6PFKA

Phosphofructokinase, inhibited t-state
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOFRUCTOKINASE
publication title Structural basis of the allosteric behaviour of phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA02
4P5DA 2A0KA 4NPAA 2IZ7A 3MAJA 3K2QA 3GH1A 3SBXA 4KXMA 1YDHA 1WEKA 2IZ6A 2F62A 4U1RA 4FYKA 2IZ5A 4P5EA 4LJRA 4RH3A 3O8OB 3IMKA 5AJUA 3U39A 4MEJA 4MCJA 1S2LA 1S2IA 2KHZA 1PFKA 3O8LA 3UQZA 3F5MA 3O8NA 5ITSA 4I36A 4I4IA 4JELA 4JEMA 3PFKA 1S3FA 4KXNA 4PFKA 1T35A 1S2GA 1F8XA 2F67A 2F48A 4LJKA 1RCUA 3OPYA 1S2DA 2KLHA 4KXLA 4WL0A 2A33A 1KZHA 3BQ9A 1ZXXA 4I7EA 2F64A 2Q4DA 1WEHA 3EHDA 4HX9A 2Q4OA 4FYIA 6PFKA 2HIGA 3HNOA 1F8YA 1MTOA 2NX2A 3OPYB 4A3SA 4OHRA 2PMBA 4OHBA 3QUAA 2F2TA 3O8OA 4LJLA 5AJTA 2PFKA 4FYHA 4JENA
chains in the Genus database with same CATH superfamily
3BIXA 3IVRA 5G41A 2GBGA 1F2UA 4GHWA 4RLQA 2GDJA 5KTOA 1RZRD 1L4EA 3K2BA 1WZNA 3QXCA 4PSKA 3G3EA 3ZHZA 5L53A 3M4NA 2BGMA 1PX2A 1O08A 1Y82A 1O54A 1OHHD 1Z07A 4PEVA 3DHYA 3AG5A 3HLKA 3L01A 1HTWA 4JBYA 4B3RB 2GEVA 1T4MA 1DXQA 2P2ZA 1O97D 3AHGA 3FCUB 3ZK9A 2WV7A 4BUZA 4DLBA 3RS2A 1U8AA 2H08A 4EYEA 3K5WA 2QUBA 3U4QB 1Q7GA 1SCJA 4QU9A 4F3NA 5B2FA 2HNKA 1Z63A 4XX0A 1AKUA 3FI0A 2X23A 3WBFA 2WEKA 5HK8A 3AFHA 3DBHA 4RH3A 1B0ZA 1BU8A 2A9RA 4R1QA 3S7ZA 1JLRA 2FVXA 3Q7PA 3R4VA 5IXSA 3BH0A 3CCFA 2P2NA 4AJPA 2XAUA 3FSJX 2IRWA 2IIQA 4MVJF 4ZDJA 4CEHA 1PFUA 1RACA 1M67A 3K53A 2P75A 4Y1EA 5B36A 3BD9A 3GBVA 2D7DA 1XAIA 1BJRE 4WJZA 3WLSA 2OO5A 1FEZA 2ZUDA 3MWGA 4XPZA 1K7XB 2Q5CA 4E12A 2DWPA 3JQDA 3ED1A 4PAQA 2JAHA 2GYYA 4D57A 5CDSA 1EK0A 2RSLA 1FBTA 5JEDA 4ZCPA 5JYEA 4F21A 2E2WA 2FF7A 2D5LA 3OH8A 1U7ZA 3VAYA 3I6MA 1HWYA 2QG4A 3DW3X 1TJPB 1H4VB 5DF1A 1EVLA 3ANLA 5HIIA 5M34A 2OCAA 4UTXA 5G1OA 3ZE9A 5LZ8A 1AK9A 3SI7A 4ZK6A 1F8XA 4XQCA 2NSYA 5J43A 4FIZA 4MRNA 2B8TA 1KP3A 1MUUA 1N78A 2HZ7A 1HSOA 4H7IA 5AMXA 2OD2A 5AOAA 3UCXA 5KOHA 5D5QA 4X1YA 2XKJE 3BTUA 4LYGA 2ACVA 2GBFA 2KLBA 1ZOIA 1TKRA 2WIJA 2WNSA 3ROKA 3DUWA 1EFAA 4Q9IA 2IFTA 4N3NA 1N6PA 3JAKB 4FR2A 3NONA 1DIBA 4PHFA 2D0OB 1RWOA 1BE1A 1UIMA 2NQ2C 5I7SA 3DMHA 3EFEA 4PLTA 1UJNA 2FPWA 2QW8A 2BF7A 3A06A 3WK5A 5LJIA 2GZ2A 4R6WA 4R69A 1S8AA 3K1TA 3WWZA 3RS8A 4COOA 5LUBA 3SOZA 1AMOA 2FWNA 3CRVA 1E4YA 1ONSA 7REQA 4TMZA 2IF2A 1KL7A 3WLHA 3SVTA 2KWIA 1OD6A 4XVRA 1UBUS 4P0TA 4BGUA 5BYAA 2OFWA 4PLYA 5F7JA 2B3DA 4PS0A 4DILA 2I2CA 3I1IA 5CAEB 1BE8A 3CSDA 4TQUS 5E4YA 3WLOA 1KO1A 1LBIA 2DJIA 2P2SA 1KY2A 3ESYA 4UM8B 1LDGA 1T0PA 2G17A 3DKVA 1WZ2A 1KI4A 3RFTA 3P96A 3VPCA 1CUDA 1QO9A 2GZ1A 4KN5A 3NW9A 3C3JA 4UTRA 5AW5A 1GTJ1 2YWGA 5B3AA 4AY3A 2DUUA 4CL3A 2YVAA 3T7CA 1UQTA 3S29A 2YUIA 4EUEA 3H42B 1R0BA 2RGBA 5JO0A 4XYBA 3EZ9A 4AJIA 3JAMA 1YRQA 2B9EA 1H2XA 4RSRA 4Y2GA 3U4DA 2Q6LA 5AHXA 1ZQ9A 2YXBA 1YRLA 3O21A 1T8SA 3O0DA 3OC6A 3OVMA 3TRJA 2GEUA 2ZU0C 3EDOA 3QE2A 4CKWB 4N39A 2OBYA 3DNFA 2GSDA 4MYUA 4TS4A 1XVUA 3O4FA 3JTMA 4DV7B 3L8YA 3S68A 4IDFA 4H31A 5IC6A 1DUVG 1NVTA 3LPAA 3RTBA 5HRCA 4Q02A 1Z82A 2CSXA 3RU2A 1EB8A 4JB0A 3U1TA 3NAQA 4C6HA 2C4MA 4BGDA 1FFGA 1KGSA 1YNSA 1JFTA 4I1PA 5IZCA 1ZM7A 4D3XA 4PAGA 4FFMA 5CFOA 1E1YA 1YZGA 4Q16A 1RQ7A 5L3RA 1T4CA 5DB4A 5ANRB 1M34B 1FU4A 1XFDA 1EFVB 1QB8A 2R8RA 2Y1EA 2FHSA 3MD9A 3O8LA 5CVTA 4ENUA 1HLGA 2NYUA 2LIVA 3O8NA 1ZD8A 3TQFA 1FYVA 3C39A 3UJHA 1VSUA 3AEZA 3AERB 2G09A 5EJ6A 4ND8A 3LWBA 4BQRA 1FA9A 2GJ9A 2LV8A 1TM2A 1UBNA 2G04A 3C3EA 1X94A 3A32A 4TXJA 2M6KA 3QOXA 3LX4A 2I6FA 5EMNA 4B87A 4ESVA 4IFTA 3AFNA 3MOSA 3QE4A 2QBYB 1TT5A 2JRCA 4K1XA 4H3HB 4L0QA 1ZJ6A 4AJ9A 1AKTA 4MZXA 4Z1OA 5F7ZA 1CHNA 3ZW8A 2CVZA 4XCVA 1JEQA 4AO7A 2BGWA 4E2ZA 2LKCA 2RAFA 4MV0A 2C98A 3IMGA 2LKDA 4RZHA 4JI5B 3FVTA 1MAHA 1U0FA 1DEHA 4ZVSA 5IP5A 4QGSA 5LKAA 2ENWA 3TD9A 1K8XB 4PXAA 3KPJA 5TPWA 5FB3A 4XOIA 4LYYA 1BMTA 5TF0A 5JSZA 3DGEC 4V2IA 2C7OA 3RS3A 1U3DA 4FKBA 4TWZA 3RC3A 5JXGA 2REXB 1SHJA 2RH4A 3M2TA 3EIEA 4IDQA 5LOVF 4QUEA 2OV8A 1JSLA 4JI4B 3QWIA 5DLPA 3WLTA 2PUAA 4NNOA 1JKIA 1I4WA 2L42A 3RGGA 3LCMA 2ASEA 3KOWA 5ADHA 1E2NA 5FPYA 7YASA 1GQSA 4CLRA 3K9NA 1UXGA 3DMGA 1MPTA 4EBFA 2YH2A 5BN3A 1R10A 2SECE 2QJTA 2ZWAA 3KVYA 3PVSA 4ITRC 3SMQA 3IKTA 3WYCA 1ULTA 1V96A 4LQLA 1HH4A 4KHPB 2PNFA 4FDUA 1W5BA 3PHHA 3FJOA 2ZRDA 4CN8A 2QRZA 2SKEA 4OJKA 5HP4A 1SXPA 1W88B 2B0JA 1W76A 5B2EA 1G38A 4M1EA 1T3GA 2WTMA 1EA5A 1Q6ZA 4L0CA 2C2OA 4PRLA 4EFKA 4IDCA 4Q9NA 2P9HA 4RKYA 2CDAA 1U9IA 3FOCA 1E6UA 1VM6A 2AKAB 2UDPA 5EL0A 5TMDA 1CEYA 3A9VA 2DOKA 3WJ7A 3L8DA 3PPWA 4MRPA 3KBBA 3AFGA 3LBNA 4FC7A 4DDKA 3X1MA 1OAOA 1DCMA 2NVWA 3WIUA 1PYOA 1WKVA 3V1UA 1VKNA 1PV2A 3E3NA 5EWMA 3CB4A 3PUXA 1LX7A 1QU2A 1ZIDA 1U8XX 4GMKA 3SE7A 1Q57A 2HDWA 1OA0A 3HKEA 3IV6A 3NGXA 4W8GA 4B3TB 1A3CA 1L6IA 2XDQB 1R4NB 4HHEA 3P0RA 5EIHA 1V5GA 4XVHA 3GCXA 3BZUA 1NBEA 3R9XA 3LUJA 5C5IA 1PGQA 3INYA 5FXMA 3M6UA 5CVEA 4TOIA 4XA8A 1XRPA 1RCFA 2X0FA 1PW5A 2YN0A 5J5VA 3QU2A 1J1ZA 4BNYA 4DIUA 3SQMA 4EYGA 1NNEA 2IYWA 2CNOA 2P6MA 3PTLA 5ITZB 3VNUA 2VK1A 3IBCA 3TF5A 4JJ7A 2JKYA 2WWFA 3C7DB 3IAM1 3O6VA 4B6EA 3MIZA 1ICIA 4O2AF 3MILA 2PRJA 2C88A 