6PFKA

Phosphofructokinase, inhibited t-state
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOFRUCTOKINASE
publication title Structural basis of the allosteric behaviour of phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA02
1S2IA 5ITSA 2Q4DA 2F2TA 4KXMA 3F5MA 3GH1A 3QUAA 2F48A 2PFKA 3OPYA 4RH3A 3IMKA 4I4IA 2HIGA 4LJKA 3PFKA 4U1RA 4HX9A 3K2QA 1F8XA 2KLHA 1S2DA 1S2GA 4FYKA 2IZ5A 4KXNA 2A33A 1WEHA 3U39A 4JENA 4PFKA 1RCUA 4FYHA 1YDHA 1KZHA 2IZ7A 4JELA 4FYIA 4MCJA 3O8OB 3HNOA 4KXLA 4A3SA 6PFKA 2PMBA 1MTOA 1F8YA 5AJUA 4JEMA 2F62A 4MEJA 1PFKA 1WEKA 2F67A 2IZ6A 3MAJA 1S2LA 3SBXA 1S3FA 1ZXXA 3O8OA 4P5EA 3OPYB 2NX2A 3O8NA 4NPAA 4OHBA 4LJLA 4I7EA 3UQZA 3BQ9A 3O8LA 1T35A 3EHDA 4P5DA 5AJTA 4I36A 4WL0A 2Q4OA 2F64A 4OHRA 4LJRA 2A0KA 2KHZA
chains in the Genus database with same CATH superfamily
3QHPA 1O9GA 1RJDA 4WPGA 3BJRA 5CCBA 1L7NA 4IGIA 4PR3A 3X0DA 1QKIA 1CF9A 4DNQA 2C2MA 1E3JA 1GZ3A 4JB0A 5D8DA 3EVFA 3GH1A 3KDPA 5T5QA 2E82A 4RJ2A 1BGXT 1MX1A 2I1VB 3ICVA 1ORIA 1GG8A 4TXJA 1OVMA 2ZTSA 5BN5B 3FLMA 2FN8A 1GNSA 2C4TA 2OFFA 4V0ME 3LVRE 1ZHOA 5IX8A 4H2DA 5HKKA 4QO7A 1JAYA 1NP7A 3B38A 4N4AA 4PGHA 4Z54A 3AH8A 4MUGA 5C37A 1TM3E 2WOJA 1IOWA 4M0DA 1MLDA 3ZEAA 4B40A 3GUCA 721PA 1RWQA 4R6WA 2EV9A 1DOHA 4BPRA 3IMGA 2O8NA 2JLVA 3IUNA 3FW1A 3NXSA 4KPUB 2BFEA 3LYUA 2Y1DA 3NCTA 4B6PA 1BXKA 4CMBA 5E1MA 4QU5A 3BSYA 4AM8A 3L93A 3A6FA 2NXNA 1PZFA 1FLNA 2WFAA 3NVMB 4EY5A 2EIHA 3EVNA 5AVZA 1OYVA 1SA0B 3I28A 2LDXA 3D6MA 3LCMA 2OWEA 4XOIA 1WE2A 3WKBA 3A9UA 1J2EA 4DCNA 3A2NA 3RG8A 1NY5A 1UQRA 2HMAA 3ABRB 4XAQA 1P75A 5AKXA 3EUWA 4BLOA 4Q9AA 3IVXA 1QIIA 4G97A 4WUTA 5LXTB 3G5MA 3U61B 2B8EA 4BFZA 2YN4A 3OWHA 2XVAA 1H65A 5G1PA 4F6LA 1CBUA 3OIDA 1M5TA 3ZDZB 5KEIA 4D0NA 4FZ3A 5BO5A 4KW7A 2NYUA 2VJNA 2YOHA 1NZJA 3EBPA 3OBBA 2IVFA 5IAJA 2IEIA 2I54A 2EFEB 2ZU0C 4EEKA 1RQLA 4B80A 2PS0A 3TL6A 4DWOA 3V3TA 3BHNA 2GJKA 5LC1A 1W4CA 5ITZA 3AVWA 3CT6A 5FV7A 4B3SB 2XCOA 3ISVA 1XU9A 1H05A 5B2ZA 3VR5H 3M6FA 3OEEA 4DZRA 2ALJA 1IN8A 2I4LA 3GT7A 3QTBA 1QYWA 3GLHE 521PA 2BFCA 1ST2A 1EP3B 2DSTA 2MR5A 4UTRA 4F1WA 1MKYA 2DUUA 3P9KA 3U3JA 4N8EA 3VU9A 1IJBA 3P0FA 1T5DX 4GX5A 5JXGA 4DDWA 2ZUEA 1QV7A 3HCBA 1DIOB 1SQGA 1GCIA 5JXJA 2XADA 5BQXA 1K1EA 5I4BA 1I4DD 3T06B 4YRBA 1YJ8A 2BBTA 5FBVB 1R15A 1TUBA 1HG0A 1UPXA 4H3VA 3KQKA 4OQNA 5CYPA 3BULA 5ADUS 3I5YA 3HXTA 3DDNA 3A2KA 4K6OA 1NLUA 3RRJA 3W77A 3A2LA 3TZ6A 1PFQA 4NFLA 2CB0A 3QW4B 3BHIA 2BMVA 2ZJ3A 3GVPA 5C4MA 1EMDA 4YI3A 4AP5A 5AJTA 2GB4A 1VRVA 4ZICA 2VC2B 3WL3A 1LK0A 3S40A 3K16A 3TLYA 4B3JA 4BXOB 3UJHA 4DLVA 3WMEA 5HOEA 1C1DB 4S1TA 4MKGA 3WR5A 1EDEA 1RXUA 1RXCA 1PP4A 3EVDA 1L5GB 1QRDA 5J9FA 3OJLA 1ZH2A 4D98A 2VJYA 3SQOA 5INTA 5L3QB 5FB3A 4LE2A 4TTSA 2K2WA 2FSPA 3KVRA 4R68A 2GILA 3Q7QA 1LB1B 1WPQA 3PZRA 2M2IA 3FYUA 4GKBA 2E0IA 4J0EA 4JLPA 3TNYA 4QBIA 2ZYVX 1MB0A 1GGJA 4YO7A 2F48A 2W90A 1Z45A 2EEPA 2GLXA 3GU3A 2A9FA 1QIEA 4YLGA 4E6EA 5BOSB 1NVAA 5AW4A 3MUOA 2YQ5A 1OHHD 1PEKE 2IPLA 4ETMA 1LK5A 4M1SA 3KHUA 3MRSA 1JDZA 3G85A 4RGQA 1GPDG 3B2QA 1JJIA 1B43A 1J70A 1K6XA 1MC4A 1NU8A 1P0QA 2HXSA 2O14A 1ZU5A 2RBGA 2X1VA 5BN5A 4FVTA 4OXKA 4FHCA 2VTKA 4ROSA 2YJ6A 3N58A 2OZEA 5LM3A 4P0PB 3E81A 2GPAA 2JC3A 4N0QA 3SC6A 2YYAA 1VHLA 2VVTA 4G86A 5CM9C 3LWBA 2XE7A 3ZDRA 3PCTA 2PBRA 1VKHA 4AS3A 5GONF 3EWAA 4OHPA 2XWSA 5A4IS 4Q1AA 4II2A 3KYDB 3LM8A 5E0KB 2BLNA 3SSAA 4ZQEA 3WHLA 3ZDYB 1W88B 4QVKA 4CMKA 4RK7A 3X44A 2WE7A 4RV4A 3HVUA 1CNFA 5HCUA 3DFZA 4Y9UA 1FFSA 1GPUA 1TUIA 5TMDA 2ZUWA 1P1RA 1MH1A 1BDBA 2UYQA 4TRNA 3WKCA 1WKVA 2D59A 1ZM2A 2XWBF 4OXYA 1HNNA 5H3LA 1B00A 5ULLA 1XXHB 1XRSB 2D7JA 3ZZ0A 4X64B 4DIMA 1KZ7B 1RFLA 4M55A 5BY2A 2X3FA 2F00A 3VPAA 1LDBA 4PZPA 1M1ZA 3TK1A 3OU7A 3BWBA 3PDIB 2MHCA 3PXXA 1ZNZA 4ARSA 4R71A 4MZXA 3EG5A 2HQOA 2AGVA 2WM3A 3LY5A 1UPAA 5AKHA 4U7DA 4MRMB 4D9CA 1Y48E 3PNBA 5FBQB 3QUQA 1UKAA 3QE0A 5KJ1A 1QO0A 3ED1A 2K87A 4MPPA 4Y0NA 3PRKE 1EJ0A 4BX3A 3Q4GA 4NENB 1YQTA 3ZCRA 2XTZA 3FVVA 3OTHA 3H2YA 3B9PA 4B9AA 5B3LA 5A4JA 2JVJA 5MN6A 4D97A 5FBZA 3E8MA 3IOCA 4FGUA 4BMYA 4IIBA 4EHLA 1X1EA 1YA4A 5CVTA 1WXHA 4TL6A 3UJBA 4Y98A 4BJ6A 4E5YA 3KBOA 3I72A 1RJ9B 1ONOA 3UW1A 4MS4A 5DK4A 3UWMA 2HF7A 4PO9A 1XZHA 1G38A 1N9ZA 1XTPA 3M5DA 2Q4RA 3SR4A 3UUEA 2XGJA 1CZOA 1R7RA 4RMIA 1DBSA 1AM4D 5A9SB 3TR5A 1IQUA 1N5DA 2I1WA 3Q8KA 4MP6A 2CT8A 3QOYA 1CZKA 4WA8A 1W34A 3N2NA 3RRYA 2V8OA 3EMDA 1G9XA 1W75A 4IYRA 5AQ1A 5H02A 4ZTUB 3R24A 3VV3A 4YMWA 2DX7A 4DQXA 1DQNA 3VPFA 1RRMA 1H2YA 3BHJA 3BB3A 5F3WB 1CP3A 2RKWA 3D02A 2FW6A 2QV0A 5FTNA 3ONEA 4PYJA 1ZM7A 3AUAA 1AJEA 4E1BA 5DHFA 5AW8A 2H7CA 2V4MA 5LL6P 1C7ZA 2O7SA 5B2EA 1MVNA 1RHMA 3MGAA 1TJ3A 2OY0A 3N0TA 4XYMA 2QTFA 5FL3A 4L8YA 1UH5A 4K1LA 3C45A 3DCJA 1EH5A 1H0SA 1MC8A 1CHDA 1O08A 5LU8A 4PLVA 3X1JA 5BYJA 5B64A 2AOTB 4LDJA 4HCJA 4WXYB 4PFSA 1Q16A 2G7ZA 4LJ9A 1H0HA 4RLSA 2IUEA 5L6LB 1I3LA 1XIVA 2QVXX 4KVGA 1QO9A 3E9MA 3D3KA 4BVJA 1QWOA 3H87A 3UJCA 1SY7A 1XB2A 5K8UA 2H16A 3HABA 3EFOA 4N7MA 2HOQA 3OP1A 4IJQA 5JZBA 4HYYA 4EHIA 3KJXA 4K40A 3SE7A 3OI7A 2R7AA 3LG2A 4YRLA 4HX9A 