3IX7A

Crystal structure of a domain of functionally unknown protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
b'APRGGKVLDTSVLVDGRVAEVAAVGFLEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERLREAAPLEVLETTPKGESVDEKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQALRPQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein TTHA0540
publication title Crystal structure of a domain of functionally unknown protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 47
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 3ix7A00
1RXWA 3ZDCA 3H7IA 5H4HA 5SV2A 2HWXA 2H1OA 2HWYA 5HMMA 1BGXT 3ZD8A 2BSQA 1W8IA 3ZDDA 3ZDBA 4XGRA 1Y82A 2IZOA 3H8SA 3QEAZ 5ECDA 3DBOB 2IHNA 5HMLA 3QE9Y 1UT5A 3H8JA 3ORYA 1TAUA 2WP8J 1TFRA 5H4GA 4MJ7A 1MC8A 4XGQA 1V8OA 1EXNA 3H87A 5ED0A 1UL1X 3TNDA 5K8JB 2DOKA 3ZVKA 1O4WA 3IX7A 3Q8MA 4WA8A 3Q8LA 2LCQA 2FE1A 3QEBZ 1V96A 2QIPA 3ZDEA 5ECYA 4CHGA 3Q8KA 1UT8A 1B43A 5L6LB 5FV7A 5ECWA 5HNKA 5L6MB 2H1CA 2HWWA 1RXVA 1YE5A 1A77A 1TAQA 3ZDAA 3ZD9A 2MDTA 3H8WA 1A76A 3I8OA 5HP4A 1XO1A 1V8PA
chains in the Genus database with same CATH superfamily
3T3DA 3HB1A 2QN9A 4WGGA 3LY9A 4XDGA 1TXGA 1XV5A 2ZEJA 1M2JA 3NMUF 3RIHA 1AN0A 4AAYA 2P78A 2C2ZA 3GJ4A 4M99A 5GVSA 1O94A 1GGKA 2WYWA 3AKYA 3X44A 1YI8A 1M54A 5H82A 3OIYA 5HZGA 1E9EA 1W8IA 4IM7A 2YHAA 3WMWA 2N1BA 4EW1A 3DHEA 1G64A 2O0JA 3O1HB 3PK0A 2HR1A 1CRLA 1OAOA 3LAWA 4NE7A 4PBRA 2NVUB 1KEEB 4C7BA 2Y1WA 1TVCA 1AQLA 4CMEC 3GDHA 1IRIA 3I2GA 3FOBA 4PS0A 3R9WA 2AG1A 1ZRMA 1FYWA 1U4OA 2M32A 2XXBA 2Y8EA 3M5WA 3KELA 3NBFA 3OLQA 3PQ6A 3AVWA 1LX6A 3NHAA 1RWPA 4XUEA 3RIYA 2F7SA 2FLVA 1ONNA 1DADA 3UAVA 3ABQB 2XTMA 2QYSA 2DQSA 3W5HA 1UK6A 2IOQA 3ZVNA 4GO1A 3ZE0B 1QIFA 1M1YA 1RHQA 1TADA 3CUVA 4ZT3A 3PGLA 3NASA 4G5FA 2JJQA 2ECKA 3BH0A 1PJSA 1QFSA 3P9XA 4NMHA 4NV3A 5GM1A 3WX0A 4EI9A 4C1BA 2QR3A 3LQRA 1L3IA 3TKLA 2HOQA 3G2PA 4Q1DA 1GCIA 4QNRA 4YJ2F 5JSZA 2YDXA 4EEXA 1IWOA 5EJAA 2CLOB 4R83A 4KX3A 4K0RA 5L8VA 5G40A 1XA0A 2NN3C 4C04A 4XVQA 3ZY6A 1HDEA 1YRWA 2QTHA 1IBKB 2HIHA 1DOHA 5CB4F 4CQMA 3FOFC 3GL9A 1EFHA 1E1KA 1KSFX 4B17A 1CR2A 1SKBA 2O2DA 3NUGA 1VXOA 3T9AA 3IAM1 1FTYA 2FEMA 3S2IA 3TQSA 4R3NA 3ZWDA 1Q5PA 1FW6A 3K0CC 4LXYA 1TGVA 1UQUA 3HDYA 1F4LA 3A1VA 3CBQA 2VF5X 3OJEA 4EF4A 3IXLA 2XUAA 3GAAA 3HU2A 2DEUA 2GF9A 1PTJC 3MC1A 2C4HA 3I1FA 3EUEA 5BP7A 4GHWA 4F5ZA 2O23A 1V8DA 2HMAA 3GUUA 1IOZA 2QRJA 3BWBA 4N65A 3W2IA 4LYJA 4C0XA 1O7JA 1T9HA 4F04A 1OXUA 2B2CA 1Z33A 4FD3A 1ZVQA 2A14A 2VNAA 3HN7A 1J06A 4JJ6A 5HJ2A 2O2JA 3X1ZA 3O9ZA 4WNAB 4YA6A 3VZQA 4JITA 4NC9A 4D0SA 5G4KB 2RCNA 5D5HA 2DHCA 3OP1A 4CEHA 4G9BA 4WX2B 5C4IA 3T7CA 4Y2QA 2VDJA 1GQRA 1SVWA 2PKXA 4B2IA 1ZBDA 3K1AB 4A3SA 3LU1A 2Q5EA 1LRLA 2FZCA 5T6MA 4EQZA 1PVDA 3FPJA 4PG8A 4J4HA 4HDOB 3GZNB 5JRJA 1TAQA 1TOAA 3NUQA 2VJBA 4FKMA 3N8NA 1DNPA 4YRGA 1TX4B 3S2YA 5JCZA 3DZKA 2RGGA 3CURA 3MFYA 4ALKA 2RSLA 3OZTA 4MUIA 4HGPA 3LNTA 2CZCA 1O6BA 1GNQA 1Z3IX 5F4ZA 2G80A 3BGIA 4IL5A 2AG6A 4O4LA 5KVCA 4Z4QA 4OU5A 3T4UA 3LLVA 3QE0A 2NVBA 5TY0A 1H2WA 1GEGA 4GYWA 4YT5A 2O50A 2CLFB 1WB9A 3ROMA 1WDKA 4I6EA 1YVRA 4TZ0A 1PFQA 4GMFA 4OMDA 4V02A 1Y7PA 1S8AA 1T0BA 5SV2A 4DNOA 4FVTA 2QPLA 3L93A 1RRGA 4C21A 2QR5A 4QXOA 3RG8A 1Z5VA 1A1VA 3V32A 5CD1A 4L5JA 2B6HA 4LI0A 1ZMRA 3BE6A 2C1XA 5IKEA 1RQLA 3W9SA 4AQ7A 2WVGA 3LE8A 4LPSA 2GNAA 5CJ2A 5DCLA 5BSUA 1NZDA 1W44A 3E7PA 3C6KA 3HI6A 1NW8A 3UTCA 3QKWA 2C96A 1M72A 1KO7A 2FG5A 1D2GA 3U4MA 3MGCA 1M7GA 4BPRA 1UPFA 3CGWA 3CX3A 4KIJA 4DLNA 4Q93A 3H3XA 1YKSA 4JIMA 1C1HA 1SQSA 1LBQA 2ADMA 4D82A 3L1VA 3KWLA 4FDTA 5FHQA 2RGBA 1N2SA 5K3FB 4LC1A 1D1SA 4PX2A 4CLHA 1J49A 2H1FA 2Y9MB 5EXXA 3TWOA 4G63A 5C31A 3ILHA 4XFDA 1J21A 2AYZA 3IA2A 3MGBA 3MMNA 5CR9A 5LDHA 1GRNA 1JKJB 4BTEA 1BYUA 2K2QB 3HZZA 4GUAA 4CIVA 3DW1X 3DGEC 3K09A 3IJRA 2ZB8A 1NW7A 3W5CA 2YIJA 4GDMA 1FFHA 4F6RA 1EXDA 2FWNA 3VVLA 1G42A 4XAQA 3HE3A 3EF0A 2VJLA 3SJUA 1UBEA 3F6EX 3JSAA 4CT0A 4M37A 4IZOA 4I3GA 4MWTA 1VSUA 2V0NA 5I7VA 1RCFA 2PUGA 1DSSG 4WV3A 3U61B 2G9NA 3H5TA 1PJ4A 1CY1A 1K5DA 3EQ2A 4DG5A 3SY8A 5DNUA 3ANYB 3KZ1E 4AZSA 1ZZEA 1NLMA 2UVPA 3LUFA 2Q46A 1HTBA 2GN1A 2IWHA 4TS4A 2B4KA 1XLVA 4FN4A 3GNLA 2IHUA 2YVLA 4LJAA 2OHOA 4E11A 2DB3A 4JL8A 1D6MA 5IJ0A 3ENVA 2VPQA 1T8UA 3P0IA 1PWXA 3EN0A 3G8AA 4PHCA 4PQGA 4X7PA 5C3MA 2V8BA 3IV6A 3GBVA 3OQMA 1KOGA 1KZ7B 1RQXA 2QK4A 3ANTA 1GCAA 4IJWA 1VP9A 3X1WA 3M5CA 3UQZA 4ZI7A 4N5MA 1JBEA 3PUVA 2HLPA 5DHSA 2FUNB 5INTA 3KKQA 2GJAA 4X61A 2WB4A 4MDEA 1U63A 1E6KA 1PU2A 2M1ZA 2VC2B 4I4CA 5K4HA 4ENTA 1BTOA 1DV1A 1K97A 5I7FA 3I28A 4FGWA 5DB4A 1G18A 1MN6A 2NV0A 4KDCA 1CVLA 1TD1A 4CL2A 1XMOB 5JVDA 4MCJA 4R69A 3H5NA 3KHUA 3A3NA 4REQB 3SXUA 1Y5NA 3FDIA 3QTBA 3KUDA 4CCSA 4Y2HA 1VHTA 2WNSA 1MH1A 1YL6A 1D2HA 5CLQA 5WRFA 5KNBD 2P5SA 5JJKA 3BMQB 5C35A 4TOIA 2W42A 3FUTA 1OKKA 1ECLA 1VP3A 4HDRA 4KQXA 4RKFA 4V0LA 4DV5B 2AZ4A 4D4JA 3KL4A 5K8LA 1YVPA 1EWQA 5HF6A 4AROA 2WHPB 2OLJA 1TO1E 1Z4KA 2EXXA 2W8BA 3G17A 4Q7KA 3VR2D 3QG1A 3WXBA 4AN4A 4GKAA 1VL5A 1DC6A 4HCJA 5BQOA 4F56A 4QZVA 3G59A 1ZD5A 2VJYA 3GGDA 5EHGA 1EWTA 5B12A 1N0HA 3L8DA 2ZBFA 3ZDBA 4ARCA 3F5FA 3V7UA 