5ARCA

Cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASCNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative Bio-Metallic Selectivity in a Tailored Protease Enables Creation of a C-C Cross-Coupling Heckase
rcsb
source organism Bacillus lentus
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
total genus 102
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5arcA00
1TM1E 2SICE 5JXHA 3TI7A 1YJCA 4FONA 2ID8A 1MPTA 2W2PA 1SIUA 1R0RE 2DQKA 1T1EA 1V6CA 2PWBA 5ARDA 1GTG1 1NLUA 3QFHA 4NE9A 3VHQA 5B1EA 1KE2A 3OSZA 5AVJA 1Y3DE 3QMPA 1R64A 1T1IA 3BPSA 3QTLA 4RYDA 3AJ9A 3HJRA 4HVLA 4YN3A 3I34X 3EIFA 1XF1A 2V8BA 1DBIA 1Y9ZA 1Y3CE 2DUJA 2XRMA 3T41A 4ZOQI 3F49S 3DDZX 4CFYA 3DW1X 3VSBA 5K7SA 4DZTA 1KDZA 1DUIA 1OYVA 2ID4A 2ZWPA 1SCDA 2Z57A 3DVSX 3VTAA 1SIBE 1PTKA 3LPDA 1SBHA 4M1ZA 1BFUA 5FBZA 1S02A 1WSDA 1C9JA 3A3PA 1P7VA 4LVOA 2X8JB 3AFGA 5JXJA 2Z2XA 1SUEA 1TM4E 1GA6A 2W2NA 1S01A 2W2MA 1GNSA 3I2YX 1TM3E 5I9SA 1OYOA 1SBIA 3DVRX 1KE1A 5JMOA 5JXIA 1TK2A 1SBTA 1KDYA 1P7WA 1IAVA 2Z2YA 1TMGE 4Z2AA 2Z56A 1Q5PA 2PRKA 1SN7A 1SCAA 3P5BA 1WVMA 1BE6A 4ZARA 1V5IA 2G4VA 5B1DA 1GCIA 2SECE 2SBTA 3DE4X 1BFKA 3BX1A 1Y48E 1BJRE 3D9QX 1NDQA 3AJ8A 3A3OA 4H6VA 3PTLA 3DE5X 3TI9A 5ARCA 1CSEE 2W2OA 4H6WA 3SICE 1AU9A 3I37X 1SBCA 2WWTA 3EE6A 1Y1KE 2QTWB 2W2QA 3LPAA 1EA7A 1NDUA 1SCNE 1SH7A 1YJAA 1ZVJA 2PWAA 4NE7A 2PQ2A 3F7OA 1KDVA 2HPZA 1GT91 4AKTA 2IY9A 3WIUA 2TECE 3DE1X 1PEKE 1PFGA 3DW3X 1IC6A 1ST3A 2WV7A 2PKCA 2ZRQA 3DYBA 4OMDA 4CFZA 2PMWB 3DE6X 5FFNA 5AMXA 1SIOA 1TO1E 2Z58A 1R6VA 4WOBA 4J94A 4WOCA 3WHIA 4BWGA 3DE0X 3DVQX 2ST1A 1HT3A 4KPGA 4KB5A 1Y33E 1CNMA 1GA4A 1EGQA 1SBNE 2SNIE 3A3NA 2PYZA 3DE7X 1GA1A 3CO0S 1ST2A 3EDYA 3L1KA 2GKOA 3BGOS 2X8JA 1VSBA 3GCWA 4C3UA 1S2NA 4DWWA 1A2QA 1TM7E 1P8JA 2Z30A 3DWEX 3CNQS 1SVNA 5FAXA 4AKSA 1SUAA 2Z2ZA 4C3VA 1Y4DE 1TM5E 1SPBS 2E1PA 5CW1A 1AQNA 1UBNA 4B5LA 2DP4E 3H42B 3VV3A 3UNXA 3DE2X 4GI3A 1SCBA 1AK9A 2WUVA 3ZXXA 3DE3X 1C3LA 3D43A 1Y3FE 1Y34E 1GTL1 4K8RB 1AVTA 1YU6A 3TECE 1SCJA 2B6NA 1WMFA 4HX2A 5JXGA 3I30X 3LXUX 3ZXYA 1TECE 1BH6A 4DJ5X 3LPCA 1SELA 5ARBA 1C9MA 1JEAA 1PJ8A 1WMDA 2ZWOA 1AH2A 1T1GA 1Y4AE 3GCXA 4I0WB 5AVKA 3VV2A 3PRKE 4KG7A 2HD4A 1MEEA 1GNVA 4NMXB 1YJBA 5SICE 1BE8A 1Y3BE 1AF4A 4H6XA 5AQEA 3GT3A 1WMEA 4OMCA 3WIVA 1SUPA 1ZVKA 1SUBA 1AV7A 1SUDA 4MZDA 4OV6B 4LVNA 3SQOA 1OT5A 3VYVA 3Q40A 1C9NA 1LW6E 3WQBA 2IXTA 4CG0A 1TO2E 1THMA 2XTJA 3F7MA 3GT4A 2P4EA 4JP8A 1GTJ1 1SUCA 3Q5GA 2WUWE
chains in the Genus database with same CATH superfamily
2GBCA 2X22A 3KKQA 4MI1A 3TK1A 4LY6A 5FTWA 4IWNA 1N2OA 4FOPA 4UEKA 5ALLA 5T4BA 2XCIA 3RU7A 3VISA 4BASA 1T0UA 5JYEA 1Q3HA 2WRZA 4HQLA 1FRFS 1VJ5A 5LIPA 1T34A 2HA7A 3LF1A 4K9SA 3R4CA 3TNJA 3CLKA 2G8LA 3GFVA 4TV9B 5EI5A 1WCXA 5G4KB 2VXYA 3CWCA 1GPBA 1FLVA 4CN8A 2IYZA 2YXEA 1L7DA 5HQ3B 1NT4A 5E0OA 3DDUA 5U4XA 1PZFA 5JSZA 2BLLA 2Q3JA 1UDWA 1P2TA 2RHDA 3QA3E 1YGYA 2GPTA 1C3XA 1E79A 1NXPA 5TR9A 2IS1A 1JYFA 4HUJA 4D26A 3WA6A 1QGED 1E2MA 3IP5A 4NESA 4OPMA 3KO8A 4YH1A 1Z4LA 3H75A 3OLVA 5EHNA 4XQ9A 3K4QA 4V0MA 2VZ9A 3OT1B 3GFQA 1UKBA 2PKYX 2UVPA 3TAXA 3UWKA 2X86A 4OGKA 1AQUA 1HE4A 3VTFA 3OQVA 3EX7C 1M34B 3MW8A 3T5CA 4ZK2A 3FTCA 4P84A 1O6BA 1PVVA 1JWBB 4URVR 2C7RA 3HBMA 4AN0A 4EYOA 1JE0A 5FKJA 5AUOB 4ZYWA 3MJFA 4PYRA 4I1SA 3GG9A 3AEUA 5EE9A 2EHDA 5CCEA 2AQKA 3SQNA 4NE7A 1PR6A 4DCSA 2Q4RA 3Q12A 3TZLA 2EW2A 1EI9A 2Q49A 1KAEA 5CFOA 4DRYA 2KWIA 3ZV6A 4YJ2F 3B3FA 2A2ZA 1X42A 2P62A 3FPHA 3PGKA 1ODTC 4B3CA 5CVTA 3BGSA 2W6ID 3IJEB 4KAXA 2RAUA 4ZCIA 3O03A 4IOLA 3CCFA 4RAOA 2FSVA 1RC8A 3HMQA 3KJQA 2H52A 1NYRA 1QFXA 2AFHE 2E2WA 4IEFB 5CXUA 3S8EA 2RCYA 2W93A 3M1YA 4U7DA 2OHGA 2C7QA 3FYSA 4M1KA 4NOMA 3EQ8A 1JEOA 3CB2A 1DWQA 4ZOEA 1L5RA 4V03A 2YMQA 4CKBB 5D1NA 4LKRA 4AUKA 4ENRA 1NN1A 1YQGA 2AR0A 3E05A 2QLMA 4O5AA 1ZAKA 4YMUA 1UUFA 1AO0A 1JHPA 2PD4A 5K0TA 3HN2A 2UUCB 3G1WA 1D04A 1YBFA 3QY0A 1Y3FE 4W9RA 2FQWA 3ABSB 2H1FA 3AFOA 5KYVA 1ESMA 4ISCA 2K2QB 1D6SA 1YACA 2X6RA 4KE6A 1ZDMA 1TECE 4R9RA 5CNJA 2JPDA 5EWJB 3V1TC 4IS2A 4Q34A 4X1IA 1ECFA 2TYSB 5HR5A 4TOIA 4F9GA 1N25A 3WDKA 5LYJB 2QMYA 2QN7A 1QJ4A 1X7YB 3ENKA 3DMPA 1JFFA 1CQIA 2XZTA 3AHJA 2C7OA 2O2XA 2ORVA 4H6XA 1YB1A 1RQNA 1CVRA 2C42A 3GAMA 3L0BA 2Q4BA 4KTVE 2WJ3A 1L5NA 3ZHTA 4AJLA 4KOAA 4KQKA 5KYUB 4FS3A 4PZPA 4G0YA 4Q66C 1CUGA 1QIMA 3R9IA 3JQPA 1XK7A 5C7OO 2Q21A 3K0HA 1HFWA 1RI5A 5LQJA 3ZK7A 3U4QB 2G06A 2LCFA 2WD7A 3BYZA 4LNUB 1T2FA 2FR8C 3R6TA 1ODIA 4O2AA 3CNEA 1EK6A 4RMNA 4B3SB 1EWTA 2BFBB 1CYEA 1T5OA 1BVRA 4EUSA 1ULTA 1ZM7A 3EFOB 3HDQA 3LUBA 2QRGA 2W58A 4AVYA 2ZPUA 4PHHA 3IDSA 1T5DX 2QTZA 3M4ZA 4U8HA 4X20A 2ZAMA 5IN5A 4ER6A 2IZ6A 3L6RA 4L2IB 4BLTA 5J4LA 1ZOOA 5KJCA 4BE7B 3JPWA 1R6DA 1SBHA 3IKLA 3UUEA 1M1XB 3ZVLA 4EDHA 2G28A 1YR6A 2RIRA 3DTVB 4G81A 4JVLA 3HI6A 4LOIA 5CNIA 4ERNA 5C8XA 4BNMA 4XIYA 4Q9DA 1BWQA 2XXJA 1P2UA 4MR7A 3V7FA 4DNFA 4EJ6A 1UFKA 4JX9A 1ZOPA 4P3PA 5DW3A 1LJ8A 2I3ZA 4FC6A 2WKWA 1G16A 3E9RA 4RVGA 4U7JA 3W5VA 4IDOA 2GN2A 4TRRA 1G8JA 5F78A 2YXNA 3EIUA 3P27A 2BUCA 3ZWOA 4WKNA 5AYVA 4R2MA 4WFKA 3MHPA 2ODEA 1VE6A 