6PFKA

Phosphofructokinase, inhibited t-state
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
b'MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOFRUCTOKINASE
publication title Structural basis of the allosteric behaviour of phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA02
4WL0A 4LJRA 4U1RA 2A0KA 1S2DA 2F48A 3U39A 3GH1A 2PMBA 2IZ7A 1S2IA 4KXNA 2KHZA 2F64A 4HX9A 3MAJA 4FYKA 4MEJA 1WEKA 4FYHA 1KZHA 4PFKA 3O8OB 3O8LA 4KXMA 2F2TA 1F8XA 4P5DA 5ITSA 4A3SA 4JENA 4NPAA 3K2QA 2Q4OA 4RH3A 3SBXA 2HIGA 4P5EA 4MCJA 5AJUA 1WEHA 1S2GA 3QUAA 2F62A 4KXLA 4I36A 3EHDA 1ZXXA 1PFKA 4JELA 3PFKA 2A33A 2IZ6A 6PFKA 1RCUA 3BQ9A 1MTOA 4JEMA 2IZ5A 4FYIA 3IMKA 4LJLA 1S2LA 3HNOA 4LJKA 3OPYA 4I7EA 4I4IA 2NX2A 5AJTA 3O8NA 1T35A 3F5MA 1F8YA 1YDHA 2Q4DA 2F67A 4OHBA 1S3FA 4OHRA 2PFKA 3OPYB 2KLHA 3UQZA 3O8OA
chains in the Genus database with same CATH superfamily
3AINA 3FZQA 4YAJA 2JK0A 1LB1B 2FSHA 1NJ2A 5IULC 1WQ3A 4F92B 4INJA 1OHHA 3AM1A 3QBJA 4HZUB 3WGYA 4KOEC 4EB3A 3DE3X 3R23A 2JBHA 1P9LA 2CUTA 1JEQB 2LKDA 4UHBA 4S1NA 2P62A 1Z73A 1FQOA 4FFBA 2NQ2C 3QVGB 5C18A 3NHSA 3ZDRA 4M88A 4KPFC 3ZR4B 5JADA 3RHSA 1KTIA 2WZDA 3NMUF 3OZVA 2BEVB 3RIHA 3OUZA 3PVZA 1H3NA 3GLVA 1AF7A 3E7PA 1CUJA 1XZ8A 2EKPA 3EUFA 4OV6B 3G13A 2WUGA 4RXUA 4NU8X 1B42A 4YJ3F 2IS2A 3GCXA 1O57A 4MW4A 3MD9A 1SK8A 2FQWA 3ISTA 1YB6A 1PNOA 3G88A 1I4LD 3K0AB 4MV8A 4FHZA 5IBQA 1Z0FA 2DE0X 4TLLB 4BYMA 1MC1A 4C7XA 3IC5A 1EUZA 1U7PA 4OTZA 3O4RA 3PFWO 2G3YA 1LK7A 2M6RA 3E3OA 4Q7MB 5KNCH 2WJWA 1B7GO 1PG0A 4JU9A 4PR3A 2BYTA 1K4KA 4OATA 4XE5A 3IFSA 1AZWA 4MS4B 5DBIA 2ZSIA 5JIBA 1Z12A 4HMOA 1BX0A 1DQRA 2YQ4A 3CUKA 2QDKA 1ISGA 2ZRHA 3KJEA 4JASB 4X6UA 5EWLB 2DZDA 3G7UA 2HLHA 3OCZA 2QX7A 2RHLA 4KGDA 2BL4A 2JGDB 4IZOA 2JLUA 3BJRA 2X23A 4OQLA 2OZEA 4W8HA 2SECE 1USVA 3F8SA 5EJ6A 4LF8B 1W49A 3RAGA 4GLFA 2J3QA 5BQXA 2QI9F 2W6QA 3OOJA 4LYEA 1FY2A 2YHUA 5C4GB 4F96A 3T1TA 1X7GA 2VT7A 5A2GA 5J23A 4HUJA 1KJQA 4OBWA 4JQSA 2EP8A 2ZIFA 3DPUA 2VK2A 3W90A 2VT2A 4DRZA 1DTWA 2HSDA 3UATA 4O1HA 1JEYB 4OP2A 4H0NA 1L4MA 2ZB3A 3AI2A 3T3HA 3CISA 4D2IA 1L4EA 3LOPA 5ENZA 3U37A 4DGQA 2D6FA 2CE2X 3OI7A 2CHUA 4GL4A 4L2IA 2V4ZA 3IMKA 4JLKA 1W5TA 2W8ZA 4AJ1A 3BSWA 4V3BA 1XTZA 1KMHB 1K88A 2GA8A 3OZXA 4QFCA 4MQLA 3G2JA 2XNDD 3P2JA 3F3YA 2O2XA 4WOKA 4AP9A 2CLCX 5HGJA 4L9RA 4CFZA 2O2YA 3HDVA 5BYAA 3D6HA 2YZ7A 3DT8A 4XIIA 1QRSA 3W5HA 2GPSA 2ZI5A 2H0QA 1P1HA 3BSFA 1N8TA 2WAMA 2XDYA 3SYNA 1U1FA 3KLOA 3SP1A 3CZ4A 3R7AA 1QHEA 3ZDCA 1W75A 4CTJA 4BFUA 1C5KA 1MEJA 1DKOA 2FRDC 4QU0A 1U2GA 1OHHD 1GA4A 3Q3HA 1I1OA 4G6ZA 3OCUA 4MUIA 3LWZA 2FHPA 2Q29A 1L5RA 2BKVA 3AB8A 3HA5A 1TEZA 2VJOA 1FZTA 1H4QA 1CQIA 1Q83A 2ZJ5A 3BGDA 2ACEA 1W46A 1NULA 1OUMA 5FBWB 1FP7A 2I7CA 5KI6A 2PUAA 3OM0A 4W1RA 1H85A 3B89A 1GPMA 4FSXA 2OK8A 2NTNA 4G4SP 4KMOA 3FOCA 5EHQA 2P6OA 4JBHA 1RI1A 3V4PB 2PZBA 2WFLB 4K0KB 3T9DA 2VR1A 3HJTA 4TL6A 5AJVB 3OU7A 3I5YA 3GYBA 1DIAA 4TSRA 4KQEA 4YAWA 3WBBA 4BUJA 3G2LA 1YA8A 5I7SA 1QCYA 1X87A 3HUTA 3HXKA 4B48A 3EC7A 3L6DA 2GZRA 4BO4A 1NVMB 1MJFA 4R51A 4UCWA 3OETA 1PQWA 3R0IA 2HQRA 2G07A 2X8AA 3E27A 4JZKA 1PR2A 4BNNA 4NH0A 3D3NA 3ZI4A 5B1EA 1F0PA 2HHLA 4ZQIA 3BE8A 3P2YA 4PFKA 5A6SA 3T54A 2VI5A 4F4JA 5LD2C 4AJHA 5J58A 3MELA 3CH6A 3X2SA 4OI1A 2Q3HA 1OI3A 5BR7A 3ZTTA 4UAJA 4QWWA 4IIJB 1CRZA 1QG6A 1M1UA 4ZICA 3AB7A 4ND8A 1JQBA 1QHXA 1Z07A 2WM3A 3HADA 4U7TB 4DJDC 3QFRA 4MW6A 4HDOB 4JENA 2OM6A 4R1QA 4L3VA 1GYRA 3TLCA 3OFKA 4LOAA 4H7PA 2H1HA 3EPRA 2IHKA 1KJ8A 4M8SA 3OCXA 4HATA 2VDOB 4QGHA 3URMA 1E5LA 3V1YA 1IOWA 5AVXA 1CUBA 5MGNA 1B6TA 1XZEA 4XYEA 3EIWA 2Y67A 1NYTA 2C4WA 1CUYA 2X0IA 4AW9A 5K0BA 2YCLA 3IBFA 3NXKA 3ZX5A 3CNOA 2CVQA 1NSFA 5KKAA 2ETVA 3DHYA 2ZUVA 3CMMA 3G6KA 4E6EA 1SIUA 3O4JA 1ACLA 3ETCA 1OOEA 3JCZA 5SY6A 2DFTA 1DBSA 3I2JA 3PA8A 3R74A 2QLBA 3ILVA 5B2FA 1QZZA 3AEQA 3KOWA 3NHYA 5EFZA 3TF5A 4G86A 1JN0A 4XWTA 2CL0X 3HK2A 4IIBA 4KMSA 4Z0HO 2YL2A 3EPJA 2JLRA 2QI9C 3OCYA 4Q7QA 4CIYA 1ZO8A 1RRCA 3M4JA 2K7FA 3UJAA 4YALA 2G06A 1Z82A 3I2IA 3QP9A 1DFIA 4P3PA 5HIMA 1AMNA 5ED0A 1DJMA 1BQ3A 2E49A 2WPDD 4H16A 1NZDA 3LYUA 1C1XB 4J75A 1H2ZA 4AZWA 5IBCA 1UEIA 2EF1A 2SKCA 1SVMA 1X39A 4FBLA 2IV2X 2IYZA 3F9RA 1BDHA 5JS1A 1VHJA 3S1AB 2UZ4A 2NXNA 5LQRA 3U7FB 5ERXA 3T4UA 2QTVB 3PYMA 1YFJA 4MARA 2FSSA 2CVFA 3HY3A 4EGJA 1ILWA 1DJLA 4YRTA 1P81A 5CA1B 2AKAB 4OI0A 1OLUA 5HKKA 3CX4A 2C94A 2VHJA 2VAMA 4F93B 1Y9DA 2K7ZA 1ZIYA 3GZNB 4TS9A 1L5NA 1KOJA 4KH1A 3U4CA 1W94A 1K0UA 1MV8A 1QTQA 2FSPA 2GCPA 1IQ0A 1FMCA 2HJHA 3BE5A 1WHSB 3HGMA 2J87A 3R7NA 3UJ9A 3B7GA 4JSTA 3GBPA 4QRHA 3T61A 3PXAA 1E1YA 2J48A 1O0SA 3DUWA 1FP4A 3GVPA 2WW8A 5K0FA 3A1SA 3KVYA 2I0FA 1XC7A 1YV9A 1W47A 2J9GA 3KYCB 3QOXA 2ZSJA 2SHKA 1OWNA 3MTDA 4JCOA 1TJYA 2CHEA 3FWKA 2JW5A 1WL8A 4RM2A 1AKQA 3BSSA 4ZAVA 3DWGA 3NHAA 2IL1A 2B0CA 3B1JA 2DHCA 2CNKA 4GD3Q 1TUIA 1ES9A 4BO8A 4A82A 2TECE 3B5IA 2QM7A 3GN1A 2ISQA 1VRCA 1N9ZA 3NYWA 3T7IA 3U2QA 1MB2A 4B3XA 4BB0A 2XMGA 3H4MA 4WFQA 3LGAA 4TVSA 1DIGA 3NUQA 4HK4A 2H3HA 3TD9A 3GLIB 2WWFA 5K8JB 2QUHA 3CZQA 4X93A 5KKCA 3BEOA 3DEYX 1J1IA 