3SHVA

Crystal structure of human mcph1 tandem brct domains-gamma h2ax complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
KPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPAMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWVLDSITQHKVCAPENYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Microcephalin
publication title Specific recognition of phosphorylated tail of H2AX by the tandem BRCT domains of MCPH1 revealed by complex structure
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 56
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3shvA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3shvA02
4JLUA 2M2IA 2XNKA 3K0HA 4BMDA 3AL3A 4IFIA 2AZMA 3FA2A 1JNXX 2COKA 1IMOA 1WF6A 3SHVA 3K15A 2WT8A 3QVGA 3SZMA 3U3ZA 2EBUA 3II6X 3PXDA 2EP8A 3OLCX 2LE0A 4ID3A 3K05A 1L0BA 1T2UA 3PXBA 2INGX 3T1NA 1Y98A 2R1ZA 3HUFA 3JVEA 4N40A 3EF1A 3EF0A 2COUA 1T15A 4XPZA 3HUEA 1OQAA 3T7JA 1KZYC 3I0NA 5ECGC 3T7KA 2XNHA 2K7FA 3COJA 3QVGB 2NTEA 3K0KA 3PXEA 1L7BA 3PXAA 2E2WA 1GZHB 3SHTA 2HTFA 1CDZA 2K6GA 2VXBA 4OFBA 1IN1A 3UEOA 3PC8A 2D8MA 3L40A 3PC6A 2L42A 3PA6A 3K16A 2DUNA 2ETXA 3UENA 2ADOA 1T29A 3PD7A 3SQDA 3L46A 4BU0A 4U4AA 3AL2A 1N5OX 2VXCA 2JW5A 3I0MA 2EBWA 4IGKA 4Y18A 3T7IA 3PC8C 3L41A 3PXCX 4BU1A 4BMCA 1T2VA 1Z56C 3PC7A 4Y2GA 2COEA 3KTFA 4XQ0A
chains in the Genus database with same CATH superfamily
4CNQA 2CXHA 1QHFA 1KGSA 1U2ZA 3BMOB 3AW8A 2VBFA 2WP0A 1OLUB 2XT0A 3KKZA 4IS3A 1A04A 1L4EA 2XJ9A 4KAFA 3SKVA 3VR5A 2GCIA 4CMGA 2GSWA 3OF2A 4UU7A 4NF2A 5ENDA 2FZVA 1RXWA 1KI3A 3ESXA 2HGZA 5FTNA 3MGBA 1QKIA 2Q0XA 4HEJA 3ECAA 3D02A 1QK3A 4WN3A 2ZRCA 3F7OA 2GD1O 3AKEA 1OTHA 4ZVKA 1C4WA 2M6LA 1QHSA 5ENVA 1MHPA 3EH1A 3OX3A 1PW7A 2C95A 3FLBA 3II6X 3PJEA 1OILA 5G4LA 5GV7A 5JYEA 2VOEA 5KSWB 1OBFO 1ORDA 1NF8A 3QKSB 1AHIA 4BQQA 4PAMA 4TSFA 2HWYA 5AT1A 2PDAA 2WR8A 2FGJA 3H2GA 4C76A 4F60A 3LQ1A 2X77A 4B82A 2YY5A 4RSGA 3U3DA 3G2QA 2BZ1A 3VC1A 4RHFA 1SUBA 3HXLA 3LHDA 3PGKA 1I13A 4RDHA 3CNEA 1NY6A 1I2CA 4JL6A 1I9GA 2GYVA 3CEPB 3D2CA 3RAGA 3ZCPA 5JY6A 5EKTA 2BISA 2IOQA 2DWPA 3LCVB 3CLRC 4K0KB 1BXGB 1WNTA 5F4BA 1OKKA 2GQ0A 1FFXB 4IGAA 5JXIA 4B34A 3GO4A 1ADBA 2FPIA 2X5NA 1R0XA 4EA9A 1G8AA 1FXWA 3GP5A 4FFBA 2A7QA 1KDZA 1HT2E 1HPLA 4MVJG 5KVQA 5JBQA 2GEVA 1GTRA 3BFJA 4G1MB 1FC0A 1WUJS 3NUGA 4M0EA 4E14A 2BCGY 4RD1A 2NMVA 1SOUA 2LUOA 1DG1G 3D7RA 1BOOA 5DISB 4KOEC 4R1SA 2OM2A 2RG7A 1I3NA 4FVTA 4RTQA 4KVZA 3A14A 3THYB 1II0A 4H7IA 1GCOA 1DAHA 4D9IA 3UAXA 1C7ZA 1XVAA 2BW0A 4I5GA 4KVGA 1JQLB 1YI8A 4OSEA 3K9FC 1FU4A 1VG0B 2E49A 4MUEA 1BX0A 2FVYA 4PG5A 3CJTA 1PZXA 1S5PA 3KC2A 3OPVA 1FY2A 2JATA 5BORA 1L7QA 4C1BA 2XUAA 5KNDH 1ZWKA 2JLRA 3FDZA 3OHPA 3VR2A 1VL0A 2DQ4A 4YMTA 2OEPA 2D2XA 2D1TA 3D1LA 1SVSA 4YC7A 1D1QA 1QTRA 3MUEA 2QJWA 1JEEA 1PGJA 2IDJA 2JW5A 1Y8QA 2I4IA 2YQ5A 4IHKA 4DBVO 2O1SA 2OCDA 1BKDR 3RRFA 3QKRB 4EZBA 1XK6A 2OPBA 4O6VA 4YMWA 3WBJA 4MWTA 3ZWMA 3TJZA 1M1NA 1YBMA 5DPMA 4EELA 5BXYA 1RC1A 4C03A 3IEPA 5LZ7A 1UJCA 4LTMA 2ZTMA 3AEZA 4N18A 4ZRMA 2VDKB 2BKAA 3EOZA 4P5DA 4DPLA 3KSBC 2ZSJA 1N5IA 1CVRA 5DTJA 4N5NA 3CZ5A 3ZGYA 4FOTA 3BTVA 4F86A 1BW9A 3A1FA 3TEJA 1YIDA 2AN5A 2BLLA 5LYYA 4I5EA 4OLBA 1KVUA 1BH6A 4NOJA 4POOA 2L82A 2QN3A 3LU1A 5A7GA 2M98A 4QDUA 1RXVA 3OQOA 3LQ4A 2VAPA 1VKZA 3T52A 4QBKA 5CK5A 2GZAA 5DHFA 5MGBA 3CF6R 3GLHB 3NEJA 4B3CA 1CHNA 3VDXA 3D6VA 2O2HA 2HLDD 4B8YA 1LS1A 5KYUB 5IT4A 4RXTA 5G4KA 3U7IA 4EW2A 2C8KA 4IF6A 4ZYWA 4LV6A 1WZEA 1M1YA 3MOSA 4GWGA 2QVZX 1FP1D 1JDTA 2EJTA 4MRVA 1C8VB 4DCOA 1ULBA 1DQNA 3PWSA 3NFRA 1QFMA 1P4SA 2NUTB 4OAPA 1DAMA 3TLMA 4CM4A 3V3TA 5IEBA 3SCZA 3FCUB 1X0XA 3FPAA 4MIEA 5HTKA 1S89A 4DNPA 1YZVA 3D6MA 2E0IA 2OCAA 2GXAA 1OI3A 4RVNA 3AONB 3TMKA 1D03A 5FUXA 1Z2AA 1AGNA 3C5WP 3VH4A 4NAVA 2BMWA 1BEZA 1RRFA 1RYHA 1XTUA 4OI2A 2I62A 4QEKA 2Q29A 2XQIA 3LW8A 5KMGB 4YH1A 2MIIA 4ARZA 4BVEA 2A3NA 1UFVA 1CD5A 3O8RA 2VYNA 2CJWA 3O3CA 4QXQA 3ZWAA 1W2WB 2FZKA 1CJKC 3TRDA 2G5GX 3Q0TA 3AR4A 4BCCA 2REQB 4ZOLA 4TZTA 3LA6A 4IQ4A 5CDYA 2C4NA 5K0SA 2HJ9A 2FR8C 4EQ6B 2I8CA 4JMPA 3KWMA 2Z04A 4PGAA 3I2YX 2PS1A 1XZJA 3UXHA 4BVHA 3IQDB 1XCOA 1MTOA 4PU0A 1G4HA 5JZ9A 1AS0A 4GXNA 2YWRA 1GAQA 3MYRA 1FU7A 1EVYA 4MUGA 3WWYA 3CRMA 3AF3A 3H1PA 1TJ4A 2ARKA 5JECA 1J1ZA 1UPTA 2Q9UA 2QN8A 4HP8A 3OOJA 4J1NA 4UUPA 3T1OA 4AJIA 4BNNA 1KXZA 3N70A 3KZOA 2A9QA 2CNKA 4JJ4A 2XQKA 1Y1RA 2FPUA 3RHFA 4XIIA 3BL8A 2EXXA 4ZZ0A 2FE4A 1U2PA 3B1WA 4PZYA 3L49A 4XDYA 1ARZA 2MOKA 2GERA 4FGLA 1ZI8A 3THWB 4IFTA 3GLHE 2XWBF 4V0QA 1OC4A 1QCDA 3PQ3A 3H99A 4CMEC 4CM9D 5T4FA 4JJAA 1WXXA 1X7XB 1KO4A 2BFAA 5F5NA 1CUHA 3AM3A 3PQDA 5FA8A 4MTCA 2HD4A 3M8KA 1NMQA 3N2ZB 1S4MA 4MUMA 4LZLA 4PLCA 2EZ8A 3T12A 3ZXSA 2ZB4A 3SFZA 5EXEA 2C94A 4JCCA 3TXXA 4D3YA 4DCNA 4RQAA 1Q77A 4DA6A 4E08A 1T1GA 2BRUA 3T3IA 3RHZA 4D43A 1KI2A 3L7AA 4Z8YA 1TUBA 1FYDA 4NBWA 3H1EA 1CJUC 5JD4A 2R6AA 2AMJA 4PN7A 6CHYA 5LP6B 2REOA 3CHYA 1R0KA 1G64A 2H29A 2HOQA 3DNMA 2Y0EA 3IR7A 4XWGA 2HJVA 4HDKA 1G8MA 3GHYA 5L3ZA 3VR4A 1F20A 1M74A 4OJMX 1L1FA 3QUQA 1E5TA 4PICA 4RF4A 1JIIA 4YCCA 1P72A 2A86A 2CWWA 4LQDA 5EL0A 3E2PA 1PKEA 3BERA 1PJAA 2XUPA 