4POAA 5CDFA 3WP0A 1EUQA 4KHPB 4GWLA 1NFQA 1EFKA 2YV1A 3MIIA 4W63A 5C0OE 4BFWA 1UFKA 4F8YA 1RYHA 3E03A 3GA0A 3LBYA 5IZ4A 2R5FA 3OSZA 1XCOA 2A9RA 4MR9B 4I46A 4P3OA 1HLGA 3QWHA 2JFZA 3R3JA 4QBHA 4B6RA 3JQAA 4ZT2A 2P9TA 5MGBA 5CM2Z 4OLJA 4RAOA 4S1PA 4R2XA 4ZAFA 3SZGA 1FXWF 4CI9A 2BGLA 1VE5A 2VT2A 3OF2A 2J0UB 1B2RA 4ZCSA 4E32A 3KWFA 5IJWA 1CUFA 2G1UA 4U9IS 3KKMA 2AFIE 4UM7A 1RQXA 4RM2A 4DYVA 3BB1A 4YFVA 1M1NB 1CIVA 4KFTA 4LJ8A 5EIBD 2YWBA 1R16A 2PAAA 2VTBB 2JLWA 1T36A 3X1YA 1RNLA 4RX1A 3HNOA 3U1VA 4C4ZA 2ZRPA 2GH1A 3E2MA 16PKA 1RI4A 1UKYA 2PUJA 3DNFA 1NI3A 3VYRB 3RADC 1QRAA 4HWOA 3VDXA 2FV8A 5FA6A 1DINA 4B4VA 2I6UA 3KOZA 3MRTA 1GU0A 2G5GX 4Q9IA 3CUTA 2LCQA 2IIQA 1PYDA 4YT2A 1TYCA 1A4IA 1W9HA 1X86B 4HVTA 1KDPA 4GPIB 4W1RA 1RYFA 2DWQA 4Y6GB 4BX0A 4LNUA 1X1RA 4ZOEA 1JYFA 3M1LA 1O6ZA 1VIMA 2X6QA 2ZRCA 4EWLA 3LAWA 3JZAA 5BSVA 5JMOA 4R41A 2Q5QA 4OTZA 4BX2A 1XK6A 2NO5A 2P91A 5DP2A 3DDOA 3PEVA 3A2MA 4HN2A 4LDRA 5IDWA 1DKOA 4I50F 1EJ6A 2RGDA 4TVKA 1QAMA 1ZUD1 3WRWA 3ZGVA 5BSMA 1Y7TA 4C7JA 3JQBA 2E3JA 1EKXA 1WXQA 2ISSD 3UK0A 1JPJA 3I2GA 2OC4A 1KIFA 2OAQ1 4L4YA 4E5DA 1UT5A 2ONZA 4QL3A 4RVOA 1N1EA 2PR2A 2QLTA 3ME5A 4HNGA 2XDAA 3ZJUA 4L0CA 4NYIQ 1M34E 1SM4A 3C6KA 3QVGB 4DCCA 4IJWA 1VECA 2F55A 3A14A 4OQQA 2EWMA 4TLMB 3WE7A 4KXXA 3SJCA 3GLGE 1EK6A 2GDJA 4F72A 5BRJA 5JI2E 3S1AA 4PZEA 3CEJA 4MMXB 2BBWA 4WVFA 3M7IA 4NE9A 2OQVA 5BQOA 4BRSA 2VYND 4LJ4A 4UBNA 2EG9A 3D7NA 1CRPA 2PT7A 1KMQA 3F6YA 2IIPA 1T9HA 5ICEA 5JC8A 4IVQA 1CLEA 1Z4IA 3AK4A 2DXIA 4AZSA 3LOQA 2AI2A 3O3OB 4RTRA 4FEAA 4CW7A 5J2UB 1M6YA 2HPZA 3BSFA 1HKHA 5A6VA 3AONB 1E9VA 1H2WA 2DBZA 4H3KB 5HQTA 4EELA 1O5IA 1TO2E 3MCVA 3FTFA 2DFDA 4D0GA 2GM3A 5J4KA 1JDVA 2ACWA 2AKAB 3DDWA 3K2IA 2QJTA 5FOUA 3T15A 1EX1A 3UK6A 1KMMA 2A57A 2FW1A 3PWTA 4LV5B 2Q4EA 5LZ4A 4IL5A 2AOTA 1YS6A 1AUXA 1DWOA 2DR0A 4QDZA 5GQSA 4W4TA 2VHTA 2X8LA 4W1PA 4J1TC 1SNYA 4LOAA 1T1IA 5DXFA 1NLFA 4FILA 3MM4A 3A6ZA 5B58T 3W6NA 1T2NA 5T3UA 2PJZA 1O4VA 3IUYA 2P9JA 2DF8A 3VC1A 3CU5A 3PDUA 4GNKA 3UHAA 4IRUB 5P8WA 1QFYA 1M54A 4ON9A 2D8MA 3ITNA 3G0IA 3PUXA 2C4MA 4UM9B 1MX5A 4XPIB 1UMCA 3ZE9A 1WZ2A 3VISA 4XR4A 4P58A 3EOBI 4BFCA 3UJ8A 4F93B 3VTAA 3QNUA 1OXBB 1WBJB 1QIGA 1GZHB 2G4CA 4IS3A 3DOFA 4XVRA 4MVJF 4C3OB 2A0YA 1LV7A 4NCKA 1ONNA 3LLVA 1A1SA 3GAAA 4IMJB 4MKXA 4JELA 1Z39A 4IDBA 2X8JB 4LX8A 4B75A 3ROFA 1SIWA 1GTJ1 1SUSA 1CZLA 2P77A 3E48A 4WJZA 1GUAA 3VJKA 4DVGA 2FPPB 3E9NA 2VJBA 4MCHA 4X97A 5K2MA 4D5GA 1J0DA 1DAEA 1PI3A 3PXAA 4IAOA 3OO0A 1ZXBA 5GJWC 5A0TA 3QUTA 2FR8C 4QU0A 3KQWA 2ATEA 5J4HA 3DOUA 4O4HB 3EOAI 3PQFA 2X76A 5L3SA 4UDXX 4WGGA 4MEBA 1DRWA 2J3LA 3ZNPA 2ZR7A 2N47A 1JIKA 1SHZA 1CVIA 2PZEA 5GGYA 4KDRA 4IFIA 2AE2A 2XMBA 4GMDA 3GOHA 1A8SA 1XEXA 4FJ1A 3B53X 1NNSA 1MDBA 3GNLA 2QG6A 2WF7A 4G1EB 5C34B 4DG8A 3JYQA 4CIAA 4RWEA 1JW9B 2E9SA 4G9GA 5ARBA 3W6PA 1A4UA 1T24A 3HADA 2WD7A 3LWNA 4ALLA 5LQDA 1OTXA 3KQPA 4L8LA 3FSGD 5ES3A 1JECA 1LV8A 2C9ZA 4PFJA 1HT2E 3FRJA 4TXNA 1G18A 3RBXA 1GSIA 1PQYA 1ZZEA 2PJDA 2WKPA 3ENWA 3OPVA 4OFZA 3K6SB 1SCDA 3HEAA 3WAKA 3TAHA 1GXSA 3K1TA 1X74A 3O83A 3S2IA 3VI3B 3OKAA 1WVIA 3H1BA 3P7MA 1IBSA 3O8LA 1U7OA 4MRPA 4O25A 1E59A 2QL7A 4PR0A 5IT5A 1MO4A 1QDEA 4IWNA 1Q15A 1KYQA 3R3YA 4QARA 4GOND 3QKSB 3JD1A 3ZPXA 2W4QA 4M8SA 5CEFA 2P3OA 1EGQA 3F6RA 3QLTA 3KRTA 1WETA 4DJTA 4QTTB 6Q21A 3W2FA 1L1RA 3MWGA 2R44A 4CCAA 1WDMA 2VHQA 1ESMA 4BGIA 4ND5A 4QUEA 1XUOA 2QI9C 3ZCQA 3F7TA 5BMVB 1E61A 3LOUA 5TF4A 4UM9D 4YV1A 3JQ9A 4C78A 3IEKA 3R7SA 3H2SA 2VI5A 4LSMA 4Q3BA 1RWMA 3RVBA 4EB3A 2WM2A 4ISBA 3FSGA 4L73A 3SDSA 4E3ZA 5L45A 5J2UA 1ZEMA 2ZS7A 4OSEA 1DAGA 3VNBA 2GCOA 4TPKA 2VYVD 1JHZA 3LHDA 3N0WA 3L0CA 5DRTA 4PZLA 3V8VA 4GDFA 3PPVA 3TEFA 1RXSA 4FQ7A 1OTHA 1UP7A 4L4UA 5LQJA 2IK8A 2XT0A 4ZCPA 4AWAA 1E9AA 2XKAA 3RU7A 3ZYCA 1OH5A 2OBNA 3ZDCA 4ZDKA 3GJ3A 3QKRB 2H2FA 3T9FA 2PY6A 5L53A 4A36A 4CT0A 1GP2A 3KFLA 3C3JA 1GGHA 5H7XA 2H7XA 3U3RA 5JD6A 1GKKA 1V8ZA 5KTMA 2ZWOA 4TSFA 3V9AA 1GTVA 2CSUA 2JHCA 2KBEA 1C0LA 3F8SA 4PNHA 1AXRA 2P5SA 3FNRA 4M38A 3SGLA 2QN9A 3FKSD 4G0UA 2QLLA 2ZUCA 1R8YA 3E35A 4DR7B 2WFZA 4YRTA 3GP5A 3QM1A 3GW8A 2X9NA 2INGX 5AVQA 1P44A 5G41A 2C58A 5AM4A 2FPIB 4C6RA 4PY2A 3B82A 2WF9A 3E58A 3HJUA 2H29A 4W99A 2IWRA 4YJ3F 2YWXA 4XPIA 4BJHB 1FMTA 1E9EA 3PJRA 3CUKA 4LHWA 1P9LA 3TG2A 2QG4A 3NM5A 4GHWA 4ALIA 2V97A 1U8CB 4Y2YA 1FRNA 1OAKA 4N8SA 1MG5A 5FPPA 1R5JA 5KNBA 1J22A 2HRQA 4GOXA 4ENUA 1T4GA 2IIBA 4QICA 4NRDA 3UOWA 4D8XA 1ZQ9A 2CY0A 2YZGA 2DBYA 2XLBA 4LDPA 5B1YA 1XDBA 2OSBA 2X3UA 1LSSA 2NNLD 5LB2A 3KXLA 3NIFB 2GTHA 1AK2A 1JKIA 1NXPA 3OZWA 4UVDA 1VI2A 5CXSA 4LF9B 3HSSA 4R2MA 4KUEA 3JU3A 1YJQA 1XD9A 1L5HB 3IDOA 4KQXA 4X71A 3LVQE 4RPKA 2PSHA 5K4AA 4O4HA 3WYGA 4D5EA 5K9ZA 2JKVA 1HMYA 2QDKA 3Q6IA 1L7PA 2M9MA 3VDMA 4FWTA 3GPCA 2C5EA 4GEKA 1E20A 1NI4A 1QYXA 1WZUA 4I9GA 4JUFA 1YSCA 3B70A 1C1HA 3GO4A 2GBGA 4GUDA 3VSCA 3UTDA 4IZHA 2PH5A 4CF6A 2Q27A 2R1ZA 3MTDA 3IR7A 3PWZA 2CD9A 1D0IA 3NHPA 2FQ1A 2ZB3A 1J1UA 1YK0A 2R68A 3F3SA 2BDEA 2P9FA 3K73O 3HCEA 4UASA 1ZPDA 4NAUA 1PNVA 1E4YA 3EVCA 3K6SA 3KNZA 