1FA 2ZDQA 4ALIA 1UBTS 2GPSA 1ZIOA 3DKVA 1GCAA 1CZHA 3VYVA 3HKEB 4RJTA 4MX8A 4NP6A 1IEQA 3GFRA 5F7JA 4CKBA 2YZNA 5AQEA 2JLWA 1GNTA 2XE7A 4XYLA 4X0EA 3TGLA 4ZOAA 3L0PA 1OWNA 2EJWA 2F67A 1K8YB 4OLHA 1V43A 2XDQB 1ZI9A 4J0FA 3D2CA 3ND8A 2G9RA 4I4LA 4KSBA 1JQDA 4MIOA 1IEXA 1XUOA 1IYZA 1Y5MA 3AUYA 1H6DA 3OD5A 3Q40A 5HKOA 4YJHA 1BWRA 4V1CA 4J16A 5SY9A 5F2NA 1HE2A 2MT9A 3BL6A 5E9JA 4BAUA 1A2KC 4UBJA 1N6LA 5IDWA 4JN6B 3SVLA 2Q5QA 3DZDA 1C5KA 2ZJAA 3DE1X 4B2IA 3UG7A 1SZCA 1AHNA 3LBNA 2C4VA 1O89A 5IJWA 5CAEB 1AF7A 1V35A 2JIPA 1UMDB 3CMCO 3CUEF 1BC5A 3HY4A 1LNZA 4GMGA 4K46A 3AF2A 4MYSA 2WMOB 3AF0A 2E7ZA 3G6KA 1OAKA 5LQMA 4FT4A 1NDHA 1JI0A 3V3TA 1Z6TA 3NPAA 5HX7A 2O8CB 4QGHA 4Y8VA 5BXQC 1KJJA 2H48A 3VR1A 5HF6A 5EFZA 4DZRA 1WW8A 1LB1B 1IPEA 3C4QA 3SBOA 3FHOA 4LISA 3EZLA 4N5MA 3F4BA 2JFVA 4RZ3A 3BXEA 5H68A 1UZMA 5HILA 1QP7A 2D5AA 1Z16A 3CO5A 2RGUA 4ZYYA 4CEHA 3VTZA 1TAQA 3CZMA 1IHUA 3PSHA 1IXKA 1PJBA 3T7TA 1XDSA 2BM1A 1WABA 1LWOA 2DR3A 3UAYA 3I2YX 1QQ6A 1R3DA 5HIAA 4FEEA 1DBSA 3HCDA 2YIJA 4KMSA 1M6YA 1OPRA 5GONF 4ALJA 3AINA 2Q4DA 2YASA 3A1UA 3S27A 4JYPA 1LRLA 2ZI6A 3AK4A 3HKDB 4GMKA 4D9NA 3SBXA 3W1EA 2Z2XA 2YY7A 4AMBA 1ORWA 4MKHA 2Q8PA 5DM1A 4BGDA 2BOVA 1RRKA 1T1SA 1PIWA 4BKRA 1DVRA 5PNTA 2B9VA 1XTSA 5EKDA 3GP8A 1Z4OA 4QXQA 3BRQA 2G5GX 4CYMA 4TYNA 1IG0A 4MUKA 3IBSA 4HVAA 2X7XA 3PFCA 2Z3ZA 1ZIYA 3D3WB 4KPFC 3BIWA 1PR0A 5JSZA 4JEHA 2W2VA 3ORHA 4CPDA 4DKJA 3RGWS 1DAPA 1PBNA 4P5DA 2ZIVB 1UQUA 3ZZMA 2RB5A 3FDJA 2V9ZA 4MWBA 4RD0A 3UWKA 4EQ6A 4B7XA 5LOVB 2VXYA 1XMIA 2XAAA 4YT5A 4HDRA 3FDXA 3SDSA 3VNQA 2JPDA 4ZC8A 1JWBB 2ZRDA 4LDPA 3UK1A 4E22A 1LSUA 4CM5A 5CT5A 4YMHA 1GNPA 3DDOA 4R1PA 4U6SA 4EITA 1OBHA 1FNNA 1Z6QA 5JPIA 1LDGA 4DZTA 5MGNA 4HAVA 2PN1A 3I01M 4L3VA 4UHCA 3BF8A 5DYWA 2WNSA 3MGAA 1IBKB 1ISIA 1GFSA 2HDOA 1D2CA 1GOTA 5ALXA 2YXNA 4Y2UA 3SQDA 4Z2AA 5LOVF 1POXA 1R0BA 2NOAA 1WVGA 