2DRIA 2E4ZA 1BXRB 3OX2A 3DWEX 3IVRA 4NNJA 2AI3A 3LRXA 3VRHA 1E2QA 1IK4A 1VE1A 1QIHA 1UXHA 3VNBA 3Q98A 4D9MA 4DV0B 3PJFA 1C8LA 1C9NA 1EFDN 4G8CA 2JVJA 1F4VA 1ZD1A 3DE0X 5C7LO 4AYXA 1XR3A 4GYYA 3VMFA 3BIXA 1CQZA 3JD1A 2XT9A 5IM5A 5B3KA 3DVAB 1JTEA 1Q0QA 2GCNA 1UBNA 3IE2A 1X14A 4F9EA 4Q4DA 1V1JA 1XVAA 1ABEA 5JYBA 4OHWA 3DCIA 3TECE 1RVV1 4BKMA 3OQVA 1UOEA 3DF7A 3O4JA 5E0KB 3W3AH 4TZ6A 5BUZA 2D62A 1H6DA 1DQPA 4AT1A 3BIOA 2VSXA 3HNPA 1JMVA 2VOJA 2ZIUB 3WGOA 5JWOA 5GOTA 3QPAA 3OVMA 2GX6A 1OBCA 1Y89A 3KUXA 1B41A 2P65A 3OLXA 4X1YB 2FEKA 1U1DA 4FZVA 3SVLA 1HX7A 2CVFA 1G41A 1A8UA 1OZFA 2B1JA 3P4XA 2IBSA 2JLRA 4P8RA 4XIYA 2AR9A 3BHMA 3RVSA 1D4FA 5GADl 1UC9A 4IFIA 2IUEA 2XGMA 3ELDA 5JG7A 5A62A 1RM4A 2B1IA 3EXHC 3C3KA 3WFZA 4BCCA 1YS6A 1QYXA 4JY7A 3RFTA 3NZEA 5ITZB 1EUCA 4YCSA 3LRTA 4MA5A 2WMNB 3L0PA 1RXEA 1J8YF 3HB7A 1MO3A 3BEOA 4MEAA 3OCWA 2RC6A 4H7DA 3S1AB 3PRYA 3VU9B 2ONYA 5CYPA 4WKOA 3D8HA 4TL9A 5JCJD 1OXSC 2Z6AA 1H3EA 1YGPA 3KJIA 5KDLA 1AKYA 4B3FX 4EFNA 1K5GA 2PGOA 5K3BA 3T3PB 4IIBA 1RZ3A 2QMEA 3QU4A 2Q62A 3ASVA 2Z08A 3MWEB 4HTFA 2O7QA 3FNHA 1NN0A 3FB1A 2ODEA 2CL7X 2X40A 3T15A 2WUWE 1DPGA 2XZOA 4A16A 5ELXA 3GJTA 4D9KA 4XRGA 5DDIP 3HN6A 5L6MB 2C82A 5IZCC 5IKPA 4OD0A 4DA7A 2PS3A 3OFVA 1KWGA 1NW3A 4YJFB 3TUJC 5KYXB 1DFGA 1NVKA 3LNCA 4LDQA 3SXPA 1FTGA 5L7TA 5K8TA 1Z25A 3ISTA 3N2KA 3PXUA 3R5KA 4GLOA 1WKCA 1KQPA 4L4SA 1DBSA 2QG6A 4O5AA 4C0LA 1E1QA 2FQWA 3EXHB 2E7ZA 4X8OA 5JSHA 4G0MA 3CN7A 4HKTA 4LF7B 5LM3A 3PIIA 4IG9A 1QP0A 2PGXA 3T1TA 1XCGB 3LDFA 3DMNA 3C3DA 3ICCA 2YJZA 2XOKD 5TSDA 2PAFA 1OLOA 2BL4A 2OCGA 4LYAA 5C1PA 2ET6A 3FJYA 1GUZA 2QVCA 4RH0A 3SVZA 3WK8A 2FW7A 5HRUA 3I4FA 3WLMA 2OUKA 1ABFA 2YW9A 3KJHA 2W6CX 3PPYA 1EAMA 1QRRA 2WJYA 3SOZA 4B6GA 3VDRA 2XTAA 1K8QA 4IXTA 4HL6A 4Q12A 4HX5A 2QG9A 4ARVA 2GN8A 2J32A 5DXJA 2V03A 4UMDA 4Y98A 3WLNA 4DIEA 1N5RA 1WDTA 4MWGA 2BGTA 5AI5A 2YUIA 4YRAA 3RWBA 2ZVPX 1T5SA 3EMKA 3L0CA 4HAZA 2X19A 5MGNA 3EVCA 1B3RA 4NMMA 5TMPA 1ZH0A 2FP4A 4C0KA 2WJ6A 1R0BA 4FW9A 1D1TA 1TUBB 4UASA 2GM4A 4HLUA 1X9IA 4HADA 4OOFA 5AJYA 4XGIA 1H1DA 1NYQA 2H29A 2OBXA 3PJDA 3DHYA 4BLOA 3EC7A 4K88A 4MLDA 4KVZA 1VGVA 1ILEA 4TTTS 4BJHB 2UZ0A 4GXQA 2IP4A 3O74A 1N32B 5IAKA 1EFRD 1QIGA 5IXSA 1K06A 2HSJA 3KSZO 3TBKA 1GVNB 4IIUA 2HA0A 5CT6A 2FSPA 2PFKA 1QKJA 3BCSA 3FKSA 4GI1A 4BLUA 4CJXA 3M6MD 2AFIA 4C4RA 3A1FA 1NVXQ 3TZEA 5EL0A 4EHBA 1YT5A 2FCRA 2HJWA 2GPTA 4KDRA 2IH2A 4HDQB 3PHCA 1WZNA 5FBRB 3K0HA 2C9DA 5FEUA 2DFVA 1HEUA 2Q6IA 2X2OA 4UAVA 1XQWA 1WEKA 5ELLA 4V1CB 3OIGA 3DNFA 3GLRA 4LTNA 4ZPXA 4EO9A 1MUUA 3NVAA 1DC4A 4RZHA 3TW6A 3SC2A 3RREA 3JASB 2X77A 2Z2YA 1DQNA 1DTSA 2IXGA 3TLBA 4JJEA 1ST3A 4WZAE 1GUBA 4BVFA 3O4RA 1WMEA 1DAPA 2FX2A 1F9EA 2F3QA 1SZCA 1X0XA 1Z5WA 3AJDA 1NF9A 3KFVA 1G7TA 4R8SA 2QENA 3DAGA 3R0JA 1KERA 3OC0A 3R5HA 3RGWS 1VMKA 4TLMB 5H81A 4A6EA 4E70A 1Q3TA 5BNZA 1SCBA 1I7SB 4PR3A 1NBOA 2AOVA 1XRPA 1ZWKA 2VWPA 3AUJB 3P0EA 3HZRA 3MS7A 4HFRA 3T5CA 3NYQA 3L41A 3Q88A 1VPTA 6GPBA 3CH5A 1P80A 2I78A 2YXLA 5HCNA 1WHTA 3VVMA 2X4LA 3LUJA 1LC0A 1C4KA 4ILEA 4XI9A 4DSOA 1GPLA 2I80A 4YT8A 1T4GA 1V9CA 5JI2E 4K87A 1JEEA 1I7PA 2C2HA 2IU4A 2ODNA 2WFMA 4F4JA 1DDOA 2EJCA 2B92A 3SQWA 1FS4A 2JZNA 2PLRA 1BE6A 4ZDWA 4D74A 2G76A 3QBJA 1O4VA 2OILA 3WGYA 4PLHA 3MMZA 2EL9A 1E62A 1A4UA 4XPIA 5DLEA 3DPSA 5AKYA 1MZPA 1ZCFA 1REQB 1N6PA 2VYFA 2W2VA 3GN2A 2P67A 3EXEB 4LMPA 3B82A 1YBAA 3RAJA 5BNTA 4F71A 1E7SA 2CHQA 5D1NA 2XZPA 3ZEIA 1DQRA 8AT1A 5LQKA 1RRCA 4MGZR 4PYNA 3N28A 2DERA 3DWGA 4IAOA 1ZU4A 4Q39A 2XGJA 2PQ6A 4J16C 1NJFA 2AJCA 2ZSHA 1U2ZA 3WWPA 1DDIA 3N8HA 5JWHA 5DBGA 1FXSA 1P7ZA 3DUFA 1C8BA 5BSRA 2ZYAA 4BLQA 2HNAA 4DBLC 1A71A 4BB9A 3BXFA 2B4AA 4DC9A 4D4LA 3FVRA 3PQ4A 3X2SA 1NQVA 3VNAA 5EJGA 3SZRA 2OAQ1 4MUEA 1E79D 3SAJA 3TINA 4IINA 4QPNA 3TL6A 1VIAA 4EHKA 3ESXA 3F6YA 5KYTA 3C1UA 3L0ZA 4FZRA 1E1CB 4G5OA 3KZCA 4EYKA 4BMOB 1ZUNB 4YR9A 2B8NA 4B3SB 1T0HB 3R20A 5JRZA 5BYKA 3WWZA 1PEDA 4QT0A 3UPUA 1G8JA 4DLWA 4HZUB 4Y9DA 1JA9A 3AEKB 4WLUA 2EGGA 3EGWA 2QRLA 2WWHA 3HGQA 2FGKA 1I0ZA 4YC7A 4ON9A 3DDHA 5TGDA 4DLVA 1ZZGA 1C30B 5KSPA 4JBLA 1S01A 2GAIA 3ZJTA 4W5HA 2FKAA 1WCWA 3R40A 2XDAA 5CLJA 5E8JA 5TQ2A 2Q41A 3VJKA 3O8NA 4B44A 4L28A 3MJSA 1SVKA 1VIVA 3CF0A 4PQEA 2IPOA 5FO1A 2GJ9A 1D4ZA 3KOXA 2V7BA 3EFEA 3IA7A 3ZHQA 2FMFA 1SUEA 2HPVA 1DTWB 1RRPA 2ARKA 3OD1A 5H1YA 1A8SA 2Q3JA 3HWSA 3WK9A 2IZ1A 4ZDJA 5K0TA 3E2IA 1GUFA 4F3YA 1P0PA 4J1TC 1X1DA 3QVWA 3PSHA 1Y8RA 4XLZA 4NS4A 2WFLA 2XCIA 3DQQA 3G8BA 1FNSA 1OJ7A 2PQMA 5KS2A 4PINA 1TM7E 4MQBA 3P52A 3OWXA 1GAWA 1DAIA 4RS4A 5FPSA 4EYGA 4R1SA 5JSQA 4QLAA 3HHPA 1FTQA 2LGJA 4B8YA 4H1WA 2BFFB 3E8SA 1PFKA 1YJ8A 2NUPA 3OEHA 3REGA 2QTRA 1ZGHA 5IDQA 1YCFA 2XA9A 5CA0B 1RM5A 4HC4A 1WAMA 3AOEA 1N25A 4HB0A 2XCUA 3BILA 4AWBA 5THXA 1T36A 4DQKA 1PS0A 4B3RB 1FLVA 2OWDA 3W04A 2QSZA 4OQZA 3OF3A 1IOVA 4JQOA 4K2HA 1UEXC 4P22A 2A9RA 2I76A 2XYHA 2H4FA 2Y1DA 1P1RA 3TGWA 5CHYA 2HF2A 4EG7A 2CNLA 2B8EA 4M0CA 3PPXA 2Z3ZA 3FNQA 3ZOKA 2VT7A 1IONA 4PQFA 3RS9A 1I3OA 3WHIA 1MHPA 1CUZA 2E0IA 4D3XA 3B5EA 3D6MA 4UXIA 2O2SA 3T4PA 2GHTA 2PMDA 3P27A 1CBUA 4DDMA 4ZEVA 2C03A 1M1UA 3GEHA 