3ISJA 2Y27A 4QD3A 3RRNA 4KXQA 2IC5A 3RVKA 1VL1A 1KFJB 2ISQA 1I36A 3C4JA 3A6PC 2JIDA 4KCGA 5GWXA 4B4OA 2FZWA 2NZJA 4AWXA 4CEIB 1OI4A 1CR6A 4N5HX 4NS1A 5ENZA 3LXUX 1KP2A 1JQ3A 1DIAA 4JQZA 2BRUA 1P6XA 4LISA 4XE5A 5EZ5A 3ZGXA 5FUQA 1SRQA 1QP0A 1G5TA 1NDUA 1IEVA 3G79A 4V0OA 4Y2QA 3VU8A 4DRXB 1RJGA 4GR4A 1GKUB 4EH1A 3L01A 5LKAA 3A1WA 2ZAIA 1NJ5A 3DE6X 3JW8A 4LI0A 2IOYA 4F2HA 1VLMA 3HHPA 4XIIA 5E6UA 3NJRA 3P0IA 5FPKA 1I8TA 3CRMA 3I5XA 2O57A 2QAGC 1BS9A 4MV4A 3KOMA 2ZDGA 3I42A 3AF6A 1SC6A 3WKEA 3KZVA 4E11A 4HPWA 2YHBA 3IBTA 1Q20A 4FZRA 3KWMA 2ZB4A 1KO7A 3THWA 4MKHA 3NBUA 1CEQA 1U0EA 2H1SA 3BL6A 5DM60 3I1IA 2V54A 1KMNA 2HT6A 2ONKA 1ZOIA 3L0ZA 3RE1A 3RK1A 3HA2A 3UOAB 4XQGA 3LSTA 2O23A 3VZCA 3T1OA 2AXPA 3V8EA 4BEWA 4LSZA 1E6UA 4KQEA 4P4LA 3NEAA 3FDIA 4L5JA 3WZMA 5EMJA 5FORA 3LS2A 1DIRA 2CC2A 2Z9DA 4M8IA 5ILGA 4AY6A 4IGFA 4ZWNA 3KPVA 1I6KA 3NWJA 3SJZA 3M1YA 3NTXA 2PSSA 2FX5A 2JBHA 1PHRA 2ZCUA 3NOOA 1FNSA 5IC6A 2H4WA 3I62A 1WB5A 3G02A 2CNWA 4JLSA 3IPAA 3R4CA 1PKXA 4EW1A 2YVAA 4F7DA 1NNUA 5KWSA 1LDMA 3U4HA 1KEEA 3QXXA 4TKUB 1ISMA 2FPIA 4KWIA 5T7BA 1G8MA 2ZIVB 4FE7A 4HDOB 3W5IA 2XZLA 1L4FA 2HJGA 1F9EA 4EG1A 2C59A 5FAXA 5F7JA 4URZR 1D3AA 3CNHA 4MVJI 4FEYA 3GG9A 2IXBA 3LT2A 2JFBA 3I5UA 4JBNA 4WSOA 1U5BB 2B82A 4DBVO 3KAPA 5CJJA 4KLRA 5EI5A 2J07A 2WPDD 4RQUA 2XJ4A 1IJEA 2DFLA 4UZFA 5DN9A 2WR8A 4YGYA 1CWUA 3SF8B 3VV2A 4MUYA 5CJ2A 2IITA 1EEXB 3VGPA 5KYKA 2GDZA 1BA2A 4Y6SA 1MJNA 2GHIA 4X3CA 1SVOA 1SZJG 1UADA 2CVFA 2F62A 2HNAA 2V9ZA 2R8XA 3CIFA 2DPMA 3GUZA 3LKZA 1C29B 4JB2A 4P4GA 4X9XA 6GPBA 4NE2A 1IEWA 2QU7A 2GK6A 3DMRA 3QIVA 2J5RA 1BHJA 2R1VA 3GGOA 3UGKA 4B33A 3OHMA 4LECA 3AUYA 1SXJE 1BE1A 5JCZA 3NFYA 2I2AA 3DKIA 4G0ZA 4I14A 1M8GA 2YIMA 5CLQA 2DUJA 4AYWA 3BXOA 2OMEA 4IV0A 4US0R 3DR3A 4OL0A 3ZHRA 3EIXA 3N2YA 4S3MA 1EWYA 4D4MA 1KC1A 1BG6A 4Q48A 2JS7A 2I9PA 1SCUA 5JS2A 1P9RA 3AJDA 4FS3A 2BGUA 3A1CA 1ACMA 2E21A 1P3DA 2ZYIA 1P3Y1 1Z38A 4OREX 2WJ4A 4PTZA 2HSZA 4XM1A 1P2DA 1W2GA 4G5SA 3KOXA 1XK7A 1BU8A 4OQXA 2WPDA 3EPLA 2Q6VA 2ZRNA 2QSUA 4YJ2A 3BAZA 3O3NB 4WJKB 1JFRA 3PL5A 2HUNA 2X2PA 1M8KA 1EI9A 1R6VA 2NYAA 3AETA 2A9KA 5F98A 3MWDA 1C3XA 2IE8A 2DG2A 3JY6A 1GQQA 1TUGA 3FMFA 1NVFA 1T0BA 1XC7A 3OEHD 4O1MA 5AJXA 3CRW1 5IKOA 2YCLA 3O84A 3SOZA 1EXMA 2A0KA 1TAGA 2DM6A 4J0JA 5A7HA 3GLFB 2PRIA 4YYEA 4Z4IA 5AVRA 1I7LA 4QPPA 4EATA 4PX2A 5ADVA 1UWKA 1DKPA 3A37A 4PQGA 1YNOA 1VG0B 1J39A 2B4QA 3FPEA 4JIGA 3R6DA 3RF7A 4CT4B 1N2HA 5DO9A 3L0IB 2QE6A 1MFPA 1US8A 1BCSA 1S96A 3N86A 1M0EA 2C97A 1SB8A 1VE6A 2PBLA 4HQNA 4FGZA 3HWWA 2GA9A 3H9BA 1ZVJA 2DQSA 5CH8A 4RC9A 3ZHSA 3NNDA 5BVHB 1N32B 3KLMX 4EPTA 3IUSA 4KTTE 3KO8A 4NH0A 2FFRA 3QLUA 1F60A 2FETA 4OBXA 2V6BA 4WXRA 4LJKA 4Y2PA 2Q6LA 5CYOA 1M6HA 1YONA 2R2GA 3GMTA 3WNQA 2BKUA 4ER6A 3OZ7A 4R40A 5T67A 4J0KA 2ZUFA 3OE5A 2QLMA 4JA0A 3H18A 4U3JB 4ER0A 3RABA 2VEOA 3DAOA 3TI7A 4Z4HA 3A9CA 1LI4A 2YJ3A 3EB9A 3G7SA 3CGWA 2QUAA 3K31A 3ROXA 3VNQA 2PUFA 2O8FA 1L5LA 4RENA 5M2QA 1P72A 1VMAA 2MSEB 2VXYA 2J3QA 3AW9A 3Q3HA 5JISA 1O6FA 3X1KA 3R2JA 5BN1A 3JD2A 3E4CA 1T8PA 5A71A 2O59A 1YCDA 2X0EA 5C81A 5EEHA 1CNMA 1CUZA 1LBSA 2ZJ7A 3TN7A 4TKVA 1JSZA 2JD0A 4ZCQA 3V7YA 3M1AA 5JNVA 5EGSA 5H5JA 3IQIX 5L9AA 4YP6A 1PUJA 3B1VA 2KWIA 4RIFA 3OTWA 3WYDA 4UUMA 2Q5FA 3EDRA 3PGXA 1DS6A 4GLLA 3TJZA 3HWRA 1GNQA 1UWLA 5EQJB 1JLSA 1QYDA 4QDJA 2I4IA 2AWNA 3L6UA 4FHGA 2F6RA 5IT0A 2RCYA 3RYHB 4ZVRA 5SICE 3T3NA 1B1AA 3CX3A 1PGNA 3MQFA 4KQKA 4EGQA 2P2NA 2XXJA 3RS8A 4N41A 1Y5MA 3A9RA 2IKQA 1XVVA 1B73A 4GW3A 4BO3A 4BNKA 1K6EA 3AG5A 4YR7A 1KTVA 1YS2X 3HXPA 3IJRA 3JQ7B 1IOVA 2MCFA 3R7AA 4CUJA 5FTLA 1PFWA 1XNGA 1MXHA 2P2GA 2PEZA 3D7LA 4NBNA 2VPXA 5H70A 3HEMA 4IIYA 1VLJA 3DEIA 3QYPA 4J90A 3CCFA 1BCRA 5L3ZA 4P1ZA 1V9LA 2F67A 3FPBA 3OA2A 1SPBS 2MYTA 1BMFA 1TCUA 3B89A 3T5TA 3PXGA 2WI8A 2GBPA 5REQA 4ZFNA 1U0OC 3NTUA 5BQPA 4BLTA 2XGMA 3A4VA 2GJ9A 1LFDB 3DUWA 4Z7QB 2DQYA 4B4KA 4F86A 2R00A 5B4TA 3BQMB 1HE1C 2OO7A 2XLCA 3TOCA 3ZCVA 2FZCA 3G5LA 4K3VA 5AM3A 5AJVB 2OHVA 5K0SA 5LQMA 3ELUA 3VNUA 4FMBB 2Q3EA 5EESA 3FWPA 3K0KA 3AIIA 5IXJA 1JHQA 3LP6A 4CZ2A 5JJBA 5DBHX 4UU7A 1G59A 2FJPA 5GJCA 2IF0A 4GDMA 4N03A 4YXWD 2H7YA 4OHKA 5LJLA 3WL4A 4GEGA 4H3HB 2EJWA 2L17A 1W5TA 3HXLA 3ORYA 4EQ6A 2OC9A 2O7RA 1J8YF 4I1SA 4HAXA 4FCWA 3HVHA 4X65B 2N0SA 3GNSA 4HYEA 3E5MA 4L7QA 2RB4A 4LYYA 3WJ1A 4WBNA 3FYUC 2HBQA 3JAKB 2J3KA 3PR1A 4G37A 4RGVA 1YUNA 3TBHA 5I8PA 4LYAA 1B0UA 4ERNA 4NBRA 1FRVA 5EIEA 4QOHA 2ENUA 3QVLA 4L3WA 3M4JA 5K0GA 2YZNA 2C3PA 5GZ6A 2FPXA 1SU4A 3CX6A 4BKPA 1E1LA 3BRWA 4HQ0A 5HIJA 5JH7A 2QD1A 5COAA 5GV7A 3AZQA 1KP9A 2XB8A 3UV3A 3K0BA 4RJIA 3VPGA 3FAZA 7REQA 1SOUA 3ORRA 1OWNA 5EVJA 3DO6A 2Q8PA 5K3FA 1KE1A 2I76A 1RQNA 5EQFA 4H35A 4HMPA 3RVPA 1ID1A 2FWJA 2NTNA 3PHBE 4MVJM 3BFPA 3BWYA 1N6RA 1Y3CE 3KR1A 4YAJA 1KFCB 1F6BA 1CKEA 5E7JA 3TXXA 4EHAA 4YXWA 3S44A 2Y1GA 4WK2B 1HH4A 4MJXA 5ALJA 2R5WA 5GADl 4RD3A 1X1AA 1ANKA 4F4DA 3Q9NA 1PG0A 4EYGA 4YI5A 1UMKA 4Q4HA 2JAWA 1WEHA 4HF7A 1U8AA 2EKLA 3M6IA 4B3IA 3QKUA 5E6RA 4ZD6A 3NDIA 2P9GA 1DC6A 3H83A 1QCZA 1P4AA 3C14C 