4QX6A 2UUBB 4AY2A 1GAXA 3OWXA 3CS3A 1QFJA 1SVWA 3IUEA 4QBKA 3VDQA 5JHGB 1EFVA 3M70A 2WJZB 1XLUA 4EDHA 2CXHA 3NPAA 4FHGA 2C92A 1RJEA 1DXYA 1MH1A 2A5LA 2HIHA 3HKCB 4V2IA 5IUJC 2E48A 3BHMA 3ZJTA 3OEEA 4UQPA 4JC4A 2ZYUX 2I1LA 3INNA 4QE3A 3R0QA 1EHYA 3MWFA 1Z7BA 2AOTA 2BEWB 3E03A 3UK2A 3ZHTA 3BMQA 4IX1A 1XLTA 2F4VB 4LV5B 2PQ0A 3H9QA 3GI1A 5E6RA 1KU6A 4MJXA 4X84A 2AG5A 4BKMA 4C29A 3J7AC 1S89A 1AY0A 1AA6A 1U2ZA 4M9QA 4X8HA 2ZBRA 1LDGA 4JLBA 4YA6A 1VLHA 1CK4A 3H0EA 3SVZA 2DP4E 4BNUA 4J1QA 5ILOA 3B6MA 2A2ZA 3VO9A 4JI0B 2WIBA 3H9CA 5DOVA 1OZGA 1P6QA 4GC9A 3OF2A 3VYWA 4NCIA 3WZLA 5A62A 4ZEOA 1M1YB 4LXUA 1ZZGA 1E2JA 1F4VA 4TVBA 4UASA 5REQA 1U8UA 1Q0ZA 2NGRA 2RK6A 4ZU3A 1TM3E 3ZCTA 5BV7A 5JI3E 2VZ0A 5C1DA 1PIWA 2FK8A 2HBRA 2CNDA 2PX4A 3VU9A 3AERB 4BQQA 3K6SA 3WIEA 1YULA 5C8YF 2DG2A 1RVDA 2ZXEA 3AEQB 4Q82A 2QR2A 4G9GA 2GUGA 1ZN9A 3A6GA 3BCUA 1E4EA 4WVLA 5ALPA 3UKDA 1J70A 4W1QA 3JAWA 4DZTA 3N2EA 3W6OA 1FL9A 1I7SB 2LW7A 1VCIA 3L4BC 5DT2A 4BDTA 3CKLA 4ZEXA 3EQZA 4BN5A 1JB9A 3MWDB 3OA0A 2V74B 4KWCA 1KDZA 3SDBA 4DWJA 3DF7A 3EC2A 1JA0A 4HAVA 5AJTA 4NXMB 1QHHB 1SKUA 1Z15A 1SBHA 2ECKA 3PUXA 4HFRA 1QOPB 3QX9A 1XQXA 1PEYA 4CKEB 3IALA 1FNSA 1LH0A 4HC4A 1A2QA 1XD9A 3MJEA 4IOKA 2GJ4A 4JWKA 4KJZA 4P4TA 3VC3A 4E4RA 4E3ZA 1HYBA 4RV9A 5BNWA 5JAOA 2H1VA 1TF2A 5GZ3A 4DM7A 4KO4S 1X9GA 3EQ2A 2GAAA 4ZOQI 3KT0A 3TKLA 2O3JA 4PAMA 1IVSA 2O05A 4BMYA 1GM5A 2I34A 1I7DA 1PF7E 2HREA 2D7DA 3OKPA 3RK0A 4G1BA 4KAXA 1IZ0A 5DI9A 1WV1A 3CH7A 4I14A 4N5NA 3KIPA 5F77A 3BRQA 4Y1GA 2CUKA 5FQNA 4ERXA 4G41A 2D5AA 3VDXA 1LW6E 5H80A 4J76A 4XCXA 3P27A 1O4VA 3OC0A 4DIMA 3ZUGA 4YP1A 2XRFA 1PS0A 1GGKA 2X4GA 3OEED 1EVKA 2YN0A 1DBWA 4EY5A 3ADOA 5E4FA 1FDRA 4RFSB 1EUCA 2ODAA 1MT3A 2CFRA 1ISFA 4DSZA 2B2XA 5HXAA 2FFAA 4OKIA 1BXGA 3GDHA 4WUVA 1BIFA 1O87A 4O4LA 4X62B 1JYSA 1MJ5A 1QANA 4Y6PA 2X0NA 3VR4D 4PPNA 3PLAE 1YCHA 3L0OA 1A5AB 1ORIA 1QFYA 2FZKA 3CKMA 3RGGA 1QJ4A 5HBRA 4BVBA 5A03A 5ABPA 1K7FB 3OECA 1KFCB 1PNQA 1V25A 2B2NA 1XEXA 4CTNA 4BPBA 3ZDEA 1EWYA 2XOKA 1JHPA 2AJBA 3IUBA 1ZD4A 4UHHA 2VA9A 3ZOZA 4C0LA 1OFGA 1YA4A 1Y4UA 3W5BA 2QT0A 1GFIA 4I5DA 5KX5A 1D1TA 1A7UA 4UDXX 5CLLA 2CUNA 3I4FA 1Z38A 3WYEA 4AYXA 4UBMA 4I6GA 3AOGA 5DLDA 1WABA 3DBRB 2V5AA 1BEZA 3QYPA 3IQZA 3V1LA 2Q3JA 2VUUA 1IIRA 1M2VB 4HADA 4WCFB 2X4IA 4WZBE 4DYDA 3Q9SA 2CL5A 1FP2A 2JFBA 4M0KA 2DFKB 1KF0A 2GN4A 2XUDA 4TS3A 3I62A 3HB1A 3B3QA 1J2RA 2NV0A 3GJ7A 1KZ4A 3FY4A 3IH5A 3W7AA 1GEGA 1TCAA 3WL4A 4D3DA 2PGXA 4J8PA 5U4XA 1Q3HA 1CDOA 4OPMA 4DA9A 4F2GA 1DSSG 3I9FA 5FTJA 4M87A 1OGYA 1XRPA 3QWFA 5MFZA 2OZLA 4YUWA 1T4DA 5D84A 2ZJ3A 3HFGA 3IQXA 3TWOA 1ULHA 2WWIA 1LDNA 1PP4A 1RXIA 1SIOA 2AFRA 1OBCA 2NSLA 2RGWA 5EP2A 3RREA 3T5BA 9ATCA 2GTIA 2NTVA 1P33A 3ZGVA 4LE0A 1BWPA 2WF7A 3DWFA 4FOSA 4XJSA 1EQ2A 3T0GA 1RCUA 1MA3A 5TARA 4UC0A 5F2NA 4KV7A 2AFIB 2DBYA 3HJGA 2GK4A 2OVFA 2VF8A 4QDZA 4XGQA 3WTCA 1SUEA 5EE3A 2FW9A 4JUBA 1VLMA 4DWWA 1YF3A 1TGYA 5BPFA 3V2UA 1MFZA 3PQ7A 4PW0A 3SK0A 3ANXA 3FXAA 4AX4A 4YHHB 3BFXA 2DAPA 4YRLA 2CV2A 1JIKA 3TX6A 3VGJA 4B71A 1P2BA 1R18A 2C2BA 4UBLA 2EFGA 1J25A 1BKDR 4IDEA 5FPKA 2HJRA 3MSXA 4YN3A 4JNCA 2WUEA 3SR0A 5A4MS 4ZVMA 1USGA 4A2WA 4ZT4A 4AUEA 2F1RA 1ZUNA 2HEGA 1T8YA 1ONSA 3IAS1 4KXXA 4OYHA 4S2EA 5D7NA 5G0WA 2OG2A 4AROA 3QV1A 1C2TA 4NESA 3KE9A 3FRJA 5EP4A 4QUJA 2VDJA 1N78A 2XVXA 1X7DA 1H2EA 4NV0A 1BVRA 1NJ1A 3D3JA 3R6WA 4TSFA 4V02A 4M53A 4XUDA 5ARBA 4C06A 1PGJA 1A1VA 5KJEA 3VZRA 1T6YA 1XF1A 4FWBA 4KPUB 1FUYB 1EJ6A 1GIAA 1JHZA 2Y71A 3EGCA 4NABA 5FXMA 1N33B 3IGFA 3M6UA 3I9MA 1MG5A 4RENA 1EM6A 4FFRA 5T57A 2GJSA 5A4JA 3PR3A 3LZCA 3VZSA 1NW8A 3CF4G 5IRCD 2GA9A 2I2XB 3FTNA 1IDN1 3FI0A 1M2OA 3O9VA 3C6YA 5JH7F 3HKDA 3DYIA 1N1GA 2DKNA 3QTLA 1X19A 4TYMA 4MWSA 1RYBA 5HIJA 3RTGA 1C1DA 4TYPA 1X15A 3D1VA 4FMBB 4MKZA 1K7YA 4UBOA 5JMPA 3DHNA 2VC2B 2DLCX 4Q6WA 1NWCA 3TUZC 3A2KA 2PX6A 3TJRA 4RQUA 3H8VA 3QVSA 4TTVA 5CCEA 1HE4A 2OO7A 4TL9A 4MEJA 3DPSA 3K8YA 4L3OA 4C89A 2HIMA 3TLZA 4B44A 2PKCA 2WWWA 2D8MA 4G84A 4RWEA 4ZQGA 3NHFA 4RD2A 5HOEA 4ONEA 1T8UA 3GRFA 4MAMA 3F5FA 2PTHA 2F2TA 4LYDA 1DHRA 4RY9A 5H16A 1UXJA 2AXPA 4TXHA 2ZITA 4OEHA 3QKSB 4DV7B 3L6OO 3UK0A 3MJDA 1GG5A 4HN9A 3ZXIA 3I4CA 4MS1A 3L4KA 3ZXYA 4GZLA 4QPCA 4PHTA 3GPLA 2O1SA 3UPDA 5J2TB 2YUTA 3RM3A 1FQKA 1XZLA 2HUNA 2NU7B 3VTFA 2PUCA 3E22A 5HRCA 2NZUG 5L3VA 1A5ZA 4URWR 1Z45A 2RJOA 2I71A 2WAYA 3QLVA 4PZYA 4X6LA 5KHLB 3R2JA 4K1LA 4R71A 3H2JA 2ZBVA 2W2QA 3DXXA 4KXLA 1A2OA 1P1IA 4ROTA 4LE1A 4F4FA 3AETB 4B0OA 3CGGA 3P26A 2XMBA 2I62A 1ZVQA 1ISMA 4OFWA 1R0KA 4MCHA 4M36A 5DEIA 3VV3A 1GPJA 3VU8A 5C8ZA 5KUTA 4N82A 3MUNA 1X7WA 4G1VA 4LISA 2W2XA 4Y6GB 4EVQA 3I5MA 2JFWA 4ROSA 4OJQA 5CDTA 3ZW9A 4C7OB 4DMRA 4FGKA 4KB5A 4LBYA 2FMHA 4LJ5A 4LOKA 3KJNA 3IE0A 1CHDA 1UIMA 1SKYB 2FUG6 3AEKB 3L8YA 1TEXA 3PGXA 2CSUA 1U4SA 1Y4AE 3EWSA 2EQAA 3T3EA 4W5HA 3AF6A 5FHRA 3CONA 1MAWA 1HK7A 1QBGA 1BE6A 4G8DA 4CF7A 2QAJA 2VQSA 3HZRA 1TADA 5A3VA 2ZE8A 4LI0A 2GD6A 4IYJA 1I4WA 3SYMA 1SXPA 1XRLA 5JQGF 2NZXA 2HDNB 2QZ9A 5AKXA 1OXXK 3CLSC 4I4NA 4F0JA 3HNRA 121PA 1MB0A 3WGJA 4E11A 