5IPFA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase from schistosoma mansoni in complex with imp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
201
Chain Sequence
b'ADCVVIEDSFRGFPTEYFCTSPRYDECLDYVLIPNGMIKDRLEKMSMNIVDYYEACNATSITLMCVLKGGFKFLADLVDGLERTVRARGIVLPMSVEFVRGLGDPSEYKDKNVLVVEDIIDTGKTITKLISHLDSLSTKSVKVASLLVKRTSPRNDYRPDFVGFEVPNRFVVGYALDYNDNFRDLHHICVINEVGQKKFSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)
publication title In vitro and in vivo characterization of the multiple isoforms of Schistosoma mansoni hypoxanthine-guanine phosphoribosyltransferases.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 48
structure length 201
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ipfA00
3OHPA 4M0UA 4P86A 2DY0A 5BSKA 2JBHA 4RQBA 4MB6A 1QCCA 4P84A 3M3HA 1XZ8A 1AO0A 4P83A 1A98A 1PZMA 1QCDA 1UFRA 2HCRA 1A4XA 1G2PA 4F8EA 1G9SA 1P18A 5ESWA 4FYMA 1GRVA 1A95A 2XBUA 3MJDA 4OHCA 2WNSA 3KB8A 4LYYA 1A3CA 1VDMA 4LZAA 1FSGA 1G2QA 1LH0A 2YZKA 5BQPA 5BRNA 3LPNA 4KN6A 1DBRA 2JKYA 1DKUA 5KAPA 4QYIB 5ESXA 4P82A 2EHJA 3ACBA 1GPH1 4S2UA 5HIAA 3OZGA 5EUCA 1XZNA 2FXVA 1IBSA 1ECJA 4RHTA 1TC2A 1VCHA 2IGBA 5K51A 1I0LA 1WD5A 3GGJA 1VSTA 4P3KA 3ACDA 3EFHA 1P19A 1TC1A 4LZOA 4X45A 4QRIA 4IJQA 4RABA 1A96A 2PRZA 4LYGA 3NAGA 4M0KA 2PS1A 3G6WA 3DEZA 1ZN8A 2VFAA 3GGCA 3DAHA 1QK3A 1CJBA 1I5EA 2H08A 3ACCA 4RQAA 1QK5A 1R3UA 1P17A 1UPUA 4ZFNA 2JI4A 4RACA 1OREA 1G9TA 3QW4B 4P80A 1DQPA 3MBIA 1D6NA 1XTTA 4QYIA 1ECFA 5HKLA 1DQNA 1XTUA 4RAQA 1ECCA 1MZVA 2P1ZA 1ZN7A 3HVUA 4Z1OA 1OPRA 1Y0BA 3OZFA 4RV4A 1STOA 1I13A 2H07A 1L1RA 3O7MA 4LZNA 1W30A 4TWBA 4X44A 5BQOA 3S5JA 1U9YA 2PRYA 1BZYA 4RANA 4RAOA 5IAOA 3N2LA 4RHXA 3GEPA 4JITA 1A97A 1QK4A 1BD4A 2H06A 4WMLA 1DKRA 4RADA 1ECGA 1O57A 5E38A 5IPFA 2GEBA 4RHYA 1QB7A 2JKZA 4WN3A 2AEEA 1NONA 1ZN9A 3H83A 1ECBA 3DMPA 4M0PA 4PFQA 1P4AA 1QB8A 1Z7GA 2E55A 1XTVA 1HMPA 1V9SA 1JLSA 1OROA 1I14A 1UPFA 3LRTA 4P81A 4PAWA 5JV5A 5KAMA 1J7JA 1L1QA 1BD3A 5JSQA 1JLRA 1HGXA 1O5OA 1NULA 4RHUA 4JLSA 1YFZA 1U9ZA 2C4KA 1I0IA
chains in the Genus database with same CATH superfamily
2WPNA 5BSTA 2HZ7A 4FOLA 3IMCA 4KE9A 5B1YA 1NVTA 1KMCA 4NPAA 5BMOA 5KTOA 4RPIA 4PGMA 4C4YA 4AX4A 5BXQC 2LWIA 4F2WA 1GWNA 4O08A 5ECWA 2CXPA 5DNDA 3IMFA 3R6WA 3JWHA 4RA9A 4V0SA 8ATCA 4CIBA 2Z8YM 1M33A 4P33A 5BN5B 2DLDA 2Z5LA 3ECCA 3G23A 3GDHA 4XX0A 4OIFA 2P3OA 3EG9B 1ISHA 1BVYF 5D7BA 2QD3A 2XB9A 4A8JC 3ROPA 3GN2A 3ONFA 3OTHA 2PD3A 1P61B 3ECSA 4WDQA 1XTPA 1G8FA 5CT8A 3UAXA 1K08A 3UV3A 5JPDA 4J2TA 3LPNA 3OT5A 3KTAB 1Q2UA 2G8LA 1ZVMA 3BWDD 4Q9NA 5JAQA 3M81A 1NFRA 1SUFA 3VM6A 1P6XA 3ZE7A 3SFTA 2YFQA 2H7XA 3EVAA 3H2GA 3FOEC 4BBAA 1UZAA 3S2UA 3T7EA 1XWFA 1A69A 3IDFA 1DV1A 3VXKA 5FUQA 5DLQC 4D9GA 2NUAB 5ITWA 1NBEA 4DMHA 3GK3A 1SA0B 4E2FA 5T4HA 4OI1A 3ZVLA 5I01A 4R2XA 1WF3A 3IKJA 4QO7A 5EPUA 4LF8B 5H3HA 3G8YA 1JIIA 1V5WA 3Q8WA 4RABA 3U4CA 1C0LA 3QY9A 4LS3A 4HQRA 2Q5IA 2WIFA 3T94A 1UOPA 4BIIA 1KRXA 1FFCA 1TU0A 1NKVA 2FGJA 2JI8A 4RD3A 3A4NA 5BNWA 4FLMA 2HMTA 3BRCA 3EPJA 1EAYA 4JIGA 3ZDQA 2CB0A 1SXJE 1DC8A 1G21A 4Q4JA 3SC2A 2B5WA 2NV2B 3VNAA 3GAAA 1G59A 4I3GA 1JFFA 2C03A 1JQ5A 3DMNA 1HH4A 3W3AD 4ND4A 1WO8A 4O2AF 5I3ZA 4A1OA 4DTCA 1FYWA 2TMGA 4TYNA 1TJ3A 3MT9A 3OLZA 4WLEA 5E9QA 2VJDA 1K0UA 3EHEA 4MAAA 2QMQA 4LI3X 1KU0A 1N9KA 3FFWA 1KMHB 4ARUA 3WLEA 2Q1YA 3ZV7A 3LFTA 4DJ5X 1I4TD 1N2CA 2AMVA 1N2OA 3C5WP 1MJ5A 2XUIA 3EGDB 3KM0A 1TAGA 1WDWB 1YK1A 2AMFA 2PT5A 2WSMA 1ZM3A 1Q6YA 1WOYA 2Y1CA 2QQGA 3ANMA 3O8QA 4UUMA 4DM3A 1RWBA 3L5KA 3ADBA 2POQX 1SIBE 3MWFA 2F3TA 3G85A 2BRUC 4Z4IA 4NH4A 4B74A 1PZFA 5F5LA 2PGAA 4PYRA 1EFUA 2R8OA 4D0GA 1DO0A 5REQB 3SSNA 3F3MA 4GI7A 1I2ZA 1AE1A 5AHOA 4BXOA 4BL5A 3JZAA 3V5NA 3ZPXA 3HKDB 2BOVA 4OYLA 4UVDA 1E0DA 5CBPB 2DQYA 4LN1A 4IZHA 3L8HA 4KNYA 3L8GA 4HAZA 3CZ5A 4PGAA 2CMDA 4YECA 2FWAA 3AB3A 4WN9B 5LOVB 4RZSA 4TXHA 4D97A 4Q21A 2Z95A 1HC7A 1KC3A 2J3IA 3CZQA 2ACEA 4OHXA 2X9GA 1A8PA 3HA7A 1ZXBA 1RXUA 2MTBA 1O7JA 1DUVG 2UV8A 3EDRA 2XD9A 4RS4A 3ETLA 4EG1A 1Y81A 4K9PA 3T7DA 2PKWA 1CUAA 2VUSA 4WZBB 3TRIA 2YQ4A 4BX9A 4JLSA 3O47A 3AF5A 1M8KA 3FPAA 3OJWA 2FMKA 4AG5A 2X9VA 3EVTA 1BE1A 2G1AA 3VMFA 3VR6A 3FDZA 1SCKA 1YBAA 3VR6D 2WUWE 3L84A 8ABPA 4MO2A 5KVSA 3GUHA 3TINA 1JDBB 4ZZ1A 5CGZA 2PGJA 3U61B 4M37A 1NUPA 2H2DA 4ZO8A 1XEWY 3QLJA 1RXVA 4NJEB 1EE1A 1KL7A 3EN0A 3LL7A 4LYHA 1JG4A 1HQKA 4Z1MA 1DQSA 4KMSA 4ZT7A 5K8LA 3KLOA 1K8ZB 4KLAA 1I4WA 2GWHA 4IY1A 2DTDA 2HR1A 3ZWBA 2A0FA 4K6GA 2DWUA 3O4IA 4ZOQI 4ZYWA 1AF4A 1CZRA 3LECA 5HKKD 4RXMA 5F35A 1LLCA 2X41A 2IP2A 3LO8A 4KUGA 3Q1KA 2HH9A 4OU4A 3V46A 1XZLA 2X8AA 5FWNA 1JEEA 3EZLA 3DS8A 1TI7A 1Y9EA 1QHXA 3WWPA 4OVKA 4XDHA 2V7XA 3UPUA 3O8BA 1E6LA 3PKIA 4Q4LA 4CM4B 1NSTA 4TS1A 4O4HB 5M2QA 1H42A 3AB8A 1HX7A 2Q5HA 4NMXB 3F96A 4D4KA 2XNCA 2VYNA 1HY3A 1UEXC 2YXDA 2WU3A 4X60A 3VR5D 2OGZA 4G0ZA 2Q0SA 1VCOA 2O52A 2FSSA 5F3DA 1D9ZA 2LV8A 1YJXA 4H3SA 1M7GA 1PSZA 2A9JA 4PE5B 2CJWB 2KE5A 1L4BA 5AM0A 4LZOA 1PDOA 3CW9A 3RLFA 3ORQA 4GC9A 1GG9A 4ROSA 2WT9A 2XCLA 1C81A 1SFRA 4ZV9A 2ID4A 4BMYA 4F38A 8ADHA 5A3QA 3R3WA 4MWOA 2PMEA 3RRYA 1RQLA 2VSFA 4LV6A 