3QBTA

Crystal structure of ocrl1 540-678 in complex with rab8a:gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
b'YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
total genus 59
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qbtA00
5K8UA 1XTSA 4Q4HA 1N6OA 5FUYA 2X77A 3EIHA 5CM8B 3VKGA 2AK3A 3K09C 1GILA 2XJ9A 5FUWA 5JEDA 2BBWA 2Q9AA 5J40A 3Q72A 4JMPA 3GCGA 1KTVA 1U94A 3QF7A 3EC2A 4A82A 1VDZA 4KFRA 3OIVA 2QPOA 1YZLA 1XRJA 1WDTA 2RH5A 3KQUA 2BMJA 1D2NA 1N25A 2FFBA 2YINC 1KGDA 3K0EA 4KJZA 5FOUA 5AJZA 5SZKB 1E9CA 3U7EB 4OQNA 2FPLA 3R9IA 3WXMA 2ATXA 1G3UA 1SKQA 2ZUDA 3AVWA 1M34E 3K0FA 4QBIA 3CF0A 4HUQB 4PANA 2REOA 5TB5A 1JQLB 3C4JA 3S1AB 1Z63A 1KI7A 1W46A 1MT0A 2VRWA 4A0HA 1R8SA 2WPDA 4JKIA 1IXSB 1Y3AA 3LVQE 1IXZA 1FFHA 4X8HA 5CLQA 4D26A 3U60B 1FTNA 1WBDA 2J0UB 3QG5A 1VYVA 3EZ9A 4P33A 4UNQA 3ZJYA 4FWTA 3VR1A 1XPUA 4DLXA 2OEPA 3WNBA 2ERYA 2YYZA 1D9ZA 1IN7A 4JLBA 2HCBA 3GEHA 1R10A 4Q7KA 2EVWX 2ZUBA 1F60A 3W8NA 2YKGA 1UBCA 3RYTC 1IM2A 4Q4JB 2ZRNA 1W0KA 1U0HC 2GJSA 4GP6A 2IYZA 4LHXA 4O25A 2WOJA 5HR5A 2D2EA 3B7GA 3CZQA 4AG5A 3D8BA 4MGKR 1XB2A 2WWXA 4PC1A 2Z4SA 4PPGA 1QHHA 2X2EA 4F4CA 1OH7A 4EAQA 4I99A 2KE5A 4M8NE 2D62A 3KTAB 4RCZA 3RC3A 4UNNA 3ZQJA 1EWQA 4G01B 5E4FA 2VP2A 5L3QA 3OEEA 4IVQA 1E94E 3A1UA 4JVNA 2XZPA 4DC9A 1CBUA 3TUZC 1N0VC 1YVDA 4PO8A 2RGAA 4LJAA 3RRYA 4LSGA 3RS4A 1E99A 5HE8A 1IHUA 4TMZA 4E09A 3DO6A 2CVHA 3RRNA 1E0AA 2EQBA 2C2HA 2ZJYA 5FI1B 2FH5B 4HYYA 2ZAMA 1VTKA 5DN6A 5FBLB 3KZ1E 3SZRA 4WAUA 4G3XA 4CYMA 4QNRA 2AXNA 1A1VA 2F3TA 2BBOA 2QT0A 1SVKA 4XWOA 4RFVA 4Q9IA 2YC4C 1NNEA 4IVRA 2PZEA 4JLDA 4B2LA 2ODWA 3CF2A 2HXYA 3LH5A 3L82B 4TMXA 3HWSA 2W83A 4Q9LA 3THXB 5ANRB 1TUEA 4JLJA 1CS4C 2FEMA 1DG3A 4U7DA 3C14C 1KO7A 1E1QA 2VH5R 3VX3A 4PSAA 1R8QA 1FZQA 2B8TA 2QTVB 5L3VA 1YKSA 1KK0A 3GJ4A 3UPUA 2GAOA 3TRFA 2D7DA 3L8ZA 2VHJA 3QIAA 4K8OA 2DFLA 1KSHA 3ECCA 4LCBA 1II8A 4URWR 2GVDC 1MRSA 1JXOA 2R6DA 2GXAA 1KMHB 4PPNA 3I5YA 1QHGA 3UANA 5JI2E 1N6IA 1P2UA 3I5XA 4AKGA 4LGMA 3P4YA 2ZITA 4AURA 1J2JA 4US2R 3DOEA 4M2LA 4TYYA 1E2FA 3QE0A 3DMDA 4OBEA 1V5WA 4LRWA 2RMKA 2A5DA 4M1SA 2GK6A 3SDZA 4LPSA 3IEVA 1ZNYA 2OFOA 4AY2A 1VCIA 4UJ3A 4DIDA 1E2MA 1G17A 1DAIA 5KTYA 3FKQA 1YR9A 4LV5B 4IEEA 4TLEA 3LX5A 1EESA 3MD0A 5J4HA 1W36D 4EUNA 1ZIPA 4X8MA 1NI3A 4MRRA 2GILA 5A4JA 2BEKA 2FA9A 4M1KA 1U0JA 2EFGA 3UMSA 2VHTA 4LJ9A 4ON9A 2GKSA 1RZ3A 2ZSAA 4GZLA 4JVSB 5CK5A 2I1VB 1R5NA 4JLVA 2W2TA 3KL4A 1W4RA 3VR4A 2HJVA 1OIXA 3NWJA 2ZJAA 3BE4A 5DE3A 2UZIR 1SVMA 2A2ZA 4NYJR 3W3AA 4PHFA 4Z8XA 3THYB 2ODBA 1Z28A 3KFVA 5L3SA 4YMUA 1P73A 1NVVR 4TT3D 1HA3A 3NVAA 1XTRA 2I3BA 2W0MA 5LD2B 1I2MA 5J4KA 1VPLA 3NEYA 1NRJB 4F4IA 1U90A 4JLAA 4KCGA 3GLIE 1UKYA 3GJ0A 2V8OA 1KY3A 1WQ1R 2G9NA 1XF9A 4MH0R 3BC1A 3IQWA 4MDEA 4V0OA 5F3WB 3DHWC 4C0BA 4E5UA 5BW8A 3A1WA 1P9NA 2HJGA 2PCJA 2KBEA 4CEIB 1CLUA 2PBRA 5EZ6B 2GJAA 2G0NA 3QUSA 5DO9A 4UNSA 1GNRA 3EA5A 2AX4A 1OKKA 3P4XA 1UF9A 1CTQA 4DLZA 4NCJA 3OHMA 4U02A 4AI6A 1EFTA 1Q20A 3IIMA 1AQYA 5E7MA 3REFA 5DI3B 1OKKD 5KDLA 2GZDA 2JLSA 2VSOA 2HXSA 4M9ZA 2C77A 4R9UC 2ZS7A 4NBSA 4JYCA 3BFKA 4Q47A 2WMNB 5KNDA 2WTUA 1EX6A 