1DKQA 2Z2KA 2FPSA 4H16A 3K0FA 4A0GA 4YX9A 1T9DA 1QV9A 2DKFA 2J9GA 3T7SA 1YCHA 3PUYA 4PSKA 2EFEB 1P5ZB 1XA4A 2K2WA 4KNWA 3WK4A 5ALFA 3VZSA 4EJSB 1Y1KE 4BDTA 4N5DA 3VR5A 4Z7NB 4IY1A 1C14A 2I34A 3NHWA 2WD7B 2ZM5A 1QK5A 1WMAA 4KJXA 2I9KA 4R5HA 3WGQA 5IJ0B 1SQ6A 1VHLA 2HL6A 3RUAA 3Q5EA 3WQSB 3KG2A 1O89A 3C4VA 2R751 4HR7A 3WRVA 4LF6B 2QI9F 1SGWA 1TKCA 2NNLD 4QZVA 3T1VA 1S5PA 1HO3A 1UDAA 4KFSA 1Z4KA 4M9QA 4MEJA 1Y33E 2LPMA 1E60A 2JBAA 4Q9KA 3HSKA 2PT9A 5M3BA 3ROEA 4KR6A 4J75A 2A0XA 1OAKA 3FBTA 3O4IA 1IN8A 4Z86A 1ZJWA 3LQQA 4KV7A 5DSTA 3PPYA 2XQFA 2FFRA 1LK7A 1WPQA 2DF8A 3ECCA 3PFFA 2ZJ0A 2B7BA 2J08A 1O9BA 2RC5A 1LEHA 1A8SA 4F56A 3OHSX 3ZWQA 3E0XA 1EP3B 1D4ZA 1IEXA 4Z9YA 1P6XA 4F04A 1XN1A 2WFZA 4XW2A 4JQZA 2ZYTX 1GHTA 4ZOLA 1AQIA 2CB9A 3I58A 1ULBA 4Q1FA 4U2CA 2O8EB 4GZMA 2OHXA 2JGMA 4C0LA 3E22B 3OCUA 3VTKA 1RWVA 3ZHZA 1CV2A 1EXDA 1AXRA 1VL8A 2RAFA 1LPOA 5JTUA 4BLWA 1SUIA 4GXTA 3TW8A 1GKLA 4O4HF 1BQ4A 4ESOA 4WNAA 2DEUA 4JJIA 4QYIA 1SRRA 2G8NA 4TV8F 2QM0A 3GJTA 1UAGA 4TWBA 1THTA 3BDVA 3D7NA 4ACBA 1UK6A 3KNZA 3LT5A 4GC5A 1KIFA 1N1DA 1P1RA 3AESB 4N8EA 1C9NA 4PFJA 5CK5A 5DHAA 5F4ZA 3F7MA 3IVAA 4GDMA 4BNYA 4BGDA 2R11A 3C7AA 3VDRA 2OCLA 3TL2A 1BKDR 1GTJ1 3G0BA 2HRDA 2MYTA 3Q5GA 4NJEA 4UE2A 4DV0B 5K51A 3K1ZA 3KM0A 3OIUA 4LQCA 3VYRB 3GIWA 2GVDC 1MPTA 2PUAA 3PPWA 3EY4A 1W36B 4Z4IA 3X2SA 5LKAA 1VSQA 2R4UA 2I4MA 2IYPA 4PZCA 5H81A 2Y71A 2RBKA 3O4FA 3QMPA 2AN4A 2XOKA 2QUJA 3AV0B 1PNOA 3Q3HA 3TOZA 5D01A 2IY7A 3I34X 4BO8A 4BCBA 1M2JA 2OXRA 2B1JA 3QEOA 3PQ6A 3VC3A 2QROA 2ZZMA 2HA0A 2TS1A 3JSAA 2C61A 3OUUA 1D0SA 2ENUA 2RHCA 2QPOA 4G9GA 4PGGA 4QC2A 3SXUA 1FJGB 2QMUA 5H9WA 1N7IA 1TKBA 1YJ8A 4BKRA 2RMKA 4PLCA 1N6KA 2WICA 1GSIA 4XZ3A 5DPMA 1WSDA 1W35A 1XDSA 2Q0QA 1J8YF 4G8CA 4W5RA 1PTJA 4ND8B 3SX4A 3LLSA 1QM5A 3ETCA 4RV9A 3W8FA 4YPOA 2I33A 2V7QD 3SS8A 1SBIA 5H4GA 2Z83A 4TKZA 3ORRA 4HATA 1BRMA 3T0GA 4C87A 3I2KA 4HBGA 3ROKA 2VWGA 3E18A 1FP2A 5JBIA 1RKXA 2WTUA 4B32A 2ZI4A 2QZ9A 4KW7A 1IUNA 3A6GA 4WCFA 4NBTA 2O3QA 2AX4A 4FQ8A 1MO3A 4OA5A 6LDHA 1L8QA 1TJ3A 5CBPB 1H5QA 3L49A 2OV4A 5HTOA 1J2JA 1ZI6A 3D8TA 1NM5C 3SDBA 2ASEA 1UC8A 1V39A 2YVLA 3BSSA 1MOPA 3D54D 3H1FA 3C1AA 1PX2A 4RA6A 3QXGA 1RXCA 1D7OA 1HZZA 4CT5A 4C01A 2NXJA 3UAZA 4DRXA 4EX6A 5L3QA 1RLTA 4CL0A 1T6ZA 2VSQA 6Q21A 2O1EA 3SZRA 3D5EA 2OGWA 2M6LA 2YZMA 5LXTF 2H2HA 4KRFA 2Q5EA 1ORHA 4O33A 4DNOA 2NP7A 2KSQA 2CT8A 4FHEA 4MI3A 3WLNA 2XOXA 1XCJA 1UZMA 2GKOA 3QKSA 3SSMA 1Z4JA 5FP0A 3FGPA 1DWUA 1QGDA 4IV5A 4ZU6X 1JI0A 1IE3A 4LHXA 4J7CA 4COKA 3OD1A 2Q0HA 3D7LA 1UBNA 1KEVA 4UPDA 3T61A 1C7QA 4EPXA 4C4YA 3EPPA 4KR3A 4BV9A 3UC5A 1IB0A 2C5EA 4ADSG 1Q6ZA 2GZRA 3EAQA 3KT0A 5LJLA 4CUKA 3PDIA 4D57A 3BK2A 4NYIR 1WZ2A 1H85A 2B61A 3SX2A 4PQGA 1C3OA 2VHTA 4ITRC 3OVMA 5LQDA 1LC0A 2AZTA 2V4UA 2NVUB 3SXJA 4MW1A 2H85A 1P3DA 4DY4A 1AMNA 3K1AB 3OECA 5CJ2A 2DCMA 3TRKA 3WS7A 2QRZA 3ZLUA 3N6VA 3F96A 5DIZA 3WIVA 1E6CA 1PGOA 3B8HA 2AOVA 3G9UA 1JPNA 4J6EA 4QJ5A 2GN6A 3K35A 3SYNA 4W82A 4CMAA 4CUJA 1LW6E 2O8DB 2GXUA 1AKWA 1T3SA 3QMVA 3RS8A 4NBSA 3GLHE 1ENZA 1CZUA 1K88A 3MOGA 5J2TB 1D8AA 4CVNA 4I6GA 1LBHA 3WWZA 5TXGA 1JDPA 3D4LA 5EHGA 2V3CC 2VTVA 3JRNA 5KB3A 1GTVA 1H4TA 3PQ7A 5BRAA 3DG9A 2EERA 1MMFB 4LF8B 3AI2A 2RH9B 3OSZA 1C81A 2VHEA 3QFRA 4AMBA 2ZJBA 5JASA 2A35A 2WHYA 3AJ9A 1U7WA 4G65A 4JQOA 1FTNA 1UQRA 2WSSD 1Y9ZA 4LY9A 2X0KA 1E3TA 3L01A 3OIYA 1HUQA 3ECSA 3FMFA 4XTCS 3PQ5A 2IOFK 5KNDA 1KOGA 2HU7A 1QH1A 5FOSA 1KDZA 3FY4A 2NZXA 5FA5A 2DBZA 3RUEA 2XD9A 2IODA 2GK6A 1Q20A 1CUCA 1SCQA 3TEFA 5J47A 1FXSA 4IDEA 2XT0A 3DZHA 1A9SA 2AQIA 2FUEA 2B78A 1CUZA 1UK7A 4EFNA 1EG2A 4B6FA 1ZGJA 1ZHHA 4BNIA 1VMKA 1DTWA 4ZOLF 2OHOA 2EBFX 2IUTA 3UYKA 2YVQA 3AKEA 4NQZA 3DFUA 1IMJA 1M5RA 3RVRA 2VP3A 3ORFA 5FLYA 2JS7A 1DRKA 1K6MA 2VRCA 3BMNB 4L6AA 1K2VN 3NZEA 4MGYR 5CT6A 4ER3A 5SZHB 4ZDJA 2DLCX 2QD2A 2LKDA 3A4LA 3RC3A 4YJDA 2R2GA 2LNDA 3WMRA 2BL4A 1X7HA 4QARA 4EI8A 1M34A 5IZCC 3RYCB 5H3HA 3ZWKA 1ADBA 2JZNA 5EZYA 3HNRA 5L51A 2GXQA 3D5TA 3IL2A 2PGXA 5CX1A 1MC1A 4QJIA 3BJZA 3SYTA 3E3MA 4YIHA 2I67A 4RCVA 5G0UA 1DAOA 2IQ5A 2QE7D 1F2VA 2QI9C 3WNVA 3RJ9A 4XR9A 4DSZA 3PJRA 1SU6A 4GLLA 3ON5A 4PHTA 3S70A 1CQJB 1V3QE 4QHYA 3Q8KA 3UVEA 3L5OA 4HGYA 2FPGB 1MA3A 4I8IA 1W73A 3IIEA 3LJKA 1PEAA 2R7LA 2FN9A 3P7MA 3T3IA 2H4ZA 3ZDQA 4PPGA 1O4WA 1UBKS 5DGIA 2NAFA 1J5EB 4PQEA 4UEJA 1A5TA 5DOVA 3CF0A 3T8YA 1XLUA 4RL6A 1I1NA 3UNXA 3DE2X 3CPSA 2Y0DA 3P97A 2XZDA 4TSKA 5FBLB 5K0GA 1TTHA 3CIOA 4JODA 3TH5A 3C87A 1QHHB 1NR5A 3SS7X 3CLSC 4ROSA 5DE3A 4DCTA 2I80A 1JKFA 2C8VA 3F5MA 5G40A 2YNMD 1DARA 1SMKA 2H9IA 1LTHR 3LQKA 4I4CA 5EQDA 5FHRA 3SIWA 4PCUA 4UMEA 1QZUA 2CY0A 1DBVO 2AG8A 3V4FA 4A8JC 4AJEA 4MGZR 3AO0B 5LQRA 4KQIA 3FB1A 3GFBA 1JU9A 1E2NA 4BZXA 1Y4SA 4GOXA 5FWAA 4D3DA 4ZN6A 5IM4A 4BWVA 5C5DA 5DGTA 3QY9A 4J0FA 3WLEA 1QP0A 4WJLA 3FPEA 1PZXA 1XXHB 2WJJA 2DSNA 1S8NA 2FWPA 3ZTYA 4CQMB 4L8WB 4XPZA 2HN9A 4G23A 4NOKA 5FOTA 2RD2A 1IUPA 1VLQA 3RANA 3HKEA 1RAGA 1QUEA 4DBLC 2JDIA 2ZRJA 3P9RA 2GDJA 5K8LA 2AE2A 2AI2A 3RSLA 1C4XA 2J3EA 4JUIA 2OENG 4YAOA 4EABA 5ILQA 1ACMA 2W6IA 1A4XA 4DEXA 