3KQOA 3TBKA 2XYGA 3PR3A 4OJYA 4AU1A 5BSGA 3U09A 2L0XA 1NOIA 3BMOB 4UNNA 1HE8B 3EYWA 5J40A 1L5NA 1RKBA 1E59A 1PR9A 3I8XA 4Y9UA 1H2RS 5C8VA 2PEZA 3RIHA 3T61A 3T4EA 1QK5A 1VL6A 2BMJA 3RYIA 1EA5A 2EJVA 4PQYA 4F3NA 5I7FA 1TM5E 1QQAA 3B8EA 3LT4A 2GZ3A 3WRYC 3QPBA 1S1CA 1JDUA 4D44A 3GUYA 1U8ZA 4KTVE 2KHZA 4E07A 4B7AA 2JHGA 4QEZA 4RF2A 4DV1B 4BLRA 3LBAA 4KQEA 1R0ZA 1TCAA 4OJMX 1F0KA 2H5IA 3QNUA 4B4UA 4F4HA 2MSWA 1Y3FE 1L1RA 4QFCA 5E1OA 1JR3A 1XCJA 3AVPA 3WGNA 5MFPA 1MO5A 1Q57A 4DLKA 1Q1QA 4EG3A 2HPVA 3I1YA 1MPXA 1Y3DE 1YKFA 3BDAA 1DBPA 2YYAA 5CVUA 2IEZA 5LPNA 2XLCA 2GZRA 3O4FA 2IYXA 3IAEA 4Q82A 2C61A 4NV1A 4UE2A 1M1XB 1Z4QA 1G8HA 2C97A 3D59A 5A6SB 3V1NA 5EJ8A 1NF8A 3ROMA 4GXTA 2RHCA 3LZCA 3GFSA 3GLRA 1HBJA 4WLVA 4FUQA 2FUNB 1UBCA 4LDQA 1ODSA 4P6VF 5EL0A 4YIHA 2Q7OE 4IEIA 2Q9AA 2XWBF 2CV2A 2QLFA 3OTIA 1Z6AA 4Q18A 2IYTA 4UUAA 3F97A 3BD8A 1HDOA 1J70A 1LDMA 3PNMA 4N54A 2FHPA 3PC8A 4Y7DA 3IQEA 9LDBA 3C43A 5ICFA 1YTUA 2I80A 1ZSYA 4QNRA 4OHFA 2Q8PA 3PC2A 3LRTA 1RXWA 4EK9A 1JECA 2XITA 3L1UA 1TYZA 1JLRA 1BJKA 2HWWA 3O31A 1RLMA 3PFWO 1PS0A 1MEOA 1R3DA 2IRWA 3CH7A 2H1IA 1O95C 4GXRA 2FWBA 3TRKA 4DV3B 4MRSA 1A2QA 2GXSA 2OFOA 3JQPA 2V3WA 3GQBA 2C9ZA 5BSKA 2CVQA 2EW8A 3PRKE 5DSZA 3CF2A 3KJZA 3TD9A 2JANA 1YKSA 4DSNA 4R2JA 1UC9A 3GJ8A 4XASA 3ZW7A 4Z9YA 4RELA 5IXSA 1BAPA 2CCJA 3VR6H 1YAJA 3GCWA 2PCLA 1F60A 4PXAA 1XP5A 4M0MA 1J7KA 1JEYB 2E82A 4J0GA 4GECA 3QIAA 3U4HA 3D2BA 4MUBA 1ZG3A 1IEXA 1N3YA 2EKQA 1TO1E 2I66A 1RYNA 3KSMA 5EHGA 4AMVA 5ALMA 4DILA 1XDGA 2NN3C 1ITZA 3H1EA 1H2AS 3SZRA 2D7DA 5DRTA 2XWPA 4UJ3A 3AFOA 4I9UA 1A5AB 1UQUA 4BMZA 4ETNA 3MOIA 1IY0A 1NP7A 1EVLA 2Q21A 1YL5A 1EX9A 1VI5A 1Y8RB 2O23A 5HUHA 2XMRA 2R8RA 1SEVA 3KJNA 2HGZA 4XGRA 3GUVA 5A71A 3QQPA 4DIUA 1OCEA 3K1YA 1BS2A 5JHGB 3B60A 3DP7A 3I5YA 4Q5IA 2IKSA 1F0NA 4U7GA 3MJEA 3BQNB 4J43A 1U98A 2Y76A 3EBLA 1HRKA 4BFWA 3NRBA 1E2MA 5BNTA 4MW1A 3MRSA 2ODBA 4DANA 1L5ZA 3OX4A 1IQ0A 1X80B 3TMAA 2A4KA 4E5YA 3FOWA 3N86A 3P2JA 2WE8A 3QP9A 3AO0B 5KNDD 2X9QA 3BILA 3I72A 1JB1A 1K68A 1SEPA 2E4WA 2WV9A 1YQQA 2VYCA 4IGIA 4Y9DA 4ZZ0A 1C9DB 4CEJB 4UE3S 1F2DA 1KDTA 2H08A 2QTFA 1OJLA 2WSSA 3NH9A 2FF5A 2WSSD 1SC6A 1PQPA 3ELWA 3M2TA 2GUWA 4OK3A 3ZXIA 1DTWA 2KMLA 5TGTA 1GM5A 2C5HA 2K4MA 3BE5A 4C7XA 2PA0A 3WLAA 1A9TA 1SCAA 3PS9A 1E8NA 4MJ7A 2HK6A 2ZROA 2FXIA 5LYYA 3SGLA 4BJ6A 3P97A 1T3TA 3ROFA 4CM9D 4F2GA 5LWQA 2ZE8A 3HJUA 3LYUA 2A58A 3RFFA 1V8ZA 1VC2A 2HPAA 2P8SA 3ULKA 5FWXA 1JHOA 3WLRA 5IAOA 1FFGA 3RRFA 4MMYB 1KYTA 2AZTA 3PC7A 3UWMA 4BRUA 1V7CA 1QHIA 3C7KA 2OAEA 3N2LA 4AS3A 5G53C 3FFTA 1PZXA 1PG2A 1FVXA 1O96A 1OFTA 2H06A 3OLYA 4P4TA 4BQOA 1BMDA 1JN0A 1U0FA 3BM5A 1QF6A 2J45A 3E61A 5A3VA 2OZKA 2Q1WA 4GKAA 2OA0A 4AK9A 1WPQA 2LDBA 3WXMA 1SUCA 3OFSA 3SHQA 2IC5A 4UTRA 5AUNB 4XJTA 4UREA 4PR3A 3PHBE 3VMMA 5ENVA 3X1YA 2VNAA 4ND2A 1LS6A 4OF4A 2W98A 4NYIQ 2J67A 4O4HA 1UAYA 1RYEA 3LPLA 1JXAA 4NOLA 4OXNA 4BO4A 3BJEA 3CX3A 4EVQA 4YEDA 2RGRA 4Z0TA 1NF3A 1Z2AA 3D9QX 1TZCA 4RJLA 5AJUA 5A02A 4EGFA 1LFAA 1NNSA 3A1CA 4X7BA 4FHZA 3M83A 4BLTA 2RAPA 2OUKA 4ZI7A 1I3MA 1H1LA 4UU8A 5CB4B 2ZJ7A 5ALYA 3EXG1 1I4LD 4KN8A 1F20A 1ZA2A 2QD1A 4NL4H 2DGDA 4RTJA 3DBHB 1NW8A 3E2PA 1RCFA 1Z6ZA 3BJZA 4QUBA 2R5FA 4ZRNA 1G2IA 4IIUA 4YP1A 2NTJA 2DKOA 3WIVA 1S3SA 3ZDDA 2XUJA 3AXTA 2WM2A 3IT2A 5KOIA 3GRRA 1U7OA 3WP0A 4AC9A 2VP6A 4OGWA 4Y1RA 1Y3AA 5C5DA 2YWHA 1K9VF 3M1YA 2IPLA 3N8NA 3PG5A 3ORRA 4P3OA 5C2JB 3D5QA 5EJ6A 5FOQA 4PQEA 2HW8A 1DARA 2PZMA 3RIMA 3VO9A 4JN6B 1NXQA 1LLUA 2ZI3A 4G3XA 1BIFA 3H4IA 4HB3A 4UDNA 3KYJB 5JD3A 3DM9B 1Q21A 1UKYA 5B1IA 2QB5A 4NF2A 3NAZA 3QFFA 3G2MA 2J3QA 2YJZA 1GZ6A 1FVHA 3HDYA 3O93A 1TAHA 4V1CA 5J3JA 1MC4A 4GH5A 3SJZA 1ZCAA 1WX1A 1TFRA 4LKRA 1G7SA 4DAEA 3CN7A 3OCZA 1I1NA 3OIVA 2I67A 3JX9A 4QLAA 2GPTA 2O3QA 2QTRA 2RFLA 4PO8A 5I9TA 1JEAA 4IRMA 3RM3A 2QTVA 1QWSA 1NE7A 4P92A 4OXXA 4RIEA 1S3IA 2WF7A 2L69A 1NNUA 4M0LA 2IELA 1EJ2A 3N8GA 1DWOA 4QQ8A 3K0CA 1KGDA 4B5KA 2AB0A 2GA8A 2FQQA 1N0WA 3EMDA 4FBGA 4IH4A 2PSEA 3P52A 2HT6A 2XKJE 3OLVA 1EFPB 1O9HA 3U3ZA 5A3JA 2K5UA 3ZDAA 2GZSA 4GMKA 4CCYB 4EJ2A 2IY8A 2Q07A 4FGSA 1VPWA 4WD3A 1K8YB 1Y9DA 4M1OA 4JA0A 1C41A 1NI4A 3D2AA 2DLCX 2BHLA 3L1IA 4HLQB 3CLSD 2JIRA 2WSLA 4LJSA 5LKAA 3HJNA 1LJLA 1WWKA 2X1HA 2BR4A 2ZJ1A 3FB1A 3GLHE 3PDIB 3R7NA 3V4OA 2D5CA 2GCGA 2HDNB 3L1HA 3RHTA 3SIXA 2QD2A 3VYWA 1XQ1A 1DKPA 1JS1X 1UBMS 5FNVF 3WFJA 4KPGA 4DZRA 5HGXA 2QM3A 3HVUA 2O54A 3KE8A 4I4TB 1OPRA 1XYYA 4PGFA 4FHDA 2Z9DA 1PW5A 3OZFA 4FLEA 4II3A 4R9SA 3SXJA 3IP6A 1YRHA 1W30A 1AM4D 4BFYA 4HQFA 4UTXA 4JV5B 3PVCA 3ITEA 3C41J 1NVXQ 4QICA 3SM3A 4YT2A 5CLJA 1YR9A 2X19A 1PS8A 4HFJA 4DREA 5K05A 1HNXB 3VRHA 2OKCA 2FN9A 1M2EA 3JALB 2JGJA 3L7NA 3QKRA 5DRYA 1NBMD 5EZQA 3VYSB 5EIFA 2AN1A 2HF7A 3D4IA 4J4TA 3DDOA 4OQNA 4OQ4A 4IIXA 3K4HA 4KIWA 4S3MA 5SZIA 5DX0A 5A4AA 1AUPA 3B48A 1E2HA 1HE5A 2MYTA 3PXUA 1Y8RA 3FUXA 5CA1B 2O50A 3S2YA 3TI9A 5KVAA 1II8B 2J0UB 3H1GA 3OETA 3HRIA 4ALNA 1XEFA 4R0NA 4BNUA 1L1QA 5ALDA 2LGJA 1YE3A 1Z0IA 2EWMA 4RCYA 2ZWIA 4FYKA 2ZS8A 5K0ZA 2AWNA 1IBKB 4MJLA 4AT1A 1ZVQA 2V03A 4B6RA 3H9JA 4K9LA 4M7OA 3S70A 2ZVDA 3H13A 4EMBA 1BU5A 