2BN4A 4RM3A 3KKZA 2XKBA 3EIUA 1I4EB 2YHIA 3ROGA 5EJ4A 3OEEA 4K8RB 1X3SA 1YRAA 4CCAA 3FA2A 4ND3A 4A5OA 5DP1A 4L22A 2VBFA 4FFDA 1ESNA 4P6VF 1US8A 4TV8F 4RPCA 2IQIA 4F8EA 3VC7A 4P4GA 4MVJH 4J94A 1LPSA 4NOLA 4WZBE 3S2GA 1XO1A 1A4RA 1G7SA 2IEDA 4KXWA 1ZNYA 4HNHA 5DXFA 4HFJA 3WQRA 1YQQA 4WESA 5CB4A 3WA7A 4H59A 4XGNA 1NVVR 1IM2A 2GN0A 1GSAA 2V5AA 3EPRA 4UVHA 3CZQA 3ST7A 1KWKA 1Q84A 3QJYA 4IFTA 1BEZA 5CJJA 1WUKS 4OHRA 2A33A 2CE2X 2HK6A 1PJRA 4Q6BA 2GR9A 4F8JA 1JEAA 1F6BA 1X7ZA 2B20A 2RGEA 3CE9A 3LY8A 3PE6A 4CCYB 4D8VA 1WZ2A 3WLSA 1EE9A 3SBOA 3DOHA 1EK5A 3VR0A 3FDXA 1LSUA 1WX1A 1LV7A 3S44A 2J48A 4H77A 3NWOA 3TD6A 4DRZA 1DG1G 2GBLC 1Z5NA 1H9BA 1QB7A 2XT0A 3CRNA 4GPZA 1MQSA 3T9CA 5AVZA 3TSYA 5CH8A 3HKBB 4YCNA 2PXHA 2HFJA 2P90A 1C9YA 2MINB 1EX9A 3B60A 3G2NA 4COKA 4QYXA 2DG2A 4MKZA 4LFBB 1MXFA 4KFUA 4F1KA 4UTZA 3ND6A 4TKMA 1YMUA 3A1SA 4YYEA 2ZI9A 3DFZA 5I7AA 3DGFC 1VZ2A 4ZVUA 2D06A 2L18A 3BFKA 1C9EA 1QKIA 3JVEA 3SXJA 3BGSA 3IDZA 4R1UA 1KBZA 4EA8A 3L06A 2HDOA 1SCUB 2YWJA 5SICE 5K0EA 3H75A 1JHUA 4XASA 4RY2A 2HDWA 1GLVA 2JGAA 5KMGB 4D5GA 4PSUA 1XDDA 2R4QA 5G02A 6YASA 4KJXA 5AJUA 3CW2A 1X7YA 5K3DA 3IUJA 2Q0QA 5EVJA 4RVDA 3VKGA 3VDXA 4O6VA 3OU6A 3B48A 2JBHA 2P79A 3ZVKA 2BJHA 4O02B 3ZBQA 5BYAA 1NOIA 2O0LA 2XAUA 2XITA 1SBQA 2HEIA 3MWDA 1N57A 4M49A 3R3UA 4J9UE 4N1AA 5C0OE 3TLKA 4M55A 2W6NA 1EP2B 3WGQA 1OWNA 1OTHA 1CX9B 1RJ9A 2HU5A 4GPD1 1KYYA 4F93B 4QQFA 1Z7EA 2AFHB 2WV7A 3ANXA 2QD3A 3TXAA 3D5QA 4BBPA 3W79A 4CYMA 1Z4LA 2R84A 5LZ4A 4HEA6 4U7GA 1OAAA 4M0PA 1NT4A 4YFYA 1OROA 4MB2A 3RAGA 4EYEA 4I9FA 5IBQA 1ZGAA 3CG4A 3N0RA 3QKUA 4H7PA 4YI5A 3W4JA 4DM7A 2QUBA 1WDMA 2VK2A 4P5EA 3Q2OA 5CVJA 5E6RA 3DP9A 4NU0A 4AUKA 4C5AA 3N0VA 5MN6A 1Q3KA 3AJRA 3K4PA 1UMDB 1OI7A 3FPFA 3N7TA 3KKPA 2WD7A 1ZC3A 2QX6A 1OLXA 2JFFA 2YV1A 2GWRA 3GJ7A 2C8LA 3OC6A 2A67A 4KGVA 5IDYA 4KEAA 5TDHA 1GEEA 1UOQA 4RTRA 1RWXA 2OHVA 4NULA 2X9QA 2Q1WA 2R6GA 3FVVA 4RCVA 1XZDA 4UUQA 1RAAA 4ZAXA 4IS3A 3NDBB 1QQAA 3DP7A 3W2EA 1C7QA 2JVKA 2X1MA 4LKRA 4NDNE 3UMBA 1HFEL 4H7FA 2RHRA 3FOZA 5KYGA 3GHHA 3V42A 5BURA 1C7ZA 1RABA 2JEOA 5CCDA 3ADDA 4RV4A 3D7LA 3L84A 5HIIA 1FP2A 1DRVA 1S96A 2VNJA 2QMHA 1RI1A 2J9FA 3GF4A 3NTXA 4G2TA 3AK4A 4HDMA 2C4VA 2RCYA 1KQGA 2F8MA 1BG6A 3WMFA 2LXNA 3V7FA 4AS2A 2X15A 2G5PA 2AOUA 1TIBA 1TMKA 3NCHA 1WV0A 5HE8A 3TVTA 4BB6A 2ZJBA 3GGOA 4ZQFA 3RU2A 4YX9A 5JATA 4TKVB 5LB2A 1WUTA 2BFDA 5ENZA 5A7HA 5CFNA 5GP1A 3QXJA 5JDIC 1QSGA 3B1JA 3VZBA 3AY7A 3UM9A 4EATA 3H97A 1SIUA 4Q4AA 1ZRNA 1IEXA 2QMZA 3W90A 3MWKA 2GDJA 3R3HA 1DU4A 1LJLA 3BJMA 5LCXA 1L5WA 3GGSA 1MAUA 2Z2KA 1ZKMA 3D2CA 1JG2A 5EKSA 4CQLB 2O1WA 1FSPA 4Q3BA 3OF5A 3EX7C 2QUHA 5CTAA 1P7PA 2IOFA 5AM4A 1D1PA 3RT9A 3V1NA 2VJMA 3T4EA 3VU0A 4W5JA 3E3MA 3QMVA 3M4YA 4QEZA 1RYBA 3QF4B 3NYIA 1NIPA 4AJ2A 2J6CA 2OPBA 3I53A 3WVNA 4F5YA 1WHSA 5E4YA 5EHIA 1Y4DE 1W8DA 4QG7A 1RP7A 2OXFA 2YWEA 1W9MA 3BTOA 2JLSA 2PSDA 1BW9B 1WQ3A 2W6OA 1I5RA 2GEVA 5DH9A 3R0VA 4N7MA 4WXPA 2BLLA 1GA1A 5DISB 3UN1A 1KYWA 4MWBA 3AZQA 4P38A 5JHGB 3VKFA 4MHSA 4K9OA 2PZEA 1XRNA 4GMKA 1JSCA 3I42A 5DM2A 2ZTLA 3K0BA 5IABA 2P1ZA 3ABSB 4NAUA 4D8YA 2OESA 1MPXA 2HWUA 3PIRA 4JYBA 2QYHA 4AWAA 1TZ2A 3KTAB 1WMDA 1E3LA 1C8KA 4AS3A 2PZFA 1M75A 1E2BA 1VGQA 2GT1A 1LRKA 2IELA 1ZXBA 2YWFA 3AM3A 3QLTA 1PR4A 1E6EA 2SKDA 1NTRA 1E5XA 1J56A 3I23A 3CKLA 4Z0NA 5G1PA 4MPPA 1J22A 3H5IA 1Y80A 2OKGA 3RUCA 4Y30A 5CDTA 3JQDA 5FOSA 4LMAA 2YZNA 3NCTA 4HQ0A 4KR0A 1NXSA 4RD3A 1PD1A 1NVGA 4FGUA 1RCTE 2HBYA 1SVNA 4JJAA 3H9JA 1C3JA 3BIWA 1QF7A 2H0QA 1TRHA 2OY0A 1X7HA 1ZPDA 2IC5A 3U9TA 3F6BX 1F8GA 5P8WA 2HHAA 1Z4MA 1SH7A 2BGGA 3ZS9A 4TMYA 1QNFA 1XYVA 3A11A 3GPCA 1N9ZA 2AZDA 5DFAA 5GZ3A 1OZGA 3PTAA 1NYLA 3BYZA 3O1JC 1ACLA 1JLLB 2D5CA 3MM4A 4FYYA 1FPQA 2DH6A 4UEJA 2C7RA 3QEJA 1XOIA 3GJ0A 3JQ8A 4WXMA 4YIKA 2DR0A 5K05A 5KDOA 3SIPA 1R9GA 3CTMA 2O2IA 4A1OA 4N5NA 2YJ6A 4WCFA 2OCAA 4QLBA 2CMFA 4IHKA 4MVJE 2JATA 3A2KA 5BV1A 5HVNA 5IMSA 3IDAA 4IQ0A 3PVZA 2WFAA 3CX4A 3IQEA 3O95A 1H4VB 3ICWA 1N5KA 4GQAA 3U5TA 1OIXA 1ST2A 3F9IA 3NRJA 3T0IA 4XWWA 5FWXA 3L4JA 1DCKA 2QSUA 2PSJA 4BMZA 1IC6A 4G8BA 4N18A 7GPBA 1U4SA 2VK1A 4RMNA 3TG8A 2YOHA 4RK7A 3HK2A 4US1R 5BXYA 3HYTA 3DLHA 3Q5EA 4JA2A 1II8B 2HBQA 1WNFA 4E21A 2FW0A 2HPAA 2WNHA 2QTTA 4DLZA 3OTWA 5EWMB 4EPVA 1A5BB 1RBYA 3NI2A 3U19A 3KIPA 4V24A 5E6SA 3ZGYA 1IZ9A 3RVQA 2CLCX 1DB3A 4DW8A 3HJHA 4X0EA 5HUHA 3E7FA 1Y4ZA 5CLHA 3TZHA 3SNKA 5D7NA 4O4HF 3WYGA 1BEUB 4IHJB 4KIUA 5BWBA 2IHNA 1BCRB 2ALJA 5JMPA 4X24A 2OORA 1N8KA 3U4AA 4GT1A 1BU8A 2HPZA 2JZCA 4KN8A 2C1EA 4D0LB 4AZWA 1GNLA 3F5QA 4IJUA 3CS3A 3O8DA 1HI9A 2QUJA 1B74A 5IG2A 5KAPA 1TPYA 4YBRA 1L5OA 2A1TR 2VHTA 1X74A 1WO8A 3FCYA 4AMVA 4BKUA 4X7BA 4K6MA 4RNDB 4PVCA 3ZWKA 5TR9A 5DLQC 3GT0A 4EW6A 3ZY3A 2ZRQA 4H35A 2W2LA 2DETA 5T3YA 2I4NA 4G0UA 3FFWA 3L6BA 3O38A 4LJLA 1JWLA 3S2UA 4AI6A 4URVR 3KKNA 4I1UA 4JN6B 4WSOA 4JD5A 3GLUA 4MMZB 2BBTA 1T4CA 1NFRA 4Z7OB 2D5IA 3A04A 3KQMA 4ZYZA 4EH1A 5LYYA 2GFQA 3I8XA 5HKLA 1A96A 4OXIA 4EGJA 1PSZA 2MWMA 5B5SA 3VBEA 4DUPA 3K16A 5A4IS 3CVUA 2E4XA 2VHXA 1TCAA 3ROTA 2J46A 1ZG3A 1EYZA 1BCSB 4PPYA 1H2BA 4O4IB 2N46A 3VNSA 3U3ZA 