4V02A 3WRXC 2VF8A 3IKJA 3R9WA 3MG9A 3WNCA 3GFPA 5FOWA 3BAFA 5JS8A 4C9BA 3N2IA 3PUXA 3FKSA 4PC7A 1TEVA 4QJ5A 5J47A 2ZI4A 3CNOA 4DLRA 5UKDA 3QEOA 1N6KA 1HUQA 2IYYA 1X1RA 2IYQA 1PJRA 3VR5A 5IRCD 4KFUA 2WSSD 4D6PA 2IHYA 1OT3A 4CT4B 4LC1A 2NPFA 3NH6A 3ONWA 5JWOA 4UQOA 3QXHA 4M1YA 3FGNA 4FWIB 3U6BA 2CHVA 3AVTA 4ZI3A 1RIFA 1Z47A 3PG5A 4JSTA 4LJ7A 2VBCA 2FX3A 4HZIA 2Z5FA 4UXHA 1KHTA 3NBYC 1W4AA 1AK2A 2ZXUA 3PUVA 2ANBA 5FL3A 3RVBA 4B34A 2HV8A 2WAXA 3NDBB 2ZSEA 2AD1A 3KUCA 1BH2A 5TV2A 1OFTA 1Z29A 3P32A 5FBQB 4TWZA 3G82C 4XSHA 2IYSA 4LY6A 3H2YA 4DEXA 2ODEA 4V0MA 2K5UA 2QAGC 1G16A 1M7BA 2ZYUX 2FSIA 4PX9A 3LX8A 5F9HA 4A36A 5KSOA 1AKEA 1N6RA 2RHMA 5BN5A 4IJMA 2EW1A 5B64A 4HLUC 5TXGA 1NIPA 2FE4A 4URVR 2DFNA 3KJHA 5DI9A 1PVOA 4DUGA 4TL6A 1FW6A 1RJ9A 5DIFA 5EP4A 2IT1A 4OYHA 3IDQA 2JLRA 1X3SA 3GJ3A 4V03A 2C98A 4NDZA 3ASZA 3VKHA 1IY2A 2J0QA 2QGZA 3K0CA 3N70A 4XWAA 1NJGA 3E70C 4P4SB 5EXPA 3GLIB 4A2WA 2JASA 3TJZA 2BEJA 1CULC 4Z1MA 1ZBDA 4GNKA 1DAFA 4B6FA 1P75A 2GZHA 4OK3A 3T34A 3W6NA 2JJ1A 3IEUA 4XD7D 1OF1A 3WRYC 1RW4A 4MUBA 4Z1MD 2P0EA 4HAWA 2OV2A 1OYYA 2AWOA 3QPUA 4FIDA 2GETA 4ACBA 1PUIA 2V1UA 2JJ1D 2GCPA 2VIIA 3F0TA 3T5GA 1VCOA 1GL6A 4QJ4A 2W58A 2ZYVX 4G1UC 1E6CA 2PL3A 4NYIR 3GLGA 1E4YA 4WIAA 4M22A 3RS3A 2RGEA 1E2IA 2ODNA 2FJUA 3BWDD 4C7OB 3L0OA 1SKYE 1UEIA 1ZUNB 3V4RA 1GITA 3TVDA 1G4AE 3AF3A 2ZR7A 4JL6A 2SHKA 5LB4A 3T15A 3T1OA 3V00A 2V55B 1T8UA 3I1FA 1ZC4A 2QP4A 3T35A 3ZS8A 1IN8A 4IDQA 2OXCA 3EIQA 3A1VA 2G88A 3C41J 4B76A 1NY5A 3D6TB 4NONA 1Z0JA 5JRJA 1G8GA 1W4BA 4C0SA 1N5JA 1XMSA 4B35A 2GJKA 4TTRA 4FMCF 3K9HA 3WMEA 4Q4AB 1J70A 5BQ5A 3ZGXA 4A2QA 3AKDA 2WHXA 4AYWA 4Q7MB 3IPYA 4KHZA 4A8JB 1Z3IX 2V7QA 1KKLA 1J7KA 1DVRA 3B1ZA 4FI3C 4QL3A 5EP2A 4D4MA 3T5DA 3ZZUA 2BVNA 1EFUA 1FNMA 2FGKA 4WOPA 3VR3A 2O8BB 4IDNA 2D7CA 4NYMR 5CIQA 5JMTA 4ZDWA 1NMXA 3SNHA 1DG1G 2QP9X 2V7QD 2AKAB 1G20E 5JLJA 1P5ZB 5FPHA 4E22A 1E79A 2QAJA 3W90A 2IYUA 4B6EA 5KOYA 4JYBA 4X8OA 2GA8A 1ZM4A 3TNFA 3MCAA 4F38A 1MOZA 4NYJQ 3QG1A 3CONA 1JPNA 1ONBA 3ADKA 4A6PA 4B74A 1NVVQ 1VCNA 4L9WA 4BLOA 2CJWA 2GEUA 2YWGA 2I4IA 1FUKA 4G5OA 1W2GA 4D0LB 1XCPA 3CX8A 1P9RA 2VEDA 2ZROA 3MWYW 1M8PA 4C0HA 3ZYCA 2IA5A 4DDWA 4N1AA 4PO1A 4GPTA 3GLFA 3D3QA 1DADA 3RS7A 2WWWA 1P4SA 1K8RA 1RRGA 1TMKA 3BRWD 3AUYA 4BFVA 4B75A 5C2JB 4IDOA 1JEDA 3QKSA 2UVQA 5AUPB 1E9AA 3EW9A 2QZ4A 1Q3TA 2OXRA 1GG2A 3NC0C 1ZM3A 2F7SA 1HE8B 2IUTA 3HYRA 4DSOA 1XJQA 3NBFA 3QVVA 1ZD9A 5AUOB 1BKDR 1U2RA 2QROA 5BXQC 1FX0B 4FCTA 2DCUA 4QBHA 1BMFA 3FHOA 5C1BA 2OT3B 4XVQA 2XOKA 4MRPA 4TL9A 3SJAA 4EFNA 4DB2A 3QBVA 4RY2A 1ZUIA 1GFIA 4QBFA 2GRJA 3B9PA 2GZAA 1HV8A 4V0KA 1AKYA 3GFOA 1W4CA 2PJZA 2BMFA 3U7FB 4LUCA 5BWMA 5GJWC 3A36A 3LA6A 1MKYA 4EFLA 4DLYA 1E2QA 3GJXC 3RLFA 2WWFA 2O0JA 1PLLA 3BERA 5AJXA 1VYTA 4HSEA 2GESA 4BRWA 4KU4A 4LOAA 4GMXA 1NVWQ 1TAGA 1P9WA 2XJ4A 1M6NA 2CHGA 3C5CA 4HDQB 4HZUB 1AGPA 3CRW1 5EJEA 4BECA 2IF0A 3FMPB 1UBGA 2FWRA 2JGNA 2O8DA 1QZXA 2VP9A 3KB2A 3VU9B 2O52A 2QG6A 3QPVA 5KSPA 2ZUCA 4WZAE 4QM7A 4Q7JB 2ZE5A 4EPWA 3DMNA 2GAAA 5JSZA 4BLTA 1U98A 1TX4B 1N0WA 2QE7A 2QUZA 2XTZA 3AUXA 5AWFC 4QGGA 2PT7A 3VX4A 5FOVA 