4H3HB

Crystal structure of a ternary complex of human symplekin ntd, human ssu72 and a rna poymerase ii ctd peptide phosphorylated at ser-7
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Symplekin
publication title An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h3hB01
2KYRA 3G1WA 4OATA 4XFKA 3TO5A 2FMKA 2HJ9A 3O21A 4IGAA 5CNMA 3IP7A 2BGGA 1JL3A 1B00A 1P8AA 1RNLA 3CTPA 5TPWA 2QXYA 2MYPA 1YIOA 2QZJA 4LDAA 3UUGA 1DCKA 3RVKA 4GPAA 4P1ZA 4RZSA 1Z15A 1BA2A 4YO7A 5HKOA 5T7BA 1PEYA 3IP5A 3OQOA 3OLYA 5DGCA 1DRJA 2FQXA 1NXXA 5CNJA 2FLWA 3QLTA 2NZUG 2LPMA 3MYYA 3NNSA 3CU5A 3TD9A 4LRQA 1QP0A 3EQZA 3RQIA 3LOPA 4RK4A 1A0OA 5C5CA 2PUFA 3T95A 5IX8A 5KWSA 2YHBA 5TQ0A 5KQLA 4ETNA 3O74A 3H5WA 1E6KA 3QLVA 1DCFA 3Q41A 3LFTA 1NTRA 4XAQA 5FWYA 2NT3A 4F06A 4G86A 1QP4A 4EVSA 2LP4Y 1EWTA 3LUHA 1A04A 4TLMB 2QVCA 4RKQA 1ZITA 2ZWMA 3K9CA 3HDGA 1Z25A 1LK0A 3CS3A 2WWVD 4MQEA 2N9UA 1DC7A 1GCAA 3KS9A 1RPJA 4MS3B 4EVQA 1SD5A 3N0WA 4KZKA 4LE1A 4MYRA 4RK0A 3Q7SA 1JFTA 3OLZA 4E7PA 1NATA 4H3KB 1C0EA 3VNBA 5C5EA 2PLNA 3H5TA 3KSMA 3F6CA 2OQRA 1PUXA 3BRQA 3N8IA 5DCLA 5EWMA 5GOTA 4EYKA 1VPWA 3FFWA 1ZGGA 3HUTA 3CNBA 4RK7A 3QLUA 1ISSA 4NICA 5HM6A 1DBQA 3HJFA 3IPAA 3I5AA 4IF4A 1W9HA 1BAPA 2L19A 4NQRA 1EHCA 2E4YA 2I6FA 4Z4CA 1F4VA 2PUCA 3D02A 4MS1A 3A3KA 4ZMSA 5IEJA 4MLDA 3Q9SA 1KRXA 1ZN2A 4B09A 3DGEC 4DADA 3N0RA 1AB6A 5BQ3A 2DRIA 1KGSA 3QEKA 4YLEA 3NNNA 3QLUC 4PYRA 3GA5A 4S05A 3E61A 3FDFA 4DN6A 2H0AA 3E3MA 4RWEA 4FB4A 3KTOA 2MYNA 1U04A 2VUIB 3LUGA 5E3JA 2ID9A 1U2QA 1DG9A 3O2SB 9ABPA 4F11A 1YMVA 3DZDA 3JTEA 2E4ZA 3RVMA 2FSPA 3CRNA 2JVIA 4MR9B 2H3HA 4IRXA 2IPLA 1ISRA 5B3JC 4TLLB 2VUHB 1LBIA 1JDNA 1QKKA 2GKGA 4QYWA 1ZVVA 2PJUA 4KNYA 2WB4A 4PE5B 3JVIA 1GCGA 1JLKA 1JYFA 4OG2A 4Q6WA 5EWLA 4NCAA 3RVOA 2R4QA 1YK0A 3O1HB 3EODA 4Q7EA 4NCBA 3DGFC 3UKJA 5KQPA 3HS3A 1YS7A 2FLKA 2R25B 2QU7A 4ZJPA 5HQJA 2FMHA 5DKFA 5PNTA 2QSJA 5F64A 4MQEB 5TQ2B 3KYJB 3H1EA 3H5VA 3BREA 3A0RB 3OO0A 4UHKA 4KPYA 5CNKA 4H60A 4MS4B 1RXEA 4WUTA 1ZH2A 2NT4A 3VNAA 3HO1A 1DBPA 3L49A 3SG0A 1GLGA 3HUUA 4MR9A 4KVFA 3A10A 1NXTA 1F51E 2PKXA 3FFXA 2VYCA 4RDCA 3LTEA 1ZHHA 3EAFA 3H5OA 3CHYA 1ZY2A 3KG2A 3KCNA 5IUKC 3LUAA 4F3TA 1OXKB 2A9PA 3T6KA 1ZGZA 3RVPA 1P6QA 4D6YA 2FMIA 3UK0A 3IP6A 1CEYA 4MR7A 2CHFA 3TX6A 4YCSA 4G0OA 3HEBA 4Z4EA 2WY2D 2FQWA 2WRZA 3QEMB 3GV0A 3O2JA 3BBLA 4L4UA 2L17A 3CG0A 3DBIA 4DQDA 4ZYLA 1YMUA 4WZZA 3Q7RA 1IIBA 1A2OA 4QPJC 3FMVA 1VLZA 3EDCA 2MSKA 3Q15C 4G0ZA 4MRMA 4QICA 1T34A 3MF4A 4M88A 4NV3A 1E6LA 1RXIA 4EY3A 5KQGA 3O2QB 3JS5A 4MS4A 1BDIA 2FEKA 4Z99A 3B2NA 4JA2A 4LZLA 3T8YA 2JBAA 2WJAA 2O20A 4O5AA 5BRJA 4N0PA 5JS2A 1Z17A 2TMYA 1SXHA 5IEBA 4KFCA 1P6UA 4EYQA 3RVRA 3F73A 3ILYA 4KV7A 2VK2A 4KK4A 4H3HB 2E4XA 2LBPA 3H6HA 3LKVA 3RVSA 1ABFA 2FN9A 1MVOA 5JNRA 3GBVA 2IKSA 2JB9A 2GBPA 4S04A 1EFAA 3KJXA 5D2CA 3QEMA 1KRWA 1PEAA 4EVRA 1YS6A 3JPWA 4JB0A 3T38A 4MQFB 2PE5A 1D5WA 1LJLA 4RK5A 2FKAA 1FQWA 2YHAA 3GYBA 2RJNA 4JASB 2V0NA 2PL1A 3IP9A 4N03A 1U0SY 1Z2EA 3Q7TA 5HSGA 1Y1LA 3HCWA 3HZHA 4Q6BA 4XARA 1SXGA 3KLNA 5B3JA 4LDZA 2HQOA 4KQ9A 3SAJA 3TB6A 5KQMA 4HYEA 4YS6A 2JCGA 5BR1A 3M9XA 2GX6A 3MM4A 4Z9AA 3M9WA 4MS3A 4G0XA 4N41A 3QK7A 4KRFA 3QX9A 3SY8A 4ZMRA 1QNLA 4RXTA 2RGYA 1BVHA 4G97A 3IPCA 2X7XA 1M5TA 5T3YA 3CKMA 3TMYA 3OM1A 4LX8A 4N76A 5IULC 4JB2A 3OQMA 5ABPA 4TMYA 4MQFA 3OLXA 4ETIA 1XHFA 4UHJA 1DRKA 1HEYA 1ZAYA 3EULA 1WETA 3SNKA 1JHZA 1L5ZA 3ILHA 5CHYA 2B4AA 2A9OA 2PUGA 1BDHA 1QMPA 2HQBA 2ZAYA 1DCMA 3F7NA 3JPYA 3N75A 3KLOA 2QV0A 4W5QA 1USKA 3DLBA 5IC5A 4JP1A 3OQNA 1KMIY 3NNDA 3CZCA 2PUAA 2M98A 1APBA 3KYIB 4RY9A 3KHTA 5KC8A 4G0QA 7ABPA 5DLEA 3I42A 1AB5A 5FBHA 3LUKA 4CBVA 4O1HA 1TVMA 5TPZD 4QYMA 1M2EA 1YVUA 1Z16A 3N53A 3W9SA 4Z4IA 2QR3A 3OLWA 3EGCA 4YRZA 2WMYA 1QP7A 1NXPA 2IYNA 1PNTA 3NBMA 5TPWB 3DLHA 2LUOA 3HSYA 1VKRA 3KKEA 5FWXB 3I45A 2PUDA 4WXEA 4GNRA 5TPZA 1QQBA 5TE9A 2MYTA 4KQCA 1RZRA 3SM9A 1CYEA 3RVJA 4O1IA 3JY6A 2GWRA 1E6MA 2FN8A 1TMYA 2FQYA 2R48A 4IILA 4JAVC 2CWDA 1Z13A 1XWWA 2R47A 3LUDA 4EUKA 3SQNA 4G0MA 3HM9A 1U8TA 2RJOA 2JK1A 1Z2DA 4YV7A 2QW1A 1MB0A 1BDJA 1GUBA 1M2FA 1USIA 2HSGA 2L2QA 4RSMA 4MPTA 4HNRA 1P2FA 3H5IA 4E7OA 1K68A 4ETMA 1CHNA 3H75A 4XLTA 1MAVA 5TQ2A 1JX6A 3MQ4A 5GQSA 1D2AA 3HDVA 4RS3A 1YTUA 4F12A 3OO1A 2A9QA 3MA0A 3LUCA 2E4VA 4RU1A 2PUBA 2OENG 3RVLA 4F8JA 3C6QA 2QVGA 3BRSA 4RK1A 1ZH4A 4IMJB 1ZESA 5FWXA 4KREA 4Z9BA 1QO0D 1XHEA 2PMCA 4W5NA 5EWMB 1TM2A 3C3MA 1Z18A 3EJWA 2L18A 1M5UA 4MR8B 6CHYA 1FSPA 3L6UA 1UDRA 3QELB 1E2BA 4PZ0A 3ROFA 2FTKE 1SXIA 1D1QA 2WJWA 3O75A 4N0QA 1ABEA 3MMNA 4YR7A 5JNTA 1FFGA 3GRCA 3LUJA 3HVRA 1QO0A 5FBKA 1PHRA 1LBHA 3C3WA 4ML3A 4MS1B 4ZPJA 3CLKA 4Z0NA 3D8UA 1NXOA 3N6VA 4D74A 4EYGA 5KC9A 3N0XA 4IMIB 4W5RA 1NXSA 1DP4A 2P9HA 5CNIA 2P4UA 4RV5A 1FFWA 5JNSA 1TJYA 3S99A 3BILA 4KK3A 5IUNC 3MIZA 2PUEA 4RY8A 4OTZA 4P98A 4RXUA 4MLCA 4RXMA 2MSWA 8ABPA 1YK1A 4WXMA 2B1JA 3HXMA 4G0PA 1OXBB 4G0YA 3M6MD 4Z4HA 3QLVC 2HPHA 1DC8A 3QX8A 2PL9A 2HQRA 5DTEA 5KI6A 2RDMA 1H9CA 2AYZA 3CFYA 1USGA 3HV2A 4FE7A 4MR8A 5BRAA 3H1GA 3I09A 3QELA 4OLAA 4MGEA 