6PFKA

Phosphofructokinase, inhibited t-state
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHOFRUCTOKINASE
publication title Structural basis of the allosteric behaviour of phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA02
3O8LA 2NX2A 2F67A 3EHDA 4PFKA 4LJRA 2A0KA 2KLHA 4U1RA 1PFKA 4I7EA 4NPAA 1WEHA 2F64A 2KHZA 3O8OA 2Q4DA 1S2GA 1S2IA 4OHRA 4A3SA 1S2LA 1WEKA 1T35A 4KXNA 4FYHA 3OPYA 4WL0A 3BQ9A 3F5MA 1ZXXA 2F2TA 5AJUA 4FYKA 2F48A 1YDHA 1F8YA 3O8OB 2PMBA 4OHBA 4FYIA 4HX9A 4JELA 1S3FA 4P5EA 1RCUA 3PFKA 4JENA 3GH1A 2IZ7A 1MTOA 3OPYB 4MCJA 4P5DA 4KXLA 1KZHA 3UQZA 2A33A 4LJKA 6PFKA 2IZ5A 4KXMA 3MAJA 3HNOA 3QUAA 2Q4OA 2F62A 2IZ6A 2HIGA 4JEMA 4MEJA 3O8NA 4I36A 3IMKA 3U39A 5AJTA 1F8XA 4LJLA 4RH3A 2PFKA 5ITSA 1S2DA 3SBXA 4I4IA 3K2QA
chains in the Genus database with same CATH superfamily
5IAEA 3P97A 2J3IA 2AJBA 4JHXA 1L1QA 4LHYA 1A4XA 3V8BA 1ZD4A 1L8LA 1SUEA 4O8ZA 3W5BA 4DMRA 2PS0A 2ZJBA 1FDRA 4E0BA 4AWBA 2VJKA 3KSMA 2ADMA 2C3PA 2OLKA 3EXFA 3QLVA 3PT9A 5DWDA 3IO5A 2GN9A 4J07A 1RHJA 4F6RB 1EDZA 1Q5PA 2BM1A 2HK7A 4R51A 1M5UA 1Q20A 4RKEA 1VYUA 3OCCA 1C7RA 2DR2A 4IGKA 3VHRA 4L22A 4AJIA 4H59A 1GTG1 1XELA 5CB4A 2ZZMA 2XGGA 3D6AA 5HDBB 3ENQA 3UMRA 3C14C 3WV4A 1NZJA 1TK3A 3ANLA 3GUCA 3QIVA 1GZHB 1HLDA 4WBNA 3U56A 1UBUS 2W6CX 1E77A 3B7GA 1FYEA 3BIXA 3U4IA 3STYA 1PL6A 2QV7A 1BHQ1 4O1HA 4UBKA 4IJUA 5CXQA 1GTVA 5I9BA 2FMIA 1G1AA 4G5OA 5DI3B 4Q0MA 2OHVA 2JJ8A 1ZK0A 2X4DA 5AKYA 2ORWA 1DCMA 3EGCA 3R75A 3IUSA 5IKEA 3I5XA 1C9EA 2YZNA 3GP3A 2GLTA 3R3UA 4TYPA 1KDVA 3SZLA 4ALJA 2JHGA 2IBMA 2QRKA 1EVQA 3BXFA 4WHMA 1NVVR 5ALPA 5ES3A 3HR8A 3PHLA 5THXA 1D6MA 3M4YA 1AHIA 1MF7A 1L1RA 2QE6A 3A7DA 4JU9A 5A6SB 3C5HA 3JVDA 5LP6C 4KRXA 3EF0A 3QVWA 1XRLA 4PYRA 1F8YA 5BSMA 4C7XA 4ZYXA 3JTEA 3BWBA 1UXJA 1FS4A 2XTZA 2IC5A 3EEQA 4G2NA 1VLQA 5JDCC 2R25B 1H1LB 3L1JA 1RWOA 3JZAA 4BVJA 1SCJA 3AONB 2BR5A 4S24A 3R0QA 3B85A 4J0QA 5F9MA 5LZ9A 4HWSA 3L4BA 3OLZA 5EXSA 5KNBA 2ZVJA 4TLDA 4CF5A 3NAGA 1B26A 2VPIA 5FT9A 5CLHA 4Z53A 1JAYA 2ST1A 2AOUA 2X5JO 3DTVD 4IX9A 3WSVA 2H5JA 2JFZA 4HZUA 1JHYA 4KR0A 4X3OA 3S2FA 2UUOA 4BBAA 4H1HA 5I7EA 3RC9A 1CFZA 1GNVA 1V8DA 3GLVA 3I42A 3IXMA 3QQ5A 4FZJA 5KYXB 3VHLB 1JLKA 4DT1A 3C3XA 2PMFA 2XE4A 3M3DA 2EW8A 5DHTA 4AJNA 2R7KA 1O58A 4MDFA 3EDYA 3EIHA 2VYQA 1W1WA 3H6HA 5GY7A 2O59A 1V2GA 1XRMA 1XRRA 2AJCA 2OFOA 2ERYA 2DWQA 1MGPA 3TNDA 2ZYHA 2VA9A 2DHEA 3NWPA 1VRWA 3WIBA 1HDEA 2HQBA 1QYCA 5EMNA 4TVSA 4EW1A 2WVHA 3KSRA 5FULA 5GGYA 3AY6A 5CURA 2C2KA 1JPUA 1PR2A 2WYUA 1VJTA 4IJ5A 3PJEA 1ZIYA 3TDNA 4BV9A 4OV6B 3DXYA 2W8BB 3S29A 4E5UA 5LZ4A 1GRVA 4PM4A 1U0RA 1PR6A 3AUTA 5FUXA 1MEOA 4AM8A 5JXWA 5CNJA 2WIFA 2NV2B 1LLQA 1B14A 3QXGA 1QANA 2GM9A 4F6CA 3AOEC 1ZNXA 1OYVA 3HA5A 3G59A 3FMPB 5TY0A 4RD0A 3SC6A 2HR1A 2DTDA 5CVUA 3MUNA 2B0JA 2VK2A 3CXRA 2NSDA 3MQFA 1B6SA 1LD3A 3M5WA 5L3QA 4XXHA 2JKYA 4I8IA 2XUZA 4JS0A 4BLQA 2VWHA 1X7WA 3BRWD 4QXOA 4CNQA 1CZRA 2VZ8A 4Y18A 4DHWA 2KLHA 1XRPA 3LSTA 1N5RA 1WA5A 4BPRA 3PNQA 3CUKA 4U6SA 4HZIA 4GWKA 4P7KA 4GZ5A 3SQLA 4NIMA 4QFCA 2P65A 2QD3A 1R27A 3GCXA 3ACDA 5KTYA 2O5EA 3DTVA 4DWJA 4RVNA 3KV3O 2YWDA 3AR9A 1CX9B 1I0LA 2VTEA 3W3AD 1MH1A 1EBBA 1IBMB 2G6TA 2WTEA 3L49A 3R3YA 2LKCA 1JMVA 4B3JA 3RQSA 1T5LA 4RIFA 4YEDA 4IWNA 5DBFA 4EQ6A 1ZG3A 4H1TA 1BXKA 3TZCA 1VSQA 3GIDA 1G98A 4FX5A 3I92A 3OZCA 5BMVF 5EZYF 3VZPA 4C29A 1GCAA 4F5EA 1TT7A 5LBTA 1VE7A 1QZTA 3GI1A 5E4TA 4LXYA 3A9VA 2MIIA 2OL4A 1IY9A 1C3EA 5BN4B 5I8PA 3DPSA 1EBFA 4RO0A 5L3ZA 1ZXXA 3GLGE 2W6NA 1FYFA 5IMSA 5ILGA 1G38A 1PNQA 1MB4A 1SKUA 2GJAA 4Q4HB 1YT5A 5AJUA 1NW9B 5G3YA 4QG7A 5F1OA 2YV2A 5IAKA 2VNAA 2CNNA 3LCRA 4HDCA 1NTRA 2D13A 3I2HA 4ZU3A 1KYWA 4QLOA 3EIUA 5EUCA 5AW9A 2B20A 4A10A 2PX4A 1BJRE 4C03A 2BR4A 4DNOA 4JELA 1GNSA 3HZHA 4KXYA 4E30A 1E1YA 1NR5A 2W0SA 1PZXA 1R5BA 3SI7A 4FSHA 4GM0A 3WK7A 1TGVA 1XZ8A 1U0HC 4LC0A 3UENA 5EUQB 1HOXA 5FTKA 4EQZA 3RFXA 4BL5A 1U2EA 2QS9A 2IEIA 4V0RA 3OBBA 4KQEA 1DIOB 5IM4F 3T3IA 1J07A 4JK3A 3E22A 2GD2A 3BRWA 1KMNA 3BOSA 4O2RA 2R87A 1G19A 2HMAA 1Z7WA 1OXMA 4TL7A 3VR5D 2WKSA 5JNWA 4G5QA 4UNPA 4UTZA 3RC1A 4RELA 1CNEA 1IDOA 3NONA 2OYRA 2ZSEA 2JRLA 2ZRKA 4KFSA 1YA8A 2DLDA 3ZZUA 4MULA 1EJBA 2VATA 4G0NA 4MUKA 4P0PB 3NU1A 4WRRA 1E2NA 2O7QA 3GGJA 3HGMA 1J24A 1IM5A 2RI1A 5BWOA 3W3AA 4NF2A 1OXTA 2GBCA 4CL0A 1M34B 2DT5A 3NBFA 1ARZA 3IR5A 4CLXA 1EX7A 1ILWA 4L7VA 1MKYA 2QRPA 1X8JA 1JS1X 4XWWA 3HCEA 3VUEA 1WDKA 2E4WA 2OY0A 1TQ8A 1WO8A 2R5FA 1Z18A 5AFSA 2ON6A 2ZR0A 2HHJA 5FV7A 4HDKB 4N48A 2FZEA 4IH4A 1O6ZA 1ZM4A 2ZQZA 5AI8A 3F73A 4FFBB 1QMGA 2PDAA 1W93A 1GTJ1 3ZGXA 4RU1A 4C7BA 3LDAA 5JY1A 5A5GA 1IJKA 3K31A 1RI3A 2C98A 5BW8A 2R6AA 1YS1X 3TFQA 3EXAA 4L75A 4Q1FA 5A05A 3K70B 5AK6A 1G8JA 3OU2A 5BN3B 3T5AA 1L5HA 2WHYA 1I2BA 1O54A 2GWRA 2IYQA 3OCWA 1YQEA 2QZ9A 4IDBA 3L8EA 5FNVA 4DDVA 2QVGA 4JUDX 1TM4E 3FA2A 4K9DA 4RY0A 4TL9A 3GROA 1ITZA 5J40A 2OM2A 3NBYC 3PIDA 4UDNA 3SX4A 4G36A 4GYYA 3K6SA 1U5AA 5JH7F 3N9IA 1SG9A 1CYDA 1VRVA 1GR0A 2NUTA 1QG6A 2QU8A 2PCJA 1GPAA 3VYVA 1PGPA 1RXUA 3ZV4A 1G291 2W37A 1ZD2P 4LJ5A 4CFYA 