1J0DA 3VHQA 4AJJA 1TTQB 4RZIA 2ZEJA 3I52A 5CEEA 2OOKA 1T4BA 4PV7A 1DOZA 1HQKA 1IY2A 4UZSA 4YUWA 4US2R 5LOVA 3H86A 1XWWA 4RSRA 4B81A 2FEWB 1Z62A 2ZYDA 3P9QA 4Y6OA 4Z0TA 4MUGA 1KETA 2NUPB 3DW1X 2B98A 2JGDA 4JL5A 2DVMA 3VTZA 4P53A 5E6UA 4EYGA 1EX1A 4KITB 1RYBA 3OZXA 3TNDA 3TZKA 1NWCA 2CJPA 4U5QA 1E4OA 1X94A 1P5FA 2A5GA 3SJCA 5JH7F 4DR2B 3IR7A 5ADVA 2V4ZA 3KT3A 2CLKB 2GETA 3DZCA 5ADWA 1R3DA 4CKXA 1CPYA 3QKSB 5TJHA 4BQOA 2H2IA 1AB6A 2VEDA 3PDWA 1XZCA 1UODA 5CW2A 1KDYA 4E5UA 2PA0A 3A6DA 4EYKA 4BVFA 2VRNA 4DLYA 4XJSA 1FX0B 2W8BA 1F0PA 4NYMQ 3BB3A 3MMXA 4V24A 3VPDA 1M73E 3CA8A 4P34A 1BJRE 4PZAA 1Z16A 3RVMA 4BX2A 4U2GA 5CR9A 2VRWA 2XR1A 3U60B 3UAOA 1ZOIA 1NDUA 2YR0A 1UDRA 5H1YA 5B58C 2ETXA 2PT5A 4RESA 3E7XA 1L1FA 5IVKA 2GLXA 4N7MA 1U0HC 4INZA 4OTZA 5DNDA 5EJEA 3H8WA 2O8FB 1Z7YA 1EWRA 1PEKE 1U0JA 5L9AA 3A10A 1IZZA 3GZJA 2VZ8A 3IB3A 1Z5PA 2G7ZA 2IXGA 3B1WA 3PS9A 4KDFA 1W30A 1DAKA 4IF6A 4FOOA 3WMWA 4B80A 5LWQA 4MGHA 5FBWB 3DMYA 4RVUA 4YCMA 2CNNA 3PC4A 4IIJF 2H00A 3B3JA 2QBYB 2VS1A 5DU2A 4ZRMA 2JKYA 3KSZO 2J7KA 4MGIR 1R66A 2SNIE 1JP7A 1KKUA 2Q8NA 2WSLA 3LDHA 3IR5A 3RR2A 4RPHA 5J5AA 5LZ2A 3DCYA 5EIWA 4L5JA 5CVUA 1P8JA 1RI1A 1UH5A 4I5DA 4OU4A 1BD4A 2NXCA 4MWBA 3R7DA 5K0ZA 121PA 3IT1A 5ISMA 2R1VB 3INGA 3FCOA 4XQGA 2ARKA 3MRXA 4OSEA 3AUUA 5L7YA 2VJKA 3OJCA 2DHQA 1RIIA 1Z88A 2BW0A 3ZXYA 4BO3A 5A9SA 5C8DA 2FH5B 3E7PA 3Q7EA 5BNZA 5T4EA 1OB5A 2D13A 3AKYA 1GRRA 2GEVA 4X8OA 5BOSB 2IE0A 3LW8A 2PR7A 3FHJA 2QK4A 1JXOA 4IOJA 1F2UB 4OG2A 5CX1B 2P77A 5DP1A 4DG8A 4F7WA 2GVNA 3KTAA 3TPCA 5HVNA 1EFTA 3VM6A 3DBIA 2V4MA 3IYLW 2DT5A 1XD2B 3AM3A 3OC6A 2JJ2D 5DXAA 4CG0A 4DG9A 4WL0A 1BZYA 2D5IA 3REGA 3FPGA 3Q3GE 2P4EA 1DXYA 1UZLA 3I09A 3DAFA 2OV6A 2ZUBA 1RAFA 4PCLA 4WERA 4A5SA 1JDBC 1USUA 3G5LA 5JJIA 4Q1BA 4NU8X 1YJCA 1XMSA 5ECDA 1YR1A 3BXGA 3D2BA 4UUBA 4W63A 4Y1RA 1DGQA 3UAGA 4J76A 1N6HA 2B4YA 2GAAA 5HZMA 3BIXA 3GIDA 4YRGA 3GVHA 4DILA 1PJQA 5F52A 1A7AA 1K4MA 3BILA 2WPNA 3DHWC 4FWIB 4A6EA 1RJWA 2AJBA 2CN1A 4GWLA 1SXGA 1UC9A 4JGBA 5K7SA 4BLSA 3OCJA 5BWLA 4QO7A 1E6MA 1NW8A 2YIMA 3B2EA 4IIHA 4RK0A 5BQ5A 1T3GA 1NE2A 1IWOA 1JH9A 3W6ZA 2X8JB 3F8TA 4AURA 1F14A 3BGWA 4CT4B 3B60A 1JNXX 1R12A 3LBNA 3H9EO 1K63A 4RY8A 3VKVA 4K6OA 4CCYB 5DM70 3RW9A 2HC9A 1T9GR 3BIJA 3OEHA 3UFBA 2WM8A 4L2IA 2A3NA 1M1YE 1V5IA 2V7VA 2WU8A 3IHTA 4DIFA 1VGVA 3NTXA 4PN3A 3QSGA 3TRJA 5A03A 4IHJB 1UZUA 5ANRB 4P2BA 1P91A 4X66B 2WQ7A 1VJCA 3ZHUA 3I64A 3J7AC 2IFTA 3GGPA 4HTAA 4S1PA 4D44A 1K7EB 1SU8A 3K0KA 3GX1A 3M34A 5CDTA 4KIFA 3JAWB 3MWFA 1G7RA 1ZVMA 4ZI7F 1ES9A 2PH1A 2AHRA 4QRHA 1JAYA 1L3CA 1QPZA 4RF5A 3ETHA 4MWCA 1LPAB 1OZFA 5ULLA 1U65A 2ZDGA 3EGDB 4TLBA 5AVZA 5AW6A 5JZ9A 2A78A 1JG7A 1HT2E 3TO5A 1JMKC 4RX1A 3RBAA 1IOVA 1RWPA 2GTHA 4PBTA 2PNFA 3TBKA 5KNLA 2XTZA 5HHTA 3TGPA 2WAMA 2PSJA 1JVBA 4MARA 5DN6D 3KAPA 2Z3ZA 1DC8A 5E8RA 3VOAA 1I3CA 3VR3A 4R2HA 2G1AA 1IJFA 1RBQA 3AERB 4UBJA 4JI7B 1B93A 1RVDA 2YL2A 4FTWA 2VUHB 1SD5A 3QGMA 3KAJA 4QUEA 2GM5A 1S96A 2Q9UA 3E9EA 2QL9A 3L0DA 3Q7SA 5FR2A 4YWJA 1E2HA 1MABB 4AZTA 2ORWA 4DKXA 2XOKD 2MU1A 5A9SB 3RS2A 4Y1GA 1DEXA 1DTEA 2JFHA 2VFAA 2M98A 2WG0A 3LY7A 1J23A 1BHQ1 3KSUA 4ZCRA 4IO0A 1BH6A 1OLUB 2BFNA 4DJ5X 2BFCA 3NIGB 4TKUB 3RTAA 4YRSA 4ZJZA 5F23A 3JQFC 5JH7A 2HGZA 4FIZA 3PXGA 4FHFA 5AHOA 1AV6A 4J0CA 2ZB3A 1SKBA 5DNCA 3WL5A 1QHIA 4K8OA 1EFPA 4UQPA 4YBZA 1O9HA 5DP2A 3VSEA 4TTIA 4UVEA 3IE0A 3ROXA 1RWQA 5L7TA 5DYIA 1MENA 3G59A 2CMKA 3HKDA 2XRFA 2ZBRA 5IMSA 4Z9AA 2HREA 4DMMA 4PFQA 1I0LA 2ADFA 3RVLA 2V5VA 3U3JA 3AHGA 1ANKA 2BC9A 4G1MB 3BRWA 4JIGA 2EDCA 2JJYA 2Q5OA 2IDKA 3SJBA 2JI6A 4E07A 3AVWA 2QV7A 1GL3A 1PW7A 2CLFB 1LK0A 1DJPA 2CXPA 2DQSA 4XWTA 3NHUA 4AJIA 3TN7A 1DQNA 2RHHA 1GNLA 1QAQA 4FSHA 5EZYB 5D6OA 5D1HA 3M6WA 5IWAB 4REOA 1QS0B 3EIFA 4J43A 4CM6A 1KQOA 3KX2A 5EJ5A 3BF8A 3DC2A 5E2BA 5C4MA 1NSTA 1DV2A 3AY0A 1YVRA 3PGJA 4BN0A 1N5MA 2VH5R 1Z4QA 1R8JA 1Y1QA 3OO1A 5E4TA 1BFDA 1DWOA 5TVKA 3TW0A 5C51B 1UJBA 1QRTA 3F7NA 1BFUA 2HT1A 1TA0A 3EIOA 1VJGA 4JGIA 5C1PA 3PB3A 1V4VA 3I23A 3TQRA 1XUOA 2WG1A 5FI3A 5CD9A 1J6UA 1AKTA 1G21A 1TM3E 2C2HA 3RV4A 3WKDA 3A11A 4HPWA 1HFKA 2YTZA 2AOWA 2CXUA 2WV9A 1IPFA 4GYKA 4E11A 4JAVC 3HPQA 3GHHA 3M4JA 5KDDA 4Z4FA 3VR5D 1ISIA 4TQGA 3BKXA 3BJEA 1GGJA 3A6KA 1AQYA 4V1CB 2ZRBA 2OTCA 1ZWLA 1W46A 4CV2A 3P0IA 1KI6B 3NWPA 3UANA 2C0QA 5IU6A 5H9VA 3GVPA 1RQXA 3A1NA 3HBLA 4TV8A 2DZDA 2DUMA 3PG5A 4F8JA 2J0SA 1E9SA 3TX6A 1FA9A 1XLWA 4Z3KA 3T7AA 3VUFA 3FSJX 1CJMA 4BNGA 1ZN9A 2WSYB 2DGDA 4C07A 4ZQBA 1XVVA 3HVJA 5KBYA 1RFLA 5CRIA 4DNPA 1TQ8A 3EG9A 5JBNA 3MB5A 4KWIA 3PRHA 2H1SA 4EL5A 3NIBA 2R84A 5BMOA 1MXFA 1J99A 1O8CA 1NNSA 2GEUA 1UMKA 1U28A 1R0LA 2GHIA 2CE2X 2FG6C 3FYUA 4GXQA 4P36A 3GRVA 4G9BA 1ST2A 4OM8A 5DGDA 3J80A 2FEOA 1I4LD 3WJ1A 4GM0A 2FFQA 1EHIA 3BK7A 3WWCA 1V35A 3SBDA 1XEXA 4TSFD 5AVUA 1T1JA 1LRLA 1E0AA 3NBKA 4PQRA 1N5JA 3OAAD 2NVUA 5GIOE 3RRXA 1C4KA 2IYQA 5IAAA 3UHOA 3UBTA 3EVGA 4GP9A 3HCCA 3ADPA 3CF6R 1CUEA 3F46A 4NF2A 1AURA 3HB7A 4HKTA 4X0EA 1LPNA 1JA0A 2M2IA 1ORVA 2O2SA 5I3CA 1SC4A 4ZYYA 1R5JA 2LIVA 4M53A 3SLKA 3TZ6A 5FAKA 5GM2A 