3BJMA 3E0XA 4QNMA 2XT9A 3NNSA 1ZRSA 4RABA 4I1OA 3L6EA 4EHNA 4L73A 2EKZA 2ZM5A 1ZD5A 2JCYA 3RS8A 4HDAA 4WPGA 4PYLA 2BI8A 3CQ9A 4TT3A 4L3WA 2DFPA 3M6MD 4G26A 5F4ZA 5EMNA 1N8KA 3SICE 4B2LA 3E3AA 1FUUA 1HTTA 1M1NB 2IKQA 1N5LA 3NXSA 4PYOA 4OXQA 4LG1A 4QARA 4PRYA 4B6JA 4F6LA 1KQGA 3IB6A 1QIFA 3QUSA 1Y1KE 4J91A 4WSOA 1VMDA 3CLVA 4DV1B 3C24A 4AU1A 4LQ4A 4JGBA 3O8OA 3W8FA 3G2IA 1IFXA 3EZ7A 1OX6A 4GYYA 1CR6A 2C9CA 1G8MA 1H3FA 2MIIA 3AFNA 2PX5A 3O83A 4UOQA 2CNLA 2P2NA 3TKAA 5E6SB 4CM8A 4KXWA 4NHEA 2NUPB 2OO5C 3IAS6 2G72A 3S5JA 3IBSA 2IXTA 5DIFA 3TMAA 3MOGA 1HXHA 2G09A 4ZXPA 1GYQA 1TVKA 1Y9ZA 1ZM7A 2AMYA 4QT0A 5J2UB 3NDIA 3VOBA 1AS0A 4DMFA 1GRQA 4BBZA 4F38A 1UJNA 5JVDA 4XI9A 1YRBA 3S2IA 3VTKA 5IX8A 3KB8A 3ZXXA 4ZRMA 5BMVF 2FWIA 3AY7A 3SXUB 4DYHA 1CC1S 1MXHA 2CXXA 4C05A 1AN0A 1ZJ6A 2VNHA 1GNPA 5IKOA 3D7KA 4JDPA 1SBTA 1SRRA 3V2HA 3G0GA 4J0KA 1UBCA 3KV3O 3T9FA 1OLOA 4X65B 1Q2XA 6REQA 2RBKA 1YI0A 2WOJA 5KOHB 4TLEA 1ZCZA 2JD1A 4R6XA 3VUFA 1I2BA 2XVZA 2IOFA 3FMFA 2H51A 3WHLA 5IYZB 3RVKA 1NATA 3RTAA 3I5AA 3JSXA 3VDNB 1ZFNA 3WI7A 5KS2A 5F9FA 5GOTA 3AJAA 2XCUA 3P96A 5K45A 2DPGA 1S01A 1W9MA 4I9GA 2P6MA 1MRZA 3HN2A 1VPVA 3RFXA 4MW2A 3ZWAA 1VG9B 2IDJA 1GTG1 3AR9A 2BM8A 4EAQA 4L07A 2P6NA 1RBMA 2F1KA 3PRYA 2D1YA 1NUQA 2P7IA 5GWXA 3HO6A 2OT3B 6LDHA 3RTEA 3JAKB 1GLGA 1A69A 1N92A 4HLDA 3LPDA 3OEWA 4R8SA 2R7LA 3NBKA 3DL0A 1YHNA 3ZHVA 5AVRA 2GXSA 2H5LA 1BQEA 3G9UA 1UMBA 1ZD2P 1W1WA 4NR0A 2Q7XA 3V9PA 4XVCA 2VRWA 2A1TR 3E23A 4RETA 4EVRA 3PP8A 5DRYA 3IDQA 4RDHA 5DHUA 2ZAMA 1L8AA 4MKXA 2GPJA 1G8KA 4QHTA 3RSHA 3UPUA 2Z56A 4WDQA 1H0SA 4ZTZB 2P6RA 2F8TA 4MYTA 1A82A 1NAHA 1Q0UA 3T12A 3LQ4A 1CXZA 3TTXA 1QORA 2CCKA 3EISA 4BECA 4KXFB 4EW1A 4BGDA 2C61A 2R6ZA 3DFZA 3F90A 3W0LB 2R2GA 2ZGVA 3OIFA 1ZGAA 3WQRA 1SB8A 4PYIA 2ODTX 4C6RA 3U44A 1Q2UA 1FFHA 4OK6A 5JAIA 2ZYRA 1GZUA 2X0RA 4FTWA 4JUFA 3EFHA 4UMEA 1U2QA 1W0KD 5HPYB 1C0LA 1GTMA 1VXRA 3AM4A 3L8MA 3RU9A 3F98A 5FOQA 3F73A 1YZGA 4QRIA 5L45A 3FCXA 3R7SA 3ZDFA 2C2MA 2B20A 2HF8A 3LQQA 1KPHA 1LBTA 2BDUA 4G0WA 4WKPA 2ARKA 4D43A 3ASUA 4H1HA 3VZDA 3KM0A 3M3DA 5DXJA 1IXRC 2CXQA 4BKPA 1ENPA 1JILA 2XHEA 1WKCA 4Z2AA 1RXWA 4EJ2A 3K5HA 3AKCA 1C0KA 5FLXA 1UBSB 4C7KA 3E9YA 5C51B 2H2WA 3EW9A 2JLQA 1G7TA 3JQPA 1VKRA 4X41A 1M2FA 3LQYA 1U63A 5EXTA 5E2AA 4U63A 5IW8A 1FC0A 1L7DA 4EB6A 5M7EA 2C59A 1C50A 3WNDA 1T36B 3BH6A 4EFNA 1XMOB 3IUSA 4ESEA 4I1RA 1RRFA 4WTOA 2N9UA 1PVVA 2BTQB 4EQ6A 3DGEC 2EEPA 1NXPA 3LK7A 3KZMA 3NHUA 4F21A 1FQJA 8ADHA 4UHDA 5CFLA 1M8KA 2X7HA 3M34A 3QXJA 2R4QA 4QULA 1T3SA 4JT9A 2QTHA 4MNTA 5EY5B 3L8EA 4OFXA 4IINA 2FW0A 4L9AA 2PKWA 4MDFA 1JXAA 3TDMA 3EY4A 3V97A 3OSZA 2VTBA 3UWDA 3WLKX 1N9KA 2PRJA 3O84A 3WB2A 4XD7A 2PGDA 1RPZA 1GPH1 1TQ6A 2DFDA 4AKTA 4WGGA 2LR0A 4L0DA 1J6UA 3MTEA 3OT4A 1G6KA 5FWAA 2BH9A 4HNAA 2HYDA 4U2BA 5JHHB 4FZJA 1NNUA 1U90A 4TXLA 5EXSA 4AIIA 1JG6A 3RHFA 4C0QC 2B3TA 1BOOA 2CFIA 3GB9A 4NAUA 1V1RB 4LKOA 5JXHA 4G01B 5KB3A 2G6TA 2EGHA 2KQUA 2VH2A 4TQAA 2Q2OA 5COBA 3OZUA 1QH1A 4YUVA 3TPFA 2F6RA 3QMMA 3S6JA 5T41A 3DMFA 4RORA 1YT5A 3GLHB 1L5WA 1D09A 3KE8A 4YV7A 2HSJA 4DSUA 4XAQA 5FI0B 2FEXA 3FW1A 3BWXA 2F62A 3TLGB 5EXPA 4XQGA 3U7EB 5A9RA 1JEOA 5FWYA 1V8ZA 1WMBA 1X2EA 4JT2A 1VYUA 3AFGA 3EULA 3I9KA 4M1YA 5IJXA 3WIOA 3WVNA 4F9FA 2PMFA 2QSZA 2HZ7A 5KNDH 3IJPA 5KYUB 1J0BA 2ZWAA 3QW4B 3AXSA 3ZV4A 2YFQA 3I6ZA 4F1KA 4F9GA 3R8FA 4I6JA 4E51A 2BBOA 3HVUA 4LRXA 3ANLA 1XXHE 2OQRA 1D8TA 4YRKA 1LVGA 1I5RA 1EE2A 2FOLA 2H5EA 5IHXA 2NUAB 1SOMA 1P61B 2ICAA 1Z2OX 2C95A 2JH8A 3B12A 3FHTA 4G0ZA 4JR0A 1QC5B 5AMXA 3SVLA 2Z8ZA 3L8DA 4D44A 3VHXA 4EL5A 5BYJA 1WUJS 4OJMX 2X9LA 3L04A 4G8JA 5JAZA 1GG9A 2JHFA 1USWA 1GAEO 1V41E 2PJUA 1GGHA 2AJLI 3KVOA 4KDRA 1L5LA 1XCPA 3RBAA 2IHYA 1KBQA 3TB4A 5HHTA 3AHFA 5LDGA 5BSUA 2WU1A 1XOIA 2XMZA 4I08A 2IUUA 1HURA 3TBHA 1T1IA 4X0EA 1BCRB 2JKZA 1F38A 3NHMA 1P4RA 2I8CA 4Q66C 2G67A 2V7PA 3KFXA 3SIRA 3D5EA 4UHFA 1GUYA 1WA5A 2O7SA 3DTTA 4PSCA 3U7HB 4R0MA 4A6EA 4FEAA 1QHFA 3MAAC 1FU8A 1Y3FE 4NBWA 3DVAA 2ZRFA 3H84A 3RC8A 5L51A 4ZI7A 3WWPA 1DINA 2VSNA 1E2DA 4QODA 1FK8A 3R0XA 2P8SA 2NUBA 2MWMA 1Z2DA 3M5WA 4FNAA 1V8PA 3VO2A 1PZFA 2ZIUB 1U3CA 1GCIA 4IF6A 3KKEA 2QYSA 2JIBA 2AKEA 2X7XA 4KR7A 2CVPA 4R8LA 1CY7A 1CY0A 1SN7A 3TG2A 1KI9A 4QBGB 2WQ7A 3HBAA 4KDCA 5CT8A 1P5FA 2LBPA 4D5EA 4RW0A 3O3OB 5SZKB 3IUMA 4YUZA 4K5QA 1ZUD1 1K8XB 3WL3A 3S2EA 1X80B 2HWKA 4DCUA 1C7QA 2NSJA 3T41A 2X8BA 2VRNA 3VXKA 1UOQA 2YWRA 1FFBA 5E9WA 2JLCA 2UKDA 2G82A 5KQLA 4KN6A 3ZVLA 2ZP1A 5IM4A 1W5EA 3DYBA 4KR0A 3VJKA 1RWWA 2WG1A 4GYKA 2CWDA 4MGKR 3H18A 4XH9B 4G5XA 2IBMA 4RZUA 4MMYB 4EUNA 4KRYA 3ZVMA 1JTVA 5JZOA 1Y3CE 3G5TA 3I1JA 4JL5A 3KSBC 2QRGA 4DJJA 3DZCA 3W77A 3FNHA 5LQNA 3HLTA 5KC9A 1OJ7A 1L8OA 1JV2B 1N2CB 1Q3TA 3E3MA 4U7GA 3TW8B 3O8LA 1WB5A 2GXQA 3UQYS 1YQXA 2F1IA 3B6ZA 3BSYA 1RLOA 5BUQA 3DZ8A 2VJDA 5IJ0B 4M83A 4NU5A 3A9RA 4HLUC 4QFMA 3ZGXA 1R4MA 5AKYA 3LECA 3IV7A 1R0YA 3U4DA 2RHMA 2HV8A 3FHJA 4FIDA 3VYTB 1RMTA 2ZBUA 2RSLA 4C0BA 3L2OB 1YU9A 3FYUB 3ICWA 2XKKA 4WY8A 1KJIA 1RWXA 2I1QA 1KI6A 3WNBA 4PLTA 3OZCA 2YXLA 