5JD4A 3V8NA 2AE1A 3JWHA 1GLGA 2F64A 3IS3A 3U61B 2ZWVA 4PWZA 2Q1SA 3BAZA 1XWWA 3DEJA 2XB4A 3WJ7A 1FPQA 1UFRA 2V7EA 1W49A 3EGDB 4QYTA 3TI9A 1G8PA 2BEUB 2QGZA 2WJAA 4AU1A 3UGQA 4CEHB 4YMLA 4IQ4A 2AW3A 2ORIA 3UMGA 1IUPA 1CEXA 3F6SA 4MYDA 221PA 2CVPA 2CVFA 2KBFA 3H2BA 4NE7A 3V6LA 4DC0A 1CF9A 2NO0A 4GMDA 1P1FA 5DM1A 5AOBA 5K3FB 4X65B 3GR6A 4C6RA 3FJOA 4IIEA 4XOUA 2D5IA 4ZAVA 1ZD1A 3BS4A 2QXUA 3UWMA 5EJFA 1G17A 4HADA 1P7WA 4H7KA 2BGLA 3L18A 2A2ZA 2PM8A 3LQ4A 4UZSA 1RWQA 1ZW1A 2BOVA 2JFGA 4JJAA 1BS1A 2PSJA 2Q07A 2YHAA 3I73A 3KT0A 1ZN8A 3HB4X 3F3YA 3WDSA 1VBNA 4FYIA 4BKUA 3TCKA 3ORFA 3DAHA 3HUUA 3CUSA 2QL6A 4TUYB 3FTEA 5A3RA 2YMPA 3U31A 5B1SA 1NYLA 4MWBA 2J31A 2EC5A 1ZGBA 3KJNA 1DUIA 2WKPA 5G4LA 3KVOA 4PF1A 3KKEA 3DKKA 4WBNF 1NVAA 4L4XA 2N42A 1II9A 3CB4A 4TS4A 1YBHA 2QP9X 2LTAA 4MYTA 4YJ3B 3WGTA 4NZPA 1C2TA 4OXXA 2LNDA 1VPTA 2QE7A 3ENZA 3KUCA 4X8OA 1LLFA 4PFSA 8MHTA 3DL2A 1IHXA 2CMDA 4O33A 4RL4A 2IELA 3FUWA 4WA8A 1RJ9A 3WJAA 4XGKA 1SOAA 3TMYA 3WLIA 2QTLA 5C1DA 5CH5A 2OENG 4G5RA 4QOJA 4TN1A 3ISJA 3ZX5A 2ZT6A 3HP4A 1VMAA 3IP3A 3OETA 1XC7A 4NECA 1K0UA 4JCOA 1BRMA 4X9XA 4YDRA 1NRJB 3D6UA 4PAWA 2Q21A 3HADA 5D1NA 4EZBA 2D7JA 3JQGA 1DMSA 1HE2A 1JKFA 3A32A 4JQZA 3TLZA 1RI2A 5MHTA 3CVJA 3IAFA 4JAVC 3VNBA 4M22A 4QREA 1KMIY 3GVPA 1V8BA 1A7JA 4MRMB 1SOUA 3QF4A 1UWCA 3F7MA 3HHEA 2JL1A 3A9RA 3PJRA 2AH5A 2G28A 3BJMA 3QTLA 2OCPA 3LT0A 1YO6A 2VPTA 4OX9B 1AC5A 4ALNA 4G97A 1UC5B 3OEED 4WPGA 1TOAA 2OD9A 3DP7A 4YLGA 5TF4A 2PXAA 3EBLA 4UTOA 3HXPA 4HLCA 3SHOA 4QOGA 4LI3X 1C7IA 4YQEA 2CWDA 3UV7A 1KMCA 4OI4A 2ACKA 2UVQA 1ZITA 2MSEB 2YBDA 3AL3A 1XF1A 3ZWYA 4DZTA 1KDYA 5EIXA 2PZAA 1IBSA 1HM5A 2PLAA 3D8NA 3IDOA 1TFUA 1X1TA 1LUAA 2QRZA 3K20A 4QPJC 3RUIA 4BBZA 5JVDB 4WEOA 2IYOA 4FE4A 2RG1A 4IGFA 3UCFA 2D1RA 1U8XX 3ZVLA 1M2OA 5T6BA 1SA0B 5EQTA 3TOXA 4K9LA 5AVXA 2O2CA 3B48A 4B8ZA 3ETGA 2Y0BA 4CFSA 3IQIX 5KQGA 2N46A 4B4KA 1XOIA 1BQ4A 4DBLC 5KS2A 4RK1A 3OM0A 4TMFA 4TTPA 4YR7A 1XD2B 4HN2A 2JS7A 4ZMSA 3TXYA 2HH9A 3LWDA 2HNBA 5HXAA 3UGJA 1CQJB 2J85A 4CG1A 1PQYA 4EUNA 1ODSA 3EQ8A 4Z1MD 1XF9A 3IP8A 4WERA 1WEKA 4EI7A 1E7WA 1GV1A 1XDUA 4UD6A 4CM9D 2H2FA 1L5SA 1KEEB 1DX4A 1LVUA 2I65A 3R5JA 4W8HA 1EB9A 1OZ0A 5J2UA 2G07A 2BI7A 2P9JA 4O3MA 1WL8A 2C5GA 3OT4A 5HIMA 3TCXB 4BO4A 3MJDA 5DPMA 1EX9A 3V42A 1PT9A 2PYDA 3ADKA 3IVRA 3LF2A 4KTVE 2R7MA 1Z0AA 3ZTTA 1TYCA 2TECE 4XD7D 2WW8A 5F3RA 4JHLA 2H1CA 1KI2A 5M3BA 2PVCA 1U0EA 6REQA 4N0EA 2YFKA 1XVVA 3C43A 1BW9B 1FOEB 2ID4A 5IULC 4NZNA 3GGSA 4LOJA 1L7VC 4YTEA 2OKCA 2PUBA 1E2DA 1JVNA 1SY7A 4Y67A 4YCBA 1S6YA 1SD2A 4OP1A 4QXAA 1A9OA 2IZ7A 5JHHB 3N86A 2LD4A 1DELA 3I6QA 4OGFA 4WH0A 3VGJA 4B09A 3Q9UA 4U9IS 4YREA 2VYCA 4FFSA 5AMXA 4R5HA 5HKAA 3EXHB 1YSCA 4R68A 5AKHA 4F06A 4FPXA 1DC5A 3GLFA 3NORA 2WF8A 4KI7A 4FYXA 1YJBA 2FA9A 5DHRA 4CCYB 3EZXA 2VDPB 4YQZA 1JYSA 1GV0A 3LQQA 4XWKA 4L6AA 4LNUB 4OHWA 4PQRA 3KZVA 2PH5A 4D8TA 1SCDA 1I80A 2F59A 2OKGA 2QZ4A 4C14A 5KYNA 1XT6A 2ALJA 3GLHA 2DRIA 1YJXA 2XCLA 2HLDA 2HT6A 2CCGA 3VPAA 3QOXA 3S81A 1RQGA 4TVOA 5FRDA 4MV1A 3LKBA 4DSNA 1CS0A 3E81A 1Z39A 1A98A 1FNSA 2H0QA 3BN3A 3PFBA 1L5NA 3HDJA 1LX7A 4FYWA 1NVKA 1W5BA 3NEJA 4IY1A 1J1ZA 5DI9A 5FD8A 4AIRA 4B34A 4IHJB 2G5GX 2H2AA 1AUOA 2GOYA 3V8EA 4FJ1A 2G5CA 2NZWA 4Q3DA 5JSZB 4F2PA 3RB8A 3DDZX 3D6VA 3N2EA 3I6BA 4IUDS 1EGAA 1II0A 3QFFA 2OO3A 3ROPA 2A0FA 2VL7A 5DT9A 1YB7A 5HF9A 1XEXA 4JD5A 4QFDA 2V7WA 2YOGA 5BO5A 1Y42X 1OXSC 2OFXA 4EW2A 1E2HA 2AVDA 3O92A 1R0RE 3U9LA 3I39X 3WZ2A 3QLUA 4HOYA 2FVXA 3EBOA 3HO8A 4N65A 3SIPA 1NU8A 2X58A 4BLTA 4BZPA 1Z12A 5GWXA 4A8HA 1HEUA 4FLFA 3O3OB 4X90A 3PC2A 1OASA 1AHPA 2O5RA 4BDSA 1ZUWA 4FBGA 3UHPA 4BTEA 3N59A 3FNGA 5DXFA 4UEWA 5AXBA 5BSTA 1GUZA 3K70C 3H9CA 4RORA 1OTHA 5KEIA 1N1EA 2R8ZA 5DZSA 2B36A 1LK5A 2A0UA 5ALFA 121PA 2NVOA 5FKJA 2ZAOA 5HM8A 2WB4A 3KJXA 1E6KA 4PNPA 4AKEA 1WHTA 1YHNA 3WO1A 2QZPA 5K6RA 3Q8MA 3HN2A 5E7MA 1KVUA 2PV0A 4ZXFA 3G49A 1PP4A 3BILA 2QZZA 4ZVSA 3LZCA 4XWTA 8GPBA 1N9GB 1UK9A 2WIDA 5JRDS 1OV4A 3DTNA 1MLDA 1DC3A 4HVCA 5JXJA 3FHJA 1ABFA 4RQAA 3ESRA 4H6VA 2YZ2A 3TSCA 4COKA 4XH9B 1E5DA 2LKDA 5A0TA 3IJRA 3KP1A 3EXG1 2OYSA 3LIIA 4HGQA 1UKVY 5JADA 3EUAA 3T7AA 3V4ZA 5DE3A 3VNQA 3T1YB 4LV8B 3F7OA 4BB5A 2O5VA 2CUTA 2ACEA 1Z4OA 2EZTA 2O48X 3ESYA 2X2OA 2ZBEA 3JAKB 5E2BA 3TW8B 3C3YA 4NFSA 1YVEI 2V65A 3I61A 1DGQA 3G5LA 3W5CA 3H17A 3P5BA 2DQSA 3HMQA 1P39A 2B3TA 3FFAA 4K6CA 4WNYA 4CCSA 4G2TA 1V95A 3DL7A 1FUYB 3RTAA 4KRFA 3WQQA 2XT0A 3L7AA 2J07A 4G5YA 2H2GA 4U7GA 4UKDA 3PP8A 1X6VA 3OTIA 4LWQA 3RREA 5LWHA 2GK4A 5AXDA 4CIAA 4QICA 1IK6A 5F5NA 5JY6A 2O3SA 4IMPA 4R1PA 4H7HA 5CK4A 1BQ3A 5FTWA 5HUHA 1VB3A 4A0SA 2Z2IA 4K05A 2Z8YA 1OZFA 2L2QA 5IARA 4LYEA 2F90A 4AG6A 3FSGD 4HATA 3W5DA 1F3OA 4MS4A 3I52A 3OT5A 2HWYA 1KSJA 4PTYA 1GCOA 4Y7DA 4KK3A 4IO0A 1BU8A 2WVJA 2XNJA 3RJZA 4NI5A 1DCFA 4MI1A 3E6AA 4HL6A 2FPSA 4PYKA 5SZIA 4A2WA 4DVGA 1KQFA 2NTYC 2FEPA 4IH9A 4IQ8A 1R0YA 1DB3A 5LLTA 2WAXA 4WEQA 3WWCA 4KVFA 1ZSVA 2I6TA 4QUIA 1Z0FA 1CR1A 1M6VA 1AXGA 5I9NA 1QMPA 3PGA1 3ZWCA 3OQMA 1NG9A 3AUAA 1Y7PA 5CDFE 4D8WA 