3WKCA 5EJ7A 1IM5A 1MORA 1UDAA 3GQBB 3ISVA 3CISA 3QX9A 1B2LA 2C3UA 2WG0A 4HQFA 4ZXPA 4A91A 2TMGA 3I09A 4PSKA 2ZRLA 3LECA 2L2QA 2C9BA 1TD9A 1JE1A 4AK9A 3ZQUA 3OLWA 4H4DA 4HXEB 4WUTA 4Q4HA 1NW5A 3LDHA 1N6IA 1TVKB 4QU8A 1E9CA 2R7KA 2X14A 1QHNA 1OH6A 1W19A 1FTSA 2YV2A 1Y5IA 2XQIA 2IK8A 4Y9RA 4DLSA 5EJ5A 3WHPA 4EZBA 3VHXB 2BTQA 1S89A 2GPSA 4TMKA 4F85A 4ZN6A 5A02A 1SMKA 4S0ZA 3BMOB 1QOQB 2X6RA 2V7XA 4X93A 2H52A 3DCJA 4U7HA 1GNVA 1QQ7A 1PJ8A 3S6JA 5JLJA 4G5SA 3L4SO 3MJ4A 3VKWA 3AY0A 2BH9A 3S5UA 1RD4A 2H31A 3EA4A 5H9VA 1BVYF 1O94C 2DFDA 2NT3A 10MHA 1A8IA 1UZUA 5U4XA 4L85A 5AVWA 1L5RA 4QU9A 1EQUA 4C5CA 5C52B 1ZA1A 3A37A 4RQUA 1OAOC 4QT4A 2YN0A 5KTYA 1KZGB 2BFOA 2XEXA 5BVGA 4ZYLA 4HXFB 3AVPA 5LQMA 1PJQA 1QVAA 2Q1XA 2I3ZA 2ZJ7A 1CR4A 2ZUVA 4LDRA 4D4GA 1GU1A 2AJBA 4DDKA 4JQZA 3W8DA 4EABA 1VRVA 1KFJB 2ECOA 1MFPA 2EP7A 2OOKA 4J3JA 4U2FA 3AEYA 3NNNA 4JUDX 1CUHA 4BQOA 2W4QA 5EP1A 5GJWC 1XROA 4NYMR 4PNEA 3CLVA 4D57A 3THSA 1Y7LA 2PD3A 3H16A 1OPRA 2QHXA 4WBSA 2L42A 1PL6A 4OQDA 2JD0A 3LC7O 3ZI4A 3LPCA 4IJ6A 5JXWA 3STYA 1SOAA 1E2FA 3WNBA 4AKIA 4MA0A 4JJ4A 3L7LA 4NZNA 4NX2A 1UKAA 2PMKA 4C5BA 5IP5A 1ISIA 1L8XA 1K2VN 1R0XA 2XF8A 2EJUA 3GRKA 1P2SA 1TQDA 2EEPA 1AN9A 4EL0A 2V9ZA 3A6ZA 3NDJA 2BDEA 4MW0A 1XTRA 4AO7A 2BR4A 3S40A 2Z5LA 2HLDA 2REQA 2ZE5A 4JH0A 4NPCA 1KDOA 3PCTA 3KT0A 4Q1EA 1QYVA 2HCTA 4S0XA 5AJZA 2ABWA 4ZZ1A 2DYKA 2Q2NA 4NZ9A 3OPYI 3C3EA 5ULLA 5ILOA 1VLJA 3EFBA 2C42A 3AX6A 3X2EA 5EHNA 2J31A 3C5VA 4WESB 1MX9A 3RLIA 2R9VA 2AK3A 5K6AA 1RADA 1U3TA 2BHSA 3CPSA 1XPUA 5IM4F 2DKNA 5CM8B 3FVWA 3YASA 1P4SA 4R51A 1BMDA 1XJ5A 2WM8A 2Q8QA 3AETA 1NW4A 5IAJA 5A5FA 2BWJA 2ZE6A 1YR2A 4H6XA 1M0TA 1ZFNA 5H68A 4ZK2A 1GADO 2Y99A 2VH1A 3FNIA 1M1YB 3AILA 1GT6A 5BSWA 3A4YA 1VSTA 1VKZA 3IUBA 1N0WA 5COBA 5EIAA 1TMGE 3FJOA 1SD2A 4BGUA 5IUKC 4S1WA 3DEJA 5JSZB 2QZ4A 4A8TA 2C2WA 3WGUA 5SYAA 5JAPA 4CMGA 1LBHA 5F1PA 3JQ7A 1H5QA 4URZR 2IH4A 3OFSA 5HM6A 2PMBA 4KQ9A 2MSKA 4RGVA 4TXHA 4CMIA 1Z6QA 4P2GA 5I9BA 1QHXA 3WQQA 3ZZUA 1OB5A 4CQMB 4UDYX 1QGAA 3D8NA 2VT3A 3ZI0A 3C3WA 1AQYA 2O3SA 1UT8A 1VJ0A 6Q21A 2W5UA 1RXYA 3OT4A 3ZTWA 3G9ZA 5DCYA 5EQFA 4HYYA 3DTNA 3MAGA 3P8ZA 4TTSA 2CZQA 2G09A 1IJFA 3IPCA 1USKA 4TVSA 3I9KA 3UTDA 3U2QA 4O2LA 2GPJA 5FBKA 3KQQA 4JUFA 4YPFA 4BRWA 4IUYA 1XQ6A 2P9FA 3M81A 4MQ4A 2YZKA 2FWIA 2VDNB 2ZTUA 5AVJA 3GVIA 3TO5A 1SKYE 4MDYA 4LF5B 1CQIA 2FUEA 2JGDA 3EJWA 2PX4A 2CV2A 5EZ5A 3MJCA 3QQ5A 3G0BA 2XXJA 1UM9A 4X6YA 4CM3A 1G3IA 1I2DA 2BGMA 3I9JA 5T4BA 4DG9A 1ZJ6A 4BV3A 3FMVA 3JPYA 5DK4A 3NBKA 2XRYA 1Z0UA 3RJ9A 1SVIA 1V8PA 3DZFA 1NWCA 2XNDD 3ZNPA 1ARZA 1KAHA 4F38A 3C45A 4F86A 3FKJA 3OBIA 1I3KA 1DJQA 1WXDA 1SKQA 5DJ5A 2XYQA 3BZWA 3CVJA 3NAGA 4MWCA 1FFAA 2QF7A 2Q8NA 1WDWB 2Q9UA 3G2IA 2HWXA 4GWKA 1XNHA 1OE0A 3HB4X 3I2IA 3L07A 3MZ0A 3OFNA 4MUXA 4R1LA 4RX1A 1R37A 5HMMA 3ZIUA 2MOKA 4DEVA 1FXUA 2E89A 5CK5A 5H9WA 4QOEA 1TZBA 2V7QD 2VJDA 4LZPA 2IHZA 1DAMA 3HY3A 1ZOIA 4XB2A 8ABPA 1BN6A 3I6YA 1T2UA 2QM8A 5JXGA 2O2GA 4MCHA 3TG2A 2X0DA 2C94A 1PWHA 4O4LB 2Q29A 3K8QA 3F8TA 3VR5H 3L40A 3RYHA 1CP2A 2P9CA 2VP6A 4LF6B 3WSTA 2IXAA 1ZD9A 3G1TA 1V1MA 3OJCA 4XX0A 5AKLA 1KBOA 2GRJA 3KZKA 4WN9A 1UBFA 3U4QA 1QO0D 2AFRA 2PDAA 2YWCA 3F8WA 2SKCA 3GDFA 3K09C 1RXCA 4QGFA 3OQOA 2V4UA 1ENYA 1D0VA 1Z26A 3MUNA 4M1QA 4LJKA 4ZOLF 1USIA 1YBFA 5FA5A 4X66B 4MHTA 2H4HA 4P4LA 3D8BA 3GRYA 4WKCA 4PF1A 1CIVA 3FZGA 3CNBA 1HLPA 1O94D 3M9XA 4HQLA 1XT6A 3LHFA 4RH3A 4F7WA 3G7SA 3G88A 3ORFA 2V6IA 3OZDA 2VQEB 1KAGA 3A4TA 3G2KA 2XUJA 3LZ6A 3TEJA 4ENUA 3ADBA 1CZUA 3NAZA 4QPZA 3MMXA 3RF7A 2PA0A 3VC3A 1ZUIA 3WP1B 5HWSA 4TV8A 1COZA 1TFUA 3BSFA 3WYEA 4DRYA 1M6WA 4BX0A 4QBFA 3UY4A 1BWQA 3G0OA 1H22A 1ZVMA 4PZEA 5CJPA 4OATA 2HCBA 1S4QA 1WTCA 2J0UA 4GVPA 2EU8A 5BMVF 1UBSB 3GFSA 1KYIA 2CB0A 5CDGA 4BJ5A 1JNYA 1O6CA 3BCRA 1KJJA 2IS4A 3TLAA 5BNIA 5KSOA 1MR3F 3TYXA 2P2GA 2MYNA 1QC5A 5DIZA 3RK4A 3D8RA 4JEMA 4JNCA 1OY1A 4KL8S 1F8FA 2BFAA 4MMXB 4NMLA 4XLTA 3RYFA 5AVVA 1PNVA 2V3VA 3GLGE 3CT6A 1UUFA 2FZ5A 3KB8A 5KQSA 1JHQA 1BDMA 3B3JA 4QL3A 4JLOA 2GM9A 4F6RB 3D0OA 2NSYA 4IGIA 5EKUA 4B4WA 3UC9A 2BEJA 4YPVA 2EFJA 1E9DA 3PHLA 4JJIA 1HL7A 3OU2A 1II9A 1SQ0A 1KZ4A 3DMRA 3PTLA 1H94A 4LHZA 4YXWD 4ZCIA 4EENA 1KO5A 3H1EA 3E7DA 1AKRA 4Z2YA 1GGEA 1O2DA 1FU4A 4CQMD 1SHTX 1CW2B 1I2MA 2BM8A 4BMDA 1TLTA 3PXEA 1RM0A 1XU9A 2NO6A 1GRCA 5TT1A 3W8RA 2PZJA 2P9JA 3NBUA 4QGHA 5THKA 2UVPB 3N8KA 3L3BA 1YE5A 2OA0A 4AF7A 4XOIA 3H19A 4XQ9A 3ZNOA 3FZYA 1YOBA 3CLSC 2QS9A 1Z3CA 1UJ4A 1EAYA 3CPJB 1OFVA 4QICA 4ZJYA 5KTSA 3PUYA 2D2XA 1P8AA 5IJ0B 3OUZA 3TFOA 1FBNA 4WA7A 4EJSA 1H6BA 1EE1A 1QHYA 1TJNA 2COEA 1I3MA 3A1DA 3GK3A 3R6LA 2A1IA 5DKFA 5FOXA 3WWYA 1KNQA 3LTEA 4MGKR 4ZI7B 1DAHA 1JMKC 1XXHA 1IHDA 2WF9A 1NHWA 3MJDA 5FWDA 4AJ9A 3RWMB 1P3DA 3HU3A 3AFNA 2EX0A 3V1KA 3WIBA 1KI9A 3WG9A 5AW7A 2IHBA 2RHHA 4MWDA 4IDNA 1H8HD 3QP9A 3P9PA 1XTZA 3FSRA 1EIWA 2HF9A 1PNRA 1NASA 3ZWCA 4GEKA 4ENWA 4BX9A 1OWOA 5M34A 3BULA 5AOCA 5JVDB 1AOXA 3LXXA 3TRDA 1OV6A 1RJEA 2YYSA 1RP1A 1LY1A 2B4RO 3SXUB 1O3YA 3PXGA 1Y82A 3H8SA 1QFJA 3ECSA 4FIZA 5DM4A 3ZX4A 2WLTA 1VXRA 4S3MA 1K1EA 4KVFA 4AZ3A 3GRPA 4BWFB 1S2GA 