1TYDE 2BR3A 1KORA 3N2GB 2HRCA 1K8QA 3PI7A 5K3FB 4RF3A 3N76A 4MKZA 2FLWA 2YUIA 4DQUA 1DO0A 1U80A 1LA2A 1KFCB 1MB4A 3AETB 1VIMA 4WZZA 2W48A 3ENNA 3LOUA 4PLFA 3X1KA 2EW8A 3VU0A 4JR2A 4C2BA 2P67A 4XQEA 5AW1A 2W83A 3HNOA 4P5DA 5CYGA 5CFLA 1CY8A 2PVCA 4TV9A 1RM5A 3V6MA 3V4VB 3OWHA 1NF8A 2FZGA 3GJSA 2H63A 1TZ2A 3BXZA 2C2KA 3PX3A 5G1NA 5H7XA 5REQA 4EB6A 1NQOA 1SURA 2FEKA 4XYLA 2DBQA 1OC2A 3IQZA 5BQFA 3BPSA 1EQUA 2ZRDA 4TSFA 1I7NA 4M7RA 4RA6B 5TE9A 4L7QA 3MPUA 1GTRA 3LCUA 3L7DA 4YQFA 1A2BA 3LUDA 1GPNA 1V41E 2A6PA 2AOTA 1ESDA 2YJGA 4NMMA 4RE6A 5KJEA 4RETA 3ZBTA 2A4KA 3EODA 2DTDA 4B8YA 4FBLA 3T99A 4GSKA 1YA8A 1C8LA 3ISTA 4MCAA 2NU6B 3WKCA 1TPZA 4U7TB 3ZJ5A 4BO2A 4DR7B 1LDYA 4TTTS 1G5PA 2EFHB 5JXIA 2F9FA 5FO1A 3U1BA 4QT0A 4BFYA 1ODKA 3VPFA 2C98A 1LTKA 3TRFA 2YIVX 4E4RA 4HHEA 1H2WA 3OJEA 5KJFA 2D62A 1EP9A 1MB2A 1WEHA 2IYRA 4NCAA 2ES4A 4UAJA 1UPXA 3AONB 4X5OA 3PE4A 2A3RA 4EA7A 3U4QA 1YOVB 4GOND 4GOOD 4W5QA 1RWWA 2O0MA 2PX0A 3PU6A 3LUFA 1J70A 1O6FA 2VYFA 3FPLA 2VDVE 3RC7A 5CEFA 1L4FA 2XUHA 3PUIA 4O2BA 4PZZA 1C7EA 2UVQA 3I53A 5DNAA 3VJMA 4ER5A 2I4NA 2VPZA 5EP4A 1P1FA 5FRDA 1YI1A 5IF9A 4CGYA 4IXTA 4DY6A 4IJKA 4IJQA 1I3KA 1C8BA 1L4EA 2A1IA 3DL0A 3KD3A 2HMUA 3KYBA 3NOQA 5JAMA 3OTQA 1V8FA 1VJ1A 3IHWA 3GJ8A 2UYQA 5F2EA 4CG3A 2IV7A 3EDYA 1B1AA 1YV9A 4KUHA 3LVBA 4DMFA 2M6SA 1QRRA 4ENUA 1VLJA 3EQZA 2JGFA 2ZYIA 1CNFA 3CRVA 1N0IA 4I1RA 2O0JA 3VYTB 1YT5A 5ALDA 1ZSVA 1PVDA 1CDZA 3H5AA 1TJ4A 2B8WA 4B83A 2Q3MA 1JIXA 3Q3JB 3M2PA 3WRXA 2HJRA 3MILA 1RXSA 3O7MA 3U7IA 4GLOA 2X0JA 4DDUA 1L7OA 2FRDA 3TLYA 4YK7A 3T4EA 3OZSA 1YVPA 1V11B 1ESCA 2BJHA 1VM6A 4PAMA 1ZD9A 2CB0A 3I04M 4AB1A 1YDMA 3KFVA 1SELA 4MRMA 2VR1A 2WR8A 1RWOA 1RZRA 4EQ6B 5AJTA 2FV8A 2VBFA 3H2SA 4OIFA 2P9CA 2IU6A 3D8HA 3L84A 1PF7E 4KFTA 3AUYA 5DWDA 4M60A 1X7GA 5ECGC 2BHLA 3I9V1 1JRLA 1VG9B 4NMXB 3H0KA 4OKIA 4Q12A 5LZ5A 1TDJA 5A4IS 1BCRA 3QRWA 1M2WA 3C8DA 2DPXA 3M9XA 4EGCB 4CEIB 4IWYA 4DV1B 3F5SA 3DZDA 4KO8A 4P31A 2EEZA 3PLAE 4ZEVA 1N78A 3K4HA 1G20A 1WUKS 3A32A 2D0DA 2QVZX 1M3SA 4LHSA 5BWCA 4LWPA 3U4AA 2IC5A 3AEUB 4UCXA 3EJWA 5JS2A 5EHQA 2IUUA 3VC2A 3Q2KA 1I6MA 2QLBA 2SICE 2WJAA 3EVDA 1PDWA 3A6JA 3KLMX 3NI2A 5J5CA 4C0WA 3L04A 4QUIA 1GPDG 1TLFA 1I5RA 2PJUA 2XA2A 2JCVA 2OP0A 4L4UA 5CM9C 1RYHA 4AJ2A 4UJ3A 4MR7B 1LI7A 3AR8A 4UKDA 1YB2A 2ANCA 2JIPA 3A8TA 3U9SA 1AKUA 3NHBA 1SXQA 1CEYA 3V42A 4ZXFA 1ADYA 1X3LA 5JAUA 3DDZX 4P92A 3QLTA 3HWWA 2GRUA 2L17A 4IZHA 4MW6A 1P4JA 1YK1A 1KJ9A 1VPDA 3RTBA 1MFPA 2XI4A 2B2CA 3PDCA 4X6YA 4XE5A 5GGXA 3WDLA 4E1BA 4Z1MD 3GD5A 4DZZA 1IXZA 2GOYA 1QO7A 2P9JA 2BFBA 2R96A 4Q3LA 3ND6A 1E1QD 3WWPA 4AG3A 4CGZA 3EVNA 1OXXK 3VR6D 3PV0A 4BYMA 5K3OA 1N2XA 2G6BA 2ZE5A 4WUVA 4D5GA 2FSVC 3W9BA 3PT9A 5J2UF 1YB6A 4GOLD 1RHRA 1LFDB 3CBQA 4M22A 5EZ5A 5SZKB 1WAMA 4F6CA 2I3GA 3WYCA 2IEGA 3QBDA 4ESHA 3H5TA 5LN1A 2WJ4A 4ZVOA 3ISVA 4XYMA 1U7TA 5ADHA 2XCLA 1GSOA 1HFJA 2RHLA 5JJCA 3AKZA 1CS0A 3ASZA 4PO8A 2W2OA 1O0SA 1OMOA 4JKOA 4RJLA 2ONJA 3QFFA 3VR2D 1CF2O 3P2EA 4KPUB 5LNK1 2HCFA 3B1ZA 4IAOA 1KVRA 4M0PA 4EF6A 1GN9A 2C9DA 4JEIA 3IKVA 3TSOA 3WK6A 2K4MA 4AKTA 3SQMA 3JASB 4D45A 2EJVA 3DB2A 4JKYA 1U81A 2DH5A 3HR7A 4IG4A 1GQQA 1RBZA 4I1YA 4EY6A 1Y0BA 2O2GA 4ZK6A 4QEZA 4ZOBA 4PTYA 5L4NA 1OZHA 2WG2A 3DDHA 4QGHA 4LJLA 3E27A 4JLUA 4L9SA 3JQAB 1I4WA 1PN3A 4KAAA 3CLHA 3NHAA 5KKCA 3GWGA 4N0QA 2CUKA 1Z35A 2WJPA 5AUQA 3ICWA 3TUJC 3HLTA 3EQ9A 4YYZA 1Y6FA 3U13A 1A9OA 1Q50A 2FRXA 1L7VC 1X0XA 5TMBA 2GPNA 1W2HA 3CN9A 3WMEA 1ZEMA 3TSWA 1NVDA 4IVRA 4DT1A 2QUIA 3BT7A 1AM4D 3C8UA 4QUJA 5J4HA 2FPPB 2IUFA 3HZHA 3M3PA 2PCJA 4FDAA 4JFRA 4B4KA 2EZ8A 4BMPB 4TWIA 1Q77A 3E22A 4HQFA 3I9NA 2NZUG 4FFOA 4I4IA 4EATA 5KKAA 1EE2A 4G0VA 2J7PA 2GERA 10MHA 3LHFA 7MHTA 4H1HA 5HILA 5JCJA 4QQKA 4G6ZA 3F3KA 3N8DA 4G4SO 3OO0A 4OQFA 4MPDA 5JPCA 2V7WA 4Q9LA 2BCEA 4N5MA 3GEPA 4KGXA 3TMKA 4XGRA 5I01A 3COPA 1KGSA 5SYAA 1FU4A 1KK2A 2TMYA 3NDPA 2CLSA 2O2IA 3OBBA 4HDKA 2ZT5A 4I5GA 4MQUA 3L0SA 3GRFA 1RXEA 2HB6A 3R6LA 4D6PA 1XZBA 3BMQA 4BHTA 1Q19A 3QEKA 3ZLBA 4N47A 1DP4A 1L6IA 1XO1A 1HQDA 3LZ6A 1ATZA 2GN1A 2EKQA 4MIEA 3OIFA 5U1PA 1GPAA 4YCLA 1KMQA 1XTQA 2Z04A 1X9IA 3AF4A 1IAQA 1NVVQ 2XWPA 2YVUA 3DM9B 2YMLA 2QPAA 4XLTA 3RFXA 4F11A 1AA6A 3F0TA 3KOYA 1U8FO 2Y1DA 4TV9F 4D9MA 1BDJA 3HB5X 2EFCB 4X7BA 1UXIA 4BVBA 2QRNA 1CZNA 1OE0A 2R25B 3FTQA 4ZI3A 4NFYA 4L3VA 5B2EA 1QO0D 2IPMA 3VJKA 3GLSA 4L78A 5AK3A 3WNQA 3T1NA 3OQ6A 5KPJA 3TTSA 3KE8A 4NBWA 4BTLA 4OMFG 3WI7A 3UMSA 2F2TA 4KRYA 5BNWA 3T4PA 2QG4A 4MQFA 3DCJA 1PW5A 1LLQA 1P2BA 2QVCA 3BDAA 4OBEA 4CL8A 3KETA 1OWNA 1CE8A 2IYLD 3NONA 5GVSA 1OD6A 4WIAA 2ZR7A 2XUAA 2HQ1A 1NJ2A 1RKBA 3TAHA 2YHAA 5CNKA 1M1NB 5A4AA 5M34A 1C9KA 2X8WA 5CXSA 2HU5A 2D2XA 2N3ZA 4KBFA 3F5DA 4F21A 4ZV4A 3THYB 4YDQA 3HKBB 2WWHA 2Q5FA 4LDNA 4PRLA 4UBOA 4GX1A 1ZD8A 3RS3A 2N9UA 3CF4A 3S2YA 4YRJA 1ZZGA 2C77A 4MUKA 4BJ5A 5EE3A 1T0IA 2P9TA 3HH8A 1BDMA 4D4LA 5FORA 4BZPA 3QX3A 1PE0A 5NLLA 4RZQA 1Q0QA 2A9FA 1JVNA 2HRQA 3L02A 4OAOA 2KYRA 5CB4A 3RAEC 5A4FS 1V2HE 3L8FA 4GPZA 4M1TA 4OH1A 3FF1A 3JASA 3B12A 1VHDA 5ALIA 1KIAA 5EQFA 4QRIA 3OQJA 2B82A 