6PFKA

Phosphofructokinase, inhibited t-state
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the allosteric behaviour of phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
molecule keywords PHOSPHOFRUCTOKINASE
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6pfkA02
4LJLA 4KXLA 3GH1A 2F48A 4A3SA 4HX9A 3O8LA 3BQ9A 4I36A 2HIGA 4P5DA 1F8YA 3HNOA 2KHZA 5AJUA 4JEMA 1T35A 4OHBA 3U39A 2PMBA 2IZ6A 1PFKA 3MAJA 4FYIA 4KXNA 3QUAA 4WL0A 1RCUA 4MEJA 2F2TA 1MTOA 2F62A 4KXMA 2A0KA 4U1RA 4FYHA 4RH3A 1ZXXA 1WEHA 2Q4DA 1YDHA 1S2DA 5AJTA 3UQZA 2NX2A 3O8OB 2Q4OA 3O8OA 3OPYA 4I7EA 3EHDA 2KLHA 2PFKA 6PFKA 3IMKA 1S2LA 4JELA 1KZHA 1F8XA 1S2GA 4LJKA 4LJRA 4MCJA 1WEKA 2F67A 1S2IA 2A33A 4I4IA 5ITSA 4NPAA 4FYKA 2IZ7A 4OHRA 3PFKA 3SBXA 4JENA 3K2QA 2IZ5A 3F5MA 1S3FA 4PFKA 2F64A 3OPYB 4P5EA 3O8NA
chains in the Genus database with same CATH superfamily
3HPRA 2DPYA 1SPXA 1C2YA 2V0NA 5GINE 3SLKA 4ZRDA 1I6WA 4J2OA 2ZI5A 3IHWA 4AJKA 1XCLA 1FFYA 3OCVA 3A1WA 3GPDG 3UN1A 5AKHA 2QAGA 2QPLA 1HPLA 2A8YA 1LW6E 5C5DA 3GLGA 2AFVA 4MVXA 4U2FA 3TGWA 3FVVA 3LXMA 1A4UA 2UUOA 4ML3A 4Z3KA 4G0VA 1MB4A 2PL9A 1KRXA 3LRTA 4D2IA 2XEXA 1EX9A 1KA9H 3QXSA 3HXQA 2ABWA 1REQB 1RWOA 3F6SA 2DKNA 4MITA 5SY9A 4BEJA 5JATA 2B61A 5F9FA 4G1EB 1C9NA 1MOPA 4HVCA 2TECE 1HDXA 3FHOA 1NNI1 1H1LB 3IDZA 4RM3A 1KYWA 4EKEA 3TG2A 2FPPA 3EC2A 3TO5A 1JALA 1SBYA 4HGNA 2C2HA 1AGYA 1Q0SA 5IAOA 4JJIA 3HZZA 4D6XA 1DRUA 3TOSA 1DBQA 1NLUA 4B0PA 2V7GA 2IXGA 4HPJB 2B99A 3O0DA 4UTPA 3DWFA 1A8PA 2VTEA 3WMFA 1VE5A 1RQXA 3DAFA 5BSVA 1QIFA 3V9AA 5CIWA 4MV6A 4KXVA 1PQ4A 1FPMA 4BV2A 2VDPB 4N8EA 2HA5A 2YVQA 1SQ0A 4FYJA 5JAHA 2IYFA 4P3KA 3M1LA 1MW9X 4EHKA 2XCUA 5E9WA 3UMBA 3IDQA 2PV0A 1OU0A 2MU1A 5F3DA 3GGCA 3HC7A 2CW5A 1I1HA 4FMCF 4IY1A 1KYQA 3H1BA 3V2HA 1KXJA 5T4FA 3I8OA 5EYPA 1SPBS 3FZYA 1X7YA 4L07A 2HRDA 1RTKA 4Q3NA 3HYTA 2VQFB 3DO5A 1WS6A 4FDUA 3EAQA 4CKBB 1YA6A 1T1EA 4F6RA 3H9UA 1RWWA 4RC9A 3DMGA 4A2PA 4KNWA 3HCDA 4F1WA 3OTWA 1VIMA 1CF4A 1X15A 5IUNC 3CLUD 1A2BA 4MPPA 2D00A 2YFQA 4M7RA 3WYDA 4C4RA 2W6ID 4DWWA 4QQRA 5JO0A 3V80A 2VH5R 1MA0A 5AH0A 1PG5A 1QQ6A 1YZ3A 1X2EA 3W2FA 4H27A 2OA0A 1DEKA 2B9VA 1WDKA 2CYCA 4JZKA 4BC1A 1DTSA 4R1LA 3ROXA 4BY9E 3V4VB 2QAGC 1F8XA 1E1CB 1KFCB 1TEXA 1VSTA 4PFSA 5DYGA 2P77A 5KX5F 3Q9SA 3OECA 4HMOA 4MO9A 4BE9A 3GZ4A 1LDBA 4D4LA 2GR9A 3OM1A 2FWJA 3I5UA 2FSHA 1JPNA 3PDHA 2NO9A 4M1QA 4R2IA 3VR6H 5HUJA 3FETA 2D2EA 3TR5A 3JWEA 4UVIA 3MWJA 1QM5A 3T4EA 2R8BA 1UQUA 1RKUA 2ATXA 4W9RA 2DHEA 1B0ZA 4OCZA 3WSVA 3KOWA 4EX7A 3I0ZA 4PVCA 2QAIA 2J41A 3TM5A 4LEIA 4AF7A 1TJYA 1NI3A 1E2JA 2IGBA 1N32B 2WY2D 2VJDA 2OHIA 4DDHA 2C9MA 2IWHA 3PQ2A 3GCZA 2AWOA 3TI9A 1YZYA 1Y37A 4K6KA 4PRYA 1XDDA 2ZQZA 3U6KA 1BCRA 2WM9B 2L18A 2JHCA 1PK9A 2WUEA 4KN9S 3OQIA 3ST7A 4C43A 3L1JA 1VCMA 3H5VA 3JVDA 4BX3A 4DQDA 3C74A 2JIPA 1Z0DA 5D5PA 1TYZA 2IHTA 1T8UA 4OKIA 4A0RA 2KI5A 3K8YA 3ETCA 2JGEA 5ALEA 4DCPA 2I5PO 1HR0B 2JJ2A 5A4KA 1JG2A 1R9MA 4BECA 4DB2A 1IN4A 2G63A 2NSHA 5DLDA 2WEKA 4U7DA 3D4LA 3VGJA 4DMLA 1NMXA 4RAQA 3MWGA 4TM8A 5H4HA 3OMXA 3WQBA 2FMKA 3KJFA 3O2NA 5KSPA 4C2BA 5MN6A 1OYYA 5FOXA 3U17A 1AKMA 2AIRA 1W88A 4PLZA 1ADFA 1GNTA 3DR5A 2R7MA 4B7UA 2G4LA 4A0HA 3U2QA 1FJ2A 5CBPA 4WD3A 1B0AA 2QB5A 3A04A 1CT9A 3HL0A 2QN2A 5AJZA 3ZE2B 3GAZA 2SCUA 4ZP1A 4O5OA 2EU8A 3H1AA 5TQ0B 5KQPA 1SHLA 2AKAB 3L8GA 4HMPA 4KLRA 1DX9A 4L8VA 3LP8A 4PZUA 3EXEA 4Q18A 2C42A 5C80A 3WK9A 1NNSA 2IC5A 4O6VA 3V4OA 4AJLA 1YRQA 1ZU4A 2ZI6A 4V0NA 4WXEA 1ZINA 1TTQB 3JQCA 4LJ4A 3PC8C 3U48A 2YMQA 1DAKA 3HUFA 4XCXA 3FDXA 1MO3A 5K3DA 1XEFA 3ZI0A 4WBNB 3AGPA 1MTOA 3GCXA 1RT9A 3IEPA 4P4NA 5L4NA 1IM5A 1KI2A 1V4VA 2VDNB 3CB4A 4MQBA 2YH2A 1YB1A 3DUFB 1CVLA 2PX5A 2YWJA 4EY3A 2GAFA 1PL6A 1US8A 2J5XA 3I61A 3PRHA 1JHMA 3ZI4A 4BN5A 1H0KA 2F43A 1HI9A 3CIOA 3D4PA 4XPIA 5B3AA 4AJ2A 1GTJ1 3LYLA 4Q9KA 2ZVJA 3INYA 3V4ZA 2WA1A 1NYTA 3WGVA 4H4DA 3HKDB 1B16A 2Y1EA 4INZA 2O2ZA 3ETGA 5IAGA 3WBBA 5JXJA 4EPXA 4MYTA 3U3KA 3U3RA 2QJFA 3OQ1A 2FPMA 1S1MA 2QYOA 1E18A 1SUWA 5TVGA 1X13A 3H2IA 2NVOA 2X13A 5SV2A 3IO3A 3TTVA 1WXWA 4YRJA 1C0LA 1SHJA 2H07A 4FW9A 1N2CE 4CM9A 4D9JA 4JYAB 5DNUA 2J3DA 3L0IB 5BSGA 3OURA 2WPDD 5HQTA 1SIOA 2C5SA 1ZO8A 2Q5FA 3A31A 4UNQA 2EX0A 3GNSA 5ALPA 3D8TA 4DQUA 1QIGA 3PDUA 3PGJA 5G3ZA 5C8XA 2OM6A 3ZKWA 5ES3A 2I9KA 4NECA 3FG9A 2G83A 3ET4A 5DTJA 2HRBA 3E84A 3OIYA 1SD2A 1EFUA 1A8IA 2WWHA 3OFSA 3QX3A 2Z2XA 3CIFA 2IHUA 3GUZA 3A1EA 4P3PA 3KLPX 1XDZA 2AQIA 3IMEA 4YDSA 1J21A 4BB5A 1KY5A 4YY3B 2PGJA 1LNQA 2PIDA 4JKOA 2V3CC 1A9ZA 2FRDC 1FP2A 4LOKA 4B3FX 4ECEA 4OK3A 1CJSA 5LQKA 2B83A 2O3JA 3DTVD 4KHZA 1XMSA 1MJFA 2GO7A 2P65A 4KUEA 4L95C 4XQ0A 5T5QA 2MSEB 3KYCA 4P5EA 1HA3A 1WZUA 4MH0R 2Q45A 2ZUWA 1Z83A 2YW2A 1SVUA 1TEZA 2FLWA 3MF4A 2V59A 3FB4A 5EESA 2P4EA 5JJBA 5FPQA 3SQNA 1UM9B 2I8LA 3TIIA 3J7AC 3UKOA 4IEFB 2RAPA 1ZDMA 2XGSA 4BVHA 4TMYA 1Q7GA 2Y2UA 4KODA 3VZCA 3GYBA 2FPXA 3MELA 2X0RA 2FN4A 4ZI7A 2WTBA 4NFHA 4LC0A 1FU8A 2PTHA 2OO3A 2UYYA 1GQRA 5ALXA 5GPBA 3WK5A 2IH2A 5EZYB 4UE2A 4MNTA 3RC1A 1U6IA 1W4RA 1K5DA 3LVRE 1QFMA 4BPBA 1XTSA 5DP2A 