4QQ8A 3HVRA 1U6JA 1LXCA 1RYEA 1YS4A 2II6A 3LT1A 1KVQA 4CKBA 3SHQA 3U0VA 3N7UA 3LOPA 4BB0A 4BP9A 1KSFX 1V25A 3LIPA 3NHMA 5CDHA 1B0PA 2Q0SA 4P0QB 1HGXA 1J20A 2QX4A 1N1MA 4B84A 4BQIA 1DOAA 3E9QA 2JZOA 3BKXA 3E70C 1GPAA 2A92A 1KI8A 4AZ3A 1J0AA 5B57C 1VSBA 1C0PA 1G291 3DHEA 1KWKA 1NF3A 1J2UA 4IM7A 1DC3A 2I7XA 3WMWA 2FK8A 1DAOA 2NTJA 1XYYA 1I80A 2I1QA 3ELDA 2VRNA 2AQKA 4GMGA 3RYIA 4ZVQA 3I45A 3QU2A 3QY0A 4M46A 1AUQA 3HJAA 1D5CA 1FW6A 3NHUA 1XDGA 3JWEA 3OESA 4Q15A 2NSLA 4U02A 1X0VA 2C84A 1ETUA 3OH8A 3ILYA 4FX2A 4G5RA 3TXYA 4D9IA 3DDCA 1RWXA 5AQEA 1CTQA 3KKLA 4DLZA 2V3WA 3GPDG 2QMOA 2EYUA 4ES6A 1G8JA 4EHBA 1NBME 2ATXA 2J08A 1YI0A 2WTAA 4WFKA 4HWSA 2R4QA 4JODA 5FT9A 5JLAA 2DHCA 1L5FA 1ZN2A 2WUDA 3WSVA 4CQJA 4FC7A 5A62A 5L7WA 1GTSA 2VJQA 1ZMBA 3FGOA 5KTKA 5BW6B 3L5KA 1XZNA 2G1AA 3ASUA 1ZWKA 3ASYA 2PL3A 2RGUA 4EK9A 1Q5PA 4FDUA 4DBZA 1AKQA 4UXHA 4YAIA 5I7HA 2WVHA 2JD2A 2HIAA 1WOYA 2PUCA 1IM8A 1CP2A 4ENSA 3WLAA 5KWIA 3KZKA 3C3PA 3PRHA 3QG1A 3ZDBA 3BX1A 1GNTA 2JK1A 4LXHA 4M1ZA 3NT4A 1KVRA 2BMEA 4YTEA 3USZA 1XU7A 1D6NA 2YDXA 5KSWB 1VDMA 4MWBA 2J9YB 2ZWPA 3LF2A 2CVHA 3ZWMA 4CCSA 5JNSA 1BH2A 1X8LA 1VSQA 1N1DA 1NVDA 1D0VA 4Q37A 2PGNA 1RABA 4RFLA 3TOSA 2EGGA 1CUVA 2PPVA 2XWJI 1UZLA 3R3HA 1RADA 2HFJA 4M1EA 3KJQA 1RXIA 3NUGA 1ATIA 2Q4DA 3LBAA 3DEYX 5C8ZA 1ZVVA 1R9JA 2J9GA 4QPJC 1AZWA 1YQEA 4YMGA 3ODGA 2QX7A 3OE7D 1W8DA 3WDMA 2NNWB 4JQOA 3KEGA 4AT1A 3U2QA 2AOXA 4HEHA 1V3QE 5JADA 1X80A 2VNHA 2HIGA 1UBKS 2F59A 2P6MA 3RFUA 4OK6A 1LJUA 2F1KA 2AN5A 2DPGA 2JGDA 4K9MA 1Z5UA 2PLWA 4MMYB 5AVKA 3AI3A 5HR5A 1MPTA 2OMKA 1NWCA 2GKOA 2UVPB 2PGXA 2D3WA 4JSTA 3SN6A 4BLQA 2OZKA 5HTOA 3PR3A 2Z2IA 3UYKA 2EKZA 5HZKA 1FZQA 4GP9A 2R97A 3DEAA 3AB3A 3B3GA 1PNOA 4DGQA 2CJPA 4NLLA 3N8NA 4DIKA 3NTRA 3F6CA 3V7FA 4EX6A 4RTOA 5JZOA 5EA2A 4YY3B 3AF2A 5CDTA 2OQRA 5LOVA 3L7AA 3WV5A 5BORA 2FSSA 4WD3A 2PO5A 1E3WA 5ALWA 1G4HA 5ALZA 4RPIA 5LNK1 1NN5A 5BYBA 1B4DA 3QPVA 1Z26A 2RKOA 2ZRQA 2V7EA 4MCJA 5JE8A 1Y4ZA 3WLPA 3W5BA 1TIPA 3KYCB 5DIFA 4B6SA 2FRVA 2AUTA 1HLFA 4P5PA 4F84A 2F3SA 4J2OA 4A5SA 1X7HA 2MINA 5AM2A 5EJIA 3IULA 3L8DA 3V8QA 1XRJA 1SOAA 2G06A 3C74A 4X5OA 4ZEOA 5FWXA 3I1YA 3QVWA 2W42A 4HDCA 4GZMA 4YCLA 2Q3FA 1OAOA 2D0IA 2B2XA 4LUCA 4YAGA 5TMPA 2C4KA 1L5SA 4X1YA 1N4DA 3TQSA 4Y67A 4DDTA 3LMKA 1C1XB 1VBFA 4AY4A 1YMVA 3JQBC 1DC7A 1Z4LA 3ZGOA 5EPEA 4U8GA 1CY0A 3E3OA 1KH2A 5JSFA 2AC7A 3LD9A 1Y80A 4ENTA 1ZYUA 2GVNA 1DXYA 1POWA 2GT1A 4KLZA 5EIBC 5IYZB 2ZPUA 4JI6B 3HJCA 2ZGVA 3TZLA 4HQ6A 4W5JA 4ADSG 5B12A 1BDHA 1Y9DA 3B1JA 2EWWA 1VPVA 2I65A 2YV2A 3AEXA 3UWOA 1U3WA 3RSHA 4W5RA 1U2SA 5AOBA 2C96A 3D1JA 3R3UA 3LY9A 1ULAA 1VJRA 2BEJA 4ZAGA 3NTOA 2IY8A 2R7LA 3W2GA 3L0BA 3WLEA 3OQOA 1D4OA 1HDGO 3FFWA 3GIWA 5AKZA 2J7PA 5LPNA 4IXWA 4RVDA 3THSA 3BMXA 2HZBA 4KPFC 1PL6A 3F7OA 4Y1RA 2CJFA 4BLSA 1VC2A 2ZRAA 4KG7A 1O2DA 1YK1A 4LZOA 3NBAA 3QHQA 4UQPA 3IQDB 2PLAA 5DSTA 1VPLA 1QF7A 3CH5A 1RKUA 4UFPA 1SAYA 3DPUA 1NMEA 1KJQA 4LBVA 4WCFB 4CM8B 5LMUB 4EY4A 3THXB 4CMGA 2L69A 4FHFA 3MINA 2GXAA 3L40A 3KL4A 4H7IA 2PKWA 4RA9B 3QE4A 1RYDA 4JYPA 4LF5B 3ILHA 4C3ZA 1YDMA 1F20A 1KDOA 1T4CB 1YE5A 2PT6A 2VPPA 2ZAOA 3EGXA 5HK8A 4BBPA 1WBDA 1UAYA 5IH7A 2F3UA 3AIMA 3QV1A 4CG0A 2C3OA 2BP7A 3B3QA 1P6UA 1KKMA 1MHPA 2RARA 2VHUA 2VAMA 4GNRA 4RMJA 4CGZA 1C3JA 2ZBPA 2CN1A 1SC4A 2J3EA 3OJ0A 3T4PA 2C98A 2P9QA 1MORA 2X5XA 4LQLA 4LSWA 2EW1A 3CONA 5DTMA 3TQFA 5JANA 1TA9A 2B8NA 3S7ZA 3M4YA 1YF3A 1KQPA 1D1SA 1TAUA 1RKBA 1TFRA 5B36A 1U2RA 4R7TA 2GFQA 2X14A 4ZXPA 1Z7WA 2PUGA 2W2LD 1G21B 2Q3DA 1Q95A 4X1OA 5EZQA 3GLHB 4F5DA 3T3HA 3VZDA 4EITA 1PK8A 1WUYA 2V5VA 2OYCA 4AG5A 5AVTA 5BW5A 1S7CA 2OORA 4YCCA 4MUKA 5LQCA 2YKGA 5KX5B 4FFLA 3LZ6A 2Y66A 1E62A 3GJXC 3ONNA 3CTMA 4Y0AA 3RVQA 3VR5A 4E13A 1ISJA 3ECCA 4YJKA 4WLVA 1X42A 3TL3A 3BA6A 3GUVA 3MMPA 5CDGA 4YCJA 1ADBA 1BWRA 2YY5A 4L6IA 3BZWA 4LJAA 4NZYA 4XFKA 1JU3A 4ZQHA 3C6ZA 1A3CA 4NDNE 2OHHA 2PTHA 2NZVG 4XRRA 3E6AA 4D0LB 2YV5A 3E2IA 3N07A 1Y7LA 2R87A 5GOZA 4Y1GA 3W34A 4YUAA 1KK2A 1PN3A 1SD5A 1XNJA 5I7FA 2WVAA 2W48A 1A2QA 1GILA 2O2YA 1UMDA 1Z36A 2H4ZA 4K03A 3N53A 1Q91A 3DBLB 1DRJA 4CIWA 2C5FA 1J2YA 2NZ8A 1FRQA 2R79A 3RFTA 2DUWA 2AKEA 4DR6B 3RIYA 3TB6A 2WICA 2DWPA 2W2QA 1MC1A 3CQ9A 4TV8A 3WL5A 3QEAZ 3T95A 3RQSA 3HR8A 4N0DA 4NABA 1YJXA 3WB9A 3NBMA 5B4UA 1YCHA 2HWYA 1RWWA 4GOOD 4UEWA 1C1XA 2I4MA 5KAPA 5A5GA 6CHYA 1DE0A 1I2MA 2FLKA 3A8TA 4LTDA 3U1TA 1TM5E 2AR0A 3EK2A 1Z4QA 2Q7OE 3UMGA 1JJ7A 1XKXA 1RIIA 2AG1A 4N39A 3LU1A 4Z7OB 2PX4A 1OWMA 1Q3TA 3CSUA 3FYHA 1E7MA 5EUCA 1Z62A 3AFIA 1QPBA 3HZRA 2NUTA 3TLGB 1E9FA 4HZUB 5F51A 1M5RA 4B6JA 4CI0B 1L8QA 1RC0A 3R20A 4BRWA 1Q6ZA 2FMFA 3EPKA 3ENVA 4Q3LA 4HGPA 2XF8A 4YR9A 3PC2A 1E7SA 2VPTA 4FP9A 4MGZR 2O4CA 2PKEA 1VL8A 3SYTA 1X6VA 5TGDA 3W8DA 4EYSA 4R98A 3JQ9C 1MA0A 3D3WB 4ID3A 1OKKD 4REMA 3H8SA 3HDTA 2IY9A 2PLNA 4JT4A 4E1AA 3CWQA 5D5HA 4Z53A 3S4YA 5LNK6 3A1VA 1DXOA 2FE1A 2OZLA 3ZJVA 2D62A 1S01A 3QVXA 3MSXA 2PL9A 3QIAA 4IFBA 2HLDD 3QWAA 3V2GA 1DIHA 2BFFB 2D2FA 4XIYA 3FNBA 121PA 5B7PA 4R0NA 2OG2A 2SKCA 4DUPA 5LU9A 1VCOA 4O2RA 