3QBTA

Crystal structure of ocrl1 540-678 in complex with rab8a:gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
total genus 59
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qbtA00
3KJGA 2WV9A 1YRBA 4OI0A 3GLGE 2JGNA 3M0EA 2Y8EA 3B2EA 4TTRA 4A15A 2YVUA 2ZAOA 4DXAA 4AKHA 3RABA 4Q7MB 1TADA 4QFMA 5FL7A 3LAWA 3BXZA 1F6BA 4CF7A 3WP1B 3KQLA 2KBEA 3PIRA 4YXWA 3T34A 4OQMA 4C30A 4AYWA 1O3YA 1QG2A 5A4JA 4NPHA 1JAIA 4NCKA 1UKEA 1P7CA 1P9NA 5FBWB 3DL0A 2ZRIA 4D4JA 1P73A 2ZRAA 5J5CA 2QGZA 5HKKD 4TYQA 4JLAA 2EW1A 4MKFA 2XOKD 1VCMA 4PC1A 1Z0KA 2QP3A 2OSBA 5JS8A 2F7SA 2GZHA 4TSFD 4Z1MA 1Z08A 1TMKA 1ZNXA 4JMPA 3QKUA 5CK5A 4C2TA 5A0FA 4FD2A 1W4CA 2E87A 4NZYA 3W3ZB 3QKRA 1UF9A 1U98A 1XJ0A 1WBBA 1M7HA 5BN4A 2PJRA 1E2IA 1XD8A 2BMDA 3AGQA 4C0QC 4P33A 3IPYA 4Q03A 3KFVA 2GJSA 4EDHA 1DPFA 1ZM3A 1N0UA 3AGPA 1JR3A 1DAEA 4ARZA 2C77A 5JHHB 1KK1A 3A8TA 1AKYA 2OXCA 3C5HA 3N70A 2HCBA 1TU4A 1FQJA 3HR7A 4US0R 3TBKA 4L9SA 1GZSA 2FA9A 4FCWA 1XMJA 2VHTA 2RHDA 3KKQA 3SC3A 3AKCA 1E9SA 4F92B 4ACAA 3RS5A 4C9BA 1U94A 2IYVA 1COWD 3LXXA 3PUXA 3T1VA 4AWXA 1KY3A 5GADl 3AF0A 3LVRE 5BW8A 2BKEA 2C9CA 4YC7A 4BRWA 2V6JA 2B8TA 3TMKA 2ZRCA 4OI4A 4XVUA 2IYUA 3IO5A 3BFVA 4MKGA 1ELOA 2B8WA 5FR1A 4MDFA 1EGAA 4YMWA 1NVWQ 3I8XA 4OK3A 4C0JA 1QVRA 4EPXA 2X2EA 4KVGA 4XSGA 4LBZA 3I32A 4HB0A 3CPHA 1WMSA 2W2TA 1XD9A 3QY0A 2OILA 3BERA 1X8JA 1JBKA 1SZPA 3Q9LA 1YZNA 1L4UA 2XSZD 4IEEA 4Q66C 3CF6R 6Q21A 1E9RA 3TQCA 1WA5A 3AEZA 4PHHA 1OXXK 1CJUC 1G3RA 1BIFA 2GXSA 3WMEA 3ZVRA 2QE7D 4B2PA 1W5TA 1JI0A 5CB6A 1NKTA 5FBQB 2V6IA 2NO0A 1FP6A 2D3WA 5FR2A 1W47A 4PO1A 1E2GA 1SVSA 1P75A 5GVSA 4M1SA 3BGWA 2ZRDA 3T12A 3PCRB 4IVQA 3QBTA 5EUMA 2ZTSA 3MJRA 3D8BA 1TL7C 3TAHA 1G6OA 4TMKA 1M8PA 5DYGA 4B2LA 3OEED 3EIHA 1UM8A 1X86B 4O3MA 1NMZA 2QAGA 2KB0A 1XEFA 2IBMA 3GJ3A 3IUYA 1KI3A 2QPAA 4RFVA 3FWYA 2DFLA 2BV3A 4BPBA 1U0LA 3TUZC 2XZOA 2RGXA 1I2MA 1OXUA 2H92A 5FOVA 1MABB 1PV4A 1N6RA 1KJWA 4QJ4A 1PJRA 3VAAA 4P0TA 4QNMA 3TRFA 5JSZA 1ZINA 4RFSA 4A2QA 3QVVA 4M1YA 4KV9A 3RWMB 4DWJA 3C16C 2QBYB 1G19A 3SZRA 3TUIC 4CEHB 1N25A 3CNOA 3TR0A 2GEVA 1NMXA 1OXTA 2BMJA 3WRYC 4MRPA 1NG1A 4QM6A 1FFHA 4TMWA 1GRRA 3PV0A 3ZVMA 3T1TA 3AKEA 3FHTA 4V0MA 3ADKA 4HUTA 1ZC3A 3GLFA 2C96A 3FKSD 4G1UC 4RD6A 2PLRA 4BZQA 3H0KA 1W5SA 4KBFA 2R2AA 4Y0AA 4P31A 4UXIA 3CNNA 3HR8A 3ZZ0A 1D9ZA 4Q48A 2XOKA 4L8GA 5EP3A 2DY1A 2QY9A 1OJLA 2FJUA 4NCHA 4EPVA 3FGNA 4TSFA 1RIFA 2GK7A 2ZR7A 4DRZA 5KDDA 2RB4A 3DOEA 4EPTA 4US2R 3J81k 2ZI6A 1ZD1A 1NL3A 3HU3A 4RZ3A 3Q8XB 3KJHA 4TQ9A 4LHVA 3CZQA 1US8A 3BB3A 2XXAA 3EPLA 3AP3A 2EFDB 4DSNA 2F3TA 1AZSC 3ZDQA 1K5GA 4M9QA 1FP7A 1XF9A 2QQ0A 2G9NA 3ADBA 3C8UA 2AFHE 1LNZA 5EE9A 3ZQ6A 1RC8A 2OT3B 2QT1A 3BD9A 1E9AA 4D0GA 4ZI2A 1RKBA 1VCNA 3WNCA 3GLGB 4NYJR 1SVOA 1S2MA 1JAHA 2O8EA 4ZO4A 3VR1A 1R5BA 2VL7A 3UWOA 4PHGA 2WSMA 2NGRA 2YHSA 3QPWA 3ZIAA 2JJ1D 4TZ0A 3U7FB 1UJ2A 4OQNA 1E6CA 1LS1A 1IJFA 4MYHA 4Z8XA 2FGJA 3QOFA 3GLHE 4B6EA 2CVHA 3AVTA 3I73A 3W90A 2VP0A 1KDRA 4LJ4A 4LK2A 4M9XA 1COWA 1E9FA 3THYB 2CK3A 4MKHA 1RYHA 4WAUA 2WPDA 4FMCF 3PEUA 4LYFA 4PQRA 2V9PA 2H57A 3WMGA 4DEXA 4PFSA 4AKEA 4QGGA 1J7KA 4IDOA 1DS6A 2FE4A 1YR9A 4WBSA 3G5UA 3V9PA 2AN9A 3V00A 2QPOA 2OAP1 5FH9A 5EE5B 4XD7D 1KI6A 2VEDA 1KAGA 1XZPA 4UJ3A 3C4JA 1Z2CA 3LW8A 4A8JB 3KL4A 1II8B 4C7OA 5HCIA 1T9HA 5CIWA 1W2HA 3ND9A 4D6PA 2HJVA 2WKQA 4KXFB 4JLJA 1CR1A 3D31A 5DI3A 5F9FA 4NCIA 2MMGA 3F0TA 4OL0A 1J8MF 5KPDA 1E2NA 3I61A 3RLFA 3FOZA 3CRRA 3FPAA 1GP2A 4BZXA 4IKEA 4XSHA 1X1RA 1YZTA 4RCZA 4GZMA 4JLOA 521PA 4GSYA 1KAOA 2OV2A 1K6MA 2X2FA 2H7VA 1G3MA 1FZQA 2QROA 5LDDC 1W46A 1TF5A 1E0SA 3DVLA 2GILA 3I1FA 1CJMA 1QZXA 1XPOA 1ZM2A 1HYQA 2QORA 1NBMA 4URZR 4EIWA 4PX9A 1OV4A 3FYHA 1VCOA 4FMBB 1Z63A 3L82B 3JZMA 1VG1A 1ZIOA 4CT4B 3KTAB 4JBXA 3I4LA 4TYWA 5J4LA 2YJTD 1F5NA 1Z29A 5H8WA 2W0MA 3CX6A 2ZI3A 5E3HA 2EWVA 2DFTA 3OEEA 1ZNZA 1A2KC 4GPTA 2IUUA 4DLVA 1Q57A 2QU8A 2ZSAA 5F9HA 2O8CA 5EXTA 1W7AA 1MR3F 2C78A 2GAAA 2P65A 2GJ9A 4ABYA 3VX3A 3HPQA 2P5SA 4Q1EA 4LRWA 2J7KA 1Z83A 2BKUA 1P4SA 1SVWA 4LJ9A 4AG6A 1G8FA 4ZI3A 2HYIC 3TVTA 1VCIA 4LX0A 5KOYA 4LJ5A 4X8OA 3KQNA 1TQ2A 4O25A 4QXAA 4G01B 2C03A 4AD8A 4JYCA 1CR4A 4D82A 3U6BA 2VP4A 3L43A 2IS4A 4IRUB 4Q4HB 3ZS8A 2OCAA 1W0JA 1E4YA 2OBNA 3O47A 1A2BA 4ZCIA 4V03A 4CEIA 2DWOA 4D26A 5JJLA 1GIAA 1MH1A 1KY2A 3ZLJA 1WE2A 2IYWA 3LDAA 4HATA 3AUXA 4DDTA 1R0WA 3BH6A 4H1UA 1IN5A 4R9UC 4WA7A 2TMKA 1DBSA 2FV8A 4JIMA 2W58A 4BECA 4FMDF 3C7KA 1TF7A 1CJKC 4ASUD 5L3SA 3PR1A 4DEYA 4U7DA 4O2LA 4EPRA 5JZVA 4S2EA 5UKDA 1KI2A 1ZNWA 3OAAD 1LW7A 4NYMR 2HF8A 3M1IA 3EC1A 4A8JC 1FTNA 4TMTA 3N2EA 3UANA 4KJZA 1S9HA 3M6AA 3P4YA 4PANA 5CDFE 2GEUA 1IN6A 1ZVQA 2FWRA 2VP6A 3OEHA 4PAMA 5EUQB 4EFMA 4A2WA 3GJ0A 4OK5A 2XX3A 2XZLA 1G5TA 2F9MA 1FX0A 3IDQA 2NQ2C 2ZI5A 1A1VA 1GOTA 3EZ9A 4HSEA 5AJXA 4NP6A 1LF0A 3T35A 4JKIA 1S1MA 2O8DB 1UBEA 3HWSA 5IDVA 3NVAA 3V4FA 4QHSA 5FPYA 2C95A 4DJTA 5JLJA 1DAMA 1U8AA 4BFZA 1ZUNB 3RRMA 3QKSB 1HEIA 3LD9A 2OZEA 2E1RA 1XXHA 1E2PA 2XITA 4PSVA 3ZGXA 4ZKDA 1TQ4A 2ZU6A 1PUIA 3ASZA 3BFXA 4XWOA 5H1YA 4EFNA 