3IDOA 4RKRA 2IDMA 1D1PA 5JNWA 4HNSA 2JVKA 2NZVG 1JWLA 1URPA 4Z4GA 1U2PA 1C4WA 2FW0A 2JVJA 2PAFA 1QPZA 1MIHA 5EWLB 4WWHA 3C3KA 3URMA 5I4CA 4PICA 5EWJB 4W5TA 4HNQA 3A0UA 5IUJC 1GUDA 4W5OA 4OLBA 4RK6A 1QQAA 4OBBA 3RVQA 2A9RA 3RH0A 3CG4A 2F8TA 1EWKA 3C97A 3R0JA 1NXVA 3K4HA 4JOQA 5TQJA 3OMWA 3ROTA 3O1JC 2GI4A 5ED4A 4EGSA 4Z4FA 2LIVA 3LKBA 5IBQA 2W42A 1JF8A 1J56A 2CD7A 3GT7A 5JS1A 1I3CA 4YP9A 1FFSA 1SRRA 1EWVA 1R8JA 1JFSA 1VRVA 3JVDA 3LUFA 4YWHA 1NY5A 6ABPA 2FMFA 1DZ3A 2CHEA 2ID7A 2XDYA 3FGZA 4XASA 1RZRD 1DBWA 2M1ZA 3P9YA 3HK2A 2E4UA 2FXIA 3GBPA 4L85A 2JRLA 2J48A 4FE4A 4LE2A 3H6GA 3H5LA 4MAAA 3G85A 1JBEA 4MR7B 2FEWB 5JNUA 2F8SA 1Z26A 4N47A 4TN5A 5EWJA 4WT7A 3O1IC 3OLVA 1TLFA 2FVYA 4LE0A 4YGXB 2FEPA 3F6PA 4EYOA 2MYUA 1K66A 4RY0A 1LJUA 1W25A 2IOYA 1JDPA 1JYEA 4MRMB 1S8NA 2E4WA 1NXWA 4Y9TA 5TQ0B 2IPNA 5JNVA 1Z12A 1MB3A 3H1FA 2NUBA 3NHZA 3OM0A 1JH9A 1DJMA 3LMKA 3OMXA 4PEVA 1JFVA 3GWGA 1D4ZA 4KMRA 5FWYB 1L5YA 1EAYA 2IPAB 2JBAB 4D6XA 3CZ5A 1PNRA 1ZDMA 2IPMA 3FFTA 4XXHA 2MSLA 2AYXA 3RVNA 3NHMA 3EQ2A 3GL9A 2Q5CA
chains in the Genus database with same CATH superfamily
2KYRA 4EAQA 2G09A 3G1WA 2IIVA 2VJOA 1T24A 4AFNA 2PTGA 3LPNA 3T3PB 2ZWOA 3GRFA 2YXDA 3GEHA 1V0JA 4BNWA 2GD1O 2BZGA 2OBXA 3KALA 1CUFA 3EZ9A 3K71B 4GPAA 1Z15A 2XF2A 1KDOA 2GEKA 2ZJZA 1KSGA 4F97A 3U16A 4CF4A 1NJSA 3JAMA 2EARA 1S8AA 3R0IA 4NBVA 2K87A 2C5FA 1NGSA 3H5RA 5FWAA 2YL2A 1B0PA 2XE8A 4JNCA 4ZEWA 4ND1A 4PO9A 3CR8A 3A4TA 3FD8A 2RC6A 3GDOA 4LGCA 1I13A 3LOPA 2XTJA 5CYPA 5GGXA 2HWYA 3BKXA 3G8YA 2HSJA 4EABA 1QFSA 1L3BA 1HDYA 1Z8FA 2IODA 2PLFA 3UTDA 4C0LA 4HX2A 1ZCAA 3THSA 4KZPA 3LFTA 4NESA 3IC5A 4PTLA 4RJIA 5DHTA 1P7YA 2PZMA 2ZE8A 3K0EA 4GLOA 1X86B 4LK2A 1XJ0A 3KQQA 4U7TB 4AKEA 4FGJA 1F2TB 5EIWA 3WS7A 3WZLA 1KP3A 2FG7C 1BA3A 2QVCA 3FHOA 2ZWMA 3MAGA 4XEHA 3WXMA 3ZHOA 5BN3A 4BNYA 3TNLA 2B7LA 2QV7A 5EG5A 2B36A 3AR5A 2JAQA 2ECQA 4CCSA 2GAIA 3AOGA 1GCAA 3SDSA 2PFSA 2ZIEA 1V2GA 3DDSA 3TNYA 4P4NA 3IV9A 1P7WA 4UCWA 5AP9A 5EZ6B 3OUTA 4E4RA 4CIAA 1BWSA 4C4TA 1L5SA 5LP1A 2I8CA 4HVCA 4J1SA 4QKQA 1IOWA 2CUTA 4Y9UA 2CD9A 4O4IB 1U0GA 3DKPA 3HJUA 3OZAA 3WGYA 2PS0A 1A3CA 4NAHA 2O8BB 4PVCA 1TZCA 4XB2A 3IQHX 4RK7A 3I3SR 5FI0B 5A2GA 4OL9A 2ZAIA 3KK0A 1NRXA 3VNSA 3GIWA 1LXCA 4WLUA 5K4AA 4EY4A 5AVZA 2GF9A 1IJBA 4NFYA 3L6CA 1C81A 4KOAA 4HUJA 4HRAA 3L8GA 4IMPA 4BNGA 1NBME 4EZIA 2VJDA 4NYIQ 1W2GA 1XCMA 5AXDA 3U4GA 1IYZA 1X74A 4B0PA 4EA6A 4FZJA 3UTCA 3INRA 2Q7OE 1LLUA 5IT9A 2QTCA 1DL5A 3NX4A 4IV8A 3TZBA 3NATA 2HFKA 5BYKA 2VHEA 3NNNA 3JZMA 1MNQA 3OEYA 3RI3A 5A0FA 3KOMA 1M34E 4K28A 1DBSA 1HGXA 1C3OA 4RWEA 2OGUA 3G3EA 3KZKA 4HAUA 1E4EA 1KE2A 1QRTA 4PHHA 3PVSA 4YRBA 4YCNA 5K0FA 1GRQA 2H5LA 3JTEA 3V6MA 1PNOA 4KI0A 4PQEA 5EMHA 1IEQA 4QG3A 2ZE7A 4INZA 1ODTC 4UDXX 4WXRA 1U6JA 5HEKA 5LQSA 2CL7X 1QLHA 1E66A 3CRVA 3TBFA 5JZBA 1G5HA 1MDBA 2D2FA 4LWOA 1TVKB 1XN1A 4R8RA 3TTYA 3PX2A 4DABA 3RYFB 4YTEA 2CHVA 5K0TA 1MABA 2VJCA 4I1PA 3EODA 4M1ZA 2XCTB 4CKCA 1NF8A 1FMLA 4QNMA 4RULA 3DMNA 3A36A 3AEQA 3DE1X 2IV7A 5CD9A 3IDSA 2JFNA 3QVLA 3ZGZA 2P1RA 2XMGA 3HWWA 4BNIA 4CU5A 3N05A 1FNCA 4Y3UA 5A4DA 1RWMA 1GQ2A 3EG9B 4I5IA 1XQ9A 4HS4A 4JZKA 4PGHA 4B6QA 4HQ0A 2FPSA 3ABRB 4GMGA 4FMCB 2UZ4A 2BONA 1W96A 4KHPB 2GCEA 1JEDA 4UAGA 1LI7A 3OO0A 4UHKA 3VI3B 3CRMA 5CNKA 1KJQA 2FZCA 4WUTA 1RXEA 3VZCA 5L4LA 3THWB 2JI7A 3KKKA 5KYTA 4OKNA 2IHNA 3ETGA 3QVWA 5CLHA 2M6LA 3L49A 1JMKC 2CFIA 4OLJA 1NBWB 1RCFA 3P2JA 2ZTMA 1FBTA 1ZY2A 3KG2A 3MCUA 4QHYA 3DR5A 4QBKA 1SVKA 3OCXA 1NDHA 4G63A 3CVXA 4I8DA 6GPBA 4OXKA 2BTEA 1NQ5A 5FUXA 3B82A 4H7JA 4EMTA 1WOYA 5JD6A 2WJ3A 1J42A 2IK8A 2ZJYA 4OHWA 4M0LA 5CDHA 1G2OA 2E3JA 1CUZA 3KOWA 4J16A 5EIOA 5CPFA 2WIKA 3R3XA 4G4SO 3DWGA 1NQOA 1EJ6A 1SIUA 4HPXB 4I1VA 3CG0A 4DQDA 1RWBA 2OCLA 1R12A 1YMUA 3H5AA 4MW7A 2VF2A 1G5FA 4G4GA 5EJIA 1QH9A 5J9FA 2P78A 2KB0A 3OI7A 4IIFA 1BVUA 3TJMA 1V11A 2JZOA 1KDTA 1FTWA 1PFWA 2ZRCA 4NDZA 1Q0HA 4W7IA 1GRCA 1OAOC 3QFHA 4A26A 3Q7EA 1EVKA 2H7XA 4I5DA 4N5MA 3FHCB 2CJXA 1WUIS 3OETA 3JD4A 5B1HA 5KYNA 4BJ6A 1U7HA 4OFXA 3LI2A 4WD3A 1XXLA 2HWUA 1XRSB 5THKA 2V54A 3L6OO 4MH0R 3S3TA 3SCZA 1Z17A 3T4PA 2AWNA 4QBIA 3HZZA 5CT5A 1SXHA 3F7OA 3WLFA 3OT1B 2X1HA 1K0UA 1WUTA 3FTDA 4P3OA 3S8MA 2UZ3A 2Q3LA 2H54A 3VBCA 2HDNB 3E53A 4DL9A 4UTRA 2Q41A 2MTBA 3Q85A 4K6MA 4CE6A 5ERYA 1A9YA 1BWQA 3AP3A 3KYCB 2CFRA 6REQB 3G2NA 2A1TR 2GRAA 4BNJA 4UTPA 1DAEA 4DV3B 1JRLA 4K9MA 2OXCA 5HILA 4BCDA 1PEAA 4QU8A 4DSAA 1GKKA 1RKQA 2OILA 1TYCA 1MMFB 2JCVA 2ROQA 3BWXA 4UQOA 5KTMA 3OJWA 3BH0A 1N6LA 2AZXA 2CHQA 1Q7EA 4LTMA 4ARBA 1ORHA 1GL3A 1D1SA 2O2YA 3DXXA 1KXJA 1Q0UA 3FGPA 4H6VA 4LDQA 4LNHA 3ZS9A 5CLJA 2IYTA 4GECA 4P58A 3IP9A 1HTBA 5KYXB 4PSKA 3DHYA 4EOGA 2EX4A 4PG4A 5JH7B 2R7AA 1U5BA 4G01B 1KQ3A 4JGBA 3FAKA 3IIMA 4JKYA 4NS1A 1JLHA 4U39A 3X1XA 1C9EA 3CM0A 4AL4A 2OWEA 4IL5A 3IP1A 3MM4A 5H02A 4Z9AA 2CLMB 3ZWBA 3TW0A 4Z3OA 1T1IA 1E1MA 2NO0A 5D5PA 3CBGA 4DYVA 2E49A 3TMKA 3IAS6 1X0VA 3SM3A 3WSTA 1K6MA 2VDLB 4P7BA 3EGDB 4ARUA 1KOGA 2FZ5A 1GR1A 1NMEA 1PT8A 5IXYA 1B8UA 2BFDB 3L0ZA 1CUGA 1XZFA 3QG1A 3ZWXA 1PWHA 