3BERA 5EIAA 2IU6A 5TQ0B 4OHPA 4HPJB 3FUUA 4DUGD 3KDPA 1L8LA 3NTUA 2VF2A 1O8CA 4V3BA 4NOLA 5DP1A 2QTZA 4UEWA 1Q7BA 2FKAA 4L5JA 3FI9A 3ULKA 4YP0A 2XT6A 3TDKA 1R37A 1OFHA 3HXKA 1MO4A 3D1VA 1A4IA 3TI9A 4HEA6 1D6NA 5JYCA 1RZUA 4IDEA 4XXHA 3C3CA 1ZI8A 4PC6A 1I51A 1VRCA 4DRXB 1FMCA 2GETA 1YRHA 3GJQA 1BX1A 3QWBA 4LQ4A 1G16A 4OMFG 4EO7A 2IYXA 4P9NA 4EFMA 4QAJA 1XTBA 4X0EA 2I9PA 4JLKA 3PWSA 3C3MA 4P6VF 4OP3A 4DCUA 4LXGA 3DB1A 4XIGS 5REQA 4U00A 4X97A 4BV9A 3BFVA 4DJFC 1EWTA 1L8QA 1ZNYA 1F8FA 1GFZA 1WLSA 1YJ8A 3AB7A 3IIJA 5AJXA 2N1BA 5E1BA 4ZAWA 2R6GA 2C3YA 3RAFC 3A4VA 4XZ3A 3GIDA 3TMYA 5KX5A 5T6MA 3CEJA 5FWXB 3OF2A 4MP3A 5CJ2A 1YS2X 2Q6TA 4PZPA 1YZLA 5C7YA 4PLCA 5LZ2A 3PJDA 1Z6GA 5A4IS 3DNMA 1YI8A 2FR8C 3ELWA 3SN6A 5KYYB 1MVNA 1E1RA 1C30B 3GEHA 4HZUA 1ZY2A 3QF7A 4V0QA 1KAOA 2VYQA 3NYQA 2ZP1A 3HBFA 3N7TA 2A14A 2IY7A 2FW1A 4ZQHA 5A4FS 5JNSA 3T35A 2DPHA 4KLZA 3OT1B 5ESRA 1T5BA 3JQ8B 1MFZA 1ODIA 5SZIA 4IMPA 5CDGA 2GBPA 1N0WA 1SXIA 4Q4JA 4UM9D 3VSDA 3OCJA 5MHTA 1PR9A 1RRGA 2OPBA 3T99A 5I3CA 2F64A 3NIBA 1XIVA 3HY3A 3RYCA 1JDSA 2H3EA 2WIDA 4BE7B 1G2QA 3JRXA 5KNBA 3PQ2A 1QNLA 4B8YA 2O7VA 1XJWA 3K7EA 2Q50A 4N3BA 4P32A 5FL3A 2JFYA 4YRZA 5K9ZA 1Q14A 2B1JA 5B7NA 5B3JA 2E3JA 2G4LA 2PTGA 3RF7A 3T52A 2PDAA 3KPUA 2HYDA 2R7KA 4B3JA 5I7FA 5LLDA 4F3CA 3OPYB 4KXUA 1MPXA 1G21E 4QRIA 3RV3A 2ZRHA 3CT4A 5H02A 1D9XA 3EVAA 3SM9A 1WXQA 4TMKA 4LJLA 1KEEB 1PUJA 1IUKA 1BEZA 2AOXA 3AR3A 2WMDA 3JAWB 1M3SA 3G82C 2ZJ7A 4GPAA 2J3QA 4TYQA 3TDNA 4A1OA 3QTLA 4LWOA 1TCVA 1ULBA 1UFVA 1YJQA 2LW7A 1U0GA 4L4YA 4XIYA 1VLJA 5E6RA 5AM3A 2CLCX 5I4IA 4O8CA 3F5DA 3PLRA 4QXRA 4PZ0A 3EGWA 4FBLA 3S55A 5AJZA 2FUNB 4FT4A 5TQ2A 4L3VA 3T1OA 2ZIEA 5A5FA 1J0DA 4Z7NB 4CL8A 2H0QA 3A3YA 3DGFC 1K8ZB 1PEKE 1YBHA 3KUCA 3E81A 2OCYC 4HLCA 4RDXA 2EZ4A 4UZSA 1UPTA 3RSOA 5JQGA 5LZ5A 2P9CA 2C58A 1TZBA 2BFEB 1QV9A 2DFVA 2W2MA 1H2FA 1NBMA 3FIUA 4I1UA 3DHVA 4UEOA 5DASA 4BO0A 2HX1A 1TLTA 2P78A 1JI3A 2MSEB 5DSXA 4B1FA 3BL6A 5DN9A 3DO8A 2QPAA 4ZVKA 2YZKA 3R20A 3ZHBA 4GQIA 4OOFA 4R1LA 1DX9A 2AF4C 1OFUA 2H1RA 4IDPA 4D56A 3HCBA 3WMFA 2X1MA 4LSWA 1R18A 3ZXYA 1NBHA 1SCBA 4QOJA 3V34A 1VB5A 2XE7A 3T38A 2XGOA 2EFCB 1UJ2A 2DF8A 2HL6A 2C1XA 2GWHA 3N76A 4QM7A 1F9AA 1L4FA 4GE0A 1DXYA 2CHUA 4M0DA 3ID6C 3KJNA 1ZZEA 4YRQA 1USIA 1FFXB 1P1CA 3TLKA 3UK6A 3WV4A 5CFMA 3LL7A 1PSDA 3HPQA 2A84A 3A36A 1KARA 2W6JA 1EZ1A 5DI9A 4FZRA 5E2AA 1JTFA 4CR8A 2A4MA 4J0HA 1LS6A 2I33A 1UFQA 5IMBA 4PSUA 3U4GA 1GZ4A 1X1CA 5HA5A 4H17A 4UBJA 1NAIA 1IM2A 3UMFA 2AUMA 4O4LB 2MYUA 3HK2A 4J91A 4RZQA 1Z8NA 4I6GA 5JDCC 2BDEA 3SPXA 3WRVA 3GARA 1IRXA 2AFVA 3ELDA 2C8VA 3IEIA 4PLHA 1XAHA 2IOHA 3LAWA 4RBNA 1YACA 2VVTA 4LPKA 3Q8LA 2OR3A 5C37A 2KLHA 4MRSA 4O3MA 4KN9S 1T9CA 4I6JA 2PVSA 1WUJS 3PL1A 3K0CC 1A7JA 1DJQA 1L7NA 3PHJA 3V33A 3VPGA 1P33A 2QLFA 1VYVA 1K3FA 3GEDA 1PR2A 1W85B 1H2AS 3B6KA 1E3DA 3DDWA 3KR1A 3NVDA 3JQFA 3GFSA 4QJBA 4EVSA 1R5BA 2PBFA 4MGZR 1ZOLA 3AEKB 3AKDA 4ZIRB 2ZSFA 4KX5A 4DPLA 1Y3HA 3RRXA 1I33A 3RSLA 2BFWA 3OJWA 1RWQA 3T3DA 5J4YA 2EWMA 3HA7A 3QUBA 1DAGA 3CJRA 4YLEA 1Q3HA 3B6ZA 2JFPA 5CLIA 3NDJA 1Y8RB 1C1XA 3KTAA 2I55A 5DISB 2IX3A 3GROA 2DFPA 1CG6A 2JIMA 2X8JA 4A8HA 1T9GR 4F04A 4YHHB 1D3AA 4KQEA 4REQA 4Y6SA 4NCBA 4Z2AA 1N6KA 5IAGA 1NF9A 1QSGA 4E5UA 1FQOA 4JLBA 4P7FA 4MV9A 2AS0A 4XE5A 1RYDA 2M6RA 1HKHA 1UEXC 4X8MA 4AYWA 1TYAE 5BSTA 2V54A 3SM3A 5D3KA 2V96A 1TIKA 1WSDA 4D6YA 4B7AA 4OUDB 1R27A 2JVJA 1X8JA 3FAZA 4MSUA 3E23A 3FPGA 4DV3B 2CDCA 3C5HA 2XWQA 3W2EA 4DMCA 3CVJA 3PGVA 2MTBA 5DEOA 5ICFA 1ZNQO 4LGVA 4MVJM 2NU6B 5CXSA 3INNA 1LA2A 1PTJA 2EDCA 3ZV5A 5SZHB 4B6RA 4ZCMA 4U7DA 2JJ1A 3A05A 4Q7KA 5EMHA 2NU8A 3ZWWA 3HO8A 3DUFA 2GESA 1E1CB 1J8QA 3CKLA 3QX8A 4HGOA 1SULA 2UV8A 4GUAA 3BWBA 4RO0A 4B4VA 2RGRA 1OVGA 1Y8QB 1YNOA 3CNQS 4TLEA 2F6RA 4UHEA 3P2JA 1K9VF 1QH9A 3U3KA 3HWSA 1IOVA 3WY9A 2WICA 1KEZA 3L04A 3C3AA 4FHZA 3SC4A 1YL6A 3GVCA 2I8CA 4UXJA 1GQOA 1QM5A 2GK4A 1DPGA 3PGA1 5JSQA 3HGMA 2IOQA 1RYMA 3KXLA 3BORA 3H1FA 2AA3A 1V8BA 1HGXA 2P9QA 3ZE6A 4B3FX 4Z4QA 5B1YA 5JFTA 4QUGA 3KZXA 3KZKA 4EW1A 1B4DA 2GF0A 2EEPA 5AHOA 1P5HA 1A82A 4KZKA 1MHPA 1VCMA 3CLTC 4X8LA 1CNEA 2H9AA 3SYMA 1IY2A 3L8FA 4KDEA 1G3QA 1BMFA 3ROZA 5IHPA 5GONA 1IG3A 3W4JA 1OBCA 2I4MA 4YIHA 3CEAA 3EBLA 3KPVA 3N8GA 3W7AA 1H4QA 1GNQA 3EGDA 3ESZA 3GN1A 4HADA 3J81k 4OSPA 2A58A 2EXXA 3KJZA 4RFSA 3W8FA 2OB2A 5KYWA 3FY4A 2RGXA 3G8BA 1GEGA 4TWJA 3W05A 1LPMA 2PCJA 1EFPA 3MQ2A 1P5JA 3UHJA 1P75A 4F7DA 1B2LA 2X4LA 3UTDA 3T7AA 1ODTC 4CM9D 3EPLA 4XX0B 2UUOA 1Z4QA 1G7TA 1Z2OX 4YMHA 1JYEA 2V7WA 3DBHB 5JS6A 3CWCA 2WINI 3LTNC 4YUVA 2WRZA 3E03A 1JKJB 5K4AA 4I4CA 5CDHA 4ISBA 5H80A 2XYRA 2J0UB 2ZRIA 4AWXA 3W5HA 4OKIA 4LVCA 2WJ4A 3FG9A 4ALKA 1PT7A 4CEHB 4Q05A 4YB8A 2FG6C 2VJMA 3CNNA 4M0MA 4U4AA 4D9CA 4NFSA 1PBTA 4QPDA 3AR7A 1HQKA 3HVUA 3GCZA 1U65A 1OX4B 3LRXA 3REQB 3N3BC 1M6HA 2IYAA 3O8QA 3EODA 1ZOSA 4WW0A 3H65A 2WYHA 1AIPA 1ZRMA 1V7ZA 1WOMA 2J31A 3JY6A 2OAP1 3KSUA 4UNSA 1KMHA 3SYTA 2GILA 1Z2DA 2UVQA 4BFZA 5MDHA 1TPZA 2WIKA 1TUBA 5IKOA 2OQVA 4I5FA 4AP6A 4YJ3B 4QUIA 1V6AA 4YUWA 