4PC6A 1NSTA 3EWSA 4LSGA 3CNLA 3THXA 4OQLA 2FFQA 4HLDA 1IXSB 1E9EA 3U7GA 3SHWA 1TQDA 2QN6A 1KOFA 1CP2A 2ZRPA 3MLEA 1CS4C 4RKFA 3LH5A 1YE8A 2OCPA 3CPEA 4ZIRA 4KITB 2GK6A 5KTYA 2JEOA 3R20A 4NHOA 4XD7A 3RANA 5CYOA 5SZIA 3E2IA 4UQOA 3EIQA 1UPTA 2SHKA 4IOLA 1M7GA 4PZZA 1T8TA 2OBLA 3AVYA 4PPFA 1GWNA 1C1YA 2FG5A 3D7MA 3DM9B 2IK8A 2Z83A 4JVMA 3TAUA 2J0UB 1PLLA 2C2HA 5L3QB 4JL5A 1M7BA 2QZ4A 4A6PA 1TEXA 1XU4A 5FBVB 3R9WA 1KK0A 1NN0A 4DSUA 2ZYVX 3H2YA 1AQYA 2CHGA 2IT1A 3K09A 1GUAA 5G53C 4E07A 2WWIA 2L0XA 3CH5A 1KI1A 3PUVA 3AF2A 4I1SA 4URYR 4GRAA 2VQSA 3NDPA 1VPLA 3GEIA 4PZLA 1BO6A 3KKMA 3T5DA 4BLSA 4HI0E 4P4UA 2FFAA 3R8FA 1KI7A 2V3CC 2CE2X 3PEYA 3EC2A 3GLHB 4RZUA 1XPUA 2IWHA 1ODFA 1I4LD 2YYZA 4FI3C 4HDOB 5IK2A 5JJKA 1T6NA 2P6UA 1D8TA 2NO1A 1KIMA 2CE7A 2VP5A 2WAXA 2RMKA 2WWYA 1UKVY 2Q0HA 1Z6XA 3LY5A 3QQ5A 3K8YA 2OFOA 4GNKA 2OESA 3AKDA 2Q21A 4DUGD 1JEDA 2BBWA 3PITA 4F7WA 3QXSA 2ZR0A 2WHXA 4CYMA 4JKYA 1JECA 3GCGA 3U44A 3FE2A 3RC8A 1KDOA 2N46A 3LBIA 1VG9B 3EA0A 2ZRLA 2W6ID 2BCGY 4AC9A 1E2MA 1GTVA 2XTNA 3A4MA 3QF4B 2AHOA 2W2XA 1JEEA 3EIEA 3N5CA 1WRBA 2BJVA 1IAQA 1QG4A 3RDPA 3ETLA 3GFOA 2YOHA 3VKWA 2J45A 2I4IA 2IS2A 4R7ZA 1NLZA 4U00A 4TN1A 2IS1A 3LBNA 2ZUCA 2QTVB 1J70A 4EQ6A 2VP9A 1BMFD 1PZNA 5C1BA 3DMDA 4R71A 4TMZA 2YC4C 4FMCB 1OFTA 3I5XA 2GEDA 1GL7A 3BJIC 3EASA 3QKTA 1QHXA 2ZREA 1FUUA 4DCTA 2D4HA 1SXJA 4Q21A 1XB2A 2JLRA 2ZRJA 3PQCA 4DDWA 2WWWA 3OAAA 3C41J 1MOZA 1RRPA 4M1MA 2NTYC 2RH5A 3X1DA 3Q85A 3DKVA 2VHJA 3WXMA 3GLIA 3QNUA 2HCJB 4US1R 4KLZA 3CR7A 2RCNA 1E2HA 2WIAA 4Q47A 2CCKA 3EWAA 1ZRHA 4KLNA 2PT5A 4Q9HA 4B47A 4BLPA 4QOSA 5AJZA 5EE0A 2J87A 4ZKEA 1L7VC 4DKXA 4M4SA 2O8FA 4YLGA 5G3ZA 1GG2A 2IEYA 2OHFA 3IQWA 5KUTA 4UXJA 1T5IA 1CJVC 2WOJA 1FL9A 1PVOA 2DBYA 3KDSE 4CRWB 3K0CA 3LX5A 3S1AB 4M1OA 5E7JA 1E79D 2ZI9A 3K1JA 3KKNA 1QHHB 3NIBA 4URWR 3W9YA 5B57C 3I3SR 3K70B 4X8HA 1KYIA 1N6NA 3B82A 4TMXA 5EXPA 2VSOA 2GWHA 2X8AA 2EYQA 3F5FA 4M1TA 4MA4A 3W6PA 2BOVA 4LJ7A 3EZ2A 4LC0A 1DG1G 3KQHA 3I8SA 1W49A 4GOKA 1OH8A 4DT1A 1K5DA 3GQBA 3UMFA 1OT3A 4GT1A 4QBHA 3GP8A 1W1WA 4DBLC 3B1WA 2JLQA 4GL2A 4DLRA 3P26A 1NN3A 2QRNA 2HF9A 4F4JA 2ATXA 3B85A 5HZHA 5L8VA 3SYNA 3LNCA 5JS7A 1G7RA 3U7HB 3NC0C 2XAUA 4GOJA 1OLOA 1KZ7B 4I4LA 2WJVA 2IYYA 4IVPA 3RYTC 4B76A 2QG6A 1YQTA 3LVQE 2WOOA 3IEUA 3OE7D 4IXNA 3EG5A 3MWYW 1SQ5A 4LV8B 5DGXA 4LCBA 3A1TA 2J5XA 2ZJYA 4EJSB 5C2JB 4TWZA 1DAIA 2ODEA 3QG5A 2OLJA 2Z43A 4AKGA 3H84A 1E9DA 4XVRA 4UNSA 4X8MA 4LV5B 1OYWA 1Z5ZA 1KSHA 4QJ3A 5KSZA 1G20E 2ZYTX 1KSGA 1HQCA 2GJ8A 4HZUA 4U02A 4HEJA 3H86A 4N3NA 2RKOA 3LWNA 2XZPA 1N0VC 3THOA 3U60B 2BM0A 2QT0A 4A6XA 1ZAKA 1MKYA 1RPZA 1N6IA 5AUQA 1G5PA 1XTKA 4RD1A 1XNJA 1E2QA 4Q18A 5A5GA 2ZI7A 4PPQA 2A5FA 3K70D 4HUQA 1YZLA 2EWWA 3CUEF 5DISB 1R5NA 4MRNA 4DUGA 1NI3A 2V7QD 4AI6A 4UNQA 2C9OA 3T5GA 1XEXA 3IHLA 2EFGA 2XNDA 4YMSA 2HLDD 3AQ4A 4WZBE 1HE8B 2R44A 4G5RA 1S0UA 2O0JA 1GRNA 2WJGA 2QQEA 4B33A 4A0FA 5DO9A 2CNWA 2WVJA 4OQFA 4NDZA 1SHZA 4L4UA 4G5QA 4MUAA 4MRRA 3VR2A 3WBJA 5AK0A 3WHLA 1UEIA 3MWJA 3N2IA 1OYYA 4B2IA 2PL3A 4W5WA 1E94E 5AJYA 5GJVC 1KHTA 3K0FA 2OM2A 3SFZA 4NTZA 4HLQB 2WWHA 1BMFA 1J8YF 1G8GA 1KO8A 3B1ZA 3IGFA 4HAVA 2P3SA 5JI2E 1EXMA 4MYTA 4Q4JB 3GMTA 2PCJA 2KSQA 4XIGS 5J40A 3R7WB 4C0BA 4EUNA 3BIFA 1NVVR 2PMKA 1E1QD 4V02A 3K0AB 3FFBA 1E9BA 1GVNB 1OIWA 1H8ED 2AFIE 4L16A 3CW2A 5KSPA 4B48A 2HXYA 1BKDR 1R8SA 2XJ9A 2C5LA 4KSCA 2QEQA 3A58B 4LY6A 1N6OA 1BS1A 3ND8A 3T61A 2BHRA 2IYTA 5KPJA 1DVRA 4QHYA 2QPTA 3RSLA 1UBFA 3CF0A 3MFYA 2G88A 3K9GA 1FTSA 1Z6GA 4Q7KA 2O8BB 4E5UA 1KDPA 5JBQA 1S3SA 4Q01A 1I2DA 3M4YA 3VFDA 2VSXA 3B9QA 5F3WB 5DHFA 2ZUBA 2GCOB 2A3RA 2EFEB 2ZS8A 3QF7A 3VKHA 1Z8FA 1OE0A 4EJSC 1Q1QA 3IHWA 4QGHA 5KSOA 1J90A 5BWMA 5EP4A 4NU0A 1AIPA 1P2VA 1F2UB 1LS6A 4LV6A 3UG7A 3SR0A 1DG3A 1RJ9A 1FMJA 3WY9A 1OF1A 4Q9LA 1SVLA 1W0KD 5FI0B 3CKLA 1RYFA 4ZDIA 4PPGA 4TT3D 1E79A 3VR6A 4A2PA 3LLMA 2VO1A 5TB5A 3ADDA 2P6RA 2PEYA 1CKEA 2FF7A 2A2ZA 3KJEA 4MYUA 4B3CA 2IYQA 2KJQA 3AF3A 2ZETA 1S96A 1K8RA 4YDHB 1TAGA 1UBGA 4NBSA 3THWA 4RD2A 3B6EA 4BFVA 1DAFA 5CLQA 1E1RD 3U5ZB 4FWIB 1XP8A 3DZ8A 3QVUA 2BMFA 4PAOA 1T0JB 2ONKA 1Q3HA 2DWPA 4DLZA 2R62A 2GCPA 5JEEA 2VBCA 2VTKA 3LQRA 2B7CA 1ZC4A 1B0UA 1LB1B 3Q3JB 2D7CA 1Q1ZA 4IJMA 4B75A 1XD2B 1XWIA 3U2QA 4RKEA 1CBUA 2FGKA 2ZVQX 1NJFA 1X8LA 4RZ2A 2RGCA 4A92A 4IDHA 3P27A 1FQKA 2ZJ2A 1YVDA 1E2JA 2IHBA 2QGNA 3OE7A 3NHAA 4D81A 1CEEA 1G5RA 3G0HA 1EX7A 2BBOA 4Q4AB 3B1VA 2VPPA 3UATA 2YOGA 4YMTA 1A4RA 4A4DA 3CO5A 1XZQA 3OF5A 4V0KA 1QRAA 1FW6A 3ICQB 4B3GA 2ASEA 2G6BA 4B32A 1F3OA 1IN7A 5J4KA 2ZE5A 4W5HA 3FMPB 4Z51A 2KE5A 4QBIA 4D80A 5CJPA 5B64A 2KWIA 2BIFA 5HKKA 2Q9CA 1R7RA 5HPYB 2J7PD 2FFBA 4UNRA 2PCLA 3RWOA 1G4AE 1P3JA 2CVFA 3FFAA 3CR8A 2WJHA 1XEWX 4UNNA 3AVPA 5FOWA 2PLFA 1N6PA 3ZD7A 1JR6A 4HB2A 2Q9AA 4OKSA 4QGAA 3AF4A 1MRSA 3TW4A 2OE2A 4P4SA 4KU4A 2GJKA 1QDEA 2V7QA 3RS7A 2ZXUA 2IS6A 3L8YA 2F43A 2GXUA 1DELA 1ZM7A 3CIOA 5FOUA 4WW0A 4OJQA 5K8TA 4II7A 1R0XA 2F3RA 2WBLC 2VIIA 4C0AC 4IOMA 4B3DA 4EPYA 3VKGA 2BBTA 2HDNB 3B1YA 4IW3B 5EZ5A 4E09A 1U9IC 1OKKD 