4BLTA 3FMVA 5L53A 1DQRA 1Y0BA 3F4KA 2WP8J 3OQPA 5AMXA 3RS0A 4U7GA 3GLHE 5A4AA 1LV7A 2WJVA 1E9BA 2M98A 1TT5B 3Q98A 4CLRA 4E13A 4KO3S 4YI3A 3ZGVA 5HZKA 4XYLA 2VXOA 2FF5A 4W82A 1IB6A 1XAGA 1P3Y1 2FEMA 2AN1A 2DUMA 3SNHA 5BSFA 4YCCA 4ENQA 1TJ3A 2A92A 3PGMA 4MGYR 2EHJA 3ESZA 1J22A 1VJ0A 4FT2A 3UCFA 5JCJD 4PRKA 3IVMA 3C8DA 2YWEA 4OL0A 3OIWA 1UXIA 3A4LA 1CJKC 5E6SB 4HSGA 5IKMA 1N34B 1SOAA 4LDPA 1XCOA 3RNOA 4ZQEA 3GJ3A 1DELA 3OHPA 3GAMA 1ORWA 2ZUTA 4MMZB 4DMCA 1W4ZA 3D6MA 3E5MA 4QT4A 3PPYA 3GDWA 3RYCA 4E32A 2INGX 4FSXA 4Q3BA 4XYGA 2WHYA 3CFYA 3N2ZB 1DJMA 4WY2A 1YE3A 1G42A 3HMQA 1H1TA 1YQEA 1NNUA 3RKRA 2DLCX 1HTTA 3P71T 4KQHA 1WTCA 3PIDA 1JMVA 4UUQA 4R4JA 5DM70 4KQCA 4JI2B 1T29A 1BCRB 2CHUA 4FJ0A 5IEJA 1KF0A 1EQAA 1Z7GA 2I6UA 3HQ4O 4AWBA 4Q66C 2LRHA 2AXQA 3L4KA 2RCNA 4HCJA 1QOPB 4HI0E 1J2UA 2V6IA 3FB1A 3KVNA 5BV7A 5C8YB 1ZHOA 1TAUA 3HHPA 3OE4A 5E4TA 3I37X 3ZOKA 3ROFA 4EYGA 1QDEA 3EWNA 1HWYA 1W2WB 2R7KA 4YP6A 4YUAA 4KR6A 1U28C 4UHBA 4XXHA 3RUEA 3TDMA 1PZGA 3QLTA 2WILA 5T7BA 4PYKA 3LLVA 3KEOA 4QQ8A 5C1BA 3B1VA 5B3JC 4BVLA 1ABEA 2AFHA 2GSDA 3ROTA 1ZICA 3D3WB 1RQ7A 5HS6A 1ZD4A 2GRJA 3H04A 4RE5A 3TNYA 2XA1A 4XTRA 3HM9A 3GJRA 1FP1D 4MP8A 1P4AA 3EVEA 3JWHA 3PPIA 4RE6A 5TDHA 3SOZA 4PFQA 1E96A 4IIGA 3VR5A 1K06A 4Z51A 5HEKA 4AZTA 4PHCA 2F55A 5EJ4A 2HXGA 2R6GA 2JFVA 4AS2A 5HYVA 1E0AA 3LRPA 2CHEA 3FOCA 4UUPA 1EFAA 1JIJA 4NESA 1Y9ZA 1BJTA 1N4DA 1U0NA 5D01A 2GHRA 2CVQA 4F9TA 4X84A 1D3AA 3FSGA 1FMJA 4W8HA 3WHPA 2AN9A 2JKZA 3CO5A 3U9SA 4HX2A 4MVJF 4Y2TA 5JDCC 5TF0A 4PPNA 3OTOB 3DAYA 1VTKA 3EFOA 3IB6A 3LF1A 2WQ7A 4ILKA 3TAUA 5IABA 1X42A 1QYIA 2IVFA 1V5EA 1KP9A 1NJ1A 1VMKA 3MCZA 4IDNA 3I4CA 4IXDA 4TQAA 2PGOA 4W4TA 5DEOA 1U7PA 4MV8A 4CF3A 2Z95A 3RRBA 1VIVA 3K5PA 4M9RA 2H54A 2VJQA 4RK0A 2RONA 4RBNA 5HJ7A 3GFTA 3OEHD 4BX2A 4ENVA 2UYOA 4TQ9A 2GAIA 5LN1A 5AVYA 2C95A 1E1KA 3AWIA 4PZEA 1QF9A 2B4AA 2C4HA 2GPBA 1UT8A 3OTGA 2UZAA 2ZJ0A 2CNNA 2W42A 3B78A 2AXPA 1N7GA 2Y66A 1T2EA 4QNMA 4EG3A 3GEHA 3PL1A 4HFJA 1R0XA 3P9QA 3RD5A 4B80A 2FEWB 2YWGA 3AUJB 3NHAA 3BEOA 4JMLA 3CKYA 2H59A 4NENA 2NUAB 1NBIA 3A9TA 4IUCS 5CLGA 1GR1A 1A5TA 3HNPA 1SKBA 1QZTA 1UK6A 1I94B 4P3XA 5MFZA 2XQFA 1DFGA 1P5ZB 4GX0A 5EG5A 5CU7A 3ANSA 1CV2A 1SH7A 2W8BA 5CFQA 3WGKA 4EB0A 2AG8A 4D80A 2OV1A 4EEZA 3GJ4A 5ALDA 3ZIAD 3PHBE 1HNZB 4UHKA 4X1YB 4BATA 1L7PA 3N7UA 4D41A 1XV5A 3B82A 2NUTB 3O93A 2WWTA 1AHNA 4HC4A 3ZLJA 2C96A 2V54A 4U7WA 1PJLA 3I1YA 4EI7A 3PE3A 1U5BB 2AHOA 2G28A 5BSWA 3H4IA 3OM8A 5K4GA 2HADA 1OPXA 1S9HA 3ITEA 3W8EA 1X7WB 2FMIA 4OXQA 2VZ8A 4LOAA 5ALSA 4CTNA 2MSLA 2GUWA 1L1FA 3CJRA 1SCQA 5FWYA 3GEBA 1NW6A 2P75A 5FA6A 9LDTA 1XALA 3IQHX 5I9IA 2NX2A 2Z5LA 4HGPA 4NS4A 4RCYA 5JFGA 5JNLA 2J6IA 2I99A 2JJ1D 3R0XA 3LG2A 5DGXA 4BO0A 4BNWA 1FQWA 2HLDD 2IU3A 3IPRA 3KLOA 2IEGA 5DX1A 3SS7X 1YU9A 4DL9A 1R00A 1BEEA 1VCHA 4I46A 5ALRA 2CY0A 3AKYA 4XH9B 2E6UX 4DLTA 1BROA 3RVDA 3UXMA 1LRLA 2O2SA 3C48A 1KNXA 3PXAA 5C2JB 4NNPA 4BZQA 4ENRA 4AN1A 2C4TA 5HTKA 3KKZA 5K7SA 5KVVA 3N6XA 1WR8A 1P81A 4AWAA 3C3EA 5CNKA 3TQIA 5JH7F 3HYLA 4ZU6X 3DTNA 3EGIA 2AKEA 4F84A 3ZE8A 3H9BA 3AHFA 4B34A 4C89A 4QICA 5ADWA 1GKYA 4DDKA 1SRRA 4JC8A 3Q7SA 3GRKA 5KC8A 1EP2B 1CZOA 1R0ZA 4FFDA 5B6PA 1XJQA 2CYBA 3NKVA 2BDTA 2PCLA 4LKOA 3S2UA 7AT1A 1DLIA 4U2DA 3PLRA 3DUFA 4YPFA 4JENA 1E61A 1GVHA 9ABPA 4RTSA 4L0MA 3PXXA 4UHCA 1VL6A 2QM8A 3DF7A 4QUKA 3EGVA 1QVAA 2HCJB 4YAIA 5FOTA 4WN9A 3R7WA 5MN5A 1FNBA 4GZ3A 4E30A 4FNOA 4Q00A 4B73A 1OASA 4C20A 1QGOA 3RTCA 1BKYA 3U13A 4Q7LA 1I6MA 3TJMA 4KV9A 2RHRA 3OPQA 2R6HA 5B1DA 4NDAA 1JZSA 1QWSA 3Q40A 4JI8B 3EW9A 1GZ6A 4B6RA 4KLNA 1FFWA 2B4YA 2ODEA 5I7OA 5AW9A 2W48A 4BP3A 1RYBA 4IINA 2HIGA 2VZ9A 4HDNB 3NHUA 3SSAA 4C4TA 4M0DA 2F6RA 2GLXA 1AE1A 2WYOA 4X00A 1B8NA 3OIVA 2RC6A 1PD0A 1KS2A 3FPCA 3MJVA 3I83A 4NHOA 4OBXA 1NMZA 1O03A 1HQCA 3EVAA 4DVJA 4E6PA 4YRNA 3VNUA 1BYUA 1FQKA 2IUUA 5C4IA 2JDID 4RIFA 3EUEA 4RHFA 4BVAA 3PJRA 4J2TA 4E5MA 5H59A 2UVQA 1CUJA 4Q12A 3FBWA 3SQLA 1ESDA 1E2UA 5CX1A 3FPAA 1M73E 4GP6A 4HP8A 2FHPA 4RQTA 5COQA 1L4EA 5HILA 4G81A 4P0TA 4GXQA 4V03A 3B6JA 2EF1A 1ZD5A 1R6TA 2PZEA 1WXDA 2FZVA 3OQJA 4F3NA 3W2HA 2JLSA 2HHHB 1KFEB 3BKWA 1SC1A 4GPD1 2XNDA 4AZSA 4MI9A 1ZH2A 3HS3A 5BQXA 1TUBB 5KQRA 4G0NA 1XTPA 1L0BA 3KX2A 5C7YA 2ZI7A 1EIWA 5K3FA 2B37A 4TS3A 2ATCA 5ELXA 3LMKA 4YRRA 4WZBE 1QBKC 3RYTC 4JLBA 1FQJA 3LKBA 4HFRA 3F5DA 1YFJA 1T8WA 4NYIQ 5ERYA 4B76A 5AKXA 4MAMA 1G6OA 1Z26A 2D3WA 3ITKA 4FYVA 4RL6A 4RV5A 4UNSA 4B79A 1EZZA 1VZ3A 4NNJA 1OB5A 2VP9A 3MQ4A 5EI5A 4EG5A 2R2AA 4MWBA 1EEXB 2BEKA 4P4SA 3H97A 1ORVA 4GWKA 1MW8X 2E37A 1OBFO 1BDMA 1WP9A 2YFHA 1YZGA 1QNFA 3CJQA 2P2ZA 4DY6A 2I4TA 3SKYA 3DV0A 3HVKA 4II3A 4QUGA 2BFCA 3KDSE 4HDMB 3DPSA 2VWPA 4RGBA 5FORA 1ZMXA 3KT8A 2JCYA 4CM8B 5KNBA 4H9GA 3HB9A 3JQ7A 5LMNB 2KSQA 1NLFA 2ZSDA 3R5FA 5G53C 3TWOA 3U81A 1EUZA 3A1VA 4PG7A 3ZLUA 3RBXA 4FI3F 1JAXA 3CHYA 1OXBB 1Z39A 5HFNA 4E15A 3SJZA 3EPHA 1HMYA 3PXUA 4OAQA 3RI3A 5IK2D 1WPXA 4UFPA 2Y1FA 1GL3A 3ODGA 4Z4CA 1FXWA 4BO5A 4G9EA 2XODA 1X3SA 1NBAA 3EWAA 1U0HC 2QP4A 3PNYA 3R6GA 3V8PA 