3T12A 2PH1A 4KBFA 2ZSBA 5CB6A 3KQHA 1US8B 4D25A 3PEWA 2WWYA 1TL7C 4KI0A 1NVXQ 3TAHA 3VNVA 3U3RA 1NBMA 3KKMA 4TMTA 3TR0A 3F3YA 2JLQA 1XEWY 3WY9A 3WYGA 2QTFA 1VG1A 2FEOA 4A1FA 1G7RA 3VKWA 4ZDJA 4MYUA 4OHVA 2F43B 4EPRA 1WMSA 3EPLA 1DARA 2DWOA 3CIOA 4AYXA 5A0FA 1HT2E 3LBHA 4Q18A 2H16A 2PX3A 3THXA 2VA8A 2WOOA 1IY0A 3BK7A 4BGDA 5EXXA 2IYWA 4G5RA 1RRFA 3GJ7A 1S0UA 1ZC3A 3W5IA 3TUIC 4A0GA 1KI6B 1N0UA 3LFUA 2PLFA 5K8IA 2C96A 3EZ7A 1OB5A 1WF3A 1KY2A 1XCMA 1F2TB 2R2AA 2VF7A 2DFTA 3HU2A 3LDAA 4OQFA 4TLBA 1GM5A 2NMVA 5GJBA 3O8RA 4KVAA 1U99A 2ZI6A 4OJQA 3K0SA 4MYTA 2ZJ2A 2DBYA 2E87A 3Q8XB 4CEJB 1OIWA 1E9EA 3H4MA 1P2SA 1QBKC 5JS7A 3IIKA 3HU3A 2IEYA 3LBNA 3ICEA 1E0JA 4UXIA 2ZRKA 3SN6A 1QHIA 1E2LA 5CJPA 2NG1A 1Z2AA 1VG0B 5JCZA 4HUQA 4IVPA 2O0KA 3S1AA 3KFXA 3FFBA 1SHZA 2GNOA 3K1JA 5GVSA 1IOZA 3K70B 4ZCLA 3U7HB 1IN5A 3SBDA 2G77B 1W47A 2DPXA 2GBLC 4NYIQ 3TAUA 2J0UA 4URZR 3AKYA 4BEJA 1T91A 4PSVA 1GP2A 2BIFA 4A8JC 2ECKA 3MGCA 1NLZA 4PAQA 3FYHA 5AJYA 3SR0A 1FUUA 1QVAA 1U8ZA 1TEXA 2BJVA 4G5QA 4Q4JA 4WXRA 4YDHB 5F9FA 2ATVA 4DDUA 3B6EA 1IQPA 2Q3FA 1XZQA 4WZBE 1JR3D 3JVVA 3ND9A 2RGNA 3R7WB 1R0YA 3AP2A 1YRBA 3ZLJA 4OJKA 4I4LA 2NPIA 1XPRA 4FCWA 1S96A 3QXXA 1BIFA 2IW3A 3THWA 3BB4A 1W2HA 1G8PA 1AS0A 1Q3HA 2VLIA 3LBIA 1BS1A 2GEDA 5HE9A 2WJHA 1DOAA 1G18A 2XXAB 2XNDD 1T3LA 4EPYA 1W44A 4LJYA 3BXZA 3SC3A 3CF6R 2VHUA 4TSFA 2YC2C 4M9XA 1G21E 4NYMQ 1R0XA 4B3GA 4PC3A 1G64A 3RSLA 4N0DA 4BFSA 2JDIA 4Q66C 3RWMB 3KXKA 4XSGA 4HLUA 4TSFD 1LS1A 1XCGB 1UFQA 2HYDA 4ZDKA 4TLDA 3RHFA 3OZXA 4GDFA 3AVUA 2E1RA 1LFDB 3TMKA 2JDID 3BOSA 4RD1A 5FPSA 521PA 3GLHE 4P4UA 3EARA 3QXJA 3Q85A 4KAXA 5CDFA 2JCSA 2VSXA 1KI8A 3CB4A 5FTMA 3AVXA 1FQKA 2NZ8A 4ZIRB 3E1SA 4BFTA 1V43A 1B23P 2QTHA 4LHYA 1KAGA 2G83A 3KKPA 1Z08A 2MSDB 4HLCA 5KPJA 3PXGA 3AM1A 2P5SA 4YMVA 2LCFA 4A6XA 1UKZA 3CRQA 5CB8A 5SZHB 2JJ2D 1G7SA 1KMHA 1XEFA 3I8XA 4MYCA 2C04A 1O87A 2HLDD 5FTNA 1E2HA 4DSUA 2EYQA 5CM9C 2XZLA 1QHNA 2WIAA 3TLXA 4QHTA 1E0SA 3W3ZB 2QNRA 3BBPA 3L0IB 4H1VA 2B6HA 4MA4A 1F6BA 2ANCA 2ZETA 3TW4A 1YR8A 3X1DA 1NG1A 5DLQC 3LRPA 3PUWA 1KDOA 1JAHA 1F5NA 4JT4A 3KQKA 1RRPA 3A8TA 5H68A 3C15C 5TVKA 4ARZB 4CEHB 1S3SA 5AUNB 3RNLA 4B3FX 5E3HA 1PLKA 1GIAA 1KJWA 2A5GA 1N6PA 1Z6YA 3A1TA 4MGZR 4PZLA 2JJ8A 3QPWA 5CLLA 4JIMA 2VP0A 2Y8EA 4DVGA 4AG6A 1YZNA 2DR3A 2QAGB 4QBGB 3R8FA 4Q4HB 2GHIA 1COWD 1D9XA 2G3YA 2H92A 1WP9A 4ABYA 3HR7A 1KSGA 1F2UB 3RANA 4OI4A 2VHQA 1H8HD 3OIYA 1SULA 4QXAA 4HDOB 5FUVA 1IAQA 4A9AA 1XD8A 4EJSB 1HT1E 4L16A 3THYA 4I81A 2OM2A 4MRNA 2QPTA 4C0QC 3Q7QA 5JWRA 2C9OA 2EFHB 2P5TB 4M1OA 3V4FA 2EU8A 4ZCMA 3FHCB 1YQTA 3ADCA 5FOXA 1NSFA 1RYHA 4U00A 5IF9A 2CLSA 1S9DA 1VG9B 2AXPA 3KQLA 3K0FB 3OIUA 1XMVA 4H1UA 1QDEA 4PC2A 4C3ZA 3OF5A 4BWYA 2IEZA 3K9LA 1GZSA 1HY3A 4HAVA 4AKHA 4D4LA 4D82A 4V0LA 1XTJA 4BE7B 1NMYA 3BH6A 1XU4A 2ZRLA 3SS8A 4QRHA 1G5TA 1H8EA 1W1WA 2P65A 1X8JA 4GSYA 4JSYA 1LVGA 1DO2A 2LWIA 2D06A 2ZVQX 4KLZA 4B3XA 3RS5A 4BLSA 2HYIC 3JVUA 2V9PA 3BFVA 4PQYA 2CCGA 4W5JA 2C95A 2QI9C 3SYNA 2B7BA 4BFUA 2VP4A 2YZ2A 1H8ED 1FMJA 3NDPA 4Z54A 3ADBA 4OHYA 2OCPA 2B21A 1NIJA 2WSMA 3PEUA 2A5FA 5DI3A 2W0SA 4B3BA 2IYVA 