4LWZA 2O4UX 3OPYA 4ZCRA 5HKBA 1XWWA 4MQUA 1TLTA 2JI9A 4GX0A 3V4VB 1L2TA 1GL9B 3WNCA 4MUJA 3WC4A 1SKYE 2VP2A 1DVRA 4PAGA 3HTXA 3LFUA 1XJQA 3VVMA 1S3GA 1SR8A 1COZA 4FGJA 1ZMXA 4X94A 3M34A 3W6ZA 1T9CA 4ZAXA 1WVGA 3WV4A 3FHOA 4D4IA 5FAKA 3WWEA 5CLLA 5KVAA 1IOLA 4YMVA 1UZMA 4WCVA 1JEYA 3EAFA 3MMXA 2O5CA 4UVGA 3IR5A 5I7AA 4UQLA 1MX3A 3E8SA 1I7NA 4PBRA 3RBZA 3B9BA 3D6NB 3W0LB 3OZBA 4DLWA 5CA1A 1Y8RA 3DNPA 3O74A 4L5YA 1C50A 4MYRA 1BVRA 2Q07A 2Z30A 3GRVA 1R64A 4C87A 1NXXA 3AIKA 4B3XA 4B83A 1W0JA 2BZ0A 3SOPA 5A3JA 1G21A 3TX6A 3Q5DA 4BYGA 4OLBA 1NR5A 3FVQA 4MLPA 1ECFA 3I04A 4LIPD 1LF0A 9LDBA 4P54A 3ICPA 5JO0A 2QOEA 1BJTA 3A1TA 1WR8A 3WA6A 2X9QA 3DE1X 1UC8A 3Q7TA 1CF4A 3TO5A 1ZOPA 2VWQA 3DMFA 5CVVA 3SZRA 4CDMA 2VHJA 1R1DA 5B1EA 1IHYA 2MSWA 2SCUA 3JALA 4OFXA 2PMCA 3QKIA 3KE8A 3MUEA 1FNMA 2H2AA 2X5JO 4NTZA 5ECDA 2BTOA 3R5FA 4B48A 3B2EA 3SSOA 4IDDA 2BGJA 4O5OA 4NF2A 5TC4A 5C8YB 3UPDA 4UBOA 1G6HA 1L7XA 4UBKA 4LHSA 1TF2A 5ICMA 3PQ6A 3FUUA 1SVLA 5EE5B 5KNBD 4BX9A 4KQJA 5C2JB 1TC1A 1W36B 4GS5A 4CF3A 4Y9TA 1A69A 4FXPA 3H16A 4X1KB 1UMBA 3NO4A 5FR2A 4DSAA 1V37A 1TTTA 2C42A 4FBLA 4UXIA 1A2OA 3TSCA 1KEPA 1ODTC 4Y8VA 4KE8A 4EABA 1AB5A 3PCRB 3NRBA 3HV0A 1BMTA 4YRCA 5JHGB 1DCTA 4BAUA 1M7GA 3TR0A 1QTNA 4P35A 5BR1A 3G23A 5CDUA 1OCEA 3EEBA 1DPGA 2FWIA 2CFTA 5EL0A 5C5IA 2HHHB 3UMYA 5IXSA 5EJ2A 5DNUA 3EFEA 1UOOA 5JVDB 5F3DA 1QSGA 4NOKA 3FB1A 1NW8A 3W06A 3AQ4A 2CV2A 4MA4A 2BRUC 3COPA 2WW8A 5C52B 3ZZNA 2I3GA 3HFSA 3GLKA 5FUXA 3WA7A 4RD4A 1JQEA 1F12A 2PX0A 2R8ZA 3DZFA 3VHRA 5CBPB 1EUDB 2LP4Y 4JOSA 4LZJA 2M6KA 3SEFA 3IV6A 4AJ4A 1H6BA 4ZYWA 2A0FA 3EDQA 1KDRA 4YDRA 2ORYA 3RKUA 2O0LA 2Z04A 1OYYA 2DT8A 3BL8A 2ZANA 2Y0DA 2BYTA 1M75A 2HRZA 2IE0A 2V03A 4XWYA 4DLXA 4CL2A 1JFSA 3IAFA 2JB9A 1GLVA 2HSDA 3AFOA 4BEBA 3H8VA 1QQ5A 1O4WA 4BMXA 2G5TA 2H63A 2VP9A 3EVEA 1V39A 3KHSA 5TQ2A 3VKVA 1NA5A 3F5MA 3WLMA 3D8UA 4TYPA 5HEKA 2EFDB 4DEYA 1EK1A 1C9NA 1G2PA 1QX4A 2BC9A 2E4YA 4XB2A 2YDYA 4CM1A 1ZMTA 3DGEC 4LEIA 4CLOB 1LTQA 4C6SA 2AEEA 2LZ0A 2MDTA 4JD5A 1QQTA 4KTVE 4KSCA 1E0JA 1VG1A 1TA4A 2BONA 5A2QA 4YT5A 5ALDA 3NTLA 4G01B 2WHPA 1LPPA 1DQRA 3G89A 3RJ5A 1AHPA 1B6GA 3QBEA 3NORA 1G7TA 3BILA 1JZQA 1ZSVA 2CMGA 2PWBA 1UM8A 2PHZA 3BGWA 3EIQA 1XMIA 3ITDA 4RHEA 5K0LA 3TL2A 4DG9A 5AW0A 1EZ1A 2NU8B 4H31A 2NQ8A 2X2EA 4MVCA 1A72A 1W36D 1D03A 2VKQA 1MQ9A 3AFGA 2V6GA 4NU5A 5G0WA 2JFVA 3WB2A 1JDSA 2V55B 4FKMA 3C3BA 2G70A 4RHUA 3T4XA 1OPXA 2CFIA 4OMCA 1KZHA 2WZQA 2FHPA 5LUBA 3REOA 4WRRA 1U0BB 5HKOA 5LQRA 3ZY6A 2PQ2A 4F91B 2X58A 3BCHA 1M0SA 4A0FA 5FA8A 2W6QA 2HEGA 4DMUB 1A71A 2XVYA 2VP0A 2XMDA 2ZI6A 4ZYTA 3C5CA 2BM1A 4NCJA 2AMVA 3INYA 3EZ6A 2ZRFA 3U0BA 1HEYA 2IOFK 3FTQA 4HNUA 2HADA 4O2AF 5C35A 1IN1A 4EKEA 1HORA 4M89A 3AFNA 1K7EB 2QUIA 2XB9A 3BL5A 2QHXA 3Q10A 3Q8XB 4NEHB 1PGQA 4E70A 1KI9A 4JR2A 4NV3A 2IHJA 1AZTA 1T0HB 2ZIXB 3EGEA 4LDQA 1PF7E 3OURA 2GGSA 3IRUA 1H2ZA 1MTOA 1NW3A 4ZZ2A 3ZI0A 1N36B 2YV3A 4YLEA 1M2KA 4B2PA 4TMFA 4MV3A 2P62A 5CIYA 5K3CA 1FDVA 4JVOA 1DPFA 1QE3A 4C0LA 5FPHA 1FX1A 3QU5A 1FP4B 1MNAA 1GZ5A 1UF9A 4G23A 2DE0X 3BGIA 4HDMB 1GZ7A 3EXFB 4RFVA 4U7WA 2BTEA 1Y82A 3D3NA 5EUQB 2YXLA 3WHKA 2DLDA 3WG9A 4KODA 1C8BA 4O8CA 2OPBA 2VXCA 1CVRA 2G36A 2WFLA 2WHEA 1WUHS 1U5AA 2CLLB 2XA1A 4QQKA 3O2SB 1VL0A 3O8NA 2DR2A 3G2LA 7ABPA 5GONB 2IPNA 4HAZA 4HY3A 4MO9A 1EGAA 4W5HA 1XRNA 3CEHA 5FL7D 2ILVA 5ES4B 4Q4AB 1V16B 3COJA 4MDYA 5A04A 2RAPA 2ECOA 4TV9F 5HM6A 5DSXA 1IY0A 3CEMA 2UXCB 4KR0A 3GFVA 4ZOQI 3I2FA 5DX0A 1UPBA 4U7GA 2P90A 2PUBA 1N2EA 3TQCA 1EDOA 3IAEA 4HUTA 3QSGA 2G9QA 2I6FA 2J3HA 1YU6A 4KZPA 4M9CA 4U7HA 3ZHUA 4L8FA 4I2VA 5TRTA 3HYLA 4H6PA 3HCCA 2DEUA 4ZIRB 2JCYA 1P2BA 4LE1A 4UAVA 4HS4A 3O90A 4CE6A 4GI7A 4Q9NA 4M8LA 3KAKA 1SHLA 5JNTA 3DZHA 2BGWA 5KZMB 4UE3S 4GG1A 5H68A 2V4ZA 1QFXA 2VR1A 4WK6A 3D1VA 4H16A 5ADWA 1E3MA 3A3YA 2WWYA 2VDLB 5CA0A 1KAHA 3BF8A 3QLUC 2WV9A 2QTLA 2RAUA 3KTAB 3M33A 1EUCA 2I78A 2GBCA 1TECE 3JQ8B 3IOYA 4RGBA 3Q0IA 2CVZA 2O8DB 3L1UA 5FL7A 4DCVA 1M2EA 5SV2A 4IDCA 3T7EA 1E1RA 4QOIA 4O5AA 5JI3E 5DIZA 1A7JA 2O3RA 1QE5A 5HFJA 3VAYA 2P9YA 4MRAA 4BMDA 3ADDA 1IHOA 1P18A 3AYZB 4DANA 3A04A 1DJPA 1CZHA 2KJQA 2O5VA 2QJFA 3H2JA 4RZSA 3UHFA 5AW7A 3GEDA 4U4AA 3AVVA 1QQAA 1Y6ZA 2BBSA 1MNQA 3HYSA 3WK7A 4BO4A 2R7NA 1RAHA 1D2MA 2OM2A 2TMYA 3NVAA 3BMNB 4EYEA 3D4NA 4ZEXA 3T12A 4JBWA 5LD2B 4EGJA 3N0XA 3BWCA 3ZC3A 4B85A 1L4MA 1Q1NA 4NX2A 2A94A 1M2OA 5IMSA 4XDGA 2CXSA 4U7FA 1UBUS 3SDZA 3QE2A 2J5QA 2WAOA 1VKZA 2IKSA 3V7UA 4PZAA 1H9BA 3X1ZA 4NBSA 1M67A 4A8JA 1RAAA 1HL7A 1L3BA 3G0CA 3L02A 4C21A 1YZYA 1TI7A 2PN1A 4NU8X 2APJA 3N8IA 3IQXA 1G4AE 2QYSA 4FW8A 1TZ2A 1PT8A 3ZGNA 4YMLA 1AH2A 4Q1VA 2RJNA 1Z2NX 3DVAB 4IOLA 1QH0A 2I8AA 2VA8A 3TUJC 3W3ZB 3RF6A 3UO8B 5HNKA 2YWJA 3CE9A 4I3HA 4XYBA 5TLSA 1NVEA 2XMRA 3B6IA 1K7YA 1GAXA 1CR0A 3DUFB 3W4IA 1NWHA 3BZUA 4OX9B 4PZDA 4RVSA 3OWOA 5JR3A 2HJHA 4J0FA 2B9EA 4BPBA 1NJ8A 4IR7A 2QRKA 4J7AA 5EWMA 3ADCA 1NQUA 4MPTA 3KTOA 4N5DA 1CF2O 2FSUA 1YZLA 3F6BX 4MTCA 5GJVC 1G2QA 4BKOA 3LYLA 3VOTA 4RS3A 2VQDA 1QKJA 1W87A 2R00C 1O57A 2ZR9A 1FP4A 