4K6FA 3UJ3X 1E6LA 1NOKA 2XV1A 2QPTA 1QVVA 1J1IA 2OTCA 3H5RA 1R37A 3PD7A 4Q37A 3A2LA 4DYHA 1ZHHA 2CZGA 3WRVA 1M34A 1DB3A 2O2YA 1NJGA 3B85A 3AEZA 4P86A 2X15A 1AB5A 4PFJA 1TZCA 4MCIA 1Q5PA 1RRPA 2BTOA 4XVRA 3IHTA 4Q7EA 3VX3A 4FE4A 2NZVG 4B3GA 4DL9A 1KO8A 4PM4A 4FYVA 5FFMA 4NATA 2Z83A 1CQIB 4R8MA 5J5CA 3WV5A 1JMVA 5T4BA 1J0DA 5ALTA 5KTNA 4BNTA 3O1HB 4U4AA 2ANCA 1ZD1A 2BIFA 3HI4A 3W2HA 4AG5A 1RE1A 3L40A 3GVIA 3NH6A 4JT2A 2BSXA 4GOLD 4F45A 2NU7A 1QDEA 1OR8A 4A8JC 3WK5A 3HSKA 4C43A 4E46A 2I22A 1WIWA 4HQ0A 3TLGB 4WA8A 4AF7A 2J7PD 3CPHA 5DEOA 5CLFA 4UC0A 1Z3IX 2VHVA 1QR2A 2ZB2A 5GOZA 2G1AA 2G04A 4GO1A 4BFCA 1CQJB 2P2NA 3EXEB 4KWIA 2HQ1A 3DZFA 1C0LA 1KAEA 3G1TA 4EPRA 1Z6PA 4G1EB 1CYDA 3ETHA 4LDNA 5EJEA 1AD2A 3Q2IA 5F9HA 3H7AA 4J1NA 1DUSA 2C2MA 1BVYF 3E84A 2ID9A 3T7RA 4CODB 4A0SA 1E9FA 2ZTVA 3DUFB 2XOKD 3E0XA 4FLMA 1WF3A 3LUJA 2NO4A 5LUAA 5BYJA 2NQ2C 2RMKA 3TSWA 4BFYA 4D3FA 4OY3A 2GK4A 1YR8A 5DOVA 5LLDA 4HWOA 5A5EA 3OUUA 3GPBA 4GKVA 1RHJA 1I4LD 1UAYA 3E82A 3QJGA 2ZUFA 2AG6A 1KZ4A 2DMRA 3LW7A 3QENA 1X15A 2CLIB 2JKVA 4G65A 4YNBA 1X0XA 2E4ZA 2ENWA 4KQJA 5ER6A 1FS4A 2H0RA 3U3JA 4KPEC 1RMYA 4FFRA 1AQYA 1JDUA 3WLHA 3KUXA 3EBOA 1B6TA 4H0CA 2HIAA 3FVVA 4MDFA 3OSUA 2FHSA 1X7HA 1BDIA 2MSDB 2AQKA 1COZA 2BF4A 2OQRA 3WIUA 4G8BA 3E9RA 4P58A 1N0UA 3WKDA 5KYWB 4FT2A 2YUIA 1XRMA 3SC4A 2Z43A 1D0VA 4G86A 1K1EA 3IIMA 1MV5A 1Y1SA 2GBFA 3GZJA 3O8QA 3QFCA 3DGFC 1P1JA 4OK5A 4Y2QA 4K26A 4BC1A 2XT0A 3DAYA 5EXTA 2QXTA 1WL8A 2AW3A 3B6JA 5T67A 4EABA 3KVYA 1L5OA 2JEOA 1U0FA 4X6YA 1GTRA 2D4HA 3R3XA 1FJHA 1U7WA 3HGMA 4PBTA 3FNIA 4IQGA 4MUGA 1OI4A 4W7IA 4ZT7A 5HS6A 2QJTA 3GJQA 4OU4A 2NV0A 3B2NA 4I55B 2YR0A 4PFSA 2RKBA 3VH3A 2V7EA 1TD1A 4U7JA 3T1TA 5AVTA 2HLNA 1OE0A 5FQOA 1DIOB 2Y1LA 4HEJA 1L7PA 1Q7GA 1P2GA 3JATA 4O8CA 4QWWA 4JENA 1PL0A 4UKDA 4BE7B 4D02A 2PUDA 4DBZA 4DDUA 3E3NA 2AA3A 4RHXA 4UZFA 3VFDA 4IINA 