1S8FA 3TSWA 1E2FA 2VA8A 4KSBA 3SS8A 4WOPA 3BFKA 2FZLA 4CEJA 1MO5A 2JJ2D 4C0LA 5G3YA 2ZS7A 1ZJ6A 1GNRA 3JVUA 2ODBA 4PQYA 3LW7A 3NG1A 1ZMXA 2OO7A 2ZJBA 3HYRA 4JLPA 3WYFA 1KK3A 3TNFA 3PVSA 1OW3B 2WICA 2RGNC 1KMHB 2C9YA 4OHZA 1KTVA 1WQ1R 2ERXA 2IYZA 1LF5A 1H8EA 3L0IB 3GPLA 4LOAA 4ACBA 1YZKA 3W8NA 4MQBA 5TXGA 4QL3A 4RCYA 2R6FA 5FTJA 4DSOA 3KXKA 3T15A 2A9KA 4F91B 2CMKA 2CCGA 3DM5A 3IO3A 2FNAA 1Q0UA 3FTQA 2F55A 5EJEA 3RS3A 4WZ6A 1ZM4A 4CVNA 1Q1EA 4KFSA 2ZROA 2DCUA 3FMOB 5FI1B 1YKSA 3KKOA 2V4ZA 3U3RA 4GMDA 2QM8A 3X1YA 4DB4A 4NE2A 1LFDB 2XSZA 4RD4A 4AURA 2JLXA 4Q9IA 1BYIA 3BE4A 4NYIQ 5K8IA 4V0OA 5DSZA 5F98A 2NMVA 1EFRD 3L0SA 2QE7A 3NBFA 2CJWB 2RHMA 2IYXA 1II9A 3BBPA 1UBCA 4PZYA 3A1WA 1R8QA 1Z2AA 2CHQA 1HA3A 3DHWC 4I1VA 4LUCA 2CLCX 4TLAA 4AYXA 2XB2A 1ZU4A 1VIAA 1ZCAA 1NVXQ 2I1VB 1P62B 1KKLA 1KNXA 1R5OA 2P67A 5JWOA 3B5JA 5IT5A 3VU9B 3OZXA 2YWHA 2PBRA 2ORWA 4TQAA 5D3MB 3DDCA 2PZEA 3B1XA 2YWFA 1M74A 4D4KA 3B7GA 1P61B 4FCTA 5DH9A 3OIUA 4G0NA 1E1RA 1XTIA 4DVGA 4EFLA 3CX7A 4F4CA 1T3HA 3F8TA 4FCVA 4J0QA 2AXNA 3FB4A 5B2ZA 4BEBA 4R2IA 5JEDA 2ZJOA 4NCJA 3RAPR 4BLTA 2GZAA 4BZPA 3D6TB 4F38A 4B6FA 4IEIA 2GDJA 1EFHA 4Z54A 2G83A 3MRSA 2AWNA 1D9XA 4C0HA 3NHBA 1W44A 2VSFA 1GL9B 3RNLA 3QJYA 2W00A 4M1WA 3GJ5A 5FUYA 3SQXA 1IONA 2IXFA 2NO6A 4N0EA 2V1XA 5DHAA 4OHWA 4FINA 1FNMA 2F1IA 1F2TB 4QBGB 5JCPA 1D2NA 4ZDJA 3MD0A 2G1KA 2WSSD 1AN0A 4OJKA 1G3IA 1OH7A 3A4NA 5DN6D 3ICEA 4M22A 4V0ME 4BLOA 4E22A 2QMHA 4L5BA 1KZGB 3PUWA 3GLFE 2QP9X 2QAJA 2ZAMA 1NRJB 3U7EB 1OH5A 2QTFA 3FKSA 1VG8A 3OHMA 4BFTA 5K8LA 1JB1A 4B74A 1G8PA 2Z4RA 5EP1A 4DDVA 1T3LA 2ZVPX 1P2TA 1XFAA 1XTSA 3KFXA 4ON9A 5AJVB 1U9IA 4Q9JA 3T06B 3CZPA 1YJ5A 2ZANA 5JMTA 2ZJZA 2VHQA 3DPUA 1EWRA 3FKQA 3QIAA 2ODWA 4HB3A 1XRJA 4Q5IA 2NZ8A 5AR1A 1FUKA 4IFBA 1T3SA 4HYYA 2WKRA 2VH5R 1G8YA 1U2RA 3BB1A 2RGNA 2W6JD 5JWHA 1DAHA 2WWFA 2P6NA 3SEAA 3KB1A 4F4IA 1Z06A 1G4UR 4LJ8A 4HAXA 1NLYA 1N6KA 4BE7B 1IY1A 1X6VA 4ERNA 1NP6A 1OKKA 3QXCA 2FPKA 3VTKA 1W36B 1JNYA 2JIZD 2ZJ8A 2YINC 4XOIA 2JJ1A 1Z07A 821PA 2H8KA 4LWZA 5E7MA 1N5IA 1MABA 2ZU0C 3AP1A 3IILA 3V4RA 1FPMA 3A6PC 3U3JA 4FWTA 1C4OA 1IXRC 1WXQA 1JQJC 1NIJA 1UDXA 2H17A 3U4QB 3DEFA 2J59A 3AVQA 1Z6AA 4PTLA 2E9SA 2AX4A 2G0NA 2IF0A 4W7SA 1OFHA 2QBYA 3GJ4A 3KKPA 1T0HB 3KXIA 2YZ2A 3CWZA 4WXPA 4CEHA 4Q00A 2IW3A 3BC1A 3JZAA 1KI8A 1YZQA 1A7JA 2LWIA 3OFND 4MDEA 4ZDWA 5E4FA 4XWKA 4JVSB 1IM2A 1OHHD 3QEOA 3CRW1 1VHLA 3QKRB 2AL7A 4PC3A 2VRWA 1QVAA 1NG9A 1E9CA 4NMMA 2AR7A 5LB4A 5K8UA 5SZHB 721PA 1Z0JA 1EFCA 5LPNA 1NMYA 2HV8A 3W3AA 3L0PA 5J47A 1X3SA 4JS0A 4B43A 4CZ2A 4W5JA 3LLUA 4ARZB 2XJ4A 2YC2C 1HT1E 3SJZA 1KK2A 2DPXA 3PUYA 1OB2A 4LI0A 2B7BA 3EZ7A 3KQKA 4B3FX 4Q4LA 3SI7A 1D2MA 3RRNA 1HT2E 1EFRA 2A5GA 1NY5A 3MCAA 3HU1A 1KJZA 2DHRA 1Q21A 1XTQA 5IHPA 1R6BX 3W6NA 4HDQB 3F3YA 1LV7A 1NBME 3CBQA 4BFYA 2ECKA 2QM7A 3IIMA 4JLNA 1N5KA 1BH2A 2PX0A 2ATVA 2J0VA 4A0RA 3GLGA 1GRQA 1S1CA 3LX8A 5TDHA 3QPVA 1G17A 1FMLA 2FFHA 3Q7QA 1UADA 2ZE7A 3WBKA 3MG9A 4KVAA 1WF3A 1FNNA 4YXWD 2JASA 1WBDA 2FSHA 1TX4B 4LC1A 3MUFA 3TQFA 1G3UA 4CDGA 1IQPA 2B6HA 4WXRA 1S3GA 2QTHA 1GITA 4JL8A 4JVLA 1UDWA 2R8RA 3THYA 2WWXA 1D2EA 1AZTA 4F93B 1EWQA 4CGZA 1YZUA 2XTMA 3ZYCA 1LY1A 1VIYA 5KNBA 2ZRNA 1PLJA 2FSFA 5CLLA 4D2IA 1F60A 3NDBB 3NBXX 1JXMA 1VYTA 4D25A 3RRYA 4Z1MD 4D0LB 4LHYA 4KI0A 2R6AA 3QPUA 4MGZR 1VG0B 3D3QA 4OHVA 2HT6A 3SJBA 3NC1C 5FBLB 2WJIA 1II8A 2ZPTX 4A8JA 1SKYE 5FUXA 1OFIA 3TR5A 4TLEA 4GOXA 5GJBA 1EX6A 1E2KA 1Z3IX 3CX8A 5IRCD 2WWGA 3A1SA 3CLVA 1X8KA 3VMFA 3ZH9B 4DDUA 5CB8A 3A37A 1XPRA 2IYRA 4B73A 2D74A 1VMAA 2IYSA 1OIXA 1E96A 4MGYR 3TKLA 2QNRA 3KZ1E 3MWLA 3TK1A 1XCMA 2ZYUX 1Y3AA 4KBGA 4ASUA 2HT1A 4GFDA 2B21A 1GKIA 2G3YA 3EPHA 2F9LA 5FUVA 1KSJA 1CJTC 1CRQA 3IBYA 2QAGB 4RJLA 3KUCA 3H1TA 4JLBA 1WP9A 1KJYA 2CLDX 4TLCA 4DZZA 3QBVA 1I4TD 2Q9BA 2O0HA 4B3BA 5BN3A 2YOFA 5FBRB 3K0EA 3UXMA 3OESA 4FN5A 3TE6A 3IKJA 2EYUA 4H9GA 3HPRA 5KU1A 3BH0A 3SHFA 5EE3A 3W6OA 1E2LA 3A36A 2WM9B 1GSIA 2BBSA 3KTAA 5JSZB 4RFSB 3CF2A 3TJZA 2W6JA 3WNDA 1SHKA 4S35A 5L3RA 2F1HA 3PJRA 4GP7A 1F48A 2X77A 4TYPA 2G77B 2CEAA 2QI9C 2ZUDA 2OLKA 4LPKA 1IXZA 1G3QA 1SVIA 4MKIA 221PA 3ZJYA 4C0SA 5KNDA 4A0HA 1E3MA 1I4DD 5JCZA 1E99A 1YR6A 1KGDA 3CRVA 3O8CA 2Q3MA 2LKDA 4RD3A 1C9KA 4Q1DA 2NIPA 3GLFB 1W4AA 4BFWA 5LD2B 3SE0A 4JZKA 4LBVA 1IY0A 1HTWA 1Y63A 3MWKA 4Q4HA 5AUOB 5FPHA 3X2SA 1ZYUA 2AKAB 1AS2A 4LYHA 4TLBA 2GVZC 1Z47A 3VNUA 1X1SA 1NJGA 3T1QA 1OH6A 2GF9A 1G7CA 1YHNA 4QJ5A 4QHTA 1VYVA 3B78A 1SVMA 1HY3A 1OHHA 2A7QA 2QL6A 1ZBDA 2K5UA 1US8B 2G0TA 2XXAB 1SULA 3QE0A 1U8YA 2XGJA 4YMVA 4HZIA 1P2UA 4OQXA 3K53A 1Z22A 2BCJQ 3AM1A 3PEWA 4G5SA 4AK9A 1V5WA 4IFEA 4C4PA 3VNVA 2FEOA 1ESMA 1NF3A 5HR5A 2LKCA 1S9DA 3U3MA 1MV5A 2F1JA 4MRVA 1OB5A 5TMPA 2WMNB 5DIFA 2O8EB 4ZCLA 1IN4A 3ZVNA 2R6DA 4WZAE 2D2EA 1HUQA 5C4GB 2REOA 1AA9A 4XWAA 3NEYA 4URVR 4GDFA 4AY2A 1Z0FA 2JAQA 4FMDB 1CIPA 4IOKA 4HLUC 5E95A 2G1JA 3L0OA 2ZSBA 4LJYA 3KXLA 2WIBA 2FSGA 3TSZA 2GXQA 5BYJA 3SN6A 3QI2A 2O8DA 2FPLA 4EKDA 1N5JA 1MO6A 4YQFA 2A30A 4TTPA 2QAGC 1MO3A 4D4MA 1KI6B 5JECA 