9GPBA 3NOOA 5HMMA 5LBTA 4XVHA 1OX4B 2Z58A 3G0OA 3N8KA 1QG0A 3JALA 2FPIA 4IMRA 4UAGA 4DNFA 3G68A 4DV2B 1RHQA 3ZHVA 2NQ2C 1JAHA 3ANNA 4B3DA 4DJFC 2O7NA 1BE0A 4D8XA 2LCIA 1SXIA 5CXSA 4ZAFA 5FUYA 4WBNF 2EBFX 5DFAA 4CTOA 1YQWA 4OSPA 2O7QA 4PYIA 4UEOA 2ZSBA 5YASA 1N5KA 1O6FA 2ZRIA 4PCLA 1Y5IA 5SZIA 2QVGA 4J0HA 5B5SA 1IG3A 1C3OB 1YQQA 2PRYA 3WLTA 4GOMD 3IAFA 5CFNA 1GGVA 4PC1A 1T5SA 3M6WA 3LL4A 1PBNA 1T15A 3PIIA 1KIMA 3WA7A 3LE8A 2JIOA 3H5AA 3R44A 5FI1B 5LYJF 3BFKA 3L4SO 2IZOA 1B6SA 5CGZA 1REQA 4LS3A 4UVEA 2JAWA 2Z6AA 4W9MC 3RHFA 1RSZA 2DEUA 4JP2A 1U0EA 1W85A 2V9PA 1YVEI 1JJBA 1LBSA 4LKRA 4D92A 1CF9A 3HVUA 3U1TA 2B0CA 2FI1A 4DQKA 5D5HA 1FA9A 3PUKA 2P62A 3E4CA 4TV9B 4DLYA 3GLIB 2FQXA 4D4GA 5HKBA 1E4OA 3ICOA 5L3VA 1WD5A 1G3RA 5IM4F 1F20A 3R7AA 4YDHB 4ZO8A 4IVQA 4D26A 5GJBA 3MBIA 4K9MA 2WT8A 3MJCA 1U1EA 1IU9A 1E0SA 3BGIA 3OJ0A 1FJGB 2H17A 4Q5IA 2EW2A 3PLNA 1DKLA 1TQDA 4J4BA 4CUKA 4H1TA 4JJEA 1W48A 3GARA 1WA5A 3KAJA 1Q3KA 2CLSA 1QP4A 4O4IF 4EHDA 2C84A 1TCVA 4Q4HB 3BRCA 5EHZA 3MRVA 4JX9A 2GD1O 4ZDIA 4X64B 2AC4A 3SR0A 4LXUA 4TT3D 3HO1A 3RQIA 4AJEA 2H1LA 2EWWA 4Z4HA 3SEFA 1YQTA 5GGXA 2FDXA 2C4UA 2I7CA 2XDQB 5I48A 4NOMA 3NHLA 1XP5A 2ZSAA 4E3WA 4NICA 3JALB 1E77A 1ZZEA 1W44A 2XYHA 3EIOA 2C88A 2FA9A 4RDXA 1VHWA 5IJ0A 1MJGA 2XWSA 3MLBA 2ZAYA 4F2HA 4HHEA 1TX4B 1RQNA 3P26A 2ZTLA 3KXPA 4J1SA 1NIPA 1PVVA 1U7UA 1U9IA 4F46A 4X91A 5ISMA 3VDMA 1EE9A 3PTZA 3DMYA 4P3YA 2IYOA 2Y1KA 1C3LA 3GRRA 4HQFA 4LXIA 1AK2A 1GGEA 1IWBB 4J1QA 3U3JA 4AX4A 4KPGA 1O9GA 1KPGA 2FUKA 2HSWA 1H9AA 1IVYA 2XUQA 4O63O 5DOZA 1J2RA 2WUGA 3GJ8A 4I5EA 4WXHA 4YBZA 1DZ3A 3MJTA 2EFYA 2Q28A 2PJZA 2PT9A 4EO7A 3GGGA 4YQZA 2EYQA 4JOCA 1QKJA 1Q92A 2ISQA 2ZWPA 3KDAA 1AQUA 5CYGA 3LXUX 5FUVA 1FPQA 1HG0A 3NEPX 1FFSA 5CD9A 2O5CA 3SHFA 3Q7EA 4KJZA 1DKMA 2FZKA 2WBLC 2VDVE 2YV3A 1NV9A 2NUPA 2CJWB 2JEOA 4E4TA 1BHJA 1WQ3A 2GVNA 2V6GA 1M2OB 1MOZA 4OEHA 3LFTA 3VI4B 1QUFA 1M8FA 1V26A 3BSYA 2X1HA 5H16A 3ROKA 3QKSB 2KE5A 3VDQA 4LOIA 1BE6A 5FXMA 1EE2A 1N5JA 5E2AA 3CLRC 4URXR 1DAIA 2PE5A 4XWKA 4LF4B 4Z86A 4PAMA 3TSZA 3BWMA 3FZEA 5DF1A 3DKKA 2O4UX 3DLCA 3MOGA 5IF3A 2CV0A 4K03A 1YVRA 5HKKD 3A3OA 3BK7A 3F3MA 3HKCA 1GL7A 3WRXC 3TMKA 3OEYA 1Y8QA 3ZBPA 4CIDA 4HB0A 3O4JA 1NVBA 1KJZA 5EWMA 4AM8A 1S3IA 3NIBA 5KYVA 1KYYA 5BRJA 1LRJA 2WHPB 3PCTA 1V5GA 4HUQA 3DDCA 5HQJA 1CUHA 1U7WA 1Z16A 2PKRA 1F60A 3CB2A 3S3TA 3CVXA 4YP9A 1ZK2A 3SF8A 3ZK7A 4AFNA 5K0JA 2I7DA 4JKIA 2X2EA 1YS7A 3UGJA 1T9GR 1N25A 1X1RA 3U44A 3DBRB 5LA6B 1W2HA 1MUUA 4K8RB 1IXYA 2EBUA 2Y3IA 4XDHA 2XR1A 3ICVA 4QGFA 4JDPA 4LSGA 1F6WA 1W94A 2OORA 4HAVA 4QJIA 1NQUA 2WDZA 1NN5A 1ZMBA 4PSAA 4IHKA 1VRVA 1Z3IX 5LZ9A 4QPNA 5FBLB 2VXYA 4JOQA 3WY9A 3WAJA 4M1SA 1TUIA 1E7MA 3COZA 2O1EA 4H2DA 3IESA 4ND8B 3TQTA 5KWEA 5CT5A 1UJCA 1B8OA 2I6SA 4PZ9A 5I3CA 2TYSB 3KIPA 5JECA 1C9DB 3L7OA 4RHXA 3UJCA 2C5BA 3QOYA 4JI7B 4TSFA 4YGYA 4YQEA 3TIFA 1KK1A 4LOJA 1G9TA 2MWMA 5AK4A 4RSRA 4BEBA 1G98A 4H7FA 1YXMA 2E55A 1RAIA 1SWVA 1ZW6A 3KP1A 3Q2OA 1H3FA 2FW9A 2P4HX 5T8KA 3R7WB 1II8B 3DAOA 1M2GA 1J1UA 1JDVA 1IHYA 1ZOLA 5DGDA 1TKAA 4QTXA 3D1JA 1CK4A 1SBTA 3RYHA 1M8JA 1RCTE 2PX6A 3WGMA 2JNWA 3ESCA 1MQAA 1K7CA 3DDHA 3OIDA 4ALNA 4PZCA 2ZCJA 2IE8A 2H1CA 4H59A 1E58A 4LJ7A 4YBRA 2AYYA 4MRRA 5IX8A 4NCNA 1H85A 1LC3A 3YASA 1SEPA 5KNCA 4WNAB 5DWDA 1L7RA 1VGQA 4LSZA 3IBTA 5JPCA 5K8VA 5COBA 2H2IA 2VA9A 4A5OA 2ZRMA 4NZ9A 1UBFA 3LHSA 2WU8A 2IUYA 1J2TA 4U7PB 1TJ4A 4JR0A 2Q9BA 4HBZA 2A5YB 2G04A 3FIUA 1P4SA 4UM9D 4D02A 2C4VA 2NIPA 5CFLA 2JLAA 4DJDC 1BW9A 3PA8A 3WLFA 3EGXB 4OJTA 5AW4A 5J58A 3BXOA 1ZC4A 3VZRA 4F1JA 3FTEA 2HR1A 1XHFA 2C83A 3TLBA 3M1YA 3O92A 4I55F 4M1WA 4FE7A 1QFZA 1FX1A 1SXJE 5COAA 1UMKA 2XQVA 4I4CA 4PY2A 4IJ6A 3K2QA 3WGHA 1NBMD 1OWMA 1D8TA 2BI7A 1JA9A 4V0ME 4MDEA 5TPZD 5GIOE 2F1IA 4ZEVA 3UBMA 3K1JA 3UJ3X 1UWLA 1C4XA 2Y76A 4KKXB 3TLXA 1DTEA 3IOEA 3B36A 2ZBDA 1X7WA 3PWZA 4HDOB 1TF7A 3TIXB 4U02A 1XMQB 4N03A 1QV6A 2CFRA 1LPAB 4B74A 1QYXA 3CVOA 5JQGA 1IBRA 5A9SB 5EAIA 1GLVA 1PQUA 2AJBA 2EL9A 5AOAA 1ZJJA 5HF9A 5JXHA 2JLBA 3LXXA 5L4LA 2Z5FA 3DKVA 4DYVA 3AIKA 1IVSA 1Y48E 2H65A 1IY1A 5DWVA 1IXKA 2HN9A 3PCXA 4FZ5A 3VI3B 1JGTA 2I1VB 3BILA 2DHRA 3VR5D 4ESHA 5A5FA 4IH4A 2O0JA 1G3MA 5FIUA 2WWYA 1E7SA 4DANA 4J6FA 4INJA 3TEJA 2LKDA 5J5CA 3WLEA 4Y67A 1XTVA 3NBFA 4AF6A 3RC8A 4JKYA 2QPTA 2DUWA 4KVGA 1CVIA 3O7MA 4O8CA 3ZNOA 1IIRA 5FL3A 3DTVB 2BMDA 2PMBA 4R1UA 5KREA 1SELA 4RA6B 2VL7A 1V7PC 1QIIA 1W35A 2F17A 3F98A 4UBOA 3SZUA 5LIRA 2PWYA 4LTMA 4K6HA 4UNNA 5G4KA 2EJVA 3CZAA 5LQUA 2JRCA 2F4NA 3BMQB 4JR2A 2ZJZA 3OT5A 4POOA 2A59A 2X8BA 3NIDB 3NVAA 4KH0A 3ED1A 5MGNA 4LMBA 1W36C 3SS9X 4YGXB 2FW6A 5GM1A 2ODBA 3GJSA 1U98A 3QNWA 4PC2A 3RRFA 3P97A 5C3MA 2XYPA 1B0UA 8LDHA 4C6TB 2E5WA 1PV2A 2G6BA 2PO7A 2Q7DA 5KZMB 1BS2A 1PJ2A 2VRWA 3P9XA 4A8JC 1GFIA 1T10A 3H5LA 2JGLA 1E2MA 3IPYA 4CI0B 1MXFA 3UK7A 3EFOB 1QR2A 4QJ3A 2P0EA 2Q3MA 2XYVA 1ZUHA 2DFNA 2JFBA 3LJKA 5AHKA 5BQPA 4DCJA 3E9MA 4RLQA 3UGTA 3ZCUA 1DDGA 2EJCA 1HETA 3CMCO 1MB9A 3LUFA 3BL8A 4L5CA 2X8JA 2HWKA 3ISTA 3FH0A 3H3FA 3I5AA 4OXXA 3WTCA 4AG6A 