1PW7A 4C2UA 5B1SA 3LV8A 4HX5A 1ZI6A 4R1PA 3E1KA 3KB2A 3ZJYA 5CXXA 4G41A 4EZEA 3VR1A 2HJHA 1XLVA 3FOBA 1LXCA 1TVKB 3RRZA 4IMPA 1QH9A 1USUA 2P41A 1N8NA 4MGZR 5GGYA 1A2OA 2XTZA 1Q7CA 1JEYA 1WSAA 3FBWA 1N32B 5HFNA 4NFYA 1D1SA 3GHHA 4HXYA 4TUYB 4IYRA 2RMKA 5K4GA 5L3ZA 3CF6R 1H9BA 4GLOA 1H6BA 4ND6A 3DTVB 5DM1A 4YAIA 4F46A 1K8QA 1T6ZA 4KQXA 3PX2A 1UC8A 2WDZA 4O4JF 3QA9A 7AT1A 3GEDA 3KEGA 4OXYA 2GVZC 3HLKA 2OSBA 4X1YB 5AT1A 3LKBA 4NOKA 2ZJYA 2AKAB 2GZHA 4ENSA 3GLIE 1V2HE 4FYYA 4MJXA 4E33A 3AVVA 4DFDA 3GGOA 1VE7A 3N2EA 1RJFA 5K51A 2VAMA 3ZQ4A 4BC1A 3EDMA 3N3BC 3IFSA 3JVUA 1V9CA 5TQJA 4UHBA 5U4XA 1HLDA 5LNK6 1FDRA 4WWHA 5KVVA 1NUHA 3BH7A 2NLOA 4JBNA 3QKUA 2MYUA 2PAAA 3NHMA 1KXJA 2PD4A 1FB5A 3IOYA 4KIFA 4PNEA 1OHHD 3ZZTA 1FDUA 3RVSA 2QWXA 4XM0A 3TAXA 1CS0B 1RAHA 3ENVA 2GXQA 3X1ZA 3CONA 2I3AA 2RCNA 5JQGB 1NYLA 3W6PA 2PVSA 3A8TA 1NLMA 2JFFA 3LT5A 2RHLA 3GRCA 8MHTA 2RKWA 4J07A 4L6IA 1VOTA 2AEFA 1V5GA 1EG7A 5B6PA 3CE9A 1XA0A 2VUTA 3OY2A 1WXWA 3NWEA 2AT1A 1GYRA 2H7CA 3LXXA 5LA6F 4KPYA 1KWGA 4RUKA 1KVTA 4TV9F 4MGIR 2CJPA 4U2GA 3OO1A 3SC3A 2ZU6A 4Y2PA 3C85A 3LLSA 4HDMA 3DBHA 3QM1A 2W4IA 4IWYA 4P1ZA 1X7YA 5TEVA 3LX5A 3LBFA 5DSTA 1E3TA 3UHAA 4CUJA 3PZRA 3SQDA 2GEKA 3GFFA 1AQ6A 2EJBA 4G85A 3WNQA 2BSQA 3Q7QA 4FMCF 3FDIA 1GQ2A 4B31A 2VCYA 1IY1A 1XAJA 3FNGA 4U2KA 2BF4A 1GU1A 5JXHA 1ID8A 1KNQA 4DS3A 3LPDA 3FPKA 1JI0A 1R4NB 3UK2A 5CCDA 2ZPAA 1MAVA 5LXTA 4BWYA 2A5LA 5ED0A 3RS9A 3U40A 1ESMA 1Q11A 4NKRA 2F55A 3W2IA 3OTQA 3DE6X 3TSOA 1T0JB 4DA4A 4EABA 3TTSA 2O7NA 1JLSA 2X0RA 3INTA 4GC5A 3MINA 4IG9A 3GLVA 2FJUA 3ETCA 3SF0A 3PL5A 3ZE9A 3GRVA 3QX9A 4FFRA 4LXUA 5IN4A 3FPFA 3AY3A 3GYGA 3K6KA 3RRMA 3ABIA 3QV2A 5IFKA 1QGUA 4Q19A 2BY4A 3N39C 4LXXA 2FDXA 1A04A 3DTYA 2ATCA 2R1VA 3I42A 5JIBA 1M1UA 4WFKA 3ZKWB 1C30B 1XU9A 4G36A 3SWWA 2UUPA 4RQTA 1NLFA 5ALRA 4CCYA 4TTPA 3NR2A 2V8OA 4QTZA 4XVQA 1UFKA 2EGUA 5I4BA 2BEVA 5JRJA 1IYZA 2Y1OA 3HC7A 4JB3A 2B99A 3DFFA 1RTTA 2IVFA 1D1PA 2GN4A 2QL6A 1Y6JA 2Z8ZA 2JGDB 1M1YE 3AEYA 3OBIA 2IX9A 4LAFA 4DNFA 2R66A 4G0YA 2C2GA 3WGYA 1Z62A 4R8RA 3R5SA 5J58A 1JXQA 5FTWA 2GEDA 3REOA 4ZN6A 1YQTA 1VJTA 1SVIA 1UUFA 1IN5A 2NZYA 3A06A 4DKXA 1G4AE 4J7AA 1W1UA 3C24A 1MRSA 1P2FA 2QYHA 4ZVLA 1MCZA 5EQFA 5T6BA 3NATA 4RHCA 5SYNA 2WTBA 5TMDA 2NZVG 3USCS 4DPLA 2IYPA 4MDFA 4PYIA 4MA4A 3DHWC 3QJGA 5DCLA 4JQCA 2VUUA 3STXA 3ACDA 4GEKA 2FZCA 1Z07A 2YBDA 3HJTA 4HNTA 3PX7A 1KS9A 1XCLA 2XKBA 4BNVA 4D82A 2R6R1 5KTYA 2CEAA 1JALA 1JJAA 2DPHA 4HZUA 2WKSA 4QGGA 3HVHA 1MB2A 4QO8A 4URYR 4RVUA 4ZDWA 1CVRA 3E9DA 3K0HA 4NC9A 3R7FA 2V7VA 3K9CA 3LM8A 6AT1A 5LJLA 2B6HA 4UXJA 5IVDA 1YZFA 4ZMRA 1AGPA 1RZ3A 4AECA 2I2BA 4G9GA 1H66A 1ZK3A 4LKOA 1K66A 5KWEA 3R9XA 2W6JA 4YONB 4XWYA 1CLUA 3P0HA 3QXHA 4HDKA 4WY2A 3EWIA 5EUMA 1XAGA 4AO8A 2PT7A 4OYYA 1P7CA 4HK4A 5ALFA 3A1VA 3E2MA 4MJ3A 1AURA 2HMUA 3HPQA 3OFNA 4OBWA 1MVOA 4QM7A 3OFND 1U8FO 1FFYA 1OBVA 3I2YX 2GJAA 4EA8A 2BE7A 3B13B 3ZHBA 4ZAFA 3RANA 5KREA 2NXCA 2X77A 3P9RA 2XZPA 4X8MA 4E4RA 3I76A 1G9XA 2GGSA 2XB8A 4DPKA 1V43A 3HWSA 1NKTA 2VDVE 3BJRA 3DTNA 3DDNA 5K0LA 5LU9A 3NVKI 3PFIA 2J33A 2IZZA 1NE2A 2WWWA 1CY1A 3T4XA 4E03A 3U19A 1RHKA 1JJIA 1QHYA 2Z08A 3B2EA 1TT7A 1QSGA 4JI4B 3WO1A 2XDQA 4K1LA 3DTVA 3WGLA 1DQYA 3DTVD 1BJTA 2OO3A 1UKAA 3ADKA 3BRWD 4RZHA 2IIVA 4BQRA 2IS1A 3F8TA 1YQEA 2ONCA 1MJGM 2XTNA 4GYWA 5DGIA 2JIOA 2PNFA 2DCUA 4GL4A 4YXFA 5A5EA 1CUDA 1RS0A 1W0JD 4H59A 4UBJA 4INPA 4WASA 4C7OA 1UKEA 4JUDX 3JU3A 4IAOA 1GTG1 1C7QA 2PHZA 4RM2A 4V24A 1E9FA 3MWLA 4XB1A 3LGXA 3DZFA 3LX4A 2SKEA 4FE7A 5AKYA 5EEHA 5EZYA 5CA0A 4KWIA 5DTJA 4HUQA 3B53X 2WAOA 1DDGA 2ZSJA 1TYDE 4JYBA 2NYAA 3VYUB 3FTQA 4NENB 2VKTA 2QORA 5IBCA 1SXQA 1B14A 5EUQB 3GRYA 2W5UA 2E5LB 2PKEA 4EPWA 3RUPA 4UARA 4BFCA 1VMDA 3QYJA 3RUCA 3U1TA 1W7AA 4OFZA 1OVMA 3B1XA 3I01M 3QW2A 3ZN2A 4ZT6A 1M0WA 2I3GA 1ZOOA 1DCMA 1VBMA 2FFAA 2O20A 4HAXA 5AUOB 2JD1A 2QE7A 5U9CA 2O2ZA 1E2EA 1JDTA 1HT0A 2QE7D 5BRNA 2IHUA 1K88A 1MXHA 1FPMA 1SHJA 1M1NA 2D2FA 2YYSA 4HQ0A 2H9AA 3R76A 1R6TA 2AKEA 3ZHRA 1P2SA 1SXHA 3RS2A 1M2JA 1BN6A 1CT9A 3BL5A 3DEKA 2ZWMA 4C22A 4E1VA 5TF0A 4ARZA 4B8ZA 1TLTA 5K09A 3V97A 1QO0D 2G9VA 4FKBA 3U60B 3FVQA 1OKKA 2LIVA 5HRCA 1OKKD 3Q3CA 1YU9A 2WZQA 4OREX 3QOXA 1AK2A 1OXSC 4NYMR 2WP0A 1P75A 1TRKA 3RVKA 4R69A 2BGRA 3UGQA 4HPWA 4ALMA 2YZ2A 4JMPA 2JBWA 1YQXA 2AQKA 4JQZA 5F98A 4KJZA 3TTXA 3A4LA 4J0JA 3K0FB 5J5VA 1QWOA 1Y4ZA 1F6DA 1OTHA 4EX7A 5K8TA 1SUWA 4C6RA 1SK9A 2VAVA 2B83A 3C5VA 3RRBA 3PDUA 3VHXB 1X1DA 2RI0A 1W73A 4QT0A 4GSLA 5DB4A 3L7AA 1RWVA 2WWIA 5JCJA 5C4GB 5JCJD 2RHRA 3ACCA 3DXZA 4N8SA 4ZVUA 3KWMA 1L7EA 4LE0A 4AW9A 3BULA 3ZHTA 5IG2A 3TLGA 4HGQA 3IOEA 1U2EA 3NKLA 1OREA 1UJMA 2H1FA 3I6IA 2NYVA 1A9RA 1MDFA 2RHMA 1SG9A 3DWIA 4OQEA 3E53A 3L07A 3MMNA 4I8DA 2I87A 3WAGA 2O9JA 4IO0A 3VTKA 3WK8A 4W5RA 2Q6OA 1U8AA 3WE7A 2IBSA 4HWPA 4UTNA 3TD6A 2FY8A 4CEHA 3LUAA 2GM3A 2IQIA 2QM7A 5FBHA 2CZCA 5G0SA 1FTQA 5JSUA 2A9FA 1KEVA 4JP1A 1YU6A 1NTRA 1QIHA 3AHGA 4G1MB 3E6AA 4HB0A 4X85A 5DBHX 2NO6A 3W0LB 3F74A 3THYA 1VMKA 3L1KA 4YJHB 2XX3A 4HTAA 3ZEAA 3KS9A 4EA6A 3FRHA 4O3MA 3ZDBA 1M2WA 2QP3A 2W71A 4Q12A 2PZLA 6GPBA 4W5QA 