3QKSA 3A1UA 1RVDA 2N1BA 4IVRA 2O0KA 4D0NA 1P9WA 5IF9A 1ETUA 4C7OB 1KDTA 4B34A 3KUDA 3VHXA 2P5TB 1HV8A 2AKYA 3ZS9A 1QHIA 3EW9A 1TTTA 5DI3B 3WP0A 1XMIA 2RGEA 2ONJA 4TL6A 2GAOA 1NNEA 2YWGA 2QMEA 4XVQA 1TPZA 3QSYA 4A1FA 4BUJA 3K0SA 1HE1C 1N0WA 2WJJA 4P4TA 2W6IA 4Q19A 4D4LA 1IJEA 1TUIA 1KO5A 2HYDA 3NH9A 4BFUA 3SJCA 3TW8B 2IUSA 1DARA 2EQBA 2XEXA 4M21A 2VF7A 3IEVA 1NN5A 2D62A 3K70C 1XEWY 2CCJA 1N2CE 5FL3A 3BH7A 3IQXA 4MUBA 4TL8A 4TYNA 2WTUA 5L3VA 2J0UA 1M6NA 4EPWA 3AF1A 4DLSA 2GESA 5J4VA 5L3QA 5LD2C 3MAAC 3U3OA 4TQUS 1XCPA 1O87A 4MRSA 1GILA 1DO0A 2ZEJA 4BRUA 3DO6A 5CK4A 1SXJE 4HDCA 3AV0B 4UJ5A 1JJ7A 3C14C 3BS4A 4AG5A 3ZIAD 5SZJA 2YWEA 1VECA 3WYGA 1RW4A 5CM9C 2O8CB 1E0KA 1QBKC 4DB2A 3RVBA 1GL6A 1NN1A 1L2TA 4RZXA 2CK3D 3GLHA 3GLIE 2WPDD 2ZYWX 2XTZA 5KO2A 4G3XA 1Q12A 2WZQA 3QG1A 2ZSFA 2JLWA 1N3BA 3CM0A 5EQTA 4ITRC 421PA 1J2JA 2W83A 3K9NA 5EE1A 1T91A 1KO1A 3E70C 1GM5A 4KHZA 1E0AA 2P0EA 2QA5A 3LRPA 1KSFX 3AVXA 4JLKA 4CW7A 4X8LA 3CRMA 3SOPA 4CEIB 2ZJAA 4HAZA 3VQTA 3CRQA 1SKYB 2IXGA 4K46A 3SYLA 1ZCBA 4NYJQ 1OIVA 1P6XA 3P1JA 5FTMA 1SKQA 4C2UA 2R6CA 2VHCA 4DCSA 4HAYA 4M9SA 3ZD6A 2GVDC 4B44A 4KFTA 3NBYC 3QENA 4WVFA 5KDLA 3X1XA 3IIKA 3ZQJA 1D6JA 3AUYA 2X19A 3QF4A 5L3SB 2FDCA 8OHMA 5HZKA 2UZ3A 3C5CA 3LBHA 2WAYA 1IHUA 2ZIAA 5FOSA 5FOTA 4LHWA 2FN4A 4RSGA 3GD7A 4BQSA 2OFXA 3WRXC 5KNCA 2BWJA 5B58C 5TV2A 3I72A 3ZZTA 4BLRA 1M34E 4ILEA 3RC3A 1L8QA 4ESVA 1NBMD 2NZJA 3GJ6A 4WIAA 3EA5A 1G7SA 4MGIR 4OHYA 5JJIA 4W9MC 5LBIA 1FX0B 5FFMA 3RS2A 3FVQA 4HLUA 2IL1A 1Q3TA 2BEJA 2CHVA 2ZRMA 4RY2A 2VHUA 4JSYA 1KMQA 4KODA 3VX4A 2J41A 2V1UA 5TY0A 4V0NA 2CXXA 2HEIA 2VLIA 4GZLA 4NONA 4U5XA 2J9RA 5D3QA 1AK2A 1XXHB 3SBDA 2CLSA 2GETA 4HAUA 2JLVA 3EAQA 4AIIA 2FMXA 3O8BA 1ZD9A 3QXXA 4B71A 4UKDA 3THXB 2H16A 2BDTA 1G291 5DI9A 5AJWA 4V0LA 2FH5B 1G41A 1W0JD 4IXMA 3UMRA 1UAAA 4JSTA 3E5HA 2JDID 3NKVA 1TF2A 1YRAA 4ZIRB 2ZRFA 3GEHA 3TH5A 4YDSA 1DTSA 2NPIA 4LJAA 3S1AA 2JLZA 2F1RA 1N6LA 2REXB 5CIQA 1JALA 1G18A 4IHQA 1QHHA 2V54A 2D2FA 2DYKA 2ANBA 1XX6A 3RHFA 1AS3A 3IPXA 1D5CA 3UMSA 2IUTA 1G21E 3TSOA 4AYTA 3H4MA 5FPSA 4PR0A 2Z0MA 2HLDA 2H18A 3HDTA 5DNYB 3CONA 3MGCA 3MJHA 5EZ6B 2VYFA 3ZZUA 1PUJA 5H68A 4DLYA 4DLXA 5JRZA 2Z5FA 1JR3E 4PSAA 5AUPB 4Q1CA 3AP2A 2ZQ5A 4KCGA 4DHEA 4XTRA 2A5JA 2P2LA 2PT7A 3G82C 4LYAA 2BM1A 5JI3E 4TL9A 4POAA 4JT4A 1CTQA 2AWOA 3ECCA 3X1ZA 3GEEA 1KNQA 3OEHD 2CL7X 3B13B 5CDFA 2ZSDA 2I1QA 3BRWD 2OXRA 2MMCA 3EX7C 4MITA 3QEJA 2REBA 4RD0A 3UG6A 3AVUA 1AS0A 1ZUHA 1G6HA 4KAXA 4KFUA 4TYYA 1CR0A 4BEJA 1JPJA 2I3BA 2A5YB 3GFPA 1CU1A 2Q3HA 4PO9A 5AWFC 4FXPA 3BK7A 3JVVA 3AVVA 1DEKA 1G16A 4UXHA 4IOJA 1E1QA 1EFTA 1EG7A 3BB4A 3TUJC 2C04A 2F6RA 2ZITA 1DAGA 3DZDA 3MSXA 3Q72A 1E0JA 1CULC 1JXOA 4QGFA 5DE3A 1OXSC 4EJSA 3LV8A 1KI9A 1ZU5A 4IDQA 1JQLB 3W34A 2NPFA 2AD1A 3VR3A 5FPKA 4PXAA 4XH9B 4NYMQ 5LB2A 1CXZA 2IEZA 4FIDA 4L9WA 1T8UA 2YNMA 2RGGA 1NSFA 2FX3A 4EAQA 3U44B 2CL0X 2YV5A 4QNRA 4JL6A 3BAFA 5FTKA 4URXR 4H1VA 4B3XA 2RGDA 3Q5DA 3HJNA 1NIPA 2ZE6A 2RGAA 2OBMA 5CM8B 3SU8A 4MH0R 3ASYA 4LPSA 5E7IA 3EZ6A 2R9VA 3GJ8A 2UKDA 2R6GA 4JVNA 3CB4A 4M8NE 4M2LA 3PFIA 2IC5A 2GZDA 2IA5A 5SZKB 3SFVA 1W2GA 4JLVA 4KO8A 4EQ6B 4RVCA 1W0KA 3REFA 5KHOC 1U0HC 3OIYA 3FHOA 2JA1A 4TT3A 3CWQA 2N42A 4I81A 5JWRA 1RRGA 1E98A 1JJVA 3NWJA 3UWKA 2PZFA 3BORA 1GKYA 1ZW6A 1SXJB 1ZD8A 4LGMA 5HE8A 1WDTA 1NLFA 3PXGA 1Z6TA 4OYHA 2J0SA 2ZRKA 4C0KA 2D06A 4Q1BA 3UIEA 4Q4JA 5IK2D 1QHSA 5C46F 3R7WA 1UFQA 5KDOA 3GLIB 2DB3A 3REGA 2ODNA 2PH1A 3K09C 1EESA 3K0AA 3W5JA 1A5TA 5M04A 4A36A 1NY6A 2OEPA 2EFCB 2OG2A 2Q6TA 2QSYA 2BC9A 2WJYA 2O8FB 3EXAA 3IBGA 4Q7JB 4OI2A 1MT0A 1JPNA 4AKIA 1B23P 3NTUA 1R0ZA 2RGBA 1XMVA 4K8OA 5FTNA 4KFRA 5H70A 3DKPA 1W4BA 1R2QA 1RZ3A 2GF0A 1U8ZA 2IWRA 1E69A 4DIDA 2QP4A 1OSNA 4JBWA 1VDZA 3WNBA 1YR7A 1WCV1 1EK0A 2J3EA 4DLWA 2O8BA 2FEMA 4DIEA 4P32A 4TL7A 5HE9A 4JJZA 4QM7A 621PA 2Z4SA 4R2HA 1BYUA 2FZ4A 3WYAA 2GCOA 4DCNA 1G7TA 1A82A 4XTCS 2ZS9A 2OAQ1 3FMFA 4UNPA 4PHTA 1E32A 4DT1B 3FDIA 1ZP6A 4DLTA 3Q5EA 1KO7A 3VHLB 1F2UA 2EVWX 2VF8A 1U99A 2J7PA 2JDIA 5GJCA 2UVQA 2PMDA 2ZI4A 1IOZA 1CF4A 4PHFA 4TMVA 4Q9KA 2FU5C 1M2OB 4NL4H 2QMOA 3WMFA 3GFTA 1AM4D 3GJ7A 2NO9A 4R98A 1BOFA 3LQQA 1CLUA 3KB2A 1M1YE 4KYUA 4Z8YA 5JRJA 2IX3A 1OFUX 3R9XA 121PA 3EZFA 1AKEA 2OFWA 3UKDA 4QKQA 1SXJD 3P20A 3PEVA 4ZDKA 1CR2A 1LTQA 2GNOA 1SGWA 3PG5A 4DCUA 5FUWA 1HH4A 2A5DA 2ERYA 2QENA 3CPJB 3RS4A 3AVOA 1N5LA 4YMUA 1RRCA 4PO8A 4LBYA 1ZM9A 4P3YA 3SQWA 2CBZA 5BQ5A 4E03A 5C18A 1IBRA 2O52A 3B8HA 1TUEA 5B30A 4I99A 1VKJA 2JJ2A 2QRZA 2ZM5A 4M9ZA 2JATA 1DADA 2BEKA 1YU9A 1QHYA 1SVKA 1ZIPA 1XD2A 1TU3A 2H5EA 4KYIB 4DLUA 1ZUIA 4GMXA 4M0LA 4M53A 4NYIR 2ZRGA 4I1OA 3UK6A 2ZRHA 2MSCB 1SXJC 1Z28A 3P32A 4HZUB 1IN8A 5EXXA 1IY2A 1L4YA 2V8OA 2O5VA 4PSKA 5F2EA 1KI4A 3RS0A 2GKSA 4Y0VA 4FW9A 2OUKA 4OI1A 1VHTA 1HURA 2XNSA 2B92A 4HB4A 4Q4AA 3AVWA 5J4YA 2DR3A 1ANKA 1KKMA 2GA8A 3UPUA 4ZCMA 1HQYE 4HUQB 1W48A 2CDNA 2AK2A 3KX2A 1G64A 2AK3A 2X1VA 3B9PA 5ANRB 3X1WA 4Q02A 1DO2A 1XEXB 4HLCA 1TEVA 4PPNA 2ZSEA 4OK6A 1YZGA 4HAWA 2JLSA 2IXEA 4Q1FA 