1Q16A 1AY0A 1UMDB 4TLBA 5BUCA 2XUKA 2CDRA 1PLKA 3JAMA 1KEZA 4XUCA 2F3TA 4HR7A 3B12A 3RFVA 4NDNE 2EOAA 2G1AA 3CIOA 3K1YA 2BGNA 3L6BA 2OCLA 3PE3A 1J2RA 4YNBA 1JLSA 3RTBA 3NFYA 1PS0A 3DZKA 3OOWA 5CLJA 4FX2A 4FBMA 3S2ZA 5DHUA 3UMYA 1VE5A 1XZJA 3WGLA 3QV1A 1QF6A 3LCMA 4HS9A 4CF6A 3OTHA 1HWYA 3VR3D 2ORED 1KA9H 2AFHE 1XBTA 2QHXA 4E4RA 5TMPA 3OURA 1A7UA 1KP2A 2BFCB 3KPUA 3RFFA 1N2CE 2A9JA 2XZDA 1Z5ZA 1OFUA 4IVRA 1NPDA 5D5QA 1M1YE 1IZ7A 1NLFA 1FA9A 1RBZA 5CYOA 4NZ9A 5EKTA 1JQLB 2B1RA 5C32A 5IG2A 1TU0A 4B75A 5I4KA 4UNSA 2HRCA 1QM5A 2RB5A 5HILA 2IFTA 3LUAA 5HF6A 5LYYA 4LS3A 3T4XA 2O8CA 4F9FA 3HPQA 3BTVA 4FU0A 3SCZA 3L4JA 1GNQA 1RYBA 1OR8A 2DM6A 4EY7A 3I5UA 1OFHA 3DYIA 2PLRA 4BFYA 1T1SA 1Z4LA 1VCOA 3OQ6A 4Y6GB 4AJOA 1IRXA 4F6LA 1N77A 4HV4A 3LL7A 5IN5A 3LT2A 4DIKA 3C7KA 1JHDA 1OFIA 1PHRA 4O4HB 1LF5A 4L27A 4NTZA 3AEUB 3SZOA 5LQCA 3HJBA 2Z9CA 1X39A 2FZVA 3NLLA 2A5YB 3GA7A 4UVHA 4WWHA 5AQ1A 4WNIA 1W581 3SC4A 3MQ2A 1QCDA 4KC0A 3W9BA 3FLAA 4N3BA 4EUSA 3Q0IA 1A77A 1SHZA 2Y1CA 3VKHA 2F2TA 2BFBA 4Q37A 1KK2A 1JJBA 4CLEA 4F0JA 2A9FA 4UC0A 4C0BA 1G5IA 1FVOA 1YDHA 2ID9A 3IUQA 1QNFA 3SS9X 5B7GA 3IR6A 4X20B 1V16B 3C7AA 3DA8A 3D8TA 4FOOA 4ZVMA 2W70A 1W36B 2GZ3A 2OHGA 2P9TA 1WX1A 1UC4B 2VHYA 5ER6A 3S44A 3I3SR 3TDMA 5I4CA 1T5OA 5FADA 2Q5LA 3WKEA 3KUDA 4GKBA 2QRJA 1R9NA 1FBTA 2GUGA 2J7KA 4PQEA 4GO1A 5L7TA 3I32A 3OZGA 1XAJA 5CIYA 1C3VA 1JJFA 4WVFA 1LLUA 3W05A 4M1MA 3L6UA 3SSOA 3WWDA 5IXYA 2PZLA 5T5QA 1JSXA 4LF5B 1AA6A 2EZ4A 2OWEA 1D6JA 4BVLA 2H9YA 4DJFC 3R8FA 2VJQA 4B48A 1QHHA 3VSBA 4O2AA 2FQXA 2VQFB 3I23A 2WHPB 1WS6A 2D5LA 2NZ2A 1C8BA 4DCCA 2O0KA 5IKOA 2XCTB 1MTZA 3RS4A 4WT7A 4PRKA 4JKYA 1XKXA 5EWJA 3PXEA 2JIMA 2JARA 3D3WB 4DM7A 3PXAA 4ESOA 1UEJA 5AHXA 5DK6A 5T4HA 1NI4B 4AN4A 3VHXB 4CMIB 1SXPA 1TQDA 3OX4A 2VSFA 4TYQA 1GZ6A 2M2IA 3BH6A 3PQDA 4JNCA 3WLNA 3EXHC 4NBWA 5AKLA 1DQSA 4I6JA 2B4RO 1JHAA 2CFSA 5TV2A 2D0DA 5JS2A 1UR5A 3NUZA 5JZVA 1IZ0A 3MMXA 4XTCS 2HIGA 4G65A 3LSYA 4JEMA 2RAFA 4MA0A 2QK4A 3FGZA 2CUKA 1RWMA 3AJRA 1GY8A 4ZN6A 4M7RA 5EG5A 3KJFA 1H85A 4IDOA 2FMHA 1MOSA 5IBRA 3T3PB 1I0IA 4BFZA 5K7SA 3E9DA 1S2DA 1J09A 2PWPA 4JJKA 2G83A 1SXJB 4C0KA 3JQ9C 3C3MA 1Y3HA 3ZV5A 4D9HA 1SHUX 3QWIA 4QGBA 4R3NA 4EJSB 3KC2A 2ZAIA 3UWKA 3ZZ1A 3K8ZA 2FDCA 2K5UA 4U4AA 1QRDA 4BO2A 1FQWA 4AJ2A 3VC3A 1TA0A 4ZCLA 3SKVA 5K5EA 5FBVB 3MA0A 1HLGA 1IM8A 1SFRA 4IZOA 4M4SA 4DN6A 3LUCA 1T9AA 1E0AA 3ZQ4A 4RHEA 1R00A 4QYIA 1RPNA 1PW5A 3AXTA 4I0WB 3MF4A 4XWOA 4I55A 3AERB 3KZMA 3I0MA 4LF4B 1M0WA 1OU4A 5BV2P 1QP0A 3K1ZA 4PZ0A 4Z99A 4ARCA 2FPUA 3SDBA 1B3BA 1YR3A 2XMCA 1GL9B 4TV9B 2ISQA 2Q2NA 1QIIA 5BNIA 2A5LA 3VDRA 4BMZA 2QTAA 2CNWD 3S2GA 5A3VA 3OIWA 2QDXA 1P4HA 3GNTA 3WSTA 2W11A 1QYRA 4TKMA 1OILA 1JQKA 5EJ8A 3H8JA 3THYA 1SOMA 1YU9A 4KG7A 2XWJI 3ELBA 4NZZA 2VT2A 1JDVA 4P36A 5FL3A 5JWHA 1ISGA 3G2KA 5D2CA 4YMWA 1QDLB 3GRKA 2F8SA 4EYGA 1GRQA 1A5SB 1J0EA 1E3TA 1UMCA 2HXGA 2P8JA 3HKDA 3PFFA 3QJYA 3G3EA 3ST7A 3I9MA 4EY8A 2RK4A 2BI8A 1U7TA 2NXWA 3VOSA 3PRJA 1CT9A 4RZQA 1TPYA 3JRNA 2FXIA 3UG6A 5K0EA 3AVTA 2GF0A 4G1VA 1C0PA 1SQ0A 2BKEA 1T1RA 4PCUA 2NO5A 3BCUA 5KQPA 1VPWA 4NX2A 5E6SB 3MFQA 2EJVA 1VDMA 3ONFA 2YIMA 1LEHA 1WKVA 1WDLA 2ODBA 1D1TA 3BB1A 2CXHA 5KYGA 2IS2A 2Q41A 3RVSA 4RVGA 1QFZA 4Z4CA 4LJ8A 3CC8A 2KQUA 2P5TB 4AZSA 3T0FA 5MFPA 2HU8A 5UKDA 3DVRX 1P80A 5CT5A 5KYUB 4NMMA 1OX4A 1FTWA 1K4YA 4DA7A 1RSZA 4M88A 2OO7A 4OLHA 1NXOA 3INGA 2DSTA 1Y6RA 1PSDA 3LA8A 1NNI1 3ETHA 3FDFA 4CTNA 1E7SA 2DPLA 5EP1A 4G4IA 1G8YA 5KC9A 1DZIA 3S1AB 1VGVA 3G8DA 1O9GA 2I4TA 4BNJA 5I8WA 4TYMA 5JMTA 2HJVA 4YRGA 2N75A 4NVRA 3VYRB 1F8FA 4AURA 3GEGA 1QS0B 3AIKA 4NDZA 3TLEA 2MYNA 4XPZA 1Q0QA 4A1OA 4EENA 4BX0A 5FPPA 1R15A 4BNUA 4C6TB 2C57A 1DKUA 1TLLA 3ZJTA 2RI6A 3E5HA 3A8TA 1V48A 1VPLA 5IKPA 3JATB 3LTEA 4JLUA 4YJ2F 3UGTA 1YCDA 3O91A 4LZWA 4JXZA 4MW1A 1C7EA 2XUPA 2ZT8A 5ALGA 1IN4A 1RRVA 1MCZA 4A6EA 4CM7A 1WU7A 2Y1FA 2P4HX 2H00A 4AJPA 4HYTA 1ANKA 2D62A 3OY7A 2YQ5A 1MA3A 4XGQA 3LKDA 4RNCA 1E3WA 4OMUA 3VKVA 4R1SA 2BSXA 2AG5A 2ZSDA 3AIIA 5FQOA 5T6MA 3U7QA 3WLFA 3GQVA 1Y1KE 3Q5GA 4S04A 4IQFA 1R0ZA 2GESA 4TQUS 1JJAA 1XMXA 1ZNWA 3A4NA 3CZPA 4MVJM 5K0JA 4FW8A 4WCVA 2J45A 3WADA 1T25A 5DNYB 1TM7E 4NPCA 4Z9AA 1NN1A 1HORA 3K30A 5LZ2A 4UARA 3AF6A 4JYAB 3ZXYA 1E8MA 5L4LA 2NP7A 5L3SB 4E31A 5KHAA 3NBAA 2OBFA 1KP9A 1QTNA 4GZ3A 5ALUA 4B35A 5AHOA 2OSBA 3ZCSA 4RMJA 2A6PA 2I6GA 4TL6A 5DRTA 3ZZ0A 1TYDE 3H6KA 3C8HA 3UHFA 1R6VA 3OT1A 1B0ZA 5D5PA 1MVNA 2BC9A 4ZVNA 4E5NA 4L2IA 4NPHA 5WRFA 3VJKA 4XZ3A 2CUZA 5KYWA 3K15A 3K4PA 3CMCO 2WMDA 1FNDA 1UOQA 3ANTA 5DIZA 2WIAA 3CRRA 3ROXA 1AKWA 4WLUA 3VPFA 4ZI3A 1U8AA 2FYTA 2J33A 4KFTA 1DKMA 3KB2A 3MWJA 4I50B 1PTKA 3BAFA 4W1QA 3JX9A 4EJ0A 4PAMA 1E1KA 1G21A 3BMQA 2ZJFA 3IB6A 2Y71A 4NONA 1YJ5A 5CCDA 2HGZA 4DMMA 1J8DA 1EM6A 3KELA 3ORYA 1TKAA 2G06A 2QQEA 1MD9A 1OT3A 4IEEA 4JQSA 1B2RA 3HRIA 5DSZA 3WE7A 4A36A 3PQFA 1R8YA 3M6AA 3U5TA 4NSNA 4LEIA 3WRXA 1MGOA 1V37A 4Z2YA 1MVLA 2C2ZA 4R2IA 5FL7D 4DBZA 3U16A 2OYCA 1FUEA 3GFOA 2IW3A 1IWPB 3QPAA 3F4KA 2CT8A 2A67A 2CV1A 1KBQA 1JFLA 