4RK1A 3UH0A 1NI5A 4CCYB 5KTMA 3HO8A 2O8CB 4RE6A 4XWOA 1ULSA 3OZAA 4I19A 1IBLB 3AL3A 4K9KA 3ECSA 2EJVA 1NUUA 1QKJA 5CTAA 4QNMA 2D1SA 4J0KA 5IAEA 1J42A 2ZIXA 5BSMA 2NP6A 2YVQA 5J2UB 3TK1A 1K7EB 3PUVA 4B44A 1NBHA 4EFLA 3KLMX 1UOOA 2FKNA 2PKWA 5DN9A 2VJMA 5IBCA 4E15A 1R6TA 1TB4A 3BJZA 1R9GA 2JFNA 2M6SA 3OE1A 1BA2A 4UARA 4UM7A 3RYFB 3U5ZB 1Z68A 4TM8A 5EJ5A 2JJMA 3O21A 2HMSA 3M2TA 3I9MA 4GR5A 1O7JA 2H4JA 3R6WA 4BFSA 3QU2A 4BCDA 1M7HA 5B12A 3PKJA 3U16A 1CUXA 3W5AA 1JG2A 4YJ3B 3CW8X 1PZGA 2RAVA 2GO1A 2HWXA 2O5VA 4M7PA 1KDTA 1NLZA 1QUFA 2BGRA 5FO0A 4X44A 3TD9A 1NG1A 3AMVA 3N58A 1QIEA 1A8PA 4QUGA 3UGQA 5KO2A 1PF7E 1XXHA 2VDMB 3SP1A 4E5PA 1XEWY 4PS1A 1GZ3A 2PRZA 4PTYA 1IZ9A 1VL8A 2J85A 1AHNA 3QLVC 4LNUA 4QD3A 1UKBA 2B34A 3BX1A 2OTCA 4Q1VA 3IDQA 1LVGA 3D3NA 3GBVA 4LQCA 3GJZA 4QUKA 2YJTD 1MJGM 2QX6A 3T1HB 2D2EA 2DY1A 4LOIA 1K88A 3ABRB 3BQ9A 4RGVA 4QUAA 3V3KA 3C97A 2ACWA 3M3PA 3RPEA 4EJSA 8ATCA 2HTFA 3F6SA 3PA8A 3OT4A 4Q6BA 5KBYA 1NQAO 1Z0UA 1B0AA 4BRSA 2G83A 2PX3A 4QPJC 3R3XA 1H1TA 3H97A 3BL5A 3F5SA 4LXUA 3C3KA 3AC0A 2F3UA 1RJGA 1X80B 3F78A 3O8QB 4AUKA 5LFAA 4TTIA 4AYXA 4TV8A 4IRUB 4YCAA 2ID7A 3F5DA 3SICE 2EYQA 3ETGA 4GOLD 4A15A 2PMWB 2EGUA 3V55A 4NFLA 4O2AB 3Q87B 1LB1B 4P1ZA 4S1PA 4DOMA 3UB3A 1X7GA 4GKBA 5JAOA 2ZI6A 4MPDA 2DHDA 1ISJA 5ALEA 3ZJUA 2ZRMA 5DLYA 1GARA 5IT0A 3BGOS 1AK2A 3SQDA 2HYDA 2IT1A 3EXHC 1SH7A 4FWIB 4OK6A 1CY6A 1Y4UA 3HLTA 5H8WA 4KQJA 4BNXA 2CZQA 5DCUA 4DXDA 3JAWB 3GQVA 4Q3KA 3HYLA 3ZVMA 1AN0A 1ZCZA 3CUYA 5JZOA 3TLKA 1QE3A 5LLTA 5H3LA 5ICSA 3BZUA 3PIIA 4CFZA 4QTTB 4U6NA 4DJDC 3B8HA 5KWVA 4GX0A 1O5TA 1QDUA 4BRZA 2ALJA 1ZH0A 3H3FA 1WDWB 3ZUGA 1UBOS 1Q15A 3W3ZB 3UK1A 4EI7A 1UBSB 4DM7A 3PHBE 3PPVA 1PO7A 4YRTA 5EP2A 1EXDA 3CV3A 2P2YA 2GD2A 3WFZA 1EBFA 4NZ9A 1XB2A 2CNNA 4UTOA 2NU6B 3PR2B 3WQQA 1SXIA 4CM8A 1YHYA 4EBBA 2C9DA 5JVDB 1EFTA 1V1RA 4F1JA 1BOFA 2GWHA 2E21A 1I51A 2AWNA 2JVKA 2XQVA 1A4IA 3UJNA 1VM6A 3H7AA 4FGKA 4G0NA 5BYKA 3TM5A 4PYNA 4D9BA 4DC0A 3L0BA 4JLKA 3H1TA 3NVDA 4RQUA 1HO3A 3K0EA 3L7KA 4N5DA 4UCXA 2QT1A 4X95A 3DFZA 1ODTC 1E2PA 4W99A 2VQEB 1NXXA 2GZ1A 5AKGA 1NOJA 3ER6A 4IIBA 3DTTA 3VJMA 2WWYA 1T4DA 2HLDA 3ZCUA 4D99A 2H85A 5C4MA 5DT9A 2B36A 5A3QA 4LOKA 2PUDA 5DGXA 3OZSA 2QAGB 2RHBA 1Z83A 3LP5A 4FDAA 4EVRA 1JDUA 3BSSA 3SD7A 3CH7A 4YAJA 2OXRA 3KLOA 1GAJA 2JFWA 3K1JA 4O4IB 3STUA 3TFOA 2V3WA 4G9GA 1NNUA 3EGCA 2W22A 3MMZA 1JKMA 4X1IA 1H1DA 5EJ7A 4M99A 4QHTA 2A94A 5DXFA 1RQXA 1PL0A 1ESZA 3PDJA 1SCUA 2ZITA 5ESDA 4C05A 2V9CA 1Z4PX 4RPKA 4ZU1X 3GJ3A 1QIIA 2DQZA 1TM5E 3KJNA 3QXJA 5FWDA 3W5UA 1MHTA 2BFFA 3DBHB 2NVOA 3PL5A 1OX5A 2B0JA 2VK8A 1OXMA 5FWXB 1T2EA 2C4VA 4X62B 5T6MA 1ZU4A 4N65A 3C98A 2JRCA 3IR6A 1Z0IA 3ENZA 5E7MA 4M0CA 4PHHA 4H6XA 5HA5A 5FLYA 1YC5A 4I36A 5CB0A 2WAXA 3Q9LA 4DN6A 4BNHA 1SCBA 5CFRA 3LDHA 2PSJA 1LPAB 1YZGA 1MB3A 3DV2A 3PJDA 1E1LA 1FSZA 1H4TA 1OOEA 3UOGA 3AR2A 4IX9A 4L4ZA 2VPWA 4E3ZA 1LZLA 2A1UB 2WIKA 3SDZA 2X5JO 3ICEA 1LNSA 2P2CA 2XUOA 3CZAA 3M1IA 1BS2A 2P4EA 2AOWA 1VE7A 3DW3X 3V1NA 4W5OA 3DPUA 3MRXA 4IFBA 2WNSA 3U4GA 1C7RA 1R12A 1I3KA 4QHYA 4OM8A 4TKVB 3S44A 2Y1LA 4JBNA 2Q28A 5D01A 2WM8A 3AKZA 2ORIA 1I7SB 1NKVA 1CDEA 3GZNB 1WB4A 3O8BA 2OD7A 3GQBA 1H2HA 3IALA 1KWGA 1HNXB 5BMVF 1R6VA 3AI2A 2G1AA 4K28A 2ZSDA 4MW5A 4N3AA 4CM9A 3NH6A 3BAFA 4KPUA 2O05A 4Q3NA 2P3OA 5CMLA 4EHBA 1ODIA 1V3TA 1VCNA 1ES9A 4HB4A 3WNQA 2SKEA 2YV1A 1JUDA 2PMCA 1R8QA 3P2YA 5DE3A 1HI9A 1FPQA 4G5XA 1VPEA 3BGWA 4IDEA 5A4IS 2WQZA 1L8LA 4RABA 3EC7A 4RL6A 3UKDA 5AKZA 2KBFA 3NXSA 1HORA 3INNA 4AZ3A 5IS2A 1FUEA 4R3WA 1NR1A 2OORC 3EIXA 4QBHA 2HSZA 2NADA 5AVWA 2HSEA 5B30A 3ILXA 4Y2HA 3RC9A 3S2IA 3TRHA 3UGTA 2PV0A 2PT7A 1PFQA 2AX3A 4DGSA 1SUPA 3PRKE 2IYOA 4P22A 3AWIA 5L3SA 3A1NA 5J43A 2Y1DA 4I3GA 2O8EA 4YMSA 2NAFA 2C5HA 5JCPA 5KNLA 5JSHA 2OCLA 1U65A 4LHEA 4NBTA 1JJAA 4MH0R 2SCUA 1Y37A 4GNKA 2B1JA 4OYLA 2BYTA 3KRTA 5ESRA 3C5HA 3AR6A 1C1DB 5ULLA 2DM6A 3U1TA 5C7IO 4II2A 1X14A 3FNEA 4PNPA 1L9XA 5E6UA 1WU7A 4DMFA 3VH2A 2FRDA 4R8MA 1C0IA 1Z7YA 5BQPA 2R44A 3KTOA 4LGMA 3AYXB 3RAEC 2ETVA 3Q3EA 3RD5A 3MB8A 5DCYA 2KLHA 2VHTA 2FQQA 2O4UX 3GMIA 2J5QA 2EYUA 3VVLA 3ZY5A 4DM4A 3GV0A 1N77A 1KJJA 2FPRA 1L7PA 3CSSA 1KRXA 2Z8ZA 2H1LA 1AURA 4S1TA 3DWGA 1G6Q1 1CS0B 3GYBA 2RKWA 4XWTA 1KMNA 2GFQA 4OU5A 4W7HA 2QI9F 1CERA 3HABA 4OL9A 4OQLA 3TINA 4HUTA 1PX2A 5IJWA 4RM2A 1SUAA 3QE2A 1TQ2A 4OBXA 5CVVA 3WO1A 1U3WA 4F91B 2IEDA 4MUYA 5FL3A 2GA9A 5KPDA 1DOZA 1QGED 2BF4A 2W6QA 4KZPA 4L76A 5BYBA 3RRXA 1C3EA 1Z9BA 4BQOA 1CW2B 5KTNA 3JTEA 4Z1MD 1J09A 3VI3B 4CIAA 2ZWIA 4GWLA 1VYUA 5D5PA 3T3GA 3H9UA 1AK1A 4LHZA 3WL6A 5HQ3A 5B2FA 2ZS7A 4BMXA 4K9SA 1UBRS 4UEQA 5IKEA 3A6LA 4XUGB 2GD0A 3R76A 2G0TA 1JPUA 2VHVA 2GZMA 3MMPA 3OURA 1CS4C 4MRMA 1DX6A 1L4GA 2P5SA 2VRBA 3ADKA 4LHWA 1GRQA 1Q0ZA 2OD2A 3HU2A 1DCMA 1WMEA 7AT1A 1D6MA 5CX1A 1S7GA 4KMRA 4LF8B 1IB6A 4QPNA 3E1KA 3GGCA 2IGBA 3ZU2A 3OJCA 1YHNA 2IEAA 5JS1A 4JYAB 4ZANA 4KZKA 4MWEA 2DUMA 1VYHA 3V8NA 4A10A 5E6SA 4LYDA 4GMDA 4H18A 3KZNA 2O2GA 4ZOBA 3H7IA 5FBKA 3LUHA 2XUFA 3SFTA 5ILOA 4RM3A 3F9IA 3Q88A 1RWVA 3MLAA 4KR6A 4QAQA 2P9EA 3KLBA 1NX9A 3H87A 1BHSA 1IM5A 3G5TA 