3NH9A 1Q1NA 3TECE 3T3GA 2FEXA 3C8UA 3DFZA 3Q9LA 4Q02A 5ITZB 3WQRA 1DX4A 2JLYA 1ECJA 2VA8A 4FZVA 4P7KA 4RX1A 1T34A 3TRHA 4A15A 2PUAA 2AJCA 4OU5A 2B7LA 1QLJA 1BN6A 1E66A 3L02A 2HF2A 4L3VA 4P4GA 3AR5A 3QSGA 4Q19A 1FMTA 1U1CA 2HMTA 2FUG6 2CNKA 3LLCA 4D9FA 2I7XA 4IOLA 4CDMA 1XRRA 3GLHB 4B8WA 5GTDA 3LIIA 3D3WA 2PN1A 3DBLB 1I9GA 1SUIA 4L57A 3OE5A 3T6KA 2QL5A 4YP0A 4KPYA 2BH2A 1JXQA 3DEZA 1GWNA 1XPRA 1F7UA 2O50A 5L8VA 4FC6A 4MB2A 1IOWA 4BKRA 1RJGA 2C00A 3GUCA 5B3JA 2C3PA 3GF4A 1VJ5A 1QE0A 2OAP1 2GI4A 2W6MA 1AQIA 3IAHA 1V1RA 1C14A 5AXAA 3V1UA 1QB8A 4N5MA 4AQDA 1F51E 1HT0A 2BFPA 2VEOA 1JFLA 4U9UA 3GW8A 3IXLA 1ZM4A 2LDBA 1JA1A 1DL5A 3ETDA 3I2HA 4MVJP 2NN3C 2QRPA 5AKGA 4FWTA 2I4MA 2JFNA 1LW7A 1NVWQ 1QK3A 2BM8A 5CFMA 5KWVA 1HV8A 2H4HA 1VA4A 1GKKA 4MX8A 3DZKA 3BZWA 3EIEA 2JFOA 1JLLA 3ENKA 4GWLA 4Y2RA 2Z4RA 2ZI9A 3C14C 1PGJA 3LDGA 1LD3A 3LLMA 4NJMA 4TN5A 5DJ5A 5DX0A 4AXBA 3SD7A 1OLXB 3QLUA 3BL6A 4Q16A 4Y2GA 3W5JA 3ZUPA 4ARCA 1L8XA 2AN3A 2W4MA 1TYCA 2OWEA 2PPLA 4HQKA 3UMSA 5F2EA 1NT2A 3BWVA 1E3TA 4X8LA 3JAMA 2R6DA 4UUBA 1DUIA 2ZYWX 3IUEA 1QS0A 2QT1A 3GOHA 3LSYA 1QVWA 2O2GA 2YJ4A 4AUMA 1XYYA 3T5MA 2H1OA 4C2TA 1EK1A 3DYBA 1FS4A 4G24A 4JSRA 1L9KA 1S2OA 2WKWA 4O1MA 1DMRA 5KQLA 4HYQA 1R9NA 1LY1A 2UUBB 2E49A 3PEVA 5SYAA 3GVHA 3WL3A 4ZQGA 1YBMA 2YUIA 4QJ4A 4G8JA 1U9CA 2A3NA 1Y6JA 1YFLA 3TEFA 3GMSA 4KN5A 2VUTA 5JS7A 1APBA 4P5PA 2OR3A 5FL7A 1UKYA 4NLLA 2Z6UA 4CL8A 1ZISA 2LBPA 1E92A 1T9GS 2VYND 1QCZA 1NYRA 3R09A 4L5IA 5I7WA 1D03A 4DBVO 5EPEA 1CJVC 3SPXA 4A6XA 4CL3A 1EAYA 2UZ1A 1Y4UA 1Q7TA 1QTNA 3U62A 4EA9A 3E1GA 3GBVA 2YN4A 3SYNA 5CFZA 5JZOA 2I87A 3BGVA 1M6EX 3CYFA 5AQ1A 3NHYA 3PX2A 3V1LA 1P0PA 3AR3A 1XTTA 2D2XA 5JNRA 1L6IA 4XQCA 4ZDKA 1ZM9A 2CMGA 1WY5A 1M1YE 4XLZA 3QE3A 3NP7A 1GPBA 2VRCD 2VYVA 1DU4A 3Q11A 2OGTA 3R3JA 3DKPA 3G5LA 3HDJA 1SM4A 4NBSA 2BBSA 4LHXA 3EPJA 2I33A 5KSWB 3GZNB 2FP4A 1PTJC 1ZOOA 4GR9A 5KYUB 2HH9A 3T15A 3P9ZA 3QEJA 3GA7A 3BA6A 4NV0A 3LBIA 1RYHA 3KOXA 1XZEA 4H7DA 1WJGA 2I66A 2P30A 1CFJA 5K6AC 2JVKA 5JNTA 2Z8YM 2WHRA 2VPZA 4F8YA 5CT8A 2C59A 2QD4A 2VLIA 2C04A 5E1DA 1QMGA 1K8XB 1YZKA 2QZ4A 3WVNA 1XR3A 3AR2A 5TPZA 1DS6A 3HEMA 3RABA 5BPFA 2H29A 4C9BA 3O75A 1LZKA 4DUYB 2XT6A 2NO4A 3H5OA 1NT4A 4TYWA 4OJYA 1GTL1 4ESEA 4W5WA 1UCFA 1ULAA 1XZNA 1M5UA 4JGIA 5ALYA 3ZZ1A 4MVJG 4MS1A 3RNLA 3OZIA 3QKTA 4QFMA 4EFNA 2BHNA 2J9FB 3KT0A 1HE8B 1YDWA 1BDBA 4TLMB 2KW5A 2XBUA 4NYIR 4S1PA 3A37A 4EFDA 1TT7A 1EHCA 3D9QX 1EWYA 3HCPA 4COOA 2YIJA 3PUHA 4RKRA 1UJ6A 2GZDA 1GD1O 1I3LA 1YJAA 3WGTA 3U3ZA 1C7ZA 4FDVA 4B5KA 4URYR 2YDXA 1JDPA 3JASB 1SA0A 3PA6A 4IXTA 4A8TA 4KYIB 1NHGA 3D6TB 4PGGA 3WYGA 1LPPA 4C3UA 4CKEA 4D9EA 2QOEA 5IVDA 1NW3A 1ZGGA 1TZKA 3N2EA 1JEOA 5KCZA 1GOTA 4WJKB 2AYZA 3TLGB 4EHFA 3GGOA 1CF2O 1Z25A 2QVYX 5CJPA 1NVVR 2FQQA 1EVJA 2F43B 3RRXA 3Q7PA 3Q15C 4NFLA 1K6EA 1U1FA 2OBNA 2FF7A 2H1WA 1KU0A 1NUSA 4QODA 4YTEA 1UJ5A 3P94A 4TXLA 5LZ2A 3ER9A 3WKEA 1HEIA 3F5FA 4BKMA 4DM4A 3PQ6A 4ZCMA 2PL1A 1EVKA 2ADOA 4RDIA 4GOOD 8OHMA 1ID8A 1GTZA 1LSUA 1O5IA 2YMLA 1GTMA 4C05A 4N3CA 3AHGA 4BFYA 4DAOA 2ESRA 4FW8A 3D4OA 4NAUA 4L75A 1K7FB 3Q9NA 2XBLA 1EXNA 4F5WA 1A97A 2UVDA 3EXFA 3BRSA 1NU6A 4FS8A 1FS5A 1TC1A 3BGSA 4LG1A 4J0GA 4RNDB 5HW0A 4LC1A 1RAEA 3GYGA 4V2UA 4D4HA 3IBFA 1B23P 4KSBA 1LQUA 1VHQA 4PBRA 4RFVA 1JV2B 4UM7A 4LE1A 5ESDA 1NXVA 3OD5A 4CLDA 5CBPB 2QMUA 4HAOA 1NYQA 2OSVA 3B1KA 3B5JA 4OFXA 4WLFA 5L45A 1S8NA 2RHHA 1GPH1 2QDKA 2XZPA 5AW6A 1BDIA 4YRCA 2EXXA 4LFAB 4MJ3A 1RPZA 4Z9YA 3OLQA 1EBFA 1TK9A 2BM9A 2V5UA 3IC5A 4RF4A 3COYA 4YDRA 3DV2A 3QUAA 4LIPD 4O2AF 5EHNA 3K20A 4QWMA 1H2AS 2VHUA 1E1DA 3A1FA 3LU1A 4FPXA 2QZZA 2I34A 2QEQA 1U9ZA 3EPRA 2YNMC 1I4DD 3W1EA 4IVNA 4AD8A 3KLNA 4D43A 2PSJA 3H17A 1KTIA 4U2BA 1J8MF 3QVOA 1P2SA 1F5SA 4G1FA 1RWMA 1YU6A 3NETA 4J1NA 4IKEA 1DBSA 1E3JA 4JHLA 5AKEA 4HWTA 4ATNA 5LDDC 3QU5A 3AL0C 1NUHA 4QEDA 4AMYA 5IJ9A 1ETUA 2OXRA 3PDJA 4RTOA 3AKCA 3K3PA 3PVZA 1JVSA 3TNFA 1DB3A 2HK6A 2EFHB 2LUOA 3H6HA 5CK4A 3PWKA 3UAVA 2GPSA 2YNMD 4AKHA 3QWFA 1NMQA 1DIBA 1GU7A 2I3ZA 2YTZA 1H3NA 2J7PA 1FP6A 1XNHA 4P4UA 3UJDA 3VNRA 1L7EA 2QU7A 4L08A 5DHRA 1QHHA 4XCQA 1DKQA 1XZBA 3DGEC 3BCRA 3Q9UA 4I9GA 1I3KA 4BJ6A 5FOQA 4GSLA 4S24A 4AMVA 3VC3A 4TV8A 2GZAA 2PQMA 1IHPA 3HCRA 1FTQA 1N2IA 3KS9A 2G7ZA 2PX3A 2ZR0A 3GPBA 3PGXA 4C0BA 1I2AA 3LZ6A 2ORIA 3R4VA 1KZHA 3ADKA 3PKIA 4EAQA 1UPBA 5E9JA 3BSFA 3BDIA 4TLCA 4TTPA 5REQB 4C2UA 2IEYA 1KIAA 1E1CA 2ZKIA 1S2GA 4LQLA 3RS4A 4OLBA 1NP7A 1S3GA 4RDCA 4LFCB 3FY4A 4B4KA 1MPTA 3JX9A 4QYTA 1QVVA 2X77A 2VP0A 1W46A 3CPJB 2V5VA 4XCVA 1I30A 4V39A 3SY8A 2OPBA 2TMYA 2E5FA 2FPLA 4GL4A 2SHKA 4LNUB 4CJXA 3P9KA 5BV8A 3AEZA 3FWKA 3AG6A 1Y1SA 1JHXA 1EVYA 1M2NA 1PYDA 2ZIZA 3KBOA 1U90A 1JNYA 3MILA 2ZU6A 2ECKA 3WLLA 1N8SA 3E9RA 3L6OO 3NM4A 1EB8A 2I6QA 1F38A 4MW6A 3H18A 2PLNA 4FUQA 2H4ZA 2WF5A 3QPAA 4NPCA 5J9FA 4EW6A 4P35A 4PZLA 3UA4A 1HT1E 2J3QA 1XCGB 2OFXA 4BLSA 2BV3A 2EJTA 4PO1A 1HT3A 3T3DA 1ZGHA 3ROPA 3F3YA 5FNVB 4MHTA 1FSSA 1LLQA 1P6XA 3FYCA 3ZDEA 4FZRA 4AMBA 1ODLA 1XDBA 1E8NA 1IEWA 2GA9A 5LR6A 2IUTA 4KQ1A 4MUJA 