4OHOA 4CTJA 5FUQA 5CCBA 4AMZA 3N7AA 3HFSA 3ROTA 3TFOA 2QF7A 3FETA 2O8FA 1WLYA 2JJMA 4HCJA 3RH0A 4AD8A 4H77A 1P6UA 4WN9B 1QHGA 2DZDA 2Z30A 3S40A 3WICA 3FVRA 1GGKA 4WFJA 1W36C 4OLFA 1Y3BE 3RTDA 4GMGA 2VXOA 2C7BA 1L5MA 3HCOA 5K20A 1NBOA 1JA1A 3RTEA 1CEEA 5DU2A 3U2QA 3ZDEA 4G84A 3HFGA 4IVQA 3ETLA 4KO2S 4HQLA 2CN1A 1PGOA 4WOBA 2D7CA 4XD2A 5L4NA 2I54A 3IAM1 4CV1A 5FOWA 1QGDA 3RYHA 4UXIA 3UAWA 3CZRA 4GP7A 4KKXB 5CTAA 4B8WA 1N78A 4NHEA 4O4LA 4D9FA 1ZM2A 4KYTA 3ZW9A 4ZOCA 2ZXEA 4JDUA 4QTUB 1VI2A 1WOYA 4ZEWA 3LDUA 1KORA 1SPBS 2H3HA 1IQUA 4MO2A 3S7ZA 3TD2A 4Y30A 1V6SA 3RDPA 3SS7X 4FIZA 1OI7A 2VAWA 4RAQA 4EABA 1G3MA 3FN4A 2AZDA 3NIWA 4JBGA 3K0FA 2D3TA 5EQDA 1E9FA 1RJGA 3O93A 2JLVA 1A88A 4D0LB 4J4TA 3T12A 3SJBA 1TW2A 5KMGB 1SGWA 3U4DA 1THZA 2PFKA 4RFSB 2ZJ4A 1NKTA 4O2AF 3RVDA 1V11A 3H9JA 1R4ZA 3OHSX 3ABZA 4D5EA 2MSNA 4LZOA 4DKXA 1JQDA 4N8DA 1EP9A 1AQIA 2OWDA 3H5OA 3DVQX 8ADHA 2EVWX 2GCEA 4HDMB 4P58A 4ARUA 3CVYA 2WFZA 3QOWA 5LP6A 1F2UB 3QEMB 3CUWA 4FIDA 4Z7NB 1KVQA 1VBFA 1P0CA 2XT6A 3BTOA 3FOCA 4RJJA 3RUAA 3D6HA 2X1MA 2CE2X 1PKXA 3EAFA 4FMDB 4MLCA 5JDCA 3I6MA 4TM8A 3RABA 2RKBA 1I4LD 1SXJC 2B92A 3ICVA 3E3AA 1P3Y1 3WQSB 5BURA 1KP3A 1GXSA 2V7UA 2NW6A 2FRVA 4X7BA 4RF5A 5HFAA 4LOAA 4EJSC 4B3MB 3SQOA 1C8LA 2IPNA 4IOKA 5DTJA 3HCBA 1KAMA 4QDOA 4Q05A 2J3JA 3C3EA 3U44A 2P6RA 3MJEA 2R00C 4L72A 1D7AA 1W94A 1Z16A 4PYNA 1H6DA 3F49S 4M9SA 3FNQA 2F4NA 2G1KA 3M6IA 4DR3B 3AZPA 1X1CA 4ZOEA 4JA2A 1K8ZB 2EF0A 5I8ZA 1C0EA 2VHZA 2QN6A 3CLUD 4D9NA 3KXIA 2ZI9A 3DVSX 1LLCA 2Z57A 3DBOB 5HA5A 3AUFA 1ULAA 4HDSA 1PR1A 3IT3A 3HKCB 4ETWA 5KOIA 1M5RA 1Y9ZA 3E61A 1JKJA 1F9AA 4NMHA 5HZHA 4DKJA 5FUYA 3LRPA 4KBYA 1XTJA 2ZIZA 5ARBA 1MOZA 2YV5A 1B42A 1MDFA 2ZUCA 4I55F 2P90A 2WIKA 5IBCA 1TZ2A 3PHGA 3AHJA 3ZZNA 5ITWA 5LSAA 4O4IB 4MVJP 3TZLA 3W2FA 5F1KA 4JOBA 5L9AA 3BREA 4W8OA 2EFHB 1CG6A 2WKWA 1HDXA 2A0WA 3E8XA 3NUGA 3TW0A 1CP2A 3VM6A 3FFBA 4KITB 1C1XA 3I9JA 1W87A 2C8LA 2WV7A 4GPAA 1L8XA 2NSLA 4XGIA 1VXOA 3O82A 1MAAA 3IQZA 3BHMA 2AEEA 4LK2A 4TLAA 4JV5B 2PX6A 4O5OA 1HO3A 5LYJB 1F9EA 5BUQA 2PL9A 4J3FA 4PAOA 1JW9B 1U8CB 1ECPA 2AVNA 1IC6A 2G36A 3M5PA 3EF3A 4QPPA 3G0OA 5E3JA 4F46A 3HL0A 4JYZA 3HBMA 4PLPA 1I0ZA 3PWTA 4LKOA 4Q9IA 1HG1A 4RMGA 1QQAA 4OLAA 4KXUA 5FTJA 1IY2A 1UJ6A 7REQA 1O0SA 3IKMB 4ZTUB 1OZAA 3BQMB 4TXLA 2VP3A 3CRW1 2JBAA 2F9LA 2I55A 4HMQA 1D6SA 3OHMA 3V55A 4BLPA 4OKIA 2QIPA 3ZWWA 1LW7A 2OV6A 1CUBA 1GPMA 1JR6A 1FUKA 4W7IA 5FA5A 3UZUA 3VPDA 3TXAA 4AZ0B 3DOJA 5I7RA 1Q44A 3NHJA 4PLGA 5IT9A 4KR6A 2YC2C 3C3WA 1YQQA 2YRWA 3T52A 3H11B 1MX9A 2EYUA 3E9MA 4KO8A 5CDHA 4CW7A 4LF7B 4K0KB 2MHCA 3SKYA 3U3RA 1NG1A 1PQ4A 3O4GA 1IG3A 4C7OA 2ATEA 2YV3A 4URXR 4WOJA 1BXZA 3N28A 5HP4A 3WNDA 4KFCA 1I24A 2VDUE 2RONA 4B0OA 3V3TA 3U7RA 2XRZA 5EVCA 4EKDA 2C59A 4LJRA 4ZYWA 3LO5A 3LUHA 2X23A 3IKTA 5YASA 1HQDA 4ZGWA 1JSRA 3DZIA 1B2LA 4ZQEA 1MV8A 2O2SA 4TXHA 3VC7A 1N6LA 4XVRA 2O54A 4ALIA 5DW3A 4AZWA 3GJ6A 3K0BA 4FWBA 3W4KA 3PQ4A 2X0FA 1JEEA 1U28A 2I34A 3CHYA 2D4HA 2JK1A 3IOMA 3GG2A 5F5XA 5LMCA 1PJ2A 4KB5A 4RV9A 3S7TA 2BDEA 4YO7A 3Q10A 4YP6A 5H3CA 1YS2X 3BMOA 4F2GA 2AHRA 2H2WA 3AEKB 3KDAA 2IBSA 3WB1A 3JSAA 3RNOA 4A92A 5FBLB 4BB6A 5EMHA 4V0QA 1E9BA 5A9RA 2ZB2A 3V4SA 3V2UA 1K9VF 4FFRA 5IJWA 2BGIA 4K9NA 4PLTA 5IWAB 1D2AA 4G09A 3HO1A 4EA9A 4OQQA 2IHBA 5A3SA 4NNOA 1ZU5A 4B87A 1S2LA 3NVMB 1CUIA 2P6OA 4ROTA 5CYFA 4DSTA 4URVR 2WB2A 3IE2A 3RQIA 4G0XA 3MPOA 2I3DA 4ZTZB 2JVKA 3C41J 4EA8A 1ZVVA 5HOEA 2EDCA 2ID8A 1GADO 1HYGA 2NXCA 2R751 2BMVA 2FZGA 3BQ9A 1Z5NA 3OQJA 4HTFB 3EIFA 3VYWA 4YAKA 4DNFA 2C95A 5CHYA 4DNPA 4QT4A 2PO7A 4DZRA 1OXKB 1M0SA 2ZRLA 3DKVA 2FX2A 2PV7A 2WMNB 4OATA 4MQ4A 3A31A 3KPWA 2GTPA 1DDOA 1JJIA 4MUGA 3OTWA 4R05A 4R8VA 5IZCC 3BKXA 1TVCA 4L3WA 3RIGA 1PQWA 3H75A 2IUFA 1O87A 3IVGA 3X1WA 1GILA 4KYUA 4EP1A 4BNZA 3GWZA 4K9RA 3HUEA 3G7NA 2C9CA 4C4RA 5LJLA 1UAGA 1RWXA 2VKTA 3LBYA 2IUUA 3K1AA 1R0SA 1U2DC 4OJTA 3PJGA 1E32A 1T2UA 4QU9A 2ECKA 5JC8A 3HM9A 3LT4A 2IYSA 5GVSA 1ZQ9A 3HCAA 3OTQA 4NFLA 2QSJA 5EIBC 1RZRA 1MNAA 1Q0SA 4M1TA 4DHEA 5EHZA 2GEUA 4DR7B 2ZQYA 1C9JA 1J97A 1EH5A 4W9NC 2NN3C 2OCXA 1R50A 1NMQA 1GPDG 3ESBA 2OZLB 3PBKA 2ZRNA 3G5AA 2QUIA 4GBMA 2ESRA 1SUPA 1THGA 2NNLD 5FO0A 5ALOA 4GD3Q 1CUZA 3GZ4A 4XLLA 3M4XA 3C24A 4NWIA 3AU9A 3AM4A 3K3PA 3PITA 4ZA2A 1TTQB 4OHZA 1XGKA 4CLRA 3NYWA 1T8SA 3P9XA 4UXJA 4YJFB 3NHWA 2JI8A 4B9EA 4BLRA 2DXIA 1KJWA 1G63A 2PSDA 1WTAA 1VECA 3GXOA 1TCBA 3DEHA 4AB1A 4P3PA 4XASA 2QY6A 2GI4A 3BGIA 1JU3A 1DBWA 2PLFA 1U8FO 2KBEA 2P69A 2I8AA 2VT3A 3V33A 3OLQA 5ER9A 2Z3ZA 3PC7A 4EGQA 5CNKA 5LZ8A 2V7GA 3CEMA 2JFQA 4JYCA 2P6UA 4YJHB 5CAEB 2AUMA 2NADA 5A7HA 1ZM7A 4D25A 1UJNA 2H51A 1V8FA 1Z36A 4M0PA 2VUUA 2ZJ7A 3H18A 2FSVC 4AJ4A 4AKTA 1GGVA 1WM1A 2R79A 3VYSB 1J9GA 2I03A 1PJ4A 4MKHA 2P68A 1FC0A 4F71A 1XJCA 1M7BA 5TPWA 5DI3A 3ROGA 1HDIA 3T7SA 1TJ4A 2X41A 4HSGA 4DUPA 1BX0A 3P9PA 3K9HA 4WZBB 1CJUC 3QBVA 2J3DA 1DRUA 2WUVA 3LVQE 3M49A 3DMGA 1J1UA 1G20B 2A30A 3HEBA 1N8TA 3V4FA 1A8IA 4Z7QB 1JSCA 1VLHA 3SVZA 1R0WA 5A6SA 4P3NA 3VBEA 5JNSA 1J8VA 2BFNA 4Y2PA 4OGLA 