2AD5A 4BASA 1YR8A 1ONBA 1NVUQ 3ONWA 2J46A 1S4QA 4ESHA 3FHCB 3U6KA 1V43A 3KQUA 1W4RA 2J1LA 1GFIA 3K0CC 3I62A 2GCNA 4LHZA 4DSTA 1VYUA 4A82A 3K0FB 1E2EA 4URUR 3SBEA 3LXRA 4PQFA 4BFSA 4PAQA 3WHKA 1WB9A 2D7DA 2EFHB 1H8HD 4LYJA 1OXVA 4NKRA 3R8CA 2KI5A 1P60A 3KJIA 5JFGA 4CT5A 3AKYA 1Z6YA 3E1SA 1Z0DA 1R4AA 2C8VA 1RRFA 2YKGA 1GNQA 3DMNA 3HP1A 4JJKA 1II0A 1E2DA 1T4GA 1RFLA 4MGKR 3C15C 1GAJA 4LHXA 3MMPA 3CH4B 3QXHA 5FL7D 1W36D 4TZ6A 2GBLC 3BOSA 2DFNA 1DOAA 3EPKA 3SNHA 5P21A 3Q7PA 3TIFA 4G5GA 5GJWC 2BMEA 2W2VA 2JLYA 2PEZA 4M1KA 2HUPA 5EXSA 1KMHA 4K81B 2W0SA 3SDZA 4ZV4A 3TGPA 4O0MA 4YONB 3ADCA 3IIJA 2ORIA 4NCNA 4C3ZA 1ESNA 4LZZA 3HU2A 3U61B 4JLMA 1Q1BA 5BYKA 1VTKA 4G5OA 2QMUA 1G9XA 4Q1AA 2RAPA 2IHYA 1T5LA 3B60A 3PENA 1W36C 1QHNA 2OCYC 5KYKA 1GNPA 1FOEB 1RJ9B 1XCGB 2PX3A 4IDNA 5FOXA 3EPJA 2C98A 3U3KA 1E4VA 2R65A 2XNDD 5TVKA 5G41A 2WSSA 3OIVA 5DLQC 4IDPA 1AQUA 4O2RA 4OBEA 5DN6A 3SYKA 1TQ6A 1JR3D 2HJGA 2CNWD 3P4XA 1LVGA 1TNDA 3RRZA 2GHIA 5JHGB 3RSOA 3NXSA 3TVDA 3THWB 3HYTA 1H65A 2EU8A 4OHXA 3ZVLA 5CITA 3O8RA 4ZPXA 2GJAA 4GI7A 5HTKA 2CJWA 1G8HA 5GVRA 1N6HA 4JYBA 5FPTA 1DAKA 2Z6VA 1ZNYA 2ZRBA 4NH0A 5ELXA 4DCVA 1XJCA 3EARA 2GXAA 3L2OB 1UEJA 2IF2A 5CYPA 2A78A 5HCNA 1Q22A 4GP6A 2Q3FA 4JBYA 3SJAA 5G40A 5FTLA 4L15A 1Q44A 2NG1A 4QC2A 4PC7A 1XMSA 3VU9A 1QF9A 5D3MA 1U0JA 1MRNA 2BJWA 4QRHA 1UKZA 3GJXC 2NOAA 2V55B 1GDDA 1RE0A 2AXPA 2QSZA 4LBWA 2PZGA 3LFUA 4BFXA 1P9RA 1XJQA 4MYCA 1XXHE 1AJEA 3LA6A 2FPMA 3R9IA 3AH8A 2JJ8A 4LDJA 1GKUB 3A4LA 2JIZA 2C99A 1UKYA 4DC9A 1MO4A 2PJZA 3BWDD 1XBTA 5BXQC 5BN5A 4BLQA 1Z0IA 4N0DA 3A1VA 3T1OA 3TLXA 2ANCA 4LJ6A 4N1AA 1XDBA 5TARA 1NKSA 1EFUA 5CJ2A 2OCBA 5C4MA 5J4HA 3W8RA 2ZR9A 1G1MA 2WKPA 2MSEB 1NVVQ 2CL6X 2MSDB 4A9AA 2FOLA 3VR4A 4TLDA 3NBZC 1F2TA 1OPXA 1P5ZB 2IYLD 3K9LA 3OIWA 1XTRA 3OFNA 4CIDA 3L8ZA 3AB3A 2KBFA 4BGDA 1CRPA 1KO4A 2GRJA 2NO7A 2FSIA 2WMOB 2ORVA 4BWYA 5AUNB 2HXSA 4GBMA 4P4SB 3O8DA 1J99A 1DE0A 1Q20A 2F43B 3PUZA 1Z0AA 1R0YA 4PC2A 2VP2A 1P72A 1U81A 3QUSA 1PLKA 4XJXA 4Q7LA 3LO5A 2J0QA 1R10A 3FMIA 2XB4A 2ZE8A 2ZJ5A 2JLUA 2BVNA 2H1LA 2UZIR 2JCSA 1AGPA 1QHGA 4CEJB 4B35A 3I5YA 2GBLA 1AGRA 5KSYA 1U90A 4A0GA 4QG7A 3I92A 3NH6A 2DFKB 4TTQA 3VR5A 2GTPA 3QXJA 4QBFA 1P2SA 3DOFA 2DWQA 4I1UA 4JT2A 1H8HA 5EP2A 2QUZA 3W5IA 1XTJA 3NEJA 3U4QA 4JLDA 3K9HA 2LCFA 5DYIA
chains in the Genus database with same CATH superfamily
2WUEA 2WV9A 3N59A 1YRBA 2YDXA 3GLGE 1PTJA 2JGNA 3FOWA 4D8TA 1XYVA 4PQEA 4AZTA 7ABPA 3E2MA 3O8LA 3OLYA 4AFNA 1KBQA 2WD7B 4A15A 1LLDA 3ZCPA 2AT1A 1TT5B 2ZAOA 3HUEA 3T4UA 3T5AA 5CA0A 5FL7A 1KWKA 1F6BA 3DVAB 4CF7A 3KQLA 4J3FA 3DF9A 2WU4A 2RKWA 3MINB 4AX4A 3BBLA 4AYWA 1Q0HA 2XVYA 2J3HA 4MW5A 5A4JA 5C5EA 3PB3A 5KAMA 2X7HA 2V74B 1ACLA 3D4PA 4NCKA 1Q11A 1UKEA 2D0DA 3W0LB 2FPIA 4D4JA 1GQ2A 1P73A 3TL3A 4HX5A 1EJ0A 4WY8A 2V59A 3NWOA 4C06A 4P86A 3HY4A 4Y1GA 2QP3A 1ZXLA 2FVXA 5C8XA 3HWX1 2JAXA 5FX2A 2HLNA 4LGYA 3QK7A 4QSHA 1T35A 1U63A 3H1GA 4JMPA 3UXHA 2JFYA 5WRFA 5KIAA 4NZYA 3W3ZB 2Z2KA 5IMSA 4Y2TA 2GRUA 4MR9B 3ETHA 5BMVF 4TKMA 2PJRA 4BUZA 1QWOA 1E2IA 2JI6A 2IBSA 3MHPA 4H60A 4B4KA 4Q03A 4YCMA 2GJSA 1H2BA 1E66A 1NRIA 1SD5A 3KJQA 2II6A 4X6UA 5B1HA 5U1PA 1DPFA 4HQNA 1N0UA 1HSZA 4YJGB 4C5CA 3NWBA 4UAJA 5DMXA 1AKYA 4BN4A 3B20A 1AUOA 5KTRA 2R5WA 2XVMA 4PXSA 3PD0A 4RTLA 1QR2A 5IJ0A 2A33A 1WW8A 2VJOA 2AYXA 5AICA 3TINA 1YD7A 3TBKA 4IYJA 1YUBA 4FCWA 3UNXA 4F56A 4ZCPA 2IY7A 4DM3A 3G5MA 5HGJA 2VJQA 3BD8A 3RKSA 1JKJB 3KV1A 3AKCA 1E9SA 4BATA 1M9NA 3BMCA 3L3BA 5IBQA 3ESXA 1KMMA 1YJXA 1KDVA 4E5YA 3E1GA 1F8UA 3O8OB 2BGMA 2G25A 2WW8A 4E5SA 4JOBA 5JAPA 4NZPA 1U94A 4AWXA 3QWFA 4GAEA 1KMNA 2XW6A 1KY3A 4K5QA 3AF0A 2FPXA 3NB0A 2HHJA 4BRWA 2V6JA 4NJMB 3OBIA 3GJZA 1ODLA 1CEXA 2R1TA 1KH2A 1UBMS 3IO5A 3BFVA 1NBOA 3I6ZA 5MHTA 1O97C 4IRMA 4MDFA 1EGAA 1VPVA 3EUFA 4NECA 5IFKA 2I8CA 3II6X 2O06A 3I8XA 2R8XA 1WV0A 4JNCA 2QJOA 3PPYA 4YALA 1JTFA 1QGOA 3DO5A 1JIUA 1NFQA 4LBZA 3HO8A 5IKEA 4FE3A 5BSWA 5CW1A 1JHOA 3IBCA 3PX2A 3BERA 3PQ6A 4EDFA 3Q9LA 3EGXA 5JE8A 3BMNA 1V25A 1Z18A 2XSZD 5ALLA 4Q66C 4KYVA 4NU6A 1HYEA 5A5DA 2VZ8A 1TZBA 3H04A 1OXXK 5ESWA 1FDUA 1W30A 4YUZA 3ZC3A 5C3MA 5L40A 1ARZA 2GXSA 3AMVA 3P0RA 1YK1A 4IDFA 4J94A 4QICA 5ECDA 1TZJA 3C8HA 2HWYA 4TTAA 1CY6A 3T9EA 3TZQA 1JI0A 2E49A 1NKTA 4HKTA 2I62A 5CB6A 1J2UA 1LLCA 2PKQO 2ZOSA 3RUFA 5FUMA 4E32A 4V1CA 4TZKA 1H3EA 1O95A 3BE5A 3PUIA 2WHEA 3AESA 2O07A 4E4YA 2X6QA 5KC9A 4KO3S 1THZA 3NHKA 2AN5A 3BXPA 2FSVC 3X1JA 5HSGA 1J22A 1GZHB 2C07A 2O5RA 2BGWA 5I7EA 3R5HA 1HDGO 1JWAB 1P9LA 3EGWA 4IFIA 4IVQA 4FONA 4CWAA 2ZTSA 3PA6A 4H27A 1ZJZA 2ZXFA 3RAFC 3OZIA 1G9TA 1V11A 4HS4A 4OKNA 5YASA 3OWXA 4BZWA 1UWKA 2JFQA 1SA0B 2Z2ZA 4CQLA 1D3AA 3OEED 2CUNA 1EAYA 3L8GA 3UWPA 1XKTA 3UJPA 1GUYA 4KX5A 4M0PA 4F4DA 2P9TA 2ST1A 2VSNA 2H4FA 5A04A 2IBMA 3ZUPA 5JQGA 2ADMA 1NBAA 2UDPA 4YO8A 1RR6A 2DFLA 3MTEA 4OJTA 1DKNA 1U0LA 3S0JA 2QVCA 2EP5A 1RCUA 3BSFA 4J0GA 2I0FA 3VU8A 1KJWA 2RIPA 1Y9AA 1NZJA 2XE6A 1XE3A 3I9JA 3VAAA 5FLXA 1BMTA 5LQKA 3KD2A 4GC5A 4OHOA 2UXCB 4GG1A 4RFSA 4C7MA 3OT1B 1PR2A 3QVVA 4M1YA 