1DEHA 2C3MA 3ZWXA 3VV3A 2QN8A 1RLOA 2VBIA 1KMNA 1NMSA 3OJEA 3ZU4A 5JROA 2BJWA 2JIZA 2WA2A 3KJEA 4QYMA 1VLLA 3LBNA 1TTPB 2G06A 2RSLA 1M34B 1AXEA 2XMSA 3KWJA 2BKVA 1VLVA 4N6GA 3I28A 3EDYA 4R68A 1KZ1A 3AB7A 5ALLA 3OKFA 3X1DA 1EDEA 3UJNA 2EYUA 4ZMSA 4MV1A 1P2GA 3P2JA 2D7DA 3M3HA 4WSOA 1EM6A 4M36A 4BWYA 4DCOA 3SQXA 4WNIA 1OTXA 4RUKA 1VHTA 1LTQA 1GRCA 1V1RB 3MAJA 2PL3A 5TC4A 3ZUGA 5A3QA 4GAEA 2RD2A 1KKUA 4H3SA 3QJGA 3UWMA 2OVBA 1QAOA 2HYDA 2PRJA 5G1PA 4LGCA 1PDOA 3EZYA 4U9HS 4UREA 3OFND 4IBOA 1ZJ4A 1E6EA 1Y1KE 1H6CA 2GHQA 1ISFA 2QTLA 5B55A 1BYIA 4YJ3A 5ARDA 5AW1A 4M53A 5AQEA 4JJ8A 1XA0A 2CDAA 1W25A 3I4LA 5CUQA 5SY4A 4J16C 3WQHA 3UMVA 3O8RA 4A1FA 1LF5A 1JUDA 1ZCZA 4B45A 4AROA 2AE2A 1YL5A 1WXQA 3QNMA 3V6LA 2O3RA 4IGFA 4G5OA 3UHAA 3O8QB 4PX2A 1ZGJA 4PSKA 1OH5A 3AR4A 1D1QA 2WIFA 2PKCA 4EW3A 2QSJA 2YHIA 3AFMA 2WZDA 2YXLA 1MQ9A 3TLJA 1CR1A 1TIPA 2C1EA 3AJAA 2RBGA 2FPSA 4YA6A 1RE1A 2XUJA 2Y1GA 1L8QA 5C37A 4HAYA 1V8BA 4YJGA 4GC9A 1KKLA 2R1TB 1JF8A 1PR0A 3HXKA 3U7RA 3IJRA 2VNKA 4WMLA 5AUNB 3CQ9A 2IYEA 1YB6A 1VI2A 4F97A 3MYRA 3W5DA 3L4EA 5ETJA 1FY2A 3QM1A 2Q0QA 3ICCA 4GKKB 4Z8XA 2R25B 5NLLA 4JSTA 2H16A 1A9SA 5LUBA 2Q4EA 4F93B 1WOMA 4UHDA 2PFKA 3CUWA 4Z7NB 1DRJA 1NRIA 1R4AA 1RKBA 2B3TA 3E1SA 4G1CA 2BMAA 2WT9A 3QFFA 4L5YA 5AYVA 3VPBA 4CN8A 4DAEA 4MW5A 1H4TA 1PGNA 5CBKA 3LPLA 4P9NA 3IIIA 4Z4QA 1MAAA 2B7CA 2V03A 2W6PA 4LECA 4JI0B 4UOQA 1NASA 2VHEA 2R96A 5DBIA 4JQYA 3TZ6A 4LJRA 1X94A 2C58A 3ZCVA 1EUYA 1PWZA 2EKQA 3QVMA 1N3LA 5A7FA 5JNWA 4YCMA 1L8OA 1XRNA 3CT6A 1N5DA 2C29D 3OPYI 4X44A 5DEIA 2E4YA 2J5QA 2W2TA 3MK31 3QBTA 3UFXB 3CLHA 1TK3A 1QO0D 2IEIA 1N6OA 4PYQA 5J43A 1XVUA 1G2OA 4YV1A 2J9YB 1AGPA 2ZJOA 2WD9A 4R6WA 5D3MB 2YJ5A 3F5MA 1R4ZA 1S3FA 1WU8A 2Q0SA 5FI5A 2P90A 2FDCA 1LPNA 2CE7A 1G8MA 1F2DA 1JZQA 3LGXA 4M8SA 2QVXX 1LVUA 3KQTA 3GGPA 4WOCA 5I9BA 2KQUA 3JYPA 4K28A 4QBFA 4YACA 3L41A 2ZDGA 3PXBA 1NATA 1OWLA 4QDZA 3B8HA 2XB2A 5F7OA 1X7DA 2I3GA 3FLAA 4C22A 2IV2X 3ER8A 3UB4A 3T3OA 1BVRA 2A0XA 3TJRA 1P0IA 1EK0A 2VDJA 3AB8A 4DKJA 4LJ6A 1B15A 3OTHA 1C30B 5JY1A 1YHYA 2JIBA 1WBBA 1O2DA 3REQA 1UR5A 3SK0A 4CDGA 1TUBA 3HBMA 4A36A 3LZCA 3E23A 3FIJA 5EZSA 1IN6A 2IEBA 4IIHA 2WUDA 4WKGA 3EXIA 2XZTA 2NTVA 4C4XA 2XW6A 2ZJBA 5MGBA 1KOJA 1NJGA 1RKXA 2CCGA 2G8LA 4OIMA 3WB2A 4X1IB 2GMWA 1NBMA 4Q34A 5CMLA 1ZI6A 2WP0A 4K1XA 1NQ5A 3AYXB 1XFDA 2PJDA 5H1YA 3UOAB 5CX1B 4IIDA 3D81A 4EKGA 1E9RA 1A96A 2BIFA 2BEWB 3COSA 3IUNA 3LOPA 3VBEA 3WRYC 4F4HA 4X95A 3LHKA 4N5IX 3KAKA 5J1TB 5TNXA 5ECDA 1SD5A 2QL6A 2KPOA 1J0CA 2YCBA 3EZ7A 1SNYA 4BBJA 4E2YA 4H15A 2QENA 2VCHA 4IHJB 2QTAA 3GA5A 2OGUA 3ZE1B 3N8NA 4Q4JA 2F8TA 4D96A 2R6AA 1ESZA 3NWEA 3TFOA 4Q3OA 4NCAA 4UEQA 1BWRA 1V7ZA 4TS1A 3FYSA 1W29A 2HT6A 2JAPA 3K35A 2XA9A 3W9YA 4EB8A 4FYYA 3NATA 3OQ6A 4DUPA 1PQYA 4DA7A 1X19A 2X6RA 3OOWA 1GCUA 4AMZA 3QW2A 1YIDA 5I5EA 3AV0B 1ONOA 4MKXA 1GPAA 2WUWE 2XWJI 3JVVA 4Z0HO 4EO4A 1TFRA 2QG9A 3FJOA 1D6MA 4MWGA 4F3RA 4DNOA 4YCDA 4OQLA 4PR0A 3G49A 4S0ZA 1IUOA 3H5IA 4U8GA 3THYB 3CRQA 4O2AA 4B35A 1QPZA 3KQOA 2Q41A 4MUXA 5HXAA 4Y7CA 5LD2B 1NF2A 1CZHA 1E4EA 2XXBA 3EEBA 3GCGA 1ESEA 3DJFA 1S0UA 3ABOB 3USCS 4HV4A 3E3AA 4FYMA 1B76A 4M9CA 4AF8A 3MINA 1Y9DA 3ONVA 1EINA 4KQ9A 3EVBA 3ZYCA 4E5UA 1ZN2A 1KI6B 2Z5VA 1C1YA 2WI8A 2DKFA 2PHZA 3DKIA 3CONA 3EQ2A 3FPEA 3JQBC 1WXXA 4IJ5A 1C80A 2H2GA 2X8WA 5BNTA 1BHSA 2A86A 5BYJA 1RLMA 1DG9A 1VJ1A 3MUNA 1W19A 4H6VA 1MB2A 4JNCA 3DZBA 4UZSA 3QFSA 4FDMA 2QX7A 1RM3A 1GPJA 4PYLA 2HK9A 1T91A 4G01B 3MHTA 3DMFA 4S3MA 2IW1A 1P1CA 1VLMA 4MA4A 1V11B 3CGGA 2ID8A 5C1PA 2XGMA 3EIFA 3T9BA 4BMVA 3KSBC 4QYIA 4HEJA 3UGKA 1DBVO 3T4XA 2YJ6A 1VXOA 1YFKA 4R5HA 3QITA 1I3OA 3WP1B 4ETWA 1L5YA 1NJ8A 4RMIA 1Q0PA 2NU7B 2CXPA 1ENOA 1O77A 1L3IA 3AW9A 3C3KA 4KLCA 2P35A 4P1ZA 3RUDA 3VH3A 2VSNA 3WYFA 2ZAIA 3RK4A 3K0CC 3DHNA 2O8EA 4OOEA 4JLNA 4ASUD 1XEXA 5EJFA 2ZJ8A 3I1FA 1EFHA 3HFJA 1BX0A 1T2FA 5CHEA 1HQYE 1SVIA 2QXYA 4I36A 3T5AA 1SIUA 1N0IA 2WJAA 1TM2A 4C7MA 2G17A 1XRLA 1AUQA 2QV7A 3A70A 4ZOLA 4ZT4A 5BURA 2WJYA 3LT4A 1IZYA 1UQRA 2QRVB 2OQVA 1TMKA 4BNKA 3SKVA 3CPEA 3E9YA 4IFIA 1K89A 3BA1A 1NL3A 2ONZA 1CYDA 4FT4A 3UF0A 1WD7A 3QE2A 3G9UA 5IW8A 2WWIA 4I4TB 3CVUA 4PM4A 2XNDD 3HZOA 4WJZA 3FSRA 3ZVKA 3KWMA 3H2HA 1NZDA 4UNRA 1LLCA 2IK8A 4BGDA 3A6EA 1V6CA 1Y5MA 3BYZA 2H1SA 3I34X 1NBOA 1MNQA 5C34B 1WZCA 2IUFA 5TS2A 3WAKA 2IIBA 4RTLA 4YUWA 4LZZA 1DIHA 1NGSA 2XTAA 3L18A 4EUSA 4Q4DA 1LK7A 1QF7A 4W8GA 1RYFA 3FUTA 4BVKA 4CMGA 4R5MA 3N7AA 2OG1A 2QIOA 1Z4JA 1FU4A 2OV4A 1DEXA 2GN6A 3IEMA 1R8QA 5CJJA 1PJ8A 4R0VA 1CJBA 4K6GA 1AKNA 2C5EA 1EX1A 3BN3A 1O9HA 3LOUA 3KR2A 1QKIA 4X20B 4AJIA 5G1NA 3PFFA 1VLJA 2FY8A 3BF8A 2BUAA 2OQRA 1DVRA 3CH7A 3MWLA 3AJ9A 4J16A 3P96A 2GHTA 3A32A 1A50B 4J0QA 3IDAA 3KZOA 4QSMA 1DQSA 1U1DA 3TX2A 1R0CA 3VSAA 4D0LB 4WXYB 3NHPA 4C08A 3DXXA 5ALGA 1QBGA 3HN2A 1FSZA 3X1MA 2AFIA 3QZUA 4HNSA 1IXZA 3LVFO 2C97A 1U9IC 1EJBA 4AN4A 1UKAA 1R6BX 4KIFA 2R7AA 3TW0A 5BN5B 1WF3A 1U8EA 4M0KA 3SGLA 2OESA 5DTEA 1M75A 1ETHA 3OLXA 3LKDA 2VDRB 2GCOA 4OQ4A 2G72A 3R9XB 4M46A 3RU2A 5JCOA 5IVKA 3VVCA 