1RAGA 3GJYA 2QJWA 1NJ2A 3P45A 4M0KA 4AC9A 2VS1A 4AZ0A 4UHJA 1IOLA 1ZAYA 2N0SA 3EULA 5AHWA 2GASA 3T4XA 4ND4A 2ZUSA 1FS4A 4LK3A 1YQUA 1BDHA 4GOLD 1YB7A 4TKVB 1RJ9B 3F7NA 1BOFA 4BTEA 3TTXA 1KL7A 1WU7A 4BX3A 5HQTA 4YHHB 5D01A 1HL7A 1KMIY 3M4XA 1SCUB 3O8QA 4P34A 2E21A 3O2NA 4A6PA 4LHXA 1OWLA 1RXYA 1U4NA 4JC4A 1AB5A 4JQSA 3S2FA 1QHEA 4CBVA 2CXNA 1XCOA 3MNFA 3JCZA 1V5GA 4XGRA 4AN1A 1N3YA 2J5QA 5DMHA 3N2KB 3RRZA 1HT1E 4EX6A 3A6GA 5DF1A 1MAUA 4Z49A 1P29A 2E37A 4PLCA 4HN4B 3O73A 4PNHA 1PQ4A 3U80A 3C6YA 4BXOA 1Z5WA 1ZUNA 2WHXA 4PC3A 4KMMA 4P93A 5C53B 2P9FA 4X6UA 1Q19A 4ROSA 5J2TA 2GJSA 1KEVA 3AY0A 5CITA 5IWAB 3Q11A 4TWAA 3GJRA 2Z6VA 4DPMA 2GBCA 3DTVD 3RIEA 4YRLA 2QIOA 5JDIA 2ZR9A 4BAZA 1DELA 1I9CA 1OT3A 2EZ4A 3CKKA 1UJMA 2FN8A 2NADA 1U2SA 4IILA 4QDOA 4C2BA 1JEOA 3ZE6A 4F45A 2REBA 3ZGXA 1WL8A 4FPXA 4KR0A 3M6UA 3I62A 1YASA 4W1QA 3GZNB 1R0RE 3H1PA 2UAGA 4O5OA 3TLAA 5H68A 1GPBA 3MOIA 1QZXA 2CW5A 4JX9A 1RM0A 2R65A 3VHLB 1N77A 1USIA 4IG4A 4J0JA 4PS0A 1BRTA 4PQRA 4D9CA 4HNRA 1A27A 5ETJA 1SC4A 3H4VA 4E5UA 1UAAA 4OYLA 3WJ7A 4TYMA 3QOXA 2XDAA 1E2GA 5TIIA 2W83A 1SHKA 4OJMX 5HF5A 4GYKA 4ABYA 4RJTA 3H2SA 1N2CB 4PZZA 3OZDA 4Y2UA 3ZWCA 1OX6A 3OBBA 1VYVA 4F12A 4G1VA 2ZZMA 4MWTA 4L9AA 1NYTA 1PRYA 2MINA 1FPMA 2RI1A 3K2EA 4LHZA 5JROA 1BMDA 4YJFA 3IKVA 2QL9A 4ES6A 1KMHB 1H4QA 2AX3A 3FH0A 4HGRA 3FIJA 2QHXA 1MBZA 1G5PA 3PIRA 3UNXA 3EPKA 1GT91 3UAYA 4RH0A 2IYSA 3MINA 3QMVA 4MA0A 1JFLA 1W4BA 5BSGA 1UJCA 3RS8A 1TKRA 2XTAA 5FNZA 5EP4A 5SZKB 4D4MA 2C4HA 1DEAA 4REQB 4UU1A 3H9BA 1V8ZA 4U6QA 1H0SA 5FOSA 1UP4A 4HMPA 3HZOA 2FX5A 2DFTA 3NFYA 3A37A 1LUAA 3TOZA 5BNWA 2ZR0A 2JEYA 3EJ6A 1Z56C 2R85A 3N6VA 1YJ8A 4PONA 3N76A 1P1RA 1EFVB 3ND5A 3T1NA 1NXSA 4UVIA 1FRNA 2GLXA 3BIOA 3I9FA 4TL9A 1RP1A 5AVRA 5JZMA 4MV5A 2EV9A 2HF2A 2VJYA 3ELWA 3AF5A 3I9V1 4EY5A 3NHFA 3GLFE 1YBVA 3ZHCA 3PF8A 3ZDRA 4YAFA 4BFTA 1N2XA 2A0YA 1U2DA 3DWFA 3GFGA 3QFRA 5I51A 1TAUA 5C8ZA 1ND6A 3RW9A 4ENRA 5JJCA 3MWKA 3QOFA 3D54D 4ND7A 3AKDA 2X41A 3D3KA 2HV9A 3H19A 3IMGA 3QLVC 5EKUA 1VLLA 4D9GA 4PBRA 1J2RA 3KQOA 4IZIA 4BFCA 1N8TA 5JZSA 4UEJA 3H8WA 1EK1A 1F20A 2F8MA 1AK1A 1USGA 3PEEA 1I3KA 4LJKA 4UAUA 4Y2VA 1BS9A 4YALA 4L5AA 3E3LA 1LX7A 1VG9B 1JB9A 5KAMA 2VWQA 3KC2A 4ZVLA 3EYAA 3WO0A 3R3SA 1VKHA 1QHXA 2YHUA 3FTCA 3O9MA 3FMFA 2IELA 2OZLB 4JEIA 4BO1A 3EC2A 3TQFA 4U2FA 5A03A 1XDWA 4HDMB 4JT2A 2PMBA 3GPIA 3IIIA 3COJA 1X9GA 3Q87B 2NO7A 4B73A 1F7UA 4FDUA 4OXNA 3JQQA 2IF0A 3GELA 2XWSA 2XUOA 4QG7A 4ZOEA 5CBKA 1I7NA 5IVDA 1BKDR 1Z0JA 4YRSA 3RH0A 1KORA 3SIPA 4Z0HO 3HJHA 2BZSA 1YQWA 3HCNA 3T7IA 4AYXA 1PR3A 2Z98A 2YVKA 3BRWA 4LYYA 4N0MA 5A6SA 3IT1A 1HDIA 1P62B 3PS9A 3VR2A 5L51A 2PHZA 4GL2A 1QDEA 2GXAA 4QU9A 5DPMA 1UWCA 2VWPA 3WMRA 1ZCZA 4G1MB 3D7MA 5MGNA 1YRWA 1UCFA 2F1JA 3EFOB 1UEJA 5FPKA 4Z9YA 5EXDA 2FFJA 4PYMA 5CA1A 1FDVA 1X80A 4E21A 5B7QA 4EI2A 2CHEA 4PHTA 4EEXA 3DAGA 3O8BA 1U2ZA 3WGIA 1E3SA 2YZNA 1K08A 1V95A 2X1LA 1I4WA 5GVSA 3UQZA 2WVJA 1TUEA 1VZ2A 3QFFA 5EMJA 4JI1B 2WUWE 1W4LA 4TT8A 3RTDA 5F9FA 1OWMA 3HB4X 4YQFA 4RGBA 4HWGA 2E5LB 1SD1A 1U7UA 2JZNA 1R9GA 4FFOA 1TTHA 4V0SA 2JLQA 3O0TA 5DEIA 4UVGA 5FUQA 3SOZA 1DJOA 2CMKA 2DPYA 2OLEA 4CMEA 4HGOA 5DNUA 1OH5A 1W19A 3BCRA 2XOKD 3U6BA 4MB6A 4OLHA 4RY0A 1C3JA 3ZWAA 5LLDA 3ONDA 4X1IB 3TRHA 1ZMOA 1YZYA 1Z7YA 1A9PA 4I50F 1NFFA 4Y2SA 2I33A 5L3ZA 3Q10A 4D44A 1QG2A 4EI9A 1TT7A 3GVPA 4D0LB 3RUCA 1D0IA 3N39C 4NK5A 5B2ZA 3T4UA 3JYOA 5LWQA 3UMGA 3GP3A 1NQAO 1L5YA 3KO8A 3LBAA 4FKMA 2D4AA 3AEYA 1GQOA 4NCHA 4QDZA 4YAJA 3RSLA 1PNRA 4WQMA 1ZXXA 3VH4A 1XZMA 3CW8X 3OQHA 4LSWA 1U9JA 2OCDA 1LW6E 4IX1A 4AX8A 3UK2A 4GE0A 4P33A 4RIIA 2Q4BA 1R8XA 3BDIA 3TUJC 1TNDA 5T3UA 1UBOS 1XLWA 4MUAA 3IVAA 1E1CA 4KBYA 3BT7A 1V47A 1W5SA 2FFAA 4G3XA 1W36C 3MG9A 3WGJA 1AUOA 3O03A 1WPGA 3ZIAD 1ZRMA 1E0SA 3GLSA 4MUXA 1XNRB 2I7CA 4EJSA 2VP0A 1IG0A 1X38A 2HX1A 5IYZF 3V3KA 4C7BA 2DFVA 1GDHA 1QTIA 2RGGA 4RZXA 2QNBA 4IHAA 1TYEB 3L07A 3JAWA 3TWOA 3RSGA 4K1XA 2F8LA 5FWYA 4X5OA 2NT3A 4IDNA 2AN1A 3FMOB 4W99A 1Y8QA 1ADFA 3UN1A 1P17A 1RJWA 2L82A 4M6WA 2CNWD 4HC4A 5L7YA 3VV3A 4BO8A 1N9GA 2YOFA 3EZNA 4YQZA 4D4HA 4DR7B 5KSPA 3T3GA 4WFQA 4RLQA 1JZQA 4GPEA 3GLQA 3ZU6A 2Q6IA 2WA1A 3ICOA 4RTRA 3N8NA 3TQCA 5FPTA 3QKWA 1SBCA 3DXFA 3AEUA 2G6BA 1W87A 2X14A 4G0VA 2QTRA 1EM8A 1Y82A 4PNZA 1U7WA 2FE1A 3SU8A 3FPAA 4HDKA 3G88A 4M1WA 3FYDA 5T4FA 5DX8A 1B93A 1OI4A 2D1TA 4K6HA 3BMCA 3K9NA 5BNFA 2AFHA 1JAHA 2PQ2A 2EKBA 3ANLA 3FBWA 4BN0A 5JMTA 3KQSA 1MFPA 2RB4A 4EUHA 3QF7A 3C5VA 1TJPB 3OHMA 1WW8A 3GD5A 3P2MA 1WZCA 3TRKA 4DNOA 1FIUA 2F3PA 2KQUA 3Q5GA 1GFIA 2DSNA 2G5TA 2PZ8A 3FDXA 1VIVA 2O6LA 4MLDA 3NHJA 2OY0A 4B09A 2NPIA 4JVNA 4G5GA 4QJBA 1JFFA 4QHSA 2J9GA 2FMTA 3RC8A 3PKJA 4E13A 5D85A 3SZGA 3TMAA 2C9ZA 4HEHA 4DEYA 5JR3A 1NRJB 3FDZB 3LC7O 4F0JA 1W93A 4K9NA 3OU2A 1RLUA 1TD1A 3KFXA 3QLUC 2NAFA 1R16A 2ZYAA 4MB2A 2J41A 2WIAA 4ARSA 1U3DA 1J99A 3VRHA 3CUEF 4IV5A 3VPBA 4ARZA 3T41A 3B89A 3W5CA 2IHVA 4OYHA 2EBUA 5EE1A 2XE7A 5E3JA 1THTA 5JISA 4WOCA 4ZVUA 1R0LA 9ABPA 2OZPA 5IZ4A 4IO1A 4DCNA 4M0UA 1WU8A 4NG4A 2OXTA 4XPZA 1BCSA 