4KV9A 3H3FA 4DWJA 3ZUGA 3ZY4A 2X4IA 3OPMA 4WDRA 3R0IA 3PE4A 3K9BA 1XNQB 1W2WB 2E6UX 1H0KA 2RHLA 4IV5A 3OTQA 5CLJA 2QTLA 1RWPA 3TR0A 2IEBA 3F5SA 3E9RA 3WRYC 2ZDHA 2B6NA 3DL4A 4WJLA 4MRPA 1PF7E 4QM6A 1NNI1 3ZVMA 1KXZA 2REQA 3KDPA 2PMEA 4KN9S 1M0EA 2Q4DA 4HUTA 1GXSB 1ZC3A 4PG5A 3M1LA 1VHQA 2C96A 3FKSD 4G1UC 4J2HA 4K9NA 3H0KA 3PZBA 3DBIA 5E2IA 1TCVA 2C3MA 4C22A 3K05A 2OD2A 4ZZ2A 1MG5A 1ZQ9A 3DZGA 3HR8A 4YRJA 4AJ9A 4KO4S 4IX9A 4MQ5A 3IJEB 2Q2QA 1OJLA 4C4AA 4D98A 2FJUA 4X66B 4D9IA 3PHGA 1CUSA 3ABZA 4YP6A 2R7KA 4EPTA 4Z4GA 2ZI6A 3D4OA 1UM9A 2EEZA 3LRXA 1NVTA 3Q8XB 4RZ3A 3FNRA 4DNQA 2P27A 4TQ9A 1K8XB 1J1ZA 4D41A 2XXAA 3DT9A 4IIJB 5FT9A 4E2WA 3RFXA 1TJ5A 2F3TA 2APJA 3KHTA 4Q6WA 2O8NA 3RHZA 1NXQA 1MIOB 1N0HA 1GAQA 2BFCA 3C8UA 4HEQA 1LNZA 5EE9A 3MTGA 3T7RA 3Q2KA 1B8PA 1K92A 3X3HA 3ZQ6A 4YMHA 1AQ6A 1OJ7A 3C39A 1AOXA 1D2AA 1E9AA 1RQLA 3HJRA 2D8MA 3QWBA 3WNCA 1NVFA 3Q8MA 4I2NA 1Q1GA 1CK4A 3KJNA 4J29A 5IVPA 3UAWA 1P1BA 2I34A 3GJYA 3OHSX 4RXMA 4ZO4A 2OV1A 2VL7A 3CUSA 1Y8CA 4PHGA 4KN6A 2NGRA 3KSZO 3QPWA 5LA6F 2XR1A 4CU2A 4R1NA 4Q05A 3TX2A 2WA1A 1MEOA 3HZZA 4OQNA 1J9GA 1IJFA 4RU1A 1C9JA 4H4EA 4MB0A 5T3UA 1XZFA 2NZWA 3AVTA 3W90A 1IEXA 4M9XA 4UQPA 2AMYA 3WGQA 2CK3A 2VPWA 2WPDA 1NC1A 2JG3A 4PQRA 4BX8A 1OBFO 3I5UA 4PFSA 1SAYA 1J7KA 1X7HA 4FOTA 2IODA 2PANA 3V00A 1G5HA 2QPOA 2OAP1 3PQ4A 1I0IA 1PZEA 2GQ0A 3OQPA 4AU1A 4PYIA 4TPKA 5KTKA 2MINB 3KR2A 2XGOA 1O94C 4A8JB 3KL4A 1II8B 5EIOA 5TJ9A 4ZODA 1T9HA 3EQ8A 5CIWA 1IC6A 5LQRA 5LKAA 3AEQB 1QV7A 2HJVA 4KXFB 4BS9A 2GJ4A 4LYYA 4EG8A 3A3NA 3H6KA 2XD9A 1WG8A 4KQJA 3N7TA 4D9MA 1Z6PA 4QAJA 3ZV6A 1F0NA 2VA9A 3F0TA 3PDIB 4LOJA 4OL0A 1MZPA 1J8MF 5A9RA 1ZOIA 1E2NA 2JGRA 2V58A 3L84A 1AHHA 3EMBA 1A1SA 4R2WA 2R84A 3U9SA 1AF4A 1H2AS 1P0CA 5K3OA 3CRRA 1KDYA 1OVGA 5E9JA 3MJCA 4OBXA 1NOIA 2AJ8A 2J48A 1E5LA 4XSHA 5LCXA 4BZXA 4GGOA 1JEAA 3IXLA 2RJ3A 2E18A 4HH3C 3LHIA 4OU4A 5EXEA 3U0BA 5GMOA 4CKCA 3EVEA 3LYAA 1KAOA 3LPLA 2OV2A 3C3PA 4B82A 5BVGA 2X2FA 1TIBA 4TWBA 3L1VA 5J2TF 3RPEA 3VOAA 4DXDA 1S8OA 2Q3DA 4RK4A 4WESB 4UU1A 5AI4A 4GKBA 1GFZA 2NAFA 4O2AB 5LDDC 1XVAA 5D6NA 1E0SA 1AT1A 4KWCA 1I3LA 1JA0A 1R50A 4CV0A 3DC7A 1QTIA 2OQ2A 2NTEA 1HYQA 2QORA 1VFPA 3AR7A 4URZR 1YQEA 1K97A 3T7SA 3PTAA 4YLYA 4BGVA 4EA7A 1UPXA 2HTEA 3T5CA 4BO6A 5AESA 2V7PA 4FMBB 2KHZA 4AZ3B 3L82B 1OT5A 1Z4MA 3VZDA 5J4LA 3L8EA 1KARA 4D9HA 4EOGA 5B2EA 3CX6A 4JUDX 1RWOA 2JD2A 3BXGA 3OQBA 2DFTA 3OEEA 1ZNZA 1V4BA 1Q7EA 2P11A 3I2GA 4IG9A 1F7VA 1H2EA 4N18A 5BR8B 1DQZA 5M34A 2GAAA 3FZGA 5K0NA 3A11A 5B7PA 1KYZA 3OX1A 3DR3A 2GSDA 1P4SA 4ZI3A 4FJ0A 3ITDA 4UEJA 2XCSB 5KOYA 1R0BA 4JBHA 1W59A 4YRQA 3AJ8A 1S2OA 2GKGA 1ECJA 3FYUB 3OTHA 4JYCA 3GC6A 3JD0A 5T57A 1FFCA 3TAXA 4FMPA 4FB5A 4PVDA 3GFSA 1NR1A 3ZI0A 3AERA 3FJYA 2OCAA 4C6RA 4C6TA 1T2NA 3O47A 3CE6A 1GNVA 2H85A 2PBFA 3OZEA 3PPVA 1XQ9A 2JFOA 4H0NA 3R5JA 5D8DA 4K2AA 2YQ4A 4XRRA 5E3JA 2PQ0A 3HB5X 2DWOA 3A2MA 2F59A 4OV6B 2PIAA 4RCVA 3RJ9A 4E30A 4J0CA 1N2IA 5CLFA 1KY2A 5JJLA 4P4NA 2Z8XA 2EJBA 1IDN1 1A71A 2G8LA 4HATA 3JQ7B 4GRDA 3AUXA 1PDOA 4DDTA 1R0WA 3TX6A 2OKGA 3OUUA 4H1UA 4FTWA 4R9UC 2VJKA 1V4NA 5COQA 1DBSA 2FV8A 4OH7A 3N3AC 4K9QA 4FMDF 3VJMA 4MV5A 3W06A 3QPDA 2YJ5A 3P2IA 4O2LA 3KDAA 4RDCA 2C0PA 2O3UA 1KI2A 4BVFA 4UPEA 4CKCB 3SIPA 3HVJA 2HF8A 3E7FA 3EC1A 2HQSA 3BWBA 3M1IA 3ST7A 1QH8A 4A8JC 4KJZA 2H5LA 4LMPA 1V1MB 4Q1VA 5IJZA 1V8OA 1R9NA 3P4YA 1A97A 3DUWA 1JU3A 1WU8A 1ZVQA 5AKJA 2VP6A 3OEHA 4GF5A 5EUQB 1PW7A 2G5CA 1XZJA 1QRTA 2QX6A 2FTKE 3AY7A 2XZLA 4BQFA 2JFFA 1FX0A 3IDQA 3M83A 4HVAA 2LCQA 3F90A 1PWXA 1NI4A 1MIHA 4NP6A 3L8DA 4BAZA 3ADPA 2RE8A 3NBKA 4WY2A 2O8DB 3HWSA 5ECYA 1WKVA 3NVAA 3OWHA 5IDVA 3V4FA 4QHSA 3VJRA 4DJTA 2OXFA 4B81A 5JLJA 4DYDA 3GF4A 2A0FA 4PGHA 4TXMA 1U8AA 4UTZA 1J09A 4XDZA 2WVHA 1F51E 1Y4SA 3BULA 1IU9A 1DOHA 4PW0A 5TPWB 1HEIA 4B46A 4L50A 1AF7A 4I4TB 5JOQA 2E1RA 4QYWA 1XXHA 4E5NA 3DNMA 1RABA 3HCEA 3HGTA 1Z5WA 2N9UA 3FCAA 4RY8A 1S8AA 4J7XA 3S40A 1M6VA 2ZBVA 1VE3A 2A9VA 4XWOA 1J07A 5K03A 4EFNA 1U5BB 2DQKA 2Q1UA 2RC6A 1TIPA 3TTYA 3V8EA 1W6RA 3EWSA 2O2YA 1M8GA 2FFQA 1IXSB 1E9EA 1V95A 4YRTA 2HRCA 4MQ4A 4ZVPA 1KP3A 1X38A 1KOFA 1UFKA 2ZSJA 3A6EA 3DYBA 1WY5A 3FRHA 1ITZA 3K0HA 1CS4C 4G09A 4UVDA 5K3EA 1XRNA 1BCSB 1HFEL 1GNTA 1EUYA 2YIVX 1NV9A 3D8HA 3M6UA 4ZIRA 4KITB 3LL4A 1CVIA 3R20A 3Q6NA 4JP5A 5GOTA 4LG1A 3UUEA 3V8VA 2HA5A 3WLAA 2AEFA 2D5AA 2IEIA 3WFJA 3OURA 1UFVA 1YRLA 3IS3A 3OIGA 3EIQA 2ODPA 3F8SA 4O8CA 4CUZA 1M7GA 1A77A 1G63A 3AO0B 5LZ7A 3RSGA 4P4LA 3AVYA 5ESDA 3MN1A 5D7NA 1GWNA 3E8XA 1A9YA 2FP3A 3IOMA 2Z83A 4JVMA 3V5NA 3FYUC 3IJ5A 5HGXA 1E3EA 3IOCA 3PEFA 4U9HS 2EFJA 3NT5A 5DYYA 5B7QA 4JN6B 1NN0A 3EXHA 3DQPA 3L7LA 4DSUA 1AQYA 3HLKA 3NO4A 4XI9A 3TCNA 2D54A 3CH5A 2B4AA 4FZRA 4KAJA 1TK2A 4MIYA 4IRXA 2Z5VA 4EP1A 1Z2PX 2WU0A 3P9KA 3TLGB 2O9JA 2VZ9A 4PZLA 4YTEA 3JQAD 3TRDA 3PEEA 4QECA 5AVUA 4P4UA 1IOWA 4WZAA 1RWWA 2H1HA 3VAYA 3R7LA 1YS1X 5FDFA 4IDCA 2EKDA 4OHRA 1YQ9A 2YZ7A 5FYQA 2V3CC 4R3NA 3EC2A 1QFYA 4D5EA 4NIMA 1K7YA 1ZK3A 4FI3C 1I4LD 1QQTA 2W6ZA 1AHIA 1T6NA 3CBGA 3KYJB 