3IX7A

Crystal structure of a domain of functionally unknown protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
APRGGKVLDTSVLVDGRVAEVAAVGFLEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERLREAAPLEVLETTPKGESVDEKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQALRPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein TTHA0540
publication title Crystal structure of a domain of functionally unknown protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 47
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 3ix7A00
3ORYA 1O4WA 3H7IA 5ED0A 5L6LB 3ZDAA 5HP4A 2HWWA 5HMLA 2IZOA 3QE9Y 2H1OA 4CHGA 1TAQA 5L6MB 1Y82A 2MDTA 2H1CA 2QIPA 2WP8J 5K8JB 1EXNA 1A76A 2FE1A 1W8IA 3IX7A 4MJ7A 3QEAZ 2DOKA 3ZD8A 1XO1A 1TFRA 3H8JA 3ZDEA 1A77A 3H87A 5ECWA 3Q8KA 5H4HA 5ECDA 4XGQA 1BGXT 1MC8A 3ZDDA 4WA8A 4XGRA 5HMMA 1V96A 3DBOB 3ZDCA 2IHNA 1RXWA 3ZDBA 1YE5A 5HNKA 3H8WA 1V8OA 1UT5A 3TNDA 3I8OA 1TAUA 1V8PA 1RXVA 2HWYA 3Q8LA 1UT8A 2BSQA 1B43A 5H4GA 1UL1X 3H8SA 2LCQA 5ECYA 3ZD9A 3Q8MA 2HWXA 5FV7A 5SV2A 3ZVKA 3QEBZ
chains in the Genus database with same CATH superfamily
1OXSC 4MKZA 3EVEA 4RESA 4LXXA 4H0FA 3EXHA 3AB7A 1ONSA 2P3LA 5I7UA 3V2GA 3MSCA 1Q0HA 4LS3A 3A11A 2R6JA 2GGSA 3IGFA 4FMCF 4ZJZA 1COWA 3P9YA 4J91A 3R5HA 4R7GA 1QRDA 5DP2A 3I92A 3QYFA 1VE1A 3MOGA 4H77A 3LZCA 4Q9HA 1A82A 2DBQA 1EEXB 5AM4A 5BSVA 3KDPA 3HSYA 3ND9A 3D3WA 3BMQB 3OUTA 4MO9A 1QIIA 1QP4A 1HZJA 1WWKA 3IT0A 2WDZA 1H4TA 1KS2A 2O52A 2M98A 3E9ZA 3NTQA 5ES3A 5K0TA 3PEYA 3GUZA 1AKTA 2B20A 4I9NA 1VMIA 5HA5A 2PD4A 2QP9X 4QGFA 2GXQA 2OO7A 2R6FA 4M7WA 3SE0A 3KR9A 3W5DA 2X14A 4L75A 3L7IA 3PUXA 4N5HX 5HTKA 4Z7QB 5KS2A 3V1MA 2QJOA 3JQ7B 4XRRA 3HEBA 1WVGA 5E95A 4D25A 2QQFA 5D3MB 4R9RA 1HDZA 3HRIA 5CNIA 4B6PA 3FZEA 3QVTA 1Z63A 4PTYA 1SGWA 1KEWA 3BFJA 2W11A 3CYFA 2C1ZA 2G07A 2H52A 1USIA 1TJYA 5AIBA 1V43A 4MRMA 3TMAA 5IVPA 1NBIA 4QVKA 3IQIX 1MOSA 4G86A 2IEYA 2YFKA 4M1WA 2GPSA 2GSDA 3JD4A 1E3IA 3REOA 1KJQA 5F77A 2IGTA 3TZBA 3WRWA 1QDLB 2QLLA 4V02A 1I7NA 3SDZA 4IIXA 4YEDA 1G291 1DRWA 2J4CA 4LNHA 4DIFA 2QXYA 3V4RA 2VJMA 2L42A 3OX2A 3IHKA 5AXBA 3VQTA 5ADWA 4D45A 4O4JB 2VJDA 1SWWA 2VDVE 2Z95A 5AI9A 3CUWA 3STHA 4ETMA 1B42A 4RD6A 4ZJYA 3KJGA 3PQ7A 4N0EA 4NMXB 1V7ZA 3WRXA 4DHEA 3VSAA 2G04A 2OO5C 3PGXA 4AF6A 3PFNA 5K3AA 3T4XA 4RZXA 1K27A 3RTCA 2C7RA 3A3KA 3UWOA 3F1KA 2HJSA 1RAAA 8AT1A 1CKEA 2CK3A 4OHMA 4C6TB 3GDHA 3LVFO 4OFZA 3TQSA 1XJQA 2W6JA 2AV6A 4AY3A 2N42A 5LMUB 3BJMA 2P8SA 4DAOA 3VMMA 1V5IA 4ZV9A 3EE6A 8ABPA 1ISIA 3FTNA 3L0DA 3PITA 4MVJI 3VJRA 1JU9A 3KG2A 4HJXA 3S29A 1KO8A 4YI3A 1T3GA 3ZE8A 4LV8B 1QX4A 2ZRGA 3JYQA 1IB6A 2GQ0A 4NS4A 4B7UA 3HG7A 2GFHA 3CRQA 3PNOA 1TEHA 3U3JA 3G82C 1E0DA 4ZWNA 3PX3A 3IPCA 3JATA 4FJ1A 4PFJA 5JVDB 2IS6A 3C70A 2RJOA 4QU0A 1CVLA 2P4SA 1BW9A 1UIRA 1PTJA 4OSEA 3EUEA 1DI0A 4OHVA 2HRDA 3UFBA 1LGYA 3W0LB 4F3YA 4YMUA 4P4LA 2P6RA 2F4VB 3INNA 1Q11A 1RLIA 4PQRA 4CCYA 2APJA 4KFCA 5THKA 3SEQA 5FOQA 1OH7A 4MR9A 1L1RA 2NLOA 1GIAA 2PT9A 2EZ8A 5GM2A 5HIJA 2YZ7A 3ZS8A 4EJSB 3SHOA 2XOKD 2BE9A 1GXSB 1IUKA 4FE4A 3D3JA 3K9QO 4IGFA 5C4MA 1L4GA 1P5JA 2OP1A 1VMAA 3IULA 5TT0A 5BPFA 1XQ6A 5E1MA 4BXOA 3CWZA 1NJGA 3GJ0A 4JWTA 2CZCA 3I1YA 3U4HA 3DDWA 4CQLB 1G66A 4DDHA 4LC1A 4IXDA 4F9FA 4DS3A 4RGQA 4HUTA 2ZK7A 2EQAA 2ZGVA 3OMWA 4EL0A 4I3FA 4IVPA 3GJ8A 1R27A 4JJEA 5A7FA 2NVBA 3VFDA 2PX2A 5K5EA 3FGNA 1UPBA 3EVAA 2D1RA 4XRGA 4XWOA 2EZTA 3G1UA 4GOLD 2VXYA 4C0AC 4FILA 3Q7SA 4TVBA 4ZOCA 4B7CA 1GNRA 2M1ZA 1F1BA 2HN9A 3W5UA 2NV6A 1ECBA 2IDZA 3RV3A 2NZ2A 1QYXA 4A8JB 1DBPA 2OV1A 3DAHA 4C7MA 1EFVA 3DR5A 4O4IA 4DCPA 4G4SO 1JJBA 6Q21A 1JAHA 3RVLA 3WB0A 1AK1A 3IR6A 4OXYA 4LC0A 4L57A 1SD2A 4WWHA 3REQA 1AHNA 3JASA 5KCMA 2PFSA 4E1BA 1F5SA 3HBFA 1AMUA 3KYDB 1TYEB 2VXCA 2CJPA 4LVOA 1WB6A 5G4KA 2WW8A 3HXKA 1MA3A 2VTBB 1NJ1A 2DBRA 2FG7C 4BMXA 1M8FA 1UDRA 3ABRB 2I6XA 5C46F 5JQGA 3ZQ6A 3RHSA 5AM3A 1KEPA 1IONA 3FOFC 2CDBA 2AMYA 4QUDA 5AJTA 3HBMA 3NM6B 4NCKA 4ACBA 1G55A 5FTMA 1ZN2A 1FFDA 2DH6A 4YLEA 5LSAA 1AB6A 3O4VA 3G7SA 2NW6A 1CQIB 1B93A 1K5PA 2JCSA 4PYLA 3W7BA 3C5VA 2C3OA 3MEQA 1IM8A 4XB6B 4D3ZA 3RROA 1EFHA 4MB6A 3VSEA 3BXOA 3CZCA 3HUUA 4MHSA 2MYUA 3RFUA 1BHJA 3WOHA 4BQRA 3BA1A 5AW0A 4BO5A 1MC8A 2JGEA 2MSKA 3PKJA 2XZOA 2TMYA 3FCYA 4J49A 4KI7A 2J9ZB 5E7MA 2HQ1A 4WERA 5DW3A 3WGOA 3X1MA 4BPRA 1M3SA 1DFHA 4EGSA 4N48A 1L8AA 3EZFA 2IU3A 5DBIA 1U9CA 2HCFA 3T3EA 3HDQA 3S8EA 5FA6A 3DFIA 1JR6A 1QE5A 1VQ1A 2HMVA 2J7PD 3DZHA 3LPMA 2R5NA 4M9RA 4YDRA 2H3HA 4B4KA 2FUKA 3WNQA 4EFLA 1ZAYA 3PCRB 1M2GA 1KSJA 4AO6A 4C6RA 4L78A 1GTRA 4CRWB 1WP9A 1G21E 2NTNA 1Q95A 1V9LA 4RVCA 3RM3A 3SS7X 3T7AA 1YSCA 2H54A 3AUKA 3M9LA 5BQ5A 4HC4A 4KO1S 3HM9A 3BL5A 4LFCB 1KJWA 1P5FA 3CB4A 4K87A 3IOYA 3ZHVA 1QZ3A 4HAWA 3AEYA 4L5JA 4TM8A 2FCRA 3BSYA 1NF2A 2OAP1 4Q15A 5DASA 5BQ3A 4Z4IA 1LQTA 2OHOA 3KPJA 1YC5A 1AKQA 4F46A 2CVZA 1YI0A 3TZ6A 5IKXA 3ANTA 3KOOA 3CJRA 5M04A 1UBOS 1YRYE 1C7JA 2HNBA 4PLTA 1L4EA 1HEIA 2KI5A 4KQMA 2H1HA 2IYYA 3Q0EA 3CR8A 3H8SA 3QHAA 2A88A 3B1VA 5H0IA 5I3ZA 4F04A 2GN8A 4JQOA 5DGDA 5K03A 3D4LA 2EG9A 5C31A 4G84A 1AXGA 3T5AA 3NM5A 5P8WA 5BO5A 2ZRNA 