2EATA 3LLVA 3S7ZA 4JJ8A 1YA8A 4LZPA 5H80A 4CUKA 1HDCA 5JT1A 5KQGA 4Q6BA 3KJEA 4FOPA 1WVGA 1ILWA 4HJXA 2MJLA 1NJ8A 1RBZA 2AHRA 3VAZA 2ZYVX 4G5HA 2D3TA 2H85A 1OV6A 2QX9A 4YV0A 1NZFA 3IDOA 2D8MA 5IVPA 4IDOA 4RVHA 5CUQA 1OGYA 2B1QA 2CLCX 2VJNA 3WYGA 3SZLA 4LHWA 1E4YA 3L4KA 2D74A 1FJGB 1SULA 2XB2A 4Y1GA 6REQB 4Y1FA 4YJ2A 1KORA 2GLXA 2W4QA 3NHAA 2OHOA 3NMUF 5AK6A 1VIMA 5K0TA 1C1HA 1EFVB 1T3GA 3RTCA 3E1SA 5EINA 3AIIA 2H5LA 1PFWA 4W6QA 5JJ5A 3CZRA 4MYSA 1Z33A 3OE7D 1RFLA 4QBHA 1EINA 5KEIA 3OFKA 4ZWNA 1S8NA 4R4JA 3WLHA 4LC9A 3KXPA 4K9MA 2YDXA 4D1YA 4XDZA 4NFLA 4URXR 2VP4A 4MWSA 4DUGD 1CW2B 1JBKA 1P9WA 3OWHA 1B42A 4M83A 4XQ9A 1PX2A 2FSHA 5CJJA 2IZOA 1E9RA 3CINA 2DBRA 5DCWA 3Q8KA 4G01B 3Q6NA 3SFVA 2FG7C 2FUKA 1XCMA 3FF4A 5JMWA 2W2LA 4NECA 4FYHA 3QSYA 1TU4A 2PZEA 2IW1A 3HI6A 5JVDF 3IEKA 3T1HB 4OGLA 2WAAA 4CHGA 3QKTA 4OAPA 1W5BA 3ETEA 2IIPA 4JELA 2OV8A 5AI5A 2VHJA 2P5TB 2ZTUA 4B2IA 3I3SR 3O2NA 3HEMA 2IUEA 1LY1A 1QKKA 3C3YA 4MVJE 2PJRA 2QRPA 1A76A 4YP6A 2PWPA 4YHHB 4PHHA 1PJ2A 2H1VA 1XU4A 2SHKA 4BCDA 2WNHA 3LHKA 2C54A 2V7BA 2I4IA 1PGJA 1H9CA 4K81B 1TCCA 2F8LA 1JHAA 2J3DA 4LYAA 4AULA 3GPLA 1X7ZB 4EPXA 2WU1A 3F5FA 4UZFA 1F4LA 3DHEA 2NSLA 4N7BA 4PSAA 2ZUWA 1Y7PA 5EEGA 4POAA 5COQA 1OH7A 1QGDA 3QNWA 1A5SB 2WFMA 4S1VA 3W5IA 1JG7A 2PMBA 4UUPA 1H6CA 2PKQO 2AOTB 2AJLI 1C80A 1O4WA 4QPNA 4DCNA 5F1YA 4JGBA 3H99A 3RH0A 2A5YB 2AG0A 1FFDA 3A1NA 4Q93A 1NL3A 3VA7A 4KKVA 3ER8A 1XI2A 2JJ8A 2G70A 1E94E 1XCPA 2AH5A 4DMCA 1XTRA 4NICA 4BIMA 3M4ZA 4GG1A 1NKSA 3LQ2A 4EHNA 2TMKA 1NQUA 4A6EA 2HCFA 2AE1A 4DLZA 1BH6A 1ZJZA 5EE5B 4QQFA 3ZZUA 1JZQA 3GO4A 1K75A 4GR9A 5DMXA 3AJRA 1PWEA 2P1ZA 4Z1OA 2X0IA 4OUDB 1JXMA 3G49A 3ML1A 1STOA 4YJGB 3D0OA 3T34A 1YQWA 4M6WB 2W70A 4IJ5A 2PT6A 1PVVA 3MQ2A 2X9LA 1W9MA 3V8NA 3TLMA 4BVFA 4O4IA 3SYRA 2EF0A 4F8JA 4G2TA 5FYQA 2IUYA 5H59A 4GRDA 2EX4A 4FC7A 3UCEA 1UKBA 3S68A 1ZYUA 1JQAA 4ARSA 1NTOA 2XAUA 3MLEA 2D2VA 1D0IA 4J1QA 4BE9A 3PC8C 3KVYA 1GUYA 1JJBA 2WBLC 2JD0A 4OJNA 2B94A 5HZMA 1C14A 1X9GA 1SD2A 2LKCA 3VZRA 4GICA 2BD0A 1WU8A 4JC4A 4LF9B 1VLMA 3H2KA 2HIAA 3P9KA 4QECA 1YCDA 3AIMA 3C3DA 2GPJA 4EG0A 1OX5A 3RIGA 3FCCA 1OJ7A 4BGIA 1HQYE 2OCIA 4K8RB 1GU7A 2LUOA 2FEWB 4P08A 1G8GA 4WL0A 3TKLA 2HA3A 4JOQA 3DWEX 4BNFA 2FW0A 3RFVA 4EB6B 4CMGA 4MQFA 3RWMB 2IDMA 1BEEA 4URHA 4N9QA 4ROTA 1KR5A 3AESA 1W0CA 2OSVA 3L0IB 1NVVR 4J3NA 2ZCVA 2HJVA 3BBLA 3UMGA 1KEWA 1TTQB 3EF3A 3IAS1 4FDUA 1V1RB 2XCTB 4YAUA 3MTEA 2AWOA 4HLDA 5J2UB 4E5MA 2ATIA 1W4ZA 2GEUA 2POCA 1IOVA 3VHXA 2F59A 2KBFA 3DT6A 2VBFA 3A32A 3IVAA 1QTRA 1T4CA 1AB6A 1BKDR 1CX9B 1SPXA 1P0MA 1TF5A 2YWDA 3CO0S 3DD1A 1JDVA 3OPXA 3W7BA 1ZPDA 2CFTA 2HF2A 4TXLA 4AQDA 5KTTA 3PQDA 5GM2A 3O95A 1C9KA 2PBFA 1M6WA 1N33B 4IIYA 4IR7A 3Q3JB 4MVJF 5E1MA 4EUHA 3DO6A 3RSSA 1Y3HA 3OH8A 1O5TA 3SI7A 4FFSA 1WMDA 4HBGA 1UOEA 1R8XA 1ZLXA 2PLAA 2IHTA 4JXZA 1C9YA 1JKJA 1PZNA 2E85A 3ZCRA 1XKTA 5FTNA 5IC4A 1P39A 4M3NA 4EHAA 4L95C 4FONA 1QOQB 4YA6A 3R8XA 3GZNB 3VNVA 2J9FB 3K5IA 5IM4F 4KO3S 3ONDA 1EDBA 1O6ZA 4YASA 3OF3A 4M7WA 3K9FC 1YJ8A 2W2KA 4QAJA 4IIGA 2HK9A 3IUQA 2WIKA 2DZDA 2QUZA 4JCCA 3CNLA 4AG6A 4BO8A 5JYDA 4S35A 4ZEWA 4CE6A 4V0LA 3U3DA 1N0VC 2ZQ5A 3T7CA 4DCTA 2VFAA 3BX1A 4X1KA 4FGJA 4X62B 2JRLA 5CX4A 1FVFA 5LYJB 3GEBA 3WMXA 3PJFA 4MGHA 4DC0A 3EGOA 3H42B 3QUQA 4RETA 1H2BA 1B23P 4B44A 3A3PA 5L6MB 1MQSA 1KMNA 4PIVA 1OZHA 2NPFA 3RS0A 5T7BA 3LJKA 3ISVA 4HNUA 2O2JA 1TUBB 3I04M 3K0BA 4DR1B 2GFHA 4Z7JA 3LZ6A 1NR5A 1E32A 1T4DA 4U39A 4B7UA 5IT0A 3LHIA 2MMCA 4KB5A 2AUTA 2ZWVA 3E84A 5JUWA 4KWHA 2L2QA 3T99A 4L75A 1HFKA 1N6RA 4NLLA 2VCHA 2Q1TA 1OF1A 1M1ZA 1WG8A 1UJBA 2BR5A 2QVZX 3UJCA 5JZVA 2VTKA 4F4FA 1DKRA 1K9SA 1QAQA 5I8WA 3PQ7A 3B1KA 1W1IA 4PPGA 4ZHQB 2QL7A 4MDYA 4OD0A 1UL1X 4RH3A 5D01A 3TIFA 4F9TA 1KU6A 1ZWLA 2AJTA 1U9JA 2LKDA 2WJ6A 3GA0A 4OQXA 1X86B 3TLYA 4CDGA 2C4TA 1QMPA 3OFJA 3EGXB 4LDJA 2GF9A 1UPBA 5KNBH 3L3BA 3OPMA 1Z4IA 2FETA 4MQEB 2UVPB 3RSGA 5FI0B 2A0XA 3NBFA 1N5OX 3GDGA 4DKJA 2BONA 3KLMX 3QFHA 2X13A 2HNBA 4TRNA 3RE1A 2I5PO 1KPHA 2XXBA 1BD3A 5BSVA 3QRWA 4HYYA 5IKMA 1QRRA 1SKQA 2I4MA 3MBOA 4HDOB 5LBUA 3NFYA 1NQAO 3IT1A 5DM60 2BTEA 3A04A 1W25A 4O0LA 1YO6A 3M5PA 5ALHA 4JP3A 2BMVA 1FX1A 2PMKA 5B58C 4I0WB 4LNUB 2N46A 2C5SA 1C0EA 4HAVA 3N1UA 2UXDB 1R1DA 2RIRA 2WR8A 3JQ7B 3TEFA 1N34B 3H5TA 1ZMBA 3AF1A 4NV3A 1CF4A 2P4QA 2PVPA 4DA9A 1LKZA 4TXMA 3SNKA 3DPSA 4CWAA 1KRHA 1QH1A 1Z5UA 1DSSG 4JKIA 4QUJA 2GZ2A 1DEOA 1O03A 4KHZA 4WFJA 4OMCA 2X2EA 2FFQA 4YMTA 2GYUA 4IJWA 4TPKA 4X65B 3PEYA 1WHTA 2EKZA 4AJ9A 1QF7A 5TRTA 4IKEA 5KJEA 1PZGA 1JPVA 1BA2A 2H1RA 2ADOA 5AXBA 5HFJA 3VAAA 1EK2A 1NBWB 2OAGA 4PLHA 2UUBB 2WFAA 2AVDA 3E9QA 1R88A 1RJ9A 2R60A 2DPMA 3AQIA 3IA7A 2IS2A 3IO5A 4JLVA 1F48A 3GLHA 4U2EA 3ZDXB 2WABA 2XW6A 1NSYA 2PS3A 3QXSA 4NBKA 2FQWA 3EEFA 4LUCA 4F9GA 3PYXA 4YGYA 1E3QA 3JYPA 3REGA 3VOBA 5JROA 5LP6F 1A9XB 1KDPA 4W4TA 5J23A 5ECGC 1EM8B 3TYXA 1HR0B 3L8YA 5ECDA 1W96A 1QONA 4OHMA 4HN2A 4QOHA 1Q0QA 2X5JO 1YA6A 1GGNA 3KWJA 4CF3A 4DLXA 4BNTA 1ZCJA 2Z56A 3HHPA 5ILOA 1DG1G 3G59A 1J42A 4A27A 2DH5A 4U8HA 3Q5GA 3CM0A 3HM2A 3Q3IA 2F9FA 4NS4A 4ABYA 4BBJA 2ZSFA 2AZDA 