4U2FA 5B4UA 1G21A 4RVHA 5HE9A 2BBOA 1RMYA 3ZR4B 2QMQA 2WUDA 3KE8A 5KCMA 3JVDA 3CPEA 5DRYA 3OZEA 2NM0A 2XRYA 5JW6A 4I2NA 1EINA 3FGOA 4UMDA 2O8BA 2HIHA 5AKYA 2Q4RA 1E1DA 5K8CA 4WXRA 4N6NA 2PGXA 1C1XB 4UC0A 5K2MA 2BGGA 1CP3A 1XQXA 4ETIA 3PRJA 1BSVA 3OZTA 1XOIA 1S6YA 5H3CA 5DT2A 4KPFC 3WO0A 2JANA 1EGHA 3PP8A 1WBJB 2BUCA 2QIPA 4Q9JA 1LW6E 5ENZA 1Z0FA 3HCFA 2BFPA 1MT0A 2IFTA 1JEOA 3UMMA 2WWWA 2NU7A 5A3RA 5AVXA 5JQGB 3KOXA 3O1IC 2CCKA 2JGRA 2CY0A 5H5JA 2XE6A 4FMPA 3WZ2A 2L17A 2VSQA 2XAAA 1SGWA 3AKCA 2ZRJA 3AVPA 3PFIA 3QV1A 3SHQA 2QXTA 1HNZB 5IHXA 2CHFA 1CUYA 3WVNA 3X1MA 1QUEA 1K92A 2PFSA 4PYRA 1V9CA 2J33A 4YRNA 3SZMA 4EPVA 1EKXA 2ZYGA 3ZE7A 1SOVA 3DV0B 1O6CA 5TS2A 3EMDA 3U3RA 3QEAZ 1IEQA 3G0HA 2GS9A 1BVHA 3ZY4A 3QHQA 5BWMA 1CBUA 3PX7A 1L5MA 2ISQA 1NJ1A 1DB3A 1TYDE 3IPYA 4E5NA 2XMSA 2E4YA 2SECE 4R8LA 5IAKA 3I4CA 5FA5A 3ZX4A 4LFAB 1GUAA 1ZUWA 3EF1A 1LQTA 1VI5A 3IVGA 1VHQA 3OPYI 4KH1A 4XPZA 3DQQA 2PVSA 2H16A 5IABA 5J59A 3PRHA 4D96A 5DVZA 5JWOA 5FNVB 3FNQA 2HA6A 1WZNA 4TWZA 4MJ3A 3S6JA 1P2VA 3RW9A 4MP8A 5AM2A 4XI9A 1ESMA 4MYDA 4EY7A 2GK4A 1ZUNB 2EEZA 2AW5A 2P68A 2J45A 2BUBA 2R1TA 2YVKA 3AV3A 1W1UA 1PT5A 4LMPA 4U2BA 5CURA 1XVTA 1ND5A 3T6KA 5CBPB 3H0EA 2Z95A 3KKLA 2HWKA 1C41A 4P7BA 3X1XA 1VB3A 4R1LA 3LPAA 1YUBA 2AJCA 3H8WA 1RXUA 2OGUA 1KP9A 4JFAA 5D87A 3T15A 3LE8A 3AY3A 1ZY2A 1Z6ZA 1DCKA 2Y1CA 1BWSA 1AKMA 4BBPA 5CFOA 1MJHA 3ZKWA 3CISA 1EDZA 2XUQA 5B3KA 1GPWB 3M70A 3EGIA 4JEUA 1O57A 4MKXA 1S3IA 4GLFA 1RR6A 1DINA 3F49S 4HVAA 4LRWA 4JLSA 5A71A 4DL9A 1F48A 3CT4A 1NXOA 1R3UA 1YS1X 4I5DA 3RUFA 4ATNA 4D0RA 3HDVA 3W77A 5CB4B 1ADCA 4Z4EA 2WC1A 3BD9A 3L0SA 3BRWD 5TGDA 4O0MA 4NBUA 1E7SA 3U4QB 1P0IA 2JLWA 1KSHA 4OXRA 1K4YA 5U4XA 3MWKA 4UQLA 4ENQA 4J03A 1SQ5A 5F64A 1KZHA 2XOEA 1HK7A 2ZBUA 2GHTA 4U6SA 2P9JA 2P4HX 2AH5A 3J7AC 3DOFA 1MB0A 5MN6A 4Q4CA 2P9GA 4DEVA 4PGFA 2EAUA 1YJ8A 1GFWA 1E3EA 2O7VA 3E3AA 1N0VC 2MMCA 4S35A 1Z22A 3WGOA 4AT1A 5GQSA 4ER5A 4YRBA 3BILA 3E7FA 4UVIA 5EJ2A 4F2WA 5AM3A 3O0TA 1DS6A 3CH4B 4PPGA 5F1YA 4DW8A 2A0WA 2AZTA 4KFUA 3ZHQA 5EHQA 1W46A 4WE3A 1KK0A 3F9CA 3S1LA 3LQKA 2NV0A 4R68A 3K2QA 3SXJA 1P2BA 1LPOA 3LXUX 2NZVG 2FLVA 2RDMA 4JIMA 2W2MA 4C7BA 1AK9A 1F4PA 1GILA 1K3FA 1XD2A 4R1TA 5EWMA 4FFMA 4JI4B 1G9XA 2OCPA 5FTWA 1HE1C 4G0WA 4N03A 1NZFA 2P5YA 1YVRA 2A4MA 4J3FA 1MKYA 4HYQA 1ZD1A 2B3TA 2IZZA 2PANA 2EJCA 3HR7A 3V6MA 2GF2A 2BD0A 2YHBA 2QPTA 1P4JA 4AYTA 1G19A 2BRUC 3I5UA 1E3QA 3DL7A 1W0JD 4RULA 3HI4A 3PGMA 3K0SA 5BWCA 5DASA 2X5KO 4MDHA 4YRLA 3OMWA 5AXBA 4XWAA 3T3PB 1A97A 1T8SA 1GRCA 1F38A 1ZRSA 4TKLA 3H1FA 5TQ2B 4WDRA 4QDKA 1MMFB 3LP6A 3KOMA 4AJJA 1L9KA 2G88A 4NMHA 1ZW1A 1ZI9A 1E79D 2CWDA 1I1NA 3K6KA 3UWMA 1LQUA 4YT2A 5MGNA 2FPMA 2WQ6A 3LFTA 5G0WA 4L8VA 1V96A 3L6DA 3Q0EA 3RUEA 3B1FA 4PSVA 4BQRA 4GD3Q 3K1YA 3DV9A 1LRKA 4LYYA 2WFAA 4OHZA 5FTMA 4YCJA 1T6YA 2BFWA 4EFKA 5A2GA 4DSZA 1RBQA 4JJ7A 3FGZA 2C5LA 4QVIA 5EMLA 4FT4A 3DBLA 4JP3A 4I55A 3MJVA 1XWFA 4LDPA 3HMQA 2H2WA 4GE0A 1ONOA 2GCOA 3DHVA 3I28A 4JP8A 1OAAA 3D2AA 3B7GA 5CYGA 2P6PA 4GOMD 3ED5A 3KB1A 4PC7A 1KFCB 1YOBA 3IUSA 4YBZA 4KHZA 4ZCQA 5B2ZA 1EHIA 5DRTA 4MW7A 4CR8A 5CA0F 2IXTA 4LE1A 2GYWA 2Z5FA 1WG8A 4Z9FA 4EKIA 2HCTA 3TZKA 1S9DA 4HFRA 3TKYA 1MR3F 3L8GA 4RV4A 4E5KA 3KU4A 5F9HA 3IQZA 4BIMA 3WLFA 4D9JA 4Y9TA 5D3KA 2JH3A 3KYCB 1DQYA 3LC0A 3ZH2A 3CLVA 3PVCA 1Q17A 3KUKA 3WNZA 1Q0SA 1GVHA 3A1UA 4Y6QA 2PO5A 4ARVA 3VHQA 1BDJA 2NVBA 5JR3A 3EYAA 5AJXA 4BKUA 4V2IA 3ZCQA 1M6YA 3NNNA 1LBQA 1DXOA 1HE5A 1J39A 3AVTA 4Z1MA 5AHXA 2EX4A 3L92A 2C9CA 3BDVA 4WECA 1RHJA 4MHSA 4KX5A 5LL6P 4Z8XA 3LUBA 4YP7A 2VJKA 3TQHA 1W48A 3STTA 1Z0DA 3O4HA 2C8VA 2IHNA 4CR6A 1B1CA 1NX6A 2VH5R 3KT8A 3C8DA 4GZLA 2C77A 1LRJA 4CETA 1MIHA 4NULA 4Z7OB 3L7OA 3LQFA 2NO4A 3JWJA 1YKGA 4I1IA 5E8JA 4C87A 3DL0A 3OCVA 2I2FA 2WKRA 2R2AA 1YNOA 3KQTA 3OCYA 2A59A 4JIGA 4DHEA 5F4ZA 3AM1A 1M8JA 2HGSA 2R6DA 4KK3A 2P67A 5HZKA 4MW1A 2W7TA 3JATB 1QYIA 1O5OA 5I7SA 4N54A 3U44A 3G88A 1OGIA 3GJ8A 2R1UA 2AGVA 2CUZA 2ODBA 4ZEWA 4XB2A 1IPHA 3TSAA 3UO8B 1T8WA 3IB6A 3VHRA 5A1TA 1F5SA 3AUUA 5AKJA 4OI0A 4PRZA 4A9AA 1KRWA 1TXGA 2WJZB 2YTZA 5EWJA 3N9IA 3N76A 4HG2A 4NFHA 3NALA 1GG5A 1NPDA 1IEWA 1LLFA 1SIBE 3H8JA 3MMSA 5ALRA 1UAAA 2YWJA 3EX7C 2UUAB 2V1UA 3EGOA 1J0XO 4YLEA 2GHIA 2VDPB 2RH8A 3M6IA 4M9CA 3I9KA 4R3NA 2BGTA 2TSYB 3KQWA 3E84A 1RDFA 1L8XA 2CDRA 2ZE7A 4IM7A 5BO5A 3BGIA 4LNHA 3I6BA 2HRBA 2XMZA 5FTKA 1NIPA 1UBHS 2O2JA 1I6LA 4HPXB 4C4XA 1T9AA 3RRBA 4ZJPA 3E48A 4Q01A 1FMLA 4TMTA 1YL6A 3K5HA 3F1LA 1ONSA 1BZYA 2F6RA 4N7MA 3CPHA 2J31A 4PCUA 5GV8A 3TTSA 1XNQB 1M72A 4GO1A 1N4DA 2OESA 3RYHB 2ZQ5A 3IX7A 4FYXA 1IZZA 5AUPB 4UEJA 4JH0A 1TU0A 1E0AA 3R3JA 4BLPA 1I4EB 1PWZA 3DAPA 4F96A 2R7MA 1QZUA 2OZKA 2J6IA 2QUHA 4XWKA 3L8HA 3O93A 3FNFA 2NGRA 4D57A 4K2AA 3FLMA 1L0BA 3VDRA 1LRLA 1BYIA 3DFFA 3T1YB 2ZYRA 1L5FA 3V7NA 1KO5A 2CJFA 2P11A 4KQ9A 3SOPA 2RBKA 3W5IA 2PLNA 1XDDA 1RWXA 1MVNA 3B6ZA 1ZGAA 4EITA 2VZ9A 1QG4A 4N3NA 1IHYA 4JYPA 2I8LA 5G0UA 3T5MA 1QH1B 4D8UA 3O2NA 1FRQA 5KOHB 2XMDA 1H6DA 3WDLA 4XTCS 4HFJA 3B9RA 4Z2AA 3QEOA 1IWBB 1KYXA 3I42A 3MUNA 4X20B 1WCIA 2B6HA 2JLSA 3FAZA 5ECDA 4HDSA 