2F8TA 2PJZA 3NZEA 1WZIA 1CUJA 3CKYA 2ATVA 3G2MA 3A25A 3STVA 2GVZC 1P5HA 3GLFA 2D7DA 2QL6A 5KNDH 2Y2UA 4FCCA 3VM6A 1K89A 4DL9A 1UBTS 4IDNA 5IXSA 1QGYA 3AR3A 5J4HA 2R00A 2RGXA 5CVJA 3CF0A 2WINI 4RA9A 1CD5A 1FPQA 2GJAA 3OU2A 3VBEA 1U3VA 1ZX1A 1NXQA 3ZHUA 5GVSA 1DKOA 4ZJPA 2XQIA 2V7VA 5B7NA 2VXBA 1I51A 3FWKA 2XH8A 3PICA 4JSTA 3ZR4B 1KC1A 3IAM6 1FX0A 3HWWA 2AQKA 3ROMA 3U3MA 3VR6A 2DQ4A 3MJEA 2Y3IA 3PGVA 1HT3A 1L5LA 3SKXA 4CF6A 1C30B 3DG9A 3KQSA 3VU0A 4B73A 4GECA 2IH5A 1ZNZA 2VJYA 2NV2B 4FFNA 1RYHA 2EKPA 5EZ5A 2PRKA 2NVUB 4X7BA 1SCKA 3OQ6A 4K7JA 4MPTA 1C7IA 5CFQA 2JJ2D 1VSBA 3W2IA 3WB9A 4DQKA 3EB9A 1ZBQA 3AVTA 1IM2A 4RC9A 4MYRA 4EVQA 3O8QB 1S2OA 1TMKA 2JEZA 2PDAA 4MW2A 3KHUA 2GJKA 4WJZA 2A5FA 1MMFB 1IQUA 2J0SA 4ZEWA 4J16A 1Z38A 2JAHA 1WA5A 3ANLA 4UM5A 4NCNA 2Q8NA 4S1WA 4RHTA 2AQ8A 2JA1A 3FLMA 5LQSA 2GF9A 1K75A 5AW9A 5LZ7A 3ZE1B 4E33A 4EB3A 5COBA 4RZHA 4CTNA 2YN0A 3O83A 2HZBA 3GLIB 3THYA 1SK8A 1A4UA 1PWXA 1R8QA 2XUZA 4KWIA 4PGMA 1OX5A 3HEMA 5EI5A 4A2CA 5CIYA 4JU8A 1XPUA 4WZAA 4WW0A 4YRAA 1U2RA 4HFMA 3NJ8A 1QWOA 2W2KB 4Y2RA 2XYHA 2YNMA 4DWJA 1NA5A 1UXGA 2ZIFA 4M9UA 3WKEA 1ZD9A 4DLYA 1E99A 4YRTA 1E7WA 2WP0A 5G02A 3VVCA 3NAGA 3VUEA 2DZDA 1E8MA 2JIMA 3DD1A 3W6ZA 1PNTA 1NXPA 1P77A 4NJEA 3ZI7A 1Y7LA 1GAXA 3ZUGA 1FS4A 4BX0A 2PRSA 4P3NA 4BYMA 1QC5B 2C8KA 5DISB 1DCMA 1H66A 4WKNA 3EXEB 1XD2B 1D0VA 1UAAA 3T7CA 2IUTA 3NP9A 4L9RA 3F47A 5I4KA 4PBRA 2ZSEA 5TQ2A 1GG9A 2C4WA 2I87A 5C1DA 2WM9B 1SBQA 5IDQA 1PS9A 4OO3A 2OFWA 2IW1A 5DHRA 4MV0A 3UPDA 4LV5B 5JXGA 4HNQA 1BYUA 1ZNYA 4UZFA 1A7UA 3ICOA 4TLEA 1JYEA 3CN7A 1JHRA 1CUWA 3GOQA 5L3QA 3LPDA 2FUCA 3VTZA 2A7XA 2XWBF 2KE5A 4Q3KA 1ZIOA 4D0GA 2BFMA 1I80A 4B31A 1G0OA 3UH1A 3K92A 1T13A 3EBLA 3NG1A 4JQSA 3QVWA 1B41A 3DPUA 4MUBA 2X2FA 2C61A 5JOQA 3OOJA 5CFLA 2R86A 1YZYA 3IPXA 3RWOA 1VC2A 2PMWB 1NBEA 4QXRA 4YV0A 2YN4A 2CC2A 4NARA 4IJWA 1N8NA 1IZZA 4RVDA 1C14A 3GROA 1OFIA 2EJWA 2D59A 2WJZB 4OQNA 1PG0A 1IJBA 3QUCA 4C76A 3VZPA 2G06A 2PMEA 3T35A 1WR8A 4F3CA 1BVYF 3LK7A 3U80A 1KOGA 1BKDR 5C81A 2VHZA 2O2DA 1HSZA 2PKRA 1UADA 3NONA 5LB4A 4RXTA 1TT7A 4Z9XA 4LZWA 4MIKA 1A98A 1EJBA 4YALA 3KE8A 5J5CA 3WYAA 4CBVA 2VRCD 1BX3A 4MMZB 2I6FA 4XI9A 5F73A 2A9RA 4JKOA 4PAQA 4EG7A 1F2VA 4JR1A 2HWKA 2QN6A 5JSQA 2XX3A 3EGWA 4JP5A 3TBHA 3QYJA 3C24A 2F90A 3COVA 4MKXA 2DETA 3I4FA 4LRXA 2X5NA 4EITA 3K6KA 5EXSA 1THZA 3ICEA 1FDRA 3KVRA 2FMFA 1SXJA 3CRNA 3W5JA 4YDQA 1XYGA 2H51A 1D0SA 1ISHA 5K3SA 1CDEA 4MHTA 5B2EA 1HDXA 4DJTA 4N7BA 2FEAA 1YUBA 2PCJA 2ZANA 4OQPA 1VKJA 3P9CA 2ZYSA 1WUHS 2YHIA 3BWVA 1T9BA 2BZGA 3GGSA 5HQTA 4CMAA 2CNNA 1ZEJA 1KEUA 1KP2A 2OL4A 1EZZA 5FUYA 4GPTA 2YV2A 5LYJB 4LFBB 3TGPA 4CF4A 4P35A 3PEUA 1R8YA 4QUAA 2Q29A 1F60A 3AQIA 4Y2QA 4OP1A 1T2FA 2BJWA 3GDOA 5ECDA 1IFXA 3RT1A 3UXEA 3CIFA 5DYTA 5T6MA 1A72A 2KMLA 3WLNA 5DF1A 1DRJA 4BQEA 1LWOA 2OZLB 4JCCA 2IOFK 4TKLA 5BN4B 3VZRA 2HHJA 3O3MB 1PT5A 2XW6A 4KMMA 2W5UA 3I9JA 2OQVA 3LZ6A 4BKOA 3GA5A 1OLUA 5JCOA 1US8B 4CKWB 4LSZA 1IIRA 6AT1A 5KTNA 3L8CA 3THWA 1NE2A 3WJ1A 3I04A 2YHBA 4EF6A 2F8MA 4CLEA 4X20A 4ENTA 1NE7A 2YR0A 4LMAA 1YE5A 2I33A 4GKBA 2WU8A 1VA5A 4MKGA 2E4VA 1E6WA 4NYIR 1IZ7A 5AP9A 4C01A 3HXQA 4NJMB 5BT8A 5HZMA 2HC9A 3C6ZA 1OTXA 1AXRA 3PRYA 1XXHA 2R8XA 4UC0A 1GGEA 5F1KA 1C7FA 2XOXA 3T8YA 4YJHA 4DDTA 5EUBA 2JFNA 2Y1GA 2SKCA 1JYSA 1X1SA 1EFAA 2NSLA 1ZRHA 2MCFA 3JD2A 1PZMA 3TXXA 2H0QA 2VWHA 3W8DA 3CN9A 1ODCA 3KC2A 1YDEA 5D3KA 1GCUA 1Y8QA 3VR4H 3L06A 4WOPA 3TS1A 2OG2A 3NHFA 1YQGA 2J87A 2SCUB 4C4OA 5TPZA 3COYA 1E9BA 1TJNA 4UPVA 1VKZA 2J3EA 5IH3A 2WKRA 1QG0A 2X86A 5IUKC 1N0WA 2QTNA 3WA7A 4K8OA 1BMDA 5LXTF 4GMXA 2LKDA 3QI2A 5SV2A 4XLTA 1QS0B 2B4KA 2BMEA 1Y7IA 2RH8A 2XODA 4RVUA 2D5BA 1IQRA 2WZCA 1FSGA 4NEGA 4E30A 2I62A 1YAJA 4H2DA 1DAMA 1XVIA 4QXMA 3VNSA 1XF9A 4GKKB 4R3UC 1XRNA 2PU5A 1P60A 4UNIA 5F4ZA 3LY8A 4C7BA 1CXZA 3NC1C 4TPKA 1YKSA 1S3GA 3W3AD 5DNUA 2YZNA 3FLAA 1J0DA 2PSDA 5IDWA 1W93A 4XVQA 1JKJA 3WKDA 3CX6A 3WFZA 2WF5A 2YVUA 5T67A 2WFMA 1PJ8A 3CRW1 5DX1A 4RJIA 4BAGA 2DERA 4TV9B 1IZYA 2CFIA 1MD9A 3JQEA 4H27A 1DNPA 3QG1A 1E3TA 5AT1A 4N0PA 2QIPA 3S7ZA 2WJPA 2WIBA 5AK6A 5A5DA 5KOIA 2B5VA 1J7JA 1G5QA 4LF6B 5G0VA 1Z2AA 4MJLA 1LJLA 1GLNA 1SC6A 1NHWA 1PD0A 2XWSA 4DIOA 1H5UA 1H23A 3BB3A 4MVJD 4N49A 1SXGA 1NONA 4BBAA 1HE2A 2R11A 5B1EA 4HPJB 3OPYB 4Y8VA 1SOWA 1H0RA 2PKCA 3ZIAD 4M0CA 3MW8A 4MV8A 2F1JA 4D4LA 4OHWA 4Z51A 3GFBA 3DLIA 4RZSA 1PWEA 4MKFA 4DBLC 3PUKA 5HHTA 4S04A 4TLMB 5BN3B 2ATEA 1K88A 2I55A 3PFFA 3ONEA 4GDMA 1P7WA 5GOZA 2JJQA 4HS9A 4ILKA 5LA6F 5AK4A 2BUBA 2P9JA 3TQRA 4WGFA 5AKJA 4G9GA 2P78A 5A3RA 3G0IA 5HKBA 3EQ8A 5AICA 3WOVA 1JBKA 2AMLA 3WLPA 4AWBA 1MJNA 3DV0B 1JFVA 3ADCA 1Z36A 5L51A 1BC5A 4RVSA 2HJVA 3Q2KA 4PG5A 3IMGA 4AJ9A 4ARZB 4DREA 3OLZA 4PG7A 5C8DA 2PT7A 2IEDA 5DGHA 1E32A 1P39A 3NH6A 1PP4A 3RJTA 5ELXA 2YVKA 1QHHA 3P9KA 5JJBA 1XN4A 2IYVA 4G0QA 3PUHA 4C0KA 5PNTA 5KX5B 2VBFA 4RHEA 5IF9A 3TZKA 5AQ1A 5CB4A 5IUNC 2R66A 1JH8A 3V5NA 4E70A 3WK4A 1T5DX 2R6CA 3SS8A 2D3TA 3EJWA 3L9XA 2VOEA 4A10A 4UD2A 4TMFA 2X42A 1RXIA 3L0SA 1T1GA 2IGBA 3PDIA 3I0ZA 1DWPA 4AUMA 2A9JA 4IM7A 2GVDC 4J7XA 1ESZA 2ERYA 