3QPWA 5IF9A 5TS3A 1SG6A 1NPTO 3SC4A 1FYVA 1Z5NA 2YMMA 3KSDO 2Q5QA 4QUIA 1XRSB 2HRQA 3N39C 2IPNA 2YV4A 4L85A 4CDMA 4D80A 3OHMA 1RZRA 2RHCA 5E7IA 5J1SB 3IAEA 3MINA 3QXCA 3FJYA 4C0JA 2V7XA 4TWRA 4FR5A 2AT1A 3O2SB 1UL1X 3GAFA 5T6MA 5JLAA 3D2AA 4CQLA 1Q0HA 1G19A 3IJRA 1KDYA 2WC1A 3G8AA 3WSWA 2B25A 4IRUB 4TTIA 3GLGA 4MS3A 4QL3A 3ANYB 1UJMA 1QF9A 3Q88A 1BJTA 3V5NA 2QN9A 4DRXB 2WTEA 3IULA 2I3DA 2VT3A 4AS1A 4KU4A 2MR5A 4KACA 4EVIA 1FTSA 2Q41A 3BWCA 2P91A 4WZBA 7MDHA 4DMCA 3OPYA 2ORIA 2C8LA 4RKRA 2HZBA 2HQ1A 1TIKA 1LNSA 3WAGA 1E2KA 1FB5A 3AIOA 3ZWKA 2GGSA 1O77A 2NWQA 5KYTA 5LMNB 1PR1A 2HL6A 3KYIB 3U4QB 3JVIA 1N5OX 3BDAA 1WMDA 1WVIA 4MR7A 1T0BA 4K9OA 1M72A 1I6LA 1T9BA 1QP0A 2CMKA 2EFYA 1ZJYA 4CL3A 2K87A 2A4KA 4NZMA 1U3GA 5EYPA 2FP3A 1I14A 2BR3A 3I2KA 3NRCA 4HQKA 1J00A 4MPRA 1IVNA 3TECE 4J0CA 3CURA 2ZJ6A 1CZRA 1Z4PX 4DVJA 4K6CA 1ZGJA 3D8UA 2WP8J 1JJAA 1FTGA 2C29D 4I1YA 4DADA 5DV9A 5HK8A 3NBUA 4K9NA 1ODLA 2C3OA 2VSXA 2W2LD 4YRGA 5KNDA 3JYNA 5DM2A 5EA2A 4OUDA 3E2IA 4U2DA 2NXWA 4NZZA 4M1EA 5E9AA 2FQ1A 3DCNA 2FPPA 4FYYA 4OX9B 3NTUA 1ZI6A 3GAMA 3PLNA 3ZDQA 4M1ZA 1VRVA 4O4HF 1DEOA 5DO9A 2EZTA 3CIFA 2KB0A 1PR6A 3E8SA 2BCEA 3WICA 3NRJA 4R40A 3AJRA 2Y77A 2A30A 2RAVA 2Z09A 4EJMA 3ZCPA 3MS2A 4YYZA 3K2IA 2ZDGA 3GGDA 1R2QA 1X1CA 4MICA 2ZLBA 3CWQA 4S04A 3A6ZA 4K6GA 1L9KA 4Q19A 1DAKA 3SSAA 1FVOA 2CB9A 2V6IA 2ID7A 2ZRLA 2CJPA 4B8ZA 5I7RA 2XQVA 4Y0AA 3W8RA 2PT6A 4TL7A 3NTXA 4IUDS 3GNTA 5KWIA 1SKQA 2XE8A 4K88A 1YBAA 2PCJA 4XOUA 3EDOA 3IEVA 2VYVD 5EIXA 2H0RA 2MSDB 4REOA 1TOAA 2R00A 3O4IA 1N0VC 1VKHA 2VJBA 3FIJA 4RYDA 3D1JA 4G1FA 3MLEA 2XECA 5HEKA 1U6JA 2H1IA 2W83A 1V6SA 3HN7A 2PH1A 4YCSA 2AUNA 1HTWA 4YRBA 4LNHA 3GJ8A 1M8JA 3HM2A 1HSZA 4DB4A 2V5VA 3FHLA 4M7PA 3OJWA 4Z86A 3VYVA 3ET4A 4N3BA 5ICFA 1R0ZA 3AEYA 3OZGA 1CQZA 1OFTA 4QFDA 2GCOA 2CXNA 4DCCA 4Y7DA 3WMFA 2Q3LA 2IEAA 5HCUA 1UKAA 3QHPA 3BCSA 1PS9A 2QD5A 4GPEA 4HDMA 4EG8A 3PWKA 5KWJA 1DIRA 1L4YA 4TV8F 1Y8CA 1U9IC 4NOKA 3FD8A 1PV2A 3P5SA 3SQWA 2J9RA 4KL8S 3KQYA 2VDQB 4IAOA 4BEBA 3G6WA 3HB5X 4CEIB 1TPYA 1VHTA 1P91A 1U81A 2OCKA 1JJFA 4FNGA 4A8JA 1WXIA 2B83A 1JYFA 2CLMB 2VSFA 4G8CA 4ITVA 4NYJQ 5HCIA 1KFKB 2YBEA 3SLKA 2ZTUA 1Q1GA 2GFQA 1E1QD 1N2ZA 2BAGA 3W1WA 2WFMA 2I3BA 5B1SA 4PY2A 1G21E 1TQ2A 1C7FA 1PQPA 3KQHA 5HQ3A 4XX0A 3BWDD 3RRFA 3VZBA 1I2CA 5P8WA 1T4BA 1U99A 3O8NA 1C81A 3F6BX 2WZQA 4BZQA 2EOAA 4NP6A 4YB8A 3WTBA 4I4CA 2WDZA 1W88A 2C7VA 4HEHA 5DNDA 1CJKC 2R79A 4MYHA 1TW2A 2FSIA 3GLFB 3C3CA 4JXXA 1Y9EA 5AI4A 5DNUA 2HA6A 3ELUA 5KYXB 1N36B 5LA6B 3QX7A 1O97C 2DLNA 3M8KA 4KV9A 3KEFA 4RH0A 5B4UA 1YQGA 4CXMA 4HBGA 3P0RA 3K05A 4P7JA 1X1BA 3D4PA 2XZTA 3OZFA 4XIGS 3UMGA 4JUCA 1JDBB 3NONA 4RJKA 4E7OA 2ZWMA 3S2FA 4CG3A 3UJ3X 4EA7A 5JBNA 3G0IA 3C3XA 1Z9BA 2R4UA 3ZHRA 4BQSA 4F5DA 3WA6A 4AXXA 1A9XA 1YGPA 2IBSA 3SC2B 4QGAA 2PIAA 5B53A 3RS5A 2QUBA 4W5RA 3HRIA 4Y30A 1E3TA 2C9YA 3QLJA 3ZHXA 2X0EA 4UBJA 2QTLA 3H8SA 1HFEL 3TBFA 4BOYA 2VF2A 3T5AA 1ID8A 3R3SA 4P7FA 4WBNF 4E5DA 2HMWA 4MVJG 1SU4A 3NM5A 1V8FA 3F67A 1Y4SA 2I4TA 1ZU4A 3H1FA 1EAMA 3AJ8A 3KB1A 2HM7A 2PSEA 3ESCA 1TAGA 1C8BA 2G76A 1ZD1A 3SFTA 1P45A 3UJBA 4AS2A 3VNVA 1PRYA 1UFQA 1IB6A 4F85A 2JFPA 5J4KA 3PPXA 4CUJA 2FG6C 1VHQA 2JEOA 1QIJA 1Q6ZA 1PJ8A 1G7SA 3MCVA 3ZD6A 4I2NA 1E3QA 2BV3A 3CTMA 4LGVA 5CITA 3S2YA 4DSNA 3KYDB 1GT6A 4MWBA 3TYXA 5LXTB 1XWIA 4B9AA 3ZWPA 3ECAA 1L6IA 1Z68A 4XR4A 1WV0A 4BVAA 3O38A 4P93A 3WGVA 2C03A 2Y76A 2PUEA 4J3NA 3DE6X 1GZDA 1P0MA 4HRYA 3O92A 1CUEA 3KTFA 3UTDA 1ACMA 3PFIA 4QC2A 2WHPA 1NFQA 2ZXFA 4IUCS 4J0FA 4OD0A 4M0PA 2AR9A 2XUPA 2BIFA 3RT7A 3GL9A 3SBDA 2JEYA 1DQSA 2YHBA 4J2OA 4M6WA 4JJKA 4I8DA 1VCOA 3B85A 2VDLB 3KTDA 4PGMA 2YVKA 5DYNA 4Y2HA 1JDNA 1A5BB 2ZYDA 2JJ2A 3E5MA 1TAHA 2IVZA 3QHAA 3A1CA 2JFFA 2F90A 4L1KA 1TM5E 4MQBA 4RVHA 1O89A 5WRFA 3ZCUA 2UYHA 2P7HA 1ZNWA 2IWHA 4B45A 3DF9A 5C2JB 3FRHA 3OFVA 4ALLA 4FGWA 3PDJA 1J42A 1Q7RA 2V54A 1DZ3A 3LXMA 3EGDB 1J9ZA 1XZHA 3UK6A 2OZVA 4PGHA 4C4ZA 1EDOA 2UVPB 4YMWA 3FWNA 3FPJA 1SBZA 1UADA 4GO1A 4RIEA 2IZ5A 1MLDA 1VDZA 1ZWKA 2XSZA 2H4JA 5JZ9A 1P2SA 2VK8A 4FDVA 4NIMA 4TWAA 2HYIC 2B8JA 1B15A 1JKJA 4O4JA 4OCZA 2EBUA 4CL2A 5IDWA 1MX5A 3QJYA 1FXWF 1JT9A 4CCSA 3FPLA 4GLBA 1CRLA 1HTBA 1K7SN 2PPVA 3H87A 1VMIA 1EKXA 3GOHA 3RRBA 3TW6A 5EVJA 1WIWA 3EXIB 4PO8A 2WQ6A 4JN6B 4US0R 2XA9A 2YDYA 3DDSA 1RBZA 5FUWA 2HF9A 1FRZA 3PHLA 1KDPA 2ATIA 1L1EA 1ZNQO 3W1EA 4D9HA 2WTXA 3DAGA 1MVOA 4LC0A 1TM1E 2FZEA 4HGPA 5KYYB 5TQJA 1QQAA 3FMPB 1CVIA 2GYVA 3P97A 1X3SA 3ND6A 3NOVA 3LG2A 2N1MA 4ZU1X 1WCYA 3KNZA 3TFQA 4YCBA 4ZYWA 3DBOB 3L0DA 3GVCA 4UEWA 4CM3A 2J6BA 3LX5A 1YRLA 5JC8A 1N1MA 4QQKA 4DXHA 1RU3A 1O8CA 2GCNA 3IOCA 2I8AA 3ENKA 2WINI 1QLHA 2PMWB 4OQPA 5K0NA 1AMOA 5EXDA 1P7CA 3L43A 1NVVQ 2J6CA 2HRZA 3UIEA 1DAFA 4GR9A 4XW2A 5JDCC 2WBLC 4WWHA 1LVUA 1C3LA 3DDZX 3FN4A 4UE6A 2DPMA 1VI2A 4TZ0A 3EQ6A 4D0RA 4E5VA 2Z43A 3JTEA 4FJ2A 1SUPA 4BUZA 4KFTA 1BS2A 2W8BB 1KJJA 1NW5A 2LGJA 1BXRA 1H5QA 3H0CA 3UZUA 3MYRA 4D9IA 1VKJA 3H1GA 5ECYA 1KMNA 4KZPA 5EWJA 5T7BA 4D0GA 1AURA 3BG5A 4UNIA 5ALSA 3UV6A 4IFBA 1ID1A 3GEMA 