3GLHB 2NIPA 2AD5A 3LXRA 5B2ZA 1AQUA 3PV0A 4C0JA 2A5JA 2YV5A 5FBWB 2N46A 4TLAA 1MR3F 2QMEA 1TQ6A 1YR6A 1Q1ZA 1ZP6A 4FN5A 4QFMA 5DHFA 5FH9A 1OE0A 3IGFA 4HB0A 1MABB 2CNWD 4HEJA 4FMBB 1W0JA 1XNJA 3Q5EA 4OHZA 3VR2A 3K70C 2V4ZA 2R9VA 4FMDF 3B1VA 4HLQB 4B47A 1XFAA 1XEXB 4RJLA 3H84A 3F8TA 5L3QB 1YRAA 4TT3A 1W0JD 5JCPA 3AF4A 4C30A 1MO3A 3NTUA 1N5IA 3GJ5A 3WMGA 1G3MA 1KI2A 3TSZA 4NCNA 3VMFA 1FMLA 3CPHA 1GL9B 2G1KA 5H1YA 4OHWA 1BYIA 4LZZA 1IJEA 2CCKA 4KFSA 1ZIOA 5CYPA 3U44B 1ZVQA 3ADDA 4TYNA 3K0AB 5FBRB 4DRZA 4TL7A 2O8CA 1AM4D 2LKCA 4DDTA 5G53C 1XMJA 2RGBA 2MMCA 1GKYA 1N2CE 4CRWB 3SU8A 1VCMA 4CGZA 4ZO4A 1PLJA 3BORA 2GF9A 4JT2A 2FOLA 4Q19A 3PQCA 5FI0B 1P62B 2YVUA 3E2IA 2X19A 1VKJA 4LV8B 4WA7A 1T4GA 1E2PA 1KJZA 1JI0A 4M21A 4GI7A 1XXHE 2Q9BA 2E9SA 4DDVA 5J4YA 3RS0A 4AKEA 5HZKA 2F1JA 1E2EA 1II8B 4KBGA 4EQ6B 5TMPA 3FFAA 1OH8A 2BDTA 2XITA 3L0PA 2HT6A 4RD6A 3VR6A 4GP7A 3TVTA 2X2FA 5KU1A 2HDNB 2IUSA 1UADA 1Z6TA 2OBNA 2WZQA 3Q9LA 4Q48A 3WP0A 4QHSA 4BFZA 1CP2A 4CT5A 1D5CA 3UKDA 2IUUA 1G5PA 4P4SA 4ILEA 1GVNB 1UEJA 1AS3A 3RRMA 4Q1CA 2WSSA 4UNRA 1W7AA 2WWGA 1NF3A 3FMIA 3VTKA 4M4SA 2VP5A 4WW0A 4XIGS 2ZR9A 5LD2C 4PTLA 2FSGA 3T61A 2JLYA 2FSHA 5HCIA 5ELXA 1OXTA 3QF4B 1OFUX 2MSCB 4O2RA 5B58C 2QM7A 2GEVA 2RGDA 4HUTA 5DYIA 4V0ME 1NN5A 4LI0A 3PUYA 2OILA 4JLMA 4Q1EA 3EZ6A 3SQXA 3CWZA 3LY5A 4S35A 1LS6A 2CEAA 4MYHA 3EPKA 1KDRA 1YE8A 4NU0A 3P20A 3QKUA 5HKKA 1Z6GA 4W5HA 1WRBA 3A4NA 3PJRA 4CIDA 4ZKDA 2QSZA 2QA5A 3EWSA 5J4VA 2J7PD 4UJ5A 2JAQA 3ZVNA 1C9KA 1I4DD 1U81A 4DKXA 1WBBA 5HKKD 1KZ7B 1WCV1 4AKIA 3VFDA 2VQSA 1G8YA 3PEYA 2AKYA 3MJRA 3P26A 1RFLA 2WKQA 1AN0A 5H8WA 3LNCA 2QBYA 4G5SA 1IY1A 1FQJA 2KI5A 5HTKA 4OI2A 1KSJA 3P1JA 4RFSB 1Z6AA 1PZNA 4KYUA 3ZZ0A 4EJSC 2R8RA 4DLVA 5BN4A 5IHPA 2GBLA 1FPMA 2FFHA 4Q4AA 4TQ9A 2CL0X 4P4TA 5EE0A 2J5XA 2XEXA 3SJCA 3ZIAD 2FN4A 3VHXA 2W2VA 2ZJ5A 4A8JA 4GFDA 2QMOA 4XD7A 3NC1C 1U0LA 221PA 4RD2A 1ETUA 3A58B 1W5SA 4DB4A 2O8BA 5KPDA 3DM9B 3KUDA 2J59A 4JL5A 1A7JA 1KK3A 3H86A 1EX7A 2GF0A 3BH0A 4M1MA 3O8DA 5F2EA 2HCJB 1Q44A 3IIJA 2ZU6A 3BGWA 1G4UR 4UXJA 1S4QA 4XJXA 4LX0A 4PXAA 2CCJA 3QBTA 2F9LA 4O0MA 1T0JB 2P6RA 3HU1A 1TQ4A 3U7GA 4IXMA 3BH7A 3K09A 2J9RA 2ONKA 1XXHB 1Q1BA 4RKEA 1SVOA 2J41A 2BC9A 3QOFA 3U61B 1PV4A 3UXMA 5EE5B 4F91B 2HT1A 4NZYA 1KI9A 2HF9A 5FOTA 3LW8A 4L9SA 5E7JA 1SVIA 3IQXA 4AIIA 3PITA 1IONA 3RS2A 3K9GA 1RVDA 1S9HA 4L8GA 3SHFA 1RE0A 4MRVA 3KQNA 2BOVA 2C78A 4PAMA 4DCNA 1J8MF 3SBEA 2B8WA 5GJCA 2ZJ8A 1JAIA 5DH9A 1HYQA 2ORIA 2WBLC 3LLUA 3IBYA 2C5LA 4MQBA 1G7TA 2PZGA 4URYR 3CZPA 3LAWA 4B2IA 3AP1A 3NIBA 1TADA 2ZRMA 3OIWA 721PA 3V9PA 1NN0A 4DBLC 2XB4A 1W49A 2ZRAA 1Q12A 4M53A 1EK0A 1F3OA 1G291 2DY1A 4ESVA 1XJ0A 1RYFA 5EE9A 5JWHA 1FX0A 3ICQB 2Z43A 4TYWA 2ZAOA 1E2JA 3LLMA 3AVQA 1P72A 2FF7A 2IS6A 4TN1A 4ERNA 5K8LA 1KNXA 2GCNA 3AGPA 4JBXA 2W6JD 2O5VA 3KX2A 4MUAA 4BZXA 2VHCA 2FZ4A 3X1YA 5GJVC 1T5LA 1HH4A 2X8AA 2RCNA 1AGRA 4PZZA 2CXXA 2D74A 5D3MB 3RRZA 1D2MA 3PIRA 4OQXA 4Y0AA 2V3CC 4D4JA 3QJYA 1RJ9B 3SE0A 3AVPA 1GSIA 4Q03A 4YXWD 3HPRA 5F98A 1TF5A 2ZYWX 4JLOA 1NMZA 3AH8A 4NCHA 3BS4A 2IF2A 3D7MA 2BWJA 3GLFE 2KWIA 5JEEA 3DL0A 