1JSXA 3L7KA 2JIZA 1CY1A 1M1YE 5HFJA 4B71A 5K6AC 4FS8A 3EGIA 3IOCA 4BNXA 5BOSA 4ZHSA 2ABWA 4KBGA 3T3NA 1E59A 2WY2D 3VR6D 3EWIA 5KOHB 3K09C 2UXCB 3B2EA 2QTGA 4WFQA 4YBRA 3TLYA 1QWOA 3AJEA 4A6DA 1GPMA 1XELA 3EDMA 1I1NA 2ACWA 4IV0A 5E7IA 4BHTA 1M8PA 1DVRA 4PXSA 2YVQA 3VSBA 1U1DA 4KWTA 2QZSA 5FYDA 3R7SA 2OV1A 1XNJA 2P4EA 5AVUA 2NO9A 2V4ZA 1O58A 2PV7A 3ECAA 1Y42X 3JALA 4OA8A 3F74A 1FFHA 2XKBA 4TL7A 1FMTA 1VJRA 3KD2A 1R4ZA 3A6DA 3L6BA 3QK7A 3DZKA 4FD2A 4LRSB 4ZQFA 1SBZA 2FQWA 3CJQA 1GRNA 1P39A 3GXBA 3AK4A 1SHUX 3PUWA 4G56A 4J43A 3ZHCA 5B7GA 4TV9A 5LA6B 3ZI0A 4Y8VA 4HDAA 5ALVA 4PTYA 3VOTA 4IVNA 5F4ZA 4MCAA 1RCTE 2VAPA 1IVSA 1FNBA 3M3PA 2GCPA 2IS6A 4ANFA 3DP9A 2YICA 3PFCA 5J9FA 2X6QA 1N36B 4Q3KA 4IOLA 3DFUA 3RWMB 3UAZA 2FRDC 5IYZF 5IBRA 3A9CA 3HY4A 2FPRA 4MI6A 4E1BA 3A4YA 1CJMA 1U81A 1C3JA 5E1DA 3VYTB 2MSWA 2O1XA 2NZWA 3BBLA 1F2TB 3PD1A 1KFKB 5IDVA 3ESRA 3D3WA 3HCWA 3GEBA 2B5OA 3DKIA 3OTGA 3BS4A 4DT1A 3E3OA 2YCLA 1CFJA 3L0DA 3J81A 4JBHA 4M9ZA 2F1KA 1ZGBA 2QXYA 2IPLA 1Z36A 1HDGO 3WGNA 5C8YF 2ZCVA 5CG2A 2DZDA 5GINE 4ZYLA 2BKAA 3IEKA 4Y30A 3U16A 3N1UA 1JDPA 1SUCA 2ATCA 3OZWA 5TV2A 4Q3AA 3LIPA 3FDFA 3VAZA 1KEWA 1WTCA 2F8LA 4B8ZA 4BNFA 4JB3A 5KTPA 5T7BA 2QVZX 2JLAA 4MK4A 1SBNE 4BGVA 1SWWA 1W5AA 4UU0A 3EZXA 3DTVD 3EULA 1T9DA 4IKOA 1IULA 1IATA 2PMWB 2J9XB 3ZQ6A 3P4XA 3BDVA 3CR3C 1O9GA 2WSYB 1MOQA 3AEXA 3H3FA 5CRIA 2QRMA 4AJ2A 1B2RA 4XKJA 1HT2E 4DJ5X 4P4NA 2HHAA 3V4OA 1SZJG 3DCJA 4CMEC 2HBQA 5D6NA 2VWPA 3QFHA 2FOIA 2YZNA 3RHTA 4X20A 2WKRA 5DGIA 3CH7A 4TXNA 1XEWX 1XJQA 1XYVA 4GM4A 4IJQA 3DE6X 4INOA 4X5OA 5CW2A 1XDSA 4B76A 1WXDA 4EBBA 1EVQA 4KNYA 4ND8B 4K81B 2O7SA 1TZKA 1OX6A 2Y0CA 5J4LA 4DDTA 4BO3A 2IK8A 1JVSA 4QXPA 3VMMA 1QWSA 1JLSA 3Q85A 4P3NA 5D5HA 4FN4A 3ETHA 1TT5B 2LD4A 4JOSA 3AF6A 2C57A 1VGQA 3OQJA 4JBLA 1YFKA 2AFIA 4LDAA 1YU6A 4GEGA 1CYEA 2P1ZA 1XEXB 5ICGA 3V7YA 1GKKA 3H9CA 4CU5A 2PMBA 1UBMS 1T3TA 2Y1WA 1CC1S 4E4TA 5C1BA 3O4RA 1DIAA 1L5WA 3G8CA 1SVWA 1VA5A 2FH5B 2ODBA 2ZJ2A 3CUYA 2B5WA 1MABB 4R51A 2EVWX 3LSTA 1VHDA 3WWYA 3S40A 2IKSA 4ENSA 4J94A 4CM5A 4ONEA 4INJA 1X8KA 1CPYA 1XNGA 4XCQA 1PFYA 2J3JA 3V8NA 4ZZ0A 3DZBA 5DM70 1HXHA 2FK7A 1Q0ZA 3MCVA 2EGGA 3TW8B 4E2YA 4D5GA 2IYTA 2HUNA 3ZH9B 4CLRB 1H23A 1VBFA 5JWRA 2VQDA 3AX6A 4D1YA 5T4BA 3NO4A 5G2OA 5BN3B 4QQFA 4PZAA 2R96A 5AI8A 4TTAA 5AW8A 1Q2XA 5L6LB 3MTIA 4AKIA 2V8OA 5JDIC 3L40A 3IAXA 1CR0A 4NXMB 1C4XA 3NRJA 5A3RA 1PJAA 3A7DA 2GRUA 4PYLA 5FWAA 5JNRA 1V7QA 2YIDA 3PD0A 1SC1A 3L06A 4EY5A 2AR7A 2O8EA 4XD2A 1F7UA 1YBMA 5C2JB 1IPFA 1J06A 5DHUA 2B1GA 5B3LA 5AVJA 4BVFA 2CLFB 2NIPA 2Z30A 2P9ZA 3K72B 3HXLA 2QIOA 4HQKA 4DDHA 1PEDA 1MBZA 3NWJA 3ND7A 3OA0A 3FRHA 1T5SA 3NB0A 4MVJI 4UUMA 2ZE6A 3IAM6 5ERGB 5HJ5A 5I4BA 1KY5A 2HA0A 1U3TA 1KMNA 5THKA 4C1NA 3U3DA 1SXJB 4YAWA 4MJ3A 9ABPA 3DVSX 4EJSC 3MTJA 3AF2A 2O1EA 3DWFA 3NKVA 4H7DA 4J0QA 2Q3HA 3RTEA 1VLZA 1MTZA 3AHCA 1YHZA 2HPZA 3CLRD 3G85A 1B7GO 1GP2A 2CNDA 3G2HA 3KWFA 3BK1A 1K92A 2F7SA 1WW8A 3IVXA 5B12A 5I45A 5HFNA 3R9XB 1NNSA 4YRNA 1AS3A 3FE2A 1TYDE 1HDEA 1C8VB 3DEAA 2VA8A 2DP4E 4GLOA 1CIJA 4L5BA 5ALWA 4MR8B 3AW9A 5KMGA 1RHUA 4DF3A 3L4KA 1KYTA 3VKVA 4JQYA 4QTTB 3ON5A 2PS9A 4WJLA 2EHJA 2VDRB 4TTIA 1TI7A 3T3HA 5EJ2A 3TH5A 2NO4A 5DCWA 5FUMA 1UBJS 3S8YA 3KQNA 3G2MA 3QENA 1XRNA 3EMKA 1STOA 1KWGA 2QEQA 1LRJA 2ZSEA 3M6IA 3TG2A 3IESA 4PHHA 2RGNC 1A4RA 1I7DA 4M8NE 1PF7E 4H6XA 1VYHA 1E9VA 3GB9A 3QYJA 4CCYA 3UW3A 2HRCA 2LUOA 2OY0A 3E8SA 4QL3A 4Z99A 2Y4OA 1TA0A 1SQGA 1ISPA 4MGYR 4TGLA 3URKA 4HH4A 2QD5A 1UFRA 1MRZA 3DBLA 1CZOA 3ZDQA 1OTYA 2ZVJA 4R1OA 1MORA 1UDWA 2IA5A 1NONA 4TMYA 4Z4HA 1KH1A 4H0FA 2IT1A 1QV7A 1BHSA 5FBQB 4QULA 1CU1A 3VR3A 2QJOA 4HNUA 4YDHB 3TYXA 4U39A 4Y2SA 3QX7A 2Y1DA 3Q3GE 3TIIA 2NV2B 4AJJA 2WBLC 4DCOA 2R00C 2TYSB 4ZVMA 2XSZD 5KX5B 2TRSB 1QIGA 4QOIA 4E94A 2AMYA 4EMUA 1Z28A 2IBMA 1T9KA 1TEXA 2PZBA 2BE7A 2D1TA 2VDNB 1VECA 5DJ5A 2FWRA 4BX2A 4XD7A 3DQQA 4UKDA 1ZSYA 2ADOA 2XDWA 2ZE8A 3A0UA 4HZUB 3LWNA 3DZIA 1CULC 1JQEA 3P0HA 1YK1A 5DWVA 3T3OA 3P2EA 8ABPA 1AV7A 3HLTA 5EPOA 1ULZA 4KB5A 2ZTMA 2QTMA 4B8WA 1T3LA 1LVHA 2IZ7A 2CFOA 5HQTA 3WLIA 2JG3A 1NFRA 4HQRA 5G0WA 5TLSA 4ZOEA 4NKRA 3WDLA 3E9NA 2NVBA 3L6CA 2AXEA 3RYCB 2ADMA 2WWXA 1BDMA 1YZNA 3KLPX 1V3TA 4RV4A 5F52A 2A5YB 3K4PA 1Z6YA 1V9SA 4ZAZA 1ZK3A 4O4LF 2C5FA 4X9XA 1RHKA 3CLSC 4EJMA 5K8LA 4WZBB 4HS4A 1B1AA 3QEJA 3CRZA 5CVJA 4YXWD 3RFCA 4Y2YA 1U4SA 4L8LA 4I5GA 1ZESA 2GD2A 2Q2QA 1GT6A 2ZWIA 1LLUA 3U60B 4E6PA 3AJ8A 5DGCA 5HZKA 4G4GA 3PUHA 3A1NA 4NDAA 3U0VA 2QM8A 2VT6A 1G1MA 5AI4A 2GPSA 3K0AB 3D6NB 3IS3A 4MW5A 5TJ9A 3W8NA 4N7MA 3ZYZA 5LQMA 1GTVA 2VPPA 4FE4A 4Q37A 5E6RB 4ZI2A 1H9AA 4XCXA 2NUTB 3K15A 4JC8A 1NVKA 2VPYA 3GN2A 2EBUA 4P93A 4UATA 3ZQUA 2GRJA 4Q3LA 4N76A 4LMRA 1UODA 4KYVA 1M2FA 3A6ZA 4IUCS 5J47A 1X9IA 5KPDA 1EQ2A 3L49A 1EJ6A 1OPRA 1XZEA 3I2JA 2VJDA 3E7FA 2A1UA 3IXQA 1RHRA 4LW8A 3SSOA 4KH0A 3IUSA 4JOBA 1BMDA 4KSYA 2JGAA 4OM7A 2V7TA 8ADHA 2BJWA 3MLBA 3KQLA 1T4DA 3TFWA 2ZYDA 1L7EA 3UKJA 1QRDA 1N57A 1OGIA 3K6JA 4PQFA 5FI0B 1L3BA 1NI4B 4QIHA 5EUBA 4ZOQI 4NK5A 1X2EA 