1DE0A 5B2FA 3SJ7A 4EB0A 1AB6A 4RQUA 3WO0A 4GC5A 3MINA 5ENZA 4BQIA 4L4UA 1I2CA 2C1XA 5EFOA 5FOVA 5P8WA 3NTRA 1VE6A 4PC1A 4OUDB 1DX9A 1M6EX 1H1LA 1QGUB 5K4AA 3UC5A 1CUXA 4TTJA 1RYFA 4FYPA 3VPGA 1INLA 2ZREA 4A16A 1W0KD 3SZMA 4YRSA 3NBQA 1WOMA 4KXNA 4BIMA 2QN9A 5CD9A 1SXGA 2WYIA 1LBIA 3DDNA 4AF8A 2I1VB 1B93A 4GNRA 5LP6F 3KKZA 1CU1A 4QA9A 3SFTA 2YWJA 1E66A 2WILA 1EGVB 2ZJ5A 1IHUA 3EBPA 2X1VA 4C89A 4X0EA 5I7WA 2NZVG 2PMBA 4PG8A 1C9MA 1NJ2A 4QYMA 1PQUA 4HNHA 2HKIA 3JWGA 3OIVA 1WU8A 3AR7A 1KY3A 1M9NA 1SIUA 1IHYA 3QKRB 3RLFA 4R2LA 2JKZA 4E12A 3F90A 3C3AA 1QHYA 1KPGA 2GSDA 4GH5A 1DU4A 4RK5A 4ZAXA 1SR8A 2IYXA 1BFKA 1QF7A 1FUIA 2I6FA 4ZCSA 4TYWA 4FS8A 1PX0A 1OBCA 3AK4A 4BXOA 3ICEA 1OMOA 1LBHA 3UB3A 1S1MA 4MGEA 4ZVKA 4WK0B 3NI2A 3AUJB 5AK0A 3RC7A 1QYXA 3I83A 2CMHA 1ISIA 2K87A 5BQFA 1D2HA 1UK6A 2ZSAA 1GFZA 1X86B 2UXDB 1WWKA 4TSFD 4DV4B 1SBYA 4GPD1 1E58A 3NT5A 5HIIA 4RTOA 2PMKA 4W9RA 2EBUA 3QHQA 3FZEA 2WF6A 4RCYA 3NRCA 5DGHA 5A4MS 5JAQA 2VRBA 1GCUA 3FMFA 4UAVA 5ALLA 1Y1TA 3WGMA 3V34A 3AY3A 5L45A 2Q46A 1EFRD 2V0NA 2XLCA 1GU7A 1Z13A 1FIUA 3TBHA 3TOZA 2NSYA 3WYFA 2GEBA 1XTPA 4EBFA 3N2LA 3SZUA 3KWMA 4X54A 3C6QA 3WLLA 1DP4A 1O2DA 1TPZA 1TAHA 3HGTA 1QIDA 1A2KC 2PGXA 3N3AC 4OM8A 4PPGA 3VPXA 4W9MC 1N0VC 3HZOA 1W0KA 2CFCA 1XCOA 2CD9A 2J87A 2Q49A 3OFVA 4H27A 3THXA 5EVJA 4FOSA 4DR6B 1ORVA 1KRXA 1M10A 2XAAA 5DYIA 4Q02A 2PUAA 3L04A 3WGQA 4IKEA 2LXNA 1QFMA 5H16A 3B3GA 4DLZA 1NBME 1NRIA 3FF4A 4M60A 2OO5C 2VKQA 3EH1A 3NEPX 4M3NA 3TUIC 2O07A 1L5ZA 1P3JA 3E7PA 2CHEA 2IXAA 4FE7A 5KVVA 4HNRA 2QUAA 5DKFA 4ER5A 1BGWA 1V43A 2CLKB 4RVFA 4BWVA 3T61A 3F8TA 3EXG2 1TLFA 2CHGA 2YVQA 3T9AA 5BN4A 5F76A 4PO3X 3T7DA 2R47A 3PUHA 5IYZF 4P4TA 4RXTA 4R71A 1RXVA 4KPYA 4JLJA 1DQYA 3INNA 1MO4A 4NATA 2GHRA 2GZRA 1O9BA 3UWDA 2IKQA 3S1SA 3FOFC 2W22A 4JI4B 4GMKA 1WAMA 4D4IA 1NM5C 1U2SA 1Z5WA 3K70D 1CD5A 4GZMA 4LRTB 3H5VA 4Z4EA 2CV0A 1AUXA 3ZCXA 1IDN1 2IYUA 1CB7A 1S2GA 1BN6A 2B83A 5ARDA 2J09A 2HCTA 4O25A 3X3HA 4TSFA 5TVKA 2DTEA 5EZ5A 3TB6A 1QQ5A 2A57A 2HBQA 5C8VA 1T35A 2V0GA 2H7YA 1TCAA 3OESA 4YMSA 3RRBA 2P41A 2HJSA 3IOCA 3KNZA 4GZ6A 2LUOA 4O4JB 1WMSA 4PBRA 2MSDB 4OSOA 4UUBA 2CZQA 4BLUA 4KZKA 1QBKC 1H05A 3IA7A 1M2WA 2NZXA 3OSUA 2UUCB 1EFRA 1JDJA 3PIIA 3CJTA 2OFWA 2RIRA 4ZHQA 4HYQA 2XITA 2NXNA 3LW8A 2CJWA 1J8FA 3JASA 3J7TA 3NHRA 4YK7A 5E1OA 5DLDA 1JECA 5T4BA 3L0BA 1RPAA 2PMWB 1E2FA 3O94A 5A04A 7MHTA 3DVAB 4MV0A 1X7DA 1W9HA 3P5SA 2XUGA 4YLEA 2ZJZA 3IUMA 4B6OA 4RKRA 1WULS 1ZOLA 2AFRA 4DYVA 3VNRA 2VI5A 4AROA 1S7GA 3ZCQA 3ELYA 1KMHB 1M2KA 1UL1X 3ZE7A 3F98A 2CYAA 2NGRA 2ONYA 2AG6A 2HA3A 3MLEA 3H5AA 2HUPA 3SU8A 4KK4A 4R7ZA 3GLTA 1A5BB 1P0QA 2YUTA 4JP3A 3QEKA 2G76A 2ZUBA 3NC1C 2L69A 1KE1A 1Y8AA 2R8OA 2QUBA 2H11A 4FFBA 4UEOA 1ENZA 2XMGA 1XTTA 3D0RA 3T7JA 3BIFA 3C4JA 5ALWA 3KUKA 3RW9A 3VZSA 3Q3HA 4LOIA 1UQRA 4FCCA 1S89A 4HXGA 3FIUA 3ZBPA 4BRZA 5JQGA 1HYBA 4F12A 2ABWA 3HHPA 5KU7A 2P9GA 4YQFA 4MRPA 2PUVA 4YP5A 1ETUA 3JYHA 3S1LA 4G01B 1ZH2A 3S2YA 1RWKA 2XUQA 3JVIA 1BVHA 3N2NA 4M0MA 3CF6R 2LDBA 3E5MA 4NYIR 1O5TA 2CZCA 3KCQA 4IDGA 5IBQA 4CMKA 1RW4A 3ZWPA 3HU3A 3K4HA 3VI4B 2CYCA 1OROA 2IEGA 3WXBA 2FSUA 5LNK6 1SXIA 1PG0A 1ZRNA 3IEPA 5H9VA 3SBXA 3K9FC 3RAFC 4IWXA 1IAQA 1X74A 1Z5OA 4JBYA 2VJAA 4MCHA 3WL7A 1CRWG 5EP3A 5E3HA 4DC1A 3PYLA 3EGDA 4JSYA 1K6IA 1SXQA 3GLUA 3OZFA 3E7DA 4P4SB 5D84A 2RGRA 2F3QA 4EMTA 4US2R 1GO2A 4QL3A 4CEHA 3L05A 1MQAA 3QTTA 4X1KA 1IWBB 3DHWC 2Z6AA 1N4DA 2B4KA 2GB4A 1JALA 2GEDA 2HQ1A 2R1TB 3EMBA 3ROFA 5JV5A 1RJWA 2FF5A 3AEYA 5JD3A 3C8MA 1FJXA 5KYYA 2HHHB 5P21A 1Z7EA 1R0BA 3LT5A 1U2ZA 4FFDA 3W2IA 2VZ9A 2ZUFA 4JJZA 4CLDA 1O8CA 1UP4A 2BMWA 3RS3A 4ZO7A 3CVOA 5D5HA 2ZPTX 3VKFA 4ER3A 2NO1A 2Z2KA 5CP8A 5K8JB 1ADCA 4NHOA 4YPOA 4A0GA 4KIGA 1KFCB 1Z4KA 3FF1A 3PUIA 4QJ3A 1DC7A 5IFKA 1JEQB 1W85A 3MGAA 1P91A 1SELA 2J30A 3BBLA 2Y77A 3KKQA 1VIVA 2OFPA 2HYIC 4LBZA 4TUYA 4BECA 1RTKA 3E8SA 3LX4A 1TTTA 2B69A 2QROA 3SQDA 5IDYA 5L51A 3CX7A 2QR2A 4OL9A 2KWIA 4MKZA 1AUQA 2PG3A 2A9OA 5KINB 2GN6A 5DEOA 3FOEC 2X7XA 5AJVB 1U6JA 4IMJB 4YT8A 4FMBB 4MW2A 1XMQB 2BLNA 3OKFA 3ZWDA 4C0AC 2VJOA 3BXGA 2M1XA 2ET6A 4YJ3A 3TQOA 3ZHTA 2AKAB 4YASA 2GEKA 3KHUA 2XB8A 2CNLA 4FSDA 4OY3A 4B1FA 5B3JA 2MINA 1SG0A 1R4AA 4F4UA 1L7OA 5CHEA 3DZDA 2CBXA 2AA3A 1C8VB 5ICSA 1WB5A 1BX3A 4GPEA 5DSXA 4G0MA 4ONEA 3S4YA 1TO2E 5BWBA 4FILA 2WSIA 4PZLA 1K63A 5KQLA 1EFVA 1XMVA 2BFWA 1ODIA 721PA 4CKBB 3ZD6A 1KARA 4CM4A 1XZNA 3LHDA 4MLPA 3DDSA 1FRVA 5KOYA 3NHBA 2ZBRA 4KPFC 2WNHA 4ZJPA 3O90A 3QWAA 5HIAA 1VMEA 1YNOA 4QPCA 4EHNA 5A9SB 4J8PA 1COWD 2D1QA 3FBTA 4IEFB 1CQWA 4B3XA 1WXWA 2AEMA 4X1YA 3OQOA 1HQYE 4B71A 4DQ0A 4XI9A 3TUJC 2DY1A 4P38A 4HQFA 3X1MA 3DGEC 4CKZA 1JF8A 1IFXA 3LK7A 3DF9A 4RKQA 3T7EA 4B33A 1DIRA 3BHIA 3BSFA 3B13B 2HDOA 2LP4Y 5A7FA 2WOOA 4D1YA 4DW8A 1RFLA 4EUHA 1LJ8A 1CB0A 1U6IA 1PTJC 2XA2A 3WLPA 4DCNA 2WKRA 2F9FA 5EL0A 3FTPA 1CUJA 2IYVA 2R6JA 5GJVC 4MQBA 2D2VA 1W1IA 4F9TA 1X8KA 3H2GA 2FUEA 2VNSA 2B98A 4I08A 4FYJA 4X62B 1R4MB 2FK7A 1AXRA 5CGQB 1II8A 1T1JA 1F12A 1G18A 5AHRA 1WTCA 3GYBA 3M9XA 4MARA 