3TQQA 3ROPA 2I2FA 1B0AA 1Y7IA 4R5MA 2B25A 3V7WA 2OO5C 4L73A 2IOFA 4LYJA 1GT91 4CLRB 5B3LA 4WE3A 4BXOA 4FZJA 3ZLTA 3DYBA 2H92A 4HGQA 1DNPA 3WYGA 3EHEA 2I1QA 5D87A 5HBRA 5SYMA 1YTUA 1V7ZA 1M75A 1X7WB 3DP9A 3FA2A 3IUJA 2G07A 3UAYA 5KYUA 2WIJA 3IT2A 4FC7A 4Y9TA 3T5GA 2ZJOA 2GESA 3FPJA 2Z4TA 2UUPA 4OHXA 1CZRA 2C2XA 4DCJA 4OUDB 2Q7DA 1FS5A 2QRUA 4ENTA 4O1HA 1FJXA 2JLWA 4DLTA 4X3CA 3JX9A 4LF7B 1CTQA 1JFLA 2A88A 5FPHA 4FWTA 3DWEX 2VOJA 1P81A 1VKNA 3EVFA 1D2NA 1RRFA 2OZLB 5FBVB 5JDIA 4PTLA 5KOJA 5DHSA 2RHRA 2XUZA 3T5BA 1TF2A 2QY6A 4S1OA 1W581 1A4UA 3AEXA 3OZBA 3KZMA 3TPFA 4NG5A 2AFVA 5L7WA 1XYVA 1EFAA 4F6LA 4QFDA 3G17A 1IHOA 3EBLA 4C03A 1XD9A 4UXJA 5MN5A 1MHTA 1S2LA 3AIMA 4UBMA 1NRIA 3JATB 1ABBA 2V6JA 1ZD1A 4RSHA 2BONA 2E4UA 3SJZA 4G2NA 1K5PA 4ZZ2A 3UK6A 3DLCA 1WDTA 2I6QA 4V0NA 3K32A 4TTVA 4RORA 1MXHA 3B7GA 1JAZA 3OZTA 3K6SA 1XZPA 1K7SN 1N0VC 1TO2E 4POAA 4RMJA 5HFNA 1PLJA 4LY0A 3KLPX 4N0DA 2AJDA 3EN0A 4EHDA 4JYMA 4QEKA 3L8MA 4KACA 1W87A 5DTEA 3OFND 4WNCA 2EF0A 3T3NA 2NVBA 5AJXA 5K20A 4EW1A 2R87A 3WSTA 2NO6A 4B76A 3C7DB 1PX0A 1VRWA 1GRQA 4LQLA 5E4YA 1L7EA 3T34A 5IF3A 1B6TA 2ZS9A 4MUNA 3NDRA 4MEBA 1OTYA 1E9DA 4RIIA 1DFGA 3LY9A 1TUGA 3RUCA 5HDBB 1NT2A 1R6XA 2ILTA 3K1YA 4MV3A 4F12A 3ZD6A 1GGKA 1NKVA 2RBEA 4MRPA 5DFAA 3CYFA 4JBHA 1G98A 3LFUA 1U0GA 1V9SA 1W93A 4RMHA 3BXFA 3SWWA 4TKVB 4ZQIA 4I55B 4E5SA 4ZJYA 2FMIA 3EDRA 4A6XA 4EZIA 1KE1A 2HA4A 3RSCA 5K6RA 1H9CA 2E9SA 3PX2A 2C0PA 2FVYA 4LV5B 3V4SA 2YN2A 1F1BA 1QGZA 5I9NA 4DANA 1YKFA 1VE1A 1ILEA 4E5DA 1Q21A 1OAOC 3ZZMA 5KAMA 5E9QA 1EIZA 3FMGA 3OT4A 3I1JA 2YYYA 3G7UA 4TUYA 3ZE6A 2X23A 2WTEA 5KX5B 5FL7A 1VHJA 1WLYA 3VC1A 3MD0A 5I9LA 1BGVA 1HKHA 2PZKA 3AJRA 1CUWA 4A0QA 4CM1A 1RIFA 1SKYB 2B4AA 4Y9RA 3AY7A 3AYXB 5FUBA 3SPXA 1ZVJA 4WNIA 4ZZIA 5DHFA 2BSQA 1QP4A 1I1QB 3JQGA 3LS2A 1YKSA 3NGLA 2I76A 2JCSA 3IC5A 4JASB 1SB9A 3IEXA 2DQ4A 4HY3A 3P96A 2H2WA 1GADO 1Z38A 2UYYA 4K9NA 3H9JA 5E9WA 3KUDA 3PDUA 4DLUA 1R6VA 5HP4A 3COYA 4M7PA 3NVMB 1K68A 5INTA 3C3CA 5LU9A 2WNIA 2AFIE 2BKUA 4KO2S 4ZDIA 4G0WA 1OKKD 2GX6A 1JF8A 4US0R 3TBFA 2QY9A 4BIIA 2YZGA 1FEZA 5FNVF 3N86A 4JJEA 3M4XA 4YRCA 2IHZA 1VB3A 2B3TA 3VKUA 2DWUA 3DAPA 2KMLA 1LF5A 1YJQA 4ZAFA 4X71A 1G19A 3X1MA 3BBLA 1EK2A 3LOPA 4KXNA 1NA5A 5LQKA 4NJOA 4PZ0A 3NNSA 4R83A 4EPVA 2CFTA 3WIEA 2H51A 3V3KA 3OCYA 4CMCA 4BEJA 3RVBA 3OEEA 1GZ4A 2WT9A 4OK5A 2ZRIA 4D9CA 3BULA 1PGPA 4RIFA 5KQPA 3CGGA 3KB6A 2ZSIA 4Q21A 4O59O 1B3BA 3DL2A 4MP8A 4PX9A 4ZJUA 1XX6A 3MINA 1E2LA 2VT3A 4IKPA 4YMVA 5JTTA 1O5IA 2C9OA 4H3SA 2CV1A 2VA8A 1MB0A 2W4IA 5BW5A 1P7ZA 1PFKA 1RI4A 4XJTA 2HCTA 1V7QA 1RW4A 1AF4A 2H17A 5AQEA 1S3IA 4FEEA 3KEMA 2IOYA 4LXGA 4L6IA 4LN1A 2CHUA 4XVRA 1SUDA 4OV6B 3SVZA 5ERXA 3PHHA 3KQSA 1DG9A 5BSUA 1CEEA 3U3OA 4EGQA 2YJ5A 3L8ZA 1YA4A 4BEWA 1SG0A 3D8UA 5LU8A 3F2VA 5TV2A 4ZYZA 3SN6A 1I3OA 3M1IA 4JVSB 1KMHA 2X4GA 3NNDA 5EMLA 5JXHA 1L6RA 3GARA 3RFFA 2O7RA 1KSJA 1MQ8B 3IVGA 1U4OA 1RM3A 3AHFA 3ORQA 3K0BA 3IELA 5F2NA 2RHGB 1LSJA 2RHJA 2W43A 4GMHA 3WY9A 1YU9A 5JISA 1V95A 4H9GA 1XRMA 4NHEA 4WZAE 5AI8A 1W8IA 4EOGA 4IRXA 2NX2A 1EESA 1J00A 2QZPA 5EXTA 1DG1G 4R1QA 4TTSA 2QW0X 1NJGA 4DZTA 2GJSA 1I6WA 1OYVA 1CIPA 4Y2UA 4A23A 3S27A 2QWXA 1R15A 2WTMA 3K6JA 4ZVKA 2FP3A 3T52A 3THXA 1FMTA 1Q3KA 2JFUA 2R44A 1G5FA 3QUQA 4NP6A 1V1RA 3JQEA 1S2DA 3MUNA 1JJBA 2Q5QA 3P2JA 2Z2XA 4NV0A 4NIMA 3PA8A 2Z5LA 4L8FA 2VH2A 1M33A 1ELOA 2PUVA 4IJUA 3SGLA 3T7KA 5AHRA 5CG2A 4DPLA 1H69A 3IFSA 4YJHA 1JSLA 5DT9A 4C29A 2C9BA 5JSZB 5C52B 1BJKA 2ZSAA 2C4KA 2GB4A 3T9BA 3CW8X 3LHIA 4FYWA 1NC1A 2GNAA 3KHKA 3LBHA 4G1BA 5G53C 1WY7A 1KI4A 1XB2A 1J2YA 1VP3A 1PL0A 3AF1A 4UVHA 3GF4A 3USZA 2V3VA 1U1GA 1Z6XA 1CP2A 4KIJA 4CR6A 9ATCA 5JSFA 3FUWA 4G0ZA 4OL9A 1SXIA 4P81A 1GRCA 3UHFA 3UPDA 4GLFA 3K2QA 2ZDHA 4N8SA 2GPSA 1FFXA 4BE9A 1NJ6A 1G5HA 3OE7D 4O8CA 5DCWA 4DV3B 3NAQA 4BAUA 5KHOC 3PE3A 4QVKA 4NCJA 1HMPA 1EIWA 2HA5A 4QPDA 1Q83A 1OHHA 5DTRA 5IAKA 4TMWA 2B6HA 3LWZA 4UVDA 4A2CA 2VJQA 4DB2A 1N1EA 5JJBA 4FHGA 2PYDA 2VOEA 4QGGA 3L6BA 4D3YA 4D74A 2O8CA 2E4XA 5DKFA 3L7MA 4O02B 5A2GA 1GVNB 2JAWA 4KWHA 3UTDA 3V1UA 2Q50A 3VZCA 3WRYA 1OOEA 4I46A 3G23A 3L1UA 1VKHA 5COBA 3OQMA 1CQZA 1EFCA 2LW7A 4MUJA 4DCVA 5LA6F 4YRIA 4TGLA 2B8TA 3FHLA 2MSLA 3MJ4A 1YS9A 4G5RA 3TR5A 3SHWA 5FFFA 3PLRA 2YOGA 5G1PA 4X6XA 4Y2JA 3U2QA 2G17A 5D3QA 4X8HA 2IE8A 4HAYA 2VJBA 3BTOA 1H2AS 3OZVA 2JAXA 3OIVA 2E82A 2NTNA 2AMJA 4M9CA 4MTLA 4GMGA 3RVDA 1U5BA 3KBBA 4AECA 1CE8B 4TYMA 4DWOA 6ADHA 4JCOA 3OA2A 4ND5A 3D8NA 3MA0A 1PJ8A 1GL7A 4K87A 3KWJA 1DPFA 4Q6WA 1SUWA 2FE1A 1ZYUA 2RDMA 1OH7A 1AG9A 4HAIA 1UBOS 2NPOA 4XB1A 1TD9A 3SHTA 5LMCA 4FMDB 2YZ2A 1T0BA 3BH6A 3U7JA 2BDTA 3H4VA 2LTAA 5AOCA 1L2TA 1PJ3A 4KQEA 4MVJA 1YR9A 2PBZA 4FKZA 1BG6A 4N76A 3GLUA 5K8TA 5CB6A 3PQCA 2EKLA 2PEYA 4UCQA 1QP8A 4CHGA 5I7WA 4Y2RA 3PEEA 4MPJA 2WBLC 3RRFA 4C6RA 1EDZA 4AF6A 4QYSA 5DCUA 1IN1A 3TQIA 4E21A 1MQAA 2ACEA 4M3NA 2ANBA 2C92A 5AVJA 5JS1A 2D59A 4B2YA 3WOHA 1GD1O 4NOJA 3TXAA 4CIBA 5IN4A 2XRMA 2EHJA 1ZSNA 1X1TA 5FOVA 4HNQA 3FVQA 4ZRNA 4X94A 1NQWA 4O08A 3T7JA 2QTGA 1NW4A 3GDOA 2P2ZA 4EW3A 