2ZRGA 1E2QA 4UHDA 3G17A 1PL0A 4L76A 1G66A 2QORA 2NXEA 3VO8A 3GLSA 4JX8A 1M8FA 4JQCA 4CN9A 1R0KA 1PGJA 2HWUA 1G8SA 1UBSB 3AV0B 4KMMA 4XWAA 4F11A 2RI0A 3UT5A 4UNPA 1RKBA 4US1R 3P2YA 1E2GA 1WQ4A 2FPLA 1YDWA 3C24A 5CFRA 1EX1A 1KQ3A 1Q91A 1NVXQ 1KK2A 1TQ8A 2D3WA 2XVMA 2AHRA 1L4BA 2ZANA 3B12A 4KBYA 4KSCA 5B2ZA 5TVGA 3TIGA 4Z7JA 2D8AA 4OATA 2IS1A 2ZRQA 2YVUA 1V41E 3IVMA 1ZW6A 1M0TA 1D4FA 3E5MA 1SVOA 4AI6A 2QD4A 1BXGA 3SBOA 2D2IA 4D9NA 2V9CA 4HDOB 5FUWA 1L4GA 3G88A 4XFJA 5F4BA 1N3IA 4YRPA 3OD5A 1SZCA 1QO0A 3MCZA 4YPVA 3W06A 1ONOA 2HFKA 3ZWBA 4F9TA 3R0XA 4AYTA 1GR1A 3II6X 2XJ4A 5AXDA 3GQBA 3GNSA 3QBVA 1GKIA 2FSUA 3VDMA 1TX4B 4I1SA 1EXMA 4Q12A 1VP9A 2ZYRA 3O38A 1WSBA 4UARA 1W36B 1R15A 4RZIA 1JBQA 1ZNZA 2QD3A 4ODIA 2HJ9A 2C9YA 1U2SA 1PR3A 1EWVA 2PT6A 3LPNA 3PRKE 4G5SA 2HLDA 1UBRS 2WM2A 4MQ5A 2QZPA 5EZYB 4XFDA 3PCRB 4FOTA 2YWJA 4J9VA 2WSLA 4UJ3A 2BEWB 4GKVA 5E9JA 2PJRA 2A4KA 4NICA 1K3UB 1IJEA 2JI7A 3EJWA 1SBQA 1YASA 2CCGA 2KJQA 4L9RA 1P7WA 2BFDA 1EDOA 2O57A 4D4LA 3CRNA 3EVCA 1SELA 4HC4A 2I3ZA 3G2NA 1W93A 4V0SA 5B4TA 2ES4A 1P9NA 3LW7A 3ZKAA 1NM5C 1XZIA 1T1RA 3P0IA 4M8LA 4MVJD 5AHWA 1SCQA 3PQ7A 1J39A 1UEJA 2JC3A 3VU9A 1IZZA 1GDDA 5AM4A 1DFGA 2JA2A 2X8JB 3VYUB 1OH7A 2I2XB 3I52A 1YBVA 2ODNA 4QGHA 4U7GA 4D25A 1KOFA 3UQYS 2XOKD 4R8SA 1U28C 3FCSB 4DWJA 4UTOA 1RPAA 2GEDA 1ULSA 4B2PA 3BB4A 2L18A 3E22B 2CXRA 2VF8A 1PDWA 1P72A 1LRLA 2W90A 3AM3A 4JU8A 4TLLB 3ZQJA 4M1ZA 2G3YA 3DF9A 3G5AA 3IKVA 3MWJA 4ZYXA 3VZDA 3NBFA 2YHBA 3W1EA 4G8JA 3UQZA 2XBLA 3MJCA 4LPSA 1PV1A 3RROA 3NETA 4B7XA 3G6WA 2IVFA 1TJYA 3FETA 4JNKA 5ECWA 5DTEA 5AFSA 2D6FA 1EVKA 2A57A 4RUKA 3M7IA 4FFVA 4YJ3F 4D9GA 2OXEA 4QHTA 1LDYA 3IJPA 2NU8B 5K3BA 5IAJA 4WD3A 5A0FA 4AFNA 3GLIE 2KI5A 1TADA 4JU9A 5CB6A 2PKEA 3ZY4A 4N47A 3WYAA 4XB6B 1ABEA 4KXQA 1CQJA 2NYVA 1DV1A 3HZZA 5TT0A 2UUAB 4QQ8A 1E61A 3HXPA 2B8WA 5ALDA 3W2TA 1H4SA 2H92A 2NU9A 3IIEA 1E2IA 4BXOA 1WUKS 3MYRA 2OZPA 5DHAA 4RTLA 2WWYA 5CK4A 1BVHA 3OO0A 3FMOB 2OVBA 3O82A 1YUBA 3R0VA 5H83A 4QPZA 1KVTA 1V8FA 5ULLA 1JZQA 3TIFA 4AX8A 1YZYA 4XPIA 5FPKA 4X3OA 3RFUA 5MGNA 2X1LA 1ZYUA 3B2NA 2W70A 3QXXA 4MUGA 5LA6F 2FI1A 3KB8A 5DULA 1Q0PA 5I9LA 4ILKA 1P5RA 2Z4SA 1H2RS 2ZRNA 2XR1A 4RFSB 3U4AA 3L4BC 3D4IA 3HEAA 4FFBA 2EYQA 2ZJ5A 2PH3A 4LXYA 3NT4A 1T9ZA 1RPNA 3GYGA 2AJ8A 3GMDA 3ZHSA 5K8IA 4FKMA 3HO1A 3KKPA 1HSZA 4J4BA 4LE0A 4O3FA 4NAUA 4DHWA 4LBZA 1TCUA 2HO4A 2V7BA 4DNPA 4LJSA 1DAKA 2OHJA 1M7GA 2PV0A 3WHKA 4BE4A 3UGJA 1GAEO 1Q44A 2HF2A 5GGYA 2C5EA 4P98A 3EVTA 3GFRA 2CD7A 4Y2RA 4BZWA 3PNMA 3PJFA 3E9CA 4HGNA 4J2TA 3RS9A 5JZMA 4BVBA 4C0LA 4EI7A 1V9LA 4LGCA 3FZEA 4BX0A 4CW7A 5F73A 3HHEA 2E1PA 1XDWA 2DBYA 2PJZA 4IFIA 5B58T 4BQQA 4RCZA 1TZCA 1P4AA 4WFIA 5EIEA 1UKBA 4QQNA 3DL7A 4DCTA 4HJRA 3OEHD 5ISMA 1I6KA 4C3OB 4OHOA 3TR5A 1IRIA 4E5KA 1GN8A 1MRSA 2JEZA 3MJDA 1I0ZA 4MQLA 3DMTC 2QDKA 3OEEA 1ZQ1A 3BCRA 1O87A 2EFYA 2IYYA 3FWKA 2FQQA 3FHCB 3RQIA 1KMHB 2O07A 3M4ZA 4RK4A 5D51S 2XUQA 3RKSA 3TWOA 1SURA 1TUBB 1I80A 4G1UC 1FP4B 4L4ZA 4OK3A 3EA0A 3SZMA 1EJ0A 2YV1A 5BW5A 2PZGA 2W6ZA 3M4YA 5DCYA 1M75A 3C7KA 4HNRA 2GOYA 4LRUA 4PGMA 2AE1A 1PU2A 1UBEA 1W5SA 2OBLA 3EOAI 4GICA 1HV8A 2CWDA 5FWYB 5TGTA 2XH8A 3JD1A 1GAWA 3RUAA 1F0KA 1VP3A 1RT9A 5ALFA 3SJBA 1XN1A 1X39A 3VJKA 2BT4A 1JE1A 2AVNA 3NHLA 3QU4A 4OU5A 3DAYA 2W2OA 1YSCA 2H31A 5CNKA 3R9WA 3CONA 5J4HA 2R1TA 3L8GA 4GO1A 2Y99A 1QG6A 3F73A 4O2LA 2O8FB 3KUDA 2NVUB 4BQOA 1VLQA 5CDTA 4HBGA 4IZ6A 5KSOA 4KEAA 4YRAA 4MLZA 3P52A 4NBUA 5BWNA 5AI5A 4QG7A 3UJ9A 5LP6F 4NQRA 2WM3A 4JFAA 2OBFA 2IQ5A 2HHLA 1LV7A 4TV9B 1ZH6A 4P4SA 1HE4A 2ERYA 4CR6A 3EY9A 3OP4A 4LG1A 3HKCA 4V1CB 3SS8A 3WHIA 4EEKA 4JJEA 1WBBA 2ESRA 1WHTB 3IODA 3BFXA 3QRWA 3T34A 1S2GA 1W581 3EQ8A 3BSWA 3OHPA 4JLVA 1INLA 4Q47A 1G19A 3KFLA 4CKBB 3EXG2 1A96A 2C7PA 3KZOA 3W0LB 3PTAA 2PUBA 5DEIA 2WSSD 4FONA 3TPFA 1JECA 1NLFA 4M9RA 1HDXA 3AP1A 1PS8A 1SG0A 1U7PA 1DAIA 1E0DA 3T7IA 2WF6A 3SZLA 3GLFE 1J8MF 2FETA 2QMYA 1A8PA 3D3WB 1YUMA 3GY0A 1I13A 2XE4A 2ORED 1B16A 4DT1B 5C4MA 2ZTVA 1U6KA 4M86A 2UYGA 2ZUUA 4ZXFA 3SIPA 1M2GA 5L7TA 1RE1A 2Y0EA 4MUFA 4JP2A 4D6PA 1T3HA 4FLEA 2VP0A 1G9TA 3HCRA 5F9HA 3TZCA 2GPNA 3JRNA 2ZAMA 1NN1A 5EIBC 3K9CA 3H1BA 3VO2A 2VLBA 3F1LA 2ZVQX 3Q7QA 5E38A 3T5GA 3ZIAD 4AB1A 4CM3A 2QHXA 4DMRA 1NGSA 4F96A 5LPNA 4QYWA 4YDRA 1L4YA 2P9EA 3ZEAA 2R47A 3ER6A 5LMNB 4IHKA 3NHZA 1NN3A 1O95C 3PNLA 1ZVKA 2Z4TA 4GOKA 3V4SA 2VS1A 1J23A 4BLRA 1CR4A 3EZGA 1ISSA 1D1SA 3KR2A 1YB6A 4F56A 4L7VA 4M9XA 3IE1A 2HWKA 3P0EA 2GKGA 3QY9A 2ZPTX 1X0VA 2YQ5A 3S1SA 1DKQA 2C9OA 4LY9A 2WMOB 4KK4A 3KPYA 3LFUA 1FTNA 2W6NA 3CX3A 2V9PA 1LQTA 4W5QA 1XE3A 3DFIA 4G5YA 4IDOA 4LOAA 2JFUA 4BC1A 4C2UA 2GARA 2X22A 4CMAA 3N2GB 4X20B 2XTJA 1JE0A 3AJAA 3LVRE 5TEWA 2PX2A 3ZCUA 5K0GA 2JCBA 5B6IA 4N48A 3ER8A 1AS0A 4DSAA 2JF0A 3OZDA 4J1SA 4C0XA 1B8UA 1GPUA 3AOEA 3OTHA 2ANBA 1TDJA 5KUTA 2YIVX 2OHIA 3ROQA 3WV5A 4IIEA 5JXIA 4A15A 2ZUVA 4HDQB 3R8CA 4Q9HA 1Y8CA 1XWFA 4D7AA 3DLHA 2KMLA 1XD8A 1JFLA 4M9SA 4BU0A 4DDUA 4ZJPA 2G9QA 1J42A 2P2LA 1G6KA 3W6PA 3FKJA 3KALA 3E2IA 2H5LA 2Q21A 4N0QA 