4ICIA 4GU5A 3ONNA 2J0UB 2PBRA 2UYCA 1FJ2A 2FN7A 4Q9NA 3SQMA 1VM6A 4ZVNA 2IY9A 1J1UA 1ESMA 1Z06A 1E63A 3T5DA 3O95A 2AS0A 3UFXB 1EPUA 1I1QB 3CH4B 4IOMA 3RQSA 1ZX1A 1FX1A 3W5JA 3UB2A 5KSOA 3UKJA 1YKSA 3LF2A 4KO4S 1I0ZA 4FFLA 1YS7A 3BMQB 3DAHA 4GSLA 1XZKA 3SN6A 2PA3A 4FS3A 3CEPB 3T12A 4ND3A 1FNSA 1G8MA 1YBMA 4Q19A 4UPDA 1UXOA 1KJ8A 1XK7A 3IBGA 5PNTA 3ZDDA 2WP8J 1Q3HA 3H1TA 4YV1A 5TQ2B 5BW6B 3ZU4A 3HG7A 4LXGA 4UM9D 3H5VA 2CCKA 1ZRSA 1RWWA 2REQA 1M2NA 3UHPA 4C6SA 2O1XA 1IXZA 5DDIP 5L3SA 4B8ZA 4AULA 1D03A 2Z6UA 3ZJUA 4N7JA 1ZH2A 3GA0A 5KJ6A 5HNKA 2GUWA 3WHLA 2EP8A 3IIKA 2H51A 1OIXA 1DUVG 1PQPA 3BZBA 3FCYA 5K6RA 2J3MA 4RZHA 3R9XA 3A6LA 3CUUA 4FOLA 1FRFS 2OOSA 1ZHHA 2ZSBA 3I28A 1L7DA 3CHYA 1H4SA 2VP2A 2IE0A 2GESA 2P1DA 5BSUA 3TIFA 1II8A 5GOZA 5LOVF 3HFRA 5BXQC 3AJ8A 4XUDA 4EQ6B 1QMGA 1Y6ZA 3SSOA 3WIUA 2OO5C 2O2SA 3EA4A 2VZ8A 3INNA 1JXQA 3FCUB 3IP6A 3W2FA 1DUIA 1XE3A 1J1IA 4IW3B 2VF5X 3DE4X 4DARA 2H31A 1Z08A 4U9IS 4G81A 1WTAA 1A88A 2F9LA 3AO0B 3MQ2A 3UV7A 3ZE9A 2HXGA 1TTQB 3ZIDA 3UXHA 4GM1A 5HUQA 3MAJA 1FDRA 3G9UA 4LVCA 1NN0A 4WZZA 3SYNA 4CMKA 4QU0A 1LLQA 3C3AA 1F6BA 2R8OA 4MRMA 1N5LA 1B3BA 4CKYA 2B5WA 1L8XA 3CH5A 3MF4A 2G6TA 4AWBA 3U56A 5LQNA 3KB8A 1E6LA 2DKNA 3FFBA 2P2LA 4N12A 3AY6A 2ZK7A 2PR2A 3PNQA 3ENVA 3W7BA 1U28C 3K94A 2LDXA 3EDMA 4G25A 2D2XA 3EEOA 1ND5A 1PQWA 1G8YA 3LO8A 3WHKA 1T2UA 2Q5IA 4LJRA 4M1QA 4ARVA 4C7VA 5B55A 4G9BA 3TM5A 1RSZA 2HSEA 2XY4A 3WGGA 3HP4A 4YJGA 4M0EA 2PX5A 4KK4A 1EQ2A 4WNIA 4RL4A 1LS1A 3QM1A 3ZV6A 1EINA 2B7CA 4GX1A 3GBSA 2DUMA 2CMDA 2ZIWB 3ZTYA 1MFZA 4B48A 2D2EA 3DDZX 2M32A 2XSZD 3EEQA 3IAEA 3NHYA 5D2CA 5G53C 2DQKA 3QI2A 3RSHA 1XLTC 3ZD6A 1JZSA 1VL8A 1QAQA 2FI1A 2RFLA 2YC4C 1V9CA 3QHPA 4GBJA 5JFOA 2GH1A 2GS9A 1M8KA 2BEJA 4FEGA 4G9EA 4MQFB 5B37A 2PE5A 5KNCA 1II0A 4IXWA 2GJ4A 2VT3A 6NULA 1UBMS 5EE0A 4GEGA 1YZGA 1AV7A 4YMVA 4FZ3A 1FNDA 3OG9A 3OY2A 5I7FA 2NUPB 1VHJA 4EB3A 3RFCA 1HE2A 5EE9A 5GGYA 3GJ3A 5KO2A 3PC2A 3R6DA 4MJLA 2HQOA 5K0LA 3VKHA 1BFDA 1LRKA 1K8YB 1B1AA 1N5DA 3KYDB 3IKJA 1K92A 1Z2OX 5JADA 1YBHA 3D6HA 4B2IA 4HFJA 4J3JA 2WTEA 1L1FA 3IB6A 1I1HA 1I3OA 2WF9A 1CJTC 4RXTA 2IW3A 2R5NA 3M5CA 3FPBA 4OU5A 4U1RA 4EY7A 1JTVA 1HF3A 2O57A 3KHUA 4X7BA 1ZQ1A 4LMRA 5A7GA 4CGYA 3FPHA 2IHJA 1R4NA 1Z82A 2AK2A 4NF2A 2YQZA 2PMKA 4E2XA 4UBLA 1A2QA 1MD9A 1C0IA 5SYAA 1NBMA 1Y98A 4I1RA 5BXYA 2ZSHA 3WIEA 1XHFA 5EXEA 5KDDA 3A9SA 3DBVO 4KU4A 1ZIDA 1HEYA 4QT0A 3EOZA 1C7JA 5G40A 4LFCB 1S4MA 3DL2A 4C7MA 5HX7A 4TMVA 2VAXA 5ES3A 4ZDJA 1NVAA 4FWBA 2G9NA 1FF9A 3KZVA 4NU8X 4P35A 1L5LA 3MTEA 3KVVA 1T4CB 2JA2A 4IHKA 1M34A 2QZ4A 1JSXA 4WY5A 3KL4A 5E0OA 2XT9A 2F1IA 4D4IA 1ZJ5A 3CQ9A 1GG9A 2PUAA 5LVAA 3UXYA 3GCGA 4RL6A 4GKJB 4ZREA 4GPIB 3T0FA 1WM1A 2W8BB 4NCNA 5HGJA 3TL6A 3RAPR 4D5EA 1H2WA 4I2NA 4UHFA 2IZ6A 4Z4IA 1N6OA 1L9XA 1HH4A 2IYAA 2VRCA 3IQFA 5WRFA 3SYLA 3L1IA 1N78A 3CCFA 4R41A 3PFWO 2F17A 1OGJA 3RAGA 4RMGA 3FBGA 1MF7A 3SHFA 2G9VA 3BK1A 3OLCX 3UOGA 1O97C 4OUKX 5KYWA 3F90A 3AF6A 4AO8A 3I5XA 2WWHA 1OYYA 1K5PA 3I45A 3KKEA 3DDHA 4ZRNA 4YUVA 4HRVA 3DWIA 1KEWA 1GZUA 3LP5A 5DSXA 3L8MA 4IVRA 4BEVA 5FEUA 4UJ5A 4LHVA 4A82A 5BWBA 3UV3A 4H0NA 1LZLA 2AG0A 3LFHA 4DCPA 4EI7A 3ET4A 1SA0A 4EUKA 2V7TA 3IULA 3MVEA 3SQNA 2UYYA 4YV7A 3RGWS 2QRNA 4JQYA 1XRQA 3DE3X 4H27A 4QXRA 5FUVA 1HR0B 2QY6A 2PZBA 2ZYHA 4RZIA 2J7KA 3GD7A 3V80A 1V4VA 5KX5F 3L06A 3CB4A 4QFCA 1U0OC 2NZ2A 2W6IA 4GBMA 3X1YA 4AG5A 1XP5A 2QYTA 1D6MA 3S40A 1PJ3A 1SNYA 3WKCA 5BN3B 2V1UA 3O0DA 4PX2A 4ETMA 2W2NA 2I4IA 2Z2KA 2ZRAA 2QD4A 1XTUA 1XU4A 2ATXA 3KBBA 4UU0A 1P2GA 1X39A 3EBPA 3W1WA 3OIGA 5JHHB 1M10A 1NW3A 2I1WA 4YAEA 3PF9A 3EARA 3ZVMA 1CEXA 5JXJA 1E2LA 1BNCA 1B14A 2E4VA 4WN9A 3REFA 1HEIA 5FOQA 4TUYA 4BNXA 5A5DA 2FPIA 3M2PA 3NKFA 4YY3B 2EFJA 2W2MA 1RVDA 4DZRA 3IOYA 1HE1C 1XT6A 2Q5OA 3KYBA 1KS9A 3A6HA 4YIKA 2J1LA 2HJVA 4G9GA 4OLFA 2W0MA 1CNMA 4IRUB 4TTPA 3GUCA 4U9UA 4W5HA 3WC4A 1FYEA 3X2SA 3U5ZB 3PEVA 4DS3A 6CHYA 4JEHA 1ESNA 3I04A 4UAJA 4WLEA 1R4MB 3ROEA 3ROFA 2ZBEA 3WAJA 1E2BA 2NO1A 4N8DA 1KFKB 4R7GA 1S1MA 2DT5A 3FI9A 4JXXA 3U9LA 1XMOB 3LUJA 2EFDB 2XKAA 5CG1A 1ZJYA 4YPFA 1R18A 5HCNA 1QDLB 2WQZA 3BCHA 2FY8A 2JIZA 3PDIA 1BYUA 4JVLA 4QULA 1P4GA 4DN6A 3T1OA 3OTGA 3OPYI 1N3LA 3QXXA 5CNIA 3FTEA 3IPXA 3RUAA 4HV4A 4G0NA 4MVJH 1KYIA 1ZK2A 4YRKA 4IMRA 1QAMA 5LMUB 1C3OB 2J9ZB 2YWCA 5ILOA 3RIHA 1E4EB 1JQAA 4QARA 3M6MD 2P6NA 3M5PA 1QOPB 4C78A 1ADYA 1GPH1 3LYLA 3ZW9A 2J87A 1Q1EA 2R68A 1J2TA 1P0PA 4QNRA 2JIBA 2ZETA 1YUNA 4A91A 3JRNA 4GVLA 4AUMA 2AYZA 2P6PA 4F5WA 2XZLA 4UEWA 5BW5A 2C96A 3HP1A 2V7EA 4OLAA 5F9MA 1ZO8A 2LWIA 3ND6A 2YV3A 2GF0A 3K9GA 5EHQA 3KPUA 3QLJA 1URPA 3ASUA 3IUPA 3O6VA 4S3MA 4U0KA 3F9CA 2P5YA 5AJZA 4LQDA 5LMNB 1UZLA 1XNQB 2QLLA 4TXMA 1MABB 1Q1GA 3BEOA 4MUIA 1YT5A 3P20A 1LZKA 3EXG1 4HNQA 5FXMA 4L0DA 2JCXA 3DT6A 3K4QA 3V4SA 3WRWA 4O2BA 3AEQB 1W4CA 4JJIA 5KTTA 1CJSA 2CK3D 2SNIE 2B6HA 4NL4H 4D9FA 2ARKA 2LZ0A 4YUAA 3PUVA 3QJGA 3DFUA 3KJEA 1Q74A 4GR9A 5FBZA 3B70A 3SSNA 1ADBA 1NC1A 4YP7A 3RS2A 1J33A 1VPVA 2ZUUA 3NBZC 1UDWA 1O6FA 3OD1A 1N33B 1UPFA 3ETHA 4Q9DA 3CF0A 4XLLA 