4L9RA 5GWXA 2WKQA 3DWEX 4LJ6A 2QL5A 3RJ9A 2PM8A 4PEVA 1PFWA 1IC6A 2Q1YA 4E32A 4S1NA 2AG6A 4YLYA 1Z07A 3OO1A 3ADPA 2A92A 2I6XA 3C45A 3O9VA 5HMLA 2BMAA 5BRNA 3SU8A 3HK2A 4MV0A 1ECCA 4F9EA 2C9ZA 4HWTA 3LXMA 4LSWA 1CFJA 5CNMA 3DHNA 4F8JA 3IV6A 1PVVA 1ZYUA 4WOJA 4FE4A 4D02A 4OGLA 3TZHA 4HT3B 5C32A 4IDBA 1MC1A 2Y1GA 3OE7A 2IHBA 4O4JB 1JSRA 4QGFA 3E3LA 3CN9A 4O25A 3C24A 3AK4A 5KQMA 2DPHA 2J4FA 3FOZA 1KYZA 1M0SA 2ZPUA 1BQ4A 3FWKA 2FPPB 3WWEA 1FSPA 4FFVA 4CIXA 3GUVA 3ELBA 1R50A 4WBNF 3GBSA 1WUTA 1MPXA 2NU9A 2O7RA 2VS1A 4MKGA 4NSNA 4R2JA 2GPAA 3S2EA 3TLAA 5HGXA 3CSUA 1EP1B 1VL2A 1KDPA 4WCFC 3B9PA 1O87A 1SA0B 2Q62A 4EVIA 1KZ9A 5DM0A 1GADO 1KEUA 1VLMA 1P81A 1C3VA 4H0CA 2WFLA 2XHZA 1PR2A 3EQ2A 5K6AA 1TM1E 5DHTA 5LQRA 2ZRDA 3C2QA 2EP7A 4HK4A 4C7XA 4YJKA 1RHRA 4ZMRA 4BV2A 4HADA 2C7QA 2HXSA 3AERA 4MAAA 3BRWA 5KYTA 1CYDA 2OFXA 2BKVA 1MNQA 4JEHA 4PO3X 4RK7A 5M3BA 2A0XA 4E94A 5IRCD 4WNAB 3SWWA 4DG8A 5A5VA 1VYVA 3AJAA 4MRPA 4IJWA 2G3YA 5LA6A 3VHXB 2VP6A 3BRSA 4TMXA 3DZJA 1Q12A 3V4ZA 5JOQA 1VSTA 5L95A 2FP4B 3KPUA 4MQUA 3OJ0A 2BCEA 3W9BA 4TQ9A 4BVLA 3SZ3A 4UHHA 3VZDA 1B42A 3EVEA 4B3FX 4HS9A 3QVKA 1RZ3A 4WN9A 2IZOA 3H9JA 4QOHA 1X7HA 1DE0A 3RNOA 5B6PA 2H8GA 4O4LB 5DNWA 3RADC 2WU1A 4GYYA 3RYIA 1T36B 4AWAA 4TUYF 1JHUA 2QRLA 3WV5A 3ZWXA 4NJMB 5DP2A 3EOBI 4YWHA 5F23A 4XDZA 5A4DA 3VC7A 1JG1A 4F84A 5IJZA 1DWOA 4WV3A 1RPJA 2JHGA 1THGA 2BGJA 3QBTA 5BQXA 2QT9A 2MYTA 2YICA 4PGHA 3EEFA 4LZZA 1EE1A 3UANA 2QMEA 2PH3A 3ZV6A 4E1VA 2G9QA 3CB2A 4C0XA 4D74A 4EMTA 5IMSA 3ABOB 2IBTA 2RHRA 3WMGA 3PFCA 4PAOA 2Z09A 4KLNA 1YB7A 1Y7PA 3WKEA 1FSGA 4II7A 5HJ7A 3R7FA 2JC3A 1YC2A 1PQPA 4NU8X 3SSNA 2O8VA 1VGVA 2ZI7A 1NBIA 2HHLA 4FFPA 2HIAA 4D8VA 4L0DA 1GA6A 1XIVA 3UPTA 4S1OA 1NW4A 1E9FA 4G1CA 1BKYA 1AXRA 1NSYA 1Z13A 3LDAA 3P9CA 4L22A 1G3RA 3C8MA 3L18A 5EXPA 2PMFA 3FB4A 5J9FA 3HKDB 2G06A 4E5DA 4WESA 2OV1A 4B87A 4GSKA 1E79A 4N3BA 3BA1A 3JVUA 4YFVA 1GZ7A 3MB5A 1JKFA 1TIBA 2GWRA 1H93A 2R25B 1IULA 3KEMA 4G0YA 3REGA 3COSA 1W36D 3I2IA 4DY6A 3K5IA 1V11A 1XQWA 3PRYA 3U40A 3BULA 4ALJA 3AF2A 1A1VA 2DFLA 4XW2A 1NNSA 1L4FA 3FG9A 3LYUA 4PYIA 4A4DA 1XQ9A 2VK4A 1O08A 3KQVA 1ENYA 2DP4E 1Q1QA 1U04A 3K0KA 4HRXA 1W9HA 2B1RA 2FRDC 2OZPA 1KIAA 3Q2KA 3EAQA 5FBZA 4OH1A 5DGIA 3G8CA 2DH5A 1ZRMA 1KQOA 1S3FA 1IYZA 1ACMA 1LK0A 5LP6F 1NW8A 2X19A 5AJWA 1U28A 1VDMA 2CBGA 4DLLA 3PX2A 4PO9A 1W7AA 1Z15A 1VBNA 1A9XB 1QGUB 4YAEA 4EA6A 3EVCA 4GVLA 2JLVA 4P2GA 4V24A 3PHHA 1PTJA 2QX9A 1EFUA 4X54A 3AFMA 3LH5A 5EZQA 4KJXA 4LY3A 4Q1BA 4TL9A 2XKAA 1SVIA 1ZH8A 3A9SA 3F2IA 3AQIA 3Q6IA 4MUFA 3AFGA 5AK5A 1QZZA 4YMLA 2DUNA 3PENA 4KPGA 3WXBA 2W6ID 1QTIA 3BIJA 3EG9A 3MHPA 3H1AA 3I04M 4EPRA 3WDSA 1GQSA 1BX3A 2P0YA 2X3UA 4CFYA 3JAKA 5G41A 3OTHA 5BVGB 5CEEA 5BSVA 1KZ1A 1O96B 2QGNA 1X42A 4M3NA 4Q9AA 4UW9A 2XWQA 3VGPA 4E33A 2EZ4A 2EBWA 3CE9A 1X15A 3DZGA 2J9FA 4PBRA 5EERA 5G53C 5K0GA 4AJ1A 4G4GA 2OGWA 2I4NA 1FUIA 2JCVA 1HDZA 3DQZA 1XGKA 3PDWA 4M49A 4P7FA 3A7EA 4KH0A 5EYPB 4E5SA 1EFAA 2Q6OA 5HGJA 221PA 1UBMS 4IJQA 2ADMA 3VNVA 2NSHA 4RLFA 2VRCD 1MOZA 4JR2A 1DUSA 2Z30A 3N2KA 3OA2A 4WOKA 1W94A 5DDIP 1QLJA 5DW0A 3SYNA 4BGEA 5A4FS 5JNTA 1Y6FA 4OQXA 3RS8A 4WFQA 4K9LA 4F5DA 1QRUA 4PFQA 4G0VA 1RLTA 3L8EA 4JJ6A 3T7EA 1EAYA 3P9QA 3QVWA 1UWVA 5L4NA 4C7OB 1HEYA 1BHQ1 1TZCA 3BHMA 5T64A 3ZU4A 1ZMRA 3CRRA 4FE3A 5AESA 5FBLB 3VX3A 4EVQA 5C1BA 1VSBA 3TGPA 1NKTA 4B3RB 2VYVD 4D8YA 4H3VA 3C3CA 4L28A 4DMKA 3WGVA 3QJ5A 2PYIA 4UUBA 2DWQA 3DMRA 3M81A 3OG9A 5AICA 2UVDA 4A0SA 4W5QA 2F43B 3AF0A 1YKFA 3KJHA 4UCWA 5WRFA 3U3ZA 4CRWB 3GLIB 1ZVMA 2VOJA 2G1JA 4FPXA 4AB1A 2BI7A 4NVRA 2EU8A 3GGOA 3FTCA 1NJGA 2N75A 3CYFA 4DANA 1KJ9A 1AHPA 3KNZA 2EV9A 1MENA 1L4LA 2EFGA 3B60A 3I9NA 4L74A 3R3UA 3C6BA 1YHZA 4G8JA 4RFSA 4W6ZA 4WACA 2ZUSA 1X7ZB 5FT9A 3NLLA 3AHIA 3W4IA 3H5IA 3JASA 4KKXB 3I9FA 4RJ2A 4NENB 2Q8PA 2C88A 2BY4A 3K96A 2RB4A 1CUJA 5LZ5A 1M75A 3ZGNA 1L1QA 2BIFA 3KL4A 1V5IA 2FR1A 4O2AF 1KO7A 2ABWA 1J5XA 3KOYA 4YUWA 2QPOA 3BH7A 4RA9B 1ZK4A 3C7AA 3PUYA 4IHJA 4UNIA 5JSZB 3TAUA 1MRSA 5ALTA 3O92A 4UU0A 2ERCA 2PSDA 1W88B 4OATA 4I1RA 3GRAA 4IDGA 4Q1EA 3AYZB 4G0UA 4BQIA 4URVR 3FNIA 5JEEA 3W34A 1MV5A 2QRVA 4NMLA 2OFFA 5K8JB 3OWOA 3KKPA 3V5NA 4M0UA 2QTLA 2YL2A 4J76A 1I32A 3RHSA 4KQIA 3PI6A 2GILA 2OZLB 2WBLC 5EIFA 2DJ5A 5B53A 5EJEA 1FP4A 3STXA 3T5BA 4RTSA 4KK4A 4OYHA 3AXTA 5JROA 3LYAA 5A6SA 2FFJA 1Z28A 4EGCB 1MXFA 1WW3A 3IKLA 2BEVA 2FZWA 4IF4A 4ZDIA 2BSAA 4ZA2A 3UJ6A 5G1OA 4A8JB 1RYMA 4YJGB 3W9YA 1KEKA 1JEQB 1TRHA 4AJOA 3PEYA 3PA6A 2WJ3A 5A05A 2MINB 4AQDA 2IPLA 1JBQA 1P73A 1JLSA 1Z7GA 3OTIA 4HVCA 4UTVA 4V1CB 1ORHA 4K9QA 4TKUA 4U8HA 3EDRA 3RTCA 1NQXA 1XVLA 2CMGA 4ZT7A 2H57A 4JQZA 5LYJB 2KWIA 3DZCA 3H5AA 4NBRA 5H02A 4F2PA 1Q7BA 3PT9A 2EF1A 3JWEA 5CYOA 3CEHA 1OA0A 4GXQA 4LVCA 2FMIA 4PIMA 5G1PA 1PLKA 5EJ4A 3HP1A 1Y9AA 2CK3D 1JFVA 3H5RA 1MZVA 4HX9A 2DBYA 4QUEA 5EFOA 5KX5B 1RC8A 3GEPA 4NU5A 1GXSA 3LQ2A 4KC0A 5KC9A 3KYJB 1OAKA 1PLLA 3PNQA 4RU1A 5J40A 3DVLA 2I34A 4V0RA 4BX8A 3PXCX 2BFNA 1A88A 3SGLA 3B38A 3W79A 1O9GA 1Y3BE 2PGAA 2FSGA 5ECYA 1QIHA 2QM8A 3V4LA 3LX4A 5KYXB 4PANA 2OG1A 1R88A 4OUKX 1RJ9B 1E0KA 1AKRA 