1SXJE 2BJWA 2P2LA 1K5DA 1NKSA 4AK9A 4PAOA 3X1ZA 4TLCA 1KDPA 1KO1A 2C8VA 3OEHD 1DE0A 5JHGB 5G3YA 3ZVRA 4POAA 3I61A 2A30A 4HAXA 3U4QA 1NY6A 3VU9A 1KYIA 2HF8A 3A1SA 1WE2A 1XD2A 3QKRA 1E2NA 2IBMA 6Q21A 2GCOB 1SZPA 4QNMA 4C0AC 2FFAA 2XSZD 1Z06A 1HEIA 1EFCA 1N6LA 1MH1A 1CEEA 2WVJA 4TL8A 4RZ2A 3Q5DA 4U5XA 1YJ5A 3PUZA 4DSNA 1US8A 3AP3A 1E9FA 1GRQA 4BLPA 4JKYA 2H17A 3WBKA 4LDJA 2FDCA 2IXFA 3OAAA 3MWLA 4BRUA 1CRPA 4HLDA 4HAUA 5KUTA 4LHVA 1XTIA 4J0QA 3QQ5A 2NO0A 3W34A 2QSYA 1G1MA 1HE1C 1UDWA 5GADl 1BYUA 4TMVA 1ZNWA 3MWKA 4KO8A 3OAAD 3OESA 4FINA 2F43A 4LJ6A 3NHAA 3RAPR 1KI4A 2J1LA 2XX3A 3BB3A 3QEJA 2V1XA 3TBKA 4D0NA 1WB9A 1ZCAA 4DCTA 3LWNA 2R44A 1M1YE 2JIZD 3G5UA 4QKQA 1DEKA 3CKLA 1UPTA 1KI6A 4W7SA 4E07A 2GXSA 1SKYB 1ZJ6A 2WJYA 4Q9HA 1VHLA 3UIEA 3UWKA 3M4YA 5CIWA 1OW3B 2XTNA 2O8EB 2B92A 2D2FA 4CEJA 2REXB 3KB1A 2OESA 1QHSA 2PX0A 1GRRA 4I1SA 3H0KA 3HYTA 5LB2A 4WVFA 3U3MA 3ZVMA 1ODFA 5G41A 1XD9A 1TU4A 2OUKA 4IDPA 3C7KA 3NBZC 5AK0A 1JXMA 1NBME 3DEFA 5AR1A 3R9XA 1P3JA 1G6OA 3PCRB 2ZJOA 4KXFB 3W6OA 4QC2A 3CPJB 3THOA 4O2LA 4A4DA 1CIPA 1VYUA 1OLOA 2AK2A 4Q9JA 2ZEJA 2YOHA 1I2DA 3TW8B 1E1RA 1ZM7A 4PQRA 1CKEA 2GWHA 2HEIA 2A5YB 2PEZA 4H9GA 4DLWA 3IBGA 5JHHB 2QMUA 3L43A 3SHWA 5BYKA 3K70D 1KAOA 2JATA 3REGA 1E1RD 2CJWB 1TTTA 3N2EA 2F6RA 3LV8A 3QSYA 2BMDA 5B30A 2DHRA 4TYPA 3AB3A 1GKIA 4RZ3A 4R71A 2W6ID 5L3RA 3J81k 1GAJA 3E5HA 2XAUA 3SOPA 2R6GA 1SXJB 2ZI5A 4KSCA 3R20A 4RD0A 4II7A 1UM8A 3QKSB 2JA1A 3KKNA 1SVWA 4B32A 2QT1A 4Q1DA 3CWQA 2NO6A 4LHWA 5G3ZA 1YZQA 4P3YA 4UKDA 1EFRD 2YOGA 4X8LA 1CJVC 4B73A 2YHSA 5EZ5A 2WM9B 4YQFA 1X8KA 4DWJA 2DWPA 3DPUA 2ZRFA 4WBSA 3W8RA 1ZD1A 2ZRPA 3AF0A 3T1TA 2QRZA 4L15A 4DXAA 4TZ6A 1DPFA 1J90A 4XWKA 3B85A 4DLUA 4TTQA 2WKRA 2ZJBA 3FB4A 1R2QA 1AA9A 1NP6A 1U9IC 3CH4B 1JB1A 2ZI7A 4YC7A 4NKRA 2QENA 5FL7D 5GVRA 4OQMA 1HQYE 3SJBA 4E03A 5LPNA 4ZIRA 2CDNA 5KNBA 4JBYA 3H1TA 2NOAA 4IRUB 4YMSA 3T06B 3QY0A 3WYAA 2OZEA 1GUAA 1OXSC 3LQQA 2OSBA 1GTVA 1KI1A 1JR3A 1NLYA 2R62A 4D80A 1KNQA 4G5GA 1M2OB 3L0SA 3GPLA 4DCVA 3AGQA 4LPKA 4TZ0A 1XJCA 1DAKA 1Z83A 3P27A 2G1JA 2IS2A 1G8FA 4GOJA 3HP1A 1MO4A 2P6UA 3ZH9B 3KXIA 2OHFA 1LY1A 1JNYA 2EFEB 4Q1BA 1UKEA 3GJ8A 3KTAA 4OI0A 1CRQA 1QRAA 2XNDA 3D31A 4JS0A 2ZU0C 1K6MA 1KDTA 1Q21A 1T0HB 1VHTA 4FMDB 1E3MA 1N6HA 2BV3A 1KMQA 3FVQA 2YWHA 2ZVPX 4BPBA 4PPFA 1CF4A 1ZU4A 2W00A 4UNPA 4CEHA 1AZSC 4BLQA 4LV6A 3T1QA 4IOMA 2Q9CA 2EWVA 1JALA 3ZS9A 1W5TA 2Q6TA 3Q7PA 2YOFA 1DBSA 2QAGA 4QOSA 2WJIA 4EIWA 1A5TA 1YR7A 4C4PA 2ZYTX 4BEBA 3SEAA 5KYKA 4DJTA 1E98A 1Q57A 2N42A 4RKFA 3CR7A 1F2UA 3PEVA 4MDFA 1R0ZA 4EJSA 4NHOA 1E69A 1HURA 3B78A 2ZE6A 3AKEA 3U3KA 4JBWA 1NSTA 1IN6A 4OK5A 2R6CA 4LBVA 3TH5A 4JL8A 1OXVA 1DAGA 2IWHA 2ZM5A 4C2UA 1GWNA 2BCGY 1UDXA 4PHGA 4DEYA 4ACAA 1QHXA 5HCNA 4PSKA 2GXUA 2JJ2A 1R5BA 4KODA 2RHDA 5C4GB 2QGNA 1YZUA 2GXQA 2HLDA 4GRAA 4LYFA 4ZPXA 4QJ3A 2QPAA 1DO0A 3GMTA 2QQEA 3QENA 1XEWX 1OYWA 2F1IA 3B1YA 5C46F 3K9NA 2OAP1 4IKEA 1XX6A 2J87A 4B48A 5E7IA 3TQFA 3T1VA 4JVMA 3I3SR 1KSFX 2Q3MA 4YMWA 3EX7C 1TPZA 3B82A 4TQUS 1JEEA 4B44A 4DT1B 2XNSA 5TY0A 2WPDD 1LF5A 3I73A 1AIPA 3O8CA 5IDVA 3ZZTA 2V6JA 1E0KA 2A3RA 