4YAEA 3F6RA 4C7MA 4G2TA 3S2UA 4F97A 5I5EA 3LG2A 3SCZA 5JMWA 3JYHA 4OX9Y 1BDJA 3UMMA 4PS1A 3C98A 1XDZA 5KO2A 4WNYA 3IHKA 3ZE7A 3SQXA 4PWZA 1K4MA 1T9BA 4GEKA 3OKAA 3MWFA 2XMZA 2FG5A 4XARA 5AW1A 3GFBA 1WXFA 3E9EA 2VJAA 5EQJB 1V1RB 2H4XA 4C0HA 1NRIA 1USUA 2IYRA 3WTBA 1C0EA 3SFZA 3FMFA 1DRUA 2QRLA 1L7RA 3K6KA 5BYJA 4A27A 4YT2A 1DRJA 2XDAA 3EXG1 3MGCA 3R3HA 4ZPJA 4P0QB 4J0JA 2CHFA 4ER3A 2OG2A 5KX5F 3O8CA 1QHEA 3NP7A 3Q9SA 4J2HA 4IHAA 1SD2A 1NQVA 3EVBA 1XRLA 4QFDA 4DLLA 3K1JA 2O8EB 5DTMA 4MYRA 3CURA 1LSJA 4UFOA 4C7BA 2HDOA 1JSCA 2G9VA 2RG1A 4ND5A 4Y2PA 2WJIA 3U2QA 2W11A 3ZGZA 1XUOA 4LF4B 4W7HA 2GLTA 4H1TA 3WL6A 2C92A 3TNFA 4BMXA 1IY9A 1O5TA 2HRBA 4PC1A 4KAXA 3WL8A 4GI5A 5JZVA 1Z56C 1XMXA 3ZDFA 4W5NA 2WJHA 3W2HA 3ZZMA 3TKLA 3VI4B 3JYQA 3GJ4A 2F1HA 3KZMA 3PNQA 1E9RA 3C6YA 1O94A 1Y6FA 4D9KA 2JFQA 4WEQA 1TT7A 5J1TB 4D4JA 3N5CA 1UQRA 3ZV4A 3FTCA 1VYTA 4D8WA 2YINC 3O92A 3U5ZB 1BCRB 2C2HA 2HV9A 3LGSA 4BX8A 4MUIA 2BGJA 2ZEJA 3FTPA 4RENA 5IRCD 1EUYA 2JGDA 3AR6A 5BSUA 3IDFA 5ALEA 3PC3A 3P2KA 5FADA 2BFFA 3TTSA 1WMFA 4MKGA 1I8TA 3WVNA 3TXYA 1IQUA 1ONBA 2UKDA 1HRKA 1Q1AA 2EQBA 2OBNA 4KQFA 5JPCA 2Y1KA 1TOAA 3KEQA 1JAZA 3IEUA 3HBLA 1VIMA 2QR2A 2WJAA 4OHCA 5FOQA 4HTFA 5EG5A 2HADA 1VE1A 2ILVA 1TK9A 2FN3A 2M98A 2R48A 3VU1A 4DNXA 3QXSA 1UMDA 2V4MA 2VCYA 1Y48E 1ZD1A 1KETA 5GPBA 1GDHA 2J7PD 1VBMA 2HK8A 3B3GA 3N59A 4QFBA 5LLSA 1XROA 3LP6A 4YRGA 1AA6A 4WECA 2WA2A 5SYMA 5IMSA 4UEJA 5IW8A 1UDBA 1KGDA 4HK4A 4OXIA 4Q4AA 3TD2A 1PD1A 4OTZA 3PC2A 3FPBA 3TZ6A 2GR9A 2Z6VA 4E3WA 4KE7A 2Q9AA 4GZLA 4I8XA 1WWKA 2QZ4A 4HWOA 5DTIA 5LIRA 2XCSB 4NIMA 4PSCA 2ZUTA 1VDZA 2H5EA 5KYXA 3ZVKA 1LF5A 2ZSBA 1A5ZA 3CT6A 1BHQ1 2D3TA 3DOCA 1W5TA 4I9UA 1R0RE 3RE1A 4D3ZA 3U31A 5JAUA 8LDHA 3VH4A 4AL4A 1H1TA 3G7SA 4GIBA 4HO1X 3PHGA 4ZJZA 4LNUB 4PVDA 1PR6A 1LNQA 1RS0A 1QBGA 3CM0A 2QL5A 1NXSA 5FLXA 3OESA 4OI0A 3T5AA 3LXRA 4N7RA 3KTFA 3K9FC 1GAXA 3MZ0A 5FUXA 4TQ9A 2QYHA 4HWKA 1GGVA 5AICA 4EL5A 2P5UA 4HAIA 5H3CA 2JH9A 3U4CA 5HNKA 4OG2A 2ZYWX 4LV5B 4DMGA 1PS9A 5B1IA 3VBEA 1Q7EA 2CJXA 5A9SA 4V0RA 2D2XA 3PF8A 1NE7A 1U2DC 4PINA 4GVXA 1PL8A 3UF0A 2YKGA 1V3QE 4BVAA 1D7AA 3GCDA 2O05A 5C3MA 1BMQA 4GOND 4MWTA 3TK1A 1GJRA 3WRXA 1NLUA 2YBDA 4TLMB 2OZEA 2J5XA 2YTZA 1NRJB 1TFUA 1M2EA 3KZNA 1KOJA 4MQEA 2XGSA 2BGLA 2II6A 3CPEA 3JYOA 1X2BA 4UHFA 3AEYA 5JAZA 4GXQA 3DD5A 4TZKA 3E05A 2Y93A 1CUHA 1SVKA 1U1FA 2I34A 2P5YA 5TR9A 3UAVA 1HI9A 4YRSA 1YQEA 3FFAA 3QU7A 1BKDR 2ZJFA 4OJQA 2A5DA 3HB4X 2GEKA 3QLUA 4DJJA 3GUUA 4MW6A 2FPIB 1I7PA 4GH5A 5TS2A 3PJGA 3H2ZA 4HMQA 1H2HA 2PGJA 4QDTA 2BMJA 1G0NA 5SV2A 1OFGA 1FZTA 2QAGA 2RBEA 3UPTA 2ZBUA 2PLNA 1X8XA 3H5NA 1RP1A 5EZYF 2J32A 4KQHA 3A9WA 2HT6A 1PNRA 3RIGA 3TM4A 4AQ7A 2CK3A 5IF9A 3EK2A 1CT9A 1J70A 4JEUA 4DLSA 1E2BA 2EKDA 4ZVTA 3TO5A 4D97A 1S5PA 4JK3A 2O0MA 1PQ4A 3WADA 1T9AA 2OGWA 3UBMA 2ZRCA 3A37A 3BWXA 4OB8A 2A59A 2H9IA 4JXJA 3Q88A 4UTPA 1MIHA 4MW0A 2B7CA 3HDHA 4G5QA 2BELA 4KITB 3QNUA 2A1UB 5ENZA 2J0SA 1OT3A 2GM3A 5F2EA 4BNTA 1CJVC 5DOZA 4R9NA 3PK0A 1AKRA 2ZUSA 1VLHA 4L6AA 3AFOA 3F6YA 4YEDA 4G9EA 1E92A 1SY7A 2VNJA 3PENA 3T6KA 4A3SA 4AECA 4CEIB 1N3BA 3F49S 3ZOKA 3B7PA 4I4NA 3HZRA 1CFZA 4FNMA 4FEYA 1ZW1A 4G41A 1E6CA 4NECA 4IEIA 1VKRA 4ZCTA 1DKMA 2R66A 4QAQA 5GV7A 1RADA 1DDGA 3BH7A 2VAWA 2CMGA 2ZYAA 1KMCA 1FXSA 1L4MA 4KE8A 3HBMA 2CUKA 2CFRA 4FK8A 3PNKA 3BXEA 1G8AA 4DR6B 2W22A 4JIGA 3UT5B 2VNSA 3R7LA 4FGLA 3FTDA 4MW7A 2DBRA 2PX6A 2ZZNA 721PA 4ZTUB 2XEXA 1IBKB 1EFCA 2NVOA 1V5WA 3D2AA 4KXMA 2B4RO 4L0DA 2BHTA 4LTMA 3TZKA 1HC7A 1Z22A 2NZJA 3DBRB 2JJMA 2XQIA 1YDHA 2D2EA 3QLVC 4WY8A 1SRRA 3BGWA 4G6ZA 1QCYA 2AW3A 2CLSA 1NNLA 2XD9A 4FYMA 3OQBA 5LZ7A 3A6HA 5CDFE 3EC2A 2OHOA 3BHJA 4IXWA 5LZ9A 2ZAYA 2XT9A 1GZ5A 2Q1XA 1V39A 4QSHA 3UHOA 4RTSA 2HM7A 4IQGA 4MYCA 3OFSA 3KXIA 4RCVA 3USES 3C6KA 1L8AA 3EF3A 2OO7A 3HUDA 5T41A 4QDXA 4BQNA 1RAEA 3WNVA 4BKQA 1XL0A 1TCBA 1Z6ZA 2WUFA 3OE4A 5M5BA 1QE3A 1IBSA 2VYCA 4CEJB 5JLJA 3M34A 3RYFB 1Y1TA 1KSJA 2AN9A 2FP4B 1CUGA 4XVUA 3V00A 5C5DA 2XXAA 2RARA 1JQKA 4TS9A 1W2HA 5CCEA 4Q7JB 2Q3EA 1RI1A 2WOOA 1IYZA 1PWYE 3KUUA 4Q9LA 2PUDA 2BFDB 4Z53A 1NNUA 3I2HA 2AX3A 2E49A 3BCSA 4HSEA 4GOOD 1U94A 4C14A 3VVMA 1YA8A 1JNYA 2VTVA 4GPBA 1KRHA 1EBUA 4BFLA 4AD8A 4ZCLA 4RESA 3SHVA 3GLVA 3MMSA 2JBWA 2IHBA 4U2EA 1XMVA 2VSYA 1JI0A 5AJVB 5JAQA 3RVNA 2H2IA 2PA3A 2Q5FA 1RDFA 3AFIA 3O90A 3PXEA 1BH6A 1O77A 4UE2A 1Y4SA 4OAQA 5AIBA 3NFRA 1UOEA 3OPYI 4Q1VA 2YNMD 2YWBA 1MJGA 2ALJA 3TX2A 4L2IA 5JHGB 3PS9A 3JQAA 4DWOA 2IUFA 4F4HA 1MMFB 3LE8A 1A97A 2BR3A 4CM6A 1JPNA 2AZXA 3WFIA 1QHFA 5FTKA 1OBFO 2JFHA 4PIMA 4CKYA 5A3JA 3MC1A 1UF9A 2VZEA 4MPTA 2Q4DA 3OIVA 1VG9B 5BXYA 4UOQA 4ZEXA 3VKFA 1AB6A 3VR5A 4DPMA 4I81A 1TO6A 2DH6A 3ET5A 2A2ZA 3ZCTA 4PC3A 4A26A 2NW6A 4OPMA 4DRYA 3PNYA 5F77A 1RLUA 2QTAA 2OGUA 3WZLA 1NZDA 2XBUA 4Q6BA 1X0XA 3DO6A 5IFLA 1Q7TA 4LK3A 4TRJA 3AJDA 3E1KA 3DT8A 3JQBA 4J49A 4KTTE 4Q4CA 2GN9A 4H0CA 1VXOA 2NU9B 4BXOB 1Z73A 4O02B 4K40A 4BMPB 3ICOA 4C4AA 3NOVA 4MV7A 2PL9A 4C4XA 2OPHA 5JCJA 2Y92A 1THGA 4QBTA 4DR4B 3FCYA 1P8AA 5KQMA 3AM5A 3OFNA 