3SHVA

Crystal structure of human mcph1 tandem brct domains-gamma h2ax complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
KPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPAMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWVLDSITQHKVCAPENYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Microcephalin
publication title Specific recognition of phosphorylated tail of H2AX by the tandem BRCT domains of MCPH1 revealed by complex structure
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3shvA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3shvA02
1N5OX 2D8MA 5ECGC 3T7KA 4N40A 4IGKA 3FA2A 1T29A 1T15A 1CDZA 2VXCA 2L42A 4ID3A 1Z56C 3I0MA 2JW5A 4BU0A 3UEOA 4JLUA 3T7JA 3PA6A 4BMDA 1Y98A 3SHVA 2XNKA 3K15A 3I0NA 3HUEA 3OLCX 3K16A 1JNXX 2EBUA 1IN1A 2AZMA 4OFBA 3HUFA 1GZHB 3KTFA 2ADOA 3K0HA 1T2UA 1IMOA 3PC8A 3QVGB 3L40A 2EP8A 4XPZA 3L41A 2XNHA 4IFIA 2WT8A 3T1NA 3II6X 3AL3A 1OQAA 4BU1A 2HTFA 1L7BA 4BMCA 2COKA 2K6GA 3SQDA 3EF0A 3QVGA 2COUA 3PXDA 3L46A 3PC8C 1KZYC 3U3ZA 1T2VA 2LE0A 4Y18A 3AL2A 2K7FA 3PXBA 3K05A 3SHTA 2COEA 2E2WA 3K0KA 3PXAA 2EBWA 1WF6A 3JVEA 3COJA 3PXCX 3PXEA 3PC6A 2ETXA 3PD7A 3PC7A 2DUNA 3EF1A 3SZMA 3UENA 2M2IA 4U4AA 4XQ0A 2INGX 2NTEA 2R1ZA 1L0BA 3T7IA 2VXBA 4Y2GA
chains in the Genus database with same CATH superfamily
1YCHA 1ZVKA 4F5WA 2C5FA 2XOKD 2JIBA 3EAGA 4FJ1A 2X5XA 3O7MA 4EFKA 1T3ZA 1KWGA 3LDFA 5BW5A 8MHTA 5AXCA 4PYLA 1TTTA 5LKAA 5FKJA 3ZD7A 5JTUA 2FG5A 3EDCA 3ED5A 1L7DA 3ANSA 3I05A 4OK3A 4UM9D 5ALJA 3VC7A 3GRKA 1XAGA 1Z4QA 4O4JA 5KBYA 1Y8RA 3AGPA 4JR1A 2D2XA 4NZOA 3SD7A 4TWBA 4PN3A 1M34B 3E05A 4EJ6A 4YJKA 1CS4C 3F7OA 3L49A 5J2UF 3CKLA 1UP4A 3H87A 3HWSA 2HLNA 4ENVA 1U0EA 2C4WA 4EM6A 2QV7A 2IYPA 3L6UA 4UHCA 4ZHSA 4UXIA 2OORC 3JWIA 3S70A 1CUCA 4EYEA 4MVJD 2BGUA 1BXKA 3TLMA 1E1NA 2YZMA 7REQB 4B17A 4IV8A 3GLGB 1YF3A 2YW9A 3L18A 3FWZA 3RUEA 3W90A 3WIBA 5JJIA 2P79A 4A2WA 5EY5B 3SF0A 3A3KA 2QTGA 4DQDA 4FZ5A 1VECA 4GPEA 3M2PA 3QVMA 1SA0A 4MB0A 4BQPA 4QPJC 1HL7A 1UMBA 2AMVA 2E4YA 4BZZA 2O3TA 3RTEA 1B16A 2DQ4A 2WVJA 1LS6A 1VIVA 1Y37A 2BR4A 2G77B 1O94A 2AD1A 1QGZA 2WIKA 3CUEF 2ZRHA 3ETLA 5FYQA 1QXSA 2DH6A 4AKGA 4S1VA 4I9GA 2P7IA 5HYVA 2JBAB 3GNTA 3IE2A 4F2GA 4GZ6A 1BCSB 3LUBA 5L7WA 4NMHA 3AI2A 3A1UA 1ZNZA 4Y3UA 4BLVA 5L8VA 2A35A 1G3MA 1XJ5A 2J31A 4IXNA 1MXFA 4RIEA 5HJ2A 3O3CA 3F46A 4HCJA 3SXJA 4F8EA 2AHOA 2HIMA 3QXSA 2JHGA 3OLQA 1RWQA 4RABA 4UD6A 4B4VA 3EUWA 2Q1WA 3LCCA 3KHSA 4P80A 4YJ3F 3ZWAA 3MGCA 2IQIA 5D85A 2CUNA 3HBMA 3COZA 4BGUA 2DERA 5GV8A 3LP5A 4OI0A 1XP8A 1O54A 1JEDA 4EFNA 4BNNA 3BG5A 1C4OA 4CE6A 1XQ6A 2C3PA 3UIEA 3TCKA 2WM8A 1U63A 4LRUA 4HVAA 1ZHOA 4MLCA 5BSTA 3TTXA 2ZT5A 4RTNA 2IPOA 2IPAB 3W5IA 5PNTA 3TG2A 1R0LA 1TUBA 5JC1A 2ZJ8A 1C9DB 3OZEA 3HYNA 3RS2A 5BWCA 5FQNA 4DMLA 3THXB 1M6YA 4EYKA 1DTSA 5K03A 5EERA 1IY9A 5EIXA 2VT3A 1P1HA 4NY1A 4Q3LA 1NQWA 3TO5A 3UGQA 3X1KA 1QU3A 5AVSA 1V71A 2QUHA 4F4IA 2JFFA 1HNNA 3L06A 3Q0TA 1N25A 2VAPA 4O4JF 4REQB 5JG7A 3PDHA 1FNDA 1SUCA 1ORHA 3C7CB 4L3WA 3U7JA 2PUEA 3V4SA 3TRJA 4XJTA 4NPCA 1MAUA 5TJHA 3SJUA 1ZK1A 4AJNA 1FBTA 1U5BB 3NUQA 3ZD9A 3ZHTA 4V0KA 2YZ2A 1WWKA 7ABPA 3F3YA 4PYIA 2V9CA 1JGTA 2R9VA 1T15A 1G21E 1NMSA 2X2FA 2C2HA 3EX7C 4NCIA 3FHLA 3NHKA 1QCYA 4OKNA 4MKIA 3IIKA 4V0MA 3QE3A 1R4ZA 4BP8A 4EX7A 2A9FA 1WQ1R 4F2WA 1CJCA 4TL7A 2BRUC 4AQYB 4CLRA 4M86A 3SSAA 3ZHBA 1X86B 3VHRA 3NVDA 1IJBA 3D43A 2P6PA 3BD7A 5C1OA 1TZJA 4IKOA 4RVOA 1SD1A 3E6AA 4I4NA 1YQWA 2G76A 1OXBB 4NEHB 2HJRA 1NBIA 1EHIA 3BRWD 2J0UA 3KAPA 4RD1A 4ZJYA 2EFJA 2OHHA 4N3NA 4F6RA 3OCUA 4QBKA 2PO5A 3HKEA 1DEKA 3FZQA 2I8AA 2R5FA 3MTIA 1IRXA 5EINA 4FD3A 2XCUA 4P81A 4FD2A 3HJAA 3OCYA 1KE1A 2B8EA 4KQGA 4BO2A 4WBNA 2W4MA 3NP9A 3R3XA 5AKKA 2QU7A 4HDRB 5F3WB 3T4UA 3N2EA 3F5FA 4BS9A 1VKRA 3T0FA 3ZYCA 3C3EA 3GZ4A 4B45A 4YV0A 5DCUA 5DX8A 1J2TA 2NADA 4QPDA 3STTA 4YGYA 4M49A 4J2TA 3A2MA 3URMA 2PXHA 2E85A 3QKRB 2GJ9A 1NE2A 1USKA 1PJ3A 3RSQA 4XTCS 1NBOA 2HTFA 1PCXA 4FDMA 3GAMA 3OMXA 1DC4A 3KR1A 5DE3A 3V2UA 9GPBA 1QVZA 1W5EA 4P92A 5LVAA 2V7TA 1CU1A 4YPFA 1NHGA 1J00A 2FMHA 3E7XA 1IZ7A 4DV4B 2ETVA 2UUAB 1BW9B 1PAUA 1X8XA 2DMRA 2HMAA 5C0OE 5LM3A 4E07A 1GPBA 2NZXA 5CJPA 3EGCA 4XW2A 3P9SA 1N9KA 3EB9A 2FJ0A 5THQA 2HA6A 5JMOA 4Z4QA 2QHXA 1LVHA 1PJZA 2W6JD 4MKRA 3B6JA 5F23A 2OBFA 2I7TA 3CGGA 1OV4A 3W78A 1L7RA 3GJRA 1OAKA 4LNAA 3KQKA 2PRYA 1ECCA 3OZ7A 4PANA 3T38A 4EDHA 1QHNA 1ZD4A 1FL9A 1XV5A 2P77A 3JQAA 4O2RA 5KTTA 3C5WP 1P17A 3RRBA 1G3IA 3HP4A 4KO4S 2YS6A 1NIJA 3TE7A 1E3LA 3DMDA 4RGQA 1OLSB 3DZFA 4KCGA 1QIIA 1TT5A 5J5VA 4ZI5A 1H69A 1IJKA 3LHKA 3IAUA 1QZXA 3EXHC 1PV4A 3T7AA 2GHQA 2JVIA 1LF5A 4MA0A 4TKMA 2PUFA 1S89A 1LGYA 4P8RA 4ND8A 2IUFA 2E7ZA 4XQ0A 1J06A 1NU8A 2KB0A 2Z6QA 1H2FA 1QB8A 4R0VA 4YCSA 5A06A 2WYUA 5K8UA 4Q7QA 2WJ4A 4LV6A 5JYDA 2NQ2C 1GUFA 3BJRA 4D5EA 3EC2A 3A6JA 2NGRA 3W2EA 3ZDCA 1JHAA 4OYHA 1XZIA 2HSEA 1I5EA 3I9V1 5LLTA 3IIMA 1H85A 4YO8A 2CJYA 3AUKA 2FFQA 3CW8X 5FORA 4INAA 2HXSA 1KEVA 5B1EA 10MHA 3AZPA 5FI0B 5BV2P 2PBLA 5ALMA 2A9OA 1B8OA 3VPDA 1VE6A 2I1VB 5KDOA 1O6ZA 1GZUA 2W0MA 1JF8A 1YMUA 3OX2A 1SIOA 1DJOA 2RKBA 