3LXMA 4HDRB 4L6IA 5A0FA 3T4XA 4EGFA 4RHEA 3EHDA 1HFJA 1XQ9A 3K5PA 2OEPA 4URWR 5EWLA 5AK4A 3P9RA 4M60A 3GRZA 5AW0A 2PJZA 2W8BB 1JRLA 2CDBA 2ILVA 2QTLA 3WDSA 1XTBA 3P0JA 2RHCA 2E3JA 5ECGC 3NIBA 2RAVA 5ALUA 4G9EA 4NXMB 3KO8A 2QP9X 1WPXA 4AY3A 5CYGA 1P1KA 1WXEA 2HMTA 4PXAA 3WMXA 2A5FA 1U0LA 5C8ZA 4DBZA 4O1MA 1K7CA 2IIBA 1VL6A 1DC8A 1E64A 1R6UA 3MJTA 5TARA 5HPYB 4MAFA 1MJFA 2C0CA 2FSFA 2PPVA 2X2EA 3VR5D 1NMSA 3LBHA 1PNQA 2ODTX 4QTUB 1E7WA 3E22A 2ID8A 4Q7LA 3O8BA 3GC6A 2P5YA 4NP6A 4XQCA 3VMMA 4AG6A 4X8HA 5TJHA 1IH8A 4OQPA 2JIDA 1PYDA 3LDGA 4DQ0A 1ODJA 2I7DA 2JEYA 4NQRA 1NFQA 3AVVA 4PIPA 3U62A 4Z7JA 4RDXA 2WZDA 5KVQA 3H0CA 1NGSA 4NJMA 5FTMA 4YALA 5B4TA 2DUWA 1RAEA 4NPHA 3JQBA 3BZBA 3U09A 4F3RA 3NEYA 3HV0A 4J4BA 1VQ1A 5CT8A 1IYZA 3ROZA 3RT7A 2D74A 2JVIA 4E5NA 4K6CA 4NCKA 1RKUA 4DLBA 4GOOD 3OY7A 2J9RA 3A0RB 2X3UA 4AVYA 1WZCA 1ZJZA 3IE0A 3ZXIA 5HS6A 3S3TA 1EUCB 1QONA 4ZGWA 4TYPA 1BDJA 3SC6A 1WPGA 2PBRA 3B85A 4YQZA 3M0EA 4JKIA 1UINA 4P32A 1HE2A 4P3YA 5BWOA 3CR7A 1IMJA 2XWSA 2ZIWB 1EPUA 4FINA 4DCMA 2EFEB 1SAYA 2A9JA 1XDGA 3BQ9A 3QFFA 4BP9A 3AJAA 2VH2A 2G08A 3L77A 5LZ7A 4WERA 5H3CA 1IDN1 4W6ZA 1N7IA 1IZYA 1GITA 4HTFB 5CFMA 3FRJA 1YCGA 2H3EA 1XDZA 1DKUA 2FI1A 1JDBC 4GLJA 5KIAA 2D1RA 2VEOA 5K3SA 1VC2A 3HXLA 2JK0A 2QXTA 1GTSA 2VQSA 2X0FA 4TVBA 4Z4GA 2C3YA 1HO3A 2CNNA 2GTHA 2G77B 2Z4SA 4II2A 4UU0A 2ACEA 1WULS 1JMYA 1A7AA 1PDOA 3L2OB 4OSEA 3FTQA 4RHTA 4X71A 3T7IA 2VYVD 4JB0A 1Z34A 4EKGA 4HLUC 3N2KB 3GJ5A 4A5SA 2A78A 2MSDB 2VUIB 5EIBC 2PFGA 2H00A 5CB0A 4J3FA 4Q6WA 5EHZA 1SRRA 1ZIOA 2J5RA 2XWJI 2ZPUA 4HVAA 3E8MA 1BRMA 5A9TA 3FY4A 4BCBA 4OMUA 3F8SA 1N78A 2IEGA 4OH1A 3R09A 1FP7A 3UB2A 4Y2GA 1FA9A 2IEIA 1SULA 4PZ9A 2A0WA 4LHYA 3EVZA 2NZJA 1LVGA 4A7PA 4XJTA 3H86A 3U0BA 4E22A 2XT6A 1D2MA 3KOMA 4L72A 1JALA 1IXZA 1RAGA 4MQ5A 1KMNA 1UF9A 4WEOA 3MSXA 3AXSA 3NHFA 2CUZA 4N3BA 4KMMA 3GPDG 3LBIA 3ND7A 4N76A 5LQNA 2AC7A 3CLSD 1JDBB 1BVRA 3NBXX 4JVLA 1OKKD 1F1BA 5DHRA 5ITWA 4P84A 5IC4A 1FJGB 2F1JA 3WKDA 1VI6A 2SKEA 5LU9A 2NADA 1CSEE 4C2BA 2C83A 1E8MA 4LG1A 2ZXFA 4MSUA 2MSCB 1UBJS 2FP4B 1UC8A 2EERA 4DC1A 4WBNF 2P62A 1HQYE 3WY9A 3GG9A 3Q0TA 4FS8A 3RJTA 1SHLA 1YRYE 1JT2A 3CM0A 4ZU1X 2GOYA 2HDNB 2ZJ0A 3ROEA 2Q6LA 1USVA 1GKKA 4BX8A 3RABA 4U2DA 5DTMA 4JROA 1JVNA 4EELA 2QJFA 1TZJA 1ODTC 1QX4A 2AL7A 2R62A 1KSJA 5F7XA 4QM7A 3DH0A 4B6EA 4A10A 2Q6KA 3BSWA 4R1NA 5J2TA 1G8PA 3A9SA 3EWNA 4U2GA 5C46F 1E4EA 2AFIB 5K4AA 3TSOA 1A9QA 1NP3A 3KRTA 4CUZA 5ALYA 2OCBA 1YR8A 4RY9A 2JJ8A 9LDTA 3C16C 1K3TA 2HCRA 3K1ZA 3IJEB 1XE3A 3IDOA 4I1YA 3HCFA 1EXMA 5IN5A 3OJ0A 4MVJM 4FNMA 2IRWA 3CUSA 3SC2B 2PUDA 3N3BC 4FFPA 4O4HA 2HF7A 4GVLA 4EKIA 1S3SA 2GRAA 1R15A 2H2GA 2JLBA 3HXPA 3PT9A 4LY3A 4MXDA 4YRFA 5IZ4A 2QLLA 1QWSA 2FUG1 2ZIZA 4F45A 2VRCA 1QZZA 2CKDA 1RRKA 3IIJA 5ALJA 5K3AA 4HYTA 3F46A 2VPZA 3BTVA 1E77A 1R0YA 1UEJA 3I1JA 4Y2RA 1PV2A 1ML3A 3MWJA 4IEIA 4QDUA 1SQGA 5EUQB 1I1NA 1T4BA 2EYQA 1CUFA 1GZSA 4LJ5A 4C4SA 1E32A 2OAGA 2GM5A 4KE6A 4WY8A 3PUWA 2W0MA 1VPVA 5FI5A 3NANA 1VJ1A 4RZSA 2EEZA 1Z0DA 4B7AA 4TMVA 3HY4A 1KVUA 1MG0A 1CFZA 2J4DA 3E27A 4WOJA 1WHTB 2JDIA 2WKPA 3SHQA 1B1CA 1M1XB 5DP2A 1XMJA 3AZPA 5A4MS 1W59A 2DP4E 1E8DA 3WKAA 1M2VA 4FYVA 3I6ZA 5JNLA 2XBLA 1SIWA 3SSMA 1YFLA 4H1UA 2O8EA 5F7ZA 3CVXA 2IYTA 3C0KA 4Y0AA 4EMTA 3HBNA 4HWKA 4DN6A 4MUJA 4PO9A 2EARA 2Q3FA 3DLTA 3AR5A 4RJ2A 2O8VA 3L0DA 1YVDA 3LK6A 3KSRA 4RSRA 3GROA 1VE5A 4Q18A 1F0PA 4XPIB 3DONA 2HPHA 2QWXA 4W63A 4Y9TA 4LCBA 4DDUA 2A84A 3HU5A 5I8WA 3JPWA 2PWZA 1DEAA 3ME5A 2HA3A 4R40A 3DXXA 3SPXA 1DJNA 2ZITA 3HEAA 1CUEA 1E1QD 1ZMBA 2QL6A 4KK4A 3JAWA 2A58A 3LW7A 4OHMA 4S2EA 1V7QA 1NUHA 3NWPA 4Q9DA 5H83A 2A9FA 2MMGA 4X7MA 3DUFB 1P91A 1FUYB 3CY6A 1T5OA 3D8SA 4HQ6A 4RMGA 5EGSA 5EUMA 1J7KA 3ZGNA 2CKMA 2O3RA 4EG1A 4ZTZB 2RC5A 2F48A 3MTIA 4Y6LA 4I55F 4YDSA 2PTHA 2ZSUA 1L5YA 2FN7A 3NM6B 4K6OA 4LQ4A 1GL6A 2H0AA 1T3ZA 2EV9A 3ROKA 3T9BA 2CNOA 4QBHA 4YMUA 1MEJA 5L7WA 3OQBA 4XB6B 3GEGA 3RUFA 1CD5A 1EDDA 1GUAA 3CUWA 3I2YX 4V0KA 1NG1A 2EKZA 2PLAA 1KVQA 1RHUA 3D3QA 3F7OA 4FWTA 2BFPA 5KOJA 5L3SA 4LKOA 3W1VA 3OEYA 4AXXA 2P6PA 1Q22A 2PVPA 3T3GA 3AOEC 1T5TA 1J9GA 5CB6A 3I2KA 3JATA 1JG3A 2VAXA 4DHEA 1VTKA 1FEZA 2WZBA 1AHHA 3FLMA 4V0QA 1Z6GA 4PSCA 5EIBD 4YP7A 1IL0A 5TQ2B 3MQFA 3H9UA 4ZJPA 3MTGA 3EZYA 1KC1A 3AB8A 3V1LA 2JCYA 3ODGA 3IP9A 3NHRA 3B1VA 1CR1A 2YVQA 4V39A 2PRJA 3I9MA 4WZ6A 5TMBA 4BP3A 3HWRA 2R4TA 4EHAA 5TPWA 3WK5A 2C9ZA 2XUKA 2OMEA 4A6XA 1O0BA 2HI0A 2QP3A 4A6PA 6AT1A 1SRQA 1R4AA 1SG6A 2BRUA 2J0SA 4P5DA 1CRQA 2WYUA 1Y8RB 3AZOA 3SF8A 1RCUA 1FF9A 2WFLB 4II7A 4MDHA 4WINA 5ALXA 3K05A 1A1SA 3C1OA 1Y5LA 3T34A 3HBJA 4ES6A 4MO9A 2H11A 1P2BA 3WTCA 1HSOA 2ZR8A 2NUPB 2ZVQX 2GN9A 3EAGA 3JARA 4UU7A 4AY4A 1SWWA 3OA2A 4ZCPA 4YIHA 2HRBA 4E3ZA 1NJSA 3ZGLA 4RVFA 2OV6A 4NU8X 4WL0A 3MS2A 4RDHA 4C3VA 3EASA 2D7DA 3HB0A 2DY1A 2CC2A 3GG2A 1A9ZA 3PP8A 1H23A 3B9PA 1T36B 2PH3A 4TXMA 4TZKA 3VYVA 4ZHQA 3U7FB 1SXJE 4CF5A 3AVQA 3GWGA 3C5WP 3B5IA 5DYNA 5JZBA 5D84A 3OMXA 3ESCA 1DCTA 4RTNA 2V6BA 5JZSA 5IM4A 1P9LA 1MX1A 4QOJA 2EJVA 3LFUA 4CN9A 1WXHA 2YRWA 3NIWA 3WIUA 1WLSA 2ZDHA 2IUUA 1DEHA 2O8FA 4EJMA 