1GQ2A 2DJIA 3DA8A 3EC2A 3HZZA 4HDMA 3M3DA 3VR2A 3QEBZ 2A1TS 1B8NA 3DAHA 3DHYA 4M0CA 1UKZA 5EP4A 4C1BA 4DG5A 5EJ8A 1E2BA 3HJRA 2VK4A 1B0AA 1CS4C 4BVBA 4HLUC 4BUJA 5JATA 2EAUA 1CUCA 3MCWA 4GPZA 4M2LA 4M53A 3PVZA 4QTZA 4Q02A 3HG7A 4ZVSA 5H0IA 2PYZA 3I01M 2OV4A 2J6IA 1BXGB 3FTCA 5MDHA 3GJZA 3GNTA 5KOHB 2W43A 2H9YA 2Z58A 4FNMA 2JIOA 3GZJA 2WM9B 4NMMA 4D3SA 4PE5B 2NV2B 3NBZC 4XEUA 3WIOA 1V16A 2XCSB 3PFCA 1XMOB 4HEA1 3KSMA 2NIPA 3EXIA 4K6GA 5CAEA 1SUIA 4FM9A 1BOOA 2IV3A 1ZH4A 2GLUA 3SQWA 3IIKA 2WUEA 2ERYA 1WVMA 2A5DA 2DSNA 1AN0A 3GJ5A 5EKSA 1KFKB 1A8QA 1DL5A 2JKYA 2V7VA 4N5LA 5BSUA 1KYVA 1LLDA 1WF3A 1XZEA 2Q3HA 3DTVD 4KK3A 4TRMA 3RRMA 3VH3A 5AVSA 5JY1A 4UHBA 1YZFA 2RDMA 4BASA 4ND6A 4OBEA 4QREA 3E18A 1GZ6A 4C0SA 4V1CI 1SXPA 3I32A 2W37A 4INOA 4AJ1A 4EUNA 2G63A 4M98A 4F5WA 4DVJA 2I6GA 3KPJA 3I09A 3KAQA 3CLRD 4A5OA 3PSHA 4CEHB 5EXTA 4WW0A 1FS5A 3PQDA 2VDRB 4RKWA 1VDZA 1XTIA 1JQJC 4B76A 3OQMA 4C0KA 3DWGA 4HYQA 1W48A 2H1LA 3TRFA 1L5YA 2HB6A 1PFUA 3KTAA 3W1VA 2NYVA 3WYCA 4DWVA 1NN3A 2VHZA 3PE3A 5DVZA 2RONA 4KAJA 4ECAA 4BZPA 2FMXA 5BN4A 1VFNA 2GARA 2JIPA 2MOKA 3GT4A 3NMUF 3SIPA 1Z5OA 2QI9F 1KY3A 1W96A 3SKYA 5GVSA 2VJMA 5I3CA 1HTWA 2IYLD 3ZY2A 1UBNA 2ZSAA 2C2WA 3INGA 4UMVA 2OM6A 3VPCA 1J06A 3B5IA 4G1CA 3HB7A 3FB4A 1HM5A 3CGGA 3K8OE 5EZYB 1YACA 3F5DA 1XZLA 3MJRA 2AOUB 2K5UA 3DTVA 4QOJA 5TPWB 3T5MA 3HFJA 1Q2XA 4XGRA 4L15A 3O75A 4QYXA 1S8NA 3RVJA 3RS0A 5FBHA 3TF5A 3H2IA 3NTVA 2Z5FA 1TU3A 5BVGA 2NAPA 5FNVF 1U11A 4EUEA 1CJCA 3G2NA 1NSTA 4HXYA 3MQ4A 3MGGA 1TF7A 1FQWA 5F1OA 1ISGA 2NVWA 2J31A 1O3YA 1OQAA 1OWPA 4XIFA 1JR2A 1LRLA 2ZUBA 3MNFA 4IX9A 3U3MA 4A8HA 1NNEA 2BKXA 5IK2A 1JR3E 1JV2B 1O0SA 2WIJA 4NPHA 1C3OB 3F4BA 5GY7A 5JT1A 3DF7A 2X5OA 1N5RA 4H7DA 5AI9A 5EXDA 1TT5A 4DT1B 3GCWA 1XA3A 2J8ZA 4ZO7A 1Q0ZA 1F7UA 3BTVA 2IYSA 3CBQA 3REQB 9ABPA 3DVAA 2ZSHA 1ZD9A 4FSDA 1W6RA 4PLFA 1ZJWA 2HMVA 2I4NA 2JFGA 3DE2X 3DFUA 5LYJB 1EK2A 1U1GA 3BH6A 4MAFA 2OHIA 3K6KA 3QF7A 5AJZA 2XNDD 1Z88A 3T94A 3HB0A 2V7TA 1IMJA 1AS3A 3B60A 5KQSA 1YRLA 4PC3A 4UOQA 5BV2P 4OQDA 1E2QA 4Y9DA 4KVZA 1NBEA 2ZRIA 2PSEA 5L51A 4O59O 5AW3A 3OFJA 4EFMA 1ESNA 3T7RA 2Q45A 2FP4A 4N12A 3UFXB 3MTJA 3RYCA 4ILKA 1PJCA 3U7RA 1WDTA 1XRRA 1Y1LA 3L7NA 4HZIA 4LRYA 4UMEA 2OE2A 1SD1A 2JIRA 5CGQB 1FJ2A 1T35A 4A1OA 3UF0A 4HL6A 1EVEA 1NUPA 3TD9A 3T34A 1LJLA 1ZJ4A 2R6JA 3BXGA 1JFTA 4CG3A 3UG6A 4J75A 2F8MA 1SOWA 1GT91 1OT3A 2D3TA 3T0IA 2PYDA 2F64A 1K4KA 1PR3A 2PZKA 1BRMA 1QOPB 1SQ5A 3FDZA 2GK4A 3KXIA 2EVWX 2W0MA 3RSLA 2IS1A 3M1IA 1W5AA 4MQFA 3TKLA 4IDQA 3ZV7A 3WTBA 1D1TA 5AVJA 1QGUA 4S0XA 3R23A 3R5XA 4B6FA 4MYSA 3AHHA 5CTJA 1KY4A 4I6JA 4NV0A 4IY1A 5EE9A 4HDSA 1PG2A 5M34A 3D0OA 1TIKA 4OSOA 5I4IA 2IX9A 3AY3A 4HI0E 1I0LA 1N6HA 3EQ6A 2NU6B 3ZWOA 5EJ7A 1OGIA 1DUVG 3EXHA 2J1LA 1Q17A 5ALTA 1NUAA 1XZFA 3SS7X 1I5OA 2ASVA 1KI7A 2D54A 1MEJA 1TTHA 4AF6A 5I7RA 4TMVA 3FPJA 4YMUA 5HHTA 5E8JA 3T3OA 1G5QA 2O1SA 4LE0A 1N78A 3ZH2A 1Q1QA 1V7QA 1LDGA 2Q5CA 3CNOA 4LVCA 1RT9A 1S2GA 3COYA 1E9CA 1F4PA 4EOGA 5EQTA 4HDNA 4M22A 4FKZA 5DE3A 2KX7A 1JLMA 3B1ZA 3GVXA 1W6UA 3BTOA 3LDAA 4NICA 1JSLA 5C8XA 3I6BA 4WT7A 4CMJA 2DHQA 2G67A 2PGJA 3EIEA 4XEHA 4NYJR 2IS2A 4UUNA 4ZARA 4LTNA 2BGKA 4GOMD 1HMPA 4PN3A 4EGSA 1ZI9A 1Q0UA 3LA8A 2QORA 5A9TA 3WJ2A 1YBHA 1PS9A 1S7GA 3GGDA 3M5WA 2PRSA 4Q66C 3KZ1E 5C1IA 1CJMA 3OCJA 1Z16A 4BZXA 2XQGA 2PUTA 4Y2HA 1ENOA 1FE8A 1A9XA 4A7PA 1EVJA 1UZUA 3VU3A 3EG9A 1GPMA 1UJNA 4PSAA 2Y2UA 1OAOC 1Y5IA 2QAIA 3FUVA 3UC5A 5I7WA 1E77A 3LTEA 3A9VA 3PJGA 4RIIA 3SYMA 4B6QA 5AVXA 2VTDA 4CUKA 4UBIA 1C5KA 3JXEA 2VNKA 4PLWA 1TL7C 2QN3A 3NHYA 3BH7A 4MVJD 2XTMA 3BEDA 1KAGA 4TSRA 3F7NA 3SVTA 2RJOA 1GN8A 4I5DA 5JXHA 1D9ZA 4MRVA 1P33A 1SELA 2EQ5A 2VOJA 1MH9A 1WZIA 3I9FA 3IPLA 3R7WA 1WSWA 3L7IA 3SYRA 1EBFA 1P81A 1Y5LA 2P79A 3L6BA 5C5EA 2Z56A 3SKXA 2B83A 1RC8A 1WP9A 1T5HX 2TYSB 3BE4A 3ERCA 3KAJA 3U4QB 4E03A 5LQNA 4XQCA 2DFNA 2ZRJA 4QGGA 2D2IA 4TWJA 2FF7A 4KFRA 3UEOA 5JHHB 4I5EA 4KPYA 3C3KA 5HWSA 2ZBDA 2Y77A 1HKUA 2CNBA 2JJYA 5LDHA 4JCOA 1GR1A 1NV8A 4OI4A 4PRLA 3O9VA 2GM4A 1VMKA 4LJLA 1QYIA 1XQVA 2Q8QA 2O8VA 4DREA 2PVCA 4HUJA 2AQ8A 1Q1BA 2JGKA 4BU1A 2CV0A 3DAPA 3UAOA 5FOQA 5H9VA 2AJDA 2EEZA 1P7PA 2J5XA 2JI8A 2IYNA 1UP6A 3NC4A 2G9VA 1N0UA 1QFSA 1U8FO 4UU1A 1NOJA 4E4YA 3RHFA 621PA 2GOYA 4WL0A 4UNQA 1CUWA 4Z0PA 1QG0A 4NJMA 3EJWA 1LKZA 1P17A 2L42A 2R65A 3SSMA 1CYEA 1Q19A 5HDBB 2B7CA 4EHNA 1O6GA 4KSBA 2BFDA 3SQXA 4Z4FA 4KGXA 3T5CA 2DR3A 2Q2OA 3HNRA 5KYWB 2AEMA 1ZH8A 4TS1A 5EY5B 3BXEA 1TEHA 1QFZA 3N6XA 3MRVA 5T4EA 4A23A 4ND1A 2PWZA 4MHOA 3THYB 1E7RA 4JVSB 1GV0A 3CVWA 3DP7A 3MLBA 4MKRA 2EBFX 3O92A 1KH1A 4HLCA 3WWZA 4Z9XA 2Q6TA 2YV4A 4S1VA 2OG1A 5EFZA 4PX3A 4BATA 4WOPA 1KI6A 4EBBA 3HJGA 1L4HA 3MTBA 5DM2A 1DKLA 4ZDWA 1EEHA 2X3YA 1ZIXA 4JBHA 1ZA1A 3D8SA 3GZNB 3M6VA 2AJLI 3FNEA 3WLJA 3ZV3A 4AKEA 4ZV9A 4FMCB 5HXAA 1SURA 5I45A 5JQGF 3HB4X 1CS0A 2YC4C 4C4XA 5F52A 1L4LA 1OU0A 1EVKA 5B3JA 1TB4A 1X8XA 3RU2A 2ZI4A 2G4VA 2VH1A 4DLYA 4O08A 1ST3A 3HU1A 3C7CB 1Z08A 2CE2X 4QVGA 2OORC 5TJ9A 4Q4DA 1NQWA 1KF0A 4MV8A 4BO2A 4R81A 