4V0SA 3R7LA 5LJIA 4J0HA 4QL3A 2QN8A 2NOAA 2PMFA 1I5EA 3JTEA 2JGLA 3QVLA 2JGNA 2DR2A 4K0KB 5DHRA 2H6EA 2JLQA 2ZZKA 1Q12A 3PFNA 4CCSA 3MOSA 3PNPA 4JXZA 2QAJA 3K2BA 5TPZA 1I33A 2O3UA 2DHCA 4TYPA 1MORA 3B9RA 1BE6A 4JC5A 3FPSA 3ZLVA 4BNZA 1T0HB 1GYPA 2I29A 4HV4A 1QHEA 1NJSA 1PJCA 1NQAO 1LSSA 3AR7A 4LRXA 5HKOA 2XRZA 2CXSA 1TT5B 2BEWA 1JBQA 1Y5NA 2ZUEA 1EVEA 1H3NA 4MHOA 2YMPA 4YTEA 4L0MA 2FN4A 2EOAA 1QO0A 4B17A 3N8IA 5KYTA 4W5NA 1WHSA 5SV2A 1U0FA 1A9TA 2OVFA 4KYTA 1PJRA 2I1WA 1QZZA 4GXRA 3RJMA 4E2XA 4F8YA 3H3FA 5CA0B 2H8GA 3QUSA 3AEKB 2YICA 3V7YA 3V8VA 2ZI5A 4OYLA 3QYPA 2ZS7A 4S05A 2PSEA 1IZ0A 4HQNA 5B1YA 4IDHA 5AXDA 4RM3A 1L7XA 2DFKB 2JRLA 2QUKA 4D8VA 3DWFA 1BEZA 2FPLA 1UXOA 2HPHA 3IGFA 3HMKA 1WKCA 2Z9BA 3W1WA 1DVRA 2E85A 2CYCA 1X80B 2CW5A 5DSXA 4C89A 1QP7A 5TF0A 5BSMA 3DE3X 2IUEA 3E0QA 4WBXC 3WL4A 4ZO8A 1WQ1R 2O8BB 5BWBA 5IARA 5K0EA 2O2DA 1KYYA 1CX9B 1ZNQO 3FCCA 3U48A 3RSOA 3H5OA 2NU8A 5TLSA 2VHYA 2WJWA 2CMDA 3B1FA 1PNRA 4ZV7A 4IDQA 5CVJA 1IBLB 4TLCA 1TU0A 2EF1A 1JJFA 2Q5CA 2B8EA 4F5EA 3EZXA 1ZK3A 4IVNA 5KS2A 3Q8LA 2GHQA 3JQBC 1GZSA 1YJBA 3TQHA 2Q62A 5LD2B 4V02A 1D2EA 3CNBA 1JQ5A 3D5QA 4KV9A 2Y27A 4AZ0B 4IFTA 1LJUA 3M1AA 3HRHA 3HYRA 3OQIA 2WF9A 4ASUD 3ENWA 4AJNA 3C5HA 3JVDA 4P58A 2Q2NA 3RUHA 1Z6AA 4P6VF 3ZXSA 4LCJA 1XVTA 4PHCA 4S24A 5H80A 4A8JA 1YAHA 1EFDN 2CYBA 4ND1A 5CLGA 5HPYB 4MICA 3RLIA 1PCXA 2IV2X 1NYQA 4NCNA 2A1TR 4AY6A 2ZKLA 3CVUA 3S1AB 4KMOA 5A6SA 4L16A 3B53X 1Z2NX 3CTPA 4HMPA 3F6YA 3BUSA 2X0RA 1YL6A 2FP4B 3QKWA 3WGLA 1Z4NA 4RKQA 1VKZA 4D02A 3B9PA 3DUFA 3BCUA 4UHDA 3V8EA 3GPLA 3VU9B 4YR7A 1U90A 2ACVA 2X5NA 4TVKA 2OORA 3FWHA 1NC3A 3JALB 3T4XA 1I4OA 2C29D 2Q41A 1M72A 4PWZA 4U7FA 4RD2A 5EXDA 3SEQA 4S3MA 3EVEA 4PRKA 4DLWA 2Y4NA 4G63A 5C7LO 2NM0A 2FMTA 1O0CA 3PHIA 1XP5A 4B75A 3A6EA 4FFBB 4P98A 3T7TA 2VHWA 3UUGA 3DP7A 3HBJA 4NONA 1OPRA 3LYUA 3SCZA 3HB4X 4ACAA 2IS2A 1WXWA 1T2AA 3C5EA 1DLIA 3LQFA 2O54A 1BXRA 1BKYA 2XYVA 4I4TB 3GT0A 4ZOLB 5ER6A 1PLLA 2OQVA 1Z5VA 2OLJA 1UBJS 2PBLA 3ILHA 4H7KA 4I08A 2EZTA 3OFSA 4X62B 3R75A 2GD0A 5EJAA 1GCAA 3LYAA 1S7GA 3S1AA 2BM0A 1K2WA 2VF7A 3ZV4A 2J5RA 2I8CA 1E7SA 2WVJA 3ADOA 1F5SA 3EXFB 4OMUA 3GLIA 2JCXA 4CT0A 1C3VA 1Z7GA 1N8TA 3PHGA 3UMCA 2NSLA 4PC6A 2ZB4A 4YJFA 3VH4A 2Q1YA 4WBNB 3IMCA 3O2JA 2H7YA 4WOBA 3GLVA 2K87A 2XLBA 2ODWA 5IM4F 4PVDA 4G1VA 1LDGA 2BFOA 1HG1A 1RBMA 3QXXA 3GG2A 3CKLA 4JROA 3IAFA 4QICA 2V74B 2W5UA 2YZNA 3S44A 3U9TA 1EFLA 1DU4A 2LUOA 1EFRA 3OT1A 4EMBA 3LD9A 3ZI0A 2ID9A 2VYVA 4LJYA 5HGJA 1KO1A 4BNJA 2VNIA 4BP3A 3OPXA 3VNQA 1K66A 3AEQA 3ZWMA 2A14A 4KQHA 4MS4B 3PYMA 3IIIA 1LX7A 2QP3A 2RJ3A 2JI8A 4QXPA 2CLIB 5KDOA 4OFBA 2P9GA 1ZGGA 3AEZA 1U3DA 3E9CA 2QVLA 1SD1A 3O90A 1C0LA 2JFQA 3E7DA 2GEDA 2H9YA 3JYQA 3RSZA 1SCUB 4CQLA 4UBIA 1D8TA 2CNDA 4B3DA 4D6YA 4HG2A 1KZ4A 1R0ZA 1ZJZA 2UV8A 2AV6A 3EMVA 4INJA 1L7NA 2PIAA 1F8UA 5K4GA 3BFPA 3GLTA 4D9HA 3G8YA 1FFHA 3OLXA 4H15A 2P8JA 1Y3BE 5DNYB 5I5EA 3B6JA 1K7XB 1TZMA 2IEIA 3AEKA 3E4CA 3SEFA 2UUBB 2ZAYA 1U28C 1FTSA 4ZVVA 5JEEA 1THMA 1RYMA 4K6HA 2DPGA 2ZTVA 3V6LA 2JHFA 2Q6LA 5CVEA 4TLLB 4YJHB 3X43A 2IU4A 4WY8A 4L75A 4NYMR 3VVBA 3O8OA 3I6BA 4J0QA 3QMWA 4L4RA 3PC6A 1XQVA 1NVUQ 2H2GA 3SFVA 1FSPA 2J5QA 1BCSB 5ABPA 1Q7BA 3A9TA 3LNCA 4NOLA 2O2ZA 4WACA 4QBKA 4CYMA 1N9GB 1E63A 1N1GA 4X3OA 3L4BA 4Y1EA 3A9SA 3WLFA 1PQ4A 3CF2A 1W4ZA 3ICVA 3DYVA 4NZPA 3ROQA 1SC9A 4KZKA 5DTQA 3VSAA 1JJVA 2P6OA 1Z18A 3UJHA 1G8YA 5D7BA 1X7ZB 4NR0A 4AO6A 4BQQA 4M1ZA 2QNBA 3P45A 1OKKA 4MDHA 4M37A 3ZOKA 3ORYA 1HI9A 5IX8A 3AG6A 3DDOA 3MT0A 4LDJA 5E8JA 5KQRA 4GS5A 1VRVA 2QEQA 3UBMA 5GJWC 3HDVA 3GGCA 3RGGA 2V6FA 4ND2A 1UZNA 2PV7A 3HV0A 5A2QA 4BQNA 2W6OA 2ZJ8A 4KLCA 3QE3A 3ELYA 3L4JA 1E89A 1JIUA 2BFDA 5C1BA 2FZ4A 3KSBC 2JLZA 3C41J 1A4RA 3D1JA 4HFNA 1VG1A 1USWA 3M0EA 4MMYB 1DKMA 2C96A 4R1TA 4AG6A 4QEDA 4G0PA 4HQ0A 1NDQA 1DINA 3ITKA 3K9NA 1ACJA 2V7EA 1G17A 2NACA 1XN4A 4INOA 3T3GA 4N40A 4ZV9A 1WP9A 4I1UA 5AVQA 4N5LA 1NBAA 1FTYA 2W2KB 1O96B 3F7OA 3IEPA 4YEDA 5BSEA 1CF4A 2JFZA 5LXTA 1CVIA 2X1LA 2GEFA 5EMMA 2JIZA 4OQXA 2HK9A 4B74A 2WV7A 2VAWA 1G18A 1KYXA 3K6KA 2WTAA 4HLDA 1EU1A 3A4TA 4D8WA 1MVNA 4FYJA 2VZEA 4LXUA 4LTMA 1U0SY 5IXJA 3D3WB 1R0KA 2JANA 3G7NA 3LDGA 4KSBA 4OQEA 4F6RA 4O4JB 5JO9A 2V7PA 1X2BA 1IXSB 2OXIA 2Y1XA 3OPMA 3PXXA 4AT1A 5HG0A 2R0QC 1BMFA 3HWX1 1E8MA 1KDOA 4XR4A 1RVV1 3MMSA 1CC1S 1PJBA 1JJAA 2BKLA 3GVIA 3O82A 4TXLA 5EIHA 4YP1A 1Y9JA 1J2TA 2R00A 5AWFC 1PNTA 1XJCA 4RPIA 5CAEA 1HORA 2HSWA 2QT9A 4XWKA 4UU0A 1XZMA 3O83A 3OX3A 4TMTA 4WZ6A 4BCCA 4C2UA 4NPAA 3SAJA 4UHBA 2XQVA 1L5HA 2WHQA 4XVCA 2ATIA 5EXPA 4BFTA 2WAYA 2PKEA 1I4EB 1RJGA 2DJ5A 3PXUA 1DUSA 3L82B 4HUQB 3R44A 5C46F 1ECPA 2OK8A 4PYNA 1T4DA 2H1OA 3SHQA 2JJ2A 1N5DA 2BEVB 3R8CA 1L4YA 3I2FA 3O7WA 4RENA 1OBCA 5DHQA 1KK1A 2Y66A 3CUUA 3TFQA 3K70B 1K06A 1Q6YA 3DMFA 3MT7A 3Q98A 5EUQB 3KQPA 3GPBA 4CLDA 4CIDA 4B0OA 1B16A 1YL7A 4HAWA 4H1WA 4XD7D 5CFZA 5I51A 5JANA 3AIOA 1DG3A 1GZ3A 1UEIA 2BGGA 2HSJA 3COJA 1Y3IA 4C6TB 5JNWA 1JDBB 4JP8A 3INNA 3LUHA 3RODA 3AHHA 3TYXA 2W2LA 4UMFA 4GNRA 4DW8A 1SBQA 4JT4A 1Q0UA 2G5GX 3HQ4O 2NU9B 5GADl 