1G4AE 2CDBA 3ZNOA 4F2PA 3F7MA 1IZ8A 1UIRA 2UYQA 3OZWA 2XITA 4JJIA 5FYDA 3TZHA 1U0OC 2VSOA 2DT5A 2HA5A 3C6MA 1RXUA 1ZY2A 4FKMA 3PWTA 4PYRA 3S0JA 1Q5PA 2KMLA 5DBFA 4ZHQF 4RQTA 1TM4E 1R6VA 1UCFA 4WA7A 1RBYA 2XZPA 3TVYA 3WMXA 1OYWA 1NUAA 3JALB 3LP6A 2H08A 3BX1A 5U4QA 4KODA 4YH1A 5LZ8A 1W35A 2IH5A 3IVMA 3DHVA 4Q4AB 1F6BA 2FMFA 1DKUA 1OAOA 5K0EA 3RTCA 2WEKA 5KQGA 1JSLA 3ONVA 4J0EA 1YL6A 1VJ0A 5JAQA 1JMVA 3E7FA 2P0EA 1MQAA 4H3SA 2GO1A 2H1LA 3DO6A 3O1HB 1JFRA 2A78A 4YPFA 1TDJA 4RLHA 1CPYA 3A2LA 1A9TA 2E87A 1QVZA 4EYOA 1CBUA 1UM9B 1YFKA 4RJIA 1FP6A 3MQFA 5EJGA 1YCDA 2OSVA 2OLEA 5CH5A 3WY9A 1KJWA 5CGQB 3KZKA 4ZC8A 2BUCA 2QV7A 3FUWA 4ISBA 1W0CA 2C5AA 1TJNA 4ENSA 1JJVA 4OAQA 4O2AA 4WNYA 2GWRA 1XPJA 3LX8A 4HDRB 4C6TA 1DWUA 2A9JA 1Q11A 4A4DA 1VYTA 1IWPB 4EVSA 5AWFC 1QGAA 2F4NA 1ZDMA 3N9IA 4FNMA 3VX3A 2Q1TA 2GBIA 2BHTA 3BXGA 4LTMA 1MB4A 2OBLA 3S70A 3OE7A 3TKYA 3IIIA 4WNAA 4XJXA 5EEGA 3DO5A 3BQ9A 3FFWA 3O94A 1M5UA 2C58A 3RSFA 1NUUA 3DHWC 1T9AA 3DOEA 1Q44A 2YY6A 3A25A 4P32A 2RB5A 2VOJA 4J1NA 4M9ZA 1SUSA 4WZAB 1EWKA 3CLKA 3IERA 2IP4A 5AVQA 3PD7A 2UUAB 4LF9B 4TVOA 3WA7A 1ZIXA 3SEAA 3R5HA 2A86A 4ER0A 4V1CB 5C3MA 3KOZA 4PGFA 4ZV4A 5C5IA 2JAUA 1D4ZA 1NYQA 4WN9A 3MRVA 2VJNA 1FIUA 4R2JA 2GESA 3D6FA 1U0HC 1EQAA 2RGXA 4UEKA 3L1HA 4IR7A 1RPTA 5BPHA 1S4MA 1X74A 4RNCA 4RK0A 3NKLA 5G2OA 4JYBA 3ETNA 4JHLA 3HEBA 3GT3A 3PXUA 4QECA 5BSWA 5KDDA 1KY2A 1LX6A 2QTTA 5DMHA 2XKBA 2DXIA 3TUJC 1AA9A 2JNWA 2HCRA 2HFJA 2XBLA 5LP6F 1JLMA 4A27A 4A0QA 2MOKA 2W98A 4HYTA 1NXTA 1QKKA 4JC5A 1MO5A 1HE2A 4R1TA 1PTKA 3COJA 3ND9A 1G1AA 1Y5RA 3DP7A 2W7TA 3HZOA 5FBKA 3W5AA 5C1PA 3EDYA 5EMMA 2LXNA 4CMBA 3CC8A 1JZSA 1PG5A 3GYGA 4CMEA 5KPJA 3DPIA 2O6HA 3EFOA 4B46A 3E81A 4YMHA 4Y0NA 3FGNA 4GLJA 1H9CA 4A91A 1IBMB 4QNRA 2GFIA 1Q57A 1XCMA 4GECA 1QQTA 5FTNA 1BXRB 1JI3A 1KAMA 2VJMB 4QDUA 5K8IA 1UJCA 1IHYA 2QGZA 3L0SA 4JFAA 1NYRA 2NO1A 1PKEA 4LVCA 1QIDA 1TA0A 2PMBA 3A14A 2PDAA 5BUCA 4G8BA 4QPZA 4QSHA 2X3UA 3JZDA 1RQLA 3T3IA 2VCEA 2I4NA 4R9VA 5EINA 5TPZA 5LWHA 1KQOA 4BTEA 5EPOA 4QUBA 3RSCA 4L7QA 3UT5A 4BX0A 4YRAA 3PYLA 3HV0A 3O31A 1ZNYA 1GNVA 4O33A 4EPXA 3AVVA 5JCJA 3OFSA 3P7MA 4B3FX 2CV1A 4FYHA 4WZZA 1I0IA 1C9DB 4OI2A 3TRKA 2ZBPA 1PDWA 2SCUB 1JLKA 3MJTA 4XASA 1QZ3A 1II9A 2H7XA 2YUIA 3KBOA 3OX4A 1NVAA 3QWBA 4KO3S 4QEDA 5ILQA 2GAIA 3Q3CA 3BJIC 5B3JC 1R0LA 1J49A 4F3YA 2QLFA 3NAQA 2YJ3A 5EIFA 2GJ8A 4N5HX 1G0OA 4DQVA 1Z7WA 3U5TA 1RAFA 3FZEA 3H2HA 4KPGA 4CKYA 4DC9A 5L7TA 4B73A 3AHDA 3OE7D 3QKRB 2YVUA 4KSYA 2ZB8A 4UPDA 2W6IA 1QONA 1ZH6A 3A9VA 1DUSA 3ZQUA 1FUKA 3DSRA 3QIVA 2QF7A 3DD1A 3PHIA 4PC2A 2DR2A 4QO7A 4IHKA 1XAHA 4Z4CA 2WFAA 3BBLA 2JCVA 1IPHA 3KJGA 5SICE 3AR2A 2D0IA 3LFUA 2AIRA 4AWBA 4ZRDA 1DNPA 1XEFA 2J9FA 2BRUC 2Q6OA 2ONJA 4RZ3A 5CHYA 3E3NA 3RT1A 1IXZA 1K08A 1NXSA 3WADA 4G4IA 4BNDB 1L7VC 3IR6A 3BMOB 2QEQA 4MRNA 4DFDA 2WV9A 3RWMB 1BD4A 4PV7A 2BKAA 3OIYA 2BGIA 4G0NA 2ZTHA 4PNPA 4DIEA 4IZIA 3RAFC 1I3CA 2FW6A 5K8UA 2JBAA 4EUFA 2WM9B 1DAPA 2ZRNA 3AWDA 2XYHA 2WMNB 4NXNB 1IPEA 3UANA 4HXGA 1WPQA 2OAQ1 4ARSA 1J8MF 4YCCA 2G70A 2O9JA 3A1EA 3MCUA 3N0RA 4IDOA 4Z8XA 1IEWA 4CUZA 4MMZB 1FYDA 3GFBA 1VE5A 4I7EA 5LOVF 3HBMA 3P0IA 2VP2A 1IH8A 5KINB 5BQPA 3R7FA 4I3GA 1LWOA 3A37A 1S7GA 1A76A 1Q17A 1SUBA 3TLXA 5IEJA 4OB6A 1RWQA 3W3ZB 1NM5C 3OOWA 5GJBA 3TINA 3VR5H 4DR4B 4JSRA 3IT0A 2GHQA 4HO1X 4E5PA 3UB2A 4ZVLA 2CMGA 3QU7A 3SN6A 1H2XA 3L79A 2ZTMA 3U3XA 2BGTA 1EUDA 2VSQA 4P4SA 3DFKA 1E2BA 3PDHA 1E64A 3SM9A 2ZRIA 1RI5A 1ZN8A 1K8QA 3GFTA 5GM1A 4R7GA 2WSYB 5AR1A 4FWTA 4CM7A 1NI4B 4XQEA 1Z2CA 2AZXA 4FONA 5DM60 1AM4D 3R3VA 4N47A 4J03A 4UTOA 4QIHA 1Z47A 1M33A 1Q77A 2NXJA 4ZZ0A 5TPZD 3CBGA 2HMSA 4RKYA 1M0TA 1TU3A 1GA6A 5CIQA 621PA 4R68A 3E7XA 1OFIA 3PUKA 4O2BA 2A1IA 5LP6C 3S8EA 2E18A 1XKLA 2IYRA 4MEBA 2QTAA 4XIJA 3STUA 2O0MA 3EVFA 4KQ2A 3RODA 2DR0A 5A5EA 2AK3A 3FWYA 4RD4A 4WK6A 1CS0B 1IZ9A 5FKJA 3FI9A 1QH0A 4U2EA 2IYSA 4P4LA 5JT1A 3QELA 4DLRA 5LQJA 4OK5A 1U80A 3H75A 5BNTA 1R74A 1SIWA 5IAAA 3DZJA 1WXFA 3H19A 3NT5A 5CG1A 3BIJA 5EHGA 4NI5A 2EQBA 3OIUA 4NCJA 1NSYA 3LXUX 3NHZA 1GUAA 1K1EA 2GLTA 2H54A 4FMCB 4DG9A 3T3DA 4R9SA 3U1BA 3QU9A 2AYYA 1H69A 4D9MA 5HZGA 2W6ID 3PE3A 3I6BA 3M5CA 3T5GA 1OT5A 2C2GA 1V5EA 2DPYA 2VQ3A 5LQAA 1YDGA 2BFEB 5GOZA 4HGOA 4DJAA 4CUKA 4AUNA 4I55F 4RVUA 1A95A 3DMRA 5EIWA 5AJHA 3UCEA 3V1KA 2OD2A 3TQOA 4BQOA 4EG5A 4GUAA 3RVMA 4D45A 3W4KA 5JZVA 2Z58A 3S28A 3C2QA 3WP1B 1DX6A 4MO9A 1RPJA 1NZFA 1WRBA 2XODA 3HACA 2XCSB 2QXTA 4HQLA 3T5DA 2YINC 4JU8A 1E60A 5FBVB 2D4HA 3HY4A 2ZTVA 5JYEA 1YS1X 1ZMOA 1Y8QB 3UGQA 1M6HA 1N75A 3PR1A 2A9QA 1VKOA 4IUYA 3KLPX 1ZD3A 1P6UA 2OXFA 2XRYA 3GG2A 5HP4A 2P79A 2IV3A 2YRXA 3GEPA 2EYQA 4BMXA 1TYDE 3GUCA 2FR0A 3WQSB 2J3IA 2BFAA 3FCAA 2MSKA 2P2CA 2D2EA 2QRJA 5CW1A 5E9JA 6AT1A 1EIWA 5CUQA 5TC4A 5ALXA 2QRNA 3KOYA 5KYVA 1RTTA 3B9BA 4Q3CA 5JNSA 3BEDA 4CPDA 4AJJA 1CJVC 1JLSA 1XK7A 5LFAA 5A3JA 3RFVA 4S0ZA 1E2HA 3ZE9A 2B5VA 4WERA 3Q2OA 1QFZA 1WMEA 4GP6A 1FTNA 1HT1E 2OAGA 4JLMA 3VOAA 4LHZA 5JFOA 3WFJA 2I2DA 3UUEA 3IA2A 3H42B 3BZUA 3DLTA 1Z74A 1CY6A 1EX9A 2F3SA 