3OUZA 4Q9JA 3DVAA 1S2NA 1J39A 1P7YA 2J3MA 1MAVA 3RODA 4PLWA 1EA5A 2EAUA 2ZRJA 4ZC8A 1E79D 2GRUA 3LRXA 3I72A 1WUJS 1Z12A 2FE4A 3UMJA 1XZLA 2V8BA 2OXCA 2YDYA 3UQYS 3KEFA 4YX9A 3D6VA 2EWMA 2WVAA 1SCAA 3PXDA 4A16A 4CM5A 1Z73A 4E6EA 4DLLA 6YASA 1C8KA 1YMQA 2XDWA 5DT2A 3INTA 1WUHS 3ZHCA 2C7PA 3AYZB 5K8LA 2LV8A 1YVPA 1EK5A 1QIHA 3OD1A 4PNHA 3DT6A 4C5AA 4EVSA 5J2TF 4H7KA 3A10A 1O7JA 2QMHA 4QLAA 1TGVA 3GAFA 3OF2A 3DAPA 3UHJA 2ZUFA 5DBFA 1J8YF 2VDMB 1N7JA 1Z6ZA 4CN9A 3N05A 4ZVNA 1HNNA 5D84A 1TTTA 1D2CA 3KU1A 2R8YA 1FTNA 2E3JA 2VH2A 4L8YA 4Y9SA 2CJPA 2XE6A 4O2RA 3WMGA 1Q91A 1UFQA 2FHSA 2GM9A 2JIDA 3M5WA 1JPVA 4GRAA 1K4KA 1S3SA 2Q6LA 2ZEJA 3M34A 1LS1A 3I1IA 4HX9A 4NABA 5T6BA 3ENQA 1E3IA 1NVVQ 2B34A 4L8WB 3VHXA 1U0RA 2R6R1 3C1UA 2HM7A 4XIIA 4N18A 5TMPA 3A58B 2V3VA 2FLKA 4CTKA 2GXUA 3EZGA 1W1UA 4Y7DA 2IX9A 3ZWAA 4YRKA 5JZBA 4HYTA 3F9CA 4DCSA 3DDWA 2DLNA 1B2RA 4W63A 2N47A 4H08A 2BHRA 3G8AA 3VPCA 2YJNA 1VSBA 1PYOA 2A9QA 2Z6VA 3COWA 3DCYA 2HLHA 2E48A 2ERXA 3DR3A 5AKZA 1DC8A 3W2GA 4ALMA 5FDFA 1VCIA 5IJWA 4KQGA 1KI3A 4F9GA 1S7GA 2WT4A 1ZOSA 3C7DB 1KSHA 1AD2A 3I3SR 3NBZC 4YFVA 5FEUA 2HWXA 2VXCA 4I1PA 1R8YA 4OUDB 2O54A 4EYEA 1GPKA 3ESQA 2DPGA 2ODTX 4TTIA 1PFQA 3C39A 5H80A 3L7DA 5JPDA 1FDRA 1BNCA 5FF9A 4DMMA 3R40A 4BB6A 3EF3A 4ZI3A 3C3BA 5TPWA 1G63A 4G8DA 2BLNA 5CT9A 4AI6A 1V39A 4Z7JA 3QEAZ 3DZDA 3SHOA 1VG9B 1N2EA 1W9HA 2Y27A 3MEQA 4AL4A 5BT8A 1NF8A 2ZJ2A 1H2XA 3NONA 3KK0A 4F4CA 4MDYA 1G38A 4P4SB 2DBQA 3FF1A 4F8JA 4ZCTA 1QO7A 3C41J 3TXXA 3BHJA 5A04A 2ZDQA 3WTBA 3AP2A 1RZRA 3S8YA 3G02A 2AEFA 2XMBA 1KMCA 1FYVA 3I62A 2V9ZA 1CR4A 2ZB7A 5AJTA 1WW8A 1DJNA 2MDTA 3TLCA 5E9AA 4YAWA 2COKA 4LYDA 4YJ3F 3ICQB 3MCWA 3F1LA 2O48X 1ZESA 4TV8B 1MHTA 3T1NA 1G8SA 4HS4A 1U2DA 5KHAA 2DR2A 2R66A 3WWCA 5LOVB 2H5JA 2DC1A 4HB3A 4LV5B 1E2FA 1AF7A 4PNZA 1A98A 1VRCA 4RMJA 1IUNA 1KARA 2R86A 2OZVA 4JQSA 4YQYA 1EMDA 3SEQA 4I5IA 1LBQA 1W52X 4OGWA 5D00A 2IY7A 2XMRA 4EGFA 3ILSA 2E5LB 2A5LA 1OKKD 1P80A 1ZGZA 3RWOA 2LXNA 3PD7A 4IFEA 2C5FA 3EH2A 3ZIDA 5FA5A 1A5AB 4CMJA 5EHIA 3WLMA 4HD8A 3C6MA 1DUSA 3NFRA 4X66B 1TM7E 2HF8A 1AT1A 2ZTMA 3G82C 5CEEA 2AZMA 2JJ1A 3K5IA 3TF5A 3OUTA 1UEXC 1XN4A 2JFFA 3ADPA 2AR0A 3H4MA 1CPYA 4G97A 3PK0A 1L5HB 3BMNA 4XOIA 2Q4TA 2YKGA 3HU3A 2C99A 3NC4A 5I51A 1IBCA 1K2VN 1XROA 4ZKEA 5K4HA 1UKEA 3F6BX 3WLAA 1EE1A 3DMPA 2CEKA 3K9LA 1USKA 3HDVA 5HBGA 2CK3A 1OTHA 1R4NA 3NW9A 4RQBA 5HUHA 4U3JB 1JIIA 2NU9B 4E5NA 1V47A 1XNGA 4IOMA 1BMQA 1EBBA 4RACA 2VT7A 5B37A 4DCVA 5H0IA 2VOEA 3L8EA 3EVZA 4CLXA 2VK1A 1OXTA 4PSDA 1ZLXA 1SVMA 1THGA 1HFWA 3D2BA 4NE2A 1QFSA 3IP5A 4RCZA 3FOZA 3VYUB 2G82A 1HOXA 4Q39A 1R18A 1NDQA 4EHLA 4AQ7A 5J4VA 4OHVA 1ECLA 2HPAA 1S7CA 2QSZA 1OGYA 1J06A 2VP4A 3S0JA 4GLJA 1IBSA 3RPEA 5LQDA 5J59A 1IN8A 2R87A 1F2TA 2PD3A 3MS4A 3C8ZA 1L9XA 4P5DA 1L5KA 1XEWX 1GHTA 1N8TA 4JYBA 2IYAA 2QR2A 4YV0A 3LNTA 4UU1A 3CF4A 1NJ2A 3AFHA 5EQFA 3ZGXA 5EIWA 1RZUA 2NO1A 1D2MA 1H2WA 5EKDA 5BWCA 1YCGA 2PQ0A 2WJ4A 2NAFA 1EI9A 2TSYB 1DWOA 1Y7PA 1YL6A 2IHJA 4RLSA 4WCFA 5DTQA 1EUDA 5JU6A 1FUIA 1FUYB 5AI9A 5DWQA 3OX2A 1KJNA 4YAOA 5IASA 2H06A 4MDFA 5A05A 1N1MA 4BNMA 4DZTA 3G7UA 1XB2A 4Z3OA 3OP4A 4CVNA 6ABPA 3D1LA 3KCNA 1GN9A 2VN8A 4Z9FA 2Q8QA 2XB6A 4JBHA 3PTAA 4ARAA 1SA0B 2ROQA 1W88B 4MKFA 2ZVDA 4COKA 1JVNA 4MR8B 1N3YA 3ACBA 4H1UA 4QQNA 3ZE7A 5JXGA 1LSOA 4ZZ2A 3RROA 4D99A 1W5BA 2JDIA 2O3TA 3ESAA 3B1JA 3KZCA 3BBLA 4DIUA 3F8TA 3HL4A 3FVQA 1RKQA 1ULBA 3FSGD 3ZV3A 3IQXA 3WIEA 1ZD8A 2RB4A 4IIJA 2Q50A 4R2HA 4MS1B 2W2QA 2HBRA 4CMIB 3WHLA 4M9ZA 3AY6A 4FFMA 1EH5A 2C2XA 3EZ9A 4LRSB 2RH4A 4G0QA 1RNLA 1AM4D 1QONA 3IR6A 1IULA 2Q4OA 2BCEA 3K6JA 4GPBA 4K6FA 4XKJA 2HNAA 1TO1E 1DV2A 2JA1A 4FE3A 4JJ4A 3E35A 4K6MA 4LRQA 3HSKA 1Z35A 5LU8A 2P2GA 1JJFA 3D64A 4LXQA 3JQDA 1J2EA 5KSOA 1UEJA 3BAZA 4DF3A 1AB5A 2V6MA 4HYYA 1XKLA 4PZPA 5J2TB 2BHSA 1U8TA 1S6YA 4EECA 3EIHA 1P61B 2BKXA 2AS0A 4ARSA 3K0AB 4FX5A 2DSNA 2G40A 3B1FA 3NOVA 4UE6A 4PN3A 3M6AA 2REXB 2WKQA 1I4LD 4Y2QA 1UBHS 2QX9A 2VNHA 3CA8A 4MQEB 4BX9A 4I3FA 3OZXA 4Y2XA 5E7IA 4JP3A 4BO1A 1YE5A 2SBTA 4W1PA 1I2CA 2G9QA 4GKBA 4UVGA 5EJIA 3RCBA 4QNNA 2JKYA 3NWJA 4U5QA 1QG4A 3FCEA 3QVSA 4DV1B 2JGDB 1Z7EA 2X9VA 1UBLS 3GUVA 3VSEA 4BQEA 4Z7OB 1L3CA 4L16A 5DK4A 4NCXA 3VC7A 4C4OA 4CLHA 1Y3AA 2R5FA 3ZW9A 3SZOA 2BGWA 5FNVF 1GEGA 3PGVA 4K87A 5IC5A 3SYTA 5BYAA 1GDHA 3RJMA 1AGRA 4DCMA 2F90A 2ZULA 3F6CA 3FDFA 1U0TA 1K08A 2X0FA 1FTWA 4M1EA 1KEPA 4EK9A 5GMOA 1K5PA 3E3OA 4XRRA 1UXGA 4FHDA 2DECA 1XI2A 2YWBA 3PHLA 3AXTA 2Q8NA 3G5TA 1OH8A 3ZK9A 1PAUA 1UFRA 2PJUA 4P4TA 3PF9A 5IN4A 2OKCA 3IEKA 1OW3B 3DQQA 1P5HA 4XB2A 3CWZA 1Q1BA 4Q7EA 2IHNA 2FEKA 1T0UA 2EKPA 4JL6A 2VQEB 2CFTA 4FMCB 4DV7B 4FFRA 4V0OA 1W6RA 4NARA 1E9AA 2VNJA 2VHYA 2ZLBA 3CRW1 4TWRA 4XYEA 3USZA 3LDHA 5JE8A 2F1OA 3MN1A 4CT5A 1WABA 2ACKA 3KQYA 1ADCA 1VB5A 1V9LA 4H6XA 4HK4A 1DP4A 1XRQA 3OZEA 3R6LA 2V74B 5DN9A 3P9CA 1IWOA 1RRFA 5LYJA 1U2RA 3B7PA 4XVQA 5J40A 4BYMA 2F9MA 1FLDA 3HWWA 3T5BA 1Z6TA 4LF5B 1IEQA 2ZCVA 5JARA 4R8SA 2JVIA 4Y30A 5AHWA 5HIIA 2HRCA 3FZNA 1T9CA 5JDCA 4WINA 1VB3A 2CKMA 3THRA 