1G7CA 3E3MA 4YDHB 4JWKA 5DJ5A 3FLEA 1UPCA 2JG3A 3CG4A 1NP6A 4RQTA 2J87A 3W1WA 1F2VA 4P4TA 2XRYA 4KB5A 4NXNB 3T3DA 2X86A 4UUAA 2IP4A 3OC0A 4UE2A 4ZAYA 5KYXA 1OTYA 1EPUA 1ZN8A 4PGAA 3SIWA 3W8FA 2H1VA 4MJ3A 4PVDA 3TQHA 2JLZA 1ACJA 1MO6A 3S29A 1T13A 1XEWY 5DX8A 3H2BA 3RANA 3GJ8A 2BT4A 4NY1A 4XR9A 3GI1A 3GAMA 1T25A 4H7PA 1U0TA 3RGGA 4BP3A 1CUDA 1P2TA 1WCWA 3EF0A 4G85A 3C7KA 3ZDFA 5AI6A 5EYPB 1HI9A 4V2UA 5AH0A 3L8ZA 4NZZA 2B5VA 1T8TA 3WMRA 3FDFA 4Y7DA 1XG5A 1VJTA 4Q3EA 1G64A 2I33A 3AV0B 2OD9A 1EAMA 1A2KC 1UBTS 2BN4A 1FDRA 3D59A 1A9RA 2ZIAA 4NR0A 4L78A 1KORA 3AJAA 4UFOA 1KBZA 1M2NA 1T2UA 4NESA 2XE4A 4TTAA 4Y6RA 4YVFA 5J5AA 4KR9A 3CKMA 5IHPA 5IKPA 1FDIA 4BQQA 4FFSA 1JFFB 1Y9EA 4C4TA 4RETA 1P7YA 3C6YA 1TX4B 1Z4KA 5FXMA 3EOZA 3U9SA 3VKHA 1REQA 1FPMA 1YRHA 3LGAA 4YDSA 1T2DA 1NL3A 3CNLA 3E7WA 5NULA 1AMNA 1HDOA 1ZNYA 5E3HA 5JW6A 5CD1A 2IDZA 4K6KA 3VNSA 4BN4A 1Y1TA 3UHJA 4EF6A 3ZX4A 3REFA 2FW8A 1GN9A 1YR1A 1ADJA 2P9ZA 2WYIA 3NIGB 5BSRA 1YNSA 5C1OA 2CF6A 5FUBA 4RDIA 2X19A 1BDJA 3WNBA 4GVLA 4EKGA 2IHVA 4QGBA 2WLSA 4NYMQ 5CT8A 4NIMA 3VTFA 5BR7A 3W7AA 2YJ4A 4WI1A 3DCNA 1E1NA 1ZGAA 4L27A 1NYQA 1NZFA 1E5XA 1V96A 2IW1A 4FMDF 1TPYA 3GQBB 4H77A 2VT3A 4MW2A 4MVXA 1THTA 3TRHA 4XD2A 4WQMA 5IABA 2XDQB 3MCUA 3EE6A 3TD2A 3DM9B 2QMHA 1FJXA 2CWDA 2VF7A 2C7VA 2H6EA 3OKFA 2ZTUA 3QQ5A 1L6RA 3L49A 4D96A 4O1HA 2G6BA 2PBFA 2CEAA 4H60A 4C3UA 1Y1KE 1NAHA 3DMNA 2C94A 1AGNA 3QE3A 5LB4A 1AY0A 1GOTA 4DW8A 1U1CA 1DV2A 4RTSA 1XLWA 2BV3A 3GFQA 1JRLA 2X0NA 3QKWA 1J8DA 4XWAA 4Q3OA 2ZS9A 1TIBA 5ICGA 2CNKA 1RRVA 2H2HA 2SNIE 2DUNA 4P7FA 5K3BA 2OKGA 3HR7A 5BSHA 3ONFA 1E2DA 4JOBA 5CFOA 1QLHA 2B0CA 2H08A 5FBKA 1T34A 4O0MA 4P82A 5FOXA 1JTFA 3TTXA 2EJVA 3Q3GE 4MI9A 4YCNA 5IS2A 3FOZA 4YALA 1RBYA 3KQQA 4UEKA 5TVGA 2XYQA 2FWMX 1T6XA 4B71A 3L7MA 4W9NA 2NVUB 3Q6NA 1LX6A 1JQLB 2X7HA 3K32A 4P22A 5E8RA 2IU0A 4RZIA 3U39A 3ZIDA 3HKDB 5L4SA 1JEQA 3MJDA 3RYTC 4FYMA 1J24A 1FYWA 1WUJS 3DGFC 3TJRA 421PA 5EIXA 1XPRA 2PZMA 2QUBA 4AY3A 4CBVA 1HA3A 3DXZA 3LPDA 4FD2A 1ZCBA 3QXSA 4DLSA 1COWD 1UJ2A 1EZZA 3QLEA 4Q18A 3OOJA 1RI1A 4G65A 5IVIA 3RVLA 4GKVA 4PAQA 1ZK3A 1MAWA 2DTEA 2OLJA 4RYDA 2JLSA 2DPXA 1DZ3A 1H4QA 3F47A 5E95A 3E22B 4GBMA 1UT6A 5EIWA 4COKA 1ZJJA 1SXHA 3ZLJA 1N0HA 3AF5A 2JIBA 3TQRA 3PA8A 4YWJA 1C3VA 3RU9A 4QIHA 4JBYA 2D0DA 2ODTX 3SFTA 4QBKA 2ADMA 4UHFA 1DX4A 1N7JA 3WDSA 4BMPB 4G1FA 1NVGA 2HCBA 2I29A 1PD0A 1Y3IA 4LXIA 3ZE0B 3OMLA 3H5OA 2VUHB 2EG5A 4IXMA 4PQEA 3OG9A 2GHQA 1TTPB 5LXTF 1YS9A 2OFOA 2OSVA 1JHPA 3C3EA 1IXYA 4GRAA 3EGDA 2IODA 1I6LA 1INLA 3RCBA 1MRSA 3AL3A 3SNHA 1F48A 1NQAO 5DV9A 1WL8A 2WAMA 5ALLA 1GRQA 2FOIA 4Z1MA 2FMHA 2RI6A 2Q1XA 2H4HA 3BH0A 1IBMB 1U1IA 2LUOA 1DG3A 3EPHA 3VZPA 2WIBA 1L7RA 4JS0A 3C6BA 5A7GA 4J8PA 2WP0A 5DYWA 4AKSA 3OPQA 4D0RA 4A82A 4GKJB 1M6WA 1ODFA 3ZE1B 1TVMA 3PTZA 4LOKA 2CK3D 1EG2A 2X8AA 2AFHA 1RQ7A 3AXTA 4QUIA 1JPUA 3NTQA 4MMZB 1HE4A 4UTXA 3ZDXB 1IN4A 1KU6A 5AUOB 3OHSX 1AZSC 1FTGA 3VJRA 2VUIB 2PFGA 2RGNA 3E9ZA 1QANA 3ZHZA 3OLVA 2PNJA 2BFNA 1KYYA 2DHRA 4RTPA 1EFPB 4XCVA 5B5SA 4FFMA 3GDGA 3KT8A 1P0MA 4LXGA 4EYOA 2LDBA 1P39A 2Q4BA 1JDBC 1QDUA 1Y4UA 3P1JA 4UDYX 4D4LA 3QI2A 2ZM6B 2NP6A 3OCUA 2WE8A 3C85A 1U8EA 3GFOA 3ENKA 3OD5A 4GXRA 1PLJA 1DFGA 3PDJA 1VI5A 4C01A 2I2XB 1J8FA 3FPGA 3B6KA 4RDCA 5DCYA 1JHVA 4EG7A 1G42A 1V8DA 1HTBA 1TQ4A 1L3IA 1GG9A 1MIOB 1Z74A 3P9NA 3OZEA 4IWXA 3V4PB 2ZVDA 4HBGA 1AZLA 1R6XA 3D4IA 3LFHA 2Y6UA 1OLXA 4LDZA 3H75A 2E5WA 4KIGA 4YC7A 2XRMA 4NHOA 4CRWB 4Q24A 1HSZA 2W6PA 2N9UA 4KYUA 1Q7EA 4ZVOA 3CF6R 1E0SA 4M88A 3MRXA 2CMFA 3PI7A 1QHSA 4IV8A 5EIFA 4BQEA 2VXBA 3BFKA 3DV9A 4X6UA 3C4QA 1QP7A 1D2NA 1JA9A 3DWIA 3NJ4A 1JAIA 2C1EA 1R5NA 3U3DA 1QOQB 2YIVX 3O94A 2B35A 1SCIA 1XF1A 2VEDA 3KJGA 2GEBA 4KO4S 4TS3A 5KJEA 4BVKA 4QZVA 1FYDA 2NU9B 1SG6A 3RSZA 3PG5A 4EI7A 5KHOC 3F9IA 3CSSA 1X2EA 3I4LA 3PR2B 5GPBA 3T3EA 4DJAA 4DYHA 1PZEA 1R12A 2DHDA 3B9QA 3JD4A 2IWHA 3TLCA 2QMEA 3V8BA 1VCMA 3V42A 3VR3D 3Q2IA 4ZYYA 5GGXA 1S2OA 5AXCA 5KWEA 3ECAA 1USIA 2CZQA 4UHDA 5KYYB 3DMHA 1TQDA 1XCGB 2EFHB 1E0KA 1H42A 2Q1WA 3OUUA 1QP8A 3QENA 2W4MA 2OBBA 2WSMA 1N2IA 3LW7A 3TPCA 4TM8A 1JR4A 3FMIA 1GL6A 4YJHB 5IC4A 1JWLA 4BLUA 4FN5A 3AERB 3G9ZA 4NPCA 1QIFA 2DH6A 1NXSA 1Z22A 4W7HA 5K51A 3GH3A 2WB4A 4UDOA 1GGKA 2B1RA 5EFOA 4FZJA 4BX8A 1T9ZA 2O1WA 3IUQA 1FYVA 1CV2A 1U8TA 4JXJA 5E38A 1R10A 4D3XA 1KAQA 2FLWA 5CHYA 2XCTB 4Q01A 1JHYA 4QA9A 4BQSA 2QE7A 4K6CA 3G8BA 2QBYB 2Q46A 1EE9A 2RGAA 5JAOA 3GMSA 4DV5B 5HW0A 4G24A 4U2CA 6YASA 2Y67A 4B8ZA 1U98A 4CTMA 2PZAA 2Z08A 4ZA2A 3NS7A 3RS9A 1WMDA 1ZXXA 2Y92A 3GVCA 5FBWB 3TZKA 3ESQA 3IO3A 3LCRA 4XDHA 3MERA 4L08A 1ND6A 4HV4A 4H3SA 3GPBA 2C88A 4DABA 4TZTA 2D8AA 3B8HA 1BJRE 1ZUIA 4OYHA 5FWYA 1DG1G 3FFAA 4X62B 5T6MA 4WE3A 2QTTA 1YBFA 2A9QA 4Q39A 5AP9A 3RTEA 2HWUA 1LBQA 3TDMA 2XDYA 3CT4A 1KNXA 2WNSA 2YWEA 5M29A 4B0PA 2BEUB 3WIVA 4C0XA 2H8GA 1F5SA 3PXBA 4LNHA 3MT8A 1U3VA 1Z33A 2OFXA 3I9JA 3NIDB 4AECA 2MSLA 1GEGA 2HA2A 4KN8A 2NZUG 1WXWA 4IP0A 4M7WA 3F6SA 2P35A 2X9GA 5AHXA 3CWCA 2QRZA 2ZKIA 3SJAA 1WG8A 3PIRA 1X1DA 3PEUA 