5BN3A 3MHTA 1E7MA 3K8OE 5CCXA 4QJ5A 1WUHS 4NBRA 3SOZA 4ECEA 2RHTA 4D0NA 1IBRA 4H7JA 3AHHA 2Q3CA 5EGNA 1L1FA 1VJRA 1B41A 2GCIA 5C46F 1GZSA 2AMFA 1XDUA 3U49A 5LKRA 1VG1A 1Z4MA 3FB4A 2BP7B 3K0BA 3N2IA 4JY7A 5FI5A 4BQRA 4PWYA 1SPBS 3AR5A 1W25A 2XE4A 3H2IA 3H6GA 5AVJA 1JTFA 4BMOB 4EKNB 5JR3A 3NT2A 1Z22A 1NT2A 2IUTA 3TDNA 4KFSA 5IK2A 3TJMA 1OXKB 3NRBA 4X1YA 3B8HA 3T4EA 1JHMA 3R3WA 3REFA 1XTRA 2HMAA 4F71A 5IM5A 1D2AA 3TQCA 4W5WA 4PNHA 4UUPA 4JKYA 2JGNA 4OXRA 5JROA 3T3OA 1WDKA 1M7BA 5ERYA 5JJCA 3EPHA 1F12A 3EEIA 4HHEA 1WM1A 2GBLC 3FDFA 3LC2O 1MMFB 1W44A 5F76A 3K0SA 2HK6A 3PD0A 4TTTS 4P5PA 4NZOA 2GZAA 2J59A 1LPMA 1PDOA 1E4VA 2WJYA 5IT0A 1EDBA 1ECGA 4UZFA 3CZAA 3MPUA 4LNAA 3TRJA 5DHAA 1JFFB 3ND7A 1MXFA 4LQDA 4I9FA 1Z5WA 2W2PA 4FT2A 5IH3A 1UXIA 1DG1G 4KQJA 4D97A 2YNMA 1KQFA 1L3CA 1TMOA 4FLEA 4XVRA 4FFPA 3ZX4A 4K05A 3NPMA 1S8OA 4REQA 1KSFX 1A9SA 1GL3A 4GM0A 5MFPA 2VPYA 4R16A 3ZGZA 1V5WA 4G56A 4GI5A 3DMPA 4BQIA 2XGGA 4AKGA 1L7EA 2VNIA 4D8XA 1LI7A 2A1UA 2QDXA 3I2HA 3LQFA 1O6BA 2P8JA 4GZ5A 4RVSA 4E5MA 3BCRA 2W6NA 3OPNA 4TZTA 3VR5A 5FLEX 4IO1A 4H15A 4C2AA 3LY8A 4U6QA 3AWIA 4YT2A 3ESBA 2WIAA 1UDBA 3AUUA 4IJVA 4ZVTA 4P5DA 1GNLA 1N2HA 1FLDA 3OEYA 1Z4KA 3SHTA 5C53B 1YVDA 1DP4A 3DFFA 1KKMA 1PEKE 4RGYA 2DCUA 2BTOA 2WKWA 2HUPA 1M1ZA 3IBGA 4MHTA 2JASA 3IPLA 1T5SA 5J40A 4ZJZA 3B3FA 4DCOA 2G80A 2R2AA 3CXRA 3GWZA 3AVXA 1KO7A 4UE2A 1CRWG 1DPGA 2EJUA 3MQ4A 4YQFA 1J8DA 1FBTA 1FYFA 4GOOD 4FM9A 2ZREA 4BXOA 5DTMA 2YIMA 1VGRA 3PX7A 4R01A 3U19A 2BKXA 2FXIA 3EZ2A 3FUUA 5BW6B 3TNFA 4IXMA 3RS3A 1EFPA 4E12A 1G6HA 3N6VA 4HY3A 3N05A 1PR0A 5FOVA 2IY7A 3P9YA 3D43A 3GELA 1IAVA 4DIBA 4EJSB 1LZLA 5T3YA 5HTOA 5DDIP 2C31A 2EBHX 1Q74A 2P1RA 2X4DA 1LX7A 3M3PA 2P9ZA 4KGXA 2EZ8A 2EKDA 4UMVA 2XBUA 4COOA 5CX1B 5CA1F 3DW1X 2WF5A 2IZ1A 4QSMA 3HA3A 2E6UX 1JS1X 2BELA 1GCOA 2EBWA 2Q45A 3ASZA 3C48A 3GU3A 4H1VA 5JSYA 4DMHA 4HDSA 1PO7A 1KQPA 1ESNA 2X2OA 5ESDA 3ZVKA 2HLPA 2CFCA 2C5BA 1VFNA 1ZXBA 1LV7A 2B6HA 4ND3A 2IUSA 3RIXA 5BWMA 5IK2D 1U8FO 4CM4B 2XXAA 2H1SA 1J20A 2I22A 3OLZA 4M22A 1CQWA 3SQXA 2FW7A 5CXUA 4YTEA 2F1JA 3TPZA 4IMPA 4LSMA 4XRGA 4Q24A 4OLHA 3C0KA 3AUYA 2CEKA 1CJTC 3CVUA 5GVSA 1LSOA 3RS7A 2YWBA 2MYUA 1I4EB 1SVNA 1XD8A 4AWAA 4F3CA 4X1IA 5AK5A 2AOWA 2QVZX 1RLJA 4UHKA 3COWA 3W3AA 5BVGB 5BN4A 4XEUA 1HLGA 4F72A 1KMMA 5CA0B 4FJ1A 5HKBA 5BV0A 1E3LA 3JYQA 2B7LA 1B8UA 1D7OA 1L5SA 1ZVKA 3SS8A 2O2IA 2CF5A 4FGLA 4N6GA 4JVLA 1XVAA 4TTJA 2NQ8A 2PNFA 4IV0A 2J7PD 3FVTA 3SDZA 2KLHA 2AVNA 3H9GA 1JH8A 3COVA 3MBIA 1NZJA 2FUEA 2I1WA 2PL9A 3H7AA 4KJXA 5E4TA 3IJ5A 3RRZA 2E4VA 1YH3A 2YHIB 3M5DA 1AGNA 1EX6A 5C7LO 3KEGA 1CIPA 4J7CA 2WJIA 3MMNA 3WNQA 2ROQA 3GZTB 4BMPB 5A4KA 3O1IC 4P4NA 4RDIA 1LV8A 2PA0A 5E8JA 2HGZA 1VE6A 2D00A 2VHCA 1E5XA 2XCIA 2ZE6A 3ZXSA 4AO6A 1X7HA 1Y0BA 2DSTA 3VJRA 3JQAA 5JUWA 1C8KA 4MX8A 2IYWA 4CT4B 5DVZA 2MCFA 5E7MA 2NP6A 3ZWCA 1KWGA 4PSDA 4YAKA 4AVYA 1AT1A 1GARA 1MGPA 1ULBA 4GIBA 1OCEA 2OV4A 1R6XA 4KI7A 4G67A 2EW2A 1SURA 4NMLA 5LIRA 1AKUA 2QLNA 2B30A 2N1BA 2XWBF 4MWEA 4U7PB 3F4KA 1TKRA 1YZVA 1X70A 1OAAA 4GXQA 2VJQA 3NYRA 2RGBA 4JLSA 2A5DA 4V0KA 1QZXA 4HQ0A 1IIBA 2TMYA 4W1PA 2JJ1A 2QNBA 4TQ9A 5DNCA 5J43A 2COEA 2WB4A 1GTSA 3MWEB 1I1NA 1V4VA 1C7JA 2HF2A 1EYZA 2IEZA 4MVJH 2JFHA 2ZZKA 1RM3A 3C3WA 4XFKA 1LW7A 1V48A 5HZHA 3T52A 3E1SA 4PG5A 1VP9A 2WVHA 1A4RA 2CNOA 3ZHBA 2DTXA 4PRKA 4M9CA 2GRAA 4B80A 4CV3A 5KWSA 3B5EA 4DBZA 4PS0A 2YW9A 4URHA 3T0FA 2OBMA 3M0EA 3NNDA 1NV8A 3QSGA 1KEVA 1MAHA 4EGQA 3OURA 5B3LA 2W2KA 1RKQA 4MW5A 4OXYA 1P60A 5KVAA 2FWAA 2TS1A 2XMCA 2OAP1 2YN4A 1A9PA 2FPIB 4MIEA 1XGKA 4OLFA 4UTXA 2YXDA 4YNBA 2EG5A 3WKBA 4AJNA 1QYCA 2XCTB 3ACCA 4F06A 5BN5B 1E2FA 4CKBB 4J7XA 5ALOA 4JBXA 4NVRA 1JJBA 3HRKA 3I42A 1KRWA 5LWQA 2JZNA 3MTGA 4JB8A 1J09A 3NTLA 1VBNA 3M6FA 5LMCA 3PICA 3D3WB 4UEQA 1JE0A 1GU7A 2ECQA 3DE1X 2BHNA 4L8YA 4MA4A 2IDZA 2VL7A 1PUXA 4PINA 5JBQA 2UXDB 2GD1O 4NULA 1KU0A 1U2GC 3JZMA 1PK8A 5TDHA 3ZLVA 2G4LA 4IS3A 1AMUA 3D7LA 2AJCA 4TKUA 1YONA 4CDGA 2YZMA 1K6JA 5I48A 3WKCA 1SA0A 4X63A 3SIPA 3W5VA 3LYLA 2RH5A 2EJCA 5ARCA 3UMVA 5LPNA 4DXDA 1MJGM 4R3NA 1LLDA 2WD7A 3OQJA 3P4YA 2A9VA 3V8RA 1K2VN 2D1FA 3LYAA 4XVQA 2WT9A 3O74A 1H4VB 4JVMA 4PC6A 3KVNA 4YRCA 5AW9A 2REQA 3A4VA 1G20E 1SEPA 3ICOA 5K3FB 2YWJA 4WEQA 3S4YA 3IS3A 1I1QB 5GJCA 4KKVA 4GT1A 3MA0A 5E3IA 4MRRA 1LPNA 2DUMA 2ACWA 1E3IA 1NLUA 1CDZA 2CLDX 2O3QA 2Q21A 2RHOA 3KQQA 5DGHA 3JQAD 4WKCA 2WMOB 3TLAA 4YGXB 3EGXB 5DNVA 1MOPA 2WKRA 4DIFA 2O8DA 2PLRA 4Z7NB 5DWQA 4CBVA 1NBMA 1WSDA 5L53A 1ESEA 5IWCA 2JAWA 2QS9A 3RI3A 3N6RA 1M6EX 3WHKA 1YQWA 2WKPA 1CY8A 4L57A 1G4HA 3MN1A 4Z53A 3USZA 3C3PA 3ITDA 3ROMA 3ZI0A 2AKYA 2ZSDA 4G0VA 1KMIY 3LL4A 2HMUA 1DJOA 1E1CB 1IG3A 4G0YA 2F8SA 4DZZA 1PGOA 3FJ1A 4YJ2B 2CEAA 2C98A 3A1TA 1R88A 3DMTA 4MMXB 5K6TA 1NT4A 1JHDA 3WB9A 2TYSB 4A03A 3JQAB 3NG1A 1DDIA 1A8UA 2H5IA 3TTWA 2JJ1D 2PSJA 2QRVA 5K3DA 5H3CA 5AI8A 1XDSA 1NLMA 3PYXA 2JBWA 2JIDA 1ELOA 3BA6A 5I7WA 1SXGA 5GZ1A 4QU5A 1E2IA 4IKEA 2R8BA 4YQZA 1ZCBA 3K6JA 4BO6A 4ZOBA 1G18A 3FCYA 1Q22A 1DAHA 2O48X 3LUBA 4YT4A 5CAEB 