2E4XA 1PR2A 3LPAA 4GM4A 3NCTA 3VUFA 1P0IA 1KI4A 3SNHA 1R50A 1Z15A 2AX3A 3DBIA 3W2TA 2FP3A 2OILA 3SC3A 2PJUA 3CUVA 4JJ4A 5JLJA 2B7LA 2RH4A 4FR2A 3ZZMA 4BNDB 2P30A 1POWA 3OZFA 4GI1A 2INGX 3TNFA 3I2YX 1SU7A 3IBFA 3IV9A 1V3UA 4N8SA 2B9EA 3A1DA 3HSKA 1VG8A 3AERA 2CUKA 3G0DA 1YUNA 2WRZA 2CT8A 2QTLA 2DGDA 3NEAA 3NEYA 3RK4A 5CPBA 5F9MA 3PNYA 3ZCQA 4BO6A 3BE5A 2O8NA 1ZI6A 2PGIA 1W9MA 1EB9A 1QR2A 4DGQA 3FYTA 3QVXA 3T5TA 4UTVA 3IL2A 2E4ZA 2VBGA 3LX8A 1UP4A 3PA6A 3PV0A 4GMDA 4BP1A 4PN3A 3IEIA 5M34A 4XFJA 3AOEA 4RORA 4M3NA 2I3AA 2IX9A 3QE0A 4IS3A 5SZKB 3W9YA 4L8VA 2B0JA 3UJ7A 2WD9A 3L4KA 2AUMA 2C97A 3P9QA 4BWFB 4DQDA 1XZBA 2NZUG 3ZZNA 1KK3A 3LT1A 1T10A 3M1YA 1NM5C 3RSSA 3ZCSA 2IIBA 5J47A 1T91A 1RZ3A 1XVAA 1TTQB 2H1LA 1K8ZB 1VTKA 4UDYX 5A5EA 2WFZA 3WDMA 2PX4A 5T64A 3KP1A 3ZKWA 2WR8A 2Y27A 1U8XX 5E7QA 2ZOSA 4ENUA 2NXCA 2RI0A 2ECPA 1LDMA 1BQ4A 3S70A 1SBYA 3HFSA 1ND5A 1DS6A 2ABWA 3ADBA 4J3FA 1G5TA 2UZIR 5JPCA 1D2GA 1N92A 2W00A 1K63A 3AKDA 3L8GA 5EIAA 5FA5A 4OHUA 2B3TA 2PKXA 1G17A 4IQ0A 2O05A 2PTHA 1X1CA 3AR2A 3QKRB 4GX5A 4N3BA 4PZCA 4TRJA 3UHFA 3UT5B 2WAAA 3ZJTA 4OU4A 4DV5B 1XMQB 1JRLA 4QDJA 3II6X 1GQ2A 2FWIA 2RHMA 2UZ1A 4PO8A 4UCWA 4TROA 3RDPA 2P69A 3FOWA 4ZEOA 4NR0A 1XTPA 2VN8A 1Z8HA 2ZTVA 5CA0B 3TF5A 1JIJA 4O4JF 4F9EA 1WU7A 2QE7D 3OZUA 4Q4JA 2OYRA 4FDVA 2ZE6A 4P83A 3R7LA 2FI1A 4UHHA 1UZAA 1PV4A 1PZGA 3O93A 4HQFA 2YDYA 3DCIA 4ECEA 2WT9A 4J75A 3CJTA 5AW6A 4J0QA 1DHTA 5IW8A 1IVSA 1O0CA 1H1DA 2DHDA 2WWHA 4Z3OA 4DG8A 4A0RA 3WWEA 2Z1NA 3MJCA 4EF4A 3GMSA 2FWPA 1U3TA 2GAOA 1DSSG 4W5HA 2AD5A 2ONKA 5CLLA 3UMVA 4MWGA 1P1RA 3JQBA 2I7DA 1JQDA 3U4AA 5IAJA 3WV4A 1JEEA 3KOXA 1GCIA 2RHTA 1ZM9A 1CEYA 3U56A 2J5KA 3U4QB 4C1NA 2Q5CA 5BNIA 1M7HA 3TRFA 3G9UA 3EZYA 3UB2A 3OJ0A 2Q2NA 2QJFA 4QFMA 4Z54A 5D51S 4TYQA 4AD8A 2JFQA 1X3LA 4CM8A 4DSUA 1EB8A 2HDOA 4P22A 1D2MA 2ZT8A 3I8OA 3UN1A 1VLQA 4TS4A 4GKJB 3IAEA 3FJOA 4WJKB 4ZT2A 2VNSA 3DPIA 3TLBA 3R3UA 4G5GA 1XMSA 1M2JA 1C8VB 4YRJA 2J6IA 4GMGA 4M0LA 3DAGA 1ZRNA 4U1RA 3ZE2B 3WICA 3WZMA 3QEJA 4BVHA 1FP6A 5BYJA 1GR0A 1RIFA 5DU2A 3MOIA 3X1YA 5E2IA 4G85A 4CIBA 4BNIA 3GP5A 1TA4A 4AJ2A 1DKRA 2C95A 4WY2A 1PDOA 2JCVA 2O0MA 1WCXA 1YVDA 4KIFA 1M66A 1ZITA 4JVOA 4BEWA 2IHBA 2VDWB 3AHEA 1ZIXA 4QYIB 4ZI5A 2W6MA 3WI7A 1Y9DA 1WKBA 1WXXA 3IUJA 1JFFB 3OE1A 3F6YA 2OLKA 3KFLA 4HOYA 5IJ0B 4TLLB 1UZUA 2H1RA 1U5CA 1YR3A 4ID3A 5J5AA 1XZQA 1PU2A 2OUKA 1CJVC 2JEYA 1H2YA 3LPNA 2C88A 1UXJA 3WO1A 1PLLA 2AOTB 3PQ8A 1ESCA 1KI1A 1X1TA 5CEJA 1Z0ZA 4CMJA 4FYKA 5TMPA 4BO4A 4YUXA 2QVXX 5GONF 2A67A 2FEPA 2PPVA 4G89A 3TLJA 1OFUX 1DQSA 4YCBA 5CUQA 4C29A 3H16A 2WPDD 5T8KC 1TKBA 4CQMD 4HVLA 4FMDB 1DU4A 1FB5A 4V0LA 3FCCA 5T4EA 3TB6A 4ARIA 1AE1A 2QL9A 2X8JA 2IHTA 3AHFA 3MF4A 2GZ2A 3PHCA 4MW7A 3D4NA 3RU2A 3KEMA 1D6JA 1PL0A 2EKZA 1PX0A 4ZCSA 3B8EA 4DUYB 3AFOA 5J2UA 3I34X 5AOCA 2PFKA 2QD1A 3AI3A 1L4MA 1M6HA 4O5AA 3O91A 2AWOA 3ABIA 4Y9TA 5LYYA 4UTNA 1YHNA 3WWZA 4FVTA 1AZSC 4M87A 1OT5A 1XTZA 1ZO8A 2AW3A 1UOQA 1CYDA 3PYXA 3KXDA 6ADHA 3VX4A 2EFJA 1EKXA 4R1PA 2FVXA 3ZWKA 3P2OA 4Q03A 4G8CA 3JRXA 3BMOB 3MXOA 1E3EA 3CISA 2YVLA 2XUDA 4F93B 1R37A 3GPBA 3ME5A 2VKQA 1IXKA 1EINA 3TIXB 3EA5A 3RAFC 1W5FA 2G4LA 2C96A 4ASUD 3I76A 1CUGA 4ENRA 3NWEA 1MX5A 2NXEA 5HPYB 4IOKA 4M7PA 3DLAA 2G76A 1D6SA 1R6TA 3EIEA 4P98A 3VMFA 1TK2A 3F5FA 3EEOA 3AHDA 4DLRA 1B0ZA 3SLKA 2OAQ1 3QEMB 4LGVA 2D1SA 2JFUA 5CEFA 2OORC 1QGOA 2VHUA 1EH5A 4MCJA 1JPUA 1QZXA 3AEUA 3E8MA 1RRMA 2A33A 2QPAA 3V42A 4PXSA 4DMRA 3HA7A 3MAAC 3O8NA 4X7RA 1SZPA 1UKZA 2C2MA 5K8LA 2N0SA 2GA9A 1QOPB 4QBTA 3SGLA 4IJ5A 3TMKA 1G8PA 2JFPA 2JIZD 3UPTA 3ZDCA 2C9ZA 2J3KA 3SJAA 2A14A 4FFBB 3JS5A 3SZOA 1GRRA 4B7XA 2FJ0A 4R6WA 3TQTA 2E85A 1XTSA 4PYKA 2GRJA 2OV2A 3U4DA 4WI1A 2ORVA 3GLRA 4RVOA 3MT8A 4ZOLF 3CZRA 4FIZA 1T4CB 2EWWA 4I1IA 1JIIA 3CPEA 1DJNA 2IV2X 3JWPA 1HTTA 2WU1A 4MDEA 1V8PA 2Q9AA 2P6NA 1MDFA 2YV5A 2PMBA 3A6PC 1ESMA 1PK7A 2UVDA 1RCTE 2EVWX 4ZT4A 4EG0A 5ESWA 4QLBA 3Q9NA 3LNCA 2XA1A 2R0QC 4IVRA 4WN9A 4LOAA 3DE6X 1PNVA 3TTTA 1HTBA 4MQ4A 1ODFA 2QT0A 3HZHA 4ZGGA 2JLWA 4DA6A 4E5YA 3FCSB 1XMJA 3AINA 3L0CA 4QPJC 2EXXA 3CLKA 4R8LA 1IDOA 2ZUDA 3A3PA 3FMVA 4YUZA 2XE4A 3PJEA 2NYVA 4L6CA 2GWRA 3AYZB 5KVSA 2P4EA 1GAWA 1FLVA 2ACEA 1ZIYA 2J9FB 5HDBB 1DDOA 3FFWA 4XCXA 3T5PA 1X8XA 2BBOA 3HKDB 3B1YA 1OB2A 5TQ0A 2JLAA 2R7MA 5I7VA 2YINC 2AHRA 4R7ZA 3N7UA 5L9AA 4XIYA 1B7GO 1Z4JA 3F74A 3UT0A 5JJ5A 4V0RA 4DJFC 2PUJA 3C4VA 2WB2A 4IIJA 5MN4A 1RXYA 2H2WA 2ZAIA 3R0JA 4DJ5X 2REXB 1XDSA 4FNGA 4LYEA 3DBRB 3E58A 4HEQA 4RKFA 1GPNA 2IEZA 3KKOA 3GLGE 5GP1A 4D8VA 1TIBA 2HMAA 4LSGA 5I9LA 5JR3A 3MWDB 4RTPA 5A4IS 5CK4A 3W2FA 2F9FA 3QVJA 2N46A 4PHHA 3WRVA 4BAUA 1OD6A 2WE8A 3ITEA 3OM8A 4O4LB 5EXTA 5C2JB 5FEUA 2VAWA 3SN6A 2VTKA 3L04A 1B6TA 1M1ZA 3C3WA 3N0VA 2V4MA 1MRZA 2BI7A 2HV9A 3UXMA 4ZDIA 2H5JA 1TYDE 1QHEA 1SHJA 3PWSA 1XEAA 2VQ6A 4YQEA 3BEDA 3B1FA 3IDFA 3GJ5A 3VGPA 2NO7A 4WOJA 1DZIA 3LYHA 1LQ2A 4DLSA 1XDBA 2QGZA 4BV8A 3GQBA 4B2IA 2W9XA 1Q91A 3K5HA 4HN2A 2AWNA 5A7GA 4AKIA 1X7ZA 1IVYA 4HAIA 4MV6A 5KHAA 1A77A 4D8UA 2OBBA 3AONB 1YCFA 3DF9A 3S8YA 1J70A 1Z7BA 2QK4A 1UAYA 2B94A 5LUBA 1KDYA 4QJ3A 