3A8TA 1PU2A 2GZDA 3H5OA 4I1VA 3ZK9A 3MMZA 2IE8A 2VG8A 4LY0A 4F97A 3OFJA 1H94A 2RKOA 1W0KD 1QOPB 3PPYA 2H7VA 3LWDA 1X1DA 2ZWVA 5CBKA 3HDJA 4PU0A 5C34B 4OM8A 1Z7YA 2ZUBA 4D57A 4LKOA 2YMLA 4CM8B 3BN3A 5C31A 4M0UA 4PZDA 3K0CC 1JHQA 1FTSA 3NCTA 4ZT6A 2OYCA 4BNLA 4R2KA 4RF2A 1QVRA 4ZTUB 2IEDA 2VSYA 4AB1A 4EECA 5GVSA 4MS1B 3G6WA 4C4PA 1P4AA 5BWLA 4BMNA 1RZRD 1KIFA 4FGKA 2V8BA 5JARA 2O1WA 2BFAA 2G71A 3GROA 1NSTA 3I0ZA 3V4LA 2PKQP 2RGDA 4RS3A 1G0NA 4ITUA 4CV3A 1UFRA 4CEJB 4XKJA 2R85A 1YBMA 4GOMD 4FLEA 2ECPA 2IUSA 1PK9A 2ZRPA 5IP5A 4RA9A 1T9GS 2Z9CA 3DCJA 4GC5A 3OWXA 1LDBA 3R44A 4IRMA 3SVZA 4D80A 2CDCA 1K3TA 4IVNA 4O5OA 5LA6B 1I4OA 1F51E 2QI9C 5I8WA 1GTZA 2I4MA 4MW2A 4N6NA 3FDIA 3HJTA 4RPLA 3VOAA 1JE0A 4DCJA 2DUMA 1BQ4A 3T3EA 3ZHQA 5EHXA 5HIAA 5JPDA 1CQZA 3FDXA 2P27A 4ZQFA 1BX0A 1RRGA 4LC1A 1TD1A 3W7AA 4TTQA 5CLJA 3CLRC 3BBPA 2PX3A 3LQYA 4KLAA 5ER9A 3G6KA 1R5OA 3WMXA 3OSUA 4MVJE 3UG7A 4FW9A 2H2DA 4LRSB 4RORA 4WFKA 4IFEA 4R98A 1JFVA 2C29D 1UBLS 2IYTA 2I71A 4Q1DA 1RJ9A 4C08A 5IF3A 2B21A 1X80B 2ZS9A 3KWMA 4QNRA 2V4ZA 1NE7A 1U9YA 3F71A 5K4GA 1NTOA 1AU9A 2EZ4A 2C3YA 1RHMA 1CJVC 1ZRHA 4LWOA 4B6FA 1OU4A 5ALDA 1KJ9A 1DTEA 2P2LA 1TW2A 1D0IA 2UV8A 3LQ1A 2Z8ZA 3NEJA 1KEPA 1QG6A 3VBCA 4BMVA 4QTXA 3VMFA 1CDEA 3LUJA 1G20B 2ZB8A 3HKDA 4AJ9A 2XGOA 5CNIA 2VEOA 2WYIA 2D6FA 4RK4A 2FPUA 1ZMOA 1T36A 1OIVA 2J6CA 1PSDA 3OIWA 1JX6A 3PTZA 4RQUA 4MR9B 4LEIA 4FT2A 3JQAD 1P0CA 1V9CA 1T6XA 3MS7A 5BQ3A 5TB5A 3U37A 3ZKWA 1V7PC 1KPIA 3S8MA 1SURA 4YP9A 1TZKA 4XD2A 2R11A 3ZIAA 4AZSA 1AA6A 3V7UA 5C1BA 1SRRA 4CEIA 2BF7A 2PJRA 3NBXX 3WZLA 5I7RA 4RXUA 1AUOA 1EM6A 4RJIA 4EEXA 2WUVA 1WEHA 2JIZD 2Z2YA 1C8KA 2NU9B 4C2AA 3W77A 1PHRA 3TNFA 3EQ8A 4MPRA 1SXJE 4DFDA 3EBLA 5L3QB 4MTCA 1VIAA 2WJAA 4HRXA 3DUFA 5ULLA 1N32B 3COWA 2L2QA 4P58A 2VYNA 1FXSA 2FHSA 4K6KA 2XD4A 1KI1A 2F8MA 3G9ZA 3Q6NA 4AJEA 4L16A 4LECA 2VP4A 4JI6B 4OY3A 4RHUA 1OHHA 1ZM3A 2AX3A 5DNAA 1O4WA 3NAGA 4GX5A 3T7CA 4DV0B 3K15A 3REQA 1SXQA 1F2TA 3SKVA 1H5UA 1W88A 3L5OA 4LVOA 1WMDA 2XCTB 2AXNA 3BC1A 3C7TA 1FLVA 1U2DC 2E4XA 2GYYA 3MJRA 3ASYA 4YCJA 1WL8A 4CF5A 4CU2A 4RVHA 1KI6A 3EF3A 5KU7A 2RHWA 3PT5A 4LGYA 4IVQA 4I1YA 5IUNC 3LPCA 1QBGA 4OU4A 1HOXA 1N2SA 1FB5A 3GNSA 3KLBA 1OF1A 4URHA 2VWPA 2I0FA 2W70A 4XIGS 2GCOB 4D6PA 4A2QA 4LJSA 1CUZA 1J9GA 2Q3JA 5T41A 4EB3A 1I4LD 1QHYA 1L5LA 2IUTA 2QX6A 3X1YA 1F06A 1HFWA 2IEGA 4H4EA 4IILA 2VAWA 5A6SB 5BSKA 1OPXA 3JYPA 1T2EA 1NQOA 4OAPA 4RFSA 5EP3A 5IJ0A 3A3YA 1JLHA 4GOXA 2YR0A 1U7DA 3LC0A 4NABA 3TKYA 4M1KA 1T43A 5JSYA 5HBRA 2OGWA 2VUIB 3I1JA 1ND5A 4E11A 1HDZA 1L7BA 1U2QA 3SIRA 5ITVA 3KQQA 3WAJA 1XZPA 4FUQA 4HK4A 4BNJA 1GTRA 4P4LA 1Y3AA 1YCGA 1M33A 2JEZA 4KR6A 3USZA 3BWYA 1Q44A 5K3CA 3AT1A 5G0UA 2JFYA 4GM1A 1R2QA 2X9VA 4Y2XA 4G1MB 5LDDC 1RHJA 4FFPA 2HB6A 5CTJA 3UTCA 3A2KA 1M10A 1HETA 1FFGA 3VH1A 3D02A 2ZR9A 2FN9A 4G5RA 4ENPA 1ZJZA 1FDIA 3MRVA 1UXIA 2QE7A 1KOGA 3N7TA 3LX5A 2DR2A 2W8BA 5C8YA 3H16A 2RGXA 2UUBB 1YQXA 2QNRA 2AJCA 1NNSA 2A3NA 3A0RB 2GZ3A 5FA6A 3QELA 3ML1A 1OCEA 4J07A 1WQ4A 1L4MA 3R23A 3WGVA 1SUWA 2UYOA 4OK5A 3VC1A 1Y82A 1XZFA 2GDZA 1JRLA 4HDKB 3RC2A 3TBHA 5A62A 1BGXT 3DDCA 3OIYA 1H2AS 4MULA 1GCOA 5EIHA 1JAZA 1UIMA 4GFDA 5K3SA 4JQSA 4DLYA 4WK0B 4EY8A 3PJFA 1JUDA 1OXSC 3M89A 1I0LA 4NBKA 4I8IA 1XTZA 2IDKA 4O5AA 3OZIA 4ZT3A 2PUAA 2YXPX 1K66A 1NJ1A 4L7VA 3J7TA 3W5UA 2QGFA 3Q3VA 3R0QA 4E0BA 5KNBA 4LZZA 3MZ0A 4Y6LA 3SJCA 3ZS9A 1NBWB 2DTXA 3ZWPA 3N8HA 5E2IA 3NP7A 5IUKC 4FZ3A 2QZSA 1OJLA 4J0DA 5IH3A 1W36D 4IF6A 5JE8A 2NW6A 2ZAMA 4IIUA 3B12A 4CNBA 1BCRA 1YIDA 1VCOA 2CYAA 4OL0A 5AJWA 1KYIA 1MORA 1T34A 2HM7A 5AK6A 5EG5A 2CMFA 5G40A 5IN5A 1PKEA 2OMEA 4RSRA 4D0GA 4JOSA 2I3DA 2QG6A 3DPIA 2GJSA 3MGGA 3B9RA 4F56A 3SQWA 1U7UA 1XB2A 4JASB 4CMBA 1WXIA 5A5GA 1X2BA 2EQBA 1TT7A 3QEJA 2FEAA 4MYDA 1N8TA 3EARA 3MLBA 4KL8S 5TDHA 3BK7A 2QYHA 3ZIAD 1ONSA 4AMBA 2IRWA 4O0LA 4UAUA 5FI3A 4FYHA 3OSZA 1VZ2A 2WSLA 3EAFA 2FFRA 4JNCA 4GRDA 3GRAA 3I32A 2FTKE 4JGBA 5FQOA 1UBEA 1E9VA 4WZ6A 3TMKA 4RE5A 4ZOLA 4HDSA 2FE4A 5E6SA 4J0IA 1EDEA 1S7GA 1U4OA 2XQIA 3DA8A 3WK9A 1VPWA 2GD6A 3DNFA 2E4UA 3GIWA 1E7MA 1UEIA 4LGMA 1VIMA 3NTVA 3AUSA 4RL4A 3VZCA 2OTCA 1JHDA 3LGSA 4KOAA 4WT7A 5CVDA 4D4IA 4EA9A 5DN9A 1DDGA 2R2GA 1P45A 1YVDA 3VX4A 1G6HA 2VPYA 2V96A 4GSLA 1UEJA 3OPQA 1WY5A 4Z9BA 4DJ5X 5CNMA 1X42A 4PX3A 4QHYA 4DT1A 2ZSDA 4FE7A 1E3WB 3FPFA 4NIMA 1DPGA 4GPAA 1A8UA 2IA5A 2OXEA 3P4YA 3O21A 4G6ZA 4X94A 5BSUA 2EP8A 3T99A 5FT9A 4C2UA 3VTZA 1E58A 2PL3A 1OE0A 4P82A 4GVXA 4OQYA 2E48A 5F78A 4F8YA 4II7A 2QORA 4KWCA 5JRDS 3EPKA 1OLUA 2ZPUA 2HK8A 2V54A 2BMDA 2XB4A 4J4BA 3RNLA 4C7BA 4DSUA 1WF3A 2JATA 3VKWA 1EFCA 4QNMA 1RIIA 4TYQA 5C8YF 4PLCA 2RKWA 2H8GA 2VRCA 4NYJR 4CKWB 3TK1A 3NASA 3DXYA 2IHVA 1TU3A 1II0A 1H6BA 1ODKA 1YAHA 1ZBDA 2ZTUA 2H3EA 6REQB 2FPLA 1RYYA 4W7HA 5KC8A 1SQGA 1YDFA 2Q4TA 3EH1A 4JC5A 4O63O 1QH1A 2GARA 5K0ZA 1YGYA 2YRWA 1PTJA 1EH5A 5FWNA 4OHOA 3IOBA 4YRBA 5KWJA 3UMVA 1PUXA 4QDZA 4D97A 3QFTA 3KKZA 3M2TA 4K6HA 2Z83A 4BNHA 2WTAA 4C3OB 3SBDA 3VNRA 5CTAA 1L1EA 2CXSA 9LDTA 5BYAA 3RYTC 1EK5A 4D92A 5IVPA 1SBIA 3CN7A 3QOWA 4J4HA 3CN9A 2FZCA 4GKVA 