4EKEA 4BNKA 2DF8A 3DTNA 2OCXA 3R3UA 4AUEA 5TPWB 3GLSA 3AFMA 1QAQA 3TI9A 4KV7A 4UBKA 1SBNE 3OIUA 4LC1A 5C81A 3GPCA 3V8NA 4E2WA 3DL4A 3KSRA 4HAOA 4KREA 2ZGVA 5ITWA 3LQKA 4I66A 5LM3A 4DHWA 3GVHA 5AUPB 2DPXA 3ZD7A 2FXVA 3T99A 4Y9UA 4TRRA 2JGDB 1OU4A 3UANA 4WBNB 1U7PA 1YL7A 3EGXA 2QYSA 1E18A 1ZKDA 1HFKA 5CITA 3GLRA 2R62A 1FVFA 3WJ7A 3D6JA 3AH8A 2WYIA 1NQXA 1BU5A 2LV8A 4Q9NA 3BRWD 1B6GA 5I48A 5I6DA 4FS8A 2FQYA 3WAGA 2WWWA 4Y6LA 4BLQA 1FMLA 5D7NA 3OFVA 1RCTE 4WBNF 2GZ2A 3PFHA 1LTHR 3IMEA 3E3LA 4JV5B 1VHDA 1QZ3A 3D6UA 3NC1C 1DNPA 2I1QA 3PGXA 4JBGA 4PXAA 4RCYA 3QPBA 5AM1A 1JVNA 3TMYA 1W4CA 2GJKA 3VZRA 3MMSA 5B4VA 5LMCA 2YCBA 1UBFA 3U4AA 4Q7QA 1OJLA 5G1NA 3BA1A 5KNBA 5BN3B 3RVSA 4KJZA 4KXUA 2NUBA 4N1AA 1YKSA 4LXTA 4ZO9A 5EJIA 4IDOA 5ESXA 4CUJA 2L2QA 2Y99A 1EBFA 3BGDA 3K8YA 5JCOA 1CTQA 3K8ZA 3N2KB 4BGIA 5KYTA 2ZTMA 4LGYA 2JJ1D 3EA5A 3NTLA 1PGNA 3OZBA 1P2SA 4XUCA 3V6MA 4MROA 1EX9A 2AF3C 4C7BA 4EJSA 2DYKA 2C3PA 1XJ0A 4KFUA 3GJRA 3UJNA 5D3QA 3O2NA 3VPAA 3DMTC 3WGNA 1QO0D 3UPDA 3JXEA 3KZOA 4ZEMA 4OQXA 4MLPA 1KMIY 4X3CA 4P4SB 4J1SA 3RTAA 2GUGA 1M2WA 3MS7A 1ML4A 4R3WA 5IPFA 4JVMA 3C97A 3LAWA 4JI4B 3H1PA 4C7KA 4J94A 2VWQA 3UAXA 3KU1A 1HFJA 2EKDA 3F73A 3ZX4A 4R16A 2OSBA 5EERA 2XNSA 3MZ0A 2XEDA 4QXOA 4YP0A 2R66A 5JMOA 3HVUA 3W6ZA 2HV9A 4R0MA 1PSZA 3RS9A 2VR1A 2QA5A 4ZMRA 5IFLA 1U3CA 1UT6A 2BFEA 5DEIA 1L0BA 2PA3A 1XZBA 3TLKA 1YZTA 3N75A 3E7PA 1K98A 3UK7A 3LDFA 3LLMA 3QQPA 2J1LA 4MEAA 2JFZA 2YHIB 3M6XA 1N75A 1U3DA 3MGBA 1XEFA 1AE1A 1XZJA 5JANA 1KQOA 1VBMA 1QAMA 3CH6A 3SYLA 4CMJA 4PQGA 2OQIA 4UREA 2LPMA 3PUWA 4WSOA 2Z3VA 3OTGA 4ZI7B 1IM5A 3WVNA 5K01A 2EP7A 4YB8A 2JFUA 2R65A 2XA1A 1V7ZA 4D0NA 3N2EA 3G5MA 3EASA 4GBMA 1SMKA 2WEKA 4UFOA 2A6PA 3NHPA 2GM4A 4AC9A 3QNUA 2EERA 3D6FA 4NYIR 4DXAA 2VJBA 4REMA 4DDWA 3PVSA 1CQPA 2CUNA 2E5FA 4IV5A 3NW9A 1PNTA 4MTLA 1HNWB 3I28A 3QU4A 1JBEA 4HVCA 4ZI7F 