3GRPA 1AN9A 1BEEA 4RTKA 3RSLA 4NE9A 5ICFA 1EMDA 4FOPA 5BP7A 1PJQA 3UICA 3PNKA 2P2GA 3EAFA 1BGXT 4M60A 2XA9A 2WUVA 4NG5A 4E94A 4JJ8A 3HCRA 4KC0A 5HR5A 3CC8A 4U6QA 3S40A 3MQ4A 5GPBA 1RJWA 3DNMA 1H8EA 3BGWA 3G3EA 3LUDA 3IAS6 3OPXA 3X43A 2W2LA 3R2JA 2Y0PA 1KEVA 1VRCA 2ZI6A 2ENWA 3F8TA 3ZXXA 1FJXA 4I9FA 1ILEA 1N9GA 1MT0A 1CE8B 1KYXA 2A2ZA 4S1TA 5DTJA 5ICSA 4LJ5A 5KVAA 1RHKA 2Q5QA 1EHYA 5AKIA 5ALVA 3IAXA 2BEKA 4MVXA 3SVLA 5A1JA 4LDPA 1ZSNA 5C0OE 2R8RA 3OPNA 2P9YA 4NG4A 5L7TA 3EOBI 3KSBC 1S2IA 2DR0A 1E2EA 4G0UA 4EABA 3V46A 3OJEA 5HFNA 4LHEA 1RKBA 1S89A 3I73A 4G5YA 3AY7A 3WVNA 3CPSA 3GN1A 4OK6A 1FNMA 5KYNA 3LT0A 5DCUA 1SB9A 3FZNA 3NI2A 4C9BA 4YRPA 3O2SB 3SU8A 3JALB 3NTUA 5HQ3B 1CERA 1W5AA 1IULA 2JLSA 2G4CA 2VAPA 2OSBA 4X8HA 3TQOA 2I2CA 4IJMA 4WUTA 3H6GA 4HQOA 2C9BA 4KRGA 2CVQA 1RI4A 2I3GA 1Y3DE 3OY2A 4OXKA 3LX6A 4HLCA 4Q9DA 3H2SA 4ZARA 4DMGA 3QIVA 4NLLA 1A95A 2EJBA 4E6PA 2KBEA 1OX6A 1FP4A 4B8YA 1RZRA 1DC7A 1UMKA 1II8B 1N6IA 3C1UA 1FDTA 3TTSA 3DBLB 2FFAA 4ZANA 2X0DA 3DZJA 4UTZA 4FZVA 3GEPA 4JYMA 2BI4A 2FOXA 3GGGA 2XBLA 5JCXA 2V8BA 4R40A 1J8YF 1I24A 3QFHA 3ROGA 5C32A 3O1IC 4TRMA 2EYUA 2LDBA 4EVSA 5I7SA 2HY7A 5CW1A 3T5BA 1P62B 1QKIA 2IZ0A 2BFCB 3NOQA 2FSIA 1P2VA 3JQPA 5E3JA 4FDTA 2XE8A 3GJ7A 1PZNA 1W5BA 4XPIB 5HM8A 1S3IA 3NVMB 3TTYA 5GIOE 1CJBA 3OIVA 1QTRA 3NPAA 4V0NA 5CNMA 4CE6A 2ZI9A 2Q3MA 3D5QA 3W2GA 3LUBA 4PLFA 3GPDG 4O2AB 1Y9ZA 1EVQA 1RE0A 1U7PA 3AUYA 4ENWA 1G4AE 1NYTA 2QLFA 2C5LA 2MSNA 4UEKA 6ABPA 1KVUA 3ZU5A 5B4VA 1U7HA 1WABA 3COWA 3CSSA 1CUYA 4GICA 1MX1A 3JZMA 1Q7EA 2XCOA 4E31A 2NO9A 2ZJOA 3BXEA 3ZX5A 1GPUA 4AIIA 2W2VA 1WXIA 5BV2P 4UBLA 1JKFA 5CX4A 5G1NA 1JPJA 1OFHA 5AVKA 2I4NA 4PSVA 2J9GA 1CUCA 3W1VA 3EAQA 2W2OA 2Y0EA 4Q3NA 5A62A 4A1FA 1J5XA 2DKOA 2E6KA 2KQUA 3OBIA 4MJ7A 2YL2A 1M2NA 3DE1X 3KB6A 2G9NA 4B80A 1TFRA 1YRQA 4OQXA 4CM4B 3GRUA 2XTMA 3B70A 1A27A 3RYIA 3D3KA 3MJTA 4Q6BA 3ZW8A 4ZZ0A 4XLLA 5H16A 3OQ1A 3G5LA 3KPWA 4KFTA 5LD2C 2R5FA 1R4MB 5JD5A 3DMTC 2DFTA 1XX6A 2P35A 4E03A 1RNLA 3CJQA 3A4YA 3BB1A 2JBAB 4FGUA 1YACA 4MYCA 3RYCB 3L93A 2JNWA 4OQEA 2HPHA 4WLFA 3RJMA 4RANA 3G9TA 1SQGA 3CT4A 4BZPA 4C4ZA 1Y7PA 3MWLA 5BV8A 4G23A 1R4NA 1SZJG 3FNBA 1GPWB 5ENZA 3F5MA 4KFSA 4JXKA 3NQ41 5FL7D 1SBCA 1G98A 3OKCA 1UFVA 5A4KA 1Q15A 3EULA 4MZDA 1EM6A 4JB0A 4UBIA 4EYOA 1EAMA 3HPQA 5JRZA 2FEXA 3AEZA 1ABEA 2OFXA 2ZB8A 5FYDA 3VVLA 2UZ3A 2BH2A 2R85A 2A30A 4Q9NA 2W2NA 3RWMB 3VSBA 2MIIA 2GKGA 3CBGA 2L18A 2W2TA 1KZHA 1VLZA 2G70A 2IW3A 1X92A 4DA9A 3SYRA 1I0LA 1JSLA 3EZ2A 4IDBA 4Y9DA 3UOWA 4UHCA 1YB6A 1A9RA 2JHAA 1DBIA 4RSHA 1TZJA 2YFHA 3A3OA 1I4EB 3UKOA 1H69A 2IK8A 2FSVC 2YIVX 2C7PA 2CL7X 3FRHA 2VSQA 2X8AA 3BRCA 3FLEA 1RLUA 3OTIA 4XCVA 5H3CA 3G2HA 1YB7A 2G0TA 3O7WA 4QBGB 4I1PA 5HF8A 2RJ3A 3HJTA 1CP3A 2HIGA 3I12A 5I7AA 2IHJA 3AKYA 4MAAA 1T29A 3E3LA 1WF3A 4KI0A 4E3WA 3H84A 1P1CA 2ZI3A 4KMOA 1YZVA 3TNYA 3E2PA 1CUIA 3EMVA 5EE5B 4DW8A 4DXDA 3IUBA 4ZN6A 1KZ4A 1ZVQA 2DH5A 2FZEA 3GPIA 4DIKA 1GT91 4PBSA 1PJAA 2EWMA 2Z83A 1JDTA 3NAMA 4X54A 5EIWA 4DA4A 5EZSA 1OXBB 1V16B 2O1EA 2AN5A 3W04A 2GEDA 2PRZA 2QG6A 3O38A 1NTRA 3PHBE 4CF7A 3P52A 2C92A 1T0PA 4D9CA 4XLZA 2CYBA 3P94A 1Q14A 4YMVA 1LD3A 4K26A 4Z9FA 1XXLA 2FUNB 2QP4A 3A2LA 2R1VB 4G5HA 4KE6A 2YJTD 4NMMA 3ZW9A 1DTEA 2DUUA 1CUZA 3D8BA 4NZMA 4PSCA 3AUXA 4B85A 4NHOA 4BCBA 1U8YA 2XR1A 3L92A 3R4VA 2OQIA 5EOVA 3H4TA 4FBLA 3UJ8A 5KOJB 1R0LA 4P7FA 3CUYA 4WLEA 5KAPA 5HZGA 2G9RA 2QYTA 3ZHYA 1CEXA 1HFKA 1X8JA 3LOQA 2RGNA 1EXNA 2ZXUA 2CHGA 3QWFA 4YJGA 4JKIA 3ZHZA 3A36A 3AR4A 4Q9IA 4QICA 1QMPA 3FW1A 5I01A 1RRVA 1UK9A 1U9JA 1W5TA 2XQVA 3QVMA 1VDMA 3SJUA 3EK2A 1L8OA 4AN4A 3OT1B 1N2GA 4PYQA 2B8EA 4AUKA 1F17A 4MV5A 3C15C 3VKWA 1JVNA 4FYHA 4MIOA 1E77A 3RS2A 4LHYA 3TCNA 3KJQA 3WLRA 1NFQA 2PSSA 1PT7A 4Q24A 4LXQA 4WBSA 4OUDB 2HM7A 4Z7OB 5FBLB 1T6XA 1LS1A 3EUAA 2Q6VA 3N0RA 1QCYA 3CNHA 4QPPA 1N4AA 1GUBA 5I4BA 5KX5F 3TECE 1GPBA 4JCOA 1N9KA 1EK0A 3ML1A 5JH7B 1UOOA 2FLWA 3B1JA 1UR5A 3GT3A 3M5WA 4JUAA 3OWXA 3BD7A 4GIBA 4KCGA 4NH0A 5FBWB 1Z5UA 2JFVA 1AGYA 2PL9A 4O4HA 4C2UA 3ND8A 4XA8A 1Z4NA 3K2BA 4MPPA 1XNRB 1OAOA 2LP4Y 1UJ4A 1V35A 1GAEO 2CFSA 1KE1A 4ZT3A 5H59A 2XTZA 3IXLA 2JLZA 4H08A 2IYLD 4O6VA 1FMJA 3DOFA 4O3FA 1JEQA 1PFQA 3QY0A 4HAOA 1GL9B 1D1QA 1EZ1A 1V1MA 1NQXA 3C7DB 2CMKA 2QWXA 5A06A 3FHTA 4CMGA 5EE0A 3NV9A 5IYZA 2ZW9A 1MB2A 4DV6B 2FWRA 1OMOA 4F86A 1JWAB 2I78A 2R8YA 4REQA 4TWZA 1EX7A 3O47A 3TD2A 3FZQA 2QLJA 1X7YB 2PUEA 4DCUA 3PHIA 5EQJB 2GN1A 3HKEB 3PF8A 1BS2A 1KMNA 1GGFA 1SOMA 2OYSA 3AG6A 4Y6RA 2OAEA 4QX6A 3BERA 4TSFA 1XAJA 1YB5A 1DO2A 1TQDA 3GVCA 3IVMA 4EJFA 3FWPA 3DFKA 4B3GA 2O54A 3CZ4A 3H0KA 1OB5A 4WZAE 2W8BA 1G4UR 1PX2A 2HF7A 2ZUBA 3EWAA 1K97A 1E89A 1MO5A 1HTWA 2C2XA 2PUHA 4PHTA 3WLOA 1EESA 3B7WA 4TXHA 5CAEB 1T9AA 4HDRA 4ZRMA 1W85A 3T12A 3A1NA 3TQCA 2CD7A 2RHGB 1XAHA 2PUVA 4TS9A 1BSVA 1D03A 4KXXA 1SQ0A 3EIOA 3RS4A 4RK1A 3ND7A 3MTDA 3WADA 4EO4A 5L3VA 3ENWA 3ADOA 1FRQA 3R24A 2VG8A 4CLOA 2JD1A 1U9IC 2PBZA 1W4RA 2VP0A 4Q1DA 4RZUA 1YJ5A 3DKIA 4F4UA 2FY8A 1JQKA 3OIYA 5GM1A 3ZY6A 3O21A 4CMCA 4LYHA 2WQ6A 2RBGA 5LP6B 2ZAMA 3FPFA 3QLJA 4GI3A 4WECA 1CZKA 