4GT1A 4ZOCA 4Z4CA 3TE7A 4K6FA 2Q9CA 1T1EA 1E2EA 4XPIB 4NPAA 3KCQA 3ESAA 5E6SB 3DPUA 3U40A 4X41A 1I4DD 2EX1A 3IQDB 4TV9F 1WKCA 3EFHA 4UM5A 3AYZB 2DUWA 3HN2A 4WHMA 1DX6A 5D2CA 3CVWA 1YMUA 3PEEA 4BBJA 3NBYC 4BNWA 5FA5A 4FFBB 3U0BA 3E2MA 3TFOA 2NSHA 2WWWA 3A4NA 2FGKA 4EHFA 5AK3A 5FOXA 1L5LA 1TQ2A 1NJ8A 2FE4A 1PSZA 1U7WA 3LD9A 3LY5A 3IR6A 4BO6A 1Q5PA 4F8YA 5IM5A 2IZ5A 2RAVA 1KR5A 3JXEA 4Q24A 3UAOA 4D46A 1VLLA 5F12A 1KC3A 5F1OA 1I0LA 2E21A 3OLZA 4BFVA 5F98A 2BHRA 4D9EA 4B4DA 1YC2A 4IZOA 2XCTB 3I1JA 3LW8A 3BWMA 3OCWA 4TN1A 1V5IA 4UU7A 4ZT4A 1P4HA 2OC4A 3WZ2A 2HSZA 3ETGA 4QTXA 4D0GA 2HMVA 4HXEB 4EHBA 3PUJA 1ZK0A 3QSYA 1EE1A 2IS4A 5HOEA 1QP4A 4O1HA 5ALZA 2B78A 3L9XA 1WUHS 5KTNA 1N7IA 2AQ8A 1B42A 3VPBA 1QTIA 2DQYA 3MG9A 4D9JA 1Z6TA 4JELA 1OA1A 5DHQA 2Q5OA 2RH9B 3M49A 4EB6A 1DC4A 4GP9A 5ESDA 5IX8A 1OLSA 2JJ2D 5I7EA 2JIDA 1I24A 1ND6A 3TLCA 3KJGA 2HO5A 3PC8C 4NESA 1RZVA 3LQQA 4K9PA 4KSBA 3BIOA 2K7ZA 1CLEA 9ATCA 1RFGE 4PF1A 1E3WB 1M2WA 4K03A 3FRJA 1WP9A 3MS2A 2EIXA 2FF5A 521PA 4MUJA 4K46A 1ZUD1 5FT9A 4C03A 4BEBA 3CVUA 5JAMA 3MGBA 3NM6B 3GNTA 1DO0A 1T8UA 2ZREA 4PPQA 3VHLB 1VZ3A 2Z0MA 2B25A 4HKTA 2OV6A 1K5GA 4ZV9A 1O6CA 1W5FA 4Q66C 3LDFA 5BVHA 4G0OA 2PBLA 1N0VC 4YMIA 1J9ZA 1NN0A 5CX4A 2R1TB 2FN4A 3WK7A 4GNKA 5A9TA 1J1UA 3H87A 1HETA 4DJEC 1QGZA 1ZIOA 2JHFA 5CLLA 1ZJWA 1ZINA 3IAS1 4Z4EA 1FW6A 3Q3JB 4WN9B 1YCGA 1DGQA 3ITNA 2Q2OA 4E6EA 1BO6A 2R6CA 3E3AA 2P9JA 3HCCA 1Q16A 1U1GA 2OBMA 2OHGA 4M88A 4TSKA 4CG1A 2VXYA 1GGHA 5ICEA 2ZPAA 5EZ6B 4IRMA 1AJEA 2O4UX 2H85A 1XRSB 1K06A 3OTOB 3CF0A 4KO2S 4U8GA 5EE0A 3SHFA 2RHMA 2JATA 3WQBA 3D43A 3FKSA 2BUBA 3GDOA 1U0HC 3E70C 3LCCA 3FNGA 4IIFA 2NV6A 1MVOA 5DW0A 1E3TA 1SPBS 4KMOA 3L7AA 5IT0A 4GMXA 1KYVA 1RNLA 3MD0A 4GC9A 4BNHA 4Y0VA 4C21A 4OYYA 2EJVA 4IG4A 3FNHA 3KT3A 3LCUA 3R77A 4IDDA 2I78A 3U9TA 1I1OA 3OX1A 4DARA 5IXYA 1QF9A 3M6XA 1N8TA 5D6OA 5ALGA 4BJ6A 4TS3A 1KIAA 2MIIA 4PY2A 3G0BA 4R31A 5LD2C 5KYGA 4PZ9A 3GAFA 3FLMA 3UFXA 5BXQC 3EFBA 3JD3A 4CMKA 3CNEA 5ALQA 2YWDA 5FL7D 1RWNA 2X7JA 1XNHA 4H1VA 3FGNA 2OO3A 1C4KA 4JUFA 4A91A 1CUYA 2ZJ8A 4TLAA 5CNMA 1B74A 3OQNA 4KRFA 1YOVA 3CF4A 4TL9A 1A72A 2WF7A 1X7GA 4RD6A 5DNEA 1YBFA 3O2JA 3DTNA 2FW8A 2OAQ1 4QQRA 5HJ7A 2IU3A 1T5IA 1YIAA 3QJGA 3TZBA 4B17A 2C82A 2G67A 4QEDA 3A2KA 3DV9A 1T2FA 2G6TA 3VKHA 1AHPA 3L93A 4ZARA 4UAJA 3PQ3A 3REFA 3MMPA 5J63A 3R0ZA 2AF3C 2Z83A 1B41A 1FTQA 3WSWA 4L15A 4QD3A 3ZI4A 5TGDA 2P68A 1AOXA 3UV7A 3WB9A 2UZ0A 3A27A 1GNSA 1MFPA 3H5AA 5FYQA 1XD9A 3ESXA 3EVNA 3REQA 2V7VA 3ROMA 3SF8A 5LKRA 5JD5A 2X13A 4DEVA 1VKZA 1JDVA 3DDOA 2VDLB 5D86A 3ESDA 4RAOA 4MVCA 4P92A 1JLLA 2ZLBA 3RF6A 4MV5A 3WDSA 4DV4B 4C29A 4REMA 3ME5A 4CIWA 5FOUA 4N03A 2NO0A 4L74A 4P8RA 1P0IA 2ZJYA 4E21A 2AN3A 3K70B 3ZBTA 5ETJA 1BWQA 3IDSA 1M5TA 3QBJA 1RJGA 2MYNA 3P9ZA 1RTKA 1D4OA 1T91A 3ZJ5A 2CHVA 1N2CA 4DQKA 3WMXA 3NIDB 1BA3A 2CXXA 3BHNA 1U0BB 3U17A 1GY8A 5KWIA 3AESB 4DR1B 4WRRA 3HM2A 3LK6A 5I9NA 2NNLD 4EZIA 4X91A 1YF3A 4ZAFA 3U56A 3I04A 3AWDA 4AMVA 1QMGA 1Z34A 2IH5A 2WG2A 3G9TA 1MT3A 1OLOA 3R2JA 3GJ0A 3NORA 1JXQA 1VLMA 4WKOA 2PSHA 4M54A 3KWMA 1Q17A 5EZ5A 1IHYA 1M0EA 2SCUB 3AOGA 1YR6A 4BO4A 1T5OA 5JH7A 1RM0A 2VWGA 3B5EA 4KQ2A 3QVUA 1C9EA 4Z1MD 3KQMA 2D2VA 2DQSA 4OQZA 4NE7A 4R8RA 4BIMA 4B3IA 3O73A 5JY6A 1CD5A 1FTSA 1MO5A 1C8LA 4Q48A 4UD2A 3T1TA 8MHTA 3GK3A 3U3OA 4YCBA 4MR7A 3VNRA 5HQ3B 4R16A 3CF6R 2HXGA 1BQEA 2FR0A 2GCEA 1GGEA 3CFYA 4LVOA 4OSOA 4E09A 3K6SB 2IITA 4IMJB 1M2JA 2YFQA 3ZWQA 1FTYA 4GX2A 4URWR 4TZ0A 4DC0A 3LTEA 4BN4A 3H2YA 4RXUA 2JARA 2GXQA 4HRVA 1E2HA 1PJLA 2ZT7A 4MHSA 5ALNA 1RKVA 1Z74A 3DDNA 2ZROA 1XHEA 3CZQA 1P1FA 3B1KA 1Z5PA 2OHFA 1E2DA 3WIEA 3QKTA 3O93A 5ABPA 2Q0SA 4M1YA 4RTMA 1T5TA 2VEOA 3NTOA 1RLIA 4JP3A 3LP5A 2AWNA 3UATA 1PQWA 2Q5HA 4NS4A 3LSYA 4K28A 4Z6KA 4CF7A 3NVKI 4FFDA 2I8AA 2MSLA 3H5VA 4BLSA 1NQWA 4H7KA 1E5DA 2QRHA 3N75A 3OHSX 1YZ3A 1A7UA 1NA5A 2JGDB 5FULA 3RBXA 4P53A 1B0PA 2FR8A 4A6PA 1P4JA 2BFFB 4CR7A 3HGQA 3EBPA 3NEJA 1V1MA 4RTRA 1PJTA 3WWCA 3K0HA 4PRYA 1A5BB 2RAUA 4M1MA 3W90A 4LF9B 1XKXA 5JS1A 3L7MA 2EQAA 4HTFB 1I7QB 2AV6A 1P19A 1K75A 2AC4A 1AQ6A 3PR1A 4P4GA 5KNCA 1CUAA 1VKHA 2ZSAA 2NSDA 4QLOA 4YCAA 1UMDB 3G5UA 5FUYA 1HDOA 1QJ4A 2JGMA 4KQ1A 4PNZA 1C7QA 3AHIA 2NXCA 3EGXA 3AR9A 1QIDA 2GA8A 4JJ8A 1YD7A 4WUVA 3ZWOA 5ARCA 2UZIR 4AJNA 1NMQA 1E9EA 1YOBA 1I6MA 4Q4AB 5TC4A 5FF9A 3HA2A 1R66A 3CS3A 3FHOA 4Z4IA 2YR0A 2EKBA 2RGWA 1LPBB 1YQ9A 1HURA 3SD7A 3KAJA 5L3SB 3W5AA 2JBAA 1YKFA 3HJCA 2HA5A 1M33A 3LC7O 2Z8ZA 2HT1A 3UANA 4R8VA 4XDYA 4ALMA 2YJ4A 4B6QA 4UUNA 4WGFA 2ZI7A 4ZOLA 4X63A 4KPYA 3L9WA 3OICA 3TM5A 4GE3A 2PGLA 3ZDRA 3ZV7A 4I4TF 1QZZA 2QTRA 2XGJA 3PQCA 4LHVA 4CDGA 3VNSA 1H5UA 4FZVA 1TZJA 2EFEB 4K2AA 5HR5A 3E9MA 3H4IA 1LLFA 3RS5A 4UOZA 2DFDA 4KFUA 2CUNA 4HGZA 4H0NA 1L7DA 4Y67A 2VO1A 2L17A 2IS2A 2BOVA 2QX6A 2HBRA 4K9KA 3VVLA 4FWTA 1FUEA 2VJQA 4R6XA 4MVXA 3L0BA 4M0UA 2J09A 3GT3A 1L7OA 4IQ4A 3EW9A 3O7WA 2WFLB 3CWZA 4RE6A 5CYGA 1SR8A 4B5LA 1GUDA 4YYZA 7ABPA 1VJTA 4JVOA 3IP5A 1SNYA 3B53X 1WDTA 3CCCA 1L5RA 3A31A 2LIPA 3GFFA 3RRZA 3GPBA 