4HWRA 1XZHA 2C5AA 2FAXA 3ICOA 1YKSA 2I8CA 3NS7A 3QE4A 5D6NA 5CD1A 5LIRA 1MZPA 3VAZA 4HG2A 3IKVA 1W0JA 1GSIA 1KJJA 2AJTA 4QJBA 3N0VA 3L9XA 3ZWWA 4BXOA 3B9QA 4XJSA 5D7BA 1K75A 2Z4RA 4HAYA 1W4AA 5E1BA 3T95A 5KNLA 1N57A 4EX6A 4C5BA 4NJEA 4OQLA 4LI3X 2L0XA 2BBTA 4PS1A 4FOTA 4KAJA 2QP3A 3M4JA 2NP7A 4L3VA 3W2FA 2ZYTX 3LYAA 2Y2VA 4R9UC 3C6YA 5CPFA 3L1KA 3LX8A 1YR1A 2IIQA 1GL3A 1DCMA 1FP4A 1X7XB 1YKGA 3KVOA 2XA9A 2XF2A 4F9EA 1E6MA 4B7AA 2QRPA 2Z6AA 4UC0A 5KYUB 4QEDA 4K0KB 1UBFA 2BUBA 2E5WA 1P2SA 3O73A 4XIIA 5BN4A 3HB5X 1S8OA 4OREX 1KVUA 2JGDB 4NU8X 5FPQA 1CR2A 1PJQA 3C4QA 1C1HA 1C8LA 3AWIA 2Q9AA 2NM0A 2WAYA 3OUUA 4N18A 4UASA 2CUTA 3QWAA 3S40A 3SMQA 3B6ZA 1YDGA 2B7LA 2I3GA 2BFBA 1ADGA 4ZDJA 3ZBUA 4HRAA 1CV2A 3COVA 4BX8A 1K0FA 5KNBD 3HCNA 5K8JB 3A11A 4HP8A 5KYGA 1JJFA 1H05A 4UQPA 1PQPA 2OHFA 4N3GA 2AG6A 3OOHA 5A5DA 2Z30A 4RPHA 2QM0A 4YCDA 1PYDA 3ZH2A 3IAHA 2DG2A 5F4BA 2L82A 4KU4A 3BX1A 3HE3A 2PLNA 4N82A 2G09A 3HU1A 3AY3A 1MTOA 3GCWA 1P0MA 3F4LA 2VZ8A 3ZY2A 1L5WA 4GQIA 4IDCA 2YIDA 4YAJA 1Z38A 3ENVA 4TWZA 5KJ1A 3BMNA 4LK2A 1TA0A 5KSOA 1P5RA 2O2SA 3L1VA 5JPIA 4DLTA 4N0DA 3T12A 1R88A 2ANBA 3ESYA 5JNWA 4TKUB 5AHOA 1I4DD 5BNFA 1PYOA 3QU9A 4MZXA 3OU2A 1LQTA 2JCXA 4ZZ0A 2VP5A 1IN8A 1IDN1 3P7MA 3DXFA 1ZM4A 2DY1A 3OLWA 4AP9A 3PX3A 1ZONA 1CNFA 4GO1A 4CQMA 3WJAA 3G5TA 3TTSA 3UXYA 1LPPA 1CVIA 3JPWA 4HNAB 1GLVA 3MG9A 3UOAB 4Y1RA 2B83A 1GPUA 3UWMA 1QYVA 1X8LA 1E7SA 3HSSA 4QWMA 2C4HA 2XX3A 3HR4A 4PZPA 3RWMB 2YHIB 1KEUA 1L7QA 3DFZA 4LNUA 3QFSA 3LLSA 4Q16A 1PT5A 2NSJA 4HTAA 1K3FA 3OQ6A 3D6VA 3FJ1A 1GQFA 1HMPA 1RHUA 5FPKA 3GA0A 3GVCA 1HT1E 4URWR 3WL6A 1M73E 2F1KA 3L6BA 4IUDS 1RRCA 3VPCA 4NH4A 2UZ1B 1LUAA 1ZVJA 4IO1A 1S7CA 4DBLC 5LBIA 5FLXA 1KAHA 1BS9A 1LI7A 4JI5B 3CSSA 1DO2A 2P3QA 4AW9A 1VMAA 2JAWA 2I2BA 3QE9Y 2JA1A 2D5AA 1WY7A 3PNMA 3GOHA 5ALYA 3P0IA 3WNBA 1Z4MA 3COPA 5E1DA 2XGMA 1OX4A 2A1TR 1A8SA 1HY3A 1YFJA 2AJDA 2C7QA 2HX1A 1YC5A 2R6DA 3TLGA 1LTQA 1M8GA 3G0CA 5LQKA 3CO0S 4BCCA 5REQA 1LSOA 5GGXA 4ZCIA 3I34X 5B36A 2QVYX 1HUQA 2F00A 3O0DA 4XEUA 5FNVB 1JJBA 4J1TA 3NIFB 1Z39A 2BM1A 3D7MA 1SCBA 1T2NA 1FBNA 1N5JA 3JTMA 5D3MA 4B6JA 4L95C 3IT1A 3BB1A 1SQSA 2D8AA 2VKTA 4GZ5A 4FGLA 2I34A 1WOMA 2HA5A 1D6NA 2ZUDA 4QDXA 4FLFA 1M5TA 2YY6A 2B8WA 2PVPA 2QTNA 5CT5A 3RVNA 2F8LA 2ACWA 2ZE6A 4JJAA 1QS0B 1TQDA 3TM5A 3QYPA 3V7NA 1Z5NA 3N8DA 4HQ6A 3DAYA 3IAM6 1EWRA 3KKQA 2L19A 3DBVO 2AT1A 4NBRA 3DNMA 2O1SA 2WABA 3PD0A 2YY7A 3SM9A 5I7UA 5E0OA 1T3GA 3BFVA 3M0EA 4PLPA 3V55A 1I5OA 2VRNA 1OXKB 2YXDA 2ZSKA 4K9LA 2FY8A 3E70C 1ZY2A 2QGZA 3KLNA 1AUVA 4Q4LA 3R75A 2X8WA 4JUBA 4QQNA 5JXIA 2D59A 4Q19A 2VJDA 2GHIA 4ZVTA 1WB5A 2LR0A 1YONA 4RL6A 3X43A 2W6ZA 3C5EA 3SSNA 4A6DA 4PPYA 1SG6A 5JJBA 1AB5A 1FRFS 2Q1TA 1Q7RA 4WBXC 3TRKA 3ZDQA 1TCUA 1A9XA 2EKLA 5CHYA 3WBFA 1L8LA 2FR1A 1K0UA 3KJQA 5BRJA 2L17A 1WHTA 3I5XA 4ESHA 3PLRA 1CEQA 3FJYA 1K5GA 4F92B 4PLFA 4DG9A 4GT1A 3IHKA 1ICIA 1BDHA 4NZPA 1G7RA 1FLAA 1I6KA 3KE8A 5TLSA 4Q3CA 4Z8YA 2GA8A 4CV0A 4X63A 1HQYE 1KL7A 3F2IA 4RTLA 2IH5A 3N8IA 3E61A 2ST1A 3BDIA 4PSUA 3U4QA 4J0GA 4X6XA 1FNBA 4TQUS 1DRVA 3QX3A 1RWVA 3TBKA 3C2QA 5FTKA 3ADDA 1JSRA 3HKBA 4DGQA 1T6NA 3E3LA 3KZKA 4XSHA 5J3JA 2ILVA 4UUBA 1IZ0A 2C8JA 1FXWA 4WXPA 4EY4A 1ZIXA 5LP6B 4DBLE 1XKTA 2LBPA 4ZZ3A 1GKLA 2NYRA 1RXUA 1PYGA 2HJSA 2JLCA 4HTFA 3OP1A 5FAXA 2W11A 3EMKA 3ITEA 3IP3A 4KP7A 3OESA 1MJ5A 4CQMD 3QKIA 3FFXA 2B20A 3ELWA 4H7DA 3T06B 1BKYA 1H2BA 2YNMA 1J0DA 3TZ6A 2ZI7A 3DCYA 2XHEA 1Y4AE 1W87A 3BD6A 4ABTA 3LUPA 3EIEA 4M0KA 4BZXA 2O7SA 4XJVA 2QN9A 1ZGCA 4C4AA 3W5CA 3BMCA 1PVVA 4LTNA 4NEQA 4W5TA 3DL2A 2CL6X 4U02A 2FPKA 4YO7A 1JQEA 3BREA 2PH5A 3K6SA 1ISSA 3AU9A 3NGXA 4RWZA 1J1ZA 2DT8A 1V3QE 2KLBA 3A7EA 3VNVA 4Q3OA 4ZAYA 1SZDA 1R9JA 4DR6B 1MAAA 1FQJA 3MGAA 1I7SB 4IH4A 4YREA 3TJRA 3AVUA 1CIJA 1LQ2A 3MW8A 3UW1A 2H00A 1KK0A 2VXBA 1ZS9A 3AETB 2CNKA 4Y7CA 5ETJA 3SOPA 5C7LO 3I62A 5K3AA 1E2QA 2BEKA 2HA0A 3RIHA 1N3BA 3GEMA 1MDFA 1B1CA 4IOMA 1B26A 4HLDA 2B2XA 1BVYF 4NMWA 1G17A 3MLAA 1WV1A 3PGKA 1JMYA 4HLUC 2C61A 4D6YA 3ZHRA 4DIEA 4MAFA 3H3XA 4LFAB 3WWEA 4LXIA 2CLCX 3L3BA 1TRKA 2WINI 2GEJA 5CM2Z 3Q15C 3THYB 3DF9A 3AOGA 2ZVDA 1ZJJA 5C35A 4B84A 1P1BA 1TQ2A 5LB2A 1MJNA 4J76A 4LYEA 3UQYS 2B0CA 4EMTA 1Y8QA 2XE7A 5KMGB 3MHPA 3SR3A 2PA0A 3T7EA 3ONWA 1RDFA 4V03A 4Y2HA 5ALFA 4B9AA 3LXUX 4BFWA 1XJWA 2MSWA 2YYAA 5GP1A 4ZC8A 4OB7A 3ZZUA 2IU4A 4K9RA 2GBLC 3F97A 1Y4ZA 2I62A 5CM8B 2YN4A 1G6OA 1RBMA 3MNFA 3UCFA 1K7FB 1NVFA 2ZJ2A 3W8NA 4TT3A 2VF4X 3ENQA 2Z1DA 3I42A 3MRSA 1W93A 4YMSA 3H9UA 2GBIA 2VNIA 2PVCA 2TRSB 3UHAA 4I5IA 5ALQA 3ME5A 3RASA 3ZOZA 5JHHB 4CW7A 2WEKA 1R6UA 5HQ3A 2AVDA 1QKJA 2XMBA 3OP4A 2PWZA 3TNDA 2AR9A 4H31A 3QLEA 2PMCA 4KXXA 2R4TA 1CS0A 3A9RA 3NV9A 2MMCA 1U80A 5BSMA 2EZUA 3LW8A 4YXWA 1FXWF 1R4NA 3HGTA 4LC9A 1C4KA 3VR1A 5I51A 4NATA 4DSZA 2PN1A 3JYQA 1N2XA 3R6GA 2VS1A 4TX1A 2EQ5A 4K9NA 5IC5A 1CYDA 2XDYA 4X1OA 1QHXA 4E2XA 4EHLA 3HJUA 4D4KA 1A2BA 3OOJA 4ZV4A 3ZHUA 5I7WA 3JQ8A 2WWYA 2G5PA 3II6X 1N8SA 1PR2A 5ALXA 3RTAA 4Z4EA 1EFUA 1JIJA 3CLTC 1GV0A 3FVTA 2D4HA 2GFIA 2XYVA 3K5WA 1IPEA 4JKYA 4L4XA 4PFKA 4QDUA 3JWHA 3OPMA 5DTRA 