4PGMA 4X41A 1EE9A 2RGYA 1UADA 1PP4A 4ZCTA 4Y2TA 1EP3B 3SS9X 2X2PA 4ZIRA 4C21A 5ADUS 3MYYA 1RM3A 2HU5A 1ADGA 4RQBA 1UZNA 2CV1A 5JXWA 4GWKA 4CQJA 2G0AA 4F11A 2J4DA 1Q7TA 4KE7A 4RYLA 1Z6AA 3PQ5A 5MN5A 2QF7A 3WGLA 1U9ZA 1YJAA 2J8ZA 2ZAOA 4RGYA 4QVGA 2O0LA 1ZIYA 4DTIA 1JWAB 4EDFA 5BNWA 4BECA 3K6RA 3IT1A 1JRLA 3E81A 1WWKA 1IY9A 4K6KA 4OK3A 2O6HA 4G5SA 3JZAA 3O8CA 2O07A 3UFXB 3TRFA 2YZ7A 4GYWA 4HVLA 1EK5A 2QZ9A 2OLJA 2O5CA 1E6UA 2RJOA 3VPBA 1VFPA 4NCBA 3OQBA 1P5ZB 2GDJA 4IUYA 1N8KA 2BKLA 2X5OA 4JYCA 1E5LA 4B6OA 5BOVA 2QPAA 3A25A 1XUOA 4CCWA 2AW3A 1SY7A 1J97A 1KEVA 1WZUA 1QFJA 3E5MA 3E7PA 3EVGA 4HYTA 4MEAA 2AR0A 4PFKA 4UNSA 4M6WA 2YVAA 3G6KA 4M7WA 3LL4A 1LPMA 2G4CA 2PD6A 3LFHA 3R3SA 2CLKB 2I1VB 3KJFA 5LKRA 1TCUA 1DBRA 3P9SA 4PLVA 4S0XA 4L95C 1KH2A 3MZ0A 2PGDA 5JHGB 1VLZA 4FLMA 3BWXA 4GUDA 2O0HA 3TSYA 1ZVJA 3W1EA 4EO9A 1AQUA 4RVCA 2X0FA 1IOVA 3LRXA 2HJSA 3N28A 1NF2A 4HRAA 4MKRA 1R1DA 4Z5XA 3LKBA 4ZGGA 1ISRA 3TDMA 2R87A 4LRXA 1QJ4A 4GNRA 1P60A 3OJOA 3A05A 1JIVA 4UEKA 1FNCA 2VT6A 1GZHB 5LXTB 3CIOA 4IIDA 4N7RA 3VC2A 3RWOA 5JWHA 1HYQA 4Q4HA 1BVYF 1H23A 4XSVA 3I9LA 4RXMA 2X1LA 3RFFA 2O0KA 3HZOA 4MR7A 3KZ1E 4DLXA 4XGNA 4EY4A 4DZTA 1RQLA 4MRRA 2ADFA 1SIWA 2P79A 1PX0A 1XTJA 2R751 1LPBB 4IEIA 1SELA 4FW9A 2I65A 4RVOA 1VPLA 4UHBA 2VR1A 3ZCSA 4RTOA 1EFDN 2GJKA 1HEIA 1VE1A 4L5BA 1ZM4A 2ZR8A 4X1KA 1OFUX 2ACVA 3BZWA 4LPKA 5KNBD 3UKJA 1JSXA 1GPAA 3EFBA 5LDDC 1ODSA 5AKIA 3OCWA 4ONEA 4RMNA 3KVNA 3M7IA 5JATA 1T4CA 3EQ9A 5M29A 4A26A 1TYZA 3SM9A 1NULA 3DGEC 3RC7A 3GJSA 4EHIA 4ER0A 1IXSB 4IO0A 3A9RA 4NBNA 3QUTA 3SIRA 1P9OA 4JSTA 3QIVA 2C4WA 4PZCA 5DTEA 2GZSA 4NEHB 4ADSG 3BMNA 1ZJ6A 1XJ0A 2PYDA 4B76A 1NL3A 2VQSA 3I2FA 3OFNA 2ZQZA 2FMXA 2IV7A 3G17A 1C8KA 1PFGA 3EC1A 1T6BY 3GIDA 1ZIPA 3MRVA 3RLFA 1NV8A 2XXAA 3GJ4A 4WJKB 5B36A 1RXSA 2G6BA 4G1VA 4L75A 4PGGA 4RJJA 4TMKA 1N2CE 2OV8A 4X85A 2HDWA 3IAM6 5DBHX 2UXCB 3RT9A 2CFCA 4HO1X 4D97A 4G07A 1P2GA 3QEMB 2GSDA 5AMXA 4FGZA 2GTPA 5TARA 3G7UA 3HHEA 5EA2A 1NWCA 1ABBA 1TMYA 5I9NA 2Y77A 4KWIA 2IEBA 3OWXA 2VRCA 4EL5A 1OI7A 1C7QA 1VECA 3TX6A 4DLNA 2ORVA 4P34A 1EQAA 1FNMA 5JSFA 2JH8A 5E38A 2IDMA 1CUIA 4ZCLA 1DJQA 4BKPA 3TFWA 3H4IA 1A9TA 1CJVC 4DR5B 1F8GA 3B52X 3PC4A 4KQ1A 4C5CA 2OILA 2IHVA 3DOUA 3ZHYA 1TLLA 1SQSA 2AX4A 3QEBZ 1A76A 2VDJA 2VYVA 2DHEA 1Q0LA 1LX6A 1YCGA 2YBEA 4FXOA 4RIGA 3WZMA 4YLGA 2FSUA 2GCEA 5IAAA 2BWJA 1VIMA 1DAPA 1E9RA 2PXHA 2PN1A 2QG4A 4CM3A 3DA8A 2BEUB 2Y71A 2WYOA 3AHHA 1SN7A 2QU8A 3N0TA 4ZYTA 1MW9X 4GH5A 5ANRB 1R6DA 4BMDA 3IDZA 3VOSA 4QOGA 2UVPB 2D0IA 1V5FA 3ZQJA 1SBYA 1H5UA 1XTTA 2ZDGA 1SHKA 1ZSNA 3E22B 2OHOA 1GPMA 1JV2B 1LI4A 1N2HA 1OHHD 1JWLA 3VPSA 3JAMA 4CKYA 1UEIA 3GR6A 4I6GA 5FI0B 2WTMA 3ODPA 4GIBA 4J6EA 2PGNA 2VVTA 3I4LA 4M1ZA 1G9SA 1ZJJA 4NE9A 1RFLA 5EWLB 1JJBA 3RSQA 2C0QA 3PDHA 3ZVRA 3PYLA 3UJDA 4EG0A 1OZGA 1G291 1DDIA 1D2MA 4CL2A 1K6MA 1SPXA 1K8RA 1GCUA 1OJLA 3JYQA 3RBVA 4N5LA 3PKZA 4PF1A 4ZI2A 3K9BA 4HNAB 1GEEA 4I4TF 3JWGA 3E9NA 3G8AA 5IJ9B 3OTWA 1Y4AE 1M6VB 2WZDA 1H85A 1T8YA 2I54A 4DPKA 3EGXA 4Y6SA 3U6BA 3BB4A 4BDTA 1UK8A 1SG0A 3U60B 1V7PC 3B6JA 3TE6A 4EB3A 2FUEA 2FHSA 5ERGB 4F38A 4YYZA 1NRXA 2QP4A 4WJZA 4R3UC 1WP9A 2MWMA 1L8QA 4DDMA 1GQ2A 2WT9A 4CEIA 4BLRA 1OB2A 1JAHA 1AV6A 3MJ4A 3WIVA 4LE0A 1VG1A 4E6PA 5AFSA 2QR5A 2O8FA 1J00A 3K3PA 2Q21A 4WKNA 2ZUDA 3TIGA 3ZHVA 4QPCA 3G8YA 1M73E 4ND4A 1FTNA 5A0VA 1JQ5A 2ZRAA 3D7KA 1GPYA 1MORA 2QTRA 3WGIA 2DC1A 2RJ3A 4NEGA 1P4GA 1GYRA 3BC1A 3IVCA 3KQOA 3LVBA 1T2VA 3M4YA 2H7XA 3TR5A 3L6OO 2BBTA 1SC6A 3P8ZA 3LOUA 4C3ZA 3DF7A 3Q0IA 2CK3A 2PEYA 3N2LA 1BCRA 1ENPA 1NPYA 1W5BA 4IYJA 1N2XA 1KYYA 1JPVA 1U3VA 4DYDA 4IDDA 5K6AC 4R8KA 5DP1A 2YWFA 3HYSA 3JD1A 1BGVA 5FNVF 1EXWA 2VF5X 3DJFA 5AJUA 1CY8A 5LB2A 4M0FA 4JUFA 4PCVA 1AQJA 1OXTA 3IEMA 4UULA 1JA9A 5ALFA 2EW2A 3EW7A 4G5QA 2YMLA 1XPRA 1J90A 3MLBA 5SICE 3EEYA 1M1UA 1OROA 2XZTA 4H4EA 1AGPA 2ZYTX 5LMUB 1WB9A 3VZCA 1U9CA 1UKAA 4IIJF 4AMVA 3DWFA 5JLAA 2QG6A 3RM3A 4HUQB 2AFIA 5EUBA 1J6UA 3H2JA 3MTIA 5DB4A 1K66A 4GM4A 5TR9A 2QX7A 4UZFA 3S3TA 2EG9A 2VP0A 3VTAA 2QRQA 3I64A 3DMDA 1EDEA 3O9ZA 3RVJA 3UV6A 2WIDA 3GA7A 4FOOA 5IFLA 5JLJA 1G3QA 2O2IA 3DEJA 4LS3A 3TQTA 5MN4A 3C3AA 4OB8A 2ZM5A 5CB4F 2Q3MA 3VR6H 4BB0A 1L8OA 1DKPA 2XV1A 1T15A 2EJWA 4MUNA 4LXHA 1FK8A 2WWXA 3PD1A 4BJ1A 5ITZB 2CLLB 3OM9A 1R3DA 3PR3A 3NO4A 2FF5A 1RACA 3BWBA 1O1YA 3UAVA 4D1YA 4EYGA 1I80A 4ZMSA 4RDXA 2HA5A 2VK2A 2ILVA 4YASA 1VRCA 5FOQA 3B13B 3CNQS 2E85A 3V1KA 2WM2A 3MINB 1JAYA 1T4GA 1WVGA 5CX4A 1GEGA 4HPJB 3KSUA 2FFBA 1O03A 1O6GA 3U9TA 3DDOA 4URUR 1WLSA 3U37A 3BFPA 4RZ3A 4L08A 4K9NA 1VI2A 3D3WA 1UC4B 4MX8A 4COOA 1M33A 2NOAA 2C5EA 3LUFA 3N74A 2GCGA 4IKPA 3UTDA 2JJ2D 3NX4A 4C0AC 3CMCO 1L4MA 4MI6A 3MJCA 4AROA 1PR0A 1I7DA 1IN1A 4I66A 3AHDA 4XX0B 1U5BB 2P4SA 4INOA 5FULA 2QN2A 2QQFA 3PC6A 4IIHA 4ZVTA 3RRZA 3ZW9A 3AM5A 1Y6ZA 1JFLA 3DCNA 4P36A 1QV6A 4IJUA 4FEAA 5T41A 3R7WB 2V7GA 1BN6A 5CPBA 3R7DA 1Z7WA 1NZJA 2LDXA 2OGZA 3D8HA 3IP7A 2R1VA 4GI5A 4Z99A 2GOYA 5FOWA 1EJ2A 2HQRA 3L6EA 2EFJA 3A6GA 1U28C 2PX0A 5LCXA 2DECA 3IV9A 3JQBC 2QZPA 3R20A 1ISPA 2OQ2A 5CJPA 2D74A 3O75A 3O82A 4Z9AA 1DRKA 