4B2LA 3FCCA 5KU1A 5DEIA 3L6EA 4TMYA 4XDZA 5ECGC 3F49S 3JQQA 2ZUSA 4M7PA 3U7FB 5CT6A 1S2IA 4OD0A 1AN9A 3PNKA 4MYCA 2AA3A 1TF5A 2VP6A 2OB2A 2VZ0A 3QVVA 1L5KA 4IQGA 1YULA 2DFTA 2FQQA 2DTXA 2YXEA 4WX2B 3TEMA 5JCXA 2Y3IA 3OZSA 3ETCA 2BCEA 4WNAB 3UXYA 2DKFA 1ABEA 2X4DA 4F0JA 1Z4JA 4ZDJA 4C7XA 4EG0A 1QIJA 4FN4A 5C3MA 1YIAA 3OQNA 1QBGA 3OT1B 4Y18A 2F9LA 3K9QO 1Z2PX 4MNTA 1ZN9A 4ED9A 2QM7A 4LF6B 3CZRA 3HYRA 1R37A 2JH9A 2N42A 2JCSA 3L6DA 4PX5A 3M4NA 4YMSA 5KB3A 4MCAA 1XDDA 2JIQA 4NCBA 1GUFA 1P1CA 3KVNA 3PUZA 4MAMA 3IXQA 4TRRA 2FUEA 4QVIA 1RLTA 1Z13A 3G2MA 1XAGA 3W04A 3SC3A 4CLHA 1KK3A 2BM9A 1J2TA 3CLKA 1V26A 2C54A 1CY2A 2ZPAA 4ITRC 4R9RA 4TZ0A 1URPA 4KRYA 1XFAA 2WBLC 3K7EA 5K8TA 4K5QA 1KFEB 4LJYA 3ND6A 4JJ8A 4UW9A 2J48A 3O8BA 4QQRA 2Y8EA 3K9BA 4CLEA 1FDTA 2P0YA 4QT0A 2XAUA 1CR2A 2WAYA 3BWDD 3PD0A 4OIMA 4A8JC 4AMBA 4E2XA 5HGXA 2HW8A 1IUKA 4WESB 3ESXA 4MQ6A 3RS3A 3MA0A 4IZIA 4LVOA 4QATA 4OP2A 2IRWA 3J81A 1L4EA 5H8WA 3HQ4O 2J46A 2AFRA 1GA6A 5JSYA 3HCRA 2E5FA 3ZBPA 1N7IA 1YA6A 1OC4A 1GZSA 1JQDA 2ZJOA 4GF5A 5A4DA 2A9VA 3THXA 1POXA 2DKNA 2DCMA 3D8RA 1CZUA 4ID9A 4KZKA 4OHOA 4ZAWA 4ZAZA 3V8PA 1O8BA 1NJFA 2O3TA 4Q1DA 3RNOA 2OBYA 2JGIA 4BYMA 4URFA 1LGYA 3OHPA 4R1PA 4C4YA 5JSHA 4PF1A 5GV8A 2J6CA 1YKGA 3NC1C 4YJHA 4CHTA 3PPIA 3PQ2A 1CETA 1N92A 4RVFA 4F5YA 3WLOA 2YC2C 1NURA 1BAPA 1I51A 1RAGA 4ZC8A 4J0QA 1PK9A 4HUQB 4D44A 2FWPA 1E4EB 2QYHA 3C8HA 4NU6A 5HFNA 2E4AA 3EBOA 4MIKA 4CTOA 1AKTA 2FYTA 4WK4B 3CCBA 1DAKA 1MGOA 2WJJA 5FADA 4KR3A 1DJMA 4AJ2A 4A2QA 1ESCA 3S2SA 4X93A 1N3BA 3A6JA 2O06A 2O8EA 2BMDA 4LQDA 2ROQA 4FUTA 4OHCA 3F6EX 3GARA 5LMNB 2PRKA 2D5BA 2H1RA 4QLAA 1OUMA 5AI8A 5KHLB 1OAAA 3FA2A 4FWBA 4MOWA 1DADA 4EEZA 1EVQA 1B2LA 1P9OA 1VJCA 1SVSA 2B98A 2EKPA 2Q9CA 2QEQA 2WP8J 5IBCA 3QFRA 4D9EA 3FXAA 2GQ0A 4KH1A 4UATA 1DKUA 3RT7A 2J4FA 4ZJPA 2C95A 2ETVA 5I9IA 3F74A 5KWVA 1Z4MA 4ENWA 4FGWA 2NO9A 5DYNA 4R0VA 3TRIA 3WSTA 2A30A 3EULA 3PYLA 1LC3A 1Y4AE 1X94A 5CYGA 3FZEA 1MPXA 3M2PA 3F0TA 4EKIA 1QQ6A 1Z37A 3AJRA 2NTYC 4IH4A 2BEVB 4U2KA 3QBDA 4JROA 3T99A 2NT3A 4YBRA 3B6MA 4P6VF 1CY4A 3VYVA 4OOEA 3HV2A 1I9GA 4AJNA 5B6IA 2VJPA 1YTLA 1YZTA 4LVNA 4DR2B 2PS9A 3JRXA 5DPMA 3ZN2A 4F4UA 5HUHA 1QB8A 4E30A 1QRUA 2CL5A 3BDVA 4HNAB 3Q8MA 3FJYA 3DL0A 3TINA 3L7KA 4CN9A 2QW0X 3WYAA 1CUBA 1DTSA 5CW1A 2IH2A 1QRRA 2P2DA 2EHDA 2Q5EA 1G20A 4D82A 5TIIA 2CJWB 4JYZA 1I7DA 1UM9B 4UUPA 3K6RA 5FWAA 4C0WA 1K8RA 4PVCA 1U2TA 2KE5A 2WWFA 1DXHA 2HFKA 4CF4A 3IB6A 2GJ4A 4PXAA 5J2UF 3H9EO 3C8MA 4IWYA 4Z2AA 1R4NA 4D8VA 1GG5A 4HSGA 4I6GA 5H4HA 1XVUA 1CJSA 2ID4A 2SKDA 1V6SA 1E1QD 3UHPA 3CZ4A 4M1YA 4JH0A 2A3RA 5JSZB 4CMCA 3R9XB 4YJDA 3DO8A 5AJYA 1CPYA 1X7XA 3WWYA 2CXNA 2UYHA 2XUKA 1B14A 4OU4A 1SOVA 4P31A 3IERA 2G80A 4BQOA 1OH8A 4QYSA 2CHQA 5AJHA 2VHEA 3U4AA 3JQGB 4AS2A 2EFYA 3H5TA 3NBYC 3AWDA 4YECA 4N8DA 1MQ8B 1SHJA 2EKQA 3AO0B 1CE8B 3QWFA 2D4HA 5ED0A 5JASA 2G07A 1XXHE 1PNQA 2Y9PB 1XQYA 1JEOA 3JVEA 4HSEA 4XLLA 1ICIA 4XVQA 2IVZA 1KO8A 1M2JA 1Y8CA 5KNDH 3TFQA 3IV7A 2ZBUA 2TMGA 4FR0A 2Q41A 1FXUA 1W85B 2JGMA 3VH4A 4IIUA 1H66A 2WJGA 2UZAA 1G98A 3F9RA 4E88A 4C89A 4Z3KA 1G55A 4ENRA 4LXQA 1E1QA 4M0LA 4WZAB 2NUPA 1A9SA 1CB0A 3I92A 1KZGB 2C9CA 1B3RA 4RTLA 1WKCA 3CHYA 2HCRA 2A7QA 4GXQA 2FF5A 2ODPA 3HPQA 4C14A 2OCBA 4B8WA 2YXDA 3SZOA 4EKYA 1WIWA 1KJWA 3AESB 1ND5A 1ZGGA 2NTEA 3RUAA 3OPXA 5L6MB 4GT1A 2A5JA 4Q21A 3SF0A 1U7HA 4O4HF 2CJXA 5LBUA 1L9XA 4GLOA 2PKCA 3IPCA 1CY7A 4MGKR 4NZPA 3HP4A 2XUGA 4KXVA 3UCXA 4ACAA 3ZCPA 4M0EA 4Q9HA 3AVUA 4DTIA 2P5TB 4AXXA 5TGTA 2G0NA 4F38A 3TLXA 1SG0A 5JZMA 4ZT4A 2YJGA 1SHTX 2XH8A 2VYFA 5T4FA 1T1SA 4BUCA 2G76A 4TYQA 3FROA 1H8HA 4LHEA 1L5ZA 1XI2A 3TIXB 1GJRA 3OT4A 3O2JA 4R05A 4YBZA 4C0QC 5C1DA 3IMCA 5L3RA 3JQ6A 1C7IA 2DKOA 4BFUA 4BNHA 3URMA 1HYQA 2DCUA 4GQBA 1XKLA 4TTJA 1SH7A 4FT4A 4G5FA 4D45A 5ADHA 3F2VA 3CB2A 3PHIA 4ZOLA 2WYVA 1J56A 1QIHA 3OKPA 3ROMA 4WLOA 3EXHC 1G2IA 3IDAA 1M2GA 1XX6A 3JWGA 5THXA 2HQRA 3RSOA 5KWJA 5MFZA 3K71B 1KNQA 4WN9A 1GUDA 3OZRA 2BEVA 3O73A 1W5EA 2BKLA 4HEQA 4XASA 3KB8A 2O19A 1YU9A 3PTLA 4G9BA 2J45A 3TR6A 1S4QA 2NOAA 1QZXA 1RBQA 2VWGA 3L1KA 2O7NA 3IOEA 3LECA 4PEVA 1OI2A 1T1JA 2I71A 3DOCA 4TL7A 3T9AA 4DQUA 3ZQ6A 2J32A 1G8SA 2WZCA 2YX1A 1A27A 2QP4A 1ITZA 1LZKA 4TMWA 3U19A 2PK3A 2BDUA 4OP3A 4FOTA 5BMVF 2HHLA 3LHFA 4BZQA 1CQJA 5CBKA 1GO2A 2AX3A 4RY9A 1SUWA 1UM9A 2Q49A 3F1KA 1P1KA 3E3AA 3WB0A 3EF3A 2GYUA 3K9CA 2VS1A 1L3CA 1ZCJA 2GPTA 3D6FA 1EFHA 4YP0A 3UXMA 2EW2A 1DC4A 4DEVA 2EFJA 4ZCLA 3ZCSA 3MJ4A 2C8KA 2JGJA 2NUAA 4UBMA 5I9NA 3ORHA 1CERA 2NVBA 1OBHA 4N1AA 3ETNA 1E5DA 4DADA 4ZMRA 1TQ8A 4LQCA 3ANSA 1H2EA 1DO0A 3JASB 1A4RA 1RP7A 2XSZA 3HA5A 3K8YA 4J4HA 5TXGA 1G6Q1 4OHMA 3EAGA 5ILQA 3RIXA 1N6PA 2OLEA 1NC3A 5DCUA 4NK5A 2OV3A 3FZYA 3BMQA 1M2WA 1N4AA 3VAAA 4QYTA 1CQXA 1EHYA 4K9KA 1PQ4A 1F8UA 2V98A 4AIIA 4AJ9A 3I61A 2X6TA 5BV0A 4BECA 3N05A 1GU1A 1V5FA 1H2AS 2IUYA 3FIJA 1CDEA 1P6QA 3H04A 3DDHA 2R7MA 4MV1A 1IG3A 1FUKA 2H3HA 2W0SA 4EO7A 5KTRA 5JAPA 3GUUA 2V5AA 2XB4A 3MILA 1ACLA 3E3LA 3UZUA 2Y76A 5IJ9B 2MYPA 2AJ8A 4MWDA 1DP4A 1SHK