1RCUA 1NJ2A 2WT9A 2GZ2A 2XWSA 3WY9A 4HUTA 1BFKA 1KJWA 4WBSA 3PRHA 4RDCA 4AECA 4QE3A 4WCFC 4KLRA 2QXYA 1M7HA 1XEFA 4O02B 4TZKA 2R86A 3OZWA 5DLEA 4HQKA 5LCXA 5DM4A 2UUCB 3P2EA 5CT6A 2QSJA 4G9BA 1AJEA 2OQ2A 1GA4A 4XD7A 4TYMA 2NYAA 3ENKA 3HB4X 2BFNA 4C6RA 1CP2A 1A7KA 3RCBA 4H3VA 1KJZA 2C9CA 2KLHA 4MYTA 3TH5A 3RGGA 1AMOA 2AOUB 1LD3A 2WF9A 4G0XA 4MDEA 2Y9PB 5F77A 2RGYA 1G5QA 4A2PA 1RNLA 1WXWA 2XPCA 4KDCA 3AFNA 4ZP1A 4ZARA 5ENVA 1F8UA 1UBRS 3F6CA 3HDHA 1JR3D 4HEJA 2WIFA 4FSDA 5DM2A 5H4GA 4HUQA 1KWKA 3AH8A 3JVEA 5AESA 1REQA 1JW9B 4QL3A 1VRCA 3GLIB 1C8BA 3PQ8A 3ECCA 3FROA 4RK1A 5F76A 2OK7A 3FLMA 2BM0A 4PBRA 2PWYA 3VM6A 3PX2A 3SZMA 1CLUA 3VR6A 3ZGNA 3H8SA 4I50B 2G1AA 5LB4A 4MEAA 4OU5A 2PSSA 1P0IA 4PQEA 2FQXA 2PUTA 2CMHA 2EBFX 1Z26A 2YJ3A 3H2SA 5K99A 2A14A 1XPJA 6GPBA 2DHRA 2GN4A 1ES9A 1FOEB 1FP1D 3F0TA 1YS9A 2B7CA 2NU6B 2GVNA 3DLTA 2OORA 2GRUA 4KNVA 4Q1CA 2ECKA 3KOZA 2G9QA 1NQXA 2PA3A 5GOTA 2OGZA 5CCXA 4PC2A 3DMPA 4M7RA 3WO1A 1EDBA 1KKMA 4JLWA 1YRQA 4OFWA 5H82A 3O8QA 1UMCB 4MXDA 3WMGA 2QVCA 1JI0A 4GWGA 4JJIA 2BFWA 3Q3CA 4IDBA 1JQKA 3NHFA 4IDGA 4UKDA 3CVYA 1E6LA 1RQ2A 4DC1A 1DC7A 1V1RA 1HI9A 3WNDA 2BEVB 1NQAO 4MI6A 1SC4A 3DH0A 4AKTA 2QTHA 1HZZC 4G85A 4LPKA 3RUDA 5HTOA 3WYEA 3HCEA 5TQ2B 1RXWA 2RK6A 2JFZA 1OW3B 2VWHA 4P0QB 1SOWA 2CXOA 3R6LA 4S2EA 4Z4HA 1WSAA 1O6GA 5DOZA 4L2IB 4OV6B 5JCJA 1C3LA 2Z2ZA 3IP5A 2N9UA 3H9BA 4PIMA 1G3RA 2A0UA 3KYIB 2QBYA 3DMNA 4QPNA 4OP3A 1Q84A 1U4SA 3C0KA 4D46A 1A96A 5KTNA 2GYWA 5J1SB 1Q1NA 4P9NA 1YFLA 3H2HA 4GPIB 4JQOA 4MV9A 1P1KA 1OFUX 2AFIB 2V6MA 1AKUA 2LV8A 3NIDB 1DJQA 3EPRA 1NQVA 1ORDA 5TQ0A 1QZ3A 2QWXA 1DZ3A 3MOSA 4Z1OA 1QDUA 1DV2A 1OASA 2PNJA 5EE3A 1NOIA 1P3JA 1VLZA 2M6LA 2CBGA 3RFCA 1I7LA 3SLGA 2UVPB 2VK2A 3TEMA 1GKIA 2V55B 4CIDA 4AVYA 1J8YF 1B6RA 2C4UA 3DVAB 3UMGA 2PCJA 4JVMA 1DUIA 8AT1A 4ESOA 4JBWA 2O8NA 1A2OA 1TUGA 1VYVA 3WWDA 2BTQB 1E94E 5B7NA 3F73A 3WGIA 3C5CA 3E9CA 3JR3A 3SI7A 4LDNA 4WN9A 3VUFA 2CXPA 2PKEA 1IH8A 5FA8A 3U9SA 2B8TA 2IXAA 5DP2A 5FR2A 1V8OA 1XVTA 4RQAA 4F11A 2FW1A 3GV0A 3WC4A 3DKKA 2QLJA 3RRMA 4FXOA 2K6GA 4R9NA 4EHBA 3SWWA 1Y6RA 4YXWD 4I81A 1TOAA 2PX5A 1ZRSA 3OOSA 5IHPA 4DLWA 3FHTA 2I4OA 5J9FA 2K7ZA 4QTZA 1HKHA 4D81A 2WIDA 4A0RA 1TJ3A 5IARA 4MKZA 4Q39A 4Z7QB 1XCLA 2ZSEA 5A5VA 1F5SA 1V7ZA 3AHDA 3BE8A 3OJLA 4D5GA 4O3FA 1L7AA 3B1ZA 4IGEA 3GPBA 3OLXA 1USWA 4JIGA 4H16A 4H3SA 4BV3A 3R7NA 1CEEA 4ZCSA 3SM3A 3FIJA 3W8FA 1DFHA 2PX0A 3V8NA 4M9SA 5I47A 2VP6A 2HD4A 1G8YA 4IIJB 4C22A 1G19A 4DAEA 3V1LA 1E5DA 1N75A 2EFDB 4ZAFA 1JKXA 1LW6E 4B34A 1Z2CA 2Q3MA 3ZX4A 4B48A 1WW8A 1XKXA 4PR0A 4UHJA 4DYDA 3FYUB 4XD7D 2J33A 3A9CA 1FU4A 1YJCA 2A5LA 4YLEA 3RWOA 4HVCA 5F51A 3MUNA 5TX7A 2VJNA 5JCOC 2P78A 3PL5A 4F9GA 2ZR7A 3HK2A 4S0ZA 5ALNA 1LK0A 1UUFA 4RKYA 1I24A 2BLLA 4DIFA 2DPLA 3T5TA 2R1VA 2HWXA 3V1MA 1CPYA 2FB9A 4JCCA 3LRXA 5K8IA 2OLJA 1GL9B 2CNWD 2ZRLA 4BNUA 1R9MA 2OCYC 1VDZA 2BRUA 5AI5A 1G42A 4FEYA 3T5MA 3E9DA 1ZXLA 2BGTA 3EA4A 4PW0A 4YHBA 3UHPA 3CUYA 1SHJA 3RSSA 2Z3VA 3T5BA 3ZNQA 2HZ7A 3JQBC 3ELYA 4PZAA 5MDHA 2V7QA 3CSUA 3B85A 4YCMA 4WERA 5JFTA 2GASA 2OG2A 3MMXA 1XQYA 2A5YB 2BCJQ 2QX8A 3DTVD 1FDRA 3FJOA 3LVQE 1ZNYA 1BS1A 1SBCA 4OQPA 1VE5A 1DC6A 4PIPA 5DM1A 1P8AA 5FPHA 4E7PA 3KUXA 5C9ZA 3GJQA 3ZDEA 1X74A 5F12A 4C0SA 2G5TA 2JFPA 1CB0A 3JZDA 4L5CA 4M6WB 5FEMA 3Q3IA 1E99A 4EG6A 2JVJA 3NT5A 1F8GA 5EJFA 1N0WA 1YQQA 3C3KA 1BMQA 3AZQA 1E2MA 1ZGHA 4CKEB 3MAJA 4DLPA 4MMXB 3RUFA 5JV5A 1ILEA 1TJ4A 1Q7GA 1KZHA 1NBEA 4Y2SA 4EUEA 1ZD1A 3SG0A 3AGQA 2XZOA 1ZSVA 1GKUB 4KGXA 3TEJA 4NBWA 4AJPA 2CDAA 1TM7E 4ZVLA 1QB7A 4QARA 1IOWA 1QHHA 4GOOD 1EA7A 1NHWA 4U5XA 2IXBA 4ZA2A 4O2BA 3VU9A 1U2TA 1A5AB 2AH5A 1LCIA 3V2GA 3HXKA 4OPMA 3K6JA 3KZNA 4IQ0A 4ZDWA 3LBNA 1YIAA 3ZY3A 1CKEA 1UAYA 3D8RA 4GBGA 3UAGA 4PSKA 2E82A 4XWKA 1M75A 1PR6A 3TSCA 3FMPB 1RXYA 2GESA 5IFKA 5K05A 5MHTA 2QRQA 1PWHA 1XALA 1VOTA 2FCRA 4H7EA 2I99A 4XWOA 4FKZA 2ODBA 3Q3EA 4UNPA 3I4FA 1DC8A 4YUVA 1PT7A 2BCEA 1GILA 2O57A 2BGKA 5TEWA 3TR5A 5CFZA 5LOVA 1RPJA 3MB8A 2KS6A 1YJXA 2K2QB 4ZT4A 5AK4A 1P73A 2AFRA 3V1UA 2NU8B 4MQEB 2WF5A 4Q7EA 4TSKA 4IIVA 1RT9A 4R01A 5DO9A 2R8PA 2Z9BA 5DT2A 3DOUA 1YB2A 3BGSA 1CY1A 1F9AA 1KEEB 2VDNB 3JRNA 3PLNA 4MA5A 4PFJA 4AZ3B 5JH7A 4FMDF 5KKCA 2O59A 3EXHA 3LF2A 2A0WA 3D9QX 4KR2A 2IEIA 1CNEA 3B82A 1Z13A 2UZ0A 3G0IA 1J7JA 2PL1A 1GTMA 2I76A 2AD5A 5JSKA 3MOGA 3ZJYA 5K0TA 4ROSA 5J4YA 1RPNA 2CV0A 4LHEA 1ZN7A 4IXMA 4FMCB 4PINA 2IEBA 5LMZA 4X20A 3KB2A 2R68A 2I1WA 4FYJA 4BFCA 1Z8FA 1L7NA 3C97A 1HO3A 3ESDA 4J91A 4YX9A 5A4AA 1II8A 5JAHA 1O0BA 2HFJA 2O7RA 2VHJA 4A82A 1G8HA 4P2BA 5CW2A 4RZ2A 5A9RA 4TV9A 1GRVA 2O52A 3AR8A 4E46A 3DT8A 1KAOA 4ZWNA 2RG1A 1NUTA 2V97A 2SKCA 4LYAA 1VSTA 3ON5A 3PPVA 3OQPA 5AJYA 2IU0A 4GMHA 2RAPA 5AD1A 2W37A 4DMRA 2FOLA 4E94A 4NU0A 3CKKA 3RV4A 1H66A 4DRZA 3L1UA 1RWNA 1UDBA 2HDWA 3B70A 2O2DA 3HFJA 3NEYA 4ZPXA 3V1KA 4JT2A 3V6MA 1SXJA 5EJAA 4AN0A 2XUJA 1E9AA 3WRYC 3QXJA 1Y8ZA 3S2YA 4EG4A 3EBPA 2ZXFA 3AKDA 3IXMA 4NAVA 4RZHA 3IEVA 2WQ7A 2WF6A 2XY4A 2IGBA 3ORQA 4QGFA 1I1HA 3ABQB 4F71A 1Y6GA 3BRQA 1C9KA 2DT5A 3HO1A 4LRYA 3ZDXB 5DOVA 1MQAA 1ZA2A 1X1AA 1Z82A 