1PTJC 1SKQA 3HY3A 5FL7D 4I3HA 3TW6A 1QVWA 4H9GA 3ZJ4A 5I7AA 3AJRA 4DJFC 5KNBA 2JIOA 3ABIA 1DC7A 2BR4A 2FMKA 2PWPA 3THSA 5GADl 3SYRA 4YMHA 4DEYA 4AKEA 1KTVA 1U6KA 5TQJA 4W5NA 4X00A 2C83A 4G41A 3M5PA 1G5RA 2GBCA 2ODPA 3GT7A 4GBMA 1IY8A 3UYLA 3JQEA 1W581 3AEQA 1QP0A 4ZMBA 4WRRA 3PU6A 3QYJA 4M54A 1T5SA 2O2DA 1OIVA 5F73A 4XGQA 2DPLA 1PEAA 2FEMA 3A70A 1NW6A 4XDGA 3G79A 4YWJA 3UWKA 4FZVA 4LF5B 2A6PA 4CKBA 1EFVB 4Y2PA 3KWLA 5IU6A 4ROSA 3DCIA 1LK7A 3GFOA 1QGYA 4H0FA 4EUFA 1I94B 2QX8A 4GLBA 3DOJA 4LSMA 3QPAA 2JLUA 5DHUA 3WK5A 5L6LB 3N86A 1XZEA 4CLXA 4WLFA 3OX2A 4K3UA 4QOJA 2LE0A 2P0EA 3OP4A 3UPDA 2WUGA 1NN1A 1TPZA 1YT5A 4BV8A 3Q85A 4RLQA 1K7SN 4UD2A 5B4VA 2W0MA 1KEEA 2XZPA 4QJ3A 4YT8A 4O08A 1ZC3A 5CH5A 1KIFA 1N7JA 5FBVB 1GFIA 2N9UA 3NEYA 4DZZA 3K2BA 3ZW7A 1PTKA 3OQMA 2F1RA 3HM2A 2DKFA 3JQFA 4FEYA 1K06A 1IH8A 2NV6A 4BJ3A 3AF6A 4JI7B 2JFQA 2FZEA 2HEIA 4L0MA 4YP1A 1F4LA 5B1YA 3QVTA 4DIUA 1FQKA 2P41A 4IWNA 1RMTA 2VAMA 1R4ZA 2GAOA 2J67A 4W8OA 4ZJZA 3I05A 1GG8A 3P45A 4GECA 1KMMA 4O2RA 1DOHA 1FYWA 2WM9B 3I73A 2NO5A 1QIFA 1EX1A 4QRHA 3VTZA 4IP0A 3W2GA 1R5OA 2F8SA 1MCZA 1K2VN 1UAYA 4QE3A 2I33A 3L84A 3GLUA 3O4FA 2C4UA 1OYVA 4EYOA 1T34A 4KDFA 3UCFA 4KREA 3B89A 1SOMA 4YJ2F 4GKKB 5M7EA 5FA6A 2Z6UA 4Q15A 4RPCA 2NU8B 4P7KA 3TOSA 4FOSA 4B4OA 1SFRA 1OA1A 1UBNA 1OHHA 2P2ZA 3L1IA 4RTPA 3WJ2A 1RP1A 1XA0A 2MSLA 3MT9A 5A4AA 5ARBA 1AXGA 2XRZA 4P54A 1NBAA 4IIUA 2FSSA 2BM1A 4KR7A 4M2LA 1M34E 1KJWA 1O97C 3KTDA 4IIYA 5FOSA 4CT5A 5P21A 5CCDA 5K8UA 1UK7A 2Q3FA 3FPKA 1MJNA 3SJ7A 4AY2A 2P6RA 2EERA 5HEKA 3PLRA 3ADCA 5ADWA 3PCTA 3PNBA 2B2XA 2PJDA 1Q14A 2QZSA 3QEKA 2HEGA 2IEZA 3I92A 4JKOA 4RKWA 4XWWA 3I5AA 1HY3A 2GFHA 2VUIB 4MEJA 1RIIA 1AF7A 4OFXA 4Q4JB 1GCGA 3IOBA 4NLLA 5FFFA 1N3BA 3IBSA 2O2YA 2RH4A 3OZUA 3STYA 4AG6A 2GN9A 2JGJA 2DUUA 3OU2A 1A2KC 4KI7A 5EIXA 4OIMA 2CYCA 4JYMA 3BVPA 1QH8B 4OHWA 4TLBA 4X3CA 4CKWB 3K0FA 3VH1A 1F8UA 5DNCA 3QXSA 1YD7A 1JB1A 2C3MA 1DTWA 1UJBA 2TECE 2PVCA 4P5PA 1U8XX 1SB8A 2XZDA 3KL2A 3T7SA 1X92A 3ZDXB 2DSTA 3I5YA 4RHUA 5AXDA 1R74A 2QT0A 1L4HA 2ZWAA 3ZLBA 4LISA 1Z56C 2JLBA 3NEPX 3OJLA 4JZKA 5HIIA 3CR3C 4N12A 1UXOA 1WY7A 1XCMA 2PL9A 3AIMA 3DZIA 2P9BA 3IDFA 3OQPA 4LYFA 4W8HA 3G9TA 3RVDA 4AN1A 1NLYA 5AOAA 5B3AA 1B1AA 1WE2A 2ZVJA 1EBBA 2QKYA 4RPHA 3JW8A 3TEFA 1QCYA 5TY0A 4WTOA 3PTAA 1RWPA 4BNYA 3I04A 3WLOA 4XFKA 2QRGA 4XWYA 5E2AA 4NONA 4KW7A 4HGRA 3VKWA 4B40A 3DOIA 1KXJA 3FA2A 2O14A 3IE0A 4LY0A 2QTFA 2YZGA 3SHVA 3D5TA 1Q3HA 4R8SA 3WLSA 5LOVB 1HDEA 2XF8A 3S8MA 3WZLA 3I45A 1UKZA 3RT1A 1MO5A 1CR0A 1FXSA 4KYVA 1P7PA 2IF2A 2CLCX 3CLTD 3MXOA 2EHJA 5GY7A 4YAIA 5AUNB 4E5UA 2Q5IA 5KHLB 2A1TS 1QG6A 4ZXFA 3TW8B 4QX6A 4YR9A 2C2HA 5EMHA 3H42B 3SFVA 3LVQE 2C9OA 4LRYA 2VAVA 5K3OA 1Y7TA 1YU6A 1ZJYA 3ORFA 1ZN8A 3Q98A 1D2NA 2JAPA 5TJ9A 3WC4A 2J9GA 4Y1RB 5LZ9A 2XQFA 3MT8A 1M2EA 1Z4MA 1BMQA 1R4NB 4BL5A 3MD0A 2XB8A 4RY0A 1ECPA 2ZGVA 2C04A 2H7VA 3EZLA 3ROGA 5ALSA 1RRCA 3W8EA 1S1MA 1ZCJA 2JIZD 2FMHA 3K8ZA 4BPBA 3BRQA 1R8JA 1Y3CE 2OP1A 3AVWA 1R4MA 3B78A 1YFJA 1NTOA 4M8IA 1X7WA 2QUJA 2D2FA 1VBKA 2ZRPA 4JBHA 3UJHA 5AVYA 5ALMA 3H0KA 1Z17A 3NYIA 1EUDA 1J0BA 2JLAA 4OB7A 1WZIA 3PIDA 4YXWA 3KT3A 3ZZ1A 4A2QA 4KMMA 1I1HA 2C3OA 1IJEA 3IJEB 3ABQB 4D3ZA 1XU7A 3P1JA 3E61A 1AIPA 2J0UA 1ZH6A 5HF6A 3QP9A 3UWPA 4Z4HA 4YAUA 1Q0RA 1TIPA 2ATEA 4GP9A 3AINA 3L7DA 3WADA 3IPXA 5ERYA 3I2KA 4U1RA 1F7UA 2A57A 1G3MA 2XVYA 3CB4A 3KJQA 1J20A 4RZUA 2LWIA 1V3QE 3RVPA 3U9SA 4RTJA 1NFFA 3ZK9A 1MH1A 2JJ2A 4B75A 1SQGA 3GDHA 1I5RA 1VCHA 4WNIA 1VLQA 3AIIA 4RMHA 1E2DA 1EFRD 2YXPX 1M10A 3BE8A 4OL0A 3UQZA 3V48A 3ZNPA 4YJDA 1QWOA 2XGJA 2QTHA 3QMVA 4FTWA 4TKZA 3SS7X 2X15A 1FS4A 1P5FA 3EBOA 4HWRA 1KEPA 3TL6A 4B9AA 3H6HA 3RUPA 4P81A 2VXYA 3H9QA 5EKDA 5JPCA 421PA 5LNK6 1OLOA 5AI6A 5DNUA 1GGVA 1K86A 1E3WA 3CBQA 1Z2EA 3KB6A 3GGJA 4C6HA 4F1KA 5K05A 1IY0A 5U1PA 4EF4A 1PK8A 4TT8A 4TWJA 4EUKA 5KCZA 1K97A 4FSDA 2H48A 2P75A 4OBBA 3DEFA 2AS0A 2Q2QA 3FMPB 3K73O 4OGKA 2FPKA 2G1PA 3ENKA 2J3MA 1LCIA 2KW5A 4IIFA 5FL7A 3Q7PA 3I34X 3DJYA 1AU9A 5E0OA 2FRXA 2ZTLA 4DV1B 2UZ1B 1U9IA 3AV0B 1KMQA 3IIJA 4U02A 3DHYA 4YP5A 3HB1A 5JASA 2B3DA 4DARA 4TWAA 4NKRA 4OQZA 3F3KA 3LCMA 1SCQA 3GLFB 5CA1A 4C0LA 3OPQA 3ZN2A 2GBPA 4FNGA 3FHOA 1F1JA 1O4VA 4Q6WA 3DMPA 3JZFA 4PZ9A 3TKLA 3V9AA 3M5WA 3VO1A 3LWNA 2HADA 4JQCA 4RJTA 5EP4A 1EH5A 2K87A 1GQYA 1A72A 4LTNA 4WK2B 4XTRA 4DJJA 1XKLA 1OU4A 5H3HA 3CCBA 1PS8A 4C22A 1H4QA 3DLHA 2VZ0A 2SICE 1KI7A 4Y2XA 3SK0A 4P31A 5CT5A 3HUDA 1KK3A 3FBTA 3HKCB 4F3RA 1CUSA 2B4QA 2XQJA 4BLUA 1UZAA 1QOZA 1B0PA 3D3KA 4OGFA 1OWOA 1XF1A 1X70A 2BZSA 2GAIA 3DE1X 1HMYA 4AP9A 3NU1A 3ABSB 4LJKA 2C9BA 1Z26A 1QP7A 3TZQA 3I23A 1XDUA 2NXWA 2DE0X 1AX9A 1QYDA 5CVJA 3DUFA 2AUTA 2V7QD 3T3OA 4NYMQ 3L79A 1BDMA 4H6VA 3UHOA 4AICA 4C6SA 1SQ6A 2I99A 2YMPA 2BDTA 3EPRA 5JI3E 3I9JA 1NQTA 3UW1A 1W29A 1XEWX 3Q6MA 2QQ5A 3OOHA 4Y9SA 3ICVA 5FO1A 4BUCA 3NHMA 3RIXA 1QJCA 1YAHA 4XYGA 3RVLA 1QO0D 2ORWA 4NBSA 4PHTA 1FFDA 1WAMA 3TOZA 3WGTA 2BHNA 3IP3A 3G0IA 4EW6A 4OBWA 2HAEA 4MW4A 4XVHA 3V1LA 3ZY3A 1P1KA 2OC9A 2K6GA 4D44A 1PR9A 4KX3A 2E4WA 4ZAXA 5LQAA 1LSOA 4PE5B 1OFUA 4PZPA 4QUJA 