4EITA 1Y3CE 1EFRD 3KAQA 1IZ0A 4CHTA 2NO6A 2A3RA 4JJ7A 2C3PA 3EIOA 4C88A 1E6UA 4HNHA 4D3SA 4AN4A 3JVDA 1J8YF 5HJ2A 4IEEA 5IAGA 5TT0A 3VGPA 4Z3KA 5C81A 2AEMA 5JC1A 4YRFA 2CSXA 3ER6A 2GPSA 3M3HA 2ATCA 5F9HA 5BW8A 1AMUA 3LT0A 3UAOA 5FWNA 3UW1A 3HDYA 2IP4A 4CLRA 4S24A 4NARA 5LU8A 1HBJA 3OE7A 4DCMA 1RABA 3Q6IA 4LE2A 5K05A 1SC9A 4E09A 4MXDA 4RACA 2HFJA 1OHHA 3PX3A 2VDJA 4RYLA 5I9LA 3LDFA 3KU1A 2O7QA 1P0MA 1QCYA 1Y1KE 1ZLYA 2DHQA 2GCGA 2KBFA 4HWSA 5THQA 3Q8WA 4DTCA 4MWBA 1AY0A 2FVYA 2H1IA 3ETEA 2C5BA 1FB5A 4WKGA 3UGJA 1BHJA 1V5IA 1W25A 1E0AA 2BIFA 1VJ1A 1XMSA 2JJ1D 4POOA 1V11B 3A04A 1BJKA 3VISA 2X6RA 4OV6B 3ZDCA 5ICMA 3ZHZA 1V3QE 3S0JA 2DTXA 3QY0A 1JQ3A 4OHVA 4BHTA 1V26A 1LNQA 4D6XA 2CWWA 2QTTA 3A31A 5F3DA 1K06A 2R2GA 4PYIA 4CDNA 1QKJA 4MVJD 5ENVA 3RVNA 4D02A 3Q3JB 3S1AA 1NFRA 2R1VA 2XLBA 3IBYA 1F6DA 2BFNA 5JO0A 2XUAA 4HQNA 1OLSA 3D4BA 3EXEA 4NSNA 2FPOA 4TRJA 5KYUB 2EQBA 3DCIA 2EFCB 1Z6PA 2ZJ5A 3D4LA 5JZOA 1MO3A 1L1QA 3EPRA 3BFJA 3IP5A 1D8AA 1XD9A 4ZOBA 4NHEA 4JT9A 4Q1BA 4X61A 2M6RA 5JDCA 5E4FA 4JX8A 1C1YA 1XXHE 3RU7A 2FF7A 3TD9A 1PK8A 4R1OA 3WWZA 3TCKA 2FHPA 3QY9A 1R64A 3HL0A 3TEMA 3SE0A 4EKNB 3C1AA 2VAMA 2WNIA 3RVDA 2B5OA 2GUGA 3FW1A 2HA7A 3CO5A 4L8FA 4ZAFA 3TZLA 5HJ5A 1HM5A 2WWWA 4UU7A 1I7QB 1UBLS 3ADKA 1RDFA 2WYIA 5K1ZA 2VTBA 4NAVA 1I7DA 2UUCB 3P71T 1O95C 5KPDA 3SHOA 1NBEA 3DJYA 1U5BB 4IVQA 4AIIA 1GGJA 1Q0RA 2IXTA 4IXTA 4R05A 4HAXA 3U13A 1EB9A 4GHWA 2H8GA 2O7VA 5ALMA 2ZJAA 2OFWA 5TR9A 3KVNA 1P2DA 5AVYA 3AM3A 3H18A 3GLIB 1OFIA 3N0WA 4I50B 5AK0A 1UP7A 1Z38A 5GM2A 3V8RA 1JSZA 2ATIA 1O58A 1YQTA 4CDGA 1Q0LA 2OK7A 3QNUA 4IY1A 2PBZA 3DM9B 4MW2A 1RLIA 5C31A 2QQ0A 5KYUA 4QEKA 1VL5A 3BSYA 3KSMA 3RANA 3I0MA 2CV1A 1J5EB 1WE2A 5ED0A 2QXUA 4RQBA 4WNCA 3W90A 1J8DA 3PQ2A 2ZXEA 2FUG1 1ISIA 3LT5A 4RKWA 3MS2A 4GKKB 4AZ0B 5JAHA 2I2WA 3UH1A 5HM6A 2DH6A 1ZJ6A 5ALZA 2NQ2C 3G7UA 4B9AA 4UULA 1RWQA 2Q7XA 4EB6B 4JBHA 4LY3A 5JALA 3GUYA 1PGNA 3B5JA 3B53X 3JD2A 1BAPA 2XA1A 4DHWA 5L9AA 4DB2A 4DJJA 1ZR4A 4MEJA 1GTRA 4UARA 1GQRA 4TUYF 4DUZB 2Z83A 2IY8A 1Z75A 3O8QB 4RUKA 5K0SA 1D7OA 2O7NA 1YVDA 3PC6A 3PSAA 5GAJA 2YX1A 3I6YA 5DYIA 4G23A 3JYLA 2EXXA 3M7IA 4B4UA 1WBDA 4U3JA 5IYZB 3V55A 1F4PA 2BM1A 2GLTA 1Z3CA 3TKAA 3VPGA 3Q3VA 3FLBA 2XGJA 1F3OA 2VUIB 3MGKA 1ZUNB 5J1TB 1ZXLA 5LCXA 3TRDA 4D80A 2X9LA 3QBVA 4HAYA 3B6JA 4F4DA 1LQUA 1VJRA 5DN6A 3H65A 4PGMA 1QLWA 3A3YA 1SU4A 1C9JA 2H3HA 3FSGD 2WT9A 5C35A 1YDMA 2VUHB 3E7WA 3F98A 1BSVA 3NHWA 3SIXA 1B6TA 4AJKA 1JQLB 3K2BA 3QXJA 3W5HA 1ECPA 3WJ2A 4R2HA 4E4TA 3U61B 2B2NA 2YXPX 1E77A 2Q2OA 3FWZA 4D0GA 3TRFA 1HDRA 3NZEA 2VT2A 1PIWA 3O5AA 4Q9HA 3FTQA 1T6ZA 2WU0A 3OPNA 1NE2A 2J67A 4LTDA 4DPKA 4LA4A 4Q7EA 5JXWA 3EGOA 4FX2A 3IAHA 3VKFA 3HS3A 2LTAA 1S7CA 2VJAA 4X60A 5H9WA 3AERA 2IDZA 1EUDA 3EDRA 1T5IA 5FTWA 5T4EA 3RABA 5HQJA 3U7RA 4RGQA 2A3NA 1PJBA 4LYEA 4OHXA 3Q7IA 4G0UA 4R68A 4UDOA 2IU6A 3DHNA 4B40A 1JN0A 4ABTA 2J3KA 4AY2A 3DAPA 4NZMA 1MH1A 1TQHA 2MINB 4B2YA 4NCKA 4LHSA 3SBDA 4D97A 5A04A 1W88A 2W6JD 1UPCA 2G7MC 2QTBA 2WWYA 3QIVA 4DJTA 3BMXA 1Q0ZA 5HOEA 3HBFA 1G4UR 3JQAA 4O2BF 1FJHA 3AB3A 4CYMA 3LTEA 4N82A 1XYVA 4FYIA 1Z0AA 3DUFA 5KDLA 5BVHA 5HKKD 5F23A 4WW0A 1SVNA 4F9EA 3L4JA 1JG2A 3P0HA 5CW2A 4FYKA 1A98A 4D6YA 3EPPA 1K7EB 2ZJOA 3HU3A 3V1KA 4B1FA 1QQ6A 4JLUA 4ZK6A 5EHZA 2NYVA 5LL6P 5TV2A 1UEIA 1MT0A 1FLDA 1B8OA 2C4TA 2WG0A 3KD3A 4MPJA 1O5TA 3GV0A 3JQCA 3K6KA 3A25A 4DDWA 4PRYA 3RM3A 4RTSA 1CRQA 3E4CA 3PI6A 4LCEA 1MG5A 1MO5A 1RYBA 3V8NA 1Q0PA 5ES4B 2YMLA 2J5KA 1ECJA 1V8PA 2XLCA 2WQ7A 3H8VA 2A14A 3V4ZA 4TXLA 4AYWA 3V8QA 1XNGA 2CDNA 4J2HA 3ULKA 3ZU5A 2H17A 3GAMA 1MG0A 5HR5A 3ZD9A 3U4MA 3HXLA 4R2WA 2NTJA 5DYGA 1ZD3A 3K70B 2CXXA 1G17A 1NJGA 2E9SA 2C8LA 2GCIA 2GHIA 3HBAA 4GDMA 4ZTZB 5EQJB 1F2VA 3INYA 4EF6A 2R8RA 4DLSA 4EYQA 2B4TO 2AMVA 3TD6A 4CMJA 5CYOA 1I2BA 2VCEA 2HIHA 1NNLA 1IXSB 2VK2A 3A3NA 4TTIA 4XPIB 4CQMA 5BR4A 4Z3DA 4IO0A 3EWIA 1Q91A 1FY2A 3PXDA 1T9CA 3BL6A 4K9RA 3ELBA 1MRZA 1M2JA 2C99A 3OAAA 5HPYB 3DBRB 4HFNA 4ALJA 3IE1A 1U0HC 4KGDA 4XKJA 1MA0A 3QWHA 3VQTA 2GRJA 2YCBA 3I2HA 1RWXA 1T6YA 3REOA 2EJWA 3EZXA 3RKRA 1OWPA 5IASA 3L46A 4IJMA 4RHUA 3GYBA 2MR6A 2ZSDA 3V2IA 3MJDA 1V6SA 2V1XA 1ZBDA 3NRCA 4PRZA 4QOIA 3VV2A 5LOVB 4LY9A 1U5CA 3R3JA 2BGRA 1W1WA 1WR8A 2D1QA 2HZBA 3FSRA 5HFAA 2YWGA 4KIWA 4XCVA 8GPBA 1CB0A 3LDAA 4YJKA 3FOAA 2JIDA 3PUWA 3P1JA 3PE4A 4JY7A 5HSGA 1JLSA 1Q7RA 4FXOA 3GRYA 2JLZA 3G2LA 3ZZUA 4MINA 1KMMA 1O5OA 1XQ6A 2O2CA 3DDOA 1K97A 5FLEX 1SBTA 1E2DA 3SEAA 3VZQA 1Y3DE 1X80B 1RQPA 1YQGA 2WKWA 2ZIAA 1DJLA 4KIUA 5JRDS 1RXSA 1SUEA 1M33A 3LK7A 4R8SA 5F51A 5EZSA 4IIUA 2YHIA 2AR0A 1SHUX 1EG2A 3DXZA 2A57A 4AU1A 4J75A 5GADl 2FK8A 2ZJ6A 1W9MA 1JDSA 2QGZA 1MORA 2HJGA 1RHQA 1RM4A 1EGQA 2IU3A 1ZVMA 4HVAA 4KW7A 4QGBA 1L4EA 4M76B 4Q4JA 1COWA 5F98A 5DHFA 2Y1EA 1YR7A 4F6RA 1N7JA 1B73A 1NR1A 2FR0A 1XKQA 3VDQA 3JWIA 1MRSA 4Q9AA 1LW7A 1LF5A 4ZO9A 1FLNA 3HYCA 5M7EA 3OZRA 1KK2A 2POCA 3D3QA 4EQZA 3KDAA 2OORA 2GKOA 1GU1A 4LF8B 4IDFA 3GMSA 5FBLB 1GO2A 4FOTA 1PUIA 2AFVA 1KAGA 1RKXA 2VTEA 4BVBA 4W6QA 2X3FA 1CJBA 3F9RA 