3FR8A 4Z0HO 3UJ7A 3K0CA 5FTNA 2NUAB 2NV2B 3OKFA 4MYCA 2Q28A 1J49A 1BHJA 3UMBA 1SUEA 1Z83A 4XWGA 4O2BF 3DAGA 1MX3A 2B0JA 3PWKA 4BECA 2GPWA 1DQRA 5FI1B 1G8MA 5L3SA 1JR3E 4M87A 3FTNA 1YR3A 4LV8B 4B33A 2PUJA 3B6EA 3DYBA 4MRMA 1GUAA 2WOJA 4AJ4A 1A9YA 1BEEA 1BH6A 3V1NA 1KR5A 3BMQA 2J4FA 5JC8A 3D8TA 1P4GA 2BSXA 3N6XA 4BO9A 3CMCO 4NVRA 1H2HA 1Z4OA 5DTEA 5LOVF 1R37A 1A4IA 5EUBA 2ZYIA 2J5QA 3NJ8A 2XE6A 4UHKA 1XXLA 3KPVA 4DUGA 3JZIA 1AKRA 1PQWA 3OC0A 1D2GA 3NYQA 1DG1G 3Q7TA 4MHTA 2YIJA 3K2BA 5E7MA 2YDYA 5FTJA 1SR8A 1R12A 1TAGA 1T24A 2OCAA 1R8SA 5CP8A 4M53A 1QE5A 5F1PA 4N5DA 4KE7A 5JH7F 3ESZA 4UXHA 4LF7B 1DGQA 3MUEA 4URVR 2UYGA 1QAQA 1OH6A 1FYDA 1XZNA 3HMQA 3NTUA 4EPTA 3ROKA 1UXGA 4I4CA 3IKJA 3SDSA 3UAXA 1X7GA 2W2QA 3CH7A 4AZVA 3GPCA 3A2NA 1PJ2A 3FIUA 4W8OA 4QZVA 3A9WA 3R0VA 4LZWA 3ROQA 4CIWA 3FCXA 1DT5A 1NI3A 4KN8A 4HGQA 4OOEA 2AWNA 4OVKA 4MK4A 1E1CB 5EHQA 3EF0A 3ZQJA 2J3IA 4KODA 2FSFA 1H2ZA 2ZRAA 2QRUA 2XZDA 3MELA 4M7WA 4XIYA 5AVXA 3BB4A 3AHIA 1Z5GA 1Y1LA 3QU5A 4LJ7A 4M9UA 4TV9F 5HIIA 4X24A 4F5DA 3AC0A 4XFKA 4PM4A 1GGJA 2BFCA 4QUAA 3QTLA 4UM5A 4NV3A 4Y6GB 3W6PA 2PSFA 4YAOA 4YJ2A 3WGOA 3T1OA 1FIUA 1C5KA 5LJLA 3SBEA 3VR2A 1GCGA 2ZBGA 3SJAA 3W5HA 3K9LA 4G8DA 3DNPA 2QROA 2HDOA 1XTJA 5KYWB 1E7RA 2FSSA 2IODA 2POQX 2WSIA 1UBUS 1YJQA 3IQGX 3N7AA 3CR8A 1NLZA 3IMCA 3IVCA 5DBEX 4EJMA 1Y63A 1TM5E 1TX4B 4N0MA 1B74A 4URZR 1CXZA 4GLBA 3BIJA 3I30X 1UBJS 3N75A 1L5KA 4MQ4A 3SX0A 5JZSA 4EZEA 1ZCJA 3IELA 4H1TA 1E2EA 2FG7C 4CG3A 1VCMA 4YT4A 4KXQA 2VTKA 4G24A 3NOOA 4R3WA 3ZU3A 4WKPA 2P6RA 1U6IA 5E6RB 2EFCB 3BGVA 1VBNA 3DV9A 4WVFA 3H18A 4CCWA 1XRQA 3OUZA 2OA0A 1JA9A 3GD7A 4LVUA 4JQCA 3H2ZA 2HK9A 4UDOA 3RS5A 4WTOA 3U4HA 1VHQA 2P3LA 4KQ9A 4ZEMA 3WSVA 2H16A 1K9VF 1IN5A 2QTLA 2OQVA 2QDKA 3V4VB 5C18A 5DBHX 3D6TB 4MYUA 4Q1VA 4YC7A 5DI3A 1E2UA 4XM1A 1RIFA 4YP5A 5EJIA 1QO7A 4Q3NA 1G8SA 1E2GA 3ELUA 4QDOA 4BE7B 1U2DA 4TRNA 5CA1B 3IBGA 2F1JA 3SSMA 3L8YA 3PBKA 2ADFA 1S2MA 3UK7A 4GKKB 1LVGA 1JYEA 3O95A 3MF4A 4QSHA 2V5VA 1GIAA 2IYZA 1T8WA 1QQ6A 2HA4A 2XQFA 3JCZA 3PNVA 4NULA 3T4EA 2QI9F 1SUBA 1UC5B 4FFLA 5AMXA 4IDNA 3NU1A 5U4QA 4OQNA 4YP6A 2CE7A 4IQ8A 4REMA 4X7MA 5C81A 2CFRA 2E5LB 3C1UA 3BQ9A 1A04A 1UK9A 2RONA 1PX0A 3IBFA 1KOJA 2OV8A 3PUZA 4RH1A 2DFPA 4P08A 2RHTA 5HQJA 4B0PA 3KKLA 1AV6A 4OAQA 3KJHA 2A9JA 1W5AA 2ANCA 3Q98A 1OILA 5T57A 1MHTA 3S27A 3R9WA 2VAVA 1PWXA 3Q87B 4OA8A 4LWQA 4GKJB 2EBUA 4IOJA 1PGOA 3LY9A 5KJEA 4V0SA 5TNXA 4W9NC 1CEYA 2ORVA 3OJXA 4FHCA 1KIMA 4H35A 2CCGA 4A7PA 1TLFA 3DQZA 2RCNA 3ANNA 2H1WA 3U3JA 5HSGA 1N92A 3DE5X 2B4YA 2WTMA 4LMRA 4MICA 4MRVA 2ZIUB 2I6SA 2QW8A 3R5FA 5L45A 1UPXA 2CXXA 3PA8A 4YWHA 5KX5B 3O6VA 1ZR4A 1Z7BA 4B8WA 1G5TA 2NUBA 1LWNA 4KG7A 1FE8A 1X7YA 4A5OA 1PT8A 2EQAA 4F91B 5A2GA 4NHOA 3LA8A 2VF7A 4Y2PA 5CDUA 4ZANA 2Q27A 3MMPA 1EX6A 3S1AA 4B6PA 1XTRA 3FDJA 4BFLA 2GNAA 4KV7A 3B5EA 1CVRA 5AI6A 3TD2A 4BO7A 5F9HA 1JZQA 1WZCA 4NE9A 4V39A 5DGDA 1R6AA 1YB1A 5LQDA 4K86A 5JSFA 2P0EA 4LRTB 1IZYA 4NBUA 5HM6A 1ZZEA 4QOIA 4WI1A 4AK9A 3HJHA 2ZUUA 4NDNE 4IX1A 1KA9H 2NO0A 4RS4A 5EJEA 3BXZA 1NBMA 4PFQA 3NBZC 4EKYA 1WMAA 4EG1A 1Y5MA 4FNOA 4RTJA 3C16C 1Y3BE 1XZKA 3D3JA 4UFPA 3H9GA 3K0FA 3P9PA 4E5DA 1ZL2A 4EA7A 1CUAA 3N74A 5CX4A 1UDCA 1AGNA 1DKUA 3GCDA 1M2OB 4AJOA 5IRCD 2IS1A 2WAMA 2NT4A 1VBKA 4ARVA 4DJJA 1E66A 3LH5A 1BMFD 4Q3DA 3WGQA 1YOVB 1NNUA 3NVMB 3QV1A 2AG1A 2ZPAA 1V5EA 2J0EA 3AUUA 4NCKA 1RD4A 2WM9B 1VJGA 3F7NA 1URPA 4FVTA 4GZMA 3ICCA 3L6CA 3Q2IA 2QIPA 4Y2UA 4BEBA 3B1VA 1AK2A 1LVUA 3LNTA 3H4MA 3T41A 5I7HA 1JHPA 3R7WB 3A6EA 3WXMA 4AY3A 4KQIA 5MFPA 4CKCB 3CINA 1I3OA 1T1GA 2IF0A 4OUDA 3BHNA 2WJJA 4PG8A 1V6SA 4Q4CA 4B7XA 2Y4OA 4F72A 4A36A 1V4NA 1ESDA 1U8FO 4L5JA 4BUZA 1XPRA 3PI6A 4JELA 4RO0A 1ZU5A 1B15A 3CRMA 3TMAA 4AIRA 5JBNA 1RWPA 3IBTA 1NFRA 2BONA 3GOQA 5JLJA 3AKYA 4Q4AA 4DQKA 1IULA 3EXFA 1IB0A 4MUMA 4BKUA 5JR3A 2ZUEA 2IYOA 1EK6A 3OF5A 2HWYA 5AIAA 1WZIA 4BATA 2QTTA 3O7WA 2GFQA 4TSFA 3V7FA 1P6XA 1G2PA 2HBQA 3K1AA 3LZCA 5EMHA 5B30A 2ZR8A 3K53A 1QV9A 1KFJB 2SKDA 4JUIA 1M2FA 4Y8VA 3TZEA 3BXPA 1HT2E 3VU0A 5A4IS 2DFVA 5DEOA 2VP9A 2OMKA 2VYFA 3O2JA 3ONVA 3RH0A 1VE7A 1BQEA 3PNLA 3T8YA 3LCJA 3MUOA 4GR4A 1ENOA 3FUCA 3FPJA 4QASA 4DDWA 4B3GA 5CIQA 1FY2A 4RW0A 3RVOA 2MYUA 4WCDA 1A5BB 1QRUA 5IBRA 5AJVB 1UQUA 2ZBPA 3SYMA 1TGYA 2QJRA 1Z8NA 3KQTA 4L6CA 2O8DA 2W90A 2PPVA 2ID8A 3INTA 1N6PA 1L1FA 2O7QA 4DS3A 1D0SA 4B6QA 1A88A 2OCLA 4ADSG 4EFMA 1I6LA 1KOLA 1TYBE 2IXEA 4KQKA 1XA0A 2GF9A 5E9AA 5DYNA 3GXOA 5KOJA 1EB9A 4IRUB 3WAGA 4FFBA 4JUFA 3EULA 1MW8X 1YVEI 4P83A 1PD0A 1FTGA 1V3UA 3QUQA 5BQXA 4TKVA 5LC1A 1JG1A 3U44A 3V2HA 2I54A 1X92A 4LXTA 4E5PA 1VL8A 1C3XA 4TN5A 3R7LA 1ZITA 3DLHA 3O8RA 1FCJA 5H8WA 3ZU2A 3GJ0A 2FUCA 1ZOPA 3F67A 3K2IA 4DA9A 4UTVA 4US0R 4L07A 2FP3A 5EGNA 4IH9A 3VZRA 1K8XB 2VFAA 2GHRA 2ZSBA 3QF4A 5ARCA 4KK3A 3F6YA 3VR5H 5COQA 4M0FA 4KACA 1KQNA 5BSHA 4FWBA 3OIGA 3ITKA 5G4KA 2DYKA 3FMIA 1DB3A 2X3UA 1G2OA 1KK1A 2HRDA 4JX8A 3NFRA 4OLAA 5AVZA 3G0GA 3RYHB 4F1KA 4L6AA 1S2GA 2GPYA 1U0FA 4OMDA 2BI4A 2QTFA 1Z0JA 4JL8A 1XVLA 2R7KA 1QYIA 2PT7A 2CLIB 3UJDA 3BCHA 5D3KA 3I4LA 2XADA 1M0EA 4E21A 