5KTSA 4IZ6A 3E6AA 3FDZA 4F3NA 1R15A 2EJCA 5HE9A 1OC4A 3TZLA 1T9CA 1J9EA 2J9XB 2V6BA 4X60A 1ISGA 2X4LA 3R7WA 2EDCA 2VEDA 2DAPA 3B2EA 3O7MA 3V3KA 1WO8A 4I50B 3DWGA 3ZY5A 1Y1QA 4LNUB 1Z4PX 4TXLA 2EJVA 2YW2A 3PUZA 3DW1X 1U9ZA 4F1KA 4R2IA 2XVZA 4IIYA 1LDNA 5JWRA 1I3LA 4P5PA 2UV8A 2AFHA 4IV8A 2Q4OA 2CMGA 3GT4A 4OGFA 1WDMA 3QOFA 4P1ZA 3RYFB 4HF7A 1D04A 1SKYB 1WD5A 4DBLE 1Z83A 2JI7A 3KCQA 3R3HA 1OH8A 1W2WB 3OFKA 1OV4A 3NYWA 2GERA 4X92A 1PUIA 3C8UA 2C84A 5DYWA 4JI3B 1MV8A 2RHRA 1GPJA 4RPLA 1GN9A 5B2ZA 5ABPA 3GGJA 3H11B 5B3KA 2VJBA 2NPIA 2RONA 1H2FA 1QXSA 4RL4A 3F90A 2JBWA 4HNRA 1W52X 4OQQA 1CY4A 1NN5A 3PXEA 3O0TA 5HKOA 2J59A 3H2YA 1W0JA 3OFJA 1C7QA 1TQ8A 4NBLA 2BD0A 2NP6A 1FZTA 2QUZA 3BKXA 1PJZA 2DX7A 1XLTC 4FSHA 1XRRA 2BRUA 3R3JA 1P44A 1F8XA 4F06A 5CXQA 3T3GA 2VYVA 3OOYA 1QSGA 4LVUA 3TLXA 5L45A 4RPJA 5JXJA 2YC4C 3VR2D 2HRQA 1GZSA 1C9NA 1SXJE 4NCIA 4OHOA 5LJIA 1TQ6A 3Q6NA 4DSTA 1OBVA 3V7WA 4HAVA 3ZN2A 4S1PA 3ZS9A 5BMVA 2X6QA 5AXDA 3A3YA 5HF5A 2Q9UA 4NZNA 5A05A 2IQIA 1R6XA 1VM6A 3CF4G 2UUCB 1GNVA 2HWYA 2HNKA 3PPVA 3PFHA 2OXFA 4I0WB 2ZYWX 4E4RA 1BCRB 4K9MA 4XXHA 4B4VA 5CP8A 2ZYAA 1NLYA 3QWHA 1GZUA 2QAGC 2IHZA 5AI5A 2YHAA 1M73E 1P9OA 4F7DA 2PGDA 3OT4A 4FKZA 4Q3AA 4OGKA 1NNSA 3CM0A 3KPVA 1KHTA 2A1TS 5AVZA 1W6RA 3USES 3SD7A 5A0TA 5FFFA 3BIFA 3FTCA 4DM7A 1E5TA 4JR2A 1KFKB 5K6TA 1P3DA 1KVTA 2CB9A 1RPJA 2IYTA 4D9GA 3KUKA 3TRKA 3UGQA 5IEJA 2Y1WA 3NATA 4DDUA 4YP9A 1TVKB 2I6UA 1DBQA 4CG2A 2EX4A 3RFFA 4WZBB 1RWMA 1SG0A 3H9JA 1L0BA 1SC1A 3NBUA 2PPLA 2E87A 2ORWA 4D4KA 2IELA 5IHPA 1PSZA 2LD4A 1Q7TA 2AIRA 2WKQA 4JLSA 4K1LA 1GYRA 2I1LA 4L0MA 3JV7A 4MARA 5ERXA 4F5DA 3HMKA 4OBXA 3AI1A 3WG9A 4B43A 4LCBA 2I4IA 2VP4A 4GKVA 4YT4A 1O0SA 4JBIA 1Z88A 4JEMA 2FR8A 4JIGA 3NCHA 2XMPA 3L0IB 1I30A 1MO4A 4M9QA 3C85A 1LPSA 1CUBA 1DV1A 3PQ3A 4K81B 4MUFA 5FBHA 4AQYB 3W3AH 3T1HB 1UBFA 2O8VA 1H9BA 4CDMA 2G6TA 4DMHA 4JVLA 1JH9A 1E6MA 3CGGA 3TR6A 4QWMA 4C7VA 3HL4A 4AS1A 3RSFA 1W7AA 3A6KA 4LTNA 3K0AA 3R5XA 4TOIA 4BRZA 4PC6A 4AP5A 3AJAA 3SC4A 3T7DA 4B6FA 4D80A 2FPIA 3OZGA 3R3ZA 2Q1WA 4HNAA 4BKQA 1FUUA 4BVFA 2R6R1 1XO1A 5JAMA 1Y8CA 1N9ZA 5I47A 2GBIA 1SBHA 1J2RA 4OPMA 2W4MA 2JIPA 1I36A 1BH2A 1KZ9A 3ZDEA 1I2ZA 1DIHA 1JR3A 1WW8A 1ZP6A 2AI2A 4LDRA 4E5DA 1Y9JA 1DXQA 5HUQA 1T5LA 4P5EA 3H2IA 4DKJA 1IOLA 1WMBA 4HQ0A 2Q45A 5KQMA 3BCHA 3WL5A 4AJ4A 4QRDA 1CRLA 2PXHA 5FQNA 3T94A 3PUIA 2I65A 2QRHA 5HS6A 4UCXA 4BE9A 4E46A 6LDHA 4BQPA 4WOBA 2CCKA 2IPOA 2JH9A 4YJFA 3QEKA 2CXSA 4RQTA 4UEOA 4WASA 3RAJA 5M29A 2WAMA 3NHSA 5A5GA 4YMSA 3WBBA 4KDEA 2VJAA 2QTGA 3PLAE 3M49A 4YR7A 4WINA 1TJ4A 4E2FA 2DUNA 3OP1A 3UKDA 1TZKA 3FZYA 3JAKA 1KF0A 1Y1KE 3D4BA 4YP5A 2QPOA 3UJ9A 4EW2A 1QV6A 1K7FB 1TM4E 3EWIA 4YP7A 2QT1A 3RYTC 2LR0A 1C9EA 4LNAA 2HRRA 3LDGA 3JWGA 5CD1A 1PBNA 2GJ9A 4GNKA 5ECYA 4N65A 5IRCD 4UTOA 4ZAFA 4L8WB 1DAPA 1NKSA 1H1LB 4HFJA 5C5CA 4ZCMA 4INOA 3SJCA 4M8NE 3VXKA 1BRMA 1UIMA 3HFGA 2EZUA 4ZU6X 1EWTA 4XVUA 2AR7A 1LI7A 1PFGA 1Z18A 2C3UA 4BWGA 1RMYA 4OHXA 3RC2A 4E08A 4BE4A 1MB9A 1Q44A 1Q7RA 2WNHA 2PYIA 3JAWA 3MAGA 4FOSA 4J2OA 4NYIQ 5D2CA 2OOKA 3I9OA 5JY1A 1OXXK 3SC2A 3CX7A 1LLUA 4I55F 4P08A 3IIIA 1FYFA 1AQUA 3P96A 4TL9A 1C4KA 3UXYA 4WKGA 2PGNA 4YX9A 3DTVA 1E1CB 4C06A 5EKXA 1FFYA 3RU3A 5FI5A 4F2DA 2IEGA 2QU8A 3MERA 4BQIA 2P0AA 1P1HA 3IKTA 5KQPA 2WTUA 2LKCA 1CB0A 1MT3A 3QF4B 4NMHA 1UKCA 3CX8A 5K45A 4I4TB 5ARBA 1A8UA 3RAPR 3W05A 2L19A 2A3RA 1YZTA 4H1UA 5KBYA 3RSZA 1TIKA 1UJNA 3PSHA 4TN1A 3TLYA 4ZGWA 2PX0A 2W6QA 3LD9A 3O92A 4NZPA 5LMZA 1DUIA 1GR1A 1Z4IA 3PWZA 4O4LF 3FF4A 4QOEA 3S3TA 5JFGA 4QUEA 1P80A 2X5KO 2I7TA 2O19A 2UU9B 4B71A 3HC7A 4HX5A 4HZIA 3GFPA 2VZ0A 4UM9D 4K1XA 5CPFA 1W5SA 4ZI7B 1Q50A 1OVMA 1Y82A 4RVGA 1E1KA 4Y2TA 5CCDA 3SVZA 4C0QC 1U8TA 2WTEA 4BV2A 4FC6A 4G4SP 5H82A 4FGKA 4UE3S 1X2BA 4I14A 4HGPA 1DAIA 2A9OA 3QXSA 2QYHA 4EQ6A 4DUPA 3T5GA 3QK7A 3MB8A 1I5RA 4HRYA 5NULA 2V7XA 2AVDA 4F38A 4C0XA 1GLGA 1P2BA 3LT2A 3TFQA 5AH0A 1BDHA 1FFWA 3WQHA 1USWA 1AUPA 1G8HA 2B92A 2W98A 5A5FA 1D8AA 3IX7A 3HKCB 5DBGA 3VU1A 5AVRA 3WX0A 4PQFA 4EDFA 4B1FA 4ZJUA 2VPQA 4P9NA 2UUAB 1OZHA 4NNPA 4I4LA 4NICA 2C2GA 1A8QA 2PU7A 4QUJA 4RMNA 3FIJA 1GUAA 4LE0A 4WY5A 1ZHFA 2J7PA 4XVHA 1U2ZA 1ZL0A 1MJGA 2JGFA 1TFUA 2Y6UA 3OM1A 4Q7LA 3Q8KA 2QMUA 1V4VA 3AB3A 3OKFA 3R9IA 1P4HA 5TS2A 2AOUB 4ZTBA 4QULA 1U3DA 3VSCA 3CUTA 1DP4A 1DUSA 1ZUD1 2Y1DA 1UBLS 1XPRA 1Q0PA 1BMQA 1LTKA 3RUCA 4DRXB 2AKEA 1U80A 1BXRA 1S8OA 2AZ4A 3M9XA 5SZIA 5I7FA 4NESA 5K2OA 1RBMA 1B6GA 1Z0FA 3U48A 3IC5A 3ESXA 2OCLA 4QT4A 1PV2A 4A15A 4JLAA 2IL1A 3I9V1 3IEVA 2D0IA 1DTWB 3FNFA 4HT3B 3A06A 3RIGA 1U04A 1WP4A 4YRLA 5E9AA 3TD6A 1T36B 1VBMA 4NSNA 3UCFA 1U63A 5DYGA 2C4TA 2BGLA 3BQ9A 1KARA 5DBFA 4B5LA 2GN2A 3FTQA 4INAA 2DBZA 1SC9A 4RSRA 1IPEA 3H65A 2FPPB 1GA6A 3CNEA 2IYAA 3VNAA 1K68A 2LZ0A 3RHFA 3BZBA 1CDZA 3CT6A 1GZ3A 3NVDA 3PC7A 3WLEA 1KQGA 1EU1A 4GOKA 5EVJA 4I5EA 4MDFA 3QLUC 1CHNA 4RCYA 1ABBA 3SWWA 5KVVA 3TRDA 2FP4A 4K05A 2R68A 2AD1A 3D5TA 3AM5A 1VHDA 1YMQA 4OIFA 3DXZA 1XCGB 4I6EA 4YDSA 2FMKA 4GS5A 3WJ7A 3DQQA 5DBHX 5HKAA 1E2MA 1EDDA 5EIEA 2HU5A 2WTXA 3WDSA 1SC3A 2QTZA 3B3AA 3WWDA 1CB7A 4ROTA 