4JVMA 1SAYA 2AFHB 4F5YA 1Y5NA 4EI2A 1MJNA 4NDNE 1TZBA 2GNOA 2V7BA 2W4IA 2NQTA 5DN6D 2ZRHA 4MW4A 2XXAB 2YXNA 3QVUA 2CB0A 1RWBA 2JGKA 3KVVA 5FR1A 3UNXA 1QDUA 2DBZA 2ZVPX 5F33A 5IUJC 1Y4AE 1GQ2A 3JR3A 4FFWA 1NOJA 4P54A 2V4ZA 4H0FA 4MVJD 3WRYA 1K8RA 3NEYA 2Z2KA 1H2RS 3FSJX 5KNCH 3QBDA 2XE4A 1L5VA 3LUDA 2AX3A 3ZWVA 1YVDA 2OV6A 3EXG1 3JQQA 4D0RA 5CB8A 4ZVVA 2MSNA 2FUG1 4EM6A 2PRKA 1ILWA 3BMOB 3KD2A 3KTDA 4NMXB 9MHTA 4D8VA 4KXXA 1VJGA 3E82A 4LXHA 4R1QA 3WWOA 4BFLA 1UPUA 4CMCA 3UW1A 2WYWA 3KKKA 4LYEA 5J2UA 1DFIA 1ZRMA 3A9UA 3IBYA 1JMYA 1WF6A 3D3EA 4BO7A 3NRCA 4MJ7A 4DLRA 2W2MA 3W2EA 3DLBA 4EQ6A 2H2WA 2Q07A 4B6FA 3HTXA 3FPHA 5DTRA 2GPNA 3NWBA 5JSZA 3V1NA 4WASA 4DG8A 1EG7A 3AM5A 3U7JA 4UZEA 4OGLA 2ENWA 3BE6A 1KH2A 1P7VA 5EMJA 5I9LA 1DG3A 1YIAA 1YZHA 2WFAA 4I1OA 4X7PA 3W3ZB 3ZIAA 4YRMA 3FOAA 4UPVA 2B5VA 1YR6A 2QY9A 4MA5A 5CXXA 2IDMA 4ESOA 1MHPA 4QTTB 5AICA 1RXWA 2EX4A 2CJFA 7MDHA 2VF4X 1KWGA 2PAFA 3NYRA 3CBQA 5HCIA 4YAGA 1I01A 2AFHE 1YC5A 1QOZA 2VIIA 3EN0A 1SO8A 4RULA 2BAGA 1BXRA 1K5GA 2D7CA 2DUUA 3RV3A 2I4IA 1PG0A 3DCIA 3O8DA 3SR3A 1IDOA 1NN0A 4Q1DA 3CLTD 1KDVA 1JZTA 3TVYA 2V0GA 2PSEA 1FNSA 4EWLA 5BR8B 3GJ5A 3P9SA 4OHZA 4D25A 2GF0A 5JVDB 3WS7A 1OXMA 4FCVA 1VDMA 4XGKA 1F0PA 1FTSA 1X1QA 2C9YA 4A2WA 4ZEMA 4LBYA 4RVCA 5JAQA 1DAGA 1KAHA 2O5RA 3LX4A 2WLTA 1G64A 3D31A 5FO0A 4FYPA 4EA6A 5TGZA 2QUBA 2I78A 2BBTA 4TVSA 3KKLA 1TM4E 3QVKA 3VH4A 4GGPA 4J4TA 3H3JA 1I6LA 4HN2A 4OQFA 5BMVF 5BOSA 3DB1A 3AINA 1ZM2A 3GRFA 1IZ8A 1CS4C 1V7CA 3PUYA 2J46A 5ALKA 4DMRA 5JFOA 4PRLA 3ASYA 2C2OA 2QXUA 4OQMA 4CT0A 1D04A 5CB6A 2F00A 2ZQYA 1WV0A 3BWXA 3QFTA 3R3VA 5AJUA 3SEZA 2BI8A 2GBLA 1RPAA 2EZTA 2V97A 3L7IA 3UICA 1PJTA 2QROA 3T7TA 5B1HA 1G8GA 4NY1A 2I4RA 6NULA 2GXAA 4CQNA 3OLYA 2HU2A 4HQ6A 5DH9A 4OLHA 2BFMA 4QL3A 1UDBA 5FT9A 3IJEB 2VF7A 2BFDA 3P32A 3L6DA 4L02A 3ZCSA 2DQ4A 4EGQA 3TNDA 2K5UA 3ICPA 3ZQUA 1OWPA 3BFJA 4GF5A 1RQGA 2WWGA 3KSRA 2ZT5A 4UDXX 5K2MA 4FKMA 4NRDA 3ZZNA 1AK1A 2P1DA 1W4AA 2XT9A 4JB3A 4FNAA 1AVTA 4PTLA 1QE3A 3VR3A 1KAMA 4MWOA 1AQLA 3CLRD 3WX0A 4ZGBA 1G8AA 3BMCA 5GM2A 2JLVA 1UZUA 3C6XA 1FDVA 1WBJB 2WYUA 1D9XA 4MWTA 4PFJA 4XWAA 5DBEX 4A2QA 4FXPA 3RDPA 3IVRA 1HEUA 1UJBA 4BFCA 3CZRA 4DVGA 2TRSB 3O4FA 5ICEA 4O0LA 1TMOA 5BWOA 2HBQA 3W5CA 2JS7A 4JB8A 3HP1A 1TZMA 4PWYA 4YK7A 5KJ6A 2YOGA 5CIQA 4GKVA 2WJIA 4F45A 3KUDA 3U60B 5I9SA 3CR3C 3LKZA 3NRBA 2PGNA 4YRFA 4ILEA 2X3YA 4RYDA 4XJTA 3RYHB 3JRXA 2RK4A 1NFFA 3IPCA 3DE1X 1PKXA 3PYXA 4Y6RA 4B82A 4UASA 1T2CA 3UMYA 1GPNA 3T1VA 3WLRA 5KAMA 4LCBA 3A2LA 3QMVA 1KDOA 3VHRA 1JX6A 3LT1A 1JXMA 4YJHA 1KP3A 1EVEA 1PZMA 5TVKA 2SICE 4ACAA 4BAUA 3MJHA 4MGZR 1AV7A 4EY4A 1GJRA 1KBZA 1Q77A 4IEIA 4KP7A 1SEVA 1XZKA 2EFDB 3TLYA 3WB9A 2VK2A 3JQRA 3OZGA 5JCJA 1ORRA 4YP7A 4OX9Y 2BEUA 4MVJE 5D87A 4CL2A 2FGKA 1U3VA 2I7VA 4TS4A 1PSDA 3VPDA 3D4IA 5FUBA 1SHUX 3KVYA 3ZGZA 3RWBA 2H1FA 4WOBA 2P3SA 3K6SB 3PXEA 1JKIA 4PYJA 3C2QA 3WICA 1DNPA 1O5TA 4YMVA 3TSCA 1QNLA 3MUEA 1BO6A 1YL7A 2J3IA 2HA6A 3I30X 3OMWA 4FFOA 1Z28A 2XADA 1KR2A 3P19A 4HEA6 2NNLD 2P4SA 4KK4A 2QNRA 3FYHA 3M3PA 3VZPA 1FW8A 5FWXB 2VTBB 4UD6A 2HV9A 2QVLA 5NULA 3O8CA 3N0TA 1YZLA 2RH8A 3AMVA 3O8NA 3MQ2A 2FJ0A 3E61A 1YZQA 3UWDA 1L6RA 1ANKA 5KDLA 3ZHXA 2OM2A 3G1TA 1T36B 3GEDA 3MJSA 3P9RA 3F97A 2DAPA 2RJNA 3PC7A 5KTSA 2IP1A 4GYKA 4HNGA 2PVSA 2UVPB 4GZMA 1A7KA 3I6ZA 4I9NA 3R3WA 1KI9A 4IO1A 4UMDA 1Y8QB 4JI3B 2XMGA 4TYMA 3SJUA 3ZV7A 4D8YA 4W7HA 5HOEA 2C07A 1P1HA 1CE8A 1R3UA 1YR3A 3BJEA 3MUOA 4Y0VA 1ZZGA 4M1KA 5CXQA 4A8JB 4D45A 2HQ1A 1BMTA 4PLVA 2AG5A 2YNMA 2UUPA 2ZB2A 4P3NA 1G17A 4AJ1A 4Y1RA 3N0WA 1Z4PX 2J3JA 3NIGB 1J8FA 4J1TC 1A8HA 3HCAA 4MUGA 4NJEB 1O6BA 3NH6A 4C0KA 1AZWA 3QVJA 1FUKA 1SOVA 1DWQA 1FBNA 4IO0A 1VSQA 1Z0AA 4KN6A 4PSVA 5FRDA 1CYEA 5K5EA 1OD6A 2XTMA 1ZJWA 4GZ6A 2IOFA 2PO5A 4L8LA 2I2FA 4LXTA 1GAWA 4MI3A 3SJBA 4AK9A 1KJYA 4ZQIA 3VAAA 1YR7A 3EFEA 4TKZA 1CBUA 1MIHA 2F2TA 4FR5A 3LVQE 3FMGA 2CXQA 3L8YA 1O4VA 4OGFA 2YWCA 4OXNA 2C7BA 2RAFA 1UBMS 3NT2A 4UUAA 4CMEC 3CVWA 4FEEA 3P5SA 1K9SA 1VQ1A 5CAEA 3AOEC 3WOHA 5C5CA 2IS2A 3CX6A 3CR7A 1MCZA 2ZI3A 3QKRA 4Q9NA 3WMXA 4TTVA 4MYHA 2NYRA 2IJGX 2IS4A 3PDWA 1WHSB 1E6LA 2GESA 2J67A 1P9NA 4DEYA 5F73A 1NULA 2WJJA 3AM4A 3DMDA 4I0WB 3LBYA 3WWEA 4G5XA 4HUTA 1G20A 4UBIA 2IDJA 5A71A 4NE7A 4D7AA 2ZXFA 1XC7A 2GO1A 4UEWA 3ESYA 4B4UA 1VHDA 4N54A 1K7XB 2QM7A 2CDBA 1MB0A 5K0FA 1HF3A 2CVPA 4HLCA 4IGIA 4QPCA 2GJ8A 2YV2A 3IAXA 1CJMA 4HYEA 4QHSA 3NASA 4C5BA 5CG1A 1QF6A 1B74A 1CIJA 2HU5A 1DKRA 1JAZA 2IEDA 3AM3A 4PLFA 3QELA 5EPUA 3PFBA 2R48A 2V6BA 4PF1A 1FLVA 4PINA 2ZTVA 3X0DA 2OHGA 5C4MA 1L1RA 2HWUA 2VYQA 4OP2A 2PH7A 4WK0B 1EWRA 2PUBA 1FC0A 3K0HA 5IJZA 1Z4QA 4XM2A 4PG5A 2J4CA 2G7MC 2OV8A 4GM1A 5EJGA 2NGRA 2O3UA 3HZHA 4XX0A 5CT6A 3FUUA 1JP7A 1U1IA 4YO7A 4UOEA 4OK6A 1OBCA 3AUYA 1HUQA 3Q3VA 3UTDA 1E2HA 1TMYA 4KFCA 4C0XA 3HCNA 5KNDD 3T1TA 1X38A 4R2MA 3ZBTA 2BWJA 5FL7D 3RS2A 1M10A 2BMFA 1WXHA 2JVJA 2PMKA 2QQFA 1F2UA 3SLGA 1ZD1A 2ZOSA 4OFBA 3QWBA 5JAUA 2CFOA 1OAAA 2XJ9A 3BTVA 2XQGA 4UQPA 2W2XA 1RXYA 2I0FA 1U4OA 2LIPA 3JD4A 4M9QA 1UQTA 