4QQRA 2IHYA 3NBXX 1U02A 4G4IA 1ZUHA 2ZU6A 1Z4LA 2CMKA 3N7UA 5DMHA 5LBUA 5K4GA 1ZS9A 1NT4A 1P2TA 1QRTA 2DKOA 3EZFA 4MVJF 3FPSA 4YAFA 3MCZA 5MFZA 2ZBPA 1NXSA 3JARB 3WGYA 4XRRA 1DJNA 5KYWA 1M0WA 3MTDA 1KVRA 4MJXA 4GEGA 1V6AA 4J7XA 4KI0A 1B8VA 3R5XA 3B9QA 4F9TA 1TQ4A 1EUYA 1YQTA 1HNNA 2WINI 3WFIA 4Y9UA 4OH7A 3G5MA 4DLVA 4URZR 4NCNA 1ZCFA 2CCJA 2F1KA 1GPLA 3HFJA 1YBAA 5DJ5A 2FX2A 1XMPA 3FSJX 5KTTA 2I0FA 2P9CA 3WJ7A 3PDIB 2VLIA 2LZ0A 3LTNC 4B6GA 3QELB 2BVNA 4PBSA 2G36A 4ON9A 5TSDA 1MABB 4Q05A 2O3UA 1T3SA 1SEVA 2Q1XA 2YC4C 4IQ0A 2HDNB 1GNTA 4LGCA 4S1WA 1XKQA 2FA9A 1HKHA 4WLVA 1WQ1R 2C4TA 4G4JA 1X77A 2QAGC 4MRNA 5EEGA 5EP1A 1XG5A 2REXB 1HH4A 2PV7A 4DIMA 2H65A 4RKRA 3IJ5A 1LDNA 3RVBA 1SBIA 1YOVB 2G67A 4JVNA 5TEVA 2QLMA 1KOGA 5CT9A 2OCKA 3ETNA 1DQPA 5GOZA 3SX0A 1T9ZA 3W5BA 1CETA 1T1IA 1U7WA 2BN4A 3W7BA 2C7PA 3GUYA 3X1KA 4BFWA 2ZB2A 5DM60 2QN9A 1TO6A 1H8ED 1D4FA 4G4SP 5AOBA 1M5UA 3D7NA 3OU6A 3U5TA 1IMOA 4DBZA 4R2MA 4RC9A 2XTZA 5FUVA 4ETMA 1L7RA 4AJ2A 4LE2A 1NHGA 3IP9A 5JO0A 4GRDA 3PXDA 3R9IA 3QPDA 5E9AA 3GD5A 4BQSA 3HFSA 3JPWA 3ZK8A 4OJYA 1LSJA 1B15A 2YV4A 3ERCA 3GEEA 2FPWA 4W1PA 2Z43A 2JLXA 8ABPA 3FYUA 3IXLA 5EJ8A 4EA7A 2IU3A 4MEBA 4BOYA 2D6FA 4I08A 4DUYB 3M9XA 1SRRA 1N4AA 3UJ9A 1XDGA 4FN4A 1RPAA 5EJAA 1SUFA 2OUIA 5JNVA 5HIMA 2VBIA 5C18A 1XT6A 2YHAA 3CVJA 2I6QA 1EWRA 4ZOQI 5AWFC 1HLDA 1MRNA 1PJLA 2ZRHA 3PQFA 4LFCB 3RSLA 1Q83A 3L05A 3ZDZB 3T95A 5DYNA 4HXFB 2FI1A 1VSVA 4TLDA 1R8XA 2PLWA 1ETUA 1DEAA 2J3IA 2Z4RA 1P1FA 1WOYA 4I9GA 4PSAA 5JSKA 2FR0A 3ZHXA 5I7OA 4OQYA 5DSTA 1BCSA 2WJIA 2XNHA 1Q1GA 4EYEA 5KPJA 1KDRA 5EY5B 4Y6LA 2ZUBA 4AS1A 4M9ZA 1CEEA 2BTQA 4JU8A 3RK1A 2ZWPA 4E1BA 4ZVVA 5GJWC 3UMGA 4CF7A 3DVAA 1Y34E 3BT7A 3KX2A 7REQB 1FXUA 2AD5A 4MV1A 2FZ4A 6YASA 5IHPA 4RZ2A 3FOFC 3DCJA 4YCDA 2WHXA 3E23A 4AF8A 1R7RA 1UUFA 2WU4A 4QFCA 4LK3A 5C8DA 1ISHA 2IYYA 4D26A 4M9RA 1FBNA 5IYZB 2F62A 2C1EA 4UFNA 3ZBQA 1JHRA 4ZYLA 1FQOA 3V00A 5ICCA 1G2IA 1CQIB 4GBJA 1QNFA 1N34B 3R4CA 1RTTA 2NZWA 3BCSA 1U2DA 3TTVA 4G0OA 5CJJA 4R9SA 1GV1A 3WS7A 5CD1A 3U61B 1U0EA 3PYXA 5JANA 1MC5A 5JYDA 1KFBB 1YRAA 2LDBA 3LLUA 4WADA 4ZEXA 1X1QA 2OBYA 1NBOA 4LY6A 4ZV7A 1GITA 4KNVA 4L5JA 4XPIA 3W2IA 2FZCA 2VA8A 3G3EA 4MVJI 4ZAFA 4B43A 2P3SA 2R60A 3PPYA 4FOLA 2D8AA 3IT0A 3FPGA 2AI3A 2BMJA 2WSSA 2J0VA 1SKMA 2IJGX 2GTHA 2WJWA 3N0RA 3ZNNA 4G25A 1NVXQ 2IDKA 2BM8A 1JQKA 4FQ8A 2VJBA 4XUDA 1PHPA 2M1XA 1O95D 1DV2A 1YRYE 2NTYC 4KQMA 4QLOA 4WBSA 4ZRNA 4D6YA 5CB6A 4KAXA 3JQ9A 5CB8A 1SBHA 1ZIXA 3N87A 1Z5VA 1ZGHA 2NTNA 2DHRA 4PFJA 2D2VA 2FMFA 2AOVA 4BNDA 5KVSA 4K0RA 1GGJA 1UBTS 2QZJA 3EPPA 3IIMA 2PZAA 3PSHA 1Q44A 1E2BA 1U1CA 2VT2A 4OHOA 3AHCA 1P91A 3OKCA 4PNHA 4RVUA 1K8XB 1IJKA 1YVUA 2NQ8A 2QHXA 2XYQA 3KR0A 4KMSA 4NK5A 4BO5A 2EZTA 3BS4A 1R10A 1HDCA 3A2LA 4L7QA 4QWMA 4ZI5A 3V8PA 3JPYA 1AQNA 1R0YA 2DEUA 1USKA 2YWEA 2HIGA 3FZEA 3HDYA 3N8DA 3RVSA 1SXPA 4B0PA 1ENOA 3AB8A 4EGAA 5KYYB 5THQA 2N46A 2V8OA 1HE4A 1LNQA 3LPDA 3L0YA 3RFXA 1NJFA 1U0RA 4DSOA 1WULS 1V1JA 1WPRA 5FWYA 4ZYUA 1HFKA 1N7IA 1PGQA 2AXQA 1OY1A 4JLAA 4A8PA 2FEKA 2HU2A 2QVYX 3AUKA 4OY3A 1ENZA 4DRZA 4FXPA 4XM0A 3GUHA 3S70A 3GRPA 4QATA 2WG2A 2VDWA 4ZCMA 2F4VB 1NQUA 2W71A 4Y0NA 1YUNA 3LO5A 3OT5A 3Q8MA 3SZGA 1G98A 4AIRA 3RS2A 2DXIA 3GVCA 1W6UA 4MB6A 5K3AA 1Z6QA 1EWKA 3B1VA 3O5AA 3B1YA 4HD8A 5EE3A 1AKUA 1HYBA 2IA5A 3U3JA 1OYWA 4CQLA 1I5EA 4V1CI 3RUCA 2OSBA 3DO8A 3O3OB 2NVUB 1VIAA 3PK0A 2WDPA 3G0CA 1T5IA 2GHQA 4WNCA 2JCBA 2QD1A 3KQMA 5FI3A 4ZVQA 2WOJA 3BXXA 3O6VA 4FBLA 1SWWA 2GTIA 2Q3EA 3GAMA 3ZWOA 4BO4A 3VYVA 3L6RA 5H59A 1Z2OX 2V7QA 4ECEA 1WPQA 3IPLA 5BMOA 1EM8A 1HF3A 5ALYA 5JMPA 2DCMA 4B81A 1R0BA 4HGNA 3MTGA 3DZKA 3JQFC 1G1MA 1EFPB 2Y0CA 2YUTA 2QD4A 2C3PA 1GPDG 2O0JA 2QP9X 2QLJA 2VHUA 3IIKA 3R3ZA 2NTVA 5TMEA 3UQYS 4J4TA 3BE6A 1PZEA 1GN9A 4UEOA 4WCDA 2PUWA 5AM5A 4Y3UA 1QO0A 2A33A 2VUUA 4UOZA 2I78A 5HILA 2JVJA 3RC1A 2YNMD 1U98A 3WYBA 4UREA 4TVSA 3DL4A 1NAHA 4Y98A 4C2TA 3RROA 2Q7OE 2FWAA 4CLEA 4LK2A 1E7QA 2FEXA 2Q41A 3OLVA 2FWRA 4MB2A 5DHSA 1D2AA 4ZVNA 2DBZA 4CMBA 2V3VA 4ENPA 1PJTA 1A3CA 4E5YA 2VH2A 1JL3A 1BIFA 2BKXA 2FY8A 4G0QA 4LI0A 1DG9A 4ID9A 4BO6A 4TZ0A 4E0BA 4WK0B 4P9NA 4YHBA 2AOTB 3DT8A 1FS6A 1DHTA 3BSFA 5GVRA 1TZ2A 4PYKA 2IE8A 2EGHA 3L41A 4MYCA 4BMOB 4JQOA 4B2LA 4YJHA 3ED1A 4JL5A 4O02B 5L3QA 3RRMA 2Z98A 2WT4A 3C39A 4EG6A 1VJ1A 3KJZA 4CIDA 2HMAA 5BSHA 3E9QA 3NHYA 1U0HC 3QKTA 5JNRA 5ADVA 4W5TA 5TPWB 1U6IA 1YJXA 1MT3A 1K7FB 1VMKA 1G16A 2WD7B 3DDZX 3T7RA 1DFHA 2Z6AA 2HZ7A 4TMWA 2DFPA 1UKCA 3V32A 1WL8A 3GFPA 3A8TA 3NM6B 1G5TA 3FCEA 3RKUA 4E21A 3H11B 2EW1A 1UBJS 3MA0A 4M83A 1RQPA 1YIOA 4IUCS 5AJYA 3T35A 3TOXA 2B4KA 1SUDA 1W4CA 2VNJA 3FWYA 4IJ6A 1SKBA 4UQPA 1W5TA 1GD1O 2ISSD 1VPTA 3UT0A 4MKIA 3W6ZA 1RJFA 1ILWA 1SOAA 1H0RA 1W19A 3G2HA 4X63A 4A82A 5LMNB 1VLLA 2CDNA 1M5RA 4ER7A 5CXXA 1EM6A 2QVGA 1XLTA 4ENWA 4BNVA 2F59A 3LCJA 5B57C 5BR7A 1VXOA 3GRZA 2FSPA 2XUZA 1H8EA 2XX3A 4BWVA 1WX1A 4Z3DA 4ENSA 4LFBB 1KA9H 3A4VA 3FVWA 5ALWA 4DDTA 1HDIA 2K2QB 3ZE9A 2W4MA 4OMFG 2R1ZA 3NIGB 3EG5A 3P94A 4IKOA 1ECFA 3QKIA 3UA3A 3ILVA 1XZCA 1UJ5A 2JGFA 1TF7A 2Z9DA 2GD6A 4TT3D 4GQAA 4PRLA 2IY8A 