1HM5A 3MELA 4WCFA 3WXBA 3PSHA 2CW5A 4MKRA 2QZZA 2GUWA 1R0KA 3D4BA 1NDHA 2EW2A 5EZYF 4M0EA 4AZSA 1VKNA 4M0UA 3ND5A 4EW3A 2ZIXA 1G6Q1 2OFOA 1CE8B 3AKDA 1ZUD1 3GFBA 3VDQA 3Q1KA 2CBGA 1H2RS 4NV3A 1L5LA 1G2PA 3PITA 4TKUA 1SOMA 1DHRA 2OZPA 2ODAA 5B3JC 2VOJA 1JECA 2X6RA 3EHDA 4JKYA 5AKLA 3ENQA 1JHZA 1BQ4A 1T9ZA 3LBIA 4DBVO 4PVCA 4TWJA 1RIIA 2ZRLA 1JAZA 4EITA 1GNLA 1GTVA 3A4MA 2QRLA 4RSRA 3QF4B 5LZ8A 4XGQA 1CEQA 4IIYA 2LCIA 1V96A 2V98A 1Y8RA 1JEEA 1Y5LA 5JD3A 1FVOA 2BJVA 4PLPA 1RAIA 2AGVA 3ETLA 2C7GA 4YREA 2I7XA 3VKWA 3D59A 1TZCA 4GYYA 2UU9B 3M9LA 4R7ZA 2IS2A 4U00A 3LBNA 2TSYB 3KWJA 2JH3A 3G7NA 5E1MA 3PFCA 3A31A 1BMFD 1PZNA 5EGSA 6NULA 3DMDA 1P18A 4TMZA 2X0EA 1OFTA 4MB6A 3FZQA 3PJGA 3VC2A 3W9BA 3PGJA 3I5XA 5KWSA 4MI6A 1SCQA 1SOUA 3GYGA 1L4NA 1PR1A 4RA9A 4ZCSA 1JZSA 2QLJA 1FUUA 3Q87B 4DCTA 4L7VA 1XCBA 5C7OO 4UHKA 3IUSA 2BAGA 1UMDA 1Z25A 4M98A 4P7GA 3MBOA 5FAXA 2AC2A 5TLSA 2OGSA 2WWWA 3JY6A 3EH2A 3LC7O 1G59A 2ZBRA 5IAEA 3GR6A 3QUAA 4R05A 3R6LA 4RV9A 1DLJA 2RH5A 3QOYA 3OPYI 3X1DA 3FCEA 4EELA 1M8FA 1PFQA 1HMPA 3LT4A 1O03A 4EB8A 5HUQA 1Z0ZA 1WEHA 1IMJA 2QD1A 3CLHA 3QNUA 2QZSA 3NUGA 4KLZA 4NICA 4Q47A 4Y18A 2DY0A 2P2GA 4WLUA 2OBXA 4B47A 4OU5A 2PT5A 4JT9A 1GPUA 1MJFA 4AL4A 5AJZA 4CM5A 1GTRA 4R8MA 3QVMA 1GGVA 4DKXA 1Y7TA 1H1TA 3GUYA 5HQTA 1L5ZA 1GG2A 1M33A 4ALLA 3IQWA 3ZY5A 1L6IA 1CJVC 5IC5A 1FL9A 3MGKA 3ZOKA 2P6OA 3OP4A 4JEMA 2EGUA 3KDSE 5ALTA 3T6KA 5KYYB 4UHFA 3Q98A 1PZFA 4ZVRA 3LX5A 1OWPA 1JKXA 3I0MA 4R5MA 5GZ6A 3G9UA 4YI5A 4G25A 3QYPA 3I9KA 1KYIA 4KXLA 3JWJA 5DEIA 3K70B 5EXPA 3ZW8A 5E9AA 4ZO9A 1XAIA 4AJ1A 2X8AA 1H6DA 4EGAA 4RTQA 1UC4B 1ZXBA 2BOVA 3H1FA 3IVCA 3LQKA 1NR7A 4LJ7A 4TTTS 1MJGA 2EDAA 5TIIA 5JAQA 2E5WA 4CHGA 3UTCA 3PGLA 4K6FA 2I66A 3FF1A 4DV0B 1V1RB 4OB7A 5E6RB 1K5DA 4ARUA 5CDHA 4QBHA 1ZHFA 1Z6ZA 1MJ5A 1W1WA 3OT5A 2BN4A 1VJCA 5AVYA 1X87A 4HNAA 5JNRA 3MHTA 2HF9A 3UAZA 4FN4A 1ZI6A 1QP4A 3GYBA 5DFAA 2Q49A 1M2NA 1R64A 1W35A 3Q0IA 4QTZA 5G0VA 3SYNA 5C5IA 4Q12A 1QLWA 3K2BA 3ETCA 1Q74A 4JEHA 1OLOA 1NV8A 1EE1A 4KGZA 1WBJB 1T0PA 3DDOA 2WJVA 3WGKA 2WTNA 5DVZA 2EKBA 1JWLA 5CB4A 2OOSA 4GXNA 4J16A 5L53A 3LVQE 2CMGA 1EGHA 3IEUA 3OE7D 3EG5A 3EWNA 3H83A 1SUPA 1VBKA 3QLVC 5T64A 3WYBA 5IBRA 3FR8A 3WDKA 3GVPA 3B3QA 3A1TA 1A0OA 1GQQA 3PDCA 2ARKA 4OJNA 5AI6A 4MO9A 2GO7A 4EJSB 1O0CA 1CQJB 1VL5A 1OWLA 1DAIA 2OLJA 3I23A 1AQLA 2ZBPA 4CF4A 3WB0A 1Y1SA 4MCIA 1I4EB 2PS9A 1Z5ZA 2P1DA 3PIDA 1H23A 1XMXA 4LV5B 3QUCA 3BWCA 4JC0A 4NEGA 5KSZA 4KO1S 1L8XA 2GJ8A 5BSEA 1EU1A 5U4XA 5AW4A 4L8FA 4U02A 1DCMA 4GBJA 4O4IB 3H86A 4N3NA 4Q3EA 2XVAA 4KP7A 3L18A 4X7BA 1MP0A 3ILXA 3P2MA 3WIEA 3ZHYA 3FX2A 4CCYB 2H7CA 2V7EA 4D7AA 2ETXA 4QDOA 1N6IA 1EPUA 1G5PA 1XTKA 2OQVA 1DTWA 1E2QA 5A5GA 1VXRA 1Z45A 2GOYA 2PG3A 1PEYA 2PSSA 4PPQA 2Y9PB 1C4XA 2ZZNA 4YAKA 3IELA 4Y1EA 4Z0PA 4JLWA 3N8KA 1KEVA 2RKBA 1NI3A 1SO8A 5DU2A 2C9OA 2JLBA 1LI7A 4Y1RB 2Y1GA 2XNDA 4WOJA 3UT6A 3H11B 3H2JA 3AQ4A 2YQ5A 2JVJA 1K6XA 1OTHA 3SY8A 4WOBA 2R44A 2GK3A 2NU7B 2O0JA 2OCGA 3DOCA 1RLTA 2TYSB 2WJGA 4RKWA 4A0FA 2ZPUA 1LDGA 3LUKA 3OBBA 2HK8A 4OQFA 5FNVA 1SHZA 4L4UA 5BR7A 4BL5A 4MUAA 1ZD5A 2NQTA 4W1RA 2QYTA 3WHLA 2XLBA 4JLSA 2LGJA 3N2IA 1BQEA 3K0KA 3LTEA 3K0FA 2P0AA 3SFZA 4NTZA 2IU0A 4HLQB 1JIJA 1T26A 2XE8A 2L19A 4Z53A 1GGEA 1USGA 1BMFA 2PUFA 4DM4A 1J8YF 1G8GA 2IQ5A 2P3SA 1TM2A 5T4FA 3GMTA 2PCJA 2KSQA 4EUNA 2PVPA 5IM4A 4C0BA 3BIFA 4MW2A 5DHRA 3M3DA 3K0AB 1ODIA 4A8HA 1CNFA 2HXYA 3LDHA 3DBRB 3PLNA 3H6GA 2J4DA 2PH3A 5IEBA 2G9ZA 3IB6A 1MQ8B 3HM9A 3MWGA 4X20A 4IGFA 2QEQA 3A58B 4XGNA 1ABEA 1Z34A 2CXUA 5KPJA 1DVRA 4QHYA 2ZSIA 1TFRA 2XGGA 3CF0A 3WK5A 4OHUA 1E8MA 2G88A 2J4CA 1XDWA 3IKVA 1ZXXA 3GEGA 1Z6GA 4UU0A 2O8BB 5JBQA 1KDPA 3RC2A 1T10A 4RVDA 5I7VA 3M8KA 3DJFA 3ILHA 3UJ7A 5CFLA 4JENA 2FUNB 2O3SA 1PZHA 1BXGA 1T5HX 3QUTA 2JH9A 3P0JA 4ZANA 3V8MA 5L6MB 2C7PA 1EBFA 4KDFA 1U3UA 1OAAA 4INZA 2ZS8A 3PD7A 4RL6A 4EJSC 1Q1QA 5KSOA 3WGJA 5BWMA 4DE5A 3MT8A 1PJTA 4NCXA 4B6QA 1NUTA 1OBHA 4LV6A 4FGJA 3SR0A 4M0DA 4QUIA 3S2FA 1DG3A 3ER8A 1FMJA 3CMCO 3EWIA 4DVJA 5FI0B 1W0KD 1M1XB 3CKLA 3N2YA 1CUJA 4ZDIA 5JYEA 1EQAA 2FF5A 4OB8A 4GSKA 4TT3D 4XVHA 2YNMC 3VR6A 4BU0A 3KZCA 1CC1S 3RIGA 4ZN6A 4M8SA 2VO1A 5FUQA 1F6DA 1N2SA 5TB5A 1EP3B 5GOZA 2HRRA 5L7TA 2DKNA 2RGUA 1A5ZA 5CR9A 4EJ0A 3A4TA 5AVSA 1DX9A 2ATIA 2KJQA 5BR4A 4K2HA 4YDHB 1UBGA 1FE8A 2EHJA 4CE6A 3THWA 4PFQA 3NRBA 4EJFA 1TB4A 1PGNA 3K1ZA 2R6JA 4KX3A 4MUJA 5KEIA 4ZTBA 3NDIA 3QVUA 1R6VA 1T0JB 1HDRA 3BF7A 2DLNA 1R4MA 2ONKA 1WVGA 3JD4A 4XXHA 2R62A 1BWSA 3L6EA 5DBEX 4EEXA 1A8IA 2VTKA 3FGZA 4ZOLF 5MGBA 3GVXA 5EHQA 5E6UA 3V9AA 1H9AA 1U2PA 4UBKA 1U0BB 1LB1B 2WABA 2EKPA 4MW0A 3Q3JB 1J5PA 1Q1ZA 3SF0A 1BVYF 1G0OA 1I7DA 1KQ3A 1WS6A 1R3UA 3QVGA 1CBUA 3TXYA 1YJ8A 1WUYA 2FPOA 2HMYB 2PUBA 3K2QA 5BSRA 4IDHA 3P27A 4JDUA 2P4QA 6PFKA 1XTVA 2PUEA 1JHQA 3UB3A 3PDHA 2AVDA 1XLVA 3ZK7A 4BTEA 3OE7A 3E6AA 3ROKA 4D81A 2C8LA 4HNRA 3U49A 5KCMA 1XL0A 4EF4A 3TGWA 4Q4AB 1MDBA 2BFAA 2VPPA 3Q7EA 4LFBB 1CZHA 4C89A 3QU5A 3MS2A 4G1MB 4RETA 3B2NA 3CC8A 5SY4A 2PZLA 1XZQA 3CMMA 2I8LA 1QRAA 4N5HX 