1ZY2A 1NPYA 1YZUA 1SBHA 5IK2A 3W5IA 4FWIB 3EZNA 1JLRA 3IHWA 5J1TB 5IUNC 4AW9A 2Q1TA 2QTWB 5CG1A 1IE3A 2C98A 4R2JA 2WP0A 1NW9B 2PGLA 2W4IA 2YHIB 1C0PA 5C4MA 5BN3A 1COWA 1NY5A 2ID9A 3JYQA 1OX6A 3QVGA 2IUYA 2OV8A 3E5NA 2VF2A 1US8B 3B9BA 2D8MA 3GVCA 1JEOA 2OP1A 4MJ3A 4R2LA 2BM9A 4CM9A 2F00A 3BX1A 3CLKA 3CXUA 1I4OA 3DKIA 5EXEA 3VHQA 3VR4A 2Y9PB 3O3NB 6LDHA 2RAFA 2Q45A 1DQZA 2YJGA 5CB4B 4O2AF 2TRSB 1S8FA 2J9ZB 3UCFA 2YJ4A 1N0VC 1VYHA 3E05A 1XZEA 2CUNA 5TMEA 1F2UA 3IHTA 2J3HA 1TT5A 4X20A 4NNOA 4JJGA 3KSUA 1FNNA 4E51A 4AN0A 2VXCA 1SD1A 5EC8A 2NU7A 1X7ZB 4CKZA 5JCOA 4PX3A 1KY4A 4F2GA 1XNRB 1DOZA 4GR5A 1R4MA 4BFUA 1YDMA 4OHPA 4PZYA 3MBKA 3KPVA 5LN1A 1CZOA 3Q9LA 1KAOA 3ZGZA 5TMDA 4HN2A 4PHFA 2O7NA 3L6EA 3F98A 1OFHA 1QF9A 4R9UC 3ICPA 5AW1A 1Q7BA 1JUDA 4DSTA 1GR0A 3OMLA 3EVDA 3FLEA 3IVXA 3RO7A 3UEOA 4YAUA 1KE1A 3E81A 2I6QA 3ZDZB 1T1GA 4CDMA 4B3HA 1WPRA 4AO6A 2DCMA 4L15A 1AXGA 2H6EA 4FYIA 5HXAA 4CV3A 1W5FA 5LQDA 1ILWA 4Y2JA 5KNCD 1Z5GA 3IX7A 4RZIA 4F11A 4JEUA 4UAUA 1GKYA 3ZUGA 1F3OA 2WC1A 1B6SA 4K5QA 2O19A 3L7MA 1P60A 1Y3DE 4JVOA 2IXTA 1GZ7A 2BCJQ 3SWWA 4ZCLA 2JBAA 1XVVA 5E0OA 1ZNWA 2JCXA 1L5LA 4ZMRA 5FD8A 1GPDG 3TB6A 3B53X 4RTJA 1FDVA 4JBXA 5KKNB 4K0KB 1U31A 4PAMA 4RPHA 1X7YB 4BO0A 3CB2A 2UV8A 5IEJA 1YC2A 5DZSA 3P4UA 2CV0A 1KEZA 2JANA 2WSLA 1U11A 1LTQA 3FHCB 2OFFA 1ZA2A 1FP4A 3KOWA 2YC4C 2VSYA 4MQLA 2V54A 9LDBA 1THTA 3MWDB 4IF6A 4W7SA 5BW8A 5JNUA 1AQUA 2H1LA 1JIQA 1RJ9B 3QVSA 2DY0A 3WZMA 3EPHA 2PYZA 2QGZA 4WJKB 5FUBA 3P94A 4ZOLA 1JAIA 3GELA 1F8XA 2HXSA 3OPQA 4GH5A 2DVMA 4OHYA 1IIBA 4OEHA 3NBQA 2PUFA 3AKCA 2Z1MA 4DLYA 3L7DA 1DUSA 4F2WA 3OOSA 2OXEA 3BB3A 3LA8A 5E6RB 2XCOA 3ULKA 2ISSD 1PT5A 3OY2A 2KWIA 2M98A 2R8XA 1OLXB 1ADYA 1VIYA 2HQRA 2WD7B 2XYGA 4NV0A 4CI9A 1C7EA 4OLHA 4UHBA 1GV1A 1ZD8A 4WY2A 3ZV4A 3ZR4B 3QV1A 3UV7A 1LLQA 1RPJA 4RTMA 1JW9B 4P3XA 3S27A 4CIYA 1UFVA 5FBQB 1NYRA 5BMVA 1RBQA 2I4OA 3A36A 5CFLA 2FW8A 1DX4A 1KI6A 4CM8A 1N9GA 2XMSA 4YAGA 2PANA 3EDQA 5CM9C 3DB1A 4MTLA 1N0IA 4WTOA 2B36A 2MIIA 2BW0A 4PZZA 1CUUA 4EHNA 3AJEA 3QUTA 4NZYA 1Q0SA 2PIAA 4ESHA 2XAAA 2J9FB 4F8YA 4ESOA 3OUTA 2CNBA 2ONKA 3T1QA 4HDMB 3KVVA 3OEED 2Y92A 4CTKA 2E4VA 1QK5A 1VL8A 1P7VA 5REQA 1Z83A 5KTKA 1FRNA 2QNRA 2AOUB 4NCBA 3GH1A 3HLYA 2DSNA 1YJXA 1CYEA 5LQJA 5IC5A 2CVOA 2Q7OE 2I2AA 3IDQA 2RHTA 3B6KA 2BFDB 4JB8A 3S8YA 4EFKA 1P75A 1QZ3A 2J07A 4N9QA 1E1RA 1ZGZA 1ZH2A 4BQQA 1DO8A 4Q4AB 5DM60 2OCLA 4A8PA 3PFKA 3KTDA 4TTIA 4XCQA 2P3LA 4BE7B 4YLYA 2JFBA 1GTMA 3IHLA 3SS7X 4HAUA 2CJPA 2FFQA 1PEKE 5AVQA 1W52X 3C5EA 1R0ZA 3CEPB 4J7CA 1WOYA 1Y8AA 4N0EA 1ZMOA 3PFCA 1CCWA 4JVNA 3QXSA 2VJMB 3DDZX 3AHHA 3PWSA 1ZD2P 2VS1A 3LYLA 4R41A 1O6ZA 3M9WA 2HMUA 2NIPA 3DCYA 3NGMA 5HYVA 4JOCA 1PT7A 2QX4A 2PKWA 4Z49A 1WHSB 2H9IA 5DSXA 2XA1A 1M2WA 1BEEA 3QKIA 4YONB 3W2GA 2NP6A 2HSGA 2P6UA 3I61A 4I1PA 3VC2A 5CGQB 1U0EA 1Y81A 3WL6A 1UJ6A 1Y4SA 2GARA 1ESDA 3R7BA 1FXWF 3LX6A 3PQ2A 4FX5A 3ZW9A 2QQ0A 2KHZA 3VSDA 2WPNA 4I14A 4G4IA 3K9NA 4GMXA 4IQFA 3UQYS 1K0FA 1GSIA 1OTYA 1URPA 2C5HA 2LR0A 3IMGA 3O0DA 3TQTA 4EKNB 5HK9A 1CY8A 3KSAC 2ZJFA 3HJFA 2QIPA 5ALEA 4DMFA 2FE4A 5LP6A 1VJGA 3X2FA 2F1IA 5A0TA 2V7TA 3MN1A 4WCFC 1CWUA 1JIUA 3BHJA 3H5WA 4DSZA 2CJYA 3UICA 5AQ1A 3QY0A 1X1AA 2IL1A 4CN8A 2W11A 3W9UA 2CWWA 5MF6A 3OQHA 5EXPA 2CLIB 1EX6A 2XWPA 1TI7A 3U3RA 2YV5A 4Y2SA 3N0TA 4B1FA 5FDFA 3NAMA 2CMGA 1V11A 1UBMS 2Q1YA 2H2WA 2XNHA 2ZJZA 3PGJA 4HWOA 4KFRA 4D99A 2CWDA 5JANA 4LISA 2GN4A 3R5FA 1VB3A 3KZNA 4N6GA 5FUYA 5A5GA 1CJBA 1BHQ1 1M7HA 2YNMD 1UAYA 2ZSAA 3GFFA 4LJ6A 4N3AA 5EJIA 3W5DA 4PX5A 1V47A 5FIUA 5NLLA 4GBGA 5LYJA 4LE2A 3ZU3A 2OENG 3DBIA 1O9BA 4TTPA 4QDZA 1C7IA 2WYHA 2UZ1A 4F6CA 3UWPA 4B3CA 4D9JA 1W93A 2GH1A 1U8CB 1R6BX 1W88A 4JLVA 2BKAA 1P0QA 1SFRA 2DT8A 3UMCA 1CR0A 1KXZA 3QENA 5M5BA 1Q50A 3GO4A 3JQ8B 4E5MA 1Q14A 2ATCA 4GBMA 4FFSA 1EB9A 2WJZB 1WG8A 3PKZA 4WCFB 4YACA 5KUTA 4ZVQA 4N5LA 2OORC 1GL9B 1U7XA 3ZE6A 2ZRPA 2Z43A 4IDDA 5L3QA 2BDUA 1CF4A 5BMOA 3ZV6A 3LUAA 4J03A 2LP4Y 5CURA 3ET4A 4K7JA 2W6PA 3OQNA 5C34B 4M1EA 1ISMA 1L7PA 2XNSA 4ID9A 4C2TA 2RHOA 4FCTA 1UFQA 5FWXB 1RTKA 3SMVA 2GD0A 3IAS1 1MO4A 1WXGA 1RWWA 1FZTA 4OX9Y 5ER6A 1DCFA 3JYHA 1VGRA 4RQBA 3KEFA 5IJ9A 1KZ9A 3GGJA 5B1EA 2G7MC 3A7EA 4RL4A 3J7TA 1KFCB 1AHIA 4C6TA 3ZWYA 1JDVA 5K6RA 3C85A 1OOEA 3TSZA 2IZ7A 5I4IA 5E6SB 3W3ZB 1UM8A 2R8BA 3QEKA 3LKZA 1YB5A 2WZCA 4IG4A 4KQHA 4HWPA 1A4XA 4P7KA 2JAPA 2GPBA 1IN8A 1L4FA 4TM7A 1RWBA 1ORIA 4M4SA 1S2MA 1A4IA 2OV3A 3BWEA 1UWLA 4KXYA 3FAKA 3EMDA 2X7HA 3IT1A 3ORSA 3G7NA 1KPIA 3I73A 2AQIA 3RF6A 1YU9A 3DR5A 3ELBA 3HFJA 2B82A 4FYMA 4IILA 3TTSA 1N34B 1AZSC 4HB2A 4P7JA 4Q1BA 5KNDH 4D9CA 4KWHA 2QVZX 2BKVA 3TMYA 1S8OA 4NFLA 2GEUA 3BL8A 4B83A 3BIJA 3DFUA 4WPGA 1AUXA 2C9OA 1MEEA 3HADA 2DWQA 4M2LA 3V9PA 1U2EA 4QAQA 4B75A 5F3WB 4X54A 4KR7A 5F2KA 3TGPA 1VHJA 3R5XA 2D8AA 1K7YA 4OUKX 4W9RA 4W5RA 5PGMA 4QHYA 2X4GA 4ARIA 4DGSA 5D2CA 1T4CB 3UANA 5CPFA 4B2YA 3U48A 3EUFA 1NJ6A 1X8JA 3RAFC 1R1DA 4BBAA 1Z6YA 3AP2A 1AS3A 1I2AA 3MPUA 3KEGA 4PX9A 4HNQA 5A3SA 4G01B 5J4HA 2XUIA 1FBTA 4X97A 4Q9JA 4ZU3A 1U1FA 2F1KA 4D9GA 2ATVA 1HF3A 4KE8A 1ID1A 4OAOA 1TVEA 1Z36A 