1FVHA 1BKSB 1N9KA 3G5LA 4GP7A 2GNPA 4GXTA 3MK31 4NI5A 2RHTA 2Y1GA 2YRWA 2B4RO 3LK6A 3RBAA 1QHSA 3VU0A 2BH2A 1Z7GA 3LUKA 1PEDA 5IABA 2UXDB 4XM1A 1R0CA 3LZ6A 3FZQA 2BEUB 3JYPA 3WGTA 2ABWA 1IY1A 2FMUA 4DSNA 4DUGA 4YLGA 5ELLA 3AB7A 4UXIA 3TTWA 2IYNA 1ENYA 2XNDD 1E1CB 4JS0A 4M98A 4QOSA 3W3AH 4AX4A 3E8MA 5JQWA 2WBLC 4GQIA 2LUOA 4UTOA 4WVLA 3SK0A 1UFRA 2ZUFA 1X7DA 3UMSA 1QQBA 4TL8A 2CY0A 5IK2A 1XEFA 4KN6A 3ZOZA 2JKYA 2OG2A 1P4AA 1MW9X 2MMCA 3MRSA 5D86A 3ENWA 1KDZA 1W7AA 4FFWA 1M1UA 1XTZA 4ZO7A 4GNKA 4WDQA 4JLBA 3ITNA 2FSUA 4EJSB 4G0MA 3UAVA 3N59A 2JK1A 5IP5A 3VNRA 3K0FB 5LXTF 4MMZB 5CM9C 3RKUA 3CH7A 2X8WA 4WH0A 4WFIA 5B5SA 3BDVA 1TRHA 1T3ZA 3QUBA 3SFVA 3JAWB 3M6LA 5EQFA 4P5EA 3G23A 1P91A 3V48A 2R6HA 1ZYUA 4FHDA 1GKLA 5DCYA 4M6WB 1M6WA 1IJFA 4OHKA 3NJRA 3H75A 2D1SA 2OFXA 3PUIA 4TSKA 3A3PA 4TT3A 4CQNA 3IHWA 4LBYA 4DEXA 5LM3A 2TYSB 4C1NA 2BF7A 4H7DA 5I7EA 3QSGA 1LNZA 1YTUA 2O8DA 3H05A 1KKMA 5F2EA 1EMDA 3S5JA 1XJCA 1CUCA 4A0RA 2OENG 3M4YA 4Y1RA 4RJLA 3BRSA 3G82C 5F3WB 1ORWA 1WMDA 2I87A 3MPOA 2BMWA 4R1MA 4IUYA 3NJ8A 2ECKA 3BYZA 3C3MA 1PGJA 1SZJG 3BWCA 2FGKA 4GPZA 4HDKB 3AKYA 3PGVA 3SXPA 1FSPA 1UDRA 2G40A 1AUQA 1Q44A 4RA6A 4D5GA 1D1QA 3HM2A 3BMCB 3MGBA 1XRJA 3LT1A 4NOKA 4HZUA 1MXHA 1BMFA 3NIFB 3TRJA 1F2UA 5IBRA 1MX1A 4EFLA 4ESEA 3WYNA 4J03A 1JGTA 1JZTA 1IHOA 4Q48A 3C3WA 2J9FA 4PLPA 1XZQA 2HTEA 3BORA 1I1OA 3LPDA 4HADA 4OM8A 2XVMA 3VOTA 1KJJA 2H52A 4HYQA 3IMEA 4PLYA 4K3VA 5EPEA 1PJQA 1MTOA 3OOWA 2C83A 1IWOA 1DAFA 1RRKA 2SICE 3HB5X 1NLFA 2C7BA 1YQDA 2H08A 2P91A 3BILA 3C6ZA 1UOPA 1Z0SA 4QUDA 3ILXA 3F46A 3W7VA 2JFHA 5DXJA 3WDLA 1YOVA 1UWVA 4IICA 4PPFA 3OZWA 1ZKDA 3GUZA 5GPBA 3S8YA 2NU9A 3ZCSA 4WXMA 4L15A 2AMJA 4OHPA 4ARZB 1IB0A 2PYDA 2WFZA 1GSAA 4YRPA 4L02A 3SDZA 2XNCA 2CYCA 5LYJA 3Q8XB 5KX5B 1YD7A 4WN3A 4NBRA 2V7WA 1WEHA 2WD9A 2DF8A 2BISA 2DJ5A 5K4GA 3WBBA 1WZIA 2IYZA 3QELA 4EHAA 1UBHS 4EO4A 1YZUA 4DFDA 3F6BX 1QP8A 1W0JA 2I4MA 4OM7A 3ZKAA 5AH0A 3P4XA 5KYYB 1M8JA 3GJ7A 2OD2A 2Z56A 2AE1A 2FXVA 3W3AD 1J5PA 1CR6A 1J0AA 1QZTA 2JVJA 5IANA 1KKUA 3LBHA 3HCRA 3MCTA 4WK2B 2G0AA 5CDFA 1O7JA 1UKCA 1OUMA 5BN1A 1JHUA 3AC0A 4M2LA 2IE8A 5I4CA 2O8CB 3FYUC 5IU6A 1XIVA 4I81A 1Z2NX 1AA6A 2H92A 4CLEA 4NR0A 5FJJA 1RTTA 1TJ4A 3I6IA 1Z22A 4DJFC 2DEUA 1JB1A 3EF1A 3SSMA 2C00A 1FQOA 2BKAA 2VSFA 4AN0A 1M83A 4AY4A 1M3SA 3RJMA 2REQB 4D8WA 3FKSD 5L3SB 2H0RA 4JLWA 1XTSA 5EZ5A 3LL7A 1K6JA 5LBIA 3F6RA 2G9QA 4ESHA 2Y68A 4L72A 3TOSA 2XTZA 4I5EA 3GJQA 2XZTA 4DMHA 3LSTA 5DBGA 1TVCA 2AF3C 3HO8A 3R9XB 2O5EA 1I6KA 5CTJA 5B36A 4MOWA 1YFLA 2JLSA 4BV8A 4PZPA 2P8SA 1Z6TA 1G3UA 1XTQA 4ARCA 4QECA 3NTOA 4DMLA 3R2JA 4M1SA 1CNEA 2QLMA 2OZVA 4D92A 1IWBB 2KLHA 1W0CA 5DT2A 2F8SA 2XCLA 3HWX1 1DS6A 2D0OB 1P1IA 2Q5QA 3X1JA 5JO9A 3RTEA 3FMIA 4CUZA 1HDZA 1NMSA 4OSOA 2O2XA 2Y6UA 2P65A 3EVZA 2DZDA 5FPQA 4I3HA 2MYUA 1K66A 1WEKA 2YVUA 3RJ5A 4MRMB 3IR7A 1YQ9A 2JFWA 1CRPA 4A0GA 5H3LA 3G7SA 2ZAOA 1XPUA 5D1HA 2VWHA 3EN0A 5HIMA 2A30A 3K8OE 1C7QA 1JH9A 4NNOA 2EJUA 4WLOA 4BWYA 5KAPA 2VRWA 1R8YA 2DBVO 3JD3A 4WUVA 3RS3A 2CVQA 4JP2A 3DHVA 3TJZA 1T0HB 2ISQA 2JCBA 2TMKA 3DZKA 4ZZ1A 4XXHA 4KYVA 4EGAA 4FHEA 4CMEC 4C7OB 5M3BA 5BUQA 4GOXA 3CLUD 2JFQA 1W73A 5K8CA 2GF2A 3GUHA 3OZTA 1TA4A 4BFUA 4C0XA 2I62A 3L7YA 3WRVA 1MR3F 1UOQA 1B00A 1P8AA 1PT5A 4B6OA 1JEQB 5ALXA 2W2VA 1G8PA 1BQ4A 3H97A 2HWKA 4FZVA 3L7NA 4R4JA 1L5NA 1PS8A 4B44A 1XPRA 2ZE5A 3ZE8A 3PR3A 4WX2B 5DGCA 4NJEA 4D4GA 3IHLA 2FLWA 1O94C 4L3OA 1MQ9A 3VVBA 3WGQA 1IHXA 3Q2IA 4H7KA 4OJKA 3EEBA 1V4NA 5AK4A 2H48A 4FT2A 4PY2A 3CLRD 1EWYA 2WA2A 4NBWA 3LFUA 4NENB 1HL3A 2PQ6A 3D6FA 5KWSA 4YMHA 4FJ0A 3J80A 1QVZA 1NW6A 4Q39A 1DCFA 1T3LA 2C94A 5EMMA 1IUPA 2MSCB 1UWKA 3D8RA 4XAQA 2OP1A 2YS6A 1VMKA 2JFFA 1A04A 1DV1A 2GA8A 4WDRA 3ABSB 4BLPA 3ZIUA 3M34A 4KQWA 2JAHA 2WINI 1BDBA 5CH3A 2R00A 5BUSA 1HV8A 4UQLA 5KIAA 2XNJA 3C15C 4EVQA 1E64A 2FA9A 3KT6A 4URUR 2PVCA 3NM4A 2P9JA 1Y48E 4GGPA 1YDGA 1ZIXA 3CA8A 3OLZA 4MWGA 3AL0C 2X0RA 2AA3A 3A9CA 3VYTB 1S1CA 1V37A 4LDRA 2FHSA 3F6CA 4LBVA 2ATEA 4E6PA 3K09C 1NN1A 1PZHA 1NOKA 3BTSA 1R4NB 5ECWA 5GOTA 3S2SA 4HMQA 1E5LA 2VH2A 2HC9A 5JAIA 3GMDA 1A76A 2NN3C 3ZNNA 1NVXQ 3B3QA 4LCJA 5ENZA 3F8WA 3HE3A 3QEOA 1XZDA 1DBQA 2GPAA 2BSAA 1IZ8A 1O77A 2HDHA 3OCZA 4KVZA 3IPAA 3DOJA 3U7QA 1XC7A 2YIMA 4K46A 4LISA 1TD9A 4IF4A 2XT6A 4YDSA 2C7VA 4RESA 4ZYXA 3GQBA 1ZC3A 3G2IA 1ZD8A 1M34B 4DOMA 1IN1A 4O29A 1H2FA 2BFCB 5TMPA 2QVBA 1NLZA 5ED4A 2O59A 4GD3Q 1T0PA 2VK1A 4JWKA 4YWJA 1GQSA 1P9NA 4L73A 2CMFA 2XH8A 2I6SA 1DBRA 3GF4A 3ND8A 3R3ZA 3WADA 4PV7A 1AKRA 3LGAA 1AG9A 3ASYA 4TSFD 1I4OA 4WTOA 4GF5A 3QW2A 4E11A 3IDFA 4RVHA 1R74A 4O4LF 1MN6A 5GJBA 2MYNA 5K09A 4TSRA 1VE3A 2IUUA 2H3EA 3TR5A 3LUGA 2YICA 4O0MA 5JXIA 3UY4A 1VSVA 4FGWA 3ORYA 5KYWB 3O2SB 1NOJA 3N2IA 1TQ2A 2GVNA 2CEAA 4H1TA 1Z0ZA 5JSQA 3NHUA 4QRIA 1UKEA 3IT3A 1LPOA 1GTSA 4OX9B 3CY6A 4TLLB 5CNMA 4BQNA 4BVFA 4FSXA 2XMDA 4HQOA 2MSNA 2JFOA 4MYCA 4GZ5A 1AKYA 1YMQA 2O06A 3GT3A 2AF4C 3IX7A 1OZAA 2XQJA 3P32A 2CDBA 2YQ4A 3QKTA 3W5SA 2LCIA 5HWSA 3PQDA 4KKXB 2ZIXA 4DG5A 2FUEA 4XVUA 3PEUA 4MKHA 