1OV4A 2JLZA 2ZSFA 2RAPA 3FWYA 3BB1A 1E2GA 3GLHA 1E32A 1Q0UA 2BHRA 3EC1A 4GMDA 3ZD7A 4IOKA 1COWA 2O8FB 5EQTA 4I1OA 5TDHA 3LVRE 4JVLA 4BZQA 3C8UA 4TMWA 3A4LA 1E96A 4HAZA 1RPZA 1W0KD 1MABA 3AF1A 3MMPA 1H8HA 4M1TA 4Q21A 4IOLA 1KI3A 3LW7A 5HZHA 2ASEA 2MMGA 4ITRC 2JEOA 1YU9A 3EA0A 1Z6XA 1XEXA 4XTRA 1G8HA 3MRSA 3THWB 5DYGA 1YZKA 4BQSA 3O47A 2WICA 2QY9A 2ZSDA 1VG8A 3CPEA 1GRNA 1HTWA 2V54A 5IT5A 2WJJA 3NXSA 2J0VA 1SHKA 3FDIA 1E9SA 1ZAKA 2R6FA 3OEED 3AV0B 4I1VA 2OAQ1 1T6NA 1FP7A 2IYTA 1M7HA 3B1XA 3O8BA 4W5WA 4D81A 3G0HA 1NN1A 3U3OA 1SXJC 2NZJA 4LHZA 3U44A 3K0AA 4BFXA 2R6AA 1GDDA 4TYQA 1WA5A 2BM0A 1NN3A 2Q0HA 5DN6D 1JQJC 1NG9A 1E9DA 4OK6A 1WXQA 1OFIA 1G3QA 2JLUA 2YWEA 3VAAA 1LNZA 3NH9A 4CEIA 1VECA 3C16C 1ZINA 1CJTC 1OJLA 2EFCB 3VQTA 1EWRA 4Q02A 3RC8A 2H1LA 1NKTA 3AVOA 1Q1EA 5A5GA 3CLVA 1DAHA 1G9XA 4HB4A 5AJWA 3X1XA 1Q22A 2ONJA 1E9RA 5KO2A 5DISB 1S2MA 1VIAA 2ZRIA 5CYOA 1T9HA 4EQ6A 2CNWA 3NBXX 1E1QD 5AJVB 3W5JA 1MO5A 1DAEA 3GQBA 3VHLB 1I4TD 1II9A 3HPQA 1QHHB 2H18A 1AZTA 2VO1A 4BLRA 2FPMA 1JJVA 2X1VA 3CNNA 2CMKA 2RGGA 2PJRA 1OB2A 2IYLD 3IUYA 1TUIA 3NG1A 5FPKA 2PCLA 2ZPTX 5J4LA 5JBQA 2OLJA 1GL7A 4V0NA 3TGPA 3U5ZB 4P31A 1S8FA 1M74A 2EWWA 4ZV4A 2DYKA 2FMXA 3SFZA 4M9QA 5DGXA 1EG7A 3JZAA 2GDJA 2GJ9A 2KJQA 2QL6A 1XBTA 3W6PA 1LV7A 2ZIAA 1ZNZA 3U2QA 3IO3A 2XB2A 3SQWA 3B8HA 3MWJA 1UJ2A 4D4KA 2CL6X 3QF4A 1FOEB 4Q01A 3Q3JB 1IJFA 1Z07A 3EAQA 3TR5A 2Z4RA 3HR8A 1O3YA 2V6IA 2IX3A 2FU5C 3GJ6A 4MKFA 3LD9A 3LO5A 2UZ3A 1LF0A 2AWNA 3QXSA 4PR0A 2TMKA 3SI7A 1R0WA 1S3GA 5TARA 2GVZC 2WIBA 3ZDQA 2B7CA 1R5OA 3KDSE 4FMCB 3AEZA 4GT1A 3AF2A 4PC6A 2ZR0A 1G19A 2IK8A 2J7KA 3UMRA 4NL4H 3WHLA 2I1QA 1EXMA 3GEEA 1IN4A 1OPXA 3IHLA 2VYFA 4YDSA 1DTSA 1OIVA 1NL3A 2FZLA 2CVFA 2PEYA 4FW9A 4IW3B 4Z8YA 1A82A 1DAMA 4PPQA 3SYLA 3U3JA 2ZTSA 3FE2A 4RFSA 5SZIA 1XDBA 2ZANA 4Q5IA 3U6KA 4URXR 2D4HA 4AWXA 4IHQA 4M1WA 2IXGA 4CF7A 5EXTA 2C99A 5KDOA 1TF7A 2FPKA 2QORA 2FGJA 1KO5A 1IBRA 2CE7A 3X1WA 3M6AA 3KXLA 4NCKA 2PT5A 2DFKB 2VPPA 1P2TA 1Z0FA 2F3RA 1FL9A 3GLIA 2HUPA 1W36B 1XWIA 1G3RA 1LB1B 4TMKA 2QEQA 1JECA 4QGAA 3MFYA 2IXEA 3A4MA 2GTPA 1RRCA 4LJ5A 3UG6A 4JLKA 1DS6A 4B43A 4TQAA 4RVCA 3DVLA 2OBMA 4R7ZA 121PA 1QVRA 4OI1A 1G6HA 1ZRHA 2ERXA 5SZJA 1N5KA 2CBZA 1ESNA 3SYKA 2DB3A 1L7VC 4EKDA 5EUMA 1RKBA 2BCJQ 4F93B 1VIYA 4L4UA 2VL7A 1NJFA 4O3MA 2C9CA 2PLRA 4CVNA 1UAAA 1XXHA 1JPJA 5FTLA 3UK6A 3FTQA 4BFYA 5L8VA 1G7CA 2ZRJA 4ZDIA 3GD7A 1Z8FA 4Q9KA 4XH9B 2J7PA 4LWZA 4F92B 4GL2A 1ZW6A 1U8AA 1P60A 3QKTA 3EPJA 421PA 5L3SB 3F5FA 4A92A 1CR2A 4C7OA 1FNNA 3FKSD 1D2EA 1G5RA 4MRSA 5FR1A 1N6NA 4KV9A 2GK7A 3AQ4A 3MUFA 2QM8A 4TTPA 2ZRDA 4BZPA 2RGNC 4IDHA 3JZMA 3B2EA 2NO1A 4Q7LA 4Y0VA 1U9IA 4C0LA 2ZI3A 1CR0A 4GOKA 3SJZA 3IILA 3GP8A 2O8CB 4M0LA 3I32A 2H8KA 2O0HA 2H57A 5M04A 4EDHA 1Z0DA 3ZIAA 8OHMA 2FNAA 4NMMA 1T5IA 4M9SA 3ZD6A 4S2EA 2OCBA 1E9BA 5FUXA 2WAYA 3EIEA 2FSFA 4FCVA 5JFGA 1II0A 1Z0AA 3I8SA 2NO7A 4IXNA 3RSOA 821PA 3BIFA 3KKOA 4QGFA 1CJMA 1OXXK 2WWIA 2ZS9A 4FD2A 4JZKA 2ZRGA 4LYAA 1BOFA 1B0UA 2NO9A 2IWRA 2C9YA 1P61B 4G0NA 4ESHA 3K53A 2Q3HA 5B57C 3B60A 3GFTA 4LK2A 3MAAC 2BKUA 3CBQA 3OFNA 3RABA 3NHBA 