1DOAA 2MR6A 3R6WA 1L4UA 1GTG1 4M2LA 3OE5A 2Y77A 3R5JA 4M1MA 3UQYS 3F1KA 2QTTA 2PSSA 3RVSA 4YAFA 1NFFA 4GKJB 1TMYA 3CURA 4C4SA 3JQGB 2YW9A 5DM1A 2H2AA 5ALOA 5JSKA 2OD9A 1MO6A 3S2UA 4REQA 2BFCB 3MT9A 4LYAA 2WYHA 4Q47A 4W6QA 4IUCS 3GLQA 4MROA 3CH6A 5IAGA 2EJUA 2XUIA 4U6SA 4WOPA 2BFPA 4NBUA 2ZIZA 4RFLA 3KWFA 5FI1B 2NZVG 5BYAA 2O50A 4GW3A 3O3OB 5ITSA 3FNQA 2FEXA 4E46A 3FOAA 1MNAA 3KVNA 2FUG1 5JSQA 1P19A 1E2IA 4TKVA 5F1PA 4BKPA 4J90A 1W5BA 5G3ZA 1TT5A 3JQRA 2WHPB 1E79D 4CIYA 4XWGA 4LC9A 2V7BA 3C1TA 4NCIA 4EB0A 3Q6MA 1Q0RA 1TYBE 1PG0A 1QBGA 4CTJA 4RK1A 2IYOA 4CTMA 4RIEA 2CLMB 1JEEA 1PUXA 3EK2A 3EGDA 3I04A 5JRZA 3KQVA 2HYIC 2IITA 1HPLA 1TF7A 2O57A 4GVLA 4YLEA 1L5WA 3P1JA 4KLRA 5YASA 1U2EA 4WFJA 3RYFA 5CDUA 4D0NA 4OHYA 2FR0A 2NUAA 3ANSA 3VVMA 4DLSA 2ZJ1A 4TYNA 1M6YA 3BRSA 1DPGA 5HJ5A 3N8KA 5IT4A 2V1UA 1X8LA 1JHXA 1QSGA 2XNJA 1QZTA 5AVVA 3S99A 4GLBA 1KYWA 2C83A 4U9UA 1M5TA 4EP1A 2NUAB 3HV2A 4FFRA 4Y7CA 1BAPA 1MRSA 4QJ3A 3PFGA 1I51A 1KQPA 1YVDA 2Q3CA 3AF6A 1D2HA 3D6AA 4N39A 3K72B 4J9VA 5BQOA 3CNQS 1GEEA 1IZ9A 3CH4B 4P7KA 1CUFA 4R6WA 4FKBA 5BVHA 2DPHA 2O6HA 3QENA 1PWYE 1KJ8A 2D06A 4FX5A 1OX4B 3WGYA 2W6ZA 3D43A 1XSEA 3FOBA 4K28A 3RRMA 1AC5A 2LD4A 4EB8A 2XUQA 3N3BC 2ZOSA 3VH1A 1E77A 1WTCA 1Z07A 3BZBA 3EIQA 3MAAC 2IIPA 4CLXA 3AF0A 4RQAA 4KDEA 4AY3A 4CQMA 1XPUA 1F7UA 3WA7A 5KHLB 3AFNA 1R74A 2DY1A 2WWYA 4KL8S 4WHMA 2XGMA 1UM9A 4PG5A 1CR2A 2ZPTX 4D8YA 4K6KA 1FSFA 3PIRA 3WB0A 4F06A 4FXPA 3PHBE 1C0EA 3S1LA 2W6PA 2O4CA 3IKMB 3KYJB 3MQ4A 1NV8A 4NZZA 1OFVA 3M6MD 2CJYA 4AYXA 1YWGO 3EIEA 3C8ZA 1MB3A 4X60A 4JP5A 3O75A 4KUEA 4QUAA 1U1EA 1WZEA 1GPYA 3DKRA 3UCXA 4IWXA 5CB0A 1W6UA 2IYAA 4KRGA 5JCJD 3LCCA 1TZBA 1HFEL 3RKSA 1U02A 1YZNA 2Q1XA 2QSJA 3SIXA 1MRZA 3I5XA 3OKAA 5M5BA 4Z99A 1Y8ZA 1AKEA 1NLFA 4RYDA 4QOJA 1CT9A 3RHSA 5KMGB 2P41A 2P6NA 3WO1A 4LK3A 4DV5B 1SQSA 1TVKB 2C7VA 2FGJA 2R48A 3N3AC 3QKRA 3QELB 4K46A 5F73A 3RFTA 1J56A 1GCOA 3MD9A 3PWKA 3QXSA 5DHTA 3VTAA 2P65A 3MMPA 4AN1A 4BOYA 3V9PA 2UUOA 3GGSA 2O7NA 4NZOA 1FXWF 4IJ6A 2OO3A 1P7VA 4DIBA 1Q1EA 3DOCA 4UE6A 2IIBA 2Q28A 1N5LA 2QE7A 2VT6A 2W4QA 2Z9CA 3QELA 4UZFA 4DCNA 2FLKA 4G26A 3OEHD 3HACA 5EMKA 3VPBA 3MJHA 2P4QA 1PKEA 3HA2A 1N57A 4JEMA 4Q7KA 5EMHA 5AW2A 4HB0A 4TQ9A 1NVGA 3K96A 1CU1A 5LWHA 3HLYA 4EHFA 1GCIA 4KQJA 5FR1A 4UUAA 2ZSFA 1B6RA 3DOFA 1L1RA 13PKA 3DE5X 1EVLA 2BGKA 3BICA 3DSRA 1OZGA 1M66A 1WUTA 5F3RA 2H4YA 2YBEA 1BIFA 4LPSA 4BUCA 1SCNE 5JQWA 1A82A 3DAOA 3HZZA 4M88A 4MITA 1YQUA 2Z8YA 4QE3A 4DOMA 1OBHA 1CP3A 1KYQA 1QVZA 1VL0A 2OD7A 2Z8ZA 1JXMA 3KEQA 1RU3A 1SK9A 4TUYB 4EBBA 1UADA 3PUHA 5KKNB 1QQAA 1J8MF 1T1RA 1BS1A 1OLOA 3GRZA 1QO9A 4KOEC 3DLTA 1OV4A 4OH7A 4HLNA 1U5CA 1QTNA 3THWA 2NQTA 2IOQA 3V32A 1HYBA 4JP3A 3RS4A 5JBQA 2IHUA 1W1IA 4Q9HA 2OCPA 3DAYA 2JK0A 2L0XA 3GUCA 4JI0B 1HA3A 5LXTB 3TKAA 7MDHA 2X6QA 3H1EA 4EG6A 2B36A 1EM8A 1SUAA 1P2DA 3KT8A 5THKA 2J4DA 2OCXA 3RNLA 4DDKA 2GBIA 3NDJA 4L22A 5CW1A 5J4VA 3F90A 4NNOA 5IYZA 1G3MA 3CT6A 2QXTA 3SG0A 1TJPB 1M7BA 3CRRA 1Q2UA 1EQ2A 1OYYA 1P2SA 5HF5A 3SLRA 4RTRA 3PPIA 4B46A 3TECE 4O2LA 4UOQA 4O5OA 3UOAB 4DDHA 2B0JA 3BJIC 2A9PA 4MA5A 4PONA 1BX1A 1HZZC 2QM7A 3RC1A 4MMZB 3HU2A 2AXEA 1KOJA 1Z56C 3DB1A 1X38A 3JWJA 3OU6A 5FPQA 4MO9A 2X5JO 1QQ7A 2AIRA 3T3PB 3BHNA 3ZI7A 4HWGA 2D0OB 3N8HA 2ZG6A 3HY4A 1VYUA 2ZBGA 3L6OO 1L8OA 3H13A 3LQ4A 4IZIA 5HFAA 3SOZA 1AV7A 2GF2A 3EZFA 3EC2A 4V2UA 4TWZA 1YQXA 1RRKA 1JFFB 1JVSA 3RIMA 3U1TA 5DM60 3L6EA 1TW2A 3FFWA 4H60A 4EGFA 4FDVA 3QBJA 4GPAA 1LS1A 2PL1A 2UZIR 2JKZA 3OZUA 1NKTA 4L74A 3TG8A 5AI9A 1BN6A 3F9IA 2WM3A 4ZMRA 5KCMA 3RGWS 1S9DA 3WMFA 3RUDA 4I50B 2OLEA 2KM1A 4M9SA 4DQKA 2P5UA 2JLCA 1XTUA 1SXJD 3RAGA 1DBIA 3ZD7A 1CR6A 1T5LA 4HLQB 4F1KA 4IGKA 3LT4A 3ZN2A 1RAIA 1ZXBA 1KO4A 1C7ZA 3EHDA 1UBRS 2GYWA 3M4YA 2QMZA 4FR2A 4MVJI 5EIAA 3RTEA 4LFAB 2P2LA 5AM4A 1CWUA 2X1MA 3V1KA 2OC4A 3PWTA 3FH0A 1IONA 3GMIA 3PFCA 2VLIA 3L1IA 3AGPA 4QG3A 1STOA 3PJFA 3ZD9A 1Y6ZA 3CX8A 1EK5A 4YXWD 4HLUC 1TFRA 4KDCA 3BEOA 1AUOA 1A71A 5C37A 4WAUA 3R9WA 3KPUA 1GITA 2XAUA 3QG5A 1M1ZA 5ADUS 1RRCA 4KTTE 1T13A 1P39A 4N0MA 3C7KA 2D2IA 2QLJA 2XGOA 3NU1A 2WMNB 4NH4A 4TVBA 1YDWA 5TEVA 4QBIA 4MW7A 1BFKA 4EPRA 4LZWA 1EA5A 1F0NA 4RQTA 3CZRA 5KYGA 1WD5A 3ZY3A 3NTUA 5BWMA 1SBCA 3CLVA 4AUEA 4BY9E 1UBLS 3T3DA 1MAAA 3D02A 4X97A 2IYVA 4LJ7A 2GFQA 3FWZA 4NATA 1NL3A 3WX0A 4LF4B 3BE5A 1QR6A 3FETA 4KEAA 4P4NA 2QORA 3DW3X 1YQWA 2RKBA 2CD7A 4BO6A 5HJ2A 4GI2A 3QPDA 1PUIA 1U6JA 3F1LA 3KQHA 3MG9A 1M2HA 3HBFA 2WF6A 4AX8A 1Z6QA 4OJNA 5FLXA 2QVBA 4GHWA 1VCNA 3K92A 1UJMA 3DJFA 2I6GA 2V59A 3PX7A 4QYXA 2OFFA 1XNHA 3ETGA 4L9AA 1M9NA 3GEGA 4GIBA 4TQAA 2XZLA 1FQWA 1WEKA 4L72A 4EI7A 3FN4A 3B5JA 1E1LA 4HNUA 1OGIA 4NC9A 3FRJA 5I4CA 4J03A 2OK7A 1FDTA 4R9UC 5F5NA 3W5AA 3N2KB 2OM6A 3FROA 5AJUA 3LX4A 3MFQA 3JQ7A 4WZAB 4YFVA 3EDMA 3FG9A 2OV2A 1T8WA 1R88A 5KQMA 3ZYZA 3G9TA 5E7QA 3ZIAA 5HQ3A 4YT2A 4MKFA 1G41A 3C97A 1Z73A 2FP4A 2FX5A 1W0JD 1JIVA 1IH8A 1U0NA 2OV3A 2X42A 3PUWA 5CTJA 1DX6A 2PSHA 1JFVA 3I30X 4CPDA 1PIWA 1SXHA 4C4TA 1KGDA 2AL7A 2X58A 4LC1A 3S2ZA 1P7PA 4X6UA 4BVLA 1UKZA 4F3KA 