4LF5B 4J90A 2ZKIA 1FJ2A 1HEIA 2AOUA 2JIZD 1DG3A 4DCJA 4O8ZA 4GM4A 4B7ZA 4CTKA 2PUDA 3WRVA 5A06A 2MHCA 1GRVA 1ADGA 3QYAA 1UBGA 2O8VA 4U3JA 5ESXA 5K99A 1PZXA 3JAMA 2QXUA 5AVYA 3K1ZA 4BMZA 4A2QA 2ODNA 4IXWA 3D8RA 2PT7A 3HI6A 3TPCA 1EBFA 4EJ0A 3TIVA 3TW4A 1B6SA 1X1TA 1E92A 1ODSA 1RABA 1WXGA 1BG6A 4KQGA 4P8RA 2YY5A 3AJDA 4TMVA 4DNFA 5F5LA 3GH3A 2JGIA 4Y2GA 3UW1A 1SBYA 2XPCA 2YOGA 3E9MA 3L7NA 3IEUA 1V3TA 2XNJA 4MROA 1E6KA 5KYWA 3THSA 4KR6A 1T2UA 3PUZA 1OWOA 1TVMA 2ACVA 1N5JA 2PAFA 1P7PA 2JFOA 4URVR 2YVQA 3B3JA 1EVIA 1OYVA 3HV2A 3BA1A 5EZ5A 3X3HA 2E37A 4WEOA 4Y1RA 2IEIA 3VQTA 4DHEA 1SUWA 2R6FA 1Y80A 4EY6A 4UPEA 2MTBA 1FNCA 1MTOA 1KO8A 1GNRA 1UDCA 3C8ZA 3G7NA 2WRZA 1SAYA 2G36A 3GGPA 1V2HE 2I87A 4HDNA 3SJZA 4BRSA 2GILA 2OBXA 1OW3B 1FFXB 2I54A 2UZAA 2E4XA 1X92A 2JF0A 3PFNA 4TTPA 1EFLA 1U5BB 3KXDA 2FI1A 3P5BA 5G0UA 3K16A 4NZYA 3EYAA 3RVPA 1SXJA 5G4KA 2RHBA 1NVGA 3Q0EA 4H7DA 1VMEA 5JJIA 3MMPA 4YMGA 4CG0A 3A7DA 1MNQA 4GF5A 5JD3A 4TKUB 4WFIA 2A1TS 1R10A 3ERCA 1X0VA 4KN5A 5E1MA 1G42A 3ROKA 4NARA 1P72A 2C97A 3OKCA 3KEMA 2P4QA 2AZMA 3BWEA 5KVVA 2OENG 4R8MA 1IXKA 2HWYA 4CF6A 2ZSEA 3FUVA 4MVJA 2PUJA 3H8WA 4JVOA 4LJ7A 1GVHA 4O4LF 5KREA 1OA1A 2OYSA 1OB2A 2IS6A 3EXEB 1FDIA 1PBNA 4I50A 4BKOA 3L0PA 5DHRA 1EHCA 3DTVD 1QO0A 4MVCA 1WDLA 4N5DA 3ZHYA 2XNCA 3FSEA 1UINA 4JP3A 2FEMA 4QTZA 4EA9A 2NAPA 3CB2A 3VR6H 3WYNA 1KK1A 5NULA 3T6KA 1NQVA 3TVTA 2ZU6A 5EERA 3RAPR 5F64A 4CNBA 2HADA 2JPDA 3EUAA 1BCSB 4PYKA 2HNAA 5FA6A 5KQRA 4WLUA 2Z5VA 4ME6A 4PXAA 2WYIA 2Y1XA 4JC0A 2X0JA 4KTTE 3TEJA 1U6IA 1TO1E 1BDIA 3PFCA 3BM5A 4AG6A 1B0AA 2ZSFA 3OH8A 3DTVB 4DV2B 1F1BA 3EBOA 2B4TO 2ZRJA 1OZ0A 4QA9A 1Y7IA 4I5EA 2P4EA 3G9ZA 1XMVA 2FX5A 4JROA 4WUTA 3RW9A 3SE0A 4L72A 1C3OA 1JQ3A 1YMQA 2ZKLA 4G25A 3AEUA 1JFSA 1UKVY 2R1VB 1DXHA 4Y9UA 1XLTC 2N0SA 1NXXA 3LF2A 4FCCA 1EAYA 3WYGA 1OC4A 5LZ9A 2BFNA 3ETEA 4FMDF 3BZWA 4F5WA 4HQFA 2CHGA 1WZEA 3PLRA 3ESDA 2A5JA 3QK7A 1ND5A 2OXEA 3A28A 3S29A 1UBFA 4D25A 1SUIA 4P35A 1P74A 2CMFA 1G66A 4X92A 2YRFA 2P9GA 3IRVA 5ALMA 1SNYA 3BH0A 4EMUA 1EFDN 1KI4A 1XLWA 4H4CA 3SC3A 3ELYA 3R44A 1YJ8A 3I6QA 3JTMA 5E3JA 2JHGA 2QMOA 2CXPA 3OT1A 1K5DA 4U7FA 4EIWA 2FZLA 1S2OA 4DR6B 4YJGA 1P8JA 1RAIA 4KK3A 3BRSA 3RAEC 1BKYA 1E69A 1MP0A 1RAEA 2C3UA 1NBOA 3AUXA 3DT9A 4H6XA 4RK1A 4WY2A 5K2OA 4A2CA 2J3MA 2KYRA 3D59A 3D4IA 1X3LA 3QIAA 1TCCA 2GO7A 4GOLD 1SXJD 4R8VA 5EL0A 2VHYA 1UMDA 1RHMA 4XM2A 2TMDA 1OA0A 4KFRA 1RP1A 4LVUA 1JHAA 1E0DA 1XE3A 4MQFB 2VHXA 3VM6A 1ZOPA 3DV0A 4CCYA 4BEWA 4A8HA 4EEKA 1WCV1 1CQJA 4LTNA 4POOA 1NU8A 3Q6IA 5TLSA 3F1KA 1AK2A 2XUAA 3N8DA 1S9DA 2E82A 3C7AA 4ZVVA 1M0EA 1VB5A 4HLCA 5SV2A 2B92A 1OWPA 2HSEA 2F3TA 3AXTA 3M6VA 1ZD9A 1OPXA 4G9BA 4MUEA 2ZK7A 4LHSA 2FPMA 1JSRA 1QVRA 1M2KA 3AHIA 1GQ2A 3C6BA 1T4CB 4AMGA 4BCBA 4LGYA 1OASA 1X7YB 3DUFA 3WKEA 1BHJA 2V97A 3LO8A 7REQB 3R5FA 5BW8A 1W87A 5CDHA 1IY8A 1P7WA 1TJ5A 5DFAA 2MINB 2W6CX 5A3QA 4HB2A 5CNKA 5H02A 4EYKA 2IFTA 2WYOA 3OZIA 5K20A 1N57A 3PFFA 1FDOA 4ZPJA 3WFZA 4C1BA 3OZTA 4RGVA 4UCFA 4DJ5X 1BC5A 1OILA 3P9QA 4OQQA 2O1WA 3HUUA 3WL8A 2IOHA 5F78A 4BV8A 3AFHA 2VZ8A 3THRA 1BMDA 5J2UF 3VAAA 2UZ1B 4G5FA 3MW8A 4RY8A 3GJXC 1ENYA 4IOMA 2E21A 4KKXB 4LSZA 4JI7B 2EKBA 1VIMA 3FBTA 4MR9A 1ZHFA 4CG1A 5LSAA 4NJMB 3EXHB 2WHRA 3G2MA 4UPVA 3IEPA 3U56A 4HNGA 3OIDA 2HQOA 4OMDA 5DF1A 2H2HA 2VCYA 1E8MA 4FC7A 5JS2A 3HCWA 5CEFA 1PUIA 3N70A 3U81A 2VH1A 3JD3A 5JPIA 3O82A 4U1RA 5DCLA 1YQQA 1M54A 4NWIA 4Q7LA 1Z2AA 2XQJA 4R9NA 1BSVA 2BFBB 1N4DA 5IYZF 2FMXA 3Q1KA 4Z7QB 5CLFA 2VQDA 4DIDA 3D6AA 3DKKA 1U3DA 2OHFA 2WHEA 2BT4A 3CSSA 4P6VF 4PFSA 4TWBA 5A6SB 3RCBA 1S6YA 4DMGA 3B70A 1L7OA 1ZGHA 4QU9A 1QOZA 4E21A 5DNYB 3EEOA 5G3YA 1IK6A 1MQ9A 2MYTA 1N1EA 2X8WA 1NBWB 1STOA 5EUQB 4RYLA 1C3VA 2KM1A 5C5DA 4PQGA 1R5OA 1OKKD 3IEMA 2NU8A 5DYWA 1P62B 3D7RA 3RRYA 2JLAA 4XXHA 4RADA 1ZGZA 3U3JA 3WLMA 5ADWA 3NVMB 2A67A 5ADVA 1SBNE 2F9FA 4QEZA 3EIHA 4D42A 1PZNA 3CZCA 3R7DA 2OHXA 4IW3B 4CFSA 4CEHB 1D7AA 3RJZA 1JG7A 2W70A 3I0ZA 1ZUIA 3WP0A 1T3GA 3MGKA 1MU0A 1CVRA 1FNBA 1MOZA 1XPRA 1R37A 1ZH0A 3LC1O 3NV9A 5LU8A 1WNFA 4JGIA 4QO8A 4R3UC 3JR7A 3SJUA 3BAZA 2VJAA 1O0CA 3G1TA 4FYVA 4ARCA 1VL5A 2W6MA 4UU1A 4DM3A 3T5PA 2BZGA 3QNUA 2PX8A 3C3KA 2D3TA 2OBYA 1TD1A 2W2TA 1CZLA 1IEXA 1Z5OA 2VT6A 2CZCA 2QZJA 4LYAA 5F33A 1QF6A 5KOIA 1EMDA 1SVUA 2Q8QA 4R1UA 4GE0A 4JELA 2C0QA 3EHEA 3K70D 2ENUA 1UDWA 1WVGA 2XVMA 1FFDA 3AY6A 4UM9D 5AFSA 2WA2A 3LDFA 4GRIA 4HMQA 5FNVB 4AG5A 3GJQA 1VSTA 1P2VA 3OJFA 1INLA 2DJ5A 3VKFA 3X1WA 2NN3C 4QUGA 1GWNA 5IWAB 3VO8A 2O0LA 3ED1A 3SZMA 4CKWA 2G9ZA 1GGVA 2G71A 3FTCA 5CGZA 3TNDA 3L49A 1OU4A 5FBLB 4Q18A 3STVA 1OXVA 3TE7A 3VH4A 5B6IA 3D64A 5LYJB 3DD5A 3S40A 2XCRB 1H8HD 2FVYA 4FJ0A 3K70B 3A4YA 2O52A 3QI7A 2UYOA 1JPJA 4GPIB 1U7HA 1TXGA 3VGPA 4UM9B 3PDIB 3WLPA 4R81A 2YWGA 4D1YA 1JQEA 1LPPA 1U3WA 2V7QD 3KWMA 1W48A 1ZW1A 5AI9A 1M3SA 2QVBA 4O25A 1DMSA 2Y2VA 3W8DA 5H4HA 2VPXA 4UUQA 3WLOA 4HBZA 1QYIA 1M2HA 5HQJA 1TIPA 1F0KA 1XNGA 4RXTA 2IWRA 3E1KA 4CVNA 4AZVA 3VVMA 1OH6A 3PGMA 1GXSB 3W2IA 2WYWA 1RFGE 2ZANA 2GN9A 1ZW6A 3HHPA 3NFYA 