3ICQB 2ASEA 2Z04A 4WN9A 3DE2X 2FHSA 5J4KA 4W5HA 4Z51A 1OA0A 3BF8A 3V33A 3RVKA 3EK2A 5CJPA 5ALHA 3H0CA 5B64A 2FVYA 5HKKA 2DQ4A 2V4MA 4J3JA 1FFYA 1TM4E 3OP1A 1RKVA 4I50B 5I7WA 1VCHA 3A9CA 1CWUA 2PCLA 3DZIA 1LK5A 2X0KA 2CVFA 1TA0A 1FFSA 1PR3A 4OP1A 2CZQA 3T94A 3IESA 5FOWA 3KZVA 4RDXA 2GPAA 3R0ZA 2WE7A 1E7WA 5ALPA 4CR7A 1IYZA 1UPCA 2ZXUA 3MTDA 2IS6A 2RFLA 1FFGA 3L8YA 4EY8A 1STOA 5G1PA 1CDDA 2W6PA 3CEMA 2HIGA 2Q3EA 2VKQA 2OLEA 3E3LA 5FOUA 3TIGA 4DJFC 1QOPB 4MPJA 2JC3A 1DSSG 1W96A 1JILA 4UDYX 3VKGA 4FJ2A 4HYTA 2FUEA 3TQHA 2MSKA 2P2NA 1UPAA 3GRFA 4FFOA 1O89A 4I6EA 3K8ZA 4IW3B 1BFDA 4JOQA 4LKRA 3HXTA 5EZ5A 4F97A 1VI6A 1X1QA 1E2FA 3OA2A 1H0SA 4WQMA 3BFKA 1Y5IA 2Z3WA 1NKVA 3ROMA 3RF6A 4AS3A 2JJ2D 4C0LA 1RWNA 2YHIA 2H07A 4XSVA 1F4VA 4ZQCB 3JVUA 5A02A 1UKBA 2XF8A 1YMQA 2OO7A 3FOEC 1C9NA 1YJBA 3HNPA 3KQQA 1AVTA 1KK3A 3PVSA 1H22A 1OW3B 1VPEA 1ZN9A 3PR2B 3I2YX 1QVWA 3OJWA 4CL2A 4OHZA 3L7AA 1ADYA 3ME5A 5A7HA 2ERXA 2NU6B 1GTSA 3DLPX 3D6HA 1JAYA 1EFKA 4LOAA 1RC1A 4BVHA 3CRNA 1YZKA 4HRVA 4WL0A 3PRYA 4MQBA 2WD7A 1IPEA 1CUEA 1TT5A 2Y67A 4Z86A 1T2AA 3L8FA 4UD6A 2R6FA 4JUIA 4PYLA 4A0QA 2VHVA 3AETB 1BFKA 3DVAA 3T15A 3LK6A 4UTRA 2E4ZA 4PLFA 3MINA 3UMMA 4A23A 4QREA 1M2KA 2CCGA 1L9KA 2HMVA 2FNAA 3IO3A 3GLSA 4WCVA 5D6OA 3W3AD 1T4BA 1K8QA 2FEPA 4WZ6A 4GS5A 2NXJA 1NC3A 3I76A 4CCWA 4PYQA 3H9EO 1YB1A 2PRKA 4U8HA 5DLPA 5E4JA 4U3JB 2VRNA 3UAGA 4DB4A 1LFDB 2CC2A 3JD1A 4RD4A 3UHAA 2JLXA 4FFPA 2IE0A 4X7RA 1CNMA 1DWQA 1H3FA 2VS1A 3H1EA 3SHVA 1QBGA 2O7RA 1R0LA 4M76B 5F98A 2VPTA 1BXKA 2PUTA 2FPPB 1CUVA 3G68A 4MR9A 2RHMA 2ADOA 5K0SA 1ECFA 4LRQA 3CCBA 3DUFB 1DKMA 1UKCA 3BBPA 3OMXA 3VNRA 2GZSA 1P1FA 1RPJA 4I3GA 2AN3A 4PZYA 2CHQA 2A86A 1Z2AA 1ZUWA 2XECA 4I1VA 5TGTA 2CLCX 1RPNA 4AYXA 3AFIA 2XB2A 1VIAA 3ZXSA 3OWOA 1NVXQ 1MC5A 2R4UA 4RACA 4CN9A 1V47A 1KKLA 2Q4EA 2B3DA 4AF6A 2P67A 3WQHA 3HR4A 4YJGA 3S55A 3OZXA 1P2FA 2PBRA 2YWHA 4G8BA 4TKZA 4ZEWA 5LOVF 2P68A 4XM2A 1ZY2A 1XNHA 3B1XA 3REOA 5CLHA 4ND3A 2YV1A 4BBJA 1FP1D 3N0XA 3GFFA 3WA6A 4EFLA 3H13A 3VOSA 4RHFA 3CURA 2B94A 4FD3A 5BMVB 2LRHA 3V3KA 2QG4A 4LNHA 5LZ9A 1EHYA 1JKJA 3SC6A 3UPDA 3ZU3A 4E4RA 4BEBA 4R4JA 3RAPR 3ZW9A 4IF6A 3O8OA 3M5CA 3R3VA 1RRVA 1TK9A 4RGVA 3GPIA 1LI5A 4WLFA 2WG1A 2OM6A 2ZSUA 3IKMB 3RK1A 3WRYA 4BNKA 3ZH2A 4BZPA 2I2WA 3UZUA 4F38A 5JH7B 1EFHA 1JIXA 3EY9A 5K99A 2G83A 5JMOA 1D9XA 4WKCA 1DBQA 4C0HA 1ZEJA 1NTRA 4NJMA 1TU0A 1DRUA 4FYJA 5BN5B 3QJYA 4M1WA 3TSCA 2BFOA 3GJ5A 3ZBUA 5FUYA 1Z4KA 2IXFA 2P30A 2O0MA 5CUQA 1KJJA 2C9BA 2V1XA 5DHAA 4OHWA 1ENYA 2BT4A 4L5YA 4NLLA 1EMDA 2V3VA 3GLRA 2YMMA 2Y1KA 1FNMA 2HOQA 2O2XA 4QVIA 1GGHA 1RLMA 1F2TB 2AQKA 4QQ8A 1C0IA 1J97A 3GIWA 3QV1A 3M3PA 1NDQA 4G9GA 3PL5A 3QRWA 5DYTA 3WFZA 5DN6D 3GJRA 4V0ME 4ZA2A 4E22A 1VHWA 3ZHOA 4L5BA 3GLFE 1OILA 1YDFA 2QP9X 2QAJA 3IXMA 4GVXA 3OC6A 3SZ3A 1LI4A 2GF2A 2QTFA 3MRTA 4IIXA 1VG8A 5I9TA 4DNFA 3KTFA 4J3NA 4MX8A 4XYBA 2QRKA 2RAUA 4DIDA 1CUAA 1SIWA 2Y0DA 1WM1A 1VM6A 3GLVA 4HX9A 1F9AA 2QB5A 5FWYB 4DSZA 4KNVA 4ON9A 4CL3A 3CR3C 5AJVB 4JI6B 1XZKA 2FG7C 5EYPB 2Y1CA 1J2TA 3CZPA 2ZANA 1IEWA 3UFBA 2B30A 1I3NA 3FKQA 1QCCA 3C3YA 1U7UA 1M2EA 3D8TA 4TX1A 2YBDA 4HB3A 4NXMB 1O4VA 1FUKA 3GFVA 4GVPA 1X9HA 4HYYA 4X1YB 1DQRA 2CNBA 3QYJA 4AP6A 4EABA 3GCZA 1G42A 2D1SA 3BB1A 3ZK8A 2W6JD 4V39A 1GRCA 1SA0A 3UW1A 2P6NA 4I0WB 2YVAA 4GR4A 3GHHA 4A6DA 1U9YA 5GY7A 2ODQA 4HAXA 4X90A 2CFOA 2PKYX 2ZYIA 4RPKA 3QXCA 4LN1A 4Y9DA 3VTKA 2FQQA 2JIZD 1MLDA 1JIIA 1O94A 2QTGA 2QTTA 2H8KA 3K0BA 1L7OA 2VZEA 3HHPA 2ZU0C 3IQEA 1QZUA 2B8JA 3V4RA 1YFKA 1OI4A 3G02A 3T0GA 1Z5GA 4A03A 1R27A 2PYIA 4MXDA 1L6RA 1UDXA 1JTEA 2J59A 3L4SO 3OT1A 1GJRA 1M75A 3WVNA 2WF8A 1GPNA 2V0GA 1JYEA 2YS6A 1G8JA 1Z36A 3OEYA 2QWXA 3KXPA 1YRWA 3WK4A 1OGYA 4V2IA 1MX5A 3KXIA 1X80B 4N8SA 2C97A 1GA4A 3CF4A 2BUCA 1PCXA 2BLNA 3BC1A 4H7IA 4MDEA 2Q5QA 1DXHA 4JVSB 4YS6A 3SXPA 3CRW1 2SNIE 2QW8A 3EG9B 3JQGB 1D6NA 1PS8A 1VHLA 2HRQA 3QKRB 2VRWA 3QTTA 4RPLA 5AXAA 1IWOA 1NG9A 2FW6A 1E9CA 3EYAA 5LB4A 4MV3A 5SZHB 4RVHA 3AG6A 1Z0JA 4HYEA 4EKNB 2IY9A 1GXSA 3LPDA 5K8CA 2HV8A 2GM5A 3W3AA 4J91A 5DNDA 1T13A 2VT7A 1X3SA 3JW8A 5J47A 3EPJA 2YWBA 4GE3A 1WU7A 4DIKA 1VBMA 3SD7A 4ARZB 1NI5A 5MF6A 1T3GA 1U2ZA 3PUYA 4AX8A 1OB2A 2VATA 2OUIA 4TUYF 2MCFA 1KS2A 1P5RA 3U62A 1AHPA 3WIBA 3I5MA 4X85A 2JIQA 2H00A 3HMQA 3ROTA 2Y05A 6AT1A 4O4LF 4F84A 4ZP1A 5I7OA 4YJKA 2A5GA 3N3BC 1KJZA 2Q50A 3PQEA 1Y5NA 4IIJA 3UUFA 2VUSA 5IHPA 1UR5A 3M4XA 4EI2A 1UOEA 4RLSA 1B8VA 1I7PA 1VP9A 2IOYA 1ULUA 2QL5A 3NT2A 5AI9A 2GKOA 1LV7A 1MIOA 1KAQA 1OC4A 3PQ2A 5EIBD 1FUIA 2HDOA 4BNJA 1JVBA 4CCSA 3EOZA 4EHKA 4AULA 3KU1A 1N8NA 5IN5A 4X91A 3CSSA 5CDGA 5I45A 1N5KA 1BH2A 4COOA 2ATVA 3A2KA 1QGDA 4K9RA 4NQRA 3QPVA 1G17A 2DETA 1RE1A 3A1CA 3OCWA 1ZESA 2A67A 2HBRA 4EJ2A 1WF3A 4Y30A 4V3CA 1XI2A 2JASA 5I51A 1KQFA 3MAJA 3TQFA 5H9VA 3SSOA 1JHAA 1IQPA 2CNKA 4WXRA 1FJ2A 4FNOA 5KTMA 2PS1A 2M32A 4FOLA 4DG9A 2WWXA 1KHHA 1D2EA 3B8EA 1EWQA 4FSDA 3PXDA 1X19A 3U3DA 1K7EB 4ZVSA 4NX2A 2NV2B 4F71A 5LLTA 4CGZA 2DQSA 1ONSA 4D2IA 1Z5NA 2HO5A 4RIIA 2R96A 3L8MA 3QNMA 4UW9A