5K8TA 3LY7A 3C1TA 1LK0A 2AMJA 3EYWA 3FB4A 3SYKA 4ZXPA 3DB2A 3U37A 1IVNA 1BHO1 1GLVA 1SWWA 2PXHA 13PKA 3UH0A 5I01A 1L9XA 2YMQA 1EM8B 1V47A 5HMMA 2NQ8A 3AFMA 4N39A 3C6YA 4HB2A 1Z0UA 2HJWA 5FTMA 1NR1A 4LHSA 2H1SA 4KN6A 5IZ4A 3A25A 1X0VA 3OZXA 4GPTA 2X0JA 2RAUA 5A9TA 4TYYA 3QIAA 1B8NA 3ZUPA 1GAJA 3GRRA 5IP5A 1P77A 3FTCA 3EQ9A 1OF1A 4LA4A 1JFVA 3ICQB 4P1ZA 4I1UA 2W2MA 4CETA 2A1IA 4LYFA 3DNMA 4TRMA 1T9ZA 3MYYA 2NUTB 1MXFA 1V1MB 2RC5A 3H1TA 3NYQA 4RSMA 3KV1A 1WNTA 1CY8A 2ZETA 3LCCA 2K6GA 4UZFA 1KZ7B 1YB5A 1COWA 4NV1A 3HMKA 2Q2VA 4PCVA 4DEVA 1BW9A 4CV0A 2UZAA 2GBGA 4MH0R 5A7GA 5K45A 5TDHA 3F6PA 2VJBA 4FNAA 3UK0A 3R7BA 5CRIA 1TUBB 1WUTA 2HXYA 1GPYA 4W5HA 3TTYA 3ZDYB 4YB8A 2YMLA 4UU1A 2UAGA 1MRNA 4FCWA 3CVXA 2HK6A 4OP2A 4IVPA 4CT4B 1T13A 1JLLB 1TM1E 2WABA 4NEGA 5ILOA 1UAAA 2O2IA 1HNNA 3EXHA 4DLUA 5EXEA 5C3MA 1UKEA 3AVYA 3EZ7A 3FCSB 1IL0A 2GA9A 2J3LA 3D3NA 2YWBA 4Y3UA 3DJYA 3EVGA 3INYA 4HQNA 5DM60 1TL7C 3RC8A 4NJEB 5AESA 1DBSA 3TRHA 2GX6A 4LNUA 4URWR 1NYRA 1NIPA 1RZVA 1EQAA 4F45A 5DXAA 4Q19A 3B7PA 4HMOA 4PN3A 3KXKA 5JJCA 2PJUA 3QBDA 4M6WB 5KTMA 2BBWA 4FOTA 4HDQB 3JYOA 1EJ6A 3FPEA 4M1EA 3WKCA 4TQGA 4NAUA 3AWIA 4C4OA 1ZIDA 2VUTA 3JQ9A 3SXJA 2GZ1A 1XMIA 3Q3VA 1UJMA 1KIAA 4Z2AA 2X5KO 1RXYA 1O8BA 5G0UA 5ALHA 2O2GA 2H2IA 4IHJA 1KO8A 2JI4A 3BWDD 1DHRA 4Y2SA 5JSZA 1P1CA 4BNTA 1KTIA 1LF0A 3L43A 4Y9TA 1Q1ZA 1USGA 3CWZA 1DCKA 3P2JA 1NPYA 4RLHA 2R6FA 3RT9A 4FLEA 3TLBA 5ABPA 2VNKA 4UUOA 4YJGA 3SEZA 1YVRA 4XR4A 2X8JA 3ZNOA 4DC9A 5BR8B 4ZHQF 1ECGA 4LFAB 3WAKA 4MJ7A 1JPNA 5AKIA 3UEOA 4ENQA 4HN4B 5C51B 4QODA 1DBPA 1ISRA 3SEFA 1HTWA 2AK2A 4C76A 1CEYA 3OOJA 1HBJA 4PYQA 1UM9B 5LDGA 1L5GB 1Q6YA 3K5WA 4M7OA 4WFKA 2BKUA 5FFMA 2HDNB 4DADA 2IH2A 5BWLA 3ZY2A 4YCMA 3OOYA 4CHTA 2OE2A 3FZQA 4G0QA 4U5XA 3ZIUA 2WLTA 2CMGA 5REQA 2IV3A 1DEKA 3N2KA 3SX0A 5LQKA 5EESA 5IAGA 2QJTA 3DUFA 3HR4A 4NNPA 4PS0A 4YUZA 1MAVA 3QVSA 5KQMA 1TFRA 3RIXA 1G64A 1PR4A 3K8OE 2DHQA 2HPHA 4KPUB 2P4QA 1U3TA 2IZ0A 2W8ZA 5AI9A 2EU8A 4BAUA 1C50A 4QNRA 3R9IA 1SB8A 3PNLA 1TTPB 3U48A 2H5LA 2HU7A 4BO3A 4N6GA 4E22A 1AKYA 1T0UA 1Z6TA 2DKNA 3GB9A 4ZO6A 4EB3A 3S8EA 1NVWQ 3TR0A 3WGJA 1PZMA 2NU7B 4J7XA 1LVHA 1D9XA 4JQCA 5CB0A 1QJCA 3LRTA 4GW3A 2B2CA 4GWLA 5FPHA 2NWQA 2ATIA 2CYBA 1E3QA 4WFIA 5FEMA 3WL3A 5HK8A 2VNHA 5LDHA 2O19A 1XZLA 1QIHA 3ZDZB 4N5NA 4EJ2A 4HS4A 2ZRMA 4DTIA 1AGYA 2H1WA 3HU2A 3OLXA 4KH1A 4OJMX 5EMMA 5DRYA 4EPWA 1XKTA 3HCDA 5IT5A 3TW4A 3TW8A 2Y76A 1S01A 1UOOA 3JAKA 3KVRA 5TARA 3RUDA 4YDQA 1QCZA 2Z56A 3JYQA 3GP5A 3DE5X 4U8GA 3IT1A 4R1OA 2GXUA 4JH0A 2D59A 2JHFA 1OH8A 2FMTA 1GAEO 5JARA 2WEKA 2GF9A 2COKA 1YRAA 2J4FA 2CXUA 1Y8CA 4J7CA 4PO9A 5DM70 1HNZB 2Y1OA 5ESWA 1KSFX 3HJNA 1V7PC 3DZGA 3FCCA 5LQDA 3AILA 3ODGA 1TMKA 1YQ9A 2MTBA 1WHSB 3DP9A 4Q01A 4TRNA 4XGNA 5LQRA 2G1JA 3ZDFA 5JQWA 4CDMA 4E13A 3DFFA 4XYMA 7ADHA 3FDZA 4PLYA 4KQGA 4ESHA 1BWQA 5CEFA 2ZZNA 3FXAA 4MUXA 5AVJA 4G07A 4C3VA 2HBRA 3X1DA 3ZUGA 1ZHOA 4E5MA 3VOTA 4UFPA 2BEWA 2WZQA 2XOEA 1FFAA 4URYR 2YIJA 4E2FA 4CMHA 3H2IA 4K6FA 2C20A 3H9QA 2B35A 2H2DA 1JDBB 1ONOA 4ZTBA 3ZY6A 1IY8A 1Q0PA 5CXXA 4WCFA 4CM1A 3WHPA 5FCDA 1P1HA 4DB4A 1ATIA 4WLNA 2COEA 1P18A 3ETEA 2VK8A 4M55A 4D9BA 2IK8A 2DQKA 3I9FA 3GCZA 4AYWA 5G1PA 4FKMA 1H4QA 2XDWA 1H1TA 3S0JA 1N2HA 4TUYF 3WKBA 2B5OA 2B1IA 4EI2A 3G1UA 4UNIA 3SP1A 4KHZA 4JXXA 3UJNA 1N4AA 4C30A 4DR2B 1DKRA 4ND1A 3B8EA 2FNAA 1VKRA 4HH3C 2G25A 3HO6A 4BO9A 3P96A 2NT4A 4KODA 5CM9C 3AX6A 2F4VB 1W0JD 4J1TA 5HQ3A 4PCAA 5BNWA 3IUBA 4UMFA 1X1SA 4YJ3F 1I13A 2J3MA 3AFOA 1OX5A 4FGKA 5EJ4A 2HCJB 3JSXA 2X76A 4C3OB 3GLGB 4ZALA 1QQBA 1N2XA 2VYVD 4R8LA 4TMTA 5E4JA 2PMEA 2VSQA 4C0QC 1VLZA 4EY3A 5EWLB 1I5OA 2OCBA 1GNTA 4FVTA 4RZXA 3RUPA 5GZ3A 4F38A 1PX2A 2XUAA 4W6ZA 5BRAA 3TOCA 4ETMA 1NLYA 2H7VA 1QP7A 4BO1A 1MH9A 1XJWA 5EZ6B 4FM9A 1QYIA 5HE9A 2VH5R 1UDBA 4D8UA 1ZKDA 3L7OA 4ND6A 5ULLA 1A4RA 2I6QA 3HC7A 4RE5A 1DS6A 1J8QA 1ZMRA 1MO3A 3UXEA 5JXIA 3E9RA 2JK0A 5H4HA 4ZI2A 3FDJA 2GZ2A 3GEMA 1GUAA 5KSPA 1A76A 1E60A 3B1KA 2VSNA 2B3DA 2C4WA 4HPXB 5JYBA 3AI2A 3OCVA 1YDFA 2IX9A 1C1DB 1YUNA 1HFWA 2FF7A 1XJ0A 3IT2A 4LVOA 3WP0A 1JNYA 3H4TA 3LI2A 1A95A 2CF5A 3DMHA 3ZLVA 1QHIA 5B53A 3MSXA 1NXPA 2P77A 4BQOA 1NNEA 3A28A 4O4HA 4LWZA 4C7KA 3AEUA 1NNSA 2BONA 4QDUA 4FEAA 1QVWA 5F7OA 2F55A 1YR8A 3KXDA 4JGGA 2WF5A 1ZIXA 4BNVA 4M98A 4Q3OA 2RD2A 2VPPA 1T2VA 4RIHA 1SXJD 4WINA 4F3YA 3K9NA 4GP9A 1J2YA 1JA0A 1KC3A 1M34E 1ZM3A 1N5KA 1NW4A 1Y80A 3E9EA 4WGGA 5CXSA 5IW8A 1JKMA 2C00A 1FTYA 5BSFA 4F4CA 3FR7A 1I7PA 3U19A 1EUQA 1FXWA 4O08A 1LX6A 2BFDA 4XYLA 1GZ5A 4X20A 4OTZA 4Q1EA 4KE9A 1V16A 4ME6A 4N6NA 4HWKA 1QGZA 3GJYA 3O4HA 5FX2A 7YASA 4LKRA 1MC5A 1W0JA 3PYXA 5DYWA 3R7FA 2IVFA 2VDVE 1QX3A 4MUEA 1BEUB 1JFTA 1ZJJA 3AESB 2E18A 2RKWA 1FDSA 1L7PA 2O0JA 4J7AA 4ZVVA 2ZTUA 5K2OA 2NQ2C 2VYVA 1PVDA 3EOZA 3K72B 3PZRA 3F5MA 4K9PA 2BSAA 1FP6A 4R8SA 1K7FB 4A6XA 4DL9A 1OA1A 1M5TA 2WI8A 1IYZA 1I36A 2ZDQA 2CJXA 3N2IA 2IYPA 3FY4A 3HL4A 3L0DA 3R7AA 2GM4A 5C18A 4XYEA 1KGDA 1LVGA 3UPDA 4ENSA 3IVXA 2Q7OE 1DOHA 1CUVA 1KZYC 3D3WA 1CDOA 2EQ5A 1HURA 5K05A 