2CFOA 4CR8A 4XUEA 1Y6FA 2HDWA 3EBOA 5TJHA 4YJDA 2Y71A 5KYYA 4LGMA 5G1PA 1XZAA 2VH1A 2H5EA 2WTUA 3B9PA 1VMIA 2VXBA 2Y0EA 3LCMA 4ZYZA 2Q28A 521PA 3SYMA 2GRJA 2N9UA 3G0CA 3TOCA 3FGNA 2W93A 5ALVA 4NG5A 3QVWA 2CYBA 2YV4A 3OOJA 5ABPA 1XD8A 1D3AA 3M6VA 4HHEA 2YIJA 3USES 4MWDA 2B2NA 3L92A 3I9JA 1O3YA 2HRZA 2CXXA 2GX6A 4K46A 4O4LB 4TS4A 5CHEA 1YVDA 4HFMA 1VGQA 4NZNA 5IN5A 1AV7A 4E30A 4MR8A 3V7FA 1KMMA 4RHXA 3B12A 1AF7A 3KNZA 4WGFA 4N6NA 5HCIA 2WWXA 4L0CA 1ZCZA 3ASVA 3PWTA 4YJFB 4YRRA 1S1MA 3NB0A 4RYDA 1Z5PA 3BT7A 2I1WA 5E4JA 1GZDA 1W87A 4OV6B 3ZHVA 3IUBA 4R8KA 2DFNA 3DV0A 4OP2A 1YHZA 1X9HA 2CHGA 1W93A 4ZU6X 4BNDB 4CT5A 4ZGWA 2EKPA 1D7AA 2A6PA 1N1GA 2IYAA 4UMEA 5CNIA 3RK1A 4ENUA 4FNGA 1RAEA 1RABA 4EFNA 3R3YA 1DWUA 4DJJA 3C5EA 2QVYX 1L5GB 1M54A 4BYGA 2V54A 1WB5A 3W1VA 5K45A 2FSGA 4UBMA 3BYZA 4C4XA 1P0CA 1V8DA 2F6RA 4MWZA 1MX9A 2DT8A 1UK7A 1GCUA 4F1KA 4Y9TA 3DL2A 5HPYB 4G9EA 3GLIA 3NOXA 2PUEA 3MIIA 2G7MC 4Q03A 4RESA 3OE4A 1FYDA 2BGTA 3NUGA 1XMQB 3R4VA 5ALJA 1VL2A 4DDTA 3KWFA 4EHDA 4IDNA 4O1HA 3MPUA 4HGYA 1UMDA 1UXIA 3OZSA 3RJ9A 5BRJA 4D8YA 4TROA 4ALIA 4MS4A 2VK8A 4N12A 1KDYA 3SDZA 3V7WA 1JIXA 1GPMA 1Z22A 2WDPA 1DAEA 1UKCA 1BX0A 1E7WA 1WF6A 2R8XA 2VI5A 1FYVA 2PR2A 3T5BA 3VKWA 2IBMA 1PL6A 3OQIA 1S0UA 4LFAB 3LF2A 4RZQA 3M6FA 1DJNA 1XAIA 2JIQA 3UK7A 3CIFA 4HRVA 1MC5A 3JWPA 1GARA 3OSZA 3QPCA 3EISA 2ZVPX 1S2NA 4JLBA 2O7VA 3RBZA 2O1XA 1QDEA 1WD5A 3UHPA 2B8TA 3BAZA 4WBXC 5LLSA 1CY7A 3SK0A 3HBJA 3IDSA 3AI1A 1J06A 3EVEA 3NBAA 1UWVA 1GL7A 3K9GA 1NATA 4YJ3A 4BMDA 2FRDA 2PIAA 3M9XA 2J85A 3MG9A 4BKPA 3V32A 1KI3A 2ERXA 4L85A 3JWJA 4IIFA 1LB1B 1RYMA 1E2GA 1DG9A 5EJ4A 4N5MA 4W6ZA 2QW1A 2ZCUA 2Z5GA 1L7BA 3NVAA 4K3VA 4TTQA 1RRCA 1V5FA 3I2KA 4X54A 5FPYA 1U3TA 3H2BA 3SE0A 5B6JA 3EZGA 2IA5A 3JQAB 3DLCA 1T34A 4DCUA 5DBGA 1GNVA 4JBIA 1V7PC 2R6CA 1K7YA 1H0KA 3R5JA 1S4QA 2H8GA 4HX2A 2KSQA 2XI4A 3K2BA 4KGDA 4MR7A 3ZZ1A 2NAFA 4C6TB 1TQHA 4MUGA 1PJZA 1JSCA 2B82A 2I71A 4DEVA 5K3SA 4ECEA 3VNSA 5CDSA 2HJWA 3MA0A 1JQ3A 3UJ9A 2HT1A 2I99A 1X3SA 2W8BB 4TT3A 1FVOA 4TT3D 5J1TB 5JSFA 4D8WA 3NTRA 2H2AA 3RS8A 4B17A 4WXRA 2EZTA 5L4SA 4F4JA 1RDFA 2F62A 3A3YA 2NVBA 3SR4A 3TVYA 2QBYB 4NONA 3TCKA 4QVIA 2FZ4A 3TJZA 5B36A 2IEBA 3UWKA 3BIFA 4FFVA 3HQ4O 4LDNA 2VRWA 4C6HA 3TW8A 1RYFA 3Q7PA 1QP7A 1LJ8A 3PNLA 4WMLA 1FDSA 4QDUA 4E51A 3CVXA 1ZM9A 2FWJA 1E99A 4GI1A 4AMBA 1Z2OX 2GJ9A 3DFZA 1PWYE 2AD1A 3DOHA 3UMYA 5EE9A 3DZHA 4PSKA 5EYPB 1IBRA 1IMOA 1ONBA 3ELYA 3AETB 4RPGA 2R7LA 3T3GA 2YV5A 1KH1A 3BF8A 4CTOA 1HQCA 3K70D 5DNCA 2BAGA 1U2QA 3PQ4A 2I1LA 2WAXA 2NO0A 3ZW8A 4W1SA 2X23A 5IP5A 1E69A 1M1YA 4Q3LA 3D02A 1USGA 5CB8A 2I7XA 5BUCA 4ZT2A 1JTEA 3AI3A 1KZGB 1Q6ZA 3RU7A 1GV0A 1GRQA 1C9MA 1W5EA 1ZOSA 3U62A 5KTPA 3HCDA 4CF5A 1QPBA 2WB4A 2XRMA 4FVTA 1QQTA 2O6HA 2UYGA 4P86A 4Q37A 3AVYA 3N6XA 3AEZA 1AMUA 5EHNA 3U5ZB 3HO8A 1CY4A 1XJ5A 4FUTA 4E2ZA 1KC1A 4UTVA 2BM8A 3LWZA 1H3NA 3GZ4A 3ZCPA 3FUTA 4A92A 1UOQA 2PCJA 4ZVOA 3BWVA 1R0RE 1QVRA 4GW3A 5IUKC 1FQOA 4WNAB 1L1EA 4PWZA 5K1ZA 1Z13A 1ORWA 2QSYA 2IZ6A 2FW6A 3T5CA 1T3SA 3P9XA 1JG3A 1NGSA 1UKVY 2RIPA 1GKKA 2YMMA 1DAPA 1KP2A 4B6SA 3BHNA 1BS9A 1KE1A 5I7VA 4RTRA 4DV6B 2O8NA 4AS1A 3EAFA 2WM3A 2RHBA 1P60A 2Z6UA 5GONB 4JHXA 3FB4A 1T8TA 3GARA 1I36A 4HGOA 2A5JA 4JBHA 3C8DA 1TYEB 4H16A 1DKMA 2R2AA 4YI3A 4EF4A 5B37A 1JRLA 5FOVA 4BVJA 1ECJA 4II7A 2CLIB 2HY7A 2Y9PB 1VJ1A 3I0MA 3V8VA 1KO4A 2ZB8A 4FMBB 1W46A 4CKEB 2AR9A 1N8TA 2EV9A 2BWJA 5H3LA 5FDFA 4MHTA 3ND8A 4GLFA 4HDRB 4AFNA 3HFRA 3FMPB 5TQ0B 3MB8A 3O75A 3PC4A 3EQ7A 5EWMB 3ZCTA 1QUFA 3DEAA 4Y6RA 2BFDB 4FNMA 4D9MA 3NAGA 1R8QA 1IBMB 1T0BA 3VPDA 2DLNA 1ZNQO 1V3VA 4CCWA 5K3OA 4GP6A 1X8KA 4PG7A 2WHEA 2Z4RA 3PF8A 4WKPA 3CPJB 4LPKA 2JLWA 4OFXA 5JLJA 2G1JA 3SZMA 1M0TA 1VRWA 2AOUB 3AEKA 4OI0A 3VVBA 5G0VA 3PJDA 2BGIA 1L5VA 3GGDA 3F90A 1JVNA 5IWAB 3IVMA 3IURA 4KMOA 3FUCA 1YBFA 1VIDA 3C3EA 1TL7C 4FXPA 4K6OA 4CNQA 4HWTA 4P80A 5I9MA 3I5MA 4DBLE 3DDZX 5EJ7A 1NLYA 5KU7A 3CZPA 3FKQA 1U4SA 1D6NA 2XDYA 2ASEA 5DLDA 4JDUA 5F12A 4DMGA 2QM0A 1HT1E 2OORA 2VHEA 3H6HA 5EIBC 4NXNB 4XQGA 1OILA 4PBRA 2NNLD 1T9AA 3A37A 3EX7C 5BQOA 3VTZA 2Q3JA 4MCAA 2LP4Y 2IYOA 3GJSA 1RM5A 3BIJA 2HM7A 5CVEA 4ZA2A 1DAGA 3S40A 4L07A 1MGPA 1P62B 5ADVA 2YJTD 3H84A 1T1SA 2HRCA 5GTDA 1GNQA 3QYAA 4BVEA 2GHQA 1RIIA 3DBLB 3RTAA 4Z2AA 2FQXA 3OI7A 3D0KA 1GR1A 4R2IA 2GEBA 1WA5A 1S96A 2TECE 3HBFA 2V55B 1JLKA 2PVCA 4GLJA 3N8DA 5F64A 3TBFA 1KYQA 4KLCA 2CY0A 2JAOA 2ZIXA 3Q10A 2W90A 2HK7A 2W2QA 4GSYA 4YLGA 4N0MA 2ACVA 2FUG6 1F6WA 2GDZA 2HLPA 3GG2A 3HADA 3LVRE 3QF4B 4BUZA 4YRIA 5A9SA 2BTOA 1QF9A 3AEQB 1DQRA 2PX6A 3JQFA 4IXWA 4ZAXA 2FG5A 5D1HA 1O2DA 3AVUA 4UHJA 3NT2A 2QNIA 4D74A 1KEZA 4IOKA 3S1AA 1DCFA 1EVQA 1ML4A 2NXNA 4PRKA 2YWCA 1MA0A 4FYJA 2PKYX 3T7SA 1Q1GA 1MAUA 1YR3A 2DY0A 5E6SB 3FZGA 4HAYA 4ESVA 4WJZA 3F9IA 3VJKA 3A11A 2B5VA 4U0KA 1J2JA 1MVNA 2JGKA 1JL3A 3EF1A 1NV8A 3U3JA 5C32A 3JYNA 4XB2A 4NBNA 1XYVA 5I51A 2J0EA 2VDMB 3BQ9A 3ISJA 3IAS6 4WY8A 4WK0B 4KK4A 1R66A 1NNEA 4PX2A 1QFZA 1JMKC 1JQDA 1E2QA 2OM2A 3O84A 4NH0A 3TRFA 3JYLA 4JJZA 4QC2A 3LP6A 2Q4EA 4YCJA 1SXJC 2F67A 3IUJA 4Q9JA 5HS6A 1TGYA 1QP0A 3E9YA 