1QZZA 3ECSA 9ABPA 1NUSA 1Z6QA 1Y3FE 2XCIA 3DA8A 1ZWLA 1T2AA 3DVLA 4WNIA 2OPHA 1SVWA 2IP4A 3DDOA 4CKBA 3K1TA 2NU9B 1OZGA 1Z7EA 1W35A 4DQXA 3J81k 4M6WA 4ZHQB 4W8HA 3WK5A 5KYXB 4AY6A 2OLEA 2G8LA 2P7HA 2I2BA 2L2QA 3PS9A 4PFKA 1CS0A 2XGSA 2WNIA 2ZBDA 2MYTA 3K1JA 4RZQA 4ON9A 2AMVA 1IK6A 1GAQA 1UF9A 3ZIDA 1Z0IA 2ATIA 2ODBA 3O4IA 2HFJA 4KHZA 4WPGA 1H0SA 3PXCX 3U7JA 4CM5A 1N25A 1WXWA 3K9BA 4WLUA 2JRCA 3DP7A 4X93A 2MR6A 4S24A 5I7EA 4PO9A 5IBRA 3OZDA 5JRDS 3NETA 3H1TA 4BKMA 2UXBB 4GRIA 2W0SA 1P3JA 2DPHA 1XCLA 1E9DA 1RW4A 2B8JA 1LBIA 2WJYA 3WFJA 2AFIA 2J7KA 3GLGB 3LXMA 3PFCA 1E8DA 3DKPA 3ITNA 4H3SA 3OIUA 4JP1A 2GEJA 3VOBA 4KGDA 3EDQA 4P82A 4UFNA 4JI8B 1O1YA 4KYUA 3CVVA 1H94A 1DRKA 1NJ5A 5HOEA 2YH2A 4MCAA 4DV3B 3SFVA 5F7XA 3VKFA 4YJ2A 4WADA 4Y98A 1C81A 2X1MA 4HDNA 4N0DA 3ZLTA 1N1DA 1Q2XA 3E3MA 3RT7A 5EZYA 2JVKA 3Q7IA 1AIPA 3LHFA 4N40A 2G1JA 4QUBA 3C3JA 1XLWA 3SF8B 1NG1A 3EXFB 4R6XA 1GQOA 2JDID 2NGRA 3N87A 1LNSA 3AI7A 4LQDA 3QNMA 3WYNA 1P73A 2OECA 1IHDA 2O8EA 2C94A 2IDJA 3WHLA 4EPWA 2AL7A 4LJ9A 3ADKA 1N7HA 3B60A 1SJ9A 2D2IA 3RC8A 1YC2A 3DDSA 2ZPAA 2JJ1A 1K4KA 2P8JA 4ZPJA 3QVLA 2WILA 2HPAA 2P4QA 1DC4A 2CL0X 2QMOA 4KAAA 4E7OA 3AVXA 1F0PA 4ZYVA 1C4OA 4XW2A 1DXOA 4C88A 3RD5A 1RRKA 4WGGA 4R0VA 5BN5B 4F9TA 2YZKA 1DXHA 1HLDA 4XWAA 4YT5A 3RJ5A 5L53A 1DT3A 3OPYI 5CU7A 5FWXB 3AW9A 2BBWA 1ODIA 3QBDA 1BTOA 4YCLA 4QM6A 3HCFA 1EXVA 1RRGA 4LZPA 3I61A 4CEIA 2XXAA 2PSJA 1P2FA 3A9UA 4S2EA 1YA8A 1B0AA 1KYZA 3KZKA 3NHYA 3TRIA 4MW1A 3H9QA 3TW0A 3WLKX 3PK0A 1GT6A 1PGPA 2HMYB 3F4KA 4Y0NA 4YONB 3IP5A 1DIAA 5JEEA 2XKKA 1ARZA 5K9ZA 2GBGA 3ZOKA 3KUCA 1II0A 2G9VA 2X5XA 2XUFA 1T8YA 4LOKA 1CR2A 4E88A 1ZN8A 1WXGA 4JA2A 5CCXA 1PS0A 4IDQA 4R8VA 1UL1X 1S7GA 5CA1A 1F8UA 3EPKA 4DYHA 2CVPA 2QTTA 1KYTA 1C1YA 3N2KA 4WA7A 5BV7A 4J0KA 5AKGA 3C7KA 2ZBPA 1Y5IA 3CUSA 3AUAA 4MRMB 5JNSA 4MYTA 2O3JA 1DV2A 3SI7A 2Q99A 1GKKA 2RB5A 4Z0TA 3RNOA 2TMKA 1EVYA 5DHUA 3SBDA 3O8LA 4JQCA 3MGCA 2PS3A 4GVPA 1J2TA 5J9FA 1XOIA 2GPWA 3GFRA 3U3RA 3GEBA 2CEKA 2H5EA 2B4QA 4G1FA 4UUNA 5F3RA 1GN8A 3RIXA 4CTKA 4CZ2A 1CK4A 4GP6A 1XTTA 2P2LA 3MWYW 1CY1A 4P5DA 2EWVA 5IZCC 4X3OA 4P7BA 1P2DA 3DVAB 2XTJA 4WJLA 2CEAA 1GTJ1 3W34A 3W7VA 1EI9A 3EWNA 4FX2A 3BL6A 3C6QA 1TCBA 2VHQA 1TAQA 4LK3A 4UHKA 3UIEA 2D5AA 1EK6A 3AIIA 2DHCA 2Q5JA 2VK4A 2O2SA 1CLEA 3OJLA 5DGTA 4RQAA 3IDSA 2XAAA 2ZWAA 3HH8A 3F8SA 9LDBA 1VJDA 2HLDA 3BXGA 4H60A 2ZXFA 5C8YA 2IEAA 5CLFA 1PJCA 5KMGA 3GBSA 4IJUA 3CA8A 4EEKA 1C7RA 2DBYA 3CV3A 1WB9A 3B1WA 2G1UA 5DCLA 1G19A 4B44A 4N9WA 3ZJVA 4PBTA 1QWSA 3D6JA 4LF5B 1RPZA 2ZYHA 3MTEA 1U0LA 1ULUA 3PDHA 3BEOA 4U9HS 5KC9A 5HIMA 1TCUA 4IX1A 2MR5A 3GEMA 3L77A 3O4JA 2FPMA 2PVPA 3M6UA 4R8SA 5JC8A 1IAQA 3G5UA 2RCYA 3U44B 2FLVA 2F55A 3SQMA 1NLZA 1YXMA 1XVLA 2J3MA 1AVTA 2PG3A 3WQBA 3R41A 2VUSA 3O3NB 5KKAA 1HG0A 2G17A 4D8XA 2GI4A 3BL8A 3Q7PA 1Q0RA 4MA5A 2OSVA 4HDQB 4J1QA 3NU1A 5D3ZA 4ZVNA 3KEGA 1K5DA 1V3QE 3LDFA 3SK0A 5FBVB 1JEYA 1QRUA 1L4LA 4URVR 1CUVA 1EWKA 1BHSA 1FNCA 4F60A 1MCZA 3UENA 1HSOA 1M6EX 3H5WA 2OHFA 4GQIA 4LHSA 2VJOA 1D9ZA 5IS2A 4H31A 5HMMA 1KI9A 3U26A 2XGJA 1V0JA 3LXRA 3TZHA 4O1HA 2XITA 4JT4A 2FVYA 4KPUB 4DV7B 3A0UA 2BC9A 2BSAA 1U11A 5K3FA 5IBCA 1K8QA 3CE9A 3T3OA 1SEPA 1Z6GA 2PGLA 2GD1O 1QG4A 4JBLA 4DILA 2ODEA 3UMMA 3V9PA 4US2R 2XCSB 2CUTA 2FXVA 5K01A 1B2LA 1USVA 3LCRA 2JFFA 4PAMA 5E1DA 3BF8A 2ES4A 3MTBA 1BXKA 2QLBA 2Z3WA 2G83A 3H18A 1SUFA 3DXXA 4O59O 2KB0A 4WCVA 2XADA 2AX4A 2ZSAA 1PSDA 1TM1E 1D4FA 1VSQA 3NWJA 4TKZA 2D7CA 4DEVA 1DQPA 3JVDA 1LNQA 3P0IA 4ZICA 1N5IA 2EW8A 2XMGA 5T4FA 2WV9A 3NKFA 4FEGA 3T7KA 3X2EA 3MOSA 3FCEA 3HVHA 2RB4A 2YZMA 2D0PB 4R84A 2PUTA 3MUOA 4KODA 4MO2A 2HTFA 1UDWA 2D5IA 2WAYA 4YJ3A 3RBVA 4NECA 3SFTA 1RTTA 1JT9A 5ILGA 1OZFA 4FEAA 4F7WA 2YWFA 3MMPA 5ENVA 3TQIA 4TTVA 3K6SA 2GKOA 2I2FA 4NCHA 4XDZA 1EFKA 1JIXA 3ELWA 1Y9AA 2WLSA 5DSTA 1XCOA 3ZXUB 3VNUA 1JU4A 4TL6A 2BP7A 1JE1A 1XCMA 3AUSA 5JEDA 3L7BA 5ALLA 4UUBA 2L17A 3L0OA 5BWMA 3EY4A 1FFXA 2I4OA 3C6MA 4O2BA 1JKIA 3SSAA 1UBMS 3MCZA 3PEEA 2P9GA 2PO7A 3KT6A 3L7DA 4MVJA 5JDIC 1AHIA 1D2EA 1V11B 2VYQA 1EXMA 1R5BA 4GPBA 1KMMA 4NS1A 4GI7A 5EIBD 3JPYA 1RWXA 3UMRA 3I5XA 2ZR8A 2O2GA 4R81A 3N2GB 5CLIA 2IU6A 1FS6A 2WJ4A 4MR7B 3VH3A 7REQB 3UJHA 2CMDA 5LBIA 2K2WA 4HPXB 4Q4HA 3H42B 4PO1A 5IFKA 3FPSA 4EAAA 2CNDA 3JQ8B 1R0BA 3D8SA 3QPBA 3E7XA 4NKRA 3ABQB 3PPYA 1TM2A 3HKBA 1A2OA 1YWGO 1YZKA 5LUAA 3GJ3A 4QC2A 5A4JA 5KU1A 1ECCA 2QORA 3BM5A 5FH9A 2M1XA 2RH9B 2NSYA 2QTHA 2ZJAA 4L76A 4AO8A 3THRA 3CVYA 1UFKA 1P61B 3HLTA 3QMVA 4OXRA 4H7HA 1E0SA 1GZ4A 4UEWA 1D07A 1HEYA 5KVQA 4BLUA 1KIFA 4Z7JA 5BNFA 3AF4A 3OE5A 4JEIA 1D4AA 2VNAA 5B4UA 4KYTA 3M82A 4HH3C 3DF7A 1YL6A 1H9AA 2HSDA 2WIJA 3HJHA 4NENA 5EQTA 5FI1B 4WAUA 3UFXA 3KV3O 5I9TA 5BSHA 4LDQA 1TMGE 4U8HA 3V8QA 3C14C 5J43A 4D9JA 3IDZA 2FMUA 5T4BA 1L9XA 1U6IA 3AV0B 5FNVB 4EYSA 2V0CA 3EF3A 1XKQA 1FNSA 3G02A 4IQFA 4Q16A 5DFAA 1T2UA 4R2MA 1XHFA 2DLCX 3I30X 4K0KB 1OA1A 4C6SA 5ALEA 1LVHA 2AJTA 3JZIA 4MB0A 3RLFA 4ZT6A 1NOKA 5KU7A 4KO8A 3O0DA 3F9IA 4EJSC 1R0RE 1G64A 4HYEA 2Z2IA 2BKVA 4LW8A 2MYPA 4C30A 3UNXA 3VR3A 2ZT5A 1ZCZA 2H11A 3GD7A 2EFCB 3QLVA 