4W9RA 3QH4A 2X1LA 1PGQA 4ZRMA 5EXSA 5BYBA 4G1CA 1ZESA 4WMLA 2Y0CA 3HYRA 1DI0A 1GFZA 2G07A 1PI3A 3NOQA 1UT8A 2MIIA 3GUVA 2C9YA 1Q22A 2QA5A 3DKVA 4MVYA 1S01A 4E5YA 4LHSA 2PHZA 2Q1XA 1JXOA 2PGDA 3AV3A 3IUSA 3PC7A 2R1TB 3SIWA 1EWQA 2PZJA 2VLBA 4MUEA 4C7VA 1BU8A 1XZGA 1MO4A 3I6ZA 4DLNA 1TMKA 3FSJX 1FQWA 2BELA 2JFVA 4ZU1X 2X6QA 1I3KA 1MJGA 4MWGA 1C9JA 4WKOA 3LK6A 1MP0A 2B4KA 1SRQA 3G59A 5CG2A 2B1QA 3IOEA 4R7GA 3PNQA 4QLOA 2NZYA 4HB3A 4XUDA 5I3ZA 4FM9A 4PC6A 1FVFA 3I76A 4EARA 1AC5A 4IEIA 2VHUA 4MR8A 1KMHA 2ATEA 1TF7A 3ODGA 4EABA 2GEBA 3T9DA 1KKUA 3RU7A 2MU1A 4KUHA 3EXEB 1MPTA 2O2XA 3ZJ4A 2VATA 4GPTA 4Y1FA 3ZWVA 4B4WA 2C7OA 1E9CA 1FLDA 1WSWA 3GVIA 4BGEA 4HNVA 1DELA 5F2NA 1BVRA 3EXIA 4UUQA 2UDPA 3C14C 1K2WA 1VMIA 1F4LA 1TQ6A 3EVZA 3WKDA 1N36B 4DGSA 5J2UB 1J1IA 2ZJ1A 2OSBA 3S68A 1QO0A 3NM4A 3DEHA 3H9QA 3GT4A 5CGQB 4NZ9A 2C4VA 3QQ5A 1Y3CE 1FFSA 3DOHA 4Q3BA 4CF6A 4QQ8A 1I2DA 1U0OC 3VKUA 5K3EA 4FYXA 4OKSA 3RBVA 3DL4A 3E5RA 5C32A 1A95A 4BMDA 2GYUA 3EVEA 1SU6A 2MWMA 3SHVA 4DM3A 5JXWA 4ZVVA 1QV7A 4I3FA 4Y2YA 3QBTA 5CW1A 2ZCUA 3I0NA 4CIXA 3AINA 3DBRB 1GZSA 3GXBA 4WNAB 4NYMQ 4IH1A 4ER3A 4DF3A 1I33A 1LJLA 1QANA 1HMYA 2QR5A 5GONA 1QJ4A 3PSHA 4DA0A 3EPPA 3G0OA 2Y92A 4D98A 3G82C 2G9ZA 4XCXA 4EVSA 1RXVA 4Q47A 3EMDA 3RC1A 1PF7E 1TLTA 3SIXA 4EP1A 2EDAA 4ZCTA 4MRRA 2FSHA 2EZ9A 3DP9A 3JATA 3VSAA 2XDQB 4AUNA 4ND4A 1A97A 4DR7B 3CZQA 4Q37A 3DWIA 1QE0A 1SD2A 2JI7A 2QAGB 4ALIA 1RAIA 4CFZA 4HJXA 4ZOBA 3HO8A 2JHFA 4QDTA 3RYFA 1GOTA 1G55A 3VO2A 1XPUA 1FMFA 2JNWA 3HABA 1U2EA 3ZIUA 1UZLA 2J6BA 5KTKA 1SXHA 1RLJA 1V43A 1JIXA 2WWHA 1YGPA 2YWJA 3ADPA 4HFMA 4W5QA 1FP2A 4NJOA 4X8MA 4C4XA 2V6GA 1BO6A 4MVJH 4FOSA 3K70B 3OM1A 1EUZA 4NQRA 2WIJA 4NENB 4YJ3B 1DUSA 3RRJA 1P9OA 2VHZA 4WACA 4ZALA 4XCVA 1AO0A 2FWIA 4FFWA 3SR0A 2YMMA 1NN1A 1R8JA 2C99A 4KDEA 5KVCA 5DEIA 4QYTA 2FGJA 3OTWA 3OM8A 5EZ5A 5HGJA 1QFXA 3P96A 5CCDA 5KNCA 2FPPA 4FOLA 4P36A 4BFTA 3DHYA 1M2KA 3TLJA 2AI1A 3HCFA 1QX3A 3GJ5A 1DKOA 4WLUA 2B4AA 3IQEA 1L7XA 4R54A 1HE4A 2J6HA 1ARZA 1XQVA 1ZKDA 3QEKA 4S0XA 5DRYA 3ABRB 5ESRA 1QIMA 5FL7A 3DMYA 4W82A 1ENYA 1D6MA 5FH9A 4H7KA 2B35A 1JPVA 2Y67A 2NO4A 3DMFA 3GHHA 1GGMA 3PQFA 1SBTA 1T0UA 3DZ8A 4MCHA 1T25A 3GR6A 4B6RA 1X7WA 5F1OA 1FTYA 1FYFA 3DFKA 3ZWYA 1P1JA 3IO3A 3GJ7A 1E7QA 5GM2A 3H7AA 3RT9A 2CVZA 4MDFA 3H5LA 1C8VB 3DAPA 4IXTA 4O4JB 3VQTA 1Y8RB 4B46A 2UUOA 3GI1A 2V3CC 1VYUA 3AFGA 4YMWA 1TFUA 5DIFA 4HZUA 5DZSA 3SCZA 2RC6A 3HHPA 3TS1A 4Q9JA 4ECAA 3SQMA 4I08A 4DIMA 1N2CA 3GDHA 4RE6A 3C8DA 4QGHA 721PA 2JFOA 3VPHA 1GAXA 5JXGA 2C5LA 2XUHA 4DPKA 1KO1A 5A0VA 4B3DA 2DGDA 3MWYW 2VUUA 5E7IA 3ZXIA 1KJIA 2OL4A 2V03A 3G5MA 2HEGA 2OVBA 4G8JA 1V96A 4HPJB 1Q77A 2C4KA 3BZUA 5GONF 5DHRA 1MO5A 4PBTA 1BE0A 4BMOB 1SA0B 1E2DA 4AFNA 1UMBB 4KQ2A 4YHHB 2B94A 1XU9A 4WNCA 2VPZA 5BR1A 2PIDA 3ER8A 3HPQA 4K9MA 1NU6A 2G8LA 4YCCA 4D79A 2HC9A 4BL5A 4X62B 1GZ6A 5AKEA 5M2QA 3N0TA 4MUGA 3L84A 2E5FA 1WZ2A 2H17A 2PBRA 2M6KA 1QO9A 1J25A 1NVVR 3HV0A 3A70A 4FP9A 2Z09A 4HXFB 5TS3A 3KAJA 3PF9A 4OIMA 1B2RA 3KOMA 3O90A 4R8VA 3A4YA 4ZKEA 4IMRA 4G09A 2H63A 1E1QD 2DJ5A 3CRQA 3Q9NA 4BJ5A 1DBSA 1U31A 1NJGA 3WTCA 4KQHA 4EW2A 1YZGA 5K0GA 2C83A 2QRKA 3FAKA 4PCLA 1E59A 5LZ8A 3LIPA 3LLMA 2LIVA 4URYR 4FS3A 4II3A 1MVLA 5A1TA 3RC9A 3I61A 2AQKA 1O5TA 2I67A 3ADOA 4MYHA 1F7VA 3NTRA 2IYWA 3QYJA 4BN4A 4JZYA 4C5AA 4MITA 2ZCJA 4HYTA 1HNZB 4MMYB 3PZRA 5I7FA 3T7TA 1WBBA 3ZE6A 2WPNA 3TVTA 3W5BA 4GMGA 4PBSA 1B2LA 1SHTX 1PK7A 2CYCA 3BF7A 1WUKS 4LE0A 2OBYA 2P6NA 2QTAA 5HF9A 5LP6C 1I4WA 2J5KA 1SVLA 4LQDA 3DPUA 4QJIA 4EWLA 3PIIA 4HNTA 3U09A 3TMYA 1TUBB 2H1CA 1AQIA 3QVGA 3ROMA 1P1FA 3B1YA 1MQ8B 4D82A 3ANMA 1RU3A 2ZDHA 4GI2A 8LDHA 5JS1A 1W4CA 1FQOA 1YZYA 1P33A 4P1ZA 4OLHA 2A9VA 3EWSA 3OT4A 4J2HA 5GJCA 5C4GB 2XYHA 4UU0A 3V48A 1LTHR 2AKYA 3CA8A 4MUIA 2R1UA 3DWGA 1NDQA 4CUZA 3ZLBA 1NMEA 3KQHA 2IBSA 2IOFK 4KQMA 4FNMA 4UNSA 3KT0A 4HWPA 3RG8A 1SKYE 1XRSB 3HDYA 3SXPA 5JQGF 4ENWA 1M54A 4DLZA 2YZGA 4QREA 3VVCA 2XAUA 2AC4A 3RANA 2ZIGA 4ZJUA 1AZSC 2DKOA 3G2KA 1PO7A 4HLUA 5B5SA 2LTAA 3IYLW 2ZRQA 3KOWA 3FY4A 4UBOA 5JBQA 4OJTA 2AMLA 2CUKA 3KHUA 3WDLA 1OB2A 1XDSA 2PRIA 5I4KA 3PCXA 3FNHA 3GWZA 1TZ2A 2WJ3A 1LK7A 1KC3A 1MPXA 4O08A 4WOBA 3AR2A 1KGDA 3UG6A 3IMKA 1N5KA 1U2GC 4GLLA 4LHZA 1M8KA 2FKNA 4LQ4A 5CX1B 5EFOA 3A6PC 3QI2A 2P0YA 3EMVA 2HU5A 2M6SA 4EG0A 1PGJA 2GBLA 2QD1A 4CDRA 1FP7A 5HRAA 5ICCA 2DWPA 4DDTA 1MENA 2P2GA 4NOLA 2JCBA 2IUUA 5C3MA 1I0ZA 4F04A 5KYXA 5ECGC 3EEQA 4CLRB 1B73A 1V8DA 2XUKA 1VJ5A 1HDIA 3ZU6A 3I9JA 3OJCA 1P0FA 2VNAA 4K05A 4PZLA 1YO6A 4AO6A 1C30A 1ZH8A 4AMGA 1J0XO 3FNIA 2CXRA 3QPUA 5DN6A 1AQLA 4KIGA 1JBEA 1W52X 4Q3KA 4QELA 2IWRA 2RGNC 2J0UB 1C7RA 4K8RB 4Y67A 4G41A 4IDPA 1A4RA 1NMXA 1X1RA 2V6BA 5HF8A 4F6RB 3KT8A 4JXXA 3GUHA 3HKEB 3PYMA 4QXRA 5CPBA 1N1GA 5EKUA 3AIOA 3H4VA 3PP8A 4HNSA 3EWIA 3ZCQA 1GPMA 2GAJA 2WUFA 1X87A 3Q10A 3RODA 4I4TA 3UCXA 3IERA 3R5XA 5LN1A 5FX2A 1MOZA 4FTWA 2FF7A 4J3JA 2H48A 2R6FA 5JWHA 1OAOC 2VA9A 1U9IC 5HS6A 1XTIA 3OTIA 1DLIA 3GRPA 1Q0HA 1J8DA 3B1WA 5AICA 3OKPA 3BD9A 3IEPA 1O95D 2R00C 5E6UA 1R1DA 5P21A 3WR5A 2ACVA 3AEXA 3O4HA 1WDWB 4WCFA 