3AHFA 3SG0A 2G1PA 2RBGA 3CO0S 1BGWA 3FBTA 3HN2A 3PXDA 3CVYA 4DDWA 4KUEA 3MSCA 3NVKI 2WSYB 2XVAA 1ZMXA 4I8XA 5I6DA 2DFLA 4C30A 4ACBA 5EUCA 2WIAA 3A2NA 3AF1A 4GGOA 1K8ZB 1PDWA 2OLEA 2JC3A 4TYQA 5EE1A 4L6CA 5CFZA 5EHXA 3N2GA 4JI5B 5BWCA 2WY2D 2RGRA 2JLCA 2G9RA 2NZ8A 3NJRA 3P1JA 5JZ9A 2WR8A 1M0WA 5TIIA 4Q4HB 1U3FA 3ZU5A 4LBWA 1G5RA 1NJGA 1WUIS 1IUKA 3KR1A 4CL0A 3NHMA 4RYDA 1ACMA 3AU8A 2CYAA 3ZQ4A 4WBNA 4D1YA 3LWNA 3U60B 3M6AA 1WF3A 2Q9CA 4CCWA 5EWJA 1T3GA 1ODCA 4YLGA 2BTQB 4YRPA 1JWAB 1RNLA 3NKFA 3OX1A 5CDHA 2UUPA 3ZCUA 1AJEA 1YQUA 1H93A 2NZYA 1YS4A 4OSPA 3ASZA 3RU7A 4Q4LA 4ZVSA 2P4SA 3OTQA 4NCIA 1CEYA 1XEWX 4H1TA 2ZXUA 2GK7A 1E61A 2QNIA 2VRBA 2P4HX 3RD5A 3QX3A 4U8HA 1I7LA 1V8BA 5FFFA 1E3EA 5LD2C 2YWRA 1J8MF 3OMWA 1MDFA 1G7CA 5HQJA 3W05A 5I4CA 3BBLA 4LF4B 2XUQA 3OZRA 2VDWA 3OEWA 2IYUA 2QTBA 3SZMA 5BVGB 4BNXA 2A0YA 2CLDX 2ES4A 2ZQZA 4FE7A 2Q0SA 1ZHFA 1INLA 1U8FO 4BZZA 4RE6A 1N2GA 2PEYA 3C6ZA 5K6AC 4LOJA 5AI4A 2GJ8A 3LP5A 4N0DA 1ESZA 3R41A 2BGKA 1X7XA 3R7SA 4N47A 5CXUA 4DV7B 3JWEA 3IP6A 4TWBA 4RKWA 5IKMA 3SSNA 1QHGA 5TGZA 2G72A 5EE3A 1AS2A 1VKNA 3F78A 1EBBA 4RIFA 5IARA 3HGTA 4HPWA 4MVCA 4RHXA 5AJWA 5KYNA 4TGLA 4J3NA 1QIIA 4EL5A 4CLRA 2AMFA 1EBFA 3DEZA 2N75A 5TQVA 1OJLA 3PNYA 4FNAA 2X5OA 4NJEA 1YRHA 4ITUA 4ZV4A 3B2EA 1MZVA 1A5SB 3EG5A 4KYTA 4M22A 2EZ8A 2FPSA 5F7JA 2ZTVA 3L4BA 4A27A 1YRLA 5JJIA 2REQB 3UCEA 4OYYA 4ZA2A 4BVLA 5LD2B 1J07A 3OA0A 4G4SO 3IRUA 1MX3A 3FROA 4QBIA 2C4WA 1ZNXA 4ZOCA 1CR6A 2R60A 2IVZA 4FLFA 5G0VA 1Y34E 3SR4A 4BO8A 4YUVA 4ZJUA 3AO0B 3K35A 5MHTA 5C2JB 1CB7A 1N2CA 4KQCA 4Y8VA 2CVPA 3JAKA 2W48A 3UJNA 5MFPA 4WOCA 3SJCA 1HTWA 2CXTA 2G40A 3WMRA 1EUDA 1JR3D 1HYGA 5K20A 4Z3OA 1PE0A 3O3MB 3GA7A 4IMPA 1QZXA 2W2LD 4LHVA 1TAGA 3AETB 1AQJA 5FLXA 4YDQA 3C7KA 3R6DA 2A9PA 5FADA 5FKJA 1QMGA 2GQ0A 5J9FA 5DGCA 3K9QO 4AJ4A 1T1IA 3IKTA 4L50A 5DPMA 1D03A 3D9QX 3GDWA 3MK31 4FXOA 3KT6A 2B30A 3QKSA 5I7OA 1XKQA 5B1HA 4PTZA 3JSXA 3NJ8A 1XRLA 2FVYA 1XZGA 3ZUPA 3BWMA 1XTIA 1PG2A 1X9HA 3VU1A 3WLRA 4PNHA 4HBGA 4HO1X 5C9ZA 1C5KA 2NUAA 3JQ7B 4A2PA 4I55A 4RVHA 2DR2A 2OFXA 4CMIB 4YJ3A 1KSGA 2AJ8A 2XYPA 4HNGA 1NP6A 2ZIAA 1XZAA 5EQJB 2AVDA 2FEOA 3PDHA 3T5PA 2FN9A 3KB6A 1QHEA 2NAPA 5BR8B 1U6JA 1IAQA 1XHFA 1KIFA 3E70C 1TEXA 2CVHA 1IZ0A 1AMNA 1IN4A 4XWOA 2UYHA 3HA5A 4B4OA 1NN1A 1KU0A 3IBGA 4NS1A 2PCLA 1DQYA 4RADA 3KQPA 4IWYA 3VR6A 4UCFA 4LK2A 8GPBA 4DRXA 3IESA 2G07A 3D81A 1F5NA 1J2YA 5H4HA 3T9FA 2O0HA 4WKBA 5B6PA 1CQIB 1K75A 3TW0A 3NW9A 2JGDB 3AIIA 3LUKA 1UM9B 2JGIA 3OO1A 4I66A 3TXXA 5AW2A 1NVDA 4L5CA 2AJTA 5F52A 2N9UA 1B1AA 1VL0A 3I01A 1K66A 1OZAA 2C61A 4ER7A 2AN4A 1KMIY 4YP9A 3EH1A 3ZS8A 4F7DA 3ESZA 1EX7A 1V7CA 2EJBA 4WNIA 3K94A 2HO5A 5TNXA 3C43A 4N0QA 2XMQA 3QLEA 3A32A 3PX2A 3THXA 4M0MA 2E5WA 3ABIA 3NTOA 2GZ1A 1NL3A 2DFTA 1UZLA 1XX6A 1KYTA 2FQQA 5FBZA 3KETA 4Q66C 1T43A 3WI7A 1KJYA 1XF9A 4LJYA 1SBZA 3O31A 4EY7A 2C5LA 3RKUA 1JA1A 2AW5A 3BZUA 4CV0A 3FX2A 1P5HA 2BHLA 5CB8A 2BHTA 5HQTA 3G2LA 2G88A 1CNMA 1M74A 1I14A 1OYYA 2NQTA 3TF5A 2PGJA 4MGIR 4CKBA 1CUSA 1DIGA 3NT4A 4Q9KA 1LPMA 3TR6A 4EPXA 4Z86A 3QVMA 1PJZA 3ADOA 4G0YA 1L7NA 4JAVC 3PQ7A 1Q16A 2Z1NA 3RYHB 2AEEA 2O5EA 4AG3A 5HK8A 3S4YA 1DBVO 1Y42X 3BVPA 4QD3A 4ZVMA 4GI7A 1V1MB 4XX0B 3U4QB 1OWMA 4WN9B 4KR6A 1TECE 1XZHA 4I5DA 1W5BA 5CCEA 5AW4A 3X0DA 2V55B 1H0KA 4C2UA 4GP9A 1P31A 2BFEA 4FEYA 4B84A 1V5GA 1I4LD 4MWOA 3TZKA 1MKYA 2OXTA 4LOHA 1FTWA 3RS0A 3ZY4A 2XCRB 2HLDD 3OF2A 2D5AA 1IY9A 1LEHA 1JAXA 1D1QA 1SBYA 3OT5A 1A7JA 4R1MA 3TN7A 5C5EA 2AEFA 2A9VA 2IGTA 4JOQA 4JI6B 5HZKA 1NI5A 3GJSA 3QFRA 4RWEA 4TV8B 1Z5UA 1BDIA 1SKYB 1VE7A 3FMGA 5DTJA 1XWWA 3H17A 3IQFA 2WTUA 1KKUA 3NKVA 2I0FA 1Z16A 3K0AA 1P3Y1 2YQ5A 3WLKX 3ZDXB 4B82A 3DAYA 2G25A 1AXRA 2J0UB 4HAXA 4W8GA 3LWBA 3PHJA 1A9SA 2P2CA 4IMJB 4QPJC 3W6NA 5HKOA 5LUBA 2HYIC 1CDOA 3NXKA 3NBAA 3RS3A 4EJSC 4OFXA 3SBEA 4KQFA 1TA0A 1FFYA 2ZBQA 2N42A 3HUEA 4TTAA 2I6GA 4DCJA 3RYFB 2X5KO 4JDUA 1QYCA 2LKDA 3KUUA 3GXOA 1WSBA 2FLWA 3FTPA 2I2DA 5B36A 3AEQA 5C7YA 3LO5A 4WVFA 3WB9A 3C7TA 1J4AA 3AI1A 1RYMA 2GSWA 1X87A 2GCEA 5BSTA 3SYMA 3OJOA 5EKDA 3VV2A 1YR9A 4I0WB 2BMFA 3IT3A 2SHKA 2H7CA 3DHWC 4XVRA 4HVTA 1ZGJA 4ITRC 1RU3A 4JBIA 1O57A 4XWGA 3R0IA 4TWIA 5CG2A 1FFEA 1UP4A 1SUIA 2VXBA 3ESBA 3MWGA 1SKMA 3BE4A 3JZMA 1UBOS 2ZANA 5HZHA 1QO7A 3FYUA 3W2TA 2O5VA 1KAEA 5L3RA 3ZC3A 2BEWA 4C0WA 3V8EA 3FD8A 1JG4A 1L5VA 2ZSDA 4QUHA 4P31A 5KNDA 4TX1A 1UBHS 1E3WA 3OHPA 2VUHB 3EIOA 3FLAA 2J45A 2EATA 3A3PA 4Y7CA 4B8WA 2EBWA 1BGXT 2ORED 4DANA 3AW9A 1R5JA 4FLEA 1MV8A 4XEHA 3WL3A 3LX5A 4EJSB 3C8HA 3DPUA 4E5SA 1JU3A 2PZ8A 1FQJA 1I4TD 4J76A 1EFCA 2GEBA 3L7KA 2HRDA 1XXHB 4GSYA 3A10A 1SU4A 2XY4A 3PL1A 1BHSA 4V03A 4WWHA 2D2FA 3D4NA 1JQLB 1QANA 4FFWA 2M6LA 3GEEA 3LSTA 3K30A 2WSIA 1UZNA 4CEJA 1Z75A 2WAAA 4ZD6A 4BNTA 1SCIA 3JTMA 1G6KA 2PKQO 3EPLA 3VZRA 5EPOA 3O5AA 4GKVA 2C5SA 2RBKA 2A92A 3CUKA 4UBMA 3FTFA 4IRMA 4N6NA 4WECA 2QGNA 4PCUA 4PNZA 1KO8A 4OKIA 3RK1A 3QH4A 4N0PA 4Z3DA 2REOA 3HL4A 1JDPA 5JO0A 3NAQA 5FI3A 5FV4A 4NESA 1L7QA 3WGGA 1E1DA 4BVBA 4YJGA 3OOHA 3G2OA 1FP6A 3JQBC 3LFTA 4AZ3B 1OA1A 1SK9A 1Y1RA 2FR1A 3VPBA 2BISA 