2PH3A 1V8OA 3ZCTA 4CLRB 3SBOA 3OTWA 4IXNA 4PX9A 5MN5A 3BK2A 3V80A 3TCXB 2VUHB 1A5AB 4L1KA 1VLMA 1DWOA 2VDQB 1GNSA 3JWJA 2AJDA 3R7AA 3QEOA 2EP7A 821PA 2XUIA 2B61A 3UCXA 2PZGA 1JSCA 3Q8LA 2OKCA 4L73A 2Z5FA 2PMCA 4OQ4A 1IJKA 1HQDA 1W49A 2WK1A 3MCUA 3EARA 3ZGZA 1JWLA 1X39A 1TF5A 3EH2A 1FDIA 2A0XA 2ZZNA 3KHSA 2IUSA 2CXOA 2G5CA 4K6CA 1R6UA 1KMHA 2B83A 3PSAA 3W8EA 4O1MA 1YK0A 4MUAA 3UJDA 4E09A 2FR0A 1VJ1A 1ONNA 4K46A 4JHLA 4JD5A 1UBHS 2GN9A 3IP3A 4UTXA 5LLDA 4ARCA 5EP3A 1WHTB 3PGLA 3PHHA 4YAIA 5CHEA 4WZAB 4O08A 5TMEA 2D54A 4RKRA 1OXKB 1Y4UA 4E5PA 1U7WA 1J49A 3OESA 4GOOD 4JJFA 5AJXA 2HW8A 7GPBA 2R87A 4EYGA 4C7XA 3P97A 4Q5IA 5LOVA 4ABTA 1C1HA 3NR2A 5AK3A 4M9CA 4FB4A 2IUFA 4ZXFA 1G7RA 1CQJB 4NJEB 1T1JA 4D96A 3PB3A 4OF4A 3TSZA 4EHDA 3EEFA 4OX9B 1T0IA 1TEVA 1M0SA 2KWIA 3SHVA 1N8SA 2DFVA 1OW3B 1UWVA 2GYYA 2WJVA 3PQ4A 3IEUA 3KEQA 1YKGA 2ANCA 3THOA 5IU6A 3LX4A 2HGZA 3RRBA 3VJMA 1PJBA 4I1RA 1BFKA 2X0IA 3EGCA 4OLJA 2OV6A 3QTBA 1E5VA 2XMSA 1WX1A 5K8JB 4BO0A 4NU6A 3SR0A 2XCRB 3FPGA 4U2BA 1SVOA 2OA0A 3UWDA 1T0JB 1IPHA 2UVQA 3BDAA 5E7JA 1V9CA 1MHTA 3MLEA 2JL1A 1O9HA 1YASA 2BFEB 2V74B 4QTXA 2ARKA 4H1WA 2BISA 3EODA 1RXUA 2X3YA 2MWMA 3GA7A 4R68A 2EOAA 3E7DA 1H2ZA 2WJIA 1RYBA 4Y3UA 5F3WB 4QBIA 1XZCA 3HU3A 3UANA 1CJMA 1UINA 1MGOA 5IN5A 3AW8A 3FMIA 3G79A 4IIDA 3LBNA 2KBFA 3ZU2A 1RBQA 4M9ZA 3WNZA 1FNNA 3L6CA 3N53A 4UAUA 2PQ0A 4KGXA 1N3YA 4MSUA 4N5NA 1C8BA 1L8LA 2J8ZA 1R9NA 1U8ZA 2QVLA 1IN1A 1U1FA 3OKPA 4YH1A 2PLRA 3QBVA 2C8LA 2GBFA 2Q1XA 3ZDDA 2JGLA 2CDCA 2MTBA 3N6VA 3NTLA 1U0GA 3OLVA 2DWUA 4QNNA 3DLTA 1BROA 1L1EA 3M83A 3O4RA 4EGCB 5LQMA 2WOJA 1M1XB 1PR5A 1T4GA 2HDNB 2XB9A 5A9TA 1SKAA 1EUDA 1HV8A 3ONVA 4A2QA 3HSSA 1I2AA 1S8FA 4HSEA 3VHLB 1WETA 1FU4A 1U3GA 2RI1A 3ZYCA 4EZIA 1XAGA 2YWEA 3FCOA 4M1YA 5DNDA 3WL3A 3NT2A 3MJRA 4IRUB 4UNSA 3WP0A 2FPRA 2IBMA 4B3SB 3TYXA 1F48A 1NUAA 5DBEX 4CLDA 4IBOA 1KBOA 1N34B 3W5HA 2YIDA 2CHEA 4I1UA 4PG8A 3F4LA 3L8MA 4LBWA 4UMEA 3T54A 1T24A 4HN9A 4Z0PA 2IS2A 1Y4AE 3TPCA 5AVWA 2AS0A 3P0JA 4HXYA 3J7AC 1DOZA 4B81A 1CY6A 1F8YA 3FOCA 1IZ8A 2IYEA 3OPQA 3P1JA 3ZY4A 5JNTA 3UBMA 2PKQP 3P4XA 4F45A 5FUWA 2QVBA 4I4TF 3JZFA 4O8CA 3C8MA 1KDRA 3KL4A 4KXQA 2W22A 4KQKA 4UOQA 5CVUA 1DBRA 1VL6A 4YWJA 4CQMA 3THXB 4P80A 3PUWA 3OQMA 2BGGA 4C05A 3FH0A 3ZHRA 3M5PA 3PX7A 1XZKA 4QDKA 2Y93A 5HILA 5A0FA 3MTIA 4KGVA 1HFJA 3GLTA 1OFVA 2ZETA 4HQ6A 5FTJA 5FWYB 1XP8A 4IMRA 1UKVY 1PT8A 3UUFA 4CIAA 4S35A 1S9HA 2CFRA 2X4GA 3LUJA 1KI2A 3OUUA 1QLHA 3WNDA 2ZREA 2QRVB 2IODA 4UXJA 1AQLA 3FUVA 2OBYA 1ZCAA 3TM5A 4XOUA 3SICE 1JEAA 4CUZA 3M0EA 5INTA 1DCFA 4K6KA 4KUGA 1OLUB 4XYEA 4HO1X 3HMQA 5BNZA 4NBRA 4LF7B 5T3UA 3KR0A 4EH1A 2YYYA 2CE2X 3DMHA 2WAXA 1JPVA 1RQLA 3HA3A 3WYBA 2LWIA 3F73A 1KDTA 2C57A 5AXAA 5FWDA 3PXGA 4D6XA 4CU2A 5EMKA 4US0R 4ZKEA 5JI2E 2JIDA 1ZOOA 4S3MA 4KN6A 3CUEF 4P84A 3VDNB 1MJFA 4KR9A 4JT8A 2ZYVX 4R0NA 3OQOA 2EEPA 3MJDA 1ZRMA 1IQPA 3K05A 1EHIA 4D4JA 4NFSA 4UDOA 3WGIA 1KU0A 2CBXA 4NRDA 2CSXA 3AETA 1TLLA 2Q6LA 2W2XA 2WYVA 3BK7A 4I19A 3BE4A 4OXIA 4RDCA 2GM3A 3RIMA 2B8TA 1VI5A 2GCEA 3N8DA 4L5YA 2DTEA 5ALHA 5IABA 3AJEA 2X77A 4ZAWA 2YMMA 4RMHA 1IE3A 2YS6A 1I6WA 3GWZA 3FFBA 4XGNA 2FPLA 3BD9A 4LE1A 1O3YA 1RAIA 4I6GA 5H1YA 5LDHA 2JKZA 2RK4A 1EVIA 3EUFA 4KKXB 2QTBA 3RAGA 1FJGB 1MRNA 3P2MA 4ZGBA 3IAHA 5BR8B 3IQDB 1Y33E 2IPXA 4AO7A 2JIZA 3F7NA 2X4DA 1H2HA 5JLAA 4GUAA 5KOHB 1UM9A 4WBNB 1GTVA 3DMGA 6YASA 4UQOA 1JQ3A 3K0EA 5JYEA 1PW5A 4MDHA 3ZE9A 3GWGA 5KQGA 1N2SA 4G5XA 1GVHA 3SLGA 3C3KA 3V8EA 4BDSA 4HB4A 3R0IA 5IC4A 1ML3A 1OWMA 4Y67A 5CDGA 3K70B 3MB5A 4IWNA 1KJYA 1JDUA 3I9MA 3ICVA 4L3OA 2H1FA 1NL3A 4UBNA 1BE8A 4ER7A 4QWWA 3M6LA 1J9ZA 1CG6A 1NAIA 2HK7A 3PQDA 4MWBA 1B15A 1GFWA 2GBLC 2O7RA 4KLNA 1Z7WA 4XWKA 3A0RB 4E2XA 3IQWA 2AFHE 5KDOA 1N8TA 1T1IA 2ZRJA 1Z28A 3BPSA 3RVJA 3B9BA 1ECLA 2W2MA 2XXBA 3ZG6A 1AQJA 2GZAA 1U7XA 4ZEMA 3Q1KA 3GG2A 4EEZA 5F2NA 4ZQCB 2R7AA 3O8OA 5JHHB 3EGOA 2YC2C 3NAZA 1KSHA 2OCIA 4AZTA 4ZOQI 1DPGA 4X7MA 4HADA 4EY8A 3OX4A 2WVGA 3L8ZA 3N8HA 5EMLA 2PLNA 1HE8B 5L3SB 2HJRA 3D6HA 5CDTA 1U4SA 1X0XA 3ETNA 4Q01A 1C41A 2C4VA 3HA5A 4MS3B 1N6RA 5JZBA 1YZGA 1HZZA 4EECA 3FZGA 2HNAA 3IQHX 4MWEA 5EP4A 4YN3A 3R7DA 1KOFA 2ISQA 4A8TA 1D8TA 1WL8A 3I5MA 4HNGA 2QQ0A 4HCJA 2QR5A 2P0EA 3RV4A 4X1KB 1VRVA 1XQYA 2ZRHA 2VZLA 4XR4A 1HH4A 4IILA 4FFDA 3ET5A 4YXWD 4TYWA 2NTVA 1DC6A 3L7YA 3EC2A 5H68A 2FQWA 2X1VA 4JOQA 3P4YA 4WKBA 1XNJA 2ETVA 1X0VA 4KRFA 1U94A 3HCAA 2O7NA 3PJFA 4L4XA 5E2AA 1K7CA 2AEMA 2FTKE 2ZIXB 3K2EA 4MRRA 2PQMA 3N0WA 4YROA 4HWGA 5KNCA 2XCUA 5F64A 2PNFA 2Y05A 3HB5X 2VSOA 3HCCA 4WMLA 4YAEA 3WMXA 3C16C 2BKAA 4J4BA 3TZQA 1GGHA 4A6PA 3SZGA 4A5SA 3COJA 1ZGAA 2B6NA 1NWHA 2A9PA 1RAFA 3GGDA 4FR0A 4URYR 5EJAA 5FI0B 4OGGA 1NI4A 3W9BA 3ZCUA 4G25A 3O8DA 4PZ9A 1FBTA 5ALSA 1GU1A 2ZT6A 4HNVA 1IXRC 2YXPX 3AHIA 4JZKA 3SX0A 1O8CA 2IP1A 4RK7A 3RQSA 3CU5A 4ZPXA 1AGPA 2D2VA 2NUPA 2XGGA 2YJ4A 3A6ZA 3NGMA 4FNMA 4UUQA 5EE3A 4BYGA 7AT1A 1RIIA 2BEWA 1GSOA 4DLTA 5AI6A 3TXYA 1OTHA 3UWKA 1T3TA 3KTAB 1HNWB 1PHPA 4WOCA 3MG9A 4BLRA 2QF7A 3MGAA 2EKLA 4J0JA 1XDGA 1JA9A 2AKAB 2O50A 3LUCA 4EPYA 5J2TB 2DYKA 3EHDA 