4D4MA 1LDBA 1EUYA 1ZICA 1LVHA 2EGGA 4BFUA 1JZTA 5KYXB 1M2OA 2J6CA 1N5KA 3A04A 3WYBA 4E5YA 1JBEA 3C5VA 5T6BA 4Y8VA 2WJGA 2XRYA 4NENB 4RHYA 2WJ6A 2KLHA 5ED0A 1G21E 1YOVA 5DM2A 2CHVA 3HXMA 1CIVA 1Y4UA 1GRVA 5IK2D 1FXUA 1XTRA 2ET6A 4WINA 3GH3A 1E1MA 3RVPA 1XQYA 3E7WA 2WJIA 3Q1LA 5BO5A 2NZWA 4OY3A 1U7ZA 2JLBA 3Q0EA 1E4YA 4R8KA 4IHQA 4KE8A 1VBNA 3QBVA 5CFNA 5AK0A 5FBKA 1ONOA 2G5PA 4A8JB 5JJLA 4YN3A 1RXVA 1VCHA 3FPAA 1XZEA 5KYNA 2QN9A 3G2JA 3HCBA 3QI7A 3LUAA 4BKMA 2F6RA 3EMBA 5HF8A 5I7RA 1KJJA 1GCUA 1KK3A 1N2ZA 2FCRA 4D9IA 3OY7A 4OXNA 5LP6F 2PLNA 2RONA 4BCDA 4QPNA 4C2AA 3D2AA 4X7PA 4XGQA 2GN0A 4QQRA 4D4GA 5JJKA 2F90A 2OPBA 5BR1A 1B76A 1ISFA 5HEKA 4BNKA 4EF5A 2I3AA 1OYOA 1L4HA 2HIGA 2BH2A 2NYRA 3E1SA 4EENA 2C59A 1QOZA 2QVXX 2VHZA 4FJ2A 2VNHA 1JEJA 4UULA 3SZMA 3ZW7A 1T8RA 4J16A 1OASA 1GEGA 3UJPA 3FIUA 3QVUA 4QHTA 1E1DA 3OEWA 3AV3A 1Y81A 4OLFA 1M2NA 3LL7A 3O8OB 1LLUA 3KCNA 1BXZA 4QTXA 4QFMA 4O4HB 1X80A 3PTLA 2R6AA 4QULA 3ZVNA 1JLKA 1Z13A 3ORHA 3Q6IA 1U1DA 3CE6A 3QEMA 4Z0NA 4B3TB 4ITVA 3G0OA 1FRZA 2ZI6A 4WD3A 4Y6SA 1IXRC 1NMEA 3AUTA 5EUMA 1JT2A 4U1RA 2AXQA 3KJFA 2GTIA 4P3KA 2WF7A 5JQGB 4GO1A 1PFGA 1WPRA 2HKIA 1FYXA 4TZTA 3TTYA 1NY6A 3IEKA 1B0PA 4RK6A 5I8ZA 1DS6A 1GZUA 3JS5A 3DZBA 3SC2B 3LT1A 4X8MA 5JZSA 2P2DA 4JSRA 5EZYF 3A1WA 4EKEA 3OCZA 4J0GA 5HFJA 3EGOA 3V8MA 1PSWA 4G8JA 4RSGA 2WF5A 1SBNE 5AW9A 3PF9A 4BTVA 3TCNA 3JD0A 5IW8A 1XL0A 4LGVA 3ZQKA 2GWHA 1J5PA 4HMOA 5J23A 1IZYA 5JCPA 4OI0A 3PQDA 3JQQA 1NP7A 4BVAA 3PQ3A 4C4PA 1MIOB 3U80A 3EA5A 4QVGA 1GL9B 1YR8A 1F6WA 2J46A 3CKKA 3FNIA 4RZ3A 4XGNA 3PWSA 2VCEA 1GRNA 3HN6A 4TRNA 1UEXC 2VJAA 3PF8A 3F6PA 2A0YA 3ZGXA 4MQ6A 4H6PA 2GZ2A 4Q15A 1IY0A 2R6DA 1SOUA 3GL9A 1C3EA 4Q1AA 1E2QA 4XFKA 4QLBA 1CZKA 3KQQA 2ZYAA 1R00A 5FNVA 3VYSB 3D1VA 3ADKA 1DEAA 2R7AA 2NO5A 3UT5B 3D6HA 2OR3A 2C97A 1CJTC 1KS9A 2JEYA 2Y3IA 4TVOA 4BPBA 5ALZA 3I9KA 3PRJA 4FNAA 2OZVA 2ZIEA 1ESEA 2GK7A 3I4CA 4R8VA 2WB4A 2BZGA 3U4CA 3P8ZA 3EXHB 1I7SB 3IIMA 4FVTA 3QH4A 4UHKA 1PGNA 3H83A 3TTWA 4B34A 5A06A 2DETA 3I4FA 4Y67A 4JCCA 1QVVA 3ESAA 2QTRA 1K92A 2ONZA 1PJAA 3B48A 2ZJYA 3I6QA 3ZE2B 4RJJA 1ZVQA 4JI3B 1CUVA 3RJZA 2REOA 4HLCA 4G0XA 5JG7A 3B85A 1G55A 1Z0JA 2E5LB 2JIZD 5EL0A 3R24A 2E5FA 3FHCB 3ZZNA 1YIOA 4NG4A 1DAPA 3HWRA 3OZ7A 1XQXA 2Q46A 3BWCA 4JLVA 4GPEA 1MAWA 3PNQA 3RS0A 3B1XA 3GNTA 4JJZA 1FMCA 5AVSA 5GZ6A 2WY2D 1UOQA 2WDZA 4R40A 2YS7A 3ZCPA 4AD8A 4B0PA 1W9HA 3IDZA 4Q6BA 4CTKA 4Q3KA 3N1UA 1ZK0A 1FXWA 4I3FA 3AEYA 1JMVA 3DFFA 3LSTA 3RFCA 1ZPDA 4L85A 1GA6A 1IEWA 1P4GA 1ZG3A 5EXEA 3WLTA 1RLIA 3A2MA 1KZ1A 1A76A 1UJ6A 1ZP6A 2PX6A 2QNRA 2QU8A 2BCGY 2JGEA 3KFLA 4MV9A 4OGFA 4Q39A 1QQ6A 4QATA 5KTYA 2V0GA 3ROZA 4MHTA 1QH1B 3HXQA 1QU3A 4ZVRA 4HGNA 3GUVA 5K3DA 4ETIA 3BZWA 2VZ0A 1BDBA 5AVRA 2X4LA 1OWLA 3PR3A 3TSZA 3AR9A 4IDFA 2C5BA 5CTAA 1KNXA 2GQ0A 5KTRA 3V9AA 4XDGA 1E5QA 1JG6A 1SAYA 3EPRA 1DHTA 2WKRA 3LX6A 3MTGA 3TAUA 4HAVA 4AZ3B 5L6LB 5CD1A 4WFQA 2XXAB 5IKEA 3WLAA 1XU9A 3OI7A 5TT1A 1NYTA 4NDNE 4ZREA 4UFOA 2NXWA 3KTAB 2OMEA 2ZJ2A 2QT0A 3C3EA 4ENWA 5IKPA 5DBEX 3NALA 4JBLA 4LV6A 3I5YA 1X8JA 2EAUA 1HETA 4J1TC 2OGZA 4CKWA 2GYUA 1AMUA 5ALXA 3OOEA 3MWGA 1CLUA 3ZCSA 4RJIA 3DC7A 3OQPA 4LG1A 5DT2A 4S04A 3ANLA 4YRQA 3SZUA 1EPUA 1XYYA 4PLWA 3GCWA 4XH9B 1S1MA 2P4UA 3K0CC 1TYAE 3RCBA 3CW9A 4RTJA 3IQFA 4CMEA 1C29B 1DADA 8MHTA 4BVHA 1YE8A 1HOXA 2YJ3A 3EZLA 4LVCA 4QWWA 4PU0A 4BNUA 4KSYA 3DA8A 5KYWB 3ZQUA 4C4OA 1IJEA 5HUJA 4D3ZA 1ZA2A 1NJFA 2XCUA 3KLBA 3KUKA 3DMTA 4EJ0A 3OC0A 4INPA 1FUYB 1V48A 1Y34E 3ZDCA 4GDFA 1P73A 1QZXA 1XOIA 1HYGA 2C4NA 2MSDB 1SRQA 2JGRA 1JQ3A 1PFQA 4H7FA 3SC4A 3LPCA 5K2MA 2NTEA 3SJUA 2QN3A 4FMPA 4HEA6 3NAZA 4DV6B 1RJDA 4B85A 1XEFA 1LSUA 2FUKA 3SQLA 4KR7A 1DAIA 2XT6A 2EU8A 2YKGA 1A5ZA 2DFDA 3WBKA 1PZGA 3OMWA 4ZD6A 1YC5A 4AXXA 4DJEC 4KO1S 2PT7A 2PMDA 3ANTA 4FGSA 5K3AA 2CL0X 3BC1A 4P35A 3E5NA 2WHXA 2JFGA 1FX1A 3EDQA 1OVGA 4OA8A 2IW1A 1KJQA 2BDUA 4DLLA 1K9VF 2YYSA 1BVYF 2HDWA 3H5WA 3V4LA 2H59A 3GNLA 4X24A 5B6JA 3I73A 3C3BA 2BHSA 4WN9B 1U3GA 3DULA 4HH1A 1FFEA 4I6JA 4WKOA 1OI3A 1RCUA 4DIKA 4EI9A 1R0YA 3JQDA 4JJKA 1NMQA 1T1IA 1UINA 3KR9A 4RWZA 1B7GO 2YY6A 3UYLA 1P44A 4MLZA 1ZUHA 3O74A 4UBKA 1OFUX 5LLDA 1T2EA 1G8SA 1ZHOA 3DTNA 3A25A 4ICIA 1RHUA 4EQ6A 4TM8A 5TGDA 3RJTA 1A9YA 3L8EA 4TKMA 1NE7A 4A92A 4FX2A 1WMSA 4AS2A 2YWRA 3ITDA 3JQFA 5IDWA 3K70C 4MMXB 2J6IA 2JGDB 2OE2A 5FIUA 4GR4A 5JY6A 1ZKDA 3IQWA 4MYSA 2OZLA 2QR2A 1T24A 1MKYA 4GU5A 4TLAA 5K01A 5LP6C 3VHXA 1IRXA 1G7CA 1U7UA 1XAGA 4RULA 4BMZA 1IWBB 3QU7A 3L6UA 3L79A 5ELXA 2ECKA 2E4YA 4KLAA 3Q4GA 3OMXA 1GFWA 1Y4ZA 3D8BA 4RQUA 4ZARA 4Q3NA 3TCKA 5E4FA 1PV4A 1E0SA 2RGXA 1APBA 1ZCZA 5IT9A 1YS6A 3CVOA 3TIIA 1C9DB 2OCIA 16PKA 1VHTA 2RGUA 3RPEA 5KTMA 4L3WA 4QYWA 4OL0A 3LPAA 3I37X 4OQNA 4QGBA 5B1IA 2YQZA 2QZ4A 4WQMA 4O29A 4ALMA 1XCOA 1KY3A 1QV7A 2QTLA 4BWYA 3ZGNA 4DDWA 3ZQ6A 1NVFA 5LQUA 2F17A 4GOKA 4RQBA 2WOOA 2ZYVX 4XD2A 7ADHA 5IUJC 1H8HD 3WYDA 3LBIA 1Z0ZA 2JKVA 2FMFA 5HS4A 3P71T 2Q4EA 1ODLA 4J94A 4B43A 1WB4A 2O20A 3LRXA 2NO0A 3N2KA 4F2HA 1MU0A 3RYIB 5AP9A 1M2VA 1CVLA 1O03A 1ZCAA 5EIBC 4CM8B