1QOPB 5LU8A 1X42A 1Y6QA 3VHXA 1XRJA 2ZUWA 2ZB3A 2ZUVA 4YECA 2IT1A 2IU0A 3S28A 4D3DA 1WMAA 3FFXA 4MQ6A 3ZXXA 3OPYB 3BCSA 3RT7A 1ZD3A 3A10A 2Y67A 3H86A 4DLXA 2OLEA 5ICMA 1KJYA 1KYQA 2OM6A 4GXQA 4JC4A 4O5AA 3ILVA 2I4NA 5IT4A 3QNMA 3A6KA 4IIXA 1PI3A 4ZIRA 3O83A 4Y2HA 1LDMA 2IHYA 2GBIA 2O20A 2QI9C 3DXXA 3DYBA 4H7FA 4U6QA 4B6EA 3MFYA 4LJKA 3G6KA 4AP5A 5LIRA 3V00A 1HTBA 2I4RA 3STWA 3R4VA 3TMKA 3ZWBA 2GBFA 3PI7A 1L6IA 4KQCA 1JZTA 4XQEA 3PUJA 3CLSD 1VKOA 3GVCA 4WOPA 3CIFA 3H8WA 2GF2A 3M34A 4ER7A 2ZSJA 1SXJA 2Z1NA 3RADC 3S5UA 3C6MA 2Y1KA 2X8WA 3E3OA 3OFND 3Q7PA 2V5VA 1CV2A 1UBRS 2BKLA 4QFBA 4EJSA 4YAOA 3QWBA 2EATA 5FJIA 5JANA 2ACWA 3HG7A 4Q3EA 1L4HA 2PD4A 3ZJYA 1RZUA 3PRKE 3R7DA 3PQCA 4GMXA 2R00A 4ZGBA 2FVYA 4QE3A 3GX1A 4G8CA 3K1JA 5BSHA 4POAA 1DRVA 2ZVPX 3B9QA 1Q0ZA 3WYNA 3PS9A 4TT8A 1TO6A 5FBWB 2YHSA 4BLOA 1YZ3A 2Z83A 1BXRA 4I1IA 4UJ3A 2TRSB 2V74B 4RVCA 4WMLA 5I5GA 3SOPA 5J47A 1RPTA 4B3TB 3VO9A 4LE1A 3AV0B 1GGNA 2GKGA 1Z2EA 3Q88A 4TV9A 1KJ8A 3LC7O 5H80A 4IHJF 4LZAA 4MR7B 2IH4A 3ZH2A 2Q9BA 3H2SA 4XCXA 1L4UA 4ADSG 3DLCA 1Z15A 2YW2A 3SJZA 5E0OA 3TPZA 1L4GA 1HE8B 3PWSA 3OA0A 2X2EA 1RAIA 2PGIA 4FGSA 4C4TA 3G85A 1KWKA 3IMGA 3EMDA 2NUAB 3ZQKA 1K6XA 4U7WA 1XRSB 1LC0A 1NX9A 4QSHA 3R7SA 2IDKA 5A3JA 4KWIA 3IO3A 3ZX4A 3NDPA 1EAMA 3WAJA 4Q9LA 2GXAA 2XPCA 5ALQA 2QMQA 2Q8NA 4A5OA 4R1NA 3C39A 1VKHA 3EVCA 5TMDA 3QYPA 1KQPA 3EEBA 5GTDA 2ZRPA 1QWOA 3N05A 3UUFA 4BB0A 2YXNA 3RE1A 4OSEA 2GZHA 2XMDA 3ZDBA 2YH2A 4D98A 4LQDA 1XALA 1T3TA 5HUJA 5EP2A 1GUFA 4XJXA 3H5LA 1NUSA 1MT3A 2HJHA 3NIFB 2H9IA 5EE5B 3C6BA 1R5NA 2XODA 3D1VA 3TQIA 1N6KA 2WYOA 2Z8ZA 1ZINA 4BMYA 1NKVA 2VUHB 1E64A 3GARA 1C3OB 4EG1A 1E0JA 2C5BA 2F9MA 5KTRA 4NBRA 2OC4A 2FWRA 4GNKA 4JJGA 2QUHA 2RGCA 3R5KA 2IP2A 3W1WA 2TS1A 4FS3A 4K5QA 2QJRA 4YMUA 4ZDKA 1D2EA 3DLAA 1NSFA 3I2IA 3PYMA 4FDTA 4C4SA 1TAGA 1S3SA 4XB2A 2WJHA 1JHQA 1ULHA 1FS5A 3AXSA 4LE2A 5CTJA 4EG5A 5JT1A 5ERGB 4XVCA 5BR7A 2RG7A 3LWBA 2DJ5A 1G42A 1Z0IA 2P2LA 1NBIA 3F2IA 1J7JA 1RLIA 4C6TA 1JDBC 1IQRA 1O95C 1XFAA 1ESZA 2HQRA 4LPKA 2DBRA 4JJ8A 4AC9A 1X9HA 4XQ9A 2B1QA 2HRDA 3CW8X 1RYEA 3JATA 4UBMA 1K7YA 4UHEA 1HT0A 5EIBD 3SBEA 2H4XA 2WICA 4HNAA 3ZHCA 2EGUA 3D54D 4J91A 2YL2A 3NZEA 2WSBA 2YXDA 4J75A 4PZZA 2FX5A 4RWEA 2ZBGA 4L9WA 5DCUA 2JC3A 2IA5A 3RSZA 4LYYA 1ICEA 4P5PA 4I4NA 1YB6A 2DR3A 2C9MA 3G5UA 1SVWA 1TF2A 4RJIA 5AVOA 4YIHA 2H4FA 3DEFA 4HUQB 1SIBE 4YCCA 4KXQA 4BVAA 1DNPA 2C9DA 2AZMA 3C74A 1PWZA 1PYGA 3B7WA 4QJ4A 1KH1A 4RJ2A 1M67A 3FUUA 2P3QA 4BMNA 5ALTA 4MEBA 4G4SO 1TT5B 4BYGA 3ELWA 1RWVA 1IVSA 3MN1A 2SKCA 3H9EO 1WF6A 4E11A 4KQKA 2JGFA 4Z6KA 4AMYA 3UBTA 3KZOA 1ZVKA 2JANA 2UYOA 1VE3A 3ET4A 1SBNE 3PCRB 4IAOA 3IH5A 4KFUA 5BNFA 1RE0A 3R3WA 2PQMA 4V0ME 5KIAA 5F73A 1P17A 3E9YA 3IEUA 1XK6A 1GT91 1S2MA 1Y4ZA 3C8DA 4J49A 4P7BA 2FPGA 2ZYTX 4IBOA 1JB9A 1QAMA 5E95A 2GQ0A 2AX3A 3KKNA 3LHIA 4P0TA 4TV8B 3DV9A 3URMA 1PF7E 4YJKA 3F5FA 3G0DA 4I3GA 4MJXA 2NO4A 3DMFA 3KLPX 4R84A 3WLHA 2HWKA 4URFA 2V7PA 4H4CA 3HJUA 1EYZA 1RZ3A 1UFQA 2Z95A 3GYGA 4HD8A 4BFLA 2Y0DA 1W34A 4A27A 2B0CA 4K46A 2YWHA 4BOYA 1AKMA 1XKQA 3IODA 3L8MA 5I9SA 4GEGA 3SOZA 2VP5A 3TTTA 4PNEA 3FCXA 2PD6A 3WMXA 2GCNA 4WXRA 3H2JA 5CGZA 2I9KA 1WVMA 2JZCA 3ICPA 5G0TA 4PZ9A 3M4ZA 3WZMA 1GYQA 3HCPA 2VUSA 3WYCA 5EA2A 4MWCA 4ZICA 1G5RA 1S2OA 2Y4OA 3GBSA 3OY2A 3DE7X 4URUR 1R18A 2QG4A 2PKEA 4F5DA 3IXQA 4DJEC 2PGAA 1NVTA 4D6PA 2CWWA 2C4HA 3HR7A 3KU1A 4X3CA 1W5EA 4C01A 4YV2A 4WN9A 1AQYA 1VL6A 2E87A 3Q41A 4UCWA 3GJ5A 3G89A 4O4HF 2HMTA 1SCNE 4QGAA 3SQWA 2O52A 4HFRA 1VL1A 4EGCB 1Q12A 4BZZA 4JUCA 1H4SA 2XE6A 3PQ3A 2BFAA 4LHWA 3EGVA 2C61A 4BDTA 5CA0B 2I2XB 1OHHD 1ADBA 1JHXA 1T8TA 1YKFA 2JFNA 5J23A 2H06A 4HX9A 4ESVA 4U9HS 4V0LA 5IUNC 4M53A 1YA6A 2VLIA 2GJ9A 3ZNQA 4A15A 1P75A 4LFBB 5GJCA 1Z56C 1TM2A 1RYHA 3HDHA 1HQCA 1I2MA 5HJ2A 1FXWF 1ENYA 1F2DA 1YZKA 5K3EA 1WCXA 5ITZB 2PSFA 5FTNA 2C42A 5IJXA 4O2BA 1NDUA 3GJ8A 1LC3A 2QW1A 2VEDA 4XLZA 2NT3A 5LBUA 3B5EA 4PFQA 3EH2A 1HKHA 1UZLA 3T1TA 2FSVA 5FWYB 1OYOA 2O8DB 4ZCMA 3OZSA 3GA0A 1J6UA 1UT5A 1Z6XA 1V3QE 3PC8C 2BEVB 2VP0A 2ES4A 4W5RA 1PSZA 3C6ZA 1L9KA 3NM4A 1Y7IA 3JRXA 3O4RA 4MWZA 4LISA 3SSMA 3PFCA 4X97A 3IPAA 3R9WA 2VJDA 3S8MA 3W9UA 1YC2A 1N36B 1U2PA 2AHOA 3LWNA 4R83A 4Q7LA 4HDMA 1N5IA 3SEQA 2QLMA 1SKBA 5KNCH 5IFLA 2FEOA 5DBEX 5B58T 2F62A 4RPGA 4LBYA 5FPQA 1F8UA 3QEMA 1PK7A 5B6IA 1HFJA 4DMLA 2FN7A 4LSWA 3PDIB 3H7AA 1AKTA 1SUAA 4D44A 3KWFA 2R3SA 2W7TA 3W9YA 3ZPXA 2ZIWB 3NWJA 4U2KA 5ESXA 3MOSA 5DASA 4FDUA 4WZZA 3ME5A 1MBZA 1W5AA 3LUFA 2JHAA 3WWZA 2BCEA 3WGUA 1RIIA 4NCXA 3SSAA 3P9KA 4UM9B 4ZAWA 5HKKA 3K5IA 4GZLA 2WJVA 2IGTA 3EODA 2FPKA 3D43A 1I1HA 1JXQA 2QNBA 1V9CA 3OZRA 4EUEA 2WU0A 1VOTA 1DEAA 2AG8A 4XKJA 3UGKA 1Z83A 4BE7B 1ULUA 4AUKA 5BPHA 1CRPA 1B8PA 3UT6A 5AVWA 1UPAA 2MSKA 1OHHA 3B1WA 1X7YB 2D06A 2XRFA 3ZNPA 5G0SA 4EGJA 3DO6A 5E3IA 1L0BA 4Z7OB 2IHVA 1K8YB 3PICA 1OT5A 1RACA 3QF7A 4M99A 3QFTA 3REOA 3U4HA 5J2TA 3P52A 4RETA 4BE9A 2B61A 2Y1DA 2R8PA 4UCQA 4N9QA 2O2EA 3S27A 2BGWA 1F0NA 1QPGA 2IXEA 4CEJB 3U3OA 5JYDA 4YPFA 4EB6B 1VJGA 4UPEA 