1QORA 5LUBA 3THXB 1A1SA 2IT1A 5BYKA 3CNNA 4BQNA 2C0CA 1JFRA 2HU8A 4OBXA 4E5KA 2YWEA 4Z9XA 1DKUA 3R41A 5FADA 3L8EA 5BMVA 3DDHA 4NCBA 1CDDA 3OQ6A 4BEJA 5F21A 2CD7A 4M8IA 3TGLA 2DFKB 3EXEB 3GDFA 2INGX 3I34X 2QIOA 4UE6A 5CJ2A 5EJMA 1I3KA 1Z7EA 3KYCB 4HPXB 2BEWB 4I99A 4D43A 4W7IA 4M22A 1D5CA 3UOAB 2BKAA 3IP9A 4MI3A 4D81A 5J1SB 2CB9A 3IUSA 3ER9A 4EELA 4MLCA 5LU8A 3OT1A 3DYVA 5ALXA 1WBDA 2VDNB 2QU7A 4W8HA 4U6SA 4B2LA 2ZE5A 2R47A 4G0QA 4CKBB 2AS0A 3L8ZA 3DMTC 4CKXA 4XIIA 1RRGA 5AD1A 2Q3HA 3UFXA 1VXRA 3CZMA 4IFIA 5AM5A 5FPKA 4JP2A 4PO9A 1CRZA 2VJOA 5BYJA 4U2DA 3USZA 3TD2A 4JQSA 1UP6A 1EXVA 2OQ2A 4WBNB 5FFMA 3AFMA 4KAAA 5TGDA 3UTDA 3MWJA 3OA2A 5JATA 1JAHA 3AJ8A 4MPTA 3WADA 3FE2A 1O94A 2E9SA 2H0RA 1MBZA 1O94D 3JQRA 3L0YA 5FHRA 1UJ4A 2NGRA 4BCCA 5AVYA 1RSZA 3QSGA 1MX3A 5HF6A 3AVTA 4E6PA 1DU4A 5DTQA 1GZ4A 5CEJA 3DOFA 1GILA 4DIDA 3DYIA 4W5NA 1FX0B 3KSRA 1R50A 1KK2A 2ZB2A 4IJKA 1RHMA 4QM6A 4ZXPA 2VJPA 1MG5A 2DH6A 1P74A 1VHQA 2GDJA 2Y0DA 1CLEA 3IDAA 4PSDA 4RADA 5ES3A 3JQCA 4L0QA 1HRDA 1FFXA 3X2SA 4FK8A 5KWVA 4ZXFA 2VHVA 4NU5A 5FBLB 4MIOA 3TPFA 3WBBA 3JQDA 1V0JA 3LSTA 4H31A 2FEOA 2F4VB 4OG2A 2WQ7A 1WCV1 2XOKA 3WB1A 1BWSA 2WUVA 2XOKD 4IZIA 4IH1A 4C87A 2XSZD 1NA5A 2NO4A 2JFNA 2P2SA 4LWOA 1E1CA 2FPIB 3JQ6A 5EFZA 2VJYA 4ZT4A 2EOAA 4JB2A 1ORTA 3KR2A 1I0ZA 4C43A 1Y1LA 3DDUA 4UPDA 4MICA 1Z6PA 4TV8F 2BGKA 2XGOA 1B15A 3MLAA 3ZU5A 3CB2A 2YKGA 3LIPA 1CY8A 1QFYA 2AG5A 5B2FA 3ZLVA 4F92B 4XSVA 4ZEVA 2O3TA 3VX4A 2MOKA 2P9FA 4FKMA 1IZ9A 4BMNA 3NBXX 2BFFB 4EUSA 4MDEA 4B6FA 5FPTA 3IYLW 4ZOLA 1H1TA 1M2OA 1TVCA 2C9MA 2IEGA 1YF3A 3HSSA 2VAXA 1JVSA 4ODIA 4X63A 2R85A 3ISTA 4IBOA 2N1BA 1DRJA 2VQSA 4US1R 1RRPA 2DHDA 2ILVA 1DFIA 1W8IA 2ZRQA 3QLUA 4I50F 2HLNA 1SBZA 2IJGX 2WNSA 1YL6A 2F64A 3BK7A 4WE3A 5AW0A 4BO2A 4Q7KA 1E18A 1PUIA 1D2RA 3EIUA 1KI8A 3NQ41 2P77A 4ONEA 5FUXA 3UUWA 4C4ZA 3FAZA 2C3UA 4HWSA 4D26A 1Q0ZA 3R3ZA 1CEXA 2V7QD 4NZPA 3W5UA 2AYYA 1NJ6A 3OLCX 5IABA 1L7MA 4OB7A 3R44A 1AIPA 1C1XA 4UHHA 1NN5A 3SVLA 4DA7A 1PT8A 5MFZA 2G9NA 3LIIA 1E98A 3QWHA 3ACBA 5EMNA 3MN1A 4TWZA 4DSZA 2EBHX 3UICA 2BEUB 4ENPA 1SBQA 3EFOB 1S6YA 5CLQA 3KPVA 5IT9A 4YQEA 2I76A 1ZJ4A 1OFUX 3S2SA 3QPUA 1RLJA 4AJPA 3EMBA 3U9LA 4P35A 1P19A 2X7JA 4R2LA 4HNAA 5ISMA 4G8CA 1UT5A 2ISSD 2RGGA 4QRIA 2W00A 4PNHA 4WRRA 5J63A 4B79A 2EZ9A 3EIXA 4KREA 2XPCA 2PFGA 1Q14A 2PX5A 4AZWA 1I7LA 1JSZA 2WJYA 2XVXA 4OLHA 3BTOA 5B2EA 2V0CA 2BBTA 1F38A 2AFIA 2OGUA 4RFSB 4ZPXA 3ZWYA 3STWA 4G8DA 4OHBA 1W76A 1FQWA 4MV6A 3V80A 4E12A 3PHIA 2ID7A 4J16A 2MR5A 2BVNA 2BM0A 2X3FA 1E9VA 3KB1A 4OHUA 1DJQA 1TEXA 4C07A 3TQHA 3WGJA 2ETXA 1M6VB 4P54A 4U5XA 1G38A 2JBAB 1XTTA 3EVCA 4E21A 3OPYB 3TOSA 1DUIA 3TKAA 3CLTC 4G4SP 3WNCA 5DTIA 3L7YA 3SX4A 2UZ1A 3UM9A 3ICEA 2CNNA 1BO6A 4C5BA 4TWBA 5DTEA 1XPRA 3UUFA 4D3DA 1DPGA 2BM9A 2ODNA 1NN1A 2QW8A 1I4DD 2O8CB 2H92A 1X74A 1A97A 3EQ8A 4OH1A 1WVMA 1JLLB 2O7SA 1IXZA 2VJCA 1FMJA 2RB4A 3KFLA 2C7OA 1OE0A 1E1RA 1FU4A 1E1RD 4K8OA 1II0A 1ONPA 4RKEA 3S8YA 1MXFA 5TXGA 4U7WA 5HNKA 4TWJA 4LNHA 3LRXA 5EUBA 1XPOA 2A59A 3FA2A 2Q5EA 5AW5A 1VHWA 1OWLA 1E92A 1EU1A 1RXEA 3JATB 3EXHA 4ZDKA 3IE1A 4EYEA 3X44A 1S2IA 1LF0A 1J39A 1DHRA 3AF3A 1GVHA 2V3CC 5E6UB 2H48A 5LM3A 2JLYA 4M9CA 4UM8B 3VPAA 2HBQA 3VO1A 1HT3A 4N82A 3WLNA 4FEGA 4KR6A 3W5BA 4M0UA 2OCXA 2AVNA 2YHSA 3I0ZA 4ZOAA 2E49A 3D43A 5C8ZA 4PLTA 4OX9Y 2C78A 2J30A 3AJDA 4CF7A 2Q8QA 4V2UA 3GVCA 3UW1A 2C4NA 1CCWA 2P2LA 5K8CA 2Q3EA 4PSCA 5EMLA 3WYAA 2JIDA 4LRUA 3UHOA 1JIVA 1EQ2A 3BZBA 4TMYA 3AKZA 3QELB 4GYKA 3V2IA 1M34E 4BB5A 1XDDA 2X2PA 2UZAA 4UFNA 2Q2VA 4A7PA 3VNUA 3MCUA 4ESOA 2VTBB 1Q3HA 2OUIA 2L42A 1G5RA 1N57A 2G0TA 2GBGA 4JYMA 4NNOA 3C97A 4HLUC 4OK5A 3NPMA 3ZWMA 3P9CA 5BSEA 5ES4B 2P9ZA 2Z3ZA 2NZJA 2P9TA 2Q2OA 4P4SA 3I83A 3EHDA 4BMCA 4YRSA 3RUAA 3M7IA 3DO5A 1W4CA 4H4DA 2B9VA 3EPHA 2OCKA 2VA8A 4EVIA 3C0KA 4O2AB 3PE4A 1TC2A 3AEXA 1G8KA 5ALOA 2C2XA 5TQ0A 1WVIA 2Y4OA 3FPGA 1NW6A 5HQJA 3GGGA 1FY2A 3OD1A 4I4LA 4RNCA 1OX4A 3D7SA 4ZQGA 2WA1A 3MBKA 3P0EA 1P2TA 1QH8B 7YASA 4KR9A 1Z2CA 2WFLB 3HUUA 2LDXA 5KOYA 1EUCA 1YS9A 3RT1A 2UXCB 4RJ2A 2JFVA 3PXGA 2I2WA 1EFKA 3NWPA 2IV2X 2I4OA 1EH5A 1AHIA 1FNBA 1TF2A 2B0CA 4BJ3A 1Y42X 4FN4A 2GAJA 3DZIA 1U2DA 1VIYA 4N0DA 5CYOA 1UH5A 2VP5A 3BXHA 1WNFA 1GSHA 3VR0A 3WSVA 3X43A 4KAJA 4UATA 4XFKA 1YASA 1DZIA 1YOBA 3GRAA 1ZMXA 4ARBA 3RNOA 3WGIA 2BP7B 2GZMA 3UO8B 1EUZA 1Z47A 1XMVA 4HRYA 5CYGA 1EVZA 1RE1A 3CUEF 4TKLA 4XD7A 2O8VA 1K3UB 4JYCA 2WAMA 5CDFE 2H65A 3LCCA 4HEA1 3K9LA 4Y6LA 5G41A 3F8SA 1PJBA 5KTKA 1SCBA 3ICCA 4NDAA 3DFKA 3KQQA 3RTEA 1EE2A 4WCFA 1T91A 4ER6A 3CT4A 2W2VA 4GQBA 2RGEA 1IHXA 4I9GA 1PFYA 4GLBA 3T3OA 3BCRA 4ZVSA 3U7HB 2WLTA 2FPPA 3WB9A 4BRZA 4OLFA 2BCGY 1DBQA 3F4BA 5JWHA 4UCXA 3ZG6A 1M3SA 2DCMA 3CX7A 3EVDA 4XAQA 4DC1A 1U80A 1GXSB 4JP8A 1IM2A 1TUEA 5CX1A 2ZUUA 3CWQA 3OX2A 4LWQA 4Z86A 5JYEA 1W6RA 2FHSA 2R96A 3BZWA 5JE8A 4DRZA 1EP9A 1ZGAA 4J4HA 4RA6B 1CTQA 4HH0A 5B64A 4HNRA 7ADHA 2QTTA 2BDEA 4GVPA 3ANTA 5CU7A 4QQNA 3TAUA 5CITA 4WXPA 3BMNA 2ZETA 2DRIA 1E79A 2JFGA 2P9JA 4MV1A 1E79D 4X20A 5DOVA 3VVMA 2H6EA 3ZQKA 4B2PA 1POWA 3EFOA 2IK8A 1PJTA 4KO8A 4H27A 3V8QA 