2DG2A 3BL8A 2H63A 2V6JA 4HGZA 4MA4A 3NAQA 5TF4A 2ZSKA 5EJ2A 2C84A 1KI1A 5LYJF 3WMGA 4O4JA 1FDSA 1KFEB 2XMPA 4YMTA 1TO2E 5FAXA 3PNKA 1UDBA 3PCTA 4YMWA 3STYA 2GYUA 3FDJA 4EY8A 1HMPA 1M1YE 2YUIA 1YULA 1X7WA 5B3KA 1XD2A 1C0PA 1KK0A 3GO4A 4M1OA 1WMAA 1C7IA 2BJVA 3JQ9C 4HYYA 4QBHA 3VPSA 1DO8A 5BP7A 3HA3A 2I3GA 4MS4B 4AURA 3U4QA 1V1RA 3IAM6 1K4KA 3B7WA 3LKDA 4TUYB 4ZK2A 2YMPA 4R9UC 5CCXA 1OXUA 1RJFA 2ZI7A 3FTFA 1Z34A 5C1BA 3GJXC 3FOZA 4FX5A 4B3SB 3EHEA 3EGIA 3P9QA 3PA6A 3V4PB 2PKXA 4X1YB 3HM9A 1E2KA 2DWPA 3KQYA 4ZVOA 3UM9A 5BUZA 1CRWG 2UDPA 4C4PA 3IEMA 4FDVA 1WDKA 5CIWA 3ITDA 1GTL1 1KETA 1ZGZA 5B58T 3MTQA 4OQNA 4A8TA 4MUHA 4HX5A 4MKFA 1ZQ9A 3R7LA 1UMCB 1F06A 2CHFA 2O0KA 4Q15A 4HEA6 4Y6SA 3UWKA 4AUNA 3UJ6A 2WFLA 1DJQA 1W44A 4BNFA 4ZZ0A 3RSZA 3PDIB 4XJXA 5G1NA 1NVWQ 4QLAA 2PEYA 3QU4A 2DYKA 3TVDA 1JPVA 3GGSA 5MN6A 4M87A 2BKVA 3WE7A 1QM5A 3CNLA 2KHZA 3PBKA 4EDHA 3A2NA 2XA9A 3BWMA 1YHZA 2W6ZA 4OK6A 4J1QA 4I14A 2PO5A 1RP7A 3M8KA 4EEZA 4FWIB 1IVNA 3FAZA 1HURA 4Z99A 1N4AA 4Q1FA 2CL6X 2WM9B 5I5GA 3B51X 4KUEA 3PQ5A 1SKMA 3GLUA 4D98A 4XWYA 3I9LA 4KIJA 3LRPA 2GAFA 1AKQA 5FI1B 3ZXXA 2NTEA 1G20E 1O8CA 2EEPA 2R87A 2VA8A 2CJYA 1N6KA 3ILYA 2KM1A 4WBXC 2G67A 4ZAWA 4V2UA 2Q2WA 1GDDA 1NJ5A 3AHCA 4BU1A 4G8CA 4QBGB 3RF7A 1ARZA 5FDFA 1ZNWA 3KQNA 4R3UC 4DG9A 4DC9A 3ZJTA 1XAJA 1YI0A 1L7NA 1Z4KA 3EE6A 2ZI6A 3VM6A 4S04A 4E12A 2Y1DA 3GQVA 4F5YA 5CH5A 2CVHA 2IBMA 2SBTA 5IVKA 1GAXA 3C3DA 3C6XA 1F8GA 3OZFA 2FW9A 4R16A 1R6BX 3V1YA 2JD2A 1GYRA 2A33A 2V7GA 2B0JA 3GLTA 4ZDWA 4O2BB 3Q12A 2O3RA 2EG5A 2WUVA 3K9LA 4PGGA 5CEEA 4QZVA 1J21A 3EF0A 5JJIA 4GI2A 1D5CA 4QJIA 1ZEJA 2Q4RA 3B9QA 4LC9A 1G4HA 3S5UA 2FPXA 5L7TA 4ENUA 2V0NA 3KEFA 3KJQA 3P9ZA 4MKRA 4L8YA 4R3WA 4EW3A 3ESXA 2HRZA 2I9KA 1FOEB 1H2BA 2JDIA 1I4LD 4JMPA 4BWGA 2XXBA 4FGSA 5FHRA 4XD7D 3WNCA 4E2ZA 3DFZA 1AQIA 3WIBA 2OQVA 3DQZA 3KXLA 4GI5A 2I4RA 3KLNA 4RBNA 5IDQA 3KTFA 4M89A 4XGNA 4CVNA 1KWGA 1ZMTA 1T4GA 1R50A 3P2IA 5DT9A 1CULC 1RYHA 3BHMA 4Z1MA 2C04A 5TVGA 1LA2A 1Y5NA 1R15A 1QKIA 3DBHA 821PA 4RTNA 2O1WA 1LU9A 3HGMA 3NTLA 3WL8A 3A4VA 1EUZA 2V8BA 3QX9A 3JVUA 2ISSD 3FPSA 2G83A 2CVPA 2QT0A 5C51B 1JP7A 1ZOIA 1MJGM 5DYTA 1E0JA 3BXHA 3PGXA 4NNPA 5KHAA 2MDTA 4I9NA 5EJ8A 3IAXA 4UNIA 5GZ1A 3SYTA 2AZ4A 2PS3A 2PWYA 3L05A 2B6NA 1GEEA 2HF7A 2QMZA 3L7AA 4R98A 1HSOA 4B8WA 4CL8A 2KBEA 4LV5B 5A1TA 3WDMA 4DC1A 5KJFA 4DR6B 4Y8VA 2X3YA 4JJ6A 2QTVA 2C59A 1SRQA 5JANA 3WLKX 1WCXA 2DFDA 4BNNA 2I1VB 3BIWA 1WXWA 3LLSA 4RHYA 3WNVA 4E5DA 4GOND 2QV0A 4W5QA 1USKA 1XR3A 3BXPA 1KZ1A 3X43A 3NNDA 2H4FA 3NHSA 2JI6A 4QIHA 3OESA 2NYAA 3I05A 5AVSA 1V7ZA 2MT9A 5IF9A 4C43A 4Q24A 2X0IA 4HYTA 4YRQA 1EE2A 5BWNA 5K0BA 3B12A 3LXRA 3N74A 4JBGA 4OOFA 5F7JA 3KSAC 1TRKA 4C4ZA 4UTNA 4LY0A 4KQFA 1G8KA 2Y0BA 3GHHA 3S1AB 4DQUA 4ZU3A 2WU1A 1O87A 3SNHA 1DNPA 2OV4A 2F2TA 2WWFA 3A1EA 4PR3A 2WMYA 2GCNA 3DUWA 3WBJA 2X5OA 3EXEB 4OQEA 3KJIA 4N9QA 4CMIA 2C5LA 4IINA 3WYEA 4UOZA 2J5RA 2PBFA 4B4WA 3JD1A 5FWXB 7AT1A 4RHXA 3ZWYA 1JALA 4DSUA 5IN4A 5JWRA 3O9VA 2PN1A 4JROA 3TSWA 5IDXA 2DPHA 4WBNA 1XZAA 2WYUA 3D9QX 3DXYA 3LNTA 3ZXUB 2PGAA 1YVEI 4C2AA 1JXAA 1NX6A 1IN5A 1WMEA 5CGQB 2CWDA 5C8XA 2XD9A 5K8IA 4XSHA 1S5PA 4ERNA 4I9UA 2WG2A 5C7YA 3MXOA 2QPOA 4HDNB 3K5IA 2QEQA 3UJ9A 2OKCA 3FWHA 2EOAA 3RREA 4BMPB 4BX0A 4FLEA 1UQTA 1NUSA 3DTVA 3STVA 4AXXA 3PCRB 1L1EA 2BR5A 3TW8A 4L4ZA 4CFSA 3PQ4A 1TEHA 4TYNA 4H17A 4ODIA 1PWXA 3W8NA 3BS4A 1Q17A 1IPFA 5H5JA 1EZ4A 1D6SA 3UENA 3LHFA 1A1SA 1UM9A 5K2OA 3FWNA 4QEZA 1P19A 1KVTA 4G84A 4RDHA 2GRUA 1N8KA 3WLJA 1TYDE 1Z2CA 3WLEA 1F1BA 2AW3A 2DFPA 3TL3A 4CUJA 4AP6A 1QUFA 2W70A 5FEMA 4NIMA 3SIRA 3AJDA 3QV1A 4HUQA 2K5UA 2PK3A 3JRXA 1N2BA 1G55A 1ZGJA 2RGBA 3EXHC 3CUYA 4HRXA 2RE8A 1U0NA 1QVAA 2UKDA 2JAOA 2YNMC 3EH1A 1NW5A 3KE8A 4RZUA 3NETA 3RO7A 2OL4A 4FYXA 4O4JF 4TN1A 5CG2A 3HYNA 4HP8A 3DFMA 1GV1A 4OCZA 3NKVA 4ER7A 4TYWA 4D7AA 1P4HA 2O7RA 1CUSA 4MGZR 3NP9A 3IVMA 1OX5A 4RC9A 1SXIA 2ERXA 3O75A 4KXQA 4NXNB 3FR7A 5FNVA 3IJEB 3GNQA 4RF4A 1NYQA 3MMNA 4E33A 5JNTA 5LC1A 1PBNA 2Z43A 4GM4A 5DV9A 1CZHA 3HVRA 3EEFA 4Q7KA 2F59A 1G1AA 1KMNA 1ZI6A 5HE9A 7YASA 3INTA 1RYMA 1D2CA 4ZPJA 3D8UA 4U7GA 4QJ3A 3W05A 4C0HA 4AS1A 1BH2A 2JGFA 2BZ1A 3AF2A 3NT5A 4IMIB 1FRVA 1GCUA 2OV1A 1DP4A 3DOUA 1Q7BA 1UK8A 3P9PA 1IBLB 4YPVA 4DIBA 2EHDA 2IX3A 4C6RA 3OC6A 3M33A 3H2KA 4LSMA 1YJXA 2HLDD 2PS1A 2B37A 2AVDA 3HUEA 1U2GC 3LWNA 2FF5A 1S2DA 4JH0A 3OTIA 1V7QA 4NEGA 5DNEA 5EYPB 4OXYA 4X92A 3ICEA 5DZSA 3JQFC 5HFJA 1WAMA 3I9OA 1D2EA 1C50A 1WF3A 1OYVA 1E7RA 2XGSA 2IH2A 1B0UA 4J29A 2H65A 3VX4A 3TSZA 3NUGA 2ZTHA 1TZBA 3LVRE 3DV0B 5BRAA 2HCBA 3E3OA 3VPDA 4M9UA 4US2R 1KSHA 4Q0MA 2A5YB 2J4CA 4KSCA 1GUAA 5DYWA 2PKQO 2JLXA 1EP3B 2YY5A 4RTQA 3D1JA 4G2TA 1DIHA 1U8CB 5E1DA 4Z4GA 4HVTA 1J25A 1U3CA 4MITA 4A6DA 1N7IA 1ZFNA 2RARA 4U4AA 3M6IA 1J09A 3UEOA 1MQAA 4LJ8A 2O1EA 3COWA 3QVJA 4JNKA 1UT8A 3USCS 1IATA 2HXSA 3A0UA 3LRTA 3LYUA 4X94A 3REQA 1FSFA 3N2EA 2EAUA 3WHIA 4RNDB 2O19A 2WU4A 3AERB 4QQFA 4UUBA 1EUDB 4LJ6A 3PHCA 1JWAB 1GXSB 2AWOA 2WF8A 2F8TA 4URVR 2JCYA 4IIJA 1NXVA 1UBJS 1Y6JA 4EFMA 