3P9KA 4YX9A 2XDQA 2C5BA 1JXMA 1K9VF 2VTEA 2JCSA 1G8PA 1DBQA 2JEYA 4NI5A 1G8KA 4IXMA 4BP1A 2IS6A 1JJFA 3TTTA 4AKIA 1VRVA 1P61B 3CIFA 3DVSX 4MLDA 4FGSA 1E89A 5DNAA 2OVBA 4JR0A 1JHPA 1TA0A 2HKIA 3UK0A 4QGHA 4DLTA 2QUIA 2R97A 1BU8A 4GQIA 4L07A 1QHYA 5BYJA 4YMIA 3FVRA 4C2AA 3OQNA 2X8BA 2ZR7A 3HKEA 1BXZA 4UCFA 2NW6A 3FGNA 1NXTA 4MIYA 3N5KA 3KPYA 4Q02A 4ZU6X 2HMUA 3QPBA 5KYGA 5IG2A 2BGNA 3I8OA 1GNLA 1YL7A 3IJRA 1E61A 4MWZA 1PFUA 4MVJH 5JE8A 3ESRA 4C06A 1RCUA 1U2EA 2HCJB 4RSHA 1GY8A 5KQSA 4OHCA 1CIVA 3EH2A 5JALA 4OUDA 2DVMA 2EZUA 2RD2A 1KNXA 4TXLA 3QHAA 1JFFA 3EQ8A 1RI1A 5L3VA 4FX2A 4U39A 1RJDA 4R7TA 5CM9C 4XGIA 2EZ9A 3K7EA 2FPIB 3OH8A 4NPAA 4BFLA 1UT8A 3SN6A 1AOXA 2C2KA 5AW2A 1EP9A 1U80A 2I6SA 4FFBB 4H1VA 5CA0A 4WKOA 3B1KA 5LLDA 3F73A 1JVBA 5ALVA 3VVMA 3F6PA 3FF1A 3HU1A 1TTHA 1QYWA 3SR0A 1QPGA 2IS1A 2YZKA 1M7BA 1N2CA 5DGDA 2WU0A 1VXRA 3RC3A 2O54A 4IV5A 1YCDA 2BM0A 3HPRA 3CUSA 3O7MA 2AC2A 2WJHA 5L7WA 1L7NA 3B2NA 4AN0A 3R8CA 3TGWA 3WK4A 4D9MA 4IXDA 2ZR9A 3A9TA 2E82A 3IE2A 4J1TA 1GZ6A 4LJ8A 1Q3TA 2Z4TA 4TMZA 4UPVA 1QX4A 2PKRA 4L5CA 5FKJA 4B17A 4BMCA 1TADA 1OXVA 1H6CA 3N6RA 4CM5A 1ONPA 2PH1A 4FJ2A 5TGZA 4I99A 3ZWYA 9LDBA 4HDAA 3R23A 3WGQA 4GDFA 1IN6A 1YDEA 2OBBA 2PKEA 4G86A 3FTNA 5EZ5A 4BFZA 1ATIA 1GU0A 1HT1E 1XAGA 3BMCA 1CVLA 5BN1A 2JI6A 3GJ0A 3IVMA 4RTLA 5C5DA 1SXHA 1O95A 3FDZB 1T6NA 4IOKA 3DNPA 4G23A 4D5GA 3B2QA 3D0OA 3C1AA 1KI1A 2Y9PB 2BKEA 4M8KA 3OOSA 1RJWA 4K87A 3ZXYA 1T2FA 1TKBA 2GKGA 1Y8QB 1IAVA 3AVQA 4LXYA 2W42A 2NP7A 4HQNA 1LWNA 4W7IA 1DARA 2E1RA 2GEDA 4I5FA 4D81A 4LF9B 5LKAA 3DTVA 1XTSA 2AG0A 1M1NB 2PWYA 3NNSA 5E3IA 5L51A 4MYHA 1RWKA 4PN3A 4RYDA 2D4AA 3WOVA 3MVEA 3JQPA 3IP8A 4IFEA 1Z39A 2ZS9A 4NU0A 3SEFA 5COBA 1FQWA 5K3CA 3OSUA 4LG1A 3B53X 4L8FA 3MIIA 1GQRA 4FFRA 2W83A 2C7OA 1BW9B 1U9IC 3FBWA 4N4AA 5H7XA 3UT6A 4DC1A 3LUGA 2A5LA 2FQWA 3JVEA 4YAWA 4EL0A 4FINA 1J9EA 1SC4A 4S2EA 1IDN1 4TN5A 4DY4A 2UXDB 2MMGA 3O8LA 3QOYA 3RS0A 1P0FA 2P90A 1VJ0A 2OA0A 1XP5A 2GAJA 3MOGA 2HCFA 3V46A 1H2XA 2YJ3A 1UWLA 1XWWA 3CNBA 4MUKA 5G4KB 1DWPA 1RKVA 4YRMA 1T9BA 3BXFA 3GYGA 3QG1A 3A6ZA 1NU6A 5LUAA 1GTSA 3C1TA 3DR3A 3CNOA 3WB1A 2G8NA 1M1YB 3NV9A 3OIFA 1XZKA 5T67A 4DCVA 3OPMA 1CQZA 4HPWA 3T4XA 3UWDA 4WZAE 4C29A 3WQBA 2B20A 1T5LA 5H82A 1G5QA 3N3AC 2VHJA 3OZDA 3QX7A 4CM4B 3HXMA 2QTZA 2IY7A 4WERA 2PNJA 1ZQ1A 2FCRA 1O6ZA 1MNAA 2IC5A 2ISCA 3ELUA 4YPFA 3ZVNA 5GVSA 2JAUA 2QOEA 1EB9A 1HDRA 2I55A 3H86A 4HC4A 4WCVA 1L5HA 3NWBA 2NIPA 1Y3DE 1UJ4A 2HQOA 2EGGA 1PK7A 5EMJA 4EARA 1H2BA 1USGA 3IRVA 3VR6D 3VVCA 1GSIA 1QHEA 3K9GA 2PRJA 5EESA 4ZN6A 4ARZB 5A62A 2XCLA 3KELA 1RQGA 3KT6A 3HEMA 3PNVA 3B3GA 4NIMA 4C0BA 5F5XA 3VYTB 2CJWB 4ND2A 3WL4A 4B9EA 4OB6A 3UXMA 2BZ0A 3OTGA 4HEA6 4MLCA 4ZOLB 5HWSA 3INTA 1YIAA 4LCJA 1GL3A 2DPYA 3L7CA 1GGEA 5ARCA 3KKNA 3F6YA 3WYFA 1LS6A 1N32B 3MWYW 3WWPA 3IB3A 5HQTA 2R0QC 3OCJA 2VXCA 1UC5B 2JFUA 3MGAA 2YNMA 1PNTA 2H0AA 2J87A 3N7TA 4Q1CA 2HI0A 2ESRA 1TCVA 3B85A 3V1UA 4BO2A 4Q3AA 1KYWA 5D3MA 1E69A 3GVHA 2A8YA 3W05A 5BSFA 4FHZA 1K6EA 1OJ7A 5K0ZA 2VHEA 3T9EA 3O7WA 4TWIA 4EG3A 2MT9A 4YACA 5KAMA 3GPLA 2CUTA 2AWOA 3AU9A 2H54A 4R2IA 3ZOZA 1U7ZA 1PWYE 2B99A 1JR2A 2BMFA 3JD4A 4Q12A 4WBNA 2QSYA 3SF8A 1O4WA 3PEFA 2PZGA 4MGZR 4RIEA 2WHQA 1JTFA 1EZ4A 2M2IA 4J07A 3TIXB 1DRVA 2BDUA 1C3OA 3AJEA 4EJFA 1QDEA 3SIPA 2QTCA 1BTOA 4DR1B 1DFIA 1MDFA 2PJRA 16PKA 4M7OA 5B64A 1DEHA 1KY4A 1V6SA 2GHRA 2H0RA 3LHKA 4GL4A 4ZT4A 5C37A 4EVSA 4UAUA 1QR6A 1JHOA 1BDIA 1Z34A 5KNCA 2PNFA 5D8DA 1J8FA 1TUBB 1PZHA 1U2TA 2BT4A 3NJ8A 4U3JA 3RSOA 3TLZA 5I01A 3DEKA 3NVMB 1G7TA 4EG1A 3RJ5A 3VZBA 4JBYA 2KPOA 3K53A 2PIAA 4PIVA 1FVOA 4HDKB 1XYGA 3GVXA 3LUPA 1T2UA 5ALXA 1GGNA 4CMHA 4F3CA 1T5TA 4HQOA 4ETNA 3CLHA 1ORVA 4HWOA 1NM5A 4RPLA 3AI3A 1M2NA 3ZJTA 1N2IA 2YJ5A 2QD5A 2W8BA 2XCUA 3C7CB 3EZNA 1XU9A 3FI0A 3IUBA 3TQRA 4HRYA 3B7WA 1YQWA 3HUUA 2JIRA 2QRMA 3P4UA 1S3GA 3D1JA 3DO5A 4ITRC 4ZVUA 2I8AA 5C4GB 2IYQA 1ZOLA 4TUYA 3KQUA 4GL2A 5FQOA 2F9LA 1NJ2A 5AW3A 3HKBA 3AZQA 1T9GR 2GETA 1VLJA 2ZIXB 3DBIA 4NARA 4GX2A 4ZJYA 1JVSA 1ABEA 1CHDA 4U7DA 1LSUA 4N7JA 4TT3A 1FYXA 2PUBA 3DG9A 2VJMB 3Q3GE 4KV7A 4EG7A 5GINE 4Q18A 2H63A 3I12A 1NURA 1PT9A 2VP5A 1YR3A 3FR7A 1XTPA 3QMMA 4JGGA 5EIBD 4ZARA 3M82A 4JNCA 1I0LA 3VSDA 3CX7A 4EYSA 1S4QA 3QBDA 2ONCA 1WQ3A 2IY9A 2ORED 3CLTC 1Z0KA 2NZXA 3HJAA 2ZKIA 4NICA 3WRXA 1CUBA 1KERA 5IXJA 4RF3A 5FLXA 4GMGA 5ES3A 3H3JA 4LYGA 1UCFA 1DBPA 3MCAA 1PJZA 1DJLA 3OCCA 3ZHZA 1NW3A 1N2BA 1QR2A 3D6JA 3HSKA 4EK9A 3I52A 4AG5A 1XXHB 5A7FA 2WMYA 1MBZA 3R5TA 1HLFA 1FEZA 4PC6A 5LMCA 5TQVA 2I66A 3RJZA 4UMFA 4P58A 4RD6A 4DLYA 2DB3A 4F8YA 1RXYA 1CUVA 1BEEA 1IVYA 1KPIA 3EFEA 1T1JA 4LNUB 3GEBA 2WAOA 4L6IA 4AUNA 4DQDA 1Y9EA 4TYYA 2IUSA 5I9BA 5LOVF 3NQ41 1I14A 3AUXA 3E7WA 2PLRA 1UXIA 1XNJA 3F8WA 1JYSA 1JHMA 2FN4A 3V42A 4K46A 4EJSB 1VMDA 2R6R1 5FPSA 4E6EA 3RARA 5FI5A 3FKQA 3MXTA 2A9RA 3K9CA 1ZJZA 2JJ1D 1AGXA 2MYPA 4MROA 1HQCA 4UPDA 1L4NA 2ZROA 4F2DA 3TG8A 4FHFA 5IKXA 1FDIA 1QCCA 2NUBA 1SUCA 1U2DC 3DMYA 4YTEA 2VZLA 3A27A 4J0CA 2AFHE 2JF0A 1DMRA 3R5SA 4TV8B 3GNLA 1DLIA 3FUTA 4P4UA 4BC0A 3IPAA 2B78A 2QI9C 3LQYA 4YUXA 2B4YA