4AJ1A 2YXBA 1WEHA 2GTHA 2QHXA 5L53A 1CZHA 2DWCA 4RENA 1Z5GA 4M1SA 4LX8A 2FOIA 3I9KA 4MWTA 4EQZA 1CIVA 1I0IA 5JXJA 3DP9A 2ORVA 3PWKA 4NRDA 4F6RA 4C4PA 1JQJC 4H1HA 5I9BA 5LZ2A 2W2OA 3NBZC 1BEUB 4B85A 2AUMA 1CB7A 3M5CA 1L1FA 2JRCA 2NZ2A 3K0AA 1Q15A 4TL7A 1IATA 4O29A 1W36D 3VH1A 3T54A 3EXAA 2Y99A 1E60A 4ME6A 2WHYA 1QUEA 1YWGO 2ZUSA 3WJAA 4EZIA 5HQTA 5JDCA 1Z0ZA 2UZ0A 3N74A 5DTMA 2P2CA 3NHPA 3JVVA 5ALNA 2VDLB 3OEWA 2C1XA 5C8XA 1PLLA 3ZU4A 1J2EA 3RBAA 2NTNA 3KQMA 2REBA 1J8MF 4RK7A 4DR2B 3ESDA 5A1TA 5JNVA 3KUUA 2HLHA 5AVUA 1CD5A 2OZVA 3LL4A 1SKMA 1ISMA 1LUAA 5T4EA 1QV7A 3O21A 5PNTA 1L2TA 4YDSA 3OOWA 5G2OA 3VU1A 2I65A 2UAGA 4JI1B 2ZYIA 4QFDA 3CXUA 3RVRA 2GAOA 1KOFA 3L7CA 4G86A 4D9JA 1DAKA 4HCJA 5KX5A 5LQCA 1D8AA 4PC2A 1RZRA 4U7HA 5G3YA 1RZRD 1UBEA 1C4KA 2Y2VA 1NQVA 1J9ZA 5IAGA 1F51E 4UHKA 3F98A 4PSVA 3VOTA 4YP5A 4NQRA 3ZDFA 4DN6A 4KXQA 1U7ZA 1JMYA 1L7PA 5D2CA 3DLHA 5JI2E 1ZBDA 3HBLA 2Q5CA 3CJQA 5FPPA 1OD6A 1FP2A 5KYWA 4Q1DA 3NBUA 2I4NA 3ED1A 2FTKE 4F9EA 4O63O 4UEJA 3N2GB 3G2LA 4XSHA 4JB8A 1N6OA 1USVA 3E22B 3COJA 3BB4A 1NJ5A 5C8YA 5JO0A 4KXWA 4CGZA 2PZBA 5KYXB 3X1KA 1RCUA 3OM0A 3V1MA 4MQMA 1XVIA 3GEMA 4JDPA 4Y6PA 4XE5A 3W79A 4OXRA 1GG5A 1IN4A 4IHKA 1CJCA 3SSAA 2NQ2C 1LNQA 3L0DA 4IV0A 4OLAA 1BE8A 1HPLA 1QFJA 3BB3A 5IUNC 3FIJA 4MNTA 4PBSA 3SNHA 4LOJA 2HRDA 3WYEA 4OGKA 2JASA 1F5SA 1OIWA 3UV7A 2D59A 4JJKA 4FE3A 3U7RA 4BFTA 4BX8A 4DR6B 1GITA 2O57A 4UUNA 5THXA 1BSVA 1GGEA 4KCGA 3LC1O 5A62A 1DCTA 2JFHA 5AJVB 1JAIA 2WLSA 3G9TA 1C29B 1CJMA 1ZNYA 1JG2A 3BIXA 1DXOA 3KR9A 4GSKA 3N2KA 3UYKA 4AQ7A 1KVSA 1WHSB 2BFEB 1CY0A 1T5IA 2QZ4A 5ALIA 1XVLA 4CKCA 4ICIA 3SX0A 1A27A 5FR1A 2C82A 4HVAA 2V3VA 3CEPB 3ELBA 2BFBB 1I14A 1RKQA 2EDAA 2AA3A 3AFIA 3ADOA 2R86A 4J2HA 5DMHA 2DVMA 3WHKA 1IIBA 5F77A 4B7CA 5LMUB 2BT4A 4CU5A 2J0QA 1VBKA 2RSLA 4PFJA 2YY6A 5ALUA 4KNWA 4KH1A 1R4AA 3KHUA 4P84A 2GSWA 1KNXA 1S2MA 1MPTA 4GOOD 2O3RA 4KE7A 1QRDA 2X0EA 1NM5A 2X0JA 4BZXA 1PV4A 2PPVA 3GT3A 5JNSA 3KVNA 4JLUA 4I8IA 5JH7A 1M10A 2ZUVA 5HHTA 1K2WA 3SHWA 4W1RA 2QUKA 3KJHA 4KU4A 3BERA 1YJ5A 3U3KA 4AUNA 1XNHA 4L5CA 4POOA 1SO8A 3EIFA 4EKEA 3TXXA 3DBRA 5EQTA 3UA3A 2WF6A 4MVXA 3DHVA 4FZVA 1N75A 1JG6A 3GRPA 4QTTB 5MN5A 5HE8A 1VE5A 2N75A 2ZRIA 5LBIA 1PR6A 4QBFA 3RSZA 2FMIA 5IVIA 2WWYA 3ZE0B 4BLVA 2R751 3B38A 3G7SA 1EK0A 2I6FA 4B48A 4WK4B 3U2QA 4C2AA 1CZUA 1VHTA 2C7GA 4D4JA 9ATCA 1SMKA 3UFBA 3L7MA 2A33A 4FSXA 1NN3A 3KTFA 4PONA 2BGWA 2ZTSA 2VPYA 4EUFA 1DPFA 2ZTHA 1D1QA 1VJ0A 4WSOA 5JMTA 3I9V1 5IKEA 3UMBA 5KTRA 1PKXA 4BPRA 4COKA 1WSBA 2OV1A 2Z2YA 4ZCSA 4HXFB 1Z25A 1G19A 3A4YA 4J1NA 3BAFA 1VSBA 1YBMA 5HIMA 2ZBGA 1VL8A 4F96A 1LX6A 2MYNA 4FHFA 4DLRA 2DTXA 2VSOA 3Q9SA 1ONOA 2ATVA 2C3MA 2P9YA 2PH3A 3R5HA 2DUJA 3RRJA 3A2MA 2XCQA 3EUAA 2ORYA 3EZFA 4U00A 4RF5A 4OP3A 2CYAA 1G3UA 1XX6A 3ZS9A 1FIUA 4BGVA 1NZDA 3ESXA 2FLKA 1CRPA 3KKZA 1ZINA 1A9QA 2QPOA 3AMVA 4JVOA 5CFMA 2J5KA 2E1RA 1JBQA 2JVJA 2PKXA 1SKYB 1F9AA 3HDJA 3LWNA 2G3YA 3V2UA 4NFSA 3QMVA 3R0JA 3Q6MA 2KW5A 3IQFA 4DDKA 3EEYA 4B3DA 1QMGA 5HMMA 1SELA 1AXGA 3QYFA 4EHBA 1A82A 1VG0B 3GXOA 4ND8A 1FF9A 3E7DA 3O3OB 4DDUA 1JYSA 3RVDA 4F56A 3O1LA 1GSAA 1VZ2A 2V7EA 1PUJA 2YZNA 5EP3A 3E82A 3KQSA 1R64A 2DPGA 2Y1XA 4JLMA 1P5FA 2AMJA 1OI3A 1PK7A 2G0NA 2NU6B 4LYDA 4ZK6A 1U8UA 4R1LA 1MIOA 3EWNA 1UJCA 3WA6A 1ODTC 5J2TA 2AI2A 3UGJA 4EENA 4ABTA 4JQOA 3FCYA 4CLEA 3AI2A 3JXEA 2XUHA 5A0FA 1AKYA 3RYHB 3F0TA 3SEZA 4FBMA 3P9NA 4YRFA 3CCFA 3S55A 1LA2A 4ZO6A 4PZUA 5JTUA 3WK7A 3K6SA 1AKMA 2WTMA 1VLZA 4KWEA 1W52X 4PFQA 3WDLA 4E70A 4FP9A 1QZZA 1R4MB 5JSHA 4GNRA 1RYHA 1J24A 1NYQA 2H2HA 3WQHA 4ZT3A 1AMOA 3PFBA 2ON6A 4C4TA 4EYGA 3U5TA 1C4OA 2JLZA 3K3PA 3THOA 1IN8A 2IY7A 3EY9A 4WHMA 3TZQA 2QPLA 3GLGB 1QZTA 4MKZA 3V3KA 4IVNA 5CURA 2XMCA 2QLBA 2XQIA 3JAKB 1SHLA 3P96A 2KLHA 4GX5A 3U48A 4EY6A 1QX3A 3JQGB 3PIIA 1L3CA 1CNFA 5BSWA 4EAAA 3QKSA 1Z4NA 3DZDA 3E5HA 4DG9A 4ZZ3A 4MRNA 1G8SA 1A50B 1N5LA 2FW7A 2OT3B 2QSUA 3A2LA 2VHQA 5F5XA 2WJGA 1A9PA 2FN8A 2OHXA 4GGOA 5AR1A 2AL7A 3H04A 2REQA 3VNBA 1U6JA 1EBFA 4L4XA 1A7UA 2HMAA 3K32A 4G4IA 4TRRA 3VHRA 5KVQA 4CG0A 5HZHA 1J9EA 1VMEA 4PS1A 3CX8A 4DR7B 5HX7A 4ZJPA 4IICA 2IH4A 2F00A 4H17A 3CVVA 4IIHA 2QMYA 1BDIA 3AFGA 1UZLA 2VJMB 3JPYA 3CR7A 3PDCA 4EJSA 3WK5A 3WYNA 1S7CA 3FM9A 2OBXA 3OZCA 5DNUA 1XA3A 3PDHA 2ZI6A 3RKSA 4R9NA 4H0NA 5B30A 2WHPB 4UM7A 4RF4A 4U2BA 4EDHA 2YHIB 5CYPA 4RSRA 3RC2A 4U4AA 4F45A 3DVLA 1YCHA 3I1JA 4U2FA 1XNQB 4IOLA 2FEAA 4RWEA 5K0SA 5DHRA 4ZKEA 2WKPA 2IYFA 1NBHA 3VZCA 2QRJA 1J2YA 5FNVB 3H0EA 2ERCA 4NYIR 4LYEA 3S28A 5C9ZA 1NYRA 1SKUA 1IH8A 1OFIA 1VXOA 2H4ZA 2VDPB 4HYEA 4L5JA 3UZUA 1XG5A 1ZOLA 2PMDA 2AXEA 3FSJX 5ALGA 1K98A 2EP7A 2QYSA 2VDQB 3CJTA 3EUEA 4NBUA 3TFWA 2VDJA 2VXCA 2WIGA 221PA 1DADA 1UDXA 4QGAA 2YXEA 4IGEA 1JLHA 4DQ0A 3CLHA 1ID1A 3LI2A 1KMIY 2BSAA 2YS6A 3MS2A 3JASB 1T29A 1RKXA 3PQ2A 1B8PA 1NASA 1K5GA 4PYOA 4H7JA 4GM4A 2EG5A 2MT9A 2HF9A 3BXZA 4FMDF 3T7RA 5KPDA 3I2GA 3SD7A 2G25A 1JA9A 5JXWA 1OH5A 5EN4A 5B1EA 4QRDA 4FYVA 3QE9Y 3SYKA 1OLUA 4KLZA 1XTIA 1PF7E 2Q2WA 3KRTA 4AKTA 4R54A 5AKIA 4C4RA 3ZLUA 2J4CA 4NBLA 1YK0A 1V2GA 2BFCB 4GWLA 1C8KA 1Y1RA 