3N5CA 5D3MA 4L5BA 3GLGE 3ASYA 4CW7A 2QP3A 1ZM9A 3ZQ6A 2XZOA 1Z5ZA 2IHBA 2UKDA 1X86B 5DSZA 4DHEA 5C18A 3OFND 1GOTA 3UATA 4XOIA 1ANKA 2QN6A 4KVGA 2WWHA 2AL7A 4B3DA 1GNPA 1OSNA 4DUGD 4ZKEA 3L8YA 3CX7A 5CK4A 4Q00A 1T8TA 2Q21A 2W2XA 4KITB 1HQCA 3LXXA 1OFHA 4QHYA 5FR2A 4B3CA 2QRNA 3DZDA 1QG2A 3C5HA 4CDGA 1G3IA 1M7GA 4EPXA 3KJEA 5JI3E 4ZCIA 3TKLA 4OKSA 1IXRC 2BBTA 1LW7A 2F1HA 4HDCA 3CW2A 2WJVA 3CNLA 1Z0KA 2MSEB 1C4OA 2GCOA 2ZREA 3X2SA 1XTKA 4MGIR 2ZRHA 3ZVLA 1CR1A 1XZPA 2YJTD 3HDTA 4R98A 3SFVA 2P67A 1P2VA 1KKMA 2L0XA 1R4AA 4LBWA 2JLWA 3EZ2A 3LQRA 4N3NA 1QHYA 1E2DA 1ELOA 3ND8A 2IL1A 5FPYA 2REBA 2CK3A 4NE2A 3WHKA 1E2KA 3KKQA 2W6JA 4MGYR 2BM1A 1ZU5A 2BKEA 3KJIA 4MKGA 1OHHA 2N1BA 1VMAA 2VTKA 4HAYA 2CK3D 5EUQB 2ZJZA 2AFIE 4RD3A 4AD8A 3OE7A 4R2IA 2PMDA 2RKOA 2ZQ5A 1N5LA 3CUEF 4YXWA 3WNDA 4B71A 1OHHD 3TIFA 2QBYB 1S1CA 1TQDA 1JJ7A 3EXAA 4D0GA 3WBJA 3CR8A 4KFTA 3OE7D 3I92A 3DKPA 1FTSA 2OFWA 2VSFA 4IFEA 3TQCA 1RC8A 4RCYA 1C1YA 3TSOA 2P3SA 1L4YA 5J5CA 1ZYUA 2XTMA 4Q1FA 2J45A 3OEHA 2O8EA 2F9MA 4NTZA 4D2IA 2AFHE 5FOSA 5P21A 4FXPA 2NGRA 1L4UA 4B2PA 4JLPA 1KJYA 2AHOA 3B9QA 2ZI9A 2OCYC 4HZUA 4XTCS 2ZS8A 4MITA 2XSZA 1SGWA 4RZUA 2IC5A 4XVUA 4RZXA 1N3BA 3NKVA 1X1SA 3UG7A 4EPVA 1G41A 2A7QA 3ETLA 1I4LD 3QNUA 3PENA 1KK1A 5FFMA 3MSXA 2WV9A 2DWQA 3R8CA 3WP1B 5H70A 4DLSA 1E79D 4I1UA 3VNUA 5BN3A 2J0SA 1YZGA 4PHTA 4A0FA 1CJUC 2Z6VA 1Y63A 3GLGB 4P0TA 1W36C 1TF2A 4XVRA 1P6XA 2ORVA 1NVUQ 1D8TA 1MV5A 1UBFA 1MRNA 2PZFA 5D3QA 4LJ4A 1JR6A 3TE6A 4QG7A 1R7RA 4QGHA 2YNMA 5AUQA 2EFDB 4ASUA 1A2KC 2GJ8A 3FPAA 4LYJA 2JIZA 5DNYB 1SXJA 3DDCA 1PUJA 1ZM2A 2ZE7A 3CH5A 4HI0E 1K5GA 4Q4LA 4EPTA 1SQ5A 1L8QA 2WJGA 4DCUA 4ZI2A 4US1R 5IK2A 1OH5A 4ASUD 1LTQA 3PR1A 4IOJA 1ZD8A 3AKCA 5JECA 4YMTA 4PZYA 4R2HA 1SXJD 2CL7X 4AYTA 2IYRA 2KBFA 2CHQA 4JJZA 4A0RA 1OXUA 3CO5A 4P32A 4US0R 4A2PA 4GOXA 1KO4A 1F2TA 5IK2D 2CLCX 4C0KA 2IS1A 3HJNA 3TUJC 4NH0A 3WYFA 1XMIA 3DZ8A 5FTKA 2AN9A 4KSBA 3I62A 1W48A 3QI2A 5K8TA 4PQFA 3I4LA 4URUR 5KNCA 5CJ2A 1UBEA 1BMFD 1KO8A 3K8YA 2QQ0A 2RB4A 3CRRA 4MKHA 1DELA 5EP1A 3IHWA 5EE1A 2XOKD 1UKVY 4A15A 3CRMA 2VP6A 1GKUB 2OCAA 3UWOA 4DSTA 3FHTA 3QVUA 1A2BA 3BD9A 3CM0A 4F7WA 5LDDC 1GNQA 4PFSA 2YWFA 1CR4A 4OQLA 3W9YA 2QU8A 4NP6A 4WXPA 2R65A 5E95A 2Z83A 2RGXA 3DKVA 4DCSA 4KLNA 5DHAA 3PVSA 2A9KA 4JJKA 2W6IA 1Z22A 4BASA 2H7VA 5BYJA 1X8LA 1ZNXA 2PMKA 2OLKA 4F4JA 3U4QB 5JJIA 1BO6A 2ZRBA 1XD2B 3QKRB 1AS2A 2P6NA 2OG2A 2D3WA 4B33A 4DLTA 2JLVA 3B5JA 2CE2X 3B1WA 2EYUA 3AVVA 3GLFB 4W9MC 1CU1A 3EG5A 5EE3A 4HB3A 1EFHA 3QXCA 3R7WA 1EFRA 3BFXA 2G0TA 1L2TA 1TNDA 1OH6A 1EGAA 2QE7D 3PFIA 1Z2CA 2LKDA 5LBIA 5G40A 4N0EA 1J8YF 4LBYA 5JZVA 3TSWA 1P7CA 3M0EA 1KK2A 1YZTA 2BBSA 5FBVB 3EPHA 4CZ2A 3EZFA 4YONB 2WMOB 2XXAA 3TK1A 5JJKA 2FFQA 4RSGA 1NBMD 4RD4A 3A6PC 4LC0A 2ORWA 4YLGA 4EFMA 5CITA 4HATA 3FMOB 3FMFA 3CX6A 2G6BA 1JBKA 5EP3A 3BJIC 5KSYA 3A37A 2OO7A 2J3EA 2AR7A 2A78A 4LYHA 4DZZA 1FP6A 4WZ6A 3UMFA 5FL7A 1JR3E 4GZMA 4MKIA 1CXZA 4C2TA 4K46A 5KHOC 3AVYA 2QMHA 4OHXA 1ZUHA 3B13B 3DM5A 4NPHA 2XGJA 1ZCBA 4NCIA 4K81B 3WMFA 4DIEA 1QG4A 4QM6A 5HPYB 1KZGB 1TQ2A 4LBZA 4BUJA 3M1IA 1ESMA 4HB2A 3CRVA 