1O97C 2QAIA 1YJ5A 5DBFA 5A3VA 3SZ3A 2H1SA 5A03A 4HXYA 5J5CA 5EWLB 3R6TA 1VMIA 4OOEA 1W73A 2ZRMA 2HH9A 1FZQA 2HHHB 1EK6A 5FTNA 4OLBA 2IZ0A 1K92A 3BDAA 4EY5A 1A7UA 3OZ7A 3MGAA 3KHTA 3BC1A 2GJSA 2EBFX 5DI9A 3FJ1A 5EZQA 1ZW6A 3EEBA 4GICA 4HVCA 2AK2A 4OYRA 4Q15A 1UJ5A 1QYWA 2F2TA 1D8AA 2YYAA 3K9HA 4JJ7A 3ZWPA 4B6SA 1GO2A 1RJDA 3ETEA 1NLFA 1P3JA 4Z7NB 3AY3A 1O0SA 3P20A 1BJTA 2HT6A 3DZGA 4J0JA 1YUMA 3DLAA 1EDOA 4Z9FA 3SN6A 5CA0F 4A26A 3PA6A 3L7OA 4HF7A 5K8UA 1A9XA 1SKAA 1CERA 2CMHA 3DAOA 3E22B 1CNEA 4AP5A 1N1MA 3QBDA 5JD6A 3AMVA 2R8RA 3AUFA 3MT0A 1V5FA 5F4BA 4CM1A 1QLJA 3PF8A 1G8KA 4OUDA 3C3AA 3PQDA 4D26A 3L01A 1G4UR 2X7XA 3N58A 4NJMB 5SZIA 5F9FA 1HM5A 1A2BA 1Z6ZA 1SHUX 1ZESA 3HBFA 4XM1A 1Z29A 3COZA 1NSFA 1R9NA 4BKQA 5DULA 3RJ5A 2GZHA 3AHJA 3I3OA 1VLQA 2ECPA 2WJWA 3T9DA 3FDZA 2X0KA 4EFMA 4QJ3A 3U37A 3D4PA 3IBCA 5HBRA 3IILA 4RGYA 2Z6UA 3WGNA 3L8ZA 5FPTA 3UH1A 5FTJA 3OAAA 5ALLA 3UJDA 3K9FC 1DT5A 4WBXC 3E9MA 2P4EA 5KCZA 1IM8A 2GF0A 1NUQA 1DG3A 2GD1O 4LTMA 5IJAA 2RHLA 5JNVA 2ZKIA 6NULA 1LF0A 3P45A 4OP1A 4KFSA 2GTIA 2P8JA 1M1ZA 5DM1A 4DIBA 2NO0A 3OM0A 1DMRA 3PXBA 4Z4EA 1YQEA 1E2GA 1IQPA 1ZQ9A 3IAM6 3QG5A 3DS8A 4JSRA 1ADGA 4XH9B 4J2OA 4ZANA 4JLNA 1FXWA 1HYHA 2PJRA 1OILA 4RMJA 2HTEA 3TMKA 2X0NA 3L6OO 4UHHA 1KXJA 2AHRA 2ERYA 4QJIA 2ZYWX 3H5RA 3T54A 5H7XA 4JHLA 3RM3A 1XCLA 3RQIA 4B31A 1FX0A 3FYHA 4MQMA 2B1RA 4KXVA 2X1LA 1E9BA 4RMIA 1ZYUA 4LRXA 4RVCA 4WW0A 1EM6A 3ZEAA 1EWKA 1Z0AA 3FWYA 3E53A 3K70C 1YTLA 2JGJA 3OLCX 3AVOA 3VAYA 5B4UA 1ZXXA 2HJVA 2NXNA 3CRVA 1SB8A 4MICA 4QARA 2ZLBA 1JAZA 3IR7A 5ANRB 4DZZA 5K9ZA 4IEFB 4TTQA 5CNIA 1P29A 2ATXA 4U3JA 1MHTA 5JQGA 4HB3A 1ZK3A 1VPWA 4GE0A 1CY4A 3RUIA 3KYBA 1WOMA 4DPKA 1P7CA 4RF3A 5FLEX 2RH5A 9ATCA 1BS2A 2HJSA 5A04A 3IJPA 4E1AA 5E2BA 3VO2A 1EDEA 2WQ7A 2VNKA 1RKQA 4KYIB 3BQMB 4S1PA 4MV3A 5T67A 1N6NA 3UAWA 3PF9A 5T4FA 3VYRB 3K9BA 4BVAA 4I46A 5A9RA 1HOTA 3D02A 1GU0A 3IAHA 4Q1CA 1P33A 4NDAA 2OHGA 3ILYA 5H16A 3ACCA 4N39A 3SICE 1HZJA 1L4MA 3KE8A 1QTQA 2X8JA 3HPRA 2C0QA 1LDMA 3EGVA 2N1MA 4Y6RA 1YNOA 3VPAA 1XVIA 3TOVA 4II3A 2V6MA 1WABA 5ISMA 1S2NA 1SC3A 1HRDA 1NMZA 2ZWIA 2GAAA 3KTFA 5EAIA 4XYEA 1VA5A 2ZUFA 5KU1A 1S4MA 2GETA 2OBMA 5HZMA 4G24A 1XD9A 1X15A 1N2OA 3G2JA 3I1YA 2Q0XA 4IIJA 4TLDA 4JI0B 3K70B 3A26A 4TLLB 1CJVC 1E2IA 5DHQA 4UW9A 4HV4A 1USGA 5GQSA 3RSOA 1QRSA 2J67A 3FGZA 1SC1A 2GI4A 2E82A 2BM1A 2OZPA 4ZI3A 2XCQA 2A1UA 3H2GA 4ESEA 2DKFA 2BELA 3IUYA 1J39A 4AC9A 3PFBA 2A5LA 2P5UA 2WKWA 4OQLA 1LH0A 2V7UA 2R1ZA 1A9RA 3KEMA 2NU9A 2P9ZA 4MVJI 1IUOA 4UAJA 4FIDA 2JD2A 3S2EA 1L3BA 2F9FA 1EU1A 2XOXA 1G2QA 1MJGA 4FX2A 4IX9A 2CD9A 5BSGA 3HXQA 2F55A 1WXFA 1FRZA 5J2TB 4FEAA 4DEXA 3T8YA 3L8GA 1E4EB 2VO1A 1OX4A 1LU9A 4BUCA 4JYZA 1P18A 4JJKA 2VPPA 1FFSA 3I9V1 1DT3A 4MS1A 1N8SA 3C74A 5JEDA 4G0XA 2R00A 3AYXB 4LGCA 4X84A 3VGJA 1MG5A 2WYOA 1D7OA 1ZEMA 1SB9A 1QFMA 3BM5A 1ZI9A 3JWIA 4HWGA 1X42A 4OL9A 1K7EB 1G3QA 1YD7A 1SZDA 2DBZA 2ZTHA 4O4HB 4LDNA 4I9NA 5TF4A 3ZZTA 4P4UA 2GGSA 4R3UC 2I22A 3H8WA 3SFVA 2KLBA 3VAZA 3A6JA 1FYDA 3STHA 2FPLA 3NWJA 2PWAA 2H0RA 4WFJA 3IDFA 5DYWA 3UJ9A 1E66A 1GUDA 2G8LA 4PGHA 1Q0LA 1AUVA 4Q1AA 4Q03A 2YN4A 4O1HA 1RQGA 4JEHA 4DPMA 2NYVA 3WAJA 3EVBA 3WLLA 1ZN9A 3BMXA 1GRVA 2BBSA 2JFHA 1DVRA 5AKEA 4BFCA 2OSVA 2AHOA 4JK3A 1T3TA 4N0MA 4NH0A 4QJ5A 3VO1A 1M2VB 1Y6JA 4X94A 2C7OA 1HMYA 3E35A 3ONWA 5DGTA 3WDMA 4YT2A 4RLHA 1N3YA 2O8EB 3QVXA 3UXMA 1YI0A 1R00A 1GAEO 2BIFA 3QE2A 4NR0A 2A8YA 1H4SA 2NXJA 4W5WA 3T7EA 1UBLS 2ZQYA 1IG3A 4IEEA 3ZDYB 2G71A 3V4RA 3CEJA 2P9HA 1X80A 1VHDA 1OCEA 4PN3A 1PSWA 1L6IA 4GU5A 2ANBA 2GF2A 1GKIA 3KR9A 2IS1A 2DSTA 2UU9B 3QELA 4YWJA 2XVXA 3PEVA 1OLSA 1V8OA 2KBFA 1W2HA 3ZE8A 4ARAA 5HUQA 3EULA 4YUYA 1DKNA 3KNZA 4ZKDA 2XRMA 4M38A 4KN9S 1FUKA 3EZGA 3EOAI 3G9TA 2I67A 2W6JA 2D1QA 2ST1A 3ESAA 3JQ6A 5AM0A 1ZSYA 3JAWB 5DNEA 1U7ZA 2A7QA 3A0UA 1T9KA 2CHFA 4D8WA 2RI0A 4H18A 4NCJA 5HKKA 1G17A 1HK7A 1TGYA 2VEDA 3ANNA 1HXHA 4G65A 2H57A 1U8AA 3M3PA 4Y1RA 1L8LA 3JALA 2HL6A 3TW8A 1HA3A 2FU5C 2Q3BA 2BRUC 4JLWA 2AR7A 3EEFA 3U31A 3R76A 1EESA 4XEUA 4MV1A 4LYYA 2KYRA 3WA6A 1TEHA 2OFPA 3EPPA 2W6IA 1WU8A 3ELUA 1VG1A 1Y3IA 1X2EA 3EZXA 2IUFA 1GPUA 3CNNA 5I01A 3TZ6A 3GMSA 4QTYA 1OI3A 1QRDA 2O2HA 3ONFA 2DFPA 1NBME 2I2WA 1N5IA 7ADHA 2BF7A 3K70D 1W76A 3ABRB 4O2BA 4QU5A 4UAGA 5KOJB 5L3SB 2HQSA 3RC8A 2LV8A 4UNNA 5JEEA 4OKSA 5GMOA 2Z57A 1A69A 3KXLA 5DGXA 3RC1A 4E5YA 4A0SA 3FOEC 3JWHA 4OFWA 1YJQA 1AK1A 3JATB 3N6RA 2CXOA 1NF2A 3HS3A 4FU0A 4HGRA 4C7XA 1B26A 4YRJA 4IYRA 1G20E 4URFA 2VDRB 1QNLA 4BNDB 1TUIA 4UEOA 5ALQA 4LAFA 3I6IA 3PNSA 1CEQA 3M6UA 3W8NA 1ZW1A 2OQIA 3TX2A 5TPWB 1LLFA 3DXFA 4HDNA 4V0RA 3PA8A 1H42A 3HCEA 1EK0A 1M34E 1MT3A 4JFAA 3WK7A 1KYVA 1P4HA 4ZC1A 1QVRA 1FIUA 3N6XA 1NRXA 1YS9A 1IXYA 3SF8B 3ZH2A 3S7ZA 3CLTC 3O6VA 4HLDA 4GLLA 1NVWQ 4Z1OA 1EGVB 3EIWA 2H8KA 3THOA 3T3MB 1TM3E 4IXMA 1Z28A 4J9VA 3SZUA 3VDQA 1H2RS 2A9QA 3K6SA 1SOWA 3CR3C 5LNK6 4XWAA 4W99A 3TRKA 1B4DA 2JRLA 1Z6XA 4QUDA 4FOLA 4LBVA 4BQPA 4R68A 2A35A 4WGFA 3MJVA 1KRXA 2O0KA 3JARB 1WUYA 3KLOA 3NHBA 3OD5A 4JA0A 3LA6A 1LDNA 1Z0FA 2VRCD 2FCAA 1VYTA 4FEGA 4JMPA 4Q37A 4EQ6A 1PF7E