3NBKA 2VP6A 2IOHA 1QYDA 5GVRA 3RU9A 1VE1A 4EBFA 5AD1A 2DLCX 1GNSA 4M1KA 2QL5A 1ZWKA 3A4LA 2FSIA 1L4FA 3AHFA 3FYSA 3NHLA 1FYFA 1UMKA 1JV2B 3ICWA 1W88B 4ZVPA 5AUPB 2X77A 1RAHA 3QX3A 4CM8A 1GPYA 4N8EA 1CERA 2YW2A 2WHEA 3JQAB 1FUKA 4D8UA 1L7EA 5E1OA 4GWLA 5BMOA 3CLTC 3KXKA 1XEXA 2C9YA 4V38A 2PBLA 1BDMA 3DUFB 3UJ3X 3CXRA 2VNIA 3HN2A 1E9VA 4X7MA 3RLIA 4A3SA 5BVHB 3U60B 4PLWA 3L41A 2ZWIA 2VXCA 2Q0SA 1NIJA 3A1SA 4LKOA 1X3LA 3H6GA 5FI5A 4Q3CA 3U7IA 3NDRA 4RVSA 1PCXA 3MBIA 4GOKA 1DZIA 2BP7A 3DB1A 1GNLA 3DQPA 2XMRA 3VJLA 3AFNA 4OP2A 4U2GA 4WE3A 5ANRB 5TT1A 1SOAA 3PUKA 3EPLA 3PK0A 5FPYA 4R3NA 1CJKC 1B74A 2QW0X 5FUMA 3K1JA 1JDPA 1DAHA 5J4HA 3W4KA 1KXZA 1VDMA 3A9VA 1F0YA 2FFHA 2G17A 2Z8XA 5GMOA 3LBFA 1AJEA 3V3TA 1MB3A 2BN4A 5AUNB 1X1EA 1JHYA 1MXFA 1T36A 3P2YA 5FO0A 1GG8A 3QFSA 3Q2KA 5AFSA 4KMRA 1QO7A 2XOKA 1RAEA 1VQ1A 2IPAB 2QM3A 4MJ7A 4UOQA 4YROA 5JPIA 5AUOB 5ECYA 3EIUA 1VPDA 3PKZA 4NLLA 3HH8A 4F3YA 3VKVA 2L69A 3ZOKA 1OJLA 3GAZA 2HBZA 4RVOA 2HR1A 2FP4A 1XG5A 3HLTA 3EIQA 4PZ9A 2VJLA 1T5SA 4CM9D 1LDNA 4AO6A 2QN3A 2TMDA 4HUTA 3KQLA 4GYYA 1YQQA 1PNVA 2KW5A 1RNLA 2H2AA 4HMOA 5G3ZA 3R8XA 2QZJA 1WUYA 3EVTA 5KZMB 1HE8B 4YO7A 4G1CA 2PMFA 2RONA 5H83A 3PA8A 1N0VC 1TM4E 3KWLA 1JJAA 4H7FA 1AXGA 3AH8A 4ATNA 2QRQA 1RLTA 4RIGA 3GLGE 1H6CA 1NXXA 2XCIA 3B9BA 5CB6A 1TJ5A 3TQQA 3T9AA 1TFRA 4W8HA 4XFDA 3LC2O 3NQ41 2GPTA 3CZ9A 4R31A 3QKRA 5J1SB 2Z8ZA 1WMSA 1VYTA 1OU4A 2WLSA 1A0OA 2QTNA 1T4MA 1A7JA 4BBJA 4IKPA 8ADHA 4MWDA 5EJ9A 1GPDG 4EO7A 1DEHA 2DQYA 3I92A 3GJ6A 1P7CA 4PTYA 4E2FA 1F7VA 3ZIAA 2V98A 2ZXFA 2V59A 4MVCA 1VB5A 3LLMA 5IXJA 3KKMA 1EWTA 4TLMB 4DIFA 1KYYA 3LZDA 4TV9A 4KXLA 4KHZA 3R5FA 4A8HA 2G82A 4E1VA 1Z25A 1LK0A 2IDKA 5A9TA 1LQTA 4YRGA 3UK6A 1E2PA 1JIXA 2MR5A 3IP3A 4IHJA 3K8YA 1DCTA 3L8HA 3JZDA 3MJEA 1RPJA 2AC7A 4XWTA 2DCUA 3GGPA 1P6XA 2WYWA 1KVRA 2YHIB 1AK9A 3Q7SA 4TMZA 4DT1A 5J4LA 1JVBA 2QUZA 3F4LA 3K0CC 3NPMA 3FB4A 4NMXB 2CNWA 3FNGA 3I3OA 2PFGA 4R01A 3C7TA 2C5AA 4RQAA 4Q4JB 4DKXA 2BI7A 1KEUA 3LY9A 1G2QA 3LWDA 5IDYA 1A50B 1GKUB 2VSOA 4F6RB 3QPDA 3L1UA 1VPWA 2O50A 1PR2A 3S29A 3UKOA 1BZYA 1H23A 2BKLA 5HE8A 1ISSA 3WRXA 1SG0A 4ZTUB 1Y6GA 3AVUA 1TU3A 1RT9A 1XALA 2ZSJA 3DDCA 5DX0A 2QTLA 4LV8B 5ECDA 5LZ9A 3AIMA 1DKOA 1NP7A 3O8LA 16PKA 3Q5DA 4WERA 2A67A 3DMRA 2WJHA 1Z5ZA 4MYDA 4ZYYA 2YWFA 3GT4A 4KUHA 4CL3A 3L9XA 1Z29A 1MGPA 1XDZA 4F4HA 3T1YB 1WCIB 2I2BA 3ZCRA 1AZWA 1RHMA 3GFRA 2X3UA 3PHHA 4N54A 4ZALA 5F2OA 3PPIA 4KLRA 2W90A 2I4LA 2G7ZA 3HFGA 4B3DA 1G42A 4JCCA 3C3JA 5BQ3A 3PEYA 1SOUA 5AJXA 1WABA 1P5HA 4DILA 1JW9B 4LG1A 3TJRA 1OLUA 5FNVF 3T3OA 3S70A 4GDFA 3UT0A 5BY2A 4M9ZA 3OD5A 1DQPA 1C1XA 2JFZA 4CJXA 3H9CA 2PXXA 3ZXIA 4YT8A 2NV6A 2CUKA 3DDUA 3KKNA 4KVAA 4RW0A 2OC9A 2P4EA 4BN4A 5CB4A 2NMVA 2RHBA 2XMBA 4CV1A 2VR1A 2ZANA 4PM4A 1DOZA 1YF3A 2IPLA 1PKXA 2DUNA 4HBZA 3F3MA 4QXPA 4ZQIA 3SR4A 1S3GA 4BB6A 1R6DA 2W2PA 4GX5A 521PA 3THOA 1VL0A 3KP1A 1I2DA 3UJNA 1KY4A 1SXJE 2HUPA 3EWAA 4IS2A 3GFFA 1U98A 3RIGA 4EHIA 1LC0A 1S2LA 4RORA 3QOWA 3V2UA 2G77B 3R74A 4F2DA 2W6CX 3O1HB 4BP9A 3OIFA 4P3YA 1XLVA 3RYHA 3KB6A 4IJVA 3RC7A 2J30A 3E23A 1JQJC 3CINA 3PLNA 4TRNA 1IULA 4ZCLA 2CKMA 4Y0AA 5JJKA 1IMOA 3D4IA 3U26A 1FEZA 1FP1D 1LK7A 2V0CA 4U7WA 3S44A 4B17A 4IUCS 4B3RB 4YRNA 5AT1A 3IR6A 2Y92A 3FOBA 4IXMA 4DCCA 1LLDA 3B78A 5DBEX 1SUAA 2W37A 3DTYA 2NT4A 1EXNA 4RV4A 2OT3B 3AIIA 1R3UA 3IJRA 5SYMA 3VAZA 3DLPX 1EHYA 2VXOA 3A4IA 3RSSA 1L4MA 2WDPA 4C0QC 5JCOC 2H5IA 1DJPA 3ICPA 1F51E 4L4XA 5HJ7A 3NXSA 3OZEA 4RABA 3L9WA 4AY5A 4DJAA 4BQQA 2J9YB 4OSPA 3ZCQA 4RA6B 3F8SA 4Y2JA 3SZOA 5EOVA 3I2FA 2ZUEA 4BTLA 4HZUB 1Z0FA 1L7XA 4QELA 2HI0A 3GEPA 3TLGA 1SHJA 7REQB 4CMHA 4YCLA 2J9FB 4MWCA 4X91A 2DAPA 2Q5JA 3K96A 1ODLA 4G1BA 1M1XB 2V5VA 3I2IA 2A84A 2HNBA 2MJLA 2AFIE 1V96A 2OECA 3FWPA 3NIDB 4P92A 2H2DA 4RANA 2YASA 5K5EA 2QRMA 2R6R1 3OY7A 4GBED 4TWIA 3TS1A 1RRPA 4CT4B 4EHFA 4WJKB 1T34A 3LTNC 1YGPA 1YOVB 2X4GA 4C29A 1JR6A 1QYXA 4Q3OA 4XDGA 4RE5A 3U3OA 2NU9B 1BDIA 2J3QA 4FDLA 2FEKA 3A6JA 4YI5A 4X1KB 1SCBA 4Y6LA 4TROA 4G0WA 2JBAA 5AHKA 3NTRA 3K0BA 1PU2A 1S4QA 5LYJB 3DMFA 4CKBA 4EO9A 4BX8A 4D1YA 4YJHA 1CQPA 4FOSA 4ZO8A 3SC6A 3BSSA 4HKTA 3V2GA 1LV7A 3G49A 2B61A 4KV7A 3A6ZA 1Z5UA 2C5HA 5LQMA 4LOJA 3H6HA 1XA0A 1KI4A 3JARA 1WSDA 2ADFA 4BFWA 1MIOA 5LR6A 1CY4A 3BXOA 2GPJA 2ODPA 2HA6A 4UKDA 2PPLA 3H11B 1JI0A 2JJMA 2A92A 2P6OA 2QBYA 1EGAA 4YN3A 2VPPA 5DLQC 4G56A 2WSBA 2EJCA 1H94A 2HOQA 2B8WA 4HAVA 1AU9A 4YX9A 1CY2A 3OX3A 3BMOB 4MUJA 4RK5A 2QLBA 2ZOSA 2BRUC 3B1JA 5DBOA 1OLOA 2CZQA 3DEKA 3SF8A 2XRZA 4IIDA 5AW7A 4JASB 2D0PB 4MYSA 3O94A 4OK3A 1CY0A 2BBOA 4S12A 2CBXA 2XSZA 3JR3A 1P5ZB 1R10A 4V1CB 2QQFA 4MDEA 1E6CA 4MUGA 3EOBI 4ENPA 1SBQA 4BN5A 5AM1A 1W6UA 1M2WA 1SXGA 2RGCA 3AJRA 3KEGA 4DAOA 4EPVA 3BL5A 3LLUA 3U31A 4KTVE 4LDZA 3M6WA 3LU1A 2CDCA 1N7HA 3EW7A 3U1TA 2YXNA 4H15A 2K4MA 3M9XA 4B33A 2PU5A 1TU0A 4QQRA 3RHTA 4U8GA 1T10A 3VKWA 4N41A 4HQRA 1MDFA 3FGNA 5IJ9A 3HC7A 1E7YA 1NI5A 3DVRX 4ZCSA 4BASA 1BVHA 3RYTC 2H85A 4ZHQA 2ET6A 5REQA 1S2MA 1L8LA 1NBHA 4J49A 1RHRA 3E84A 1B6RA 3DONA 4JB2A 3GOHA