4LF4B 5HCIA 1E3DA 3K0HA 3M9XA 4I4LA 1HDCA 1U1DA 1L3IA 3FUUA 5D00A 4V3BA 5SYAA 2QRMA 1EJ2A 2BJHA 4M1ZA 1KIAA 1X13A 2H4YA 4IEEA 3QY0A 4CGYA 4EFDA 4FX5A 5FNZA 4HXYA 4P3NA 4YJGA 5JZVA 2WVHA 3FNQA 1BKDR 1U3DA 1F38A 2GNOA 2LCFA 3INRA 4UVIA 3SZUA 4D0SA 1IQRA 2FZVA 4CM3A 2F48A 4ZKDA 1YRLA 1SULA 2COKA 2ZI5A 3HBNA 4ZAGA 4F9TA 3JQAB 4FMPA 3ZCSA 3C39A 4GL4A 4LVNA 1QZZA 1PL0A 2Y4NA 3SSOA 2VWQA 5A1JA 1NRIA 4X71A 4DA6A 5IMSA 4ERXA 1TT5B 3SNHA 3ZTYA 2REBA 3IEIA 1KZYC 1AUXA 2A0KA 2O48X 2QJWA 3RIGA 2R7LA 3NRCA 4O6VA 4JVSB 5TMDA 2Q4EA 1XLWA 3PVSA 4ND8B 2K7FA 4X3PA 4ZMSA 3U80A 2PM8A 1U98A 1A9TA 3IVAA 1U2PA 3WDKA 1Z4KA 3R9KA 1YB5A 5IVIA 2JGNA 4K0RA 5EZYA 4Y7DA 3RFVA 2J9XB 1YDMA 4FIZA 4M1YA 2VH2A 3RSFA 1UPFA 3AERA 4JEUA 4A4DA 1Z5PA 3H13A 5J59A 4EB8A 5KIAA 3MRXA 4JB3A 1NRJB 4JA0A 4FEGA 4X7RA 4TXJA 5KOIA 2XWQA 2AZ4A 1ADCA 4A6XA 5AR1A 4DNPA 3C4VA 1XZAA 5B6JA 4YI5A 4EK9A 2I2CA 3QPVA 3DCNA 2WAOA 2FU5C 5BMVA 4R1NA 3PS9A 4ZMBA 3CKMA 2QLMA 2B5OA 3P9XA 1TYEB 2BBSA 1OZHA 1HZZA 1U0HC 4ND3A 3IKLA 2QN3A 3E2PA 4FXPA 4GVPA 1IN4A 4RC9A 2R6ZA 4WA8A 5AUNB 1LKZA 4MGKR 3AILA 3TVYA 1PZGA 1RKUA 2C2GA 2PFGA 2X8LA 5DV9A 4ZCQA 4IUYA 1JFTA 1HRDA 1ZI8A 2Y1DA 3PNOA 3U2QA 3V5NA 5C8DA 5JD4A 3D81A 1WU7A 4UCWA 4CTOA 5FXMA 3P0FA 4I4TF 3HVJA 3OE1A 2J48A 1WXXA 1DOAA 2BBOA 4PAOA 1PG0A 4R83A 4CIAA 4MUFA 5B2ZA 3U9TA 2C8LA 4CR7A 1Q0TA 2IVFA 4DRXA 1BYIA 1UBMS 1NJ8A 3KHKA 4OBXA 4UEWA 2B6HA 4EHJA 5KAMA 3O75A 1TA4A 2Y8EA 2E87A 2P6OA 2CZQA 2YV1A 3WNQA 4PTLA 1MX9A 4YMUA 5C8VA 2WHYA 4KKXB 3ANXA 4KN5A 5CLLA 5ILOA 3K94A 1BG6A 2JASA 2DUWA 2QN8A 4G37A 2BZ1A 4CIYA 4WH0A 3TG8A 2EBHX 2RGEA 1ZD8A 3BE6A 4WDQA 1Q0SA 2ODEA 3H75A 3CR3C 4BNTA 4E15A 1I3NA 1Q1ZA 4G0PA 4RA9B 5B1HA 1CRPA 4D56A 2AG8A 4YBZA 3RVLA 3NVKI 5TEVA 1BFUA 4JITA 1JDTA 5HILA 1IHOA 2IOFA 5GADl 1DC3A 4PTZA 1FVHA 4A9AA 1GFIA 3WADA 2Z3ZA 4MWEA 2XZPA 2BGGA 4KDFA 1J56A 1HL3A 3T3OA 2J4DA 5C8XA 2FOIA 2PGAA 4TVSA 3UUFA 4ZRDA 3S1SA 1DLJA 3KEQA 4C07A 1JIUA 1BE6A 2FPXA 3BERA 4KN9S 1P31A 4H4DA 3JQPA 3CLTD 2F3PA 4RJKA 2KWIA 4MRNA 1RJ9B 3OX3A 4ZCRA 3DV2A 2O3JA 1TO1E 2Q5JA 3INYA 2HPZA 4G5YA 4MS3A 3WVNA 1RS0A 3A4IA 2V7UA 2P9YA 1C3OA 1YZFA 4PYOA 3AHJA 3G2OA 1D09A 4RLSA 4FB5A 4J0CA 3LHFA 5EZYF 5I01A 1YZNA 4OHYA 1H1LA 3VC2A 2J5RA 5MFZA 1GSAA 1X9GA 2OHXA 1N7JA 2X3FA 3GLRA 3L6EA 2P3SA 4LSMA 3RS8A 1WCYA 2PT5A 3JX9A 4W1PA 5C4IA 5JCOA 3CZ9A 3DR5A 1JLLA 4XOIA 1G7TA 3HKDB 1M34E 4M1EA 1ZUD1 5T8KC 2GILA 2K4MA 4OGFA 3R8CA 5BMVF 1U1IA 3GH3A 1ZJYA 4OFXA 1WMFA 1NKTA 4QRDA 5AKGA 1MB0A 2ZIEA 2Z4SA 1T36B 3RIXA 3QJ5A 3ZGVA 4KUEA 4AURA 2JGMA 2HMTA 2JJMA 3G9TA 1KVQA 5FBQB 3V80A 3D4LA 4EUSA 2R3SA 4ZHQA 5F5XA 4MUBA 1AHHA 3TLXA 4A2CA 2AZXA 5AM5A 3VTAA 3GLGE 4LMAA 4KH1A 3ZKWB 5KNDA 1QP0A 2O8BA 1OC2A 2GK3A 1G9TA 2PKCA 2BMJA 1U2ZA 2CNLA 2PR2A 1USIA 3G8CA 3OM0A 2C7BA 2CK3D 3JQBA 3KCQA 3OHSX 4K46A 4GWKA 4N65A 5MGBA 1HYGA 2JAUA 4AZWA 3ZWKA 2I7XA 4JLNA 2FVXA 3H1BA 2LDBA 1ECGA 4TOIA 1OJ7A 4BYMA 3F8TA 4L8YA 3PNYA 4ARIA 5LQAA 4ZVOA 3H04A 4KXYA 3DUFB 4AU1A 3LKZA 2WZCA 2XIQA 2BFOA 5L4NA 3LQKA 3G8AA 1A2KC 2R4UA 1V5FA 3HP1A 4Z9FA 1WPQA 2E9SA 1YOBA 4N7JA 3H99A 4NRDA 5ESWA 4CL3A 3UJNA 2GXAA 2BE7A 3M3HA 2P0AA 4PWZA 2DETA 3VNUA 1CF4A 1DQNA 3K73O 3LPLA 4OLFA 4X8OA 3W34A 3HRHA 4GQBA 3BGWA 4N40A 1U5AA 3Q0EA 2WYHA 1BE8A 1XVIA 1JKFA 4RK7A 4JI1B 3PU6A 1F2TB 5AKXA 4RVNA 1LU9A 1W88B 3OLYA 5WRFA 4CR6A 4TVBA 3RTCA 4ZC1A 4OYLA 4MPDA 4ZQEA 2P4SA 5ENZA 3IUEA 1KI6B 2NZVG 1VG9B 4ZYTA 3I0MA 2JW5A 5THKA 2H9AA 5C1PA 1E1YA 4E4YA 2IJGX 3FGZA 4KTTE 1GQRA 3UHOA 4X65B 3V4RA 4IKEA 1BTOA 1ENPA 4HQRA 4LDAA 4UEKA 2FK7A 2EGHA 3QXCA 1PRYA 2PJDA 3P0JA 3OEHA 1Z74A 3AYXB 4NCXA 1U7PA 3H97A 2ZLBA 2RGUA 3ESBA 1JQDA 4RFSB 1KE2A 1MQSA 3E58A 3HYCA 3IH5A 5IJ0B 1M8JA 4Y6SA 2TYSB 4INPA 3NHMA 4M1WA 5IYZA 3KWFA 1T4MA 4MP6A 4O1IA 1GZDA 4CYMA 1XYVA 2AZMA 1BA3A 4JT9A 5L6LB 2YN0A 13PKA 3UWOA 1KF0A 2OYSA 1QZTA 2PGLA 2PCLA 3AM5A 1R0YA 1N4DA 4BNMA 5LU8A 2P9HA 3PXGA 2HHCA 4IQFA 4XX0A 1IY8A 3K0EA 1QLHA 3CRRA 1EFRA 4E32A 4NDAA 5D1HA 3RRXA 3U31A 5IC4A 3EMBA 8GPBA 1N7IA 1D5CA 3EHEA 4UUNA 1MRNA 1IVNA 3GFSA 2HJ9A 3KOOA 4GD3Q 1OREA 3HY4A 4HLNA 1DCTA 1ZO8A 3ZDRA 2REOA 2FVYA 2DULA 2P62A 2W8BB 3ASVA 3K8QA 5C8YB 2IFTA 2I8LA 3DD1A 2XA1A 4OJMX 4J49A 1QR6A 4BNDA 2XUOA 4IJ6A 2RI0A 1VBFA 1XJ0A 2FWRA 3E0QA 3M7IA 1EVLA 5GQSA 1PT6A 3OD5A 2SECE 2IV3A 3QELB 1TTHA 4EVIA 4ZHQF 2I6FA 2DB3A 4AQ7A 1OAAA 3QMVA 4RTOA 2PIAA 2OO3A 1IBRA 4NL4H 1XZMA 2WKWA 1I6MA 1AD2A 1X3SA 3A36A 4LVCA 1UFOA 5AI8A 4HMOA 2NYUA 1UPCA 1MBZA 2IH2A 3A7DA 1E3SA 1F3OA 3A9TA 3OZCA 1ZCAA 3DSRA 4BUCA 2Q21A 5KCZA 1OI7A 5KTPA 5G0WA 2IYFA 4QVKA 4X0EA 1F2UA 1PZNA 3FPEA 2Q2WA 3WRYA 1ODSA 3GLUA 5F3DA 4BQRA 4DNQA 1Z6AA 2PKQO 1P61B 4IXDA 3LTEA 1Z17A 2DUNA 5E4JA 1CR4A 1LK5A 1QIKA 3FCOA 3WHLA 2YFQA 4AI6A 3DM5A 1T9BA 4KIUA 4PG4A 1JQ3A 1S9HA 2QLNA 2YL2A 4JWTA 1XZJA 4LMBA 4RETA 5H59A 3CVOA 4RSHA 4HGNA 3N58A 3AZOA 1BCRB 2IZ5A 4FGUA 2CZGA 1VSUA 4NBNA 1MFPA 1MH9A 2PT9A 5AVVA 1Q1EA 2C5GA 4N48A 1O87A 2M6RA 1PFWA 4DKJA 3EGDA 3O9ZA 5HFNA 3PNSA 4ZI2A 4FFVA 1U3FA 1K4MA 3TTYA 1N2ZA 2O06A 3IDOA 1ADYA 3K1JA 3ITDA 5CXQA 2P91A 2ZRFA 3C1AA 5FIUA 