1R12A 3WLQA 4L16A 4BLSA 1T43A 3SZ3A 5AW1A 3EEQA 4MDYA 2XNDD 1AIPA 1GZ5A 3SZRA 2X1VA 1BGWA 4YRBA 1WW3A 2HWWA 2GTIA 4I5EA 3GN2A 5TEWA 2QN6A 3M83A 3DEIA 4HYQA 5FOTA 4ZVSA 1WV1A 4L27A 4Q12A 2WAYA 4NICA 4C22A 1WMBA 2BEUB 2OMKA 1EG7A 1D03A 3FOWA 3MJHA 3TL6A 4P93A 3ER9A 4ML3A 1Z2OX 3FZGA 2AFHB 2NGRA 3MCTA 1KEVA 1OZHA 4Y0VA 4Z86A 5JS6A 1X2EA 1QG0A 2XT6A 1WB4A 1JLSA 3DS8A 5GMOA 2WDPA 1DDGA 3T9BA 2F9FA 2Q41A 3BG5A 2UZIR 2P2DA 3OY2A 3M1LA 3PCXA 4OI4A 5CH8A 4LF8B 1X8XA 1YR1A 3MUFA 4P92A 2H1RA 3LKZA 4C1BA 3M4XA 3AHHA 3RSFA 1SC3A 1HNNA 1I4EB 4H59A 3RYFB 2C4HA 4RPJA 5K4AA 2R1UA 2RJOA 1I5EA 2PYIA 3DULA 5COBA 4F06A 1RD4A 4HQRA 5ALRA 3FB4A 2VJQA 1ACLA 4UHFA 4PG8A 4Z4CA 1ZH6A 1HSZA 5JH7A 1KFCB 3OY7A 2LW7A 4OB7A 2UZ4A 2GPNA 3DOCA 3IDFA 2ZUTA 2JAHA 3I1IA 3E05A 5L51A 2YJ3A 4UW9A 1GZVA 3VZBA 5J47A 4NBVA 2B4TO 1U1GA 2OVBA 3KXDA 1UCFA 4FEAA 2PBRA 4PSUA 3SX0A 1DADA 3OTHA 4DA8A 3U09A 1DDOA 2WT9A 2ONCA 1G20E 3IVXA 3KEOA 4X20A 4E11A 4F85A 1Y80A 2BGMA 2XCUA 1E9RA 3CCCA 4KQEA 2IOFK 1SQGA 3MS4A 2BEWB 5CDFE 1J0CA 1QYDA 4UEWA 2NO9A 1TA0A 2OQVA 4KIFA 2WINI 2IY8A 1WD7A 5G4LA 3RF6A 1SCUA 4DR4B 5A0VA 4AY2A 5KC8A 3AF4A 3AFOA 1H8HA 1XU9A 4RVNA 5L3SA 2DVMA 2OYSA 5EHIA 4I5IA 3DTYA 1X9HA 4FCTA 2IU0A 3DYIA 4CETA 1SVIA 4IXDA 2QD4A 5C80A 4BU1A 1H4TA 2J0EA 4J3NA 5FP0A 1YVUA 2QD5A 1K5DA 2WYOA 1J8VA 3C6ZA 1MQAA 1IY2A 1PUIA 1RMQA 1ZSVA 1Z8FA 3KQQA 1E59A 1MKYA 4EF4A 2X9VA 1PD1A 1TYAE 4MV8A 5GM2A 2NPOA 1K5HA 3KKOA 3KVNA 3SP1A 4XM2A 4ESHA 1J23A 2KLBA 1GAJA 4D4IA 4PS1A 3NIGB 2JRCA 3VOTA 1HE5A 5KAPA 2Z2YA 5KUTA 4L57A 2YWDA 2PH3A 4P3YA 2Q3LA 4J76A 2G80A 3SK0A 3ZGYA 1W48A 3MWYW 1UK7A 2ODEA 3RO7A 4Y6GB 5GADl 4NULA 4R2XA 3RD5A 4INJA 1I5OA 4OH7A 1P9WA 3MMPA 4TXHA 1W0JA 1XRSB 2IHYA 4LNAA 4PG6A 3I12A 3BN3A 1HBJA 3B36A 2VP0A 1KZHA 2H9AA 1G38A 3M4ZA 4FS3A 4RSRA 3Q0IA 1U7TA 1FX1A 1Z56C 4QQRA 4V39A 4ATNA 4TL8A 5K8IA 3H0EA 16PKA