3O83A 1TJNA 5CLFA 2CCGA 4G8BA 1BXGB 4YLEA 5HP4A 3AVXA 1X7DA 3CZ9A 1DWQA 1O57A 2RHTA 2X8LA 1TK2A 1C3JA 5A7HA 3VH4A 4I46A 2FQ1A 4WBSA 1YR7A 1I5OA 1MZPA 2WTXA 3JS5A 1WKBA 3FWNA 2H29A 3HZOA 4UNPA 5IT5A 1Z82A 3EIOA 1AGYA 5ULLA 1G42A 3JQFC 4TLBA 3PLAE 1BNCA 3VPBA 5ILGA 3QQ5A 4ARCA 2JHFA 3CLUD 1UCFA 3PNQA 2X4DA 3FPSA 2GN2A 3KL4A 4O4JB 1QIFA 4DCPA 2JC3A 3IQHX 2HNKA 4Y0NA 4CT4B 3EBPA 3NC0C 1ILEA 3FCXA 4Z4GA 2J9YB 5DNVA 1QH0A 5F2KA 2X0DA 2P6PA 3GJ5A 2XMPA 2Y1FA 4GXNA 5EXDA 1VYVA 4TOIA 4F85A 4KQCA 2R11A 3KTOA 4N3CA 3WGQA 4YPFA 4AY4A 2HHJA 5TLSA 2NUPA 5DTRA 5HE9A 2ZRHA 2HMWA 1DNPA 4KKXB 5CJPA 5AJHA 1KE2A 3IXQA 1CIJA 4OHPA 3UWOA 3TB4A 3PITA 1FE8A 4X93A 3GCXA 3V4RA 1WY5A 4RVNA 2W6OA 1BW9A 1BJRE 2G06A 4KN6A 1JFTA 1EUDA 4DJDC 1H5QA 3R75A 4ZGGA 4KHPB 1C3LA 4Q1EA 4WUVA 1Z45A 1T2NA 4MTCA 1W48A 2IP1A 2IYEA 2PSDA 3B20A 4DNXA 3FMIA 3FYDA 3F7TA 1JEOA 4NCAA 2HIGA 1NOJA 3CT6A 1HL7A 1YL7A 2XGSA 3ES9A 1PT5A 2BFNA 4KDFA 3HVJA 4M8KA 4UDXX 1XL1A 1HZZA 4B45A 3ITKA 1QGED 4MB0A 5LA6B 4Z0PA 5AHKA 3UVEA 2I7TA 4TV9B 2YNMD 4WY5A 2Q3DA 1BDMA 5LKRA 3RYHA 1IK4A 3UXEA 2W43A 4C06A 3IVXA 2WZBA 3P2IA 2RH8A 3ZDZB 1BWPA 1Q2XA 1WB6A 1N2IA 2W0SA 3OIDA 1XZKA 1VBNA 3O4GA 2H59A 3RHFA 5B3KA 3JZMA 5D5PA 1H65A 2A94A 2QTBA 2HJSA 2QPTA 5F4BA 1ZL2A 4FMCB 3U39A 2G1KA 3PXXA 4JSTA 3KV3O 2ETVA 4ANFA 4TTSA 5K0NA 2EAUA 2OEPA 1EX1A 3EZXA 5JBQA 4IGFA 3IE0A 3CRVA 4EHHA 1FSZA 3TQCA 3UV6A 1EXWA 2FMUA 1QYCA 4N7MA 4K2AA 5BW4A 2Q9BA 4JZKA 4CODB 4OBEA 4I14A 1EK5A 2DX7A 2HC9A 4F1JA 1T2DA 2A1UA 2O06A 2RGWA 4HEA6 1BWRA 4K03A 1D6MA 1KY5A 1Y0BA 4L2IB 1D6JA 1RPZA 1KFJB 4FDTA 4LJLA 4Q0MA 3IQGX 4E2YA 1AQIA 3Q8MA 1XRQA 2B1GA 4IZ6A 2XGMA 1UOOA 4RTKA 1O0SA 2Z2IA 1WQ1R 5EA2A 1T8PA 4B3SB 3W1WA 1WDLA 4E5NA 4MZXA 4FB5A 1VKJA 3UATA 3H0CA 4ZIRA 5CAEA 3NUZA 3E27A 4J6FA 3NP7A 5H9WA 2IXBA 1W9HA 2C77A 5BV8A 5JQWA 1NT4A 2C4UA 2FSVA 4NYJQ 5BOSA 4QYMA 4ZJUA 2OD2A 5TPWB 1RAFA 1HKHA 1IC6A 4U3JB 4C1NA 1PFGA 2HAEA 2E55A 3RVLA 2Y77A 5FTKA 4ARIA 1J56A 2C2WA 2NWQA 2R6JA 4YPVA 3GJXC 2GKGA 1GFZA 2I2DA 5JV5A 4AX8A 4WADA 1ISIA 1NP3A 1OWMA 1BGXT 1IQRA 4OHZA 2C84A 3WLSA 3QU2A 2HOQA 2Q3BA 5AKKA 2CN1A 2Z0MA 5DHAA 4D6PA 4ZICA 1EZ1A 1BS1A 3IQXA 2IYRA 4MGEA 4TM7A 3M6XA 4UC0A 4MPDA 4JL6A 5IJ0A 1K8XB 3C4QA 1V45E 3TJMA 1T0IA 4FKZA 2FOLA 5U1PA 4BKMA 3ST7A 4I3FA 2YXLA 4D7AA 5TX7A 2HB6A 5DVZA 3L7DA 5IANA 3DQPA 4XGQA 1YBHA 3UJ6A 5ALWA 3AW9A 3FDXA 3PXBA 4L27A 3HDTA 2DECA 4AWXA 4BO3A 3G5LA 1Z7BA 2ANCA 2XBUA 4IHJA 4WZZA 4MUHA 5LC1A 5HIIA 4G5YA 3KSZO 2P3QA 2EF1A 5DHSA 5FUVA 3UK0A 2FYTA 3WICA 1ZBQA 4ETMA 1ZFNA 3GNLA 4I1YA 2BFAA 3C5HA 4G1CA 1HWYA 2GCNA 5EKTA 3TLJA 2FWIA 3FKSA 3N2IA 3OJCA 1YZGA 5TQVA 5IH7A 2V5AA 3PUWA 4RGQA 5AKGA 1ZD8A 1EVIA 1NF9A 2Z8XA 4MV9A 4QEDA 2X42A 4CTMA 2I8LA 1L4NA 3FPLA 3OZGA 1YRLA 5G1NA 2CT8A 4GGPA 4BFLA 1Q7TA 4XI9A 1HFEL 4DRXB 2E4VA 1HI9A 1P80A 1KAQA 2XA1A 2H9YA 3O5AA 3V1UA 1ZQ9A 3SSOA 1N7JA 2OBBA 2YIMA 3MTBA 4RJIA 1Y63A 2CUTA 1Z38A 3BCSA 4MYCA 3ZWDA 4F06A 5SZHB 1JGTA 1GUZA 2X1MA 4B81A 2FCAA 1FRVA 1DEKA 2R6DA 3UKOA 1C0KA 4CMCA 2VDKB 3IBYA 4OBBA 5JFOA 4UBLA 3ZHZA 1DXYA 4DYDA 5JALA 3EWSA 4R7GA 2X3YA 5AI0A 3W6UA 1P4JA 3DEZA 1Y5NA 4QDZA 5TEWA 3MF4A 4J16C 2FEPA 1UDAA 1LGYA 1UEJA 3KT8A 3NBQA 5BP7A 3FWKA 2AFVA 2J32A 1I5EA 4LXGA 4RQAA 2B7BA 3NBMA 1NW5A 3KLBA 2VZEA 4C1BA 2O4UX 1OQAA 4MRMB 3UUEA 1E2UA 3F73A 2AC7A 3NTQA 1U81A 2E37A 2ZPTX 4K0RA 2B8EA 1P0QA 2WMYA 3AR5A 5DYTA 2GPWA 1F9EA 2WTNA 1V3QE 2G09A 1XD2A 3IHWA 5G40A 4CHTA 1CE8A 2EP5A 3BFKA 1XTKA 2I1VB 2IF2A 3BXOA 5AWFC 1JHRA 3NWJA 1KFEB 4OGGA 3ILHA 5DPMA 2L19A 4UHDA 4XRGA 3BCUA 3MXTA 3PVSA 4YAEA 3VZBA 4W5OA 3DAGA 1THZA 5HTOA 3HXLA 4K9DA 3FHLA 3H9QA 3OC0A 5EWLB 2ZTVA 4B75A 2Q5JA 1E4EB 2BZ0A 5FT9A 1QRTA 4B9EA 3VPHA 3DFIA 1ESDA 1LBIA 2DOKA 2PJZA 1XTJA 4MP8A 4Q4DA 3BMQA 4ILKA 5DASA 5FP0A 5DNEA 5IDQA 4TKUB 3SCZA 3ZU2A 4AYWA 4ENWA 2RK4A 2XYVA 1WL8A 5DXJA 1YUNA 2Q3FA 3FSGA 5EY5B 4NATA 3FSGD 3BMCB 3ZY6A 5DYNA 2PZFA 2DFDA 2VUHB 3CE6A 3EXHC 4MGYR 3RD5A 4CMBA 2VBGA 2G88A 3D4LA 4HT3B 4N39A 1QYWA 4R3WA 1F3LA 5EJIA 5EWJA 3GB9A 4B3FX 3ELUA 3H5OA 1M34A 4JLPA 4MVYA 1LBHA 5E2IA 4YYZA 2XZDA 1QU3A 4IIVA 3I2JA 3LNTA 5I45A 1J7JA 4F8YA 1O8BA 4JJAA 4LE2A 1LLFA 2ZRGA 1BXZA 4M9XA 3R4CA 3H6KA 4K3UA 4RYLA 5EG5A 1Z8HA 1L7XA 3ZI0A 3EQZA 4ZARA 3R3JA 4ZJZA 1WXIA 1L8QA 1PX0A 2G71A 2WFZA 2ZRAA 4INZA 3NHZA 1PP4A 4KFRA 3MT7A 3OICA 4PO1A 3KR1A 2D2XA 4TYPA 1NF2A 1P5RA 1R16A 2YH2A 4LJ9A 3HB9A 4UZSA 3K1TA 3UJBA 4ZYLA 5KYKA 2HHHB 1YXMA 2ZSAA 5KOJB 3NU1A 4R8SA 5I4KA 3W06A 5F78A 5AXAA 4HDNA 1SHTX 2J4FA 3MNFA 4O2BF 3CGGA 5JOQA 5KYUB 5C31A 4PN7A 2BGUA 3R3HA 3THSA 1G1AA 3Q8XB 5KDDA 1G64A 4EITA 4NE2A 1E3LA 1GZSA 1G2QA 1YGYA 2GM9A 2YZKA 4YWJA 3VR2D 3AUFA 5L4LA 1T2UA 1YOVB 2YBEA 1FXUA 1R0BA 2FVXA 2GKOA 1LPMA 4CIXA 5HOQA 5JD6A 3DO8A 3UPTA 3QFTA 2DU8A 5EJGA 2QLMA 4P82A 2RKBA 3K09C 1A9ZA 4CYMA 3ZK8A 3OAAA 1P2UA 2VF7A 3A25A 3OAAD 4Q15A 3DCJA 3WYFA 1WCIB 4Q9HA 4IQ8A 4RIFA 5CDFA 2IU3A 2OTCA 3SICE 3CR8A 1WCXA 1T8UA 2OHFA 3I9V6 1UK6A 3K15A 5ENZA 4HDQB 5CLGA 3OE5A 3TZHA 2Q6VA 3W9UA 1MO2A 3JCZA 4UMDA 5JS6A 4X61A 1BXRB 5KSZA 4DB2A 2A5GA 3A6LA 1U2DC 4HL6A 5TVGA 2PS1A