4KHPB 4JU8A 1OVGA 3IA7A 3GFBA 1P2DA 1YWGO 4INZA 1NFQA 3IQZA 1FYXA 3ORSA 4PICA 3QF7A 3LW7A 1T4CA 2OQIA 3WLPA 3E9MA 4HDSB 4DB4A 2C3OA 2JD2A 2GCEA 5E6SB 1OB5A 2HRRA 1E4YA 4B3JA 3KQOA 5J5CA 4N9QA 2VDVE 2Y1GA 1NJSA 1GUBA 3WLMA 1RP1A 3LDUA 5IYZF 4UD2A 2YHAA 3EE6A 2FSUA 2OT3B 3GGOA 3QNUA 4PR3A 5CRIA 1YZKA 1KP3A 3PKZA 2G04A 4HYYA 5DGIA 4YRAA 1DX9A 4ZQGA 2ZJ7A 4YIKA 3H6KA 5IAOA 2WC1A 4QUJA 1ZBQA 4ZYZA 1YZQA 4LXYA 3R6DA 1O57A 1QV6A 2REQA 3KEFA 2FF5A 4Q4JA 4X41A 2QP4A 1YZUA 1EX7A 3JRWA 3QUAA 2B7BA 2D1SA 2PLRA 5KS2A 3IB3A 1QM5A 1KK3A 2O2JA 1OLUB 3CR7A 2ZUVA 1EJBA 5IG2A 3EIXA 3TQTA 3UY4A 1K88A 1Y1QA 1E7WA 3FGOA 5THXA 1W19A 3S3TA 3UHJA 3GLHA 4ZGBA 3BFKA 2H59A 4OQFA 3B78A 3SXUA 5EIBC 2X4DA 4WEQA 3AY7A 3WB9A 4BVKA 2B4TO 1JXMA 2FEKA 3LGAA 3L7OA 3JQQA 3L40A 1I1QB 5HUJA 1GPJA 3MBIA 3DJYA 1Q19A 2JI6A 4UMDA 1QH1B 1OSNA 4YFVA 2DUJA 2X42A 5FBHA 2O05A 2P7HA 1OLXA 4XYMA 2D2IA 4JCOA 3QEMA 4AD8A 5KNBH 1W25A 5IANA 4AKHA 1NJFA 4KGVA 2IXTA 4UMEA 1W35A 3CEHA 2PS1A 4D9EA 1DKLA 4HRVA 1J0AA 1CY4A 2GA9A 3PPIA 5H4HA 4POOA 1Y9EA 4HHEA 2QUIA 5L3RA 2Q3LA 3KSMA 1L7MA 1BGVA 4C14A 4R71A 1Q11A 2N1MA 2XGSA 3TQRA 3C6MA 4MKGA 4HXEB 3GJZA 4PHGA 1QTQA 2I66A 1EQUA 2J9ZB 4R1TA 4ZO7A 5DASA 2HQSA 3TD6A 2AC7A 1JA0A 2PEZA 4BXOB 1H6AA 2QD5A 1XA4A 4F46A 4S05A 4NNOA 3DOCA 1A8IA 5ENDA 2COEA 4NJEB 4F4UA 3HCCA 1HORA 3AR3A 3WYDA 2ZROA 4EB6A 4M4SA 1YCDA 2YCLA 3UMCA 1FP4B 3IAM1 1KKLA 1P2VA 3QX8A 3R41A 4J0FA 1BU5A 4LF9B 2B69A 4ALMA 3CX7A 3JVIA 2IH4A 1Z88A 3P8ZA 4G5GA 2P9ZA 1RKQA 5BN4B 5AK0A 4HS4A 2V5AA 1SBHA 3CS3A 4QOSA 3QE2A 4TRJA 4BUJA 1CRQA 4HWSA 4EF6A 1MUUA 4Y6OA 2JCSA 3JARA 2PUCA 4B9EA 2F4VB 2QRGA 2BFBB 2FZEA 1G4HA 2PX8A 1PV1A 1IY1A 1N5OX 4GI3A 5A02A 2WTUA 3MTGA 4P3KA 1YVPA 4BVGA 3VJLA 2H1HA 2RH4A 5GY7A 2XZTA 3JSXA 3JWEA 1C3JA 2ZYRA 3QVOA 5JD5A 2X0FA 3G8YA 1JHXA 5CD9A 3GVHA 5CVVA 3SEAA 5ADHA 2Q5OA 2ZYUX 3HVIA 1FUYB 1PLJA 2UXBB 2I2WA 4C3ZA 3BMNB 1ZK0A 1H0HA 3KTAA 3U17A 4W9NA 1O1YA 1EU1A 4LOAA 5CITA 2CXNA 4KO2S 3UEOA 4YRKA 1KYQA 4PLWA 3I58A 1B8UA 4M8LA 4S1OA 5FD8A 4P4UA 4AF7A 4EPYA 1DCKA 3QUSA 3SN6A 2ZYHA 4BGVA 2IPMA 2WMNB 4NAHA 4XB6B 5C7IO 4RACA 1ODCA 4MWTA 3BS4A 2NT3A 2ONYA 2DKNA 1ZD5A 4ZAXA 3T94A 4KE9A 3HZZA 3TQQA 3GB9A 3W1VA 1JDZA 3C1OA 1VJTA 1A8HA 4CQMB 1IBLB 2ZJ0A 3JWPA 3A4LA 1STOA 1U81A 1JEAA 2W7TA 4Y1RB 1Q20A 3I83A 2PQMA 4DHEA 4QM6A 4KVFA 3HUFA 3BFXA 4AJKA 1HDXA 1JWBB 3O26A 4J1SA 4LNUB 1G20E 2DFKB 1F3LA 2BV3A 3UW3A 4LC0A 1J24A 4MQFA 3TE6A 1HFJA 3VPBA 1V35A 3L4KA 3IP1A 2O8FA 4ZVRA 4LJ4A 1SWVA 4AP5A 2VQSA 4MCIA 3DP7A 1S3SA 2QYTA 1JALA 4IVRA 1IK4A 1R16A 1KH2A 1OQAA 3HH8A 4AG3A 5JSZA 3EZFA 4EUHA 4X3CA 1AX9A 3TQHA 4YWJA 1YBVA 1GN8A 2HDNB 2AEJA 3OM9A 3OPNA 4PRLA 5FUXA 3TSWA 3PKJA 5I3CA 3HU5A 2V4MA 3I9KA 4Y98A 4RTSA 2VHCA 2CVHA 1OX4B 2VUSA 3IJPA 4J0EA 4LJKA 1G5RA 1ULHA 4BO3A 4EO7A 5HNKA 2D3WA 2IITA 2OGUA 4EMUA 3UC5A 4LDZA 5LUBA 1IHUA 4GKAA 4ZOEA 4TZTA 1H4SA 2OESA 3TLGB 2PZ8A 1F2DA 2X9LA 3KC2A 3HB0A 5REQB 2QRZA 3MT9A 3U40A 5E4TA 4RJLA 5HGXA 4S3MA 3K96A 4Q9NA 5A6VA 3PVCA 3WKAA 2RIPA 1A0OA 5CEJA 1EGVB 4OXQA 1VM6A 1WLSA 2PKYX 5KYTA 1II9A 1Z2PX 4S1PA 3W6OA 4JBLA 5KKAA 5D3MB 1GV1A 4LE2A 3CLSC 4R0MA 1YV9A 4L74A 4ARAA 1E1RD 4YRJA 4PWYA 3MCVA 3T3GA 1WNTA 3I04A 5DBGA 3H6HA 2EXXA 1WKCA 4N3CA 4U7GA 4DT1B 5JS6A 4P2GA 2OFXA 4CHGA 2P41A 3GJTA 1EYZA 1OBFO 1A98A 3A4TA 3UT0A 2NQTA 1YZVA 2V9PA 1JE1A 2XUGA 3IP8A 1XHFA 3D0OA 3WYNA 3RIMA 1EUDA 1Z25A 1RQLA 3EQ6A 3PC3A 2X5NA 1Q7CA 2QOEA 1NWHA 3X44A 4GEKA 3TFQA 4CCYA 4P34A 4ZVUA 3IVMA 3SF8A 1QF6A 4KJXA 2V0GA 2BGMA 5AVUA 1FFCA 3RV3A 1X0VA 1YKFA 3PQ5A 2HQRA 2NMVA 1VI5A 2NTJA 5FO1A 4LAFA 4MVJI 4WVLA 3U81A 3IOCA 5HKAA 3UMRA 1K06A 1P91A 1Z4PX 1E62A 4CV1A 2OENG 2WWWA 5D86A 3FH0A 4GH5A 4M8IA 2GM3A 1LPNA 1F8FA 2FEOA 2PG3A 3SFTA 2ERYA 3ZJTA 1A9XB 2CXHA 2DRIA 2VRWA 2AMYA 2ZJ5A 3A32A 3DT6A 2QMEA 4FS8A 1Q7BA 1FX1A 2BIFA 4TRRA 2MYPA 4D3ZA 3QWIA 1UKZA 4Q1FA 4C87A 1SBYA 4EJSC 1WHTB 5BNWA 2ZBEA 1LBTA 3N6VA 1EK1A 4NZYA 5E9QA 4BV2A 3TLKA 4DUZB 3FTEA 3I6IA 1RW4A 1W5SA 3MBOA 3UAWA 3GP5A 2YOGA 1EXDA 4KPYA 3AKCA 3A58B 1A76A 2CMDA 5KCMA 1EAMA 3KJXA 3OURA 4FE3A 1X1QA 2FX2A 5TF0A 5LZ4A 3U4QB 1GAQA 2WJWA 3I23A 4ZO8A 2CF5A 3LQQA 2LD4A 4GICA 3TI9A 1QPGA 2NSHA 1JT9A 1U6JA 1W9MA 1WXDA 2C2YA 2P30A 1BWQA 2E6KA 3HKBB 4K6MA 4M0LA 4DLVA 4ZDKA 3GJYA 2RB5A 3AUJB 3OZFA 4TN1A 1YUBA 4A3SA 2NPIA 3QEAZ 3FOBA 3V8BA 4MIOA 3BWXA 3T7DA 3J80A 1JEJA 1PLLA 4M0MA 5B6PA 2I9KA 2GLXA 3BKXA 4HTFB 1G9XA 1ULBA 4HH0A 2JJQA 3PFBA 3Q8LA 4LFBB 4P4SB 4FOPA 4MUYA 1ZIOA 4EY7A 4ZQCB 2DVMA 3IE1A 2X2PA 1GPAA 1YJ5A 1DFIA 1ONOA 1WQ3A 4G4JA 3V9PA 3NRBA 4N03A 4CTMA 1RC8A 3FI9A 1SUIA 1F0PA 7GPBA 2Q8NA 1HE3A 2GEVA 3CJRA 3KT3A 1M6VA 4DCNA 1XELA 3PNKA 4YAGA 4DVJA 4TS4A 5CDFA 3LI2A 3BMCB 2JFUA 3O8LA 3H1PA 2BISA 3ICQB 1JLKA 3X3HA 4IUCS 2IX3A 4FGZA 1UFVA 5AJZA 3K6SB 2V7PA 2VXYA 2GKOA 3C7KA 3LO8A 5EE0A 3A3NA 4UTNA 4OGGA 4XM2A 2HA7A 1ZIPA 5JTTA 1X8JA 2WG2A 4XGRA 5AW5A 4Y0NA 1H22A 3Q7IA 4JR2A 5AW4A 3MS4A 3KT6A 2DHQA 3RHTA 5BSFA 4RTMA 3AOEC 1JDVA 2D5BA 4QJ4A 3N53A 2UXCB 1GG2A 1OXTA 3FD8A 1WB6A 3QPAA 5AXBA 5JQWA 4L5AA 1NVDA 5CT4A 2MSEB 4Q05A 2QD3A 3L7NA