4PPYA 3IO3A 4KRXA 5ULLA 3RFCA 1GOTA 3T4XA 3OFJA 4P3YA 1J1ZA 5IXYA 1A5TA 2ZAGA 1QHIA 2HA0A 2Y0CA 3K72B 3LUKA 3NHBA 3UHPA 3HPQA 1IATA 1WO8A 1AD2A 3A04A 2P77A 4IMRA 2FLKA 1K8RA 2FJPA 2KS6A 1OI4A 2JCGA 3E1GA 4Q12A 2ZG6A 5G1OA 4C76A 2WSIA 2NZ2A 5GIOE 1D6NA 1Z35A 1DEKA 1XRQA 5EJIA 1UJ5A 4ZD6A 2V9CA 1Y5IA 1T9DA 2HPAA 2PQ2A 3AHGA 2ZJ1A 3LIIA 5DYGA 5G0TA 2Z95A 4V0QA 2Z6AA 3B1FA 1CR2A 1QQ7A 1A8IA 1YB1A 4QOGA 4GX0A 2HIAA 3K94A 4JITA 1W85A 3BREA 2CHVA 2FUKA 4HDKB 5C37A 2JGMA 1LRKA 1U0GA 1PQYA 2C42A 2IU4A 1C9KA 2VFAA 2VKTA 3WE7A 5MDHA 3EJWA 4KQMA 4FFMA 2WWYA 1AVTA 2GERA 4QQNA 1Z29A 4P81A 1IN1A 1TK2A 3VISA 1R6UA 2BJWA 4C2TA 3THOA 4E1BA 1FTWA 1YVEI 2GXUA 3DDWA 5DWDA 1WCIB 4HS4A 3STYA 1G0NA 3VPCA 1M34E 2RCNA 1DKQA 4UDYX 1XF9A 2R48A 3NHPA 3C1OA 4LWZA 3K71B 3QLVC 3IV9A 2J3HA 4HOYA 4LK2A 4HTFA 4GPTA 2YHAA 1HQKA 5LDHA 4A6DA 1PWYE 5MHTA 2FZWA 3W7BA 1JIVA 2P3OA 4OLBA 4P5EA 4RK7A 3VC7A 3P2OA 1W4BA 3P19A 1P6XA 3CVWA 3LZDA 3ZBUA 1CEEA 4GR5A 4X85A 1KH3A 1R9GA 1F3OA 2XDWA 3CVOA 3MF4A 3NCHA 1HI9A 3OTIA 2JJ8A 3OFNA 3PUWA 3RUPA 2ZSKA 2NTYC 2O7VA 1Q50A 3AKYA 2VDPB 4B3HA 1BWRA 4LC1A 4TTAA 3R0VA 2JIQA 4GMDA 5GONA 5T64A 5TVKA 3ZCQA 4CETA 2D7JA 3IHKA 1EESA 4MPDA 1IU9A 2G9QA 3L46A 3COYA 1YR8A 2VUHB 2ZUWA 3D0QA 4M9XA 4MZXA 4QOIA 2O0KA 3TDKA 4KN8A 4D8UA 5IT5A 3LFHA 4ZIRB 3Q2KA 3CNQS 3JY6A 3KWFA 5T4HA 1W76A 1VIVA 2C2WA 4DOMA 4YWJA 1DKRA 1TU4A 5EQJB 3B13B 3ED5A 4MA0A 1II8B 2BM1A 4M49A 4DVGA 4QXRA 2FJ0A 3EVGA 3CRW1 2EFCB 3V8EA 1RWPA 2KJQA 3HEAA 3DOFA 1MB9A 5EJ8A 5K6AA 4ENWA 2NACA 3T35A 1AJEA 3CRNA 4CMIB 3CA8A 3R5SA 5LMUB 3P4UA 3EUWA 1LNZA 1H6AA 3KELA 4UATA 3AZOA 1F60A 3MCWA 5JQGA 4CIVA 4FYXA 4AZ0A 1G8FA 1OBHA 2Q5IA 2RONA 3GUUA 1QB8A 4NQRA 1VOTA 1RFLA 3OP1A 3ER6A 4KVAA 1IOLA 2OHIA 5JAHA 3LNTA 3A1WA 4BE7B 1UM8A 1BQ4A 2QY9A 3KL4A 4QRDA 4OUKX 2AN3A 2ZATA 4AMBA 3RYFB 1G98A 2AWNA 3TTVA 2PUGA 3GJYA 2NUTB 4PZAA 4ASUA 3GNQA 1PJRA 4DA7A 5CJPA 3EIUA 1X38A 2WJGA 1BNCA 4WIAA 2J0EA 2VP4A 1AC5A 3ZEAA 4JJEA 4UVDA 3AF1A 1SUAA 4LFBB 2HW8A 4GRDA 3Q3JB 3CKKA 4XA8A 1J5XA 5IBPA 3WQBA 1I3LA 4YJHB 5FX2A 1XNQB 1CR4A 4HUQB 3RYHA 4DYVA 4QYWA 3IAHA 2QLLA 5EZYA 4FOTA 2NSYA 4OXKA 1VL6A 1L7QA 4PANA 2D0DA 2P6PA 3FCUB 3ADBA 3KSAC 3SZLA 2IF2A 3ZNQA 4N3AA 2DSNA 1YZFA 4KAAA 4ZQEA 2O8EA 3CUSA 5TX7A 1R6DA 2QD1A 5A71A 4RY2A 4B5LA 1J7JA 1CNEA 1JJIA 1XZMA 5FV7A 4DPLA 4C0SA 2GN2A 4MUBA 1NQXA 4YONB 2CFOA 2EX0A 5BMOA 2PGJA 1MG0A 5TGZA 4AYWA 5KEIA 1ABBA 1O96A 1PV1A 3ZWYA 5IDQA 2G08A 4EUKA 1RMYA 1Z88A 3W06A 3LF1A 1Z6PA 4B3GA 2O5VA 3SHFA 5B6JA 1UUFA 2BKUA 5DCUA 5BMVA 3PUIA 1N2XA 4X1KA 3UAGA 4RELA 3IVGA 4UM7A 4C4TA 1Y9JA 2JLWA 3C4QA 1AKRA 2OFFA 1N6KA 1XQVA 2AEEA 1G20A 5IAEA 3QE0A 1WXHA 1QMPA 4Y2JA 3SDSA 4N3NA 2NPIA 4KW7A 2ZDQA 2H1CA 3OFND 1D2MA 1RYFA 1BYIA 3EIXA 4G65A 1IJFA 1E63A 2OESA 2IRWA 3QWIA 4RJJA 5BY2A 4B3CA 3Q10A 2A9KA 4RDCA 2VBGA 5LMZA 2HA2A 1FP1D 1JWBB 4YUXA 5A9SB 2FU5C 3MOIA 3RS0A 5AHKA 1HKHA 3R5KA 3B7PA 4FW8A 4RA6B 4MI6A 1Y3IA 4RESA 1YACA 3PEEA 5H5JA 1XZQA 3SBXA 3TEMA 1ZD8A 3ZV7A 1OR8A 4AY5A 4ENUA 5KJ1A 2A5GA 4OHWA 4TVKA 1YDMA 2J4DA 1HL7A 3A3OA 1YQDA 1P1BA 3I28A 3PJDA 4JJZA 4NEGA 4QHSA 4M86A 3V33A 3ZW8A 4RDXA 5CHEA 3L4JA 3I32A 3NEYA 2W6OA 4QPDA 4EATA 3ZE1B 1A96A 1U1EA 3Q40A 2GSDA 3FDJA 3LLVA 3PKZA 10MHA 2ZUBA 4Q39A 1QRTA 1GO2A 1RRPA 1ZGGA 3AIIA 4H08A 4MWGA 5JSZA 4RMNA 5KSZA 4I4LA 1VKZA 2J67A 3A11A 3LK6A 4D99A 1D5WA 1U0LA 2B5OA 2RK4A 1HT2E 2O8NA 3MT9A 4ZOAA 2HU8A 3V4LA 1G2PA 3D0RA 3BD8A 5A1TA 1DHTA 4IQ8A 5E9QA 2ERCA 2ZB7A 3GW8A 5CD9A 3EYWA 4RF3A 1SOVA 3HDYA 4EHJA 2EWVA 1DBQA 4FFNA 3QYFA 4A26A 4WADA 2CNNA 1HSOA 1SRQA 2P2LA 2O7QA 3CX7A 3IR5A 4EFMA 3VMFA 4BQFA 3TE6A 2E4ZA 2JGRA 3QE2A 1NX6A 4JFRA 4RIHA 5BW5A 2BR5A 2QJFA 4Z4FA 4N4AA 4FCVA 4L0QA 5FTWA 4TRJA 4B6PA 3R7WB 3AUAA 3KUUA 3V3KA 3EVBA 4TLBA 4UQLA 1CUDA 4IO0A 2V0NA 1W7AA 2CNBA 4LF6B 5D7BA 2MMCA 1I4DD 2JLZA 2OUIA 3W4IA 5BWNA 2UAGA 1PJTA 1UWCA 1DCTA 2Q50A 2PKQO 4N0EA 4EUEA 1YZHA 1AGPA 4OAPA 2BEUA 3OAAA 1JAYA 2I6QA 2VHZA 1F0NA 3AR3A 3DBHB 3GEGA 4HNSA 4K26A 4RIIA 2NVUB 3UC5A 5CLQA 5AKGA 2OCBA 1L0BA 2DT8A 3AL2A 2X9VA 3JATA 2P65A 5F9MA 1VTKA 2FMKA 3N2KA 1XUOA 1N5KA 1JUDA 2AJ8A 4E09A 1KQ3A 1U5AA 2FZVA 3EEQA 4RQBA 1DRUA 5DH9A 3N2GA 1V45E 1CDEA 2WTNA 4ZJYA 2Y93A 5ICEA 1BHO1 3JRXA 3W9UA 5TT0A 1TFRA 1Y6QA 2PN1A 2VNJA 4HB3A 4QDTA 3GJ5A 1HE3A 4E5YA 3NETA 5B1YA 1EWTA 5FRDA 3H9JA 5BRNA 2HJSA 1YMVA 3JPWA 3U39A 4EMBA 1E3WB 4J07A 3OZ7A 5DW0A 2JDID 1JYEA 1Q0QA 3ADPA 3SFVA 8LDHA 1GGEA 3FVRA 1GZ3A 2ODPA 1YIAA 1OX4B 4YAOA 4LZNA 4KP7A 3JQCA 4E07A 4XPIA 1VE1A 3OJXA 1P2FA 1RP7A 4F3NA 3LDAA 3DDCA 4UVGA 4BVKA 1U2PA 2CJWB 2ATCA 1QRDA 4MVWA 2UXBB 2QN7A 1IEQA 1EUQA 3OQIA 3TR0A 2EV9A 1FRNA 4TX1A 3UN1A 1L7NA 4BV2A 3BQNB 5BO5A 2X1LA 3CJRA 4MJLA 1RWMA 3AL3A 3FSRA 3KZVA 4GICA 4F04A 4JYAB 4DA8A 2B35A 1FMLA 3GUHA 2NSHA 4YDRA 1E2EA 1R27A 4WI1A 4ZV7A 3V7NA 5AKHA 3SX0A 4URXR 4YCDA 4EGAA 1K6IA 3OBBA 5ITZB 5LLDA 4GXNA 3H5AA 1VL8A 1QE3A 3AFMA 3JQRA 3L05A 3M6LA 1I2AA 1QB7A 3NIGB 4FW9A 5JSKA 3RUIA 3W5UA 3ZH9B 2KI5A 2GEVA 1IXSB 4EH1A 2OHHA 3HDHA 2R65A 4QGSA 1FZQA </