1G5RA 3TK1A 1QR6A 4B6OA 5BORA 1ZKDA 3W77A 3FWZA 3V9AA 2DFLA 2ERCA 3LLUA 3QBTA 4A03A 2CV1A 2HREA 2EJTA 2O5VA 4IQGA 1RBYA 4KQJA 1UPUA 1BJTA 4HQNA 1OKKA 3SKVA 3CEAA 3NWBA 4BTVA 4F4JA 3OQIB 2OYCA 1KO4A 2VC2B 1QK5A 4QJ5A 2Q3HA 4R9SA 1P45A 4HH4A 2VHVA 2QMQA 4HR7A 1Q83A 3PPXA 2ECKA 3VAYA 4W9MC 2GFQA 1UP7A 3GLQA 4EHNA 2IYZA 1JPNA 1R5JA 4Y6OA 3VH4A 1G3QA 2Q0QA 3BMNB 4FYWA 4DNFA 1YQUA 3DTTA 1HLFA 4HH0A 2PS9A 3FWYA 2GBPA 2IVFA 5ITZB 5F98A 1R9JA 2O20A 2PH7A 4YAOA 4GL2A 1YU6A 3N8KA 3S2FA 4P4SA 2MU1A 1YO6A 2YHUA 3IUEA 3L8DA 3LX5A 4DC9A 2FFHA 1ZQ9A 1XR3A 4RWEA 4BJ1A 4BNNA 3I45A 3JZDA 1UMDB 2QZ4A 4J2TA 5FBRB 5TPWB 2FG6C 3EH1A 3F3KA 2XKBA 2CJWA 1ZGHA 3C97A 3VO1A 1DOHA 4XZ3A 2E2WA 1ISMA 1KH1A 1IY9A 2EJUA 4JB3A 4D9IA 1EFTA 1MC4A 2ZYTX 4CR8A 2VWPA 2JKVA 5DKFA 1TVEA 1WCWA 1VPDA 4YIKA 1AKWA 3EASA 2ZJ4A 1XJWA 4UHJA 2GLXA 3UCEA 3ELDA 3QKTA 1X14A 1EE9A 1PEAA 4PAWA 1Y5LA 3LSTA 3D5EA 3C3BA 1RVV1 2YCLA 1EUZA 1C3OB 3DMRA 4J43A 3MD9A 2V7PA 3JQAA 3KDAA 1Z75A 1QIKA 3BFXA 1ZJ4A 2DPXA 1LW6E 2A5GA 2OCBA 2WA1A 3QKSA 2GCIA 3DMFA 3OM9A 2QX8A 3OD1A 4RK5A 2F17A 5BY2A 5CXSA 3CZPA 3JW8A 4GLBA 3HU1A 4JKYA 4TWJA 3H2HA 4LYFA 4M36A 121PA 3VI4B 3WGYA 2WG0A 3FYUB 4I9GA 4V1CA 3G8CA 4DY4A 3W2EA 4BNWA 5CLJA 4LYJA 5L6LB 2H18A 4JC0A 2H07A 2REQA 1PE0A 1BD3A 2EKDA 3HS3A 3MGGA 4X1YA 2C9CA 1SU8A 1DWUA 1YRAA 3I52A 4W5NA 2QSUA 4TS1A 5EJGA 2WI8A 2I2WA 3SQLA 2FWAA 3UPUA 1L7DA 3CLSD 1PNOA 3OLCX 5DHQA 3FVQA 4A6EA 3PENA 4ZT5A 1RM3A 2DFNA 2Z2KA 4XUGB 3ANSA 4RD1A 4MRNA 3DZIA 2POCA 4CLXA 1BVHA 2JGRA 3GDGA 1QNLA 4NQZA 1TMYA 4PRZA 5IMSA 3WGNA 1WZ2A 4KQ1A 3BT7A 1Z7YA 3RFXA 2Y92A 4WZZA 2CYAA 1TE2A 3OU6A 4X6UA 1XB2A 3ROTA 2BI8A 4OHPA 2IT1A 3QKWA 3QMWA 1FIUA 3MJFA 4CWAA 4P4TA 4F4FA 1MBZA 5C52B 5T3YA 4D0RA 3AESB 3H83A 3E9DA 3OPMA 4D4IA 1GTG1 5LU8A 4CKEB 1N2BA 1U7TA 3AEKA 3C6YA 2HO5A 1BVRA 4O02B 5ALTA 4YUWA 2PUFA 1UMCB 4YB8A 4DN6A 2QMZA 2QUKA 1GDTA 3FPBA 2GZDA 3VU3A 4X66B 1GPAA 1SCIA 2VYCA 1GUDA 2WSBA 4EKYA 2O0KA 2WD8A 1BU5A 1H6AA 3OMXA 5EG5A 4A0SA 2GYUA 6CHYA 1LSJA 2EZ9A 5DLYA 4EW3A 1XA0A 1YZNA 3CH4B 2EBHX 5JFTA 2C03A 2I8CA 2G80A 3L46A 4C3OB 5C9ZA 1N2CA 5F23A 1IBCA 2GPJA 2DLNA 3GFSA 3CIOA 3CO5A 4R5HA 5C4IA 5CDHA 1I94B 2QJRA 1KAOA 1XZNA 2K7ZA 1UC9A 1AY0A 1IATA 1QM5A 4OB8A 1NPDA 4QATA 1A96A 1F7VA 1SCUA 2WYWA 2I34A 2XB6A 3U16A 2V1XA 1PKEA 4OREX 4O4IF 1C1XA 3YASA 1S1MA 3SJZA 1JR4A 2BIFA 5BRJA 3B82A 2FOLA 4H3VA 2B21A 1NBOA 3LM8A 4G8DA 4GZMA 5IK2A 1DO0A 4RGYA 3T06B 3G0CA 4AX8A 3LCVB 2E4UA 3WBJA 2PRIA 4KRYA 3TEMA 3ZWNA 3IO3A 4Y0VA 1FDUA 1EVKA 3L4SO 1GP2A 1GOTA 1G8MA 1SC4A 3Q85A 3K7EA 1SHZA 3WFIA 4QPZA 2IPNA 5JQGF 5KYKA 1M7BA 3I23A 1W75A 3SY8A 2ZIUB 4GYKA 2O2IA 5H3LA 4DCCA 5AVYA 4A0FA 2ZEJA 4PO3X 1F0NA 1VE3A 3DFFA 2UXDB 1W0KD 3ZQUA 2FRDC 5BOSA 1NP7A 3AZOA 4EZBA 5K99A 3VU9A 1AA6A 4MEAA 4M37A 3UXHA 4AJNA 3MLBA 3PE6A 4UZSA 3TSOA 4AKSA 5B6PA 4ETNA 2R7KA 4BLSA 5ICCA 1MW8X 2XTNA 5NLLA 2JLRA 2M6SA 4KV7A 1D5CA 4MWCA 1EG2A 1ZK1A 2PUAA 2QAGA 4O63O 2CNWA 3T9EA 4LF9B 2HEGA 1TAGA 2ZKIA 3ZHSA 5FUVA 4J6EA 1X80B 3NORA 3M7IA 4IEEA 3A04A 3BJEA 1JVSA 1RPAA 2B98A 2C5HA 2HD4A 4L27A 4F6RA 1RC0A 3BVPA 4LC9A 1QH8B 3ABZA 5FFMA 2QN8A 1E6KA 4W82A 4MYSA 2GEUA 3H2KA 4C22A 1O4WA 4M1ZA 1NX6A 5EQDA 2OWEA 2GUWA 4QUGA 5AHOA 4FDMA 2GDZA 1LB1B 2DHEA 2RHLA 4PIMA 5DYNA 3WE7A 5BXQC 1ZU4A 3P71T 1P7YA 2I1VB 3K9HA 3L5OA 2ZPUA 3OTHA 2HWWA 2V8OA 4KN5A 3EDOA 1D1SA 3G2NA 4NZOA 2Y1CA 3MINB 4QPNA 3WLMA 1A2BA 2C77A 2C4HA 2WJWA 3FUTA 3QU4A 4MK4A 4BX9A 5JDCA 2GCOB 1N57A 4Y2XA 3K5IA 1O94A 4HB3A 2WVAA 1VKRA 3ODPA 2QM0A 4LJLA 1T34A 2WUDA 3IAAA 1BS9A 2O23A 1II9A 4GOND 4HTFB 3O8BA 4LI0A 5DT2A 4BGEA 3V4SA 1DC5A 1T3HA 2JD2A 4RLQA 1G9TA 3WL6A 1BYIA 4CIWA 3P5BA 2HUNA 5AHWA 3GT7A 3OQHA 1DEAA 1BZYA 1TAHA 1Z34A 2OHIA 3U31A 1XYVA 1YFKA 2O2HA 3ZLJA 4FP9A 3KU1A 4G0NA 4BL5A 3HCEA 4YAJA 5REQA 4BASA 3EXG1 2C7OA 1FTSA 4LXTA 4R2WA 5L8VA 1ID1A 4RPCA 2HBQA 3JD0A 3ISTA 3ENZA 4WN9B 4K9KA 4ENSA 5E6UA 1RMTA 2QTCA 2X5OA 3WLAA 4E2ZA 3TI7A 3GT0A 4MUXA 3DAFA 1N5LA 3CKMA 2PKWA 3L7JA 1GPH1 1G60A 1PR4A 3CEMA 3G17A 1HMPA 2HLHA 2JFGA 3BMCB 5EWJB 3MSXA 5WRFA 3WZ2A 5JRJA 1O54A 2ZI5A 3AUJB 2PSFA 1GPYA 2O57A 4HDSB 1XTKA 3Q7TA 4OUKX 2ID9A 1E3MA 2OZPA 3BHIA 2K87A 1XALA 5KWSA 2Z9DA 1Q20A 2BM9A 1E3WB 3GU3A 4NCJA 1A0OA 1F1JA 1G20A 1QGDA 2ID7A 4DMCA 1ZM2A 3WAKA 4YRQA 4D44A 4ND8A 1CX9B 3A9VA 3KJZA 1PQPA 1RP7A 3GCDA 2JHPA 3BAZA 5G0WA 4DMFA 4UM9B 1XQWA 1BMFD 1K4YA 1ZD2P 3NIGB 1RWWA 2NO4A 3BWBA 3V48A 4O1IA 3KAJA 4TVSA 5KCZA 1TMOA 1WUKS 2AFIE 4TZ0A 2VJLA 3MYRA 3STXA 1I7PA 2O2EA 5K09A 2VOJA 1HI9A 2XDQA 4RTMA 4BB6A 1KVRA 2CVOA 2QVGA 2FZKA 2ZBUA 5SY4A 5E4JA 3DB1A 3D3QA 4H7PA 1MIOA 1V6SA 1XQ9A 2D3WA 3K15A 3VDMA 3WIOA 5KTOA 2CHVA 5BVGB 3ESRA 4UVGA 3NBKA 5KHOC 3O90A 1T26A 3KS9A 3PXXA 4RMIA 4YXFA 2V54A 1FP2A 2BEVA 1IDN1 4ZCPA 1YD7A 2YXNA 2JLQA 4BGIA 1N2EA 3SOZA 4P38A 4HWSA 5FV4A 3RW9A 1HYEA 3PXAA 1VMDA 2LW7A 4B75A 4KP7A 1SULA 1JZTA 1Z82A 2Y4OA 3SIPA 4E12A 1G63A 2VRBA 3OFSA 4PVCA 1UZMA 3QPAA 5FP0A 2BR5A 1HDOA 1EDBA 5HGXA 2O5RA 1LPOA 3U7QA 1NMXA 4OKIA 3RUFA 2ZBEA 5EYPA 1EP9A 4K9RA 4Z4QA 3NO4A 4DQVA 1XTUA 2QX4A 3CLSC 3NAQA 1U5BB 3N75A