1D5CA 4C0XA 3UT5B 2A92A 3AJAA 4TMXA 1NOJA 4LUCA 2H4YA 4X63A 5AJWA 1N6IA 4MS3B 4NJOA 4WFQA 1ETHA 3I34X 3OE4A 5ALJA 2AF4C 2GJ8A 2BZSA 1M2GA 1W5FA 3V1MA 3VH1A 4F11A 2HNAA 4GRDA 4CKEA 1NUAA 4CM8A 4TV9F 4F2HA 4EATA 5HE8A 1FRZA 2VHCA 4HB0A 2F3PA 5IC4A 4INOA 3BWXA 5EZSA 4JOCA 3AKEA 3MOGA 3TTWA 1AA9A 1HTTA 3IDZA 2WVGA 2AFHB 1NOKA 5ELMA 5AVTA 1WCIB 4B3GA 4MLZA 1TMYA 2INGX 4QQKA 3KQLA 3REFA 1CULC 1N2CB 4QEDA 2XA1A 1E61A 1JG3A 3AHIA 1U94A 3IBCA 1ID1A 1M1YB 2D8MA 2JGNA 2XQVA 3O8BA 3U09A 4PRYA 4D4KA 4ZV7A 4Q7KA 3HXLA 2F1HA 2PJDA 3EMKA 1HL3A 2X5XA 2AR0A 2GPSA 4GAEA 3K32A 4RFLA 4UBJA 3E0QA 2CC2A 5CJPA 2I99A 3GRUA 3UKDA 3KYCA 2HT1A 1XYGA 3EPHA 1DG9A 1AH2A 4JR2A 4MHTA 2GAJA 4AY5A 3U3KA 2J3EA 1PLJA 5DFAA 3VO1A 2NXJA 3ZWNA 1DLJA 4JYPA 2HA4A 4LDZA 1Q19A 4DDHA 1KJIA 1UEIA 3NYIA 4AZ0A 5HKBA 3O7WA 3W6NA 1EZ1A 3SKXA 4CKXA 1YRQA 1QVAA 2UKDA 3B6KA 1HDGO 4D9KA 2Z08A 3E4DA 1P0FA 1XZEA 1QHXA 2YOHA 4YYEA 2V9PA 3R3VA 2AMFA 4U2CA 1Y9JA 4W7HA 3ASUA 2W71A 1IHOA 4MKGA 1EDOA 3K0SA 1CDZA 2GBPA 5KDLA 4KXXA 2BKVA 4RPLA 2OT3B 1VMDA 3MAJA 4TLCA 4Z4HA 3C7CB 4PINA 3QLJA 5F78A 1LWNA 4I1VA 5IDXA 1GPBA 3HBJA 4WV3A 2PX8A 4P2BA 3LXUX 4P8RA 3MOIA 2WD7B 2ZWMA 3B9PA 4OAOA 1PJSA 3Q6MA 4B4DA 4BTLA 5JZOA 3MS7A 3BJEA 3ZWMA 1T3LA 3AFNA 3DF7A 4NYMR 2ZEJA 3WLMA 1ZLXA 3GNSA 4LTNA 1YE8A 1PUXA 2IPXA 2Q1UA 2BY4A 4Y8VA 3AM1A 4XARA 4QULA 2DEUA 2B1JA 1U7ZA 4UTRA 4WCDA 4I81A 2EARA 3W1EA 3TGPA 1OREA 4JBWA 5D1HA 1KQNA 1TUEA 2VFAA 5FV4A 5JWRA 3D2AA 4MHSA 2FZKA 1J99A 4C5AA 4FMPA 2R60A 1AQLA 2ZBUA 1KDOA 3WL5A 3GOQA 4LMRA 3ENWA 3I09A 5CDSA 5HS6A 1P2DA 4UMVA 2FN4A 5FQNA 2JGDA 4FHGA 4JZKA 1ZK2A 4D46A 4DEYA 3HN6A 4EI8A 1BGXT 5JO9A 4ZJYA 1Z9BA 3H2KA 3ZHQA 5JALA 1N34B 1V2HE 1K2WA 2V5UA 4J9UE 1SIWA 2QM3A 4GSYA 4IP0A 1MORA 2I1WA 3NAQA 5CH8A 5DNVA 3P8ZA 4RD4A 4GF5A 7AT1A 1KYXA 1WQ3A 3AGPA 3KLOA 2PEZA 3QKTA 4GS5A 3HKEB 3OZEA 1H2XA 4I2VA 4I9FA 5FLKA 4D9MA 4AY4A 4G9GA 3WQRA 2C2OA 1Q3TA 2Q2WA 2ZTVA 3OHPA 4HAOA 3IIMA 2B2XA 3ZS9A 2J5XA 3OCYA 4YRAA 1UOPA 2XADA 3MTDA 4CFZA 4F4HA 1TAQA 2DHRA 2ZTLA 3V1KA 3W7BA 2QTVB 5ARCA 4U39A 1Y3DE 1DIAA 1GL7A 3NM6B 4YI5A 3EEOA 2C7OA 3DZ8A 2LGJA 4UUMA 3U7EB 4RKYA 4F3CA 1LFDB 1NW7A 1XXHB 2X8AA 3L8HA 4WZAA 1N1MA 2HEGA 1XCMA 1UC8A 3ZHOA 1JH9A 1EUYA 1PS8A 4LN1A 3A9SA 1GQSA 2JFWA 3LS2A 4Q15A 4QDZA 5HIJA 2F48A 1JG1A 3F4BA 1OX6A 3SLKA 4MRRA 2A7QA 3LPDA 4NEQA 2PLWA 1MPTA 3REQB 4AF7A 4F84A 1YE5A 2RB4A 1UFKA 1UDRA 2HV8A 1HG0A 2H8GA 3G0BA 4BBPA 2FSPA 4JENA 3MRTA 3PHJA 4BUJA 1JIQA 5EEHA 4Y0VA 3GXBA 4MYUA 2WJZB 2AMYA 2OK8A 4XPIB 5KSYA 2F6RA 4Y1GA 1JWAB 3MJCA 3PHCA 1XO1A 2ISCA 4PY2A 1XQ6A 3TSZA 5T57A 1XRNA 4EKEA 2O8BB 1BCRA 2VCYA 3PVZA 4CIDA 1TK2A 5GADl 4JY7A 4B0PA 1VLVA 2PSEA 3WA7A 4L1KA 2NMVA 2GPBA 2OTCA 2VP9A 3PDCA 1VC2A 4N5IX 3ER9A 4JQOA 4ZJUA 3EDQA 1JJVA 2CLMB 3NBMA 2R97A 5GQSA 4JOQA 1ZIPA 3G8BA 5HK9A 1P7CA 5HJEA 2OZKA 3AB3A 3N8IA 4J4HA 4CR6A 5CAEA 5T3YA 3W34A 4WLEA 5EQFA 2WWHA 4EA7A 3JWJA 5BUZA 1FSFA 1P3DA 1X1QA 1QORA 2AC2A 2EDAA 1EAYA 2XQFA 1NT2A 3M6VA 4KN8A 3W4IA 3LO8A 2PFSA 4M8SA 2XB9A 3SLRA 2QWXA 3OZVA 4FNOA 4RSGA 4Y1RB 1FVXA 1KKUA 4QOEA 5DV9A 3CZAA 2YJ3A 3EXEA 5LQMA 1HMPA 1AZTA 1GAQA 1V9SA 2VPQA 3DD1A 3FHLA 4Q6BA 5B58C 4WZBA 4EH1A 5JCJD 2X3YA 3BPSA 3V7NA 1UZAA 1P0MA 1QCCA 3TQFA 4UVGA 4DJAA 2L18A 3AUKA 1T8YA 1ZWLA 3AWDA 3HP7A 3LY5A 4YRPA 4CU2A 1TQ4A 4L50A 4R8RA 3Q1KA 3Q7QA 5KYTA 4HRVA 2XNCA 3BTSA 3M8KA 4QZVA 1D2NA 3QE2A 4NULA 4TPKA 4ASUD 2V6FA 2JPDA 1D2GA 1H8HD 1IB0A 3GJ7A 4X1IA 5ED4A 3ILXA 5AH0A 3ONNA 3LQ2A 3ZU5A 3MCTA 1M8PA 1E1QD 1RRCA 3LUDA 4IJWA 3ON5A 1MT0A 4U2DA 3TE6A 3KSBC 4FGWA 5C1OA 1W4BA 2ZITA 1HSZA 1ONNA 1PQPA 1ZBQA 1OXBB 1ZIOA 2OZPA 3VZRA 1Z8NA 3M9WA 4AUMA 1VE9A 3T9CA 2I33A 3IDAA 3MMNA 5AVZA 1H5UA 4B3HA 4YIKA 3GFTA 1R8QA 3OKAA 4M0KA 4M8LA 1WUYA 3SM3A 1NGSA 3BIWA 4FMDF 4IIJB 4JVSB 3KOOA 4H6XA 1U5BB 3FZYA 3VO2A 3BK1A 1GPKA 3TVYA 3DOFA 3W7VA 5BYJA 3I05A 4EYQA 3ZQ6A 1NPTO 2IYTA 2P3LA 4KSCA 5CM2Z 3U4AA 1RHQA 4N3GA 2XZOA 5IEJA 3RU9A 3A9UA 1AUVA 1F0YA 3VR5H 3R0VA 1G8FA 4RA6A 4BN0A 1OC4A 1NMXA 2XUJA 4FYHA 2MSLA 5FFFA 3P2EA 3KZCA 4FYMA 4Q03A 5JMPA 3MGCA 3OI7A 4B3RB 1QZUA 5AM0A 1CR2A 4XVQA 1N5DA 1CEQA 3R5FA 1PTJA 4X8LA 1YJ8A 5D85A 5J2TF 4DARA 5ALIA 5C80A 4ZEOA 4DUYB 3ZV3A 2GRJA 4HUJA 3GEEA 3S3TA 1XTIA 1KETA 1Q14A 3LD9A 3L8CA 3K92A 5JCJA 4HO1X 2XF2A 3F8SA 1EVKA 4CL3A 2C2BA 4DWOA 1ZJZA 3PK0A 2JGEA 4ITVA 4LJSA 2CLHB 2NAFA 4JB8A 4JOSA 9LDTA 1Z25A 5LXTA 1F0PA 1PJLA 3LX6A 2EBWA 3OZ7A 1DXOA 1NX6A 2WIJA 1L2TA 4JT9A 3CZ5A 5TEVA 3DE0X 1H8HA 2JIOA 2Q4EA 2G80A 3RHZA 1E1LA 2C29D 1U2GA 4B9AA 4C3UA 3EZLA 1UBNA 5H3LA 2AFIE 1E1QA 1XQVA 1WABA 3DMNA 3RIHA 4XCVA 5ADUS 4Q4JA 5LQSA 5AJYA 1OH7A 2HWWA 3ZJ5A 4MX8A 4WXPA 1A9ZA 4R9RA 1M2FA 2BD0A 4ATNA 3T3GA 4F5ZA 5I51A 10MHA 1Z38A 4G1BA 3GP8A 2HUNA 1BXGB 3OLWA 4A03A 3WGNA 2H63A 4E5VA 2EL7A 2QVLA 3RASA 3MYRA 3CCCA 4K6OA 4Q21A 5EYPA 3WP1B 1QV6A 1BZYA 3TZHA 2HPZA 1IBKB 5ERXA 5B3KA 1ABBA 2VJLA 4GSLA 1F38A 1D7OA 1PE0A 4DSZA 1HDZA 3N5KA 5DTQA 2YVAA 2PZKA 3QEAZ 2BFOA 1ZI8A 1I6KA 4OX9Y 1XVUA 1DEXA 3THWA 4D6YA 3ADDA 4QHTA 2XW6A