5BR8B 3URMA 4MQEB 1JJFA 4DBLC 4F2WA 5AW4A 1ZRHA 3EPJA 2EJTA 1NY5A 3JQGA 2CXPA 3QFTA 4G0MA 4Q5IA 4DSTA 4F12A 3D8UA 4D9MA 2EZUA 3SK0A 3WIOA 5K09A 1MAWA 2PL5A 4C22A 3NTLA 4IWXA 1YMQA 3OT5A 1OB5A 4I14A 1G21B 1ODLA 5D8DA 1F9EA 5EYPA 4XEHA 3EQ6A 4N3CA 3IERA 2BCEA 4RANA 5EERA 5T8KC 1SKQA 4QDOA 4D9HA 3OAAA 2CHQA 2E9SA 3T5DA 3WL3A 5AM0A 4HAUA 3TLXA 5KQRA 3L1IA 5DIZA 2HYIC 3LLCA 4G5RA 3FJ1A 1QYIA 5C4IA 5IVPA 4AJOA 1S9HA 2L19A 2NUAA 3PNVA 3BTOA 3U4MA 2NZ8A 4P34A 4BNKA 1SCKA 2PXXA 2QM3A 4RJIA 2FSVC 4TMWA 3ABQB 4ZRNA 4E0BA 4DWVA 4F8JA 5DLYA 5JDCA 1Z8FA 1GZ6A 4ZALA 3Q5DA 1GKYA 4ZDWA 3NU1A 1LSUA 1YUNA 3FYUB 1V2GA 5BQFA 2XRZA 4DABA 2BKEA 4MAMA 3EEBA 3A2MA 1WIWA 1OKKA 3H9JA 3C7AA 3NJ4A 2X5XA 2Y77A 3BA1A 3K0CA 4N82A 4U0JA 5DBFA 3STWA 3T9EA 4BZZA 9MHTA 1PG0A 2E85A 2PWBA 2CNLA 4FCCA 3EH2A 3PR3A 4HY3A 1DKLA 4PX3A 1JVNA 4BO5A 1ZHHA 4KR3A 4HLQB 3JQ9C 3PDIA 1DI0A 3CYFA 5AOCA 1KPGA 1T1GA 2JAUA 2J6HA 3B1YA 1UZAA 2C29D 3ISJA 3W4IA 1EK2A 3DV0B 3AFMA 2DTXA 1X7WA 2OHXA 3LPDA 4H7JA 1J8YF 4DC9A 1H05A 4G4SP 3FWZA 2ETXA 3M4JA 1L5QA 2DKOA 2JIPA 3CEPB 3F8SA 2CMKA 1YZQA 3O74A 1XDDA 1YXMA 2B2CA 3FNEA 3OUTA 4JL5A 3L6EA 4II2A 1A4UA 2TMKA 3V4LA 3NV7A 1DO8A 3IB6A 3AF3A 3H8JA 4WADA 5D3ZA 2XWSA 2P3OA 2GBLA 1ZIXA 1WP4A 2RDMA 1JHAA 4MI1A 3GELA 1SVUA 3BTVA 4ZV4A 4ZVNA 3GAZA 1MC1A 5CA1B 3EW7A 1V95A 4PW0A 5U9CA 2YRWA 2ZIZA 1EP1B 1ZIPA 4G0YA 4QODA 3TQHA 1NT4A 4OVKA 2YVKA 5D85A 2EL7A 1ZN7A 4MKXA 5KREA 1JEYB 1U1EA 5AUNB 4RIHA 2C5BA 1SQ5A 2G1UA 4I1OA 4Q3BA 5KSZA 3S2IA 3ACDA 3EA5A 4EQ6B 1BH2A 1UM9A 1MKYA 3BHMA 1SHKA 3GDHA 3ISTA 1W8DA 3ABIA 1KZHA 2I7XA 3EEQA 1RHQA 1L7MA 1N2EA 2C78A 2LGJA 2Y68A 4MQFA 4EHKA 1O8BA 4B6GA 2Z9DA 3B9PA 4RA6A 1OI3A 1TA9A 2PQ6A 5A6SA 2DMRA 1WE2A 2L69A 4OI4A 2WAXA 3QFSA 3ZU3A 1X1RA 4UHCA 2XXAB 4F45A 3UUGA 1IHUA 2P4QA 4EUKA 4LRYA 1QGUA 2A9QA 3ENZA 4KVZA 4GZ6A 1WD7A 2O2YA 1QAMA 4RZSA 3DEHA 1VI6A 2AJBA 3ONFA 5AI0A 5T3UA 1OY1A 2CBZA 5IKPA 5L3ZA 3V8MA 4PE5B 4LJ5A 4FE3A 4MICA 3TIVA 3W34A 5AW7A 1GGJA 4TMXA 4AWAA 4ES6A 4FE7A 4IM7A 4WE3A 1XU9A 1VHWA 2ZSJA 5FWDA 1K7FB 2FPUA 3STVA 1T6BY 2F1OA 1Y4ZA 3IO5A 4LJ9A 3SKVA 3UKDA 3W8RA 4A0FA 1U9CA 1YCFA 1UC9A 1EEXB 4AP9A 5JCXA 2E4ZA 3NEAA 4CL0A 4M22A 4RJJA 2BYTA 3EGEA 4YR7A 2V5AA 1A7KA 3DXXA 1TAUA 4L2IB 1KBQA 3JQAB 2C96A 5FLKA 2MR6A 5JLAA 5JYBA 1ZI9A 2RH8A 1OBOA 3RU7A 5K3FA 3NOXA 3MWYW 5FPHA 1SBIA 4JJAA 5CEJA 4EATA 1D5WA 3ZCRA 2KE5A 2BHSA 2NP6A 1UZUA 1JKXA 3R75A 1WS6A 1ATIA 3OPXA 4RWZA 4J03A 1EUCB 1XJ5A 4N18A 4R68A 5A62A 1WR8A 4F5ZA 4NENA 3F78A 3GLIA 3IALA 1G59A 3TCNA 3LHDA 3N2LA 4H59A 4IICA 1E5VA 4TX1A 3W7BA 3TN7A 3QKRA 5E1OA 1T29A 1V6SA 3AYXB 4RTQA 4MS1A 2I6UA 1G20A 2F55A 5E95A 1Q3KA 4GSLA 4QXOA 4Y9TA 3N8HA 3PNOA 5LNK1 4X6UA 2P79A 3PHIA 3WMWA 2HCRA 4G4JA 1S2LA 1KFJB 3D6AA 5BNTA 2YWHA 3T0FA 1MHTA 1OYVA 3TR6A 1GAJA 3AIOA 3L0IB 1E99A 4N8EA 2F8TA 3JQPA 2J3IA 5BN1A 2GUGA 3OU2A 5DM0A 4KRXA 1RTTA 2XB8A 4LOIA 4XRRA 1G7SA 2P3LA 4DUZB 4DY4A 1NDQA 5CLJA 3NAMA 2AZTA 3QVGA 2H29A 5BSWA 3PFNA 2HSEA 1K7EB 1N2SA 1DLJA 1GPJA 1OGJA 2P0EA 3IBGA 4YJ2F 5H3LA 1SC6A 2CHGA 3G8YA 4M9UA 2BZGA 2VTBA 1TPYA 2B2NA 1FOEB 3JTEA 4XWGA 4QPCA 3CZPA 3E1GA 4A6EA 1ZMBA 5K0FA 4N01A 3WA6A 5LMUB 5HG0A 3K09A 4P1ZA 4R98A 3AR5A 4QELA 3WO1A 3V9PA 3MTEA 5AOVA 5LQNA 2I4OA 2ZETA 4KRGA 1POXA 1K68A 2QQ5A 2VZLA 3B3JA 3TVTA 2WHQA 4OHVA 3P9RA 2QP9X 4KO1S 1USGA 4Y7CA 2XGMA 4HAOA 1YB1A 5EAIA 4JSYA 3RS4A 1QQAA 5ED0A 3UC5A 3DV2A 4DOMA 4CMIA 2CVQA 4F5DA 2HK6A 3RSGA 3ITKA 5GJBA 4U7TB 2JASA 3TW6A 4KPUB 4X71A 2PZ8A 2OV4A 4RD1A 5ALMA 1U8TA 2G71A 5BN5A 1L6RA 1UJ4A 1HDCA 3G1TA 4J1TC 1XZDA 2X76A 5AVTA 3DKRA 4DXHA 4ZVRA 1J2TA 1OLSB 3K1AA 1C8BA 3D2LA 4C30A 3S1AA 5EIXA 5AUPB 1PNOA 3WLKX 2FRDA 5IDQA 3UMVA 2VHXA 4B3CA 1HNXB 1QONA 1JHPA 3A11A 3FSEA 4E3ZA 3GP8A 3WAGA 1W87A 3O75A 3PZRA 2GFIA 3RIYA 4L57A 5DBGA 3TAHA 5DNUA 1M1YB 2ZQYA 4HUQA 4BX3A 1AQJA 4MPDA 5FO0A 1EXNA 1H8HD 2Y71A 5ALPA 4NYMQ 1R6UA 2EBHX 2FPMA 2HQRA 3RRMA 3TX6A 4E5VA 1CF9A 4ZMRA 3NS7A 3RVRA 4F3YA 1JFFA 3NIFB 5J58A 2OXRA 3OTIA 1Y3CE 1OLUA 4C4TA 4CMHA 4A23A 5BVHB 2WHPB 5IJ9B 4ZVQA 4KWHA 5AQ1A 5ALTA 2TSYB 2BKXA 4DNOA 2YDXA 3VTZA 3MEQA 3F97A 3VNQA 3FFBA 2CBGA 2NPIA 2ZUWA 4R7ZA 4AF8A 3R5TA 1VC2A 3DQZA 5I3ZA 2ACEA 3MLAA 1PR1A 3VTKA 4QWWA 5KOIA 1KFEB 2IZ1A 1YQWA 2BBWA 2A0WA 2B92A 1YZKA 2X9VA 3PRYA 4J2OA 1TUEA 4FOLA 4OJTA 4MRAA 4RSGA 5TS3A 4QGGA 2CDNA 1VTKA 1TJNA 1FQJA 2XI4A 4QXMA 1RRMA 1JMYA 2IDKA 4PLWA 3M6FA 1QQ7A 2ZBPA 5AT1A 5DDIP 4Y6GB 3AHEA 3IP1A 2JZNA 2WU3A 1NUAA 3UMGA 1AA9A 3UC9A 1OWNA 1I94B 2JK0A 1UUFA 2OYRA 1NPDA 3HPRA 2B20A 2EP8A 3IBTA 1BWRA 2YYSA 2VUIB 2ECFA 4WSOA 4RTPA 3A1SA 1V4NA 4GAEA 4H1HA 1GXSB 1L5OA 2Q3BA 1UMBA 4CMEA 1HR0B 1UAAA 3K0KA 4OL0A 2XQKA 4MEJA 4ZAVA 1GA4A 2YWCA 5FTLA 4O4HA 3UEOA 2GBCA 4LUCA 4FEEA 2FP3A 2ZCUA 4XLLA 1OWMA 2H4WA 4AF7A 2WFAA 4PWYA 5ITSA 2B94A 3IUBA 2WWTA 4Y9UA 2W8BA 2ECOA 3VTAA 5CLFA 1WXXA 1XHFA 2A6PA 2QRVA 3G49A 2IWRA 1V8ZA 3VKUA 4X1OA 1WSWA 3K30A 4UC0A 4NNPA 1OTHA 1YOVB 4AIRA 2X1HA 3HV0A 1G3MA 1MDBA 1DIHA 1E1RD 3CA8A 4JMPA 4DLKA 1N2ZA 1DAEA 1OU0A 4ZKEA 1WMBA 