4YRBA 4ZIRA 1U7OA 3FNRA 3S1AB 3AP3A 2IYLD 4Y1RB 2AMLA 1OAOA 3SXUA 3FWHA 1C1XA 4FCCA 1G5PA 3FZQA 3A28A 3PD1A 2JLUA 1GYRA 3UV3A 5JJCA 2QN6A 4CF4A 1D2NA 3LQQA 1Q2UA 3AUUA 4LDQA 4N40A 1AO0A 3S5JA 2X4GA 3EX7C 3C24A 3BE4A 3IUJA 4UEKA 5CRIA 3PHCA 4GNKA 3UHOA 4D3YA 1P2UA 2W71A 1Q21A 2PGXA 2O9JA 3EGOA 2O8FA 2OOSA 3BJRA 3QENA 3A1DA 1RBQA 3QPUA 1X7HA 4NDZA 1XMXA 1JH8A 3FWZA 5LWHA 1WKBA 2OZPA 3W2TA 4BTEA 4UXIA 1JE0A 4P22A 3AF4A 3CLSC 2WFZA 4M4SA 1V3UA 1XK7A 5FR2A 4PX9A 1Z07A 4OQPA 4A5SA 2Q4RA 1L7VC 4WPGA 4FD2A 3T9EA 1K6XA 3F67A 3B48A 3AVWA 2VHJA 2VJNA 3RRNA 5JXIA 2V98A 3HZRA 4O8ZA 3TQRA 4F21A 721PA 5CDTA 5EXTA 5D3QA 3KJIA 4A92A 5AK3A 3HJUA 1XYVA 5GY7A 2OL4A 3K05A 4N7RA 2FPIB 2RGNA 4CM4A 4REMA 4D81A 4IWXA 4W9NC 3AR9A 2GM4A 2V7XA 4EPYA 3GLUA 1ZBQA 2GFIA 1WZEA 4B83A 1Y81A 3DXFA 2Z4SA 4ECAA 1ZONA 4X9XA 3IUSA 4NPHA 1G9XA 2QRMA 3CH5A 1RJ9A 4O2BB 2EC5A 3BS4A 1EUQA 3HYSA 3AJ8A 3BT7A 4K8OA 2FMXA 3DJYA 3BHIA 4FFBB 2XGOA 3I0MA 4IZ6A 1T8TA 2Y9MB 4AO7A 3TZLA 4AECA 4CDRA 2QMQA 3LL7A 4BNFA 1NSTA 4JIMA 1UF9A 3JQGA 4EYKA 2C2KA 3KZ1E 1BVUA 2LCQA 1KJ8A 1QPBA 4C88A 3CRVA 1S2DA 3IA2A 2ZRDA 2P6RA 2BCJQ 3ZY3A 1ZEJA 3DLHA 3GJXC 1KC1A 4KQMA 4XVCA 4NS1A 3QMPA 3V8VA 3AZQA 3PUWA 4M0CA 4WLNA 4IPTA 2NWQA 2P2YA 4M9XA 3SEAA 4DIMA 4DLKA 4JL5A 2FV8A 3FPLA 3CF6R 4DCTA 4EMSA 4L7QA 3EEOA 4DIBA 5G0SA 5LFAA 3N39C 1MC4A 1Q95A 3KYDA 3HY3A 3KJNA 4FYWA 5G41A 5FAXA 1ZVJA 4R1OA 2CSXA 4GOLD 1SC6A 4RVFA 4XJSA 3WLHA 2K2WA 4KQFA 1Z8DA 2AI3A 1A88A 1PE0A 1T8SA 2EDAA 1ODIA 2FW1A 3ET5A 3H75A 4G8BA 3WYAA 4PWZA 1FCJA 1PJZA 2J32A 2EP5A 2PRSA 3AJEA 3MD0A 5EWLA 4GR4A 4YT8A 4C29A 2BR5A 4LDAA 4XB1A 4CI9A 1F9EA 2OGWA 2P6NA 4J0FA 4HN4B 3FA2A 3E5HA 1H0RA 3RRYA 3T3MB 3ZHRA 4B40A 3ZDCA 4ZN6A 5DX8A 4F96A 3LUHA 4YCAA 1GNVA 1TADA 3IOMA 2WHEA 4X6XA 3JWPA 1IDN1 3MMSA 1W76A 2AZTA 5BVGA 1MH1A 2EHDA 1R8JA 2P5SA 3BXPA 2HSDA 3PC6A 4NVRA 1T6ZA 5T57A 1TPYA 4V1CA 1CY4A 3CG0A 3W9BA 3L3BA 5KYXB 1EXVA 3ZJ4A 1P4RA 3HEAA 1FMFA 1XZ8A 1E2EA 1XQWA 4EPRA 5G0TA 4GMXA 4M6WA 4DDMA 1CKEA 3DA8A 1ESNA 4B75A 1ZRNA 2XRYA 2YOFA 1GILA 1RQLA 3HXOA 4J0EA 3VU9A 5IDVA 2WIJA 4K46A 1JQ5A 4LJYA 4MLCA 4UDOA 5B2FA 1IG0A 1JHYA 3MB8A 3WWZA 4TVBA 2EEPA 5KTRA 3G7SA 1KH1A 3O38A 1RQPA 4P08A 4KREA 4IJQA 4EP1A 2VNAA 1SOWA 4CEJB 4E14A 4NOJA 5HFAA 4C7OA 4K9OA 4TKMA 3PT5A 1I2ZA 4QHTA 2QQGA 5BSHA 3WA6A 3A6JA 4G4IA 3LM8A 4Q6WA 2XMPA 1TEHA 4MP6A 2O2HA 3W0LB 4YT4A 2GYWA 3DVRX 2YVLA 3RWMB 5E9QA 1PLKA 1JYSA 5EA2A 1BE8A 2YW9A 1SG0A 5KJCA 2F4VB 3MGAA 1OLOA 3I6MA 3CVJA 2W6CX 3T12A 4QVKA 5CXUA 4BNZA 1WPRA 2QG6A 3OAAA 1DBPA 4LWQA 3L8ZA 3VR5H 3FLEA 3H42B 1OAOC 2F62A 5KUTA 1BOOA 3RTDA 2B1JA 2IQIA 3B70A 4POAA 1TD1A 3KKQA 1Y4SA 3WGUA 4XW2A 4MUYA 1QC5B 3UMRA 5IFKA 5EIEA 1I7LA 3GLVA 5F9HA 3K9HA 2QQEA 1MC8A 5FB3A 5KWIA 2EZ4A 3T99A 2G0AA 1ZH4A 2BJVA 1HRKA 3NBKA 4RQAA 4ZALA 1KVTA 1W6UA 4MKRA 3MWFA 4ZVOA 4DY4A 1Q1GA 1OV4A 1W0JD 3QF4B 1YCFA 4WIAA 4DDWA 1YZFA 3IL2A 4HNTA 1JQKA 1MC1A 1HLDA 1KGSA 1IVNA 1L3BA 1ZVQA 4IVPA 2WAYA 4PAGA 1VOTA 2H2HA 1K7SN 2O8FB 3E8SA 2FNAA 1JFVA 4P2BA 3LPNA 5C1IA 2ZB8A 3K1YA 2ZRLA 2ILVA 1MRZA 4PIMA 3LK6A 3NTQA 4KQKA 3U9TA 2Z2ZA 3BB3A 3O95A 1OFHA 4BJ5A 2FPWA 1A7AA 1C1DB 3QF7A 1E2QA 5FWNA 5I4BA 4L72A 4MW1A 2QLMA 4BQRA 4PGMA 2IODA 3JARA 3H9JA 3RYIB 3AEUB 3SDSA 2A5FA 1T1IA 2PDAA 3BMXA 1M0TA 4XTCS 4NYMQ 1AKWA 4D9HA 3A4YA 4WT7A 3NQ41 2XXAA 1N9GA 1TGYA 4X1YA 4D57A 3FDJA 1XRPA 2BGKA 2RHOA 2NVUA 1TB4A 5EJMA 3NFYA 1A82A 1V1JA 3FD8A 2ZR8A 1QZXA 3ACDA 3S68A 3ADOA 3HCCA 2EZ8A 3U7QB 2JI6A 3AEXA 4FOTA 1IB0A 4MW7A 3RIYA 1QRUA 5EZYF 3ZD7A 2C5GA 4MZXA 2P5TB 4DG5A 4PO3X 2RI0A 1PV4A 3N6VA 4JP8A 4LNAA 2QN1A 5BNFA 1M34A 5EP3A 2C8KA 1LZLA 5D7BA 3BERA 2BDEA 4YN3A 2QRKA 6LDHA 3NBAA 4NENB 5C0OE 1JL3A 2MSWA 2D13A 5KJFA 3NV9A 3QH4A 1ULZA 2LVBA 5CDSA 1TVEA 3CC8A 1GTVA 2I62A 1J4AA 3PC8A 1F17A 2Z9BA 4AWXA 3VX3A 2YBEA 3JQFC 1LH0A 4QLBA 3LT0A 4U00A 4EFMA 3B9RA 4B8ZA 1K97A 3GUYA 1NKVA 1CNFA 1HXHA 4R8LA 1V9CA 1P5RA 2HGSA 4BX0A 2AD5A 4TLBA 5BWMA 1Z2CA 3X1YA 2WJGA 4Y6SA 1W4LA 2XRZA 1CEEA 1Q0ZA 3KXKA 2JFHA 3O2QB 3B9QA 3PQDA 3OUUA 5EZ5A 4WKBA 2HCFA 1U7DA 4MKZA 3KBBA 1Y9JA 4HNRA 3F7NA 4AZWA 1UEIA 2PMCA 2O2EA 2C3OA 2MMGA 5KU7A 5BV1A 2MINA 2ZRGA 5CB4A 2P67A 3G2NA 1UDXA 3R5XA 5G3YA 4EBFA 5DHQA 1JQJC 1AURA 5KNCD 5ALFA 3V2IA 1WULS 1PWXA 3HVIA 3A6HA 4B44A 1EIZA 1M1XB 2RG1A 5IC4A 3Q8XB 3R3ZA 5BMVA 4EW1A 1Z5WA 1ZJYA 3ISVA 3ADDA 2X22A 4PONA 3A6DA 2PKXA 1Y3CE 5IFLA 1LBIA 4Q21A 5TQ2A 4B3IA 3S2IA 1R5OA 3OKPA 2P1RA 3ZU6A 1X1DA 3QA9A 4F2DA 1TRKA 1T2DA 4TWBA 1RHJA 3R8FA 3X1JA 3Q3HA 3HB4X 4OYRA 1SXGA 1M74A 4FBGA 1FBTA 3AR6A 4H7IA 3MWEA 5AJVB 3UAXA 4ND5A 1XA4A 5DXAA 5L3SA 2CLHB 5EXEA 3PZRA 3K0FA 5FPTA 1QHHB 3WHIA 4DSOA 1KDTA 1SC4A 2VT3A 2BSAA 4Q01A 4V24A 4XI9A 2FSVC 2D1YA 4XASA 1BTOA 4MAAA 1JMKC 1GG8A 1M2KA 1ELOA 1T2AA 1K1EA 1XDWA 1T5TA 2BUCA 2P2SA 2Q1UA 1XAHA 2FZLA 2X76A 3R5KA 4XR9A 4WZBA 3H9GA 4A6DA 4CMAA 2RHMA 2PBFA 4X8HA 1NXTA 3BQNB 3C5HA 3UJBA 5EKUA 2C9DA 4R05A 4JP1A 3BCSA 1WXEA 1Z7BA 4RVNA 4MYUA 4IDAA 4OXKA 1U11A 4BNUA 9ATCA 3HV0A 3PJDA 3DUWA 4FQ8A 1P62B 1NV8A 1H9BA