2ODQA 2I99A 4A36A 1ECCA 5DU2A 3CUWA 4LCEA 3WL5A 10MHA 1YB2A 2YX1A 1RCUA 3D6JA 3HSYA 3IPYA 2P90A 1FMFA 5BURA 3HDJA 4PLGA 4M1SA 2I54A 1DJLA 3N86A 2H59A 1N2IA 1QCZA 3E9DA 1UH5A 2IHNA 2EV9A 1HO3A 2XE8A 3K35A 5KNBD 2Z2YA 3GG2A 4B79A 5LDHA 3OMLA 4BKOA 3UAYA 1Q7RA 4FHCA 2G0TA 2WJGA 5M3BA 1ODCA 3EAFA 1VGVA 3MB5A 4EECA 2O5VA 3KIPA 1D8AA 3IE0A 1CTQA 1CP2A 1ZKMA 2VOJA 3OEWA 3PT9A 4UULA 3MCAA 1BJTA 3ZXIA 2RHBA 3TQIA 2RCNA 5KJEA 4KMSA 2IYSA 1FNCA 4AYXA 1JLLB 2Q3MA 1KVQA 4PYKA 4DIBA 2C4WA 2IPXA 4J16C 4AZTA 4BV8A 5LYJF 3ZD6A 2DC1A 1R1DA 4L8YA 5CVCA 1THZA 4EARA 4AUEA 4C0BA 1GSHA 3U7JA 5J23A 1U2QA 3QYPA 3P20A 2QV0A 2BEUA 2DWUA 4G65A 4NMWA 3L8ZA 2HTEA 4E4RA 5KNBH 1W0KA 1GYRA 2ZB2A 3L07A 1F06A 2D0PB 4QNNA 1JWBB 3DDHA 3Q98A 5AXBA 1N8KA 1RQPA 4B46A 4YCCA 3IPRA 2FEPA 1XPUA 2PRZA 3ACBA 5BSGA 2HDHA 3HCAA 2A0KA 1R4MA 3EIFA 4IIGA 1QGDA 1T8RA 4S1NA 4GOMD 3ZWAA 4EJSA 5HTOA 4C7OB 1JLKA 5AK4A 1Y5NA 3TMAA 5K8CA 1GGFA 1JT2A 1E62A 4RJ2A 5HILA 2O0JA 4YRJA 3ST7A 4FT2A 3CX8A 4LY6A 1GNRA 4AZSA 4F6RB 2X8AA 3ZBUA 2HCTA 3HP4A 3OE7A 1SQFA 5FBZA 4M8SA 4BB6A 4ZYVA 5JH7B 1KI9A 3GGPA 3WS7A 3RARA 2CWWA 3FGPA 1CZHA 4ZT3A 4B0PA 1THTA 5KDDA 2GYVA 1XSEA 1JU4A 1Y1QA 3M5PA 4I5EA 4IIBA 3UA4A 3V8PA 4MKRA 2X5OA 4FFRA 4IVPA 1Y63A 2WVGA 2HMWA 4L5CA 2AG6A 2H9YA 4A8JB 4Z4FA 3INRA 4C2AA 2H2FA 1DWOA 4BN5A 4PG8A 2RGNA 2RGGA 1SD5A 4R9UC 1PGPA 1P1JA 1PLLA 1LEHA 4G0ZA 1CLUA 1VPWA 2QXUA 3OCCA 2NTNA 2W6JD 1C3VA 3KSMA 3QMPA 4FGZA 1NV9A 3TECE 4X94A 1W49A 4BO8A 2C8LA 4YMLA 3EWAA 2E5WA 2NGRA 2ZZKA 3REGA 5JJKA 3INTA 3M1AA 3N39C 3NWPA 1QGOA 2BP7B 3OQ1A 5JNLA 4P4UA 2PVPA 4A82A 3BAZA 3CU5A 1Z4PX 5AD1A 1EM8A 1NJ2A 4GRAA 5EVCA 4AO6A 1K7CA 2R00A 5ALUA 4C2BA 5KTTA 5BVGB 4V0NA 1YZFA 3NHYA 1QCDA 4GWLA 2ZTUA 2F48A 4YASA 1Y3BE 4YIKA 3TQCA 1W36D 4MGEA 1XJ0A 4JDPA 3E7PA 3PP8A 3VBCA 4LF5B 3A1UA 1QZXA 2BI4A 4C9BA 1JBEA 1U8FO 4GYYA 4ZI7A 5CB4F 2JNWA 1DS6A 1V1MB 4H08A 4NRDA 3KJEA 4PBTA 1NAHA 5JFOA 2SICE 5GOTA 5DBIA 1PYGA 1PT6A 5KKNB 2Z2ZA 1YR3A 1DBQA 2ZAOA 1IJFA 1OC2A 2EFGA 2PE5A 2V7PA 3CEHA 4MI3A 2CLDX 2V59A 4ARBA 1W1IA 5JAPA 3KQQA 4AP5A 1W25A 4JZKA 4AMZA 3CRW1 2C4UA 5IM4A 2PBRA 3F8WA 1GKUB 3H0EA 4RK6A 3L4JA 3U5TA 3HACA 1UKVY 2X5NA 3H4VA 4Q9KA 2VA9A 3BWDD 2P2YA 4KPFC 1KSHA 3DC7A 1VG1A 4BJ3A 5PGMA 3VHRA 3ZVMA 3OQIB 2A9OA 5EA2A 3QFCA 5F5NA 1PJZA 1XR3A 1DKOA 2MR5A 3OJLA 1CJSA 4BAUA 4KREA 2QA5A 3L7DA 5GV8A 2Z3ZA 3GZ4A 5HIJA 5CP8A 3KHSA 4F3KA 2EL9A 1UM8A 2ZIXA 4DKXA 4GVPA 1RXEA 5MN5A 3TQSA 1UP7A 2KS6A 3DE1X 4QVIA 1G8FA 4WUTA 2E5FA 2V3WA 2DKFA 3W5VA 3WRYC 4UZEA 2ZTHA 4OB6A 4DW8A 1RKQA 3V8QA 2ZRFA 3WO0A 5HUJA 1U8ZA 5BWMA 3QUAA 2J9FA 3C3PA 3PPYA 4XM2A 3RADC 2HJVA 4I1RA 2JIQA 2DPXA 3PFBA 4UMDA 2M32A 3B8EA 3LVQE 1Q19A 1DJMA 2JJ1D 1SBCA 3ITEA 5I47A 1NLMA 2XIQA 4G2NA 1Z0SA 2O0KA 2XMCA 4KN6A 3TOSA 3KVNA 4EP1A 2SHKA 5AO9A 3AG6A 1UXOA 1L1RA 3ADDA 3T3PB 4MW9A 4HDSA 3JWGA 1M2VB 1JDJA 1XZJA 1Z3IX 2C03A 4JKYA 5H4HA 4N5HX 3SHTA 2QRJA 4DQXA 3AUSA 1SIOA 4QGFA 1YA4A 4ZQIA 3ZCPA 4HQNA 1PQUA 2MDTA 5CA1F 3W79A 4PHGA 1RHMA 3D59A 2HWWA 4FI3F 3I83A 1JG7A 1DOHA 1N9ZA 1DQYA 2BEJA 3N58A 4P5EA 4G8BA 1CRQA 2KQUA 5G1NA 4CT4B 2VYNA 2O0HA 5CPBA 2JIOA 5EI5A 1BMFD 1FLNA 2R5NA 2GTPA 1K0UA 1Y3AA 2RHCA 2WWGA 1NQTA 3IA2A 2IUUA 3SLGA 2XRFA 3DM9B 2R1UA 4IUDS 1ZJJA 2QTWB 3AUAA 3OMWA 3KVVA 1BGXT 3IQZA 4JY7A 5IEBA 1VHJA 4DMKA 1SD1A 4PC7A 4QPNA 1YVPA 3K4QA 2QKYA 2A7XA 1GSOA 3HHPA 1Z88A 3EXIA 4G5GA 5JWHA 4GLBA 5CFLA 4K9QA 4QASA 5J2TA 1WABA 5EMLA 1JIQA 3A1WA 2FEXA 4MCIA 2Q4TA 2IYVA 3R6LA 3HB5X 2H7XA 3HJBA 1DMSA 2HLHA 2QL9A 3NNSA 5FQOA 4AG6A 1ZMTA 1C0IA 1TIBA 4PFQA 1I3CA 2VBIA 3M3DA 1YDEA 1T0HB 1WQ3A 5DX0A 1ZN8A 3U61B 2QLJA 1HYEA 1KH2A 3UAXA 3LOQA 4D5EA 2B99A 1SAYA 2F3UA 1ZL2A 2Q7XA 3KCNA 3GGCA 2WZDA 4DCCA 1IH8A 5CFPA 1W4CA 1Q83A 4HXGA 4D9BA 3O03A 1G2IA 4O8ZA 4WLFA 4FFSA 1DG3A 2YWFA 2FFAA 1XP5A 1MQSA 2ATVA 4P58A 3H1TA 4ATNA 3EXFB 1E7WA 5BO5A 5ITVA 2JIZD 2B6NA 4NARA 4RA9A 1S1MA 4AZWA 3DMDA 3HDVA 1XJCA 1ESCA 1B0UA 1MXFA 1N5LA 2J33A 5KMGB 3AI1A 1XNRB 4IJMA 3F1KA 1CIPA 3ZYCA 1UQUA 2PUJA 4LBVA 5HW0A 1BE6A 1RKXA 1TQ6A 2QYOA 3D0KA 3HP7A 4M7RA 1F8UA 3HL4A 2FJUA 6PFKA 4F2GA 1X8LA 4QHSA 2XMDA 1EGHA 3FX2A 4WXEA 1YU9A 1E3IA 5JTUA 4HAYA 1U28A 4KGDA 1DQZA 1XC7A 5JV5A 2NXWA 3R9KA 2J46A 2FPPA 4RKWA 3ZTYA 2VT2A 2UZ3A 1O0BA 4G01B 2BI7A 1FP2A 4PYMA 1VE7A 5KU7A 4IHJB 1PFGA 1NW8A 2P11A 4F4DA 1IHOA 1P18A 1N77A 4BJHB 1UZLA 1VPTA 3B5IA 1M1NB 1D03A 4MRMA 1R8JA 4QYSA 1LJLA 4B44A 2FK8A 2JAWA 3OJFA 1GUZA 2GCIA 3LJKA 3N6RA 5EKTA 5JPIA 3B52X 3GPDG 4RA6B 2A1TS 5F35A 3TZEA 1U02A 4MIKA 4G1VA 1N1MA 3G0CA 4QJIA 5J2UA 2QNBA 5KAMA 3OOYA 4TPKA 4K88A 3EVFA 4LHSA 1II8A 1GZSA 2I3GA 2RD2A 2WTUA 2QSUA 3GD5A 3F6CA 1ISJA 1RYYA 4OQFA 3TEMA 1AF7A 1IQPA 1LDNA 4QYXA 3K71B 2YJGA 3HGTA 4ZGGA 4GC5A 5H16A 1NBME 1BS1A 1HK7A 1XTUA 4I50B 4XUCA 3ZK7A 5BW8A 2JGKA 1N4AA 1X3LA 4D8UA 4CQMB 1I6LA 5EKDA 3WFJA 5KYUA 3W1VA 1I5OA 4AF6A 2PD3A 2HIAA 3NAGA 4LDJA 2PU7A 5FTWA 3TL2A 3B3AA 3WMEA 3DLPX 1DIGA 3WB2A 3C1OA 4EVRA 1U8UA 3OBIA 1H42A 2Z2IA 1NLYA 4KO8A 3BFPA 3NHFA 3WP1B 3JYPA 4HLDA 4EG7