1T3HA 2ZE8A 3DOFA 3MJHA 4GBMA 4JLNA 5KDDA 2J46A 4PO9A 2RGCA 1TU3A 1S1MA 1X6VA 2H5EA 1D6JA 3NEJA 2KB0A 4KYIB 2OFXA 3KJGA 1KOFA 4AC9A 621PA 1H65A 5JRZA 5KSZA 2IS4A 2O8DB 2FG5A 3IPXA 2OE2A 2ZRCA 5FPTA 1SVSA 2FV8A 3EASA 3IO5A 2F55A 5EXSA 4BFWA 5JSZB 1E4VA 1XPOA 5JJLA 1F48A 4Z51A 1ZMXA 1R6BX 2BMEA 4LJ8A 1CJKC 3FOZA 1XTQA 2KSQA 2OBLA 1U8YA 4DT1A 3K0CC 1NLFA 3MLEA 2NTYC 1J99A 1Q1QA 5FTJA 1QF9A 4Q1AA 1MO6A 1SVLA 3GEIA 3L2OB 4OL0A 1KIMA 2Z0MA 2C03A 4IFBA 1XP8A 4ARZA 1AJEA 1A4RA 5CDFE 4PHHA 3RDPA 4IEIA 2O8FA 2WKPA 1T3SA 3EWAA 1YHNA 2IYXA 2F1RA 3I72A 2CLDX 2JLXA 1Z0IA 2NQ2C 3RWOA 5C4MA
chains in the Genus database with same CATH superfamily
4HH4A 5K8UA 3DNMA 1N6OA 2QRVB 4PLTA 3N0WA 1NVDA 5ED0A 4DLAA 1ORDA 3WL8A 2D0DA 1U8UA 4JXZA 1YBVA 2VT6A 5FUQA 5J23A 2MIIA 2Q9AA 4IGAA 3T4XA 4XUCA 5IXJA 1FBNA 3Q72A 4ZAYA 2RE8A 1B15A 4EF6A 1PGNA 1NATA 3DH0A 3OIVA 3FCEA 1POWA 2YZMA 1LQ2A 1K7EB 1AZLA 2P5UA 4TZTA 4WWHA 1N25A 5I5EA 2YINC 3PK0A 6ABPA 3D54D 2NVWA 4GWKA 4HFRA 5SZKB 4K05A 4RCVA 4D56A 4OQNA 1H2HA 4P7BA 1SQFA 1U1CA 4MUXA 4AQYB 2M6LA 1HFEL 3EY4A 5A6SA 1H4QA 3M5DA 5E9JA 2UXCB 1H1TA 2QRLA 3N0TA 4MPTA 2RHTA 3CF0A 1Z0SA 1BG6A 2BR4A 3IE2A 2QL5A 1JQLB 2DHEA 2QUIA 2QZSA 1JQAA 3OCYA 1MT0A 4RLFA 2QK4A 4HX5A 4EB6B 1OAAA 1Y3AA 1RWOA 5DEIA 1N77A 5JDIA 2AR9A 1FFHA 1GQOA 2HRRA 3KLBA 2HMSA 2J0UB 4F9GA 1VYVA 4O2BB 2WLTA 4JKOA 4S24A 4CV0A 4FYVA 3G0GA 1Q0ZA 3IEXA 3JQGB 2CLKB 5DGIA 1IN7A 4FE7A 4JLBA 4YDQA 5BQ3A 3PUKA 1LH0A 2HBZA 4G25A 2BEVA 4Q7KA 2EVWX 3PQDA 3R0QA 2YKGA 1UBCA 2X3FA 1IM2A 5AVOA 1ISJA 1W6UA 1ADYA 2ZRNA 1SOWA 4KDEA 1U0HC 2GJSA 4GP6A 3TOXA 4JU8A 4KC0A 4BNLA 1Z4LA 3LU1A 3KVRA 1MB4A 3MTQA 4O25A 3HUDA 1ZW1A 3B7GA 1IH8A 2H4JA 2RKWA 4MGKR 2HO4A 1Y4ZA 2HHCA 3GIWA 1KE2A 4F3RA 3WLQA 4EGSA 4I99A 1OH7A 4ND6A 1RBZA 1EM6A 2D62A 3QX9A 3ILHA 3BTVA 3SQMA 3K8ZA 3IMKA 3GJSA 3A27A 1QG0A 4JC4A 2FFJA 4LSZA 3OZCA 3EDCA 4DMMA 5AVRA 3ZQJA 3V1KA 1KAMA 3PC8A 3L06A 1SU8A 3INRA 4Z86A 4NX2A 4WJKB 1ENPA 2XZPA 3I34X 4DC9A 1CBUA 1L4KA 2JGIA 1N0VC 1YVDA 1YUNA 1ZO8A 2RGAA 2YS6A 1OBFO 1Y5LA 1IUKA 1SUEA 2DSNA 2FMHA 1K7SN 1F38A 4LOJA 4M0CA 3GUVA 4LSGA 5CPBA 3W3AH 3UBTA 1PT7A 1E99A 1XRLA 4WTOA 3FN4A 3MB5A 3JQBA 4IEFB 4O02B 5BYBA 3WB2A 4TVSA 1S5PA 3L7OA 1R12A 2OHIA 1DC8A 1MB0A 4XFDA 4CG2A 1AQ6A 1IUNA 3L9XA 2X86A 4QU0A 4CYMA 5L51A 2ZYRA 2F3TA 3O91A 1FNBA 2I4RA 3RU2A 4EO7A 3SSOA 1E63A 3JRXA 2JPDA 5JADA 1JHPA 2ODWA 1RPAA 2HXYA 1ZD3A 1E3WA 1ZCJA 4QPNA 1S7CA 3C6QA 2C0CA 4BNYA 4JLJA 5B58T 2R1ZA 1IC6A 3R76A 5AESA 6REQB 4U7DA 3HH8A 5AYVA 4J91A 3LQ4A 2VK2A 4PIVA 1CRZA 3AW9A 3AJRA 3PDJA 4XQ9A 5JSKA 1R8QA 3T0GA 5L3VA 2QTVB 1KK0A 3GJ4A 4V3CA 2QDKA 2GAOA 2HSWA 2D7DA 3L7LA 2VHJA 4EFMA 5BWNA 2AZMA 2DFLA 1KSHA 2VTVA 6ADHA 4LJRA 2EKZA 4WERA 4URWR 3MJFA 3O03A 1IHPA 4GLFA 3CGGA 4R81A 1L8XA 3K9CA 2Q7DA 3UANA 5JI2E 1N6IA 3EVZA 2ON6A 4MJXA 2RAUA 1A2OA 4NJEB 3U1VA 3P4YA 3EH2A 3L8EA 4PV7A 2P1RA 4EL0A 3DDZX 4M2LA 3FCCA 4FOLA 5KNDH 2OZPA 1E2FA 5DHRA 2E82A 2RMKA 3IEVA 2GK6A 1T8YA 4LPSA 4WLVA 2OFOA 3TRHA 1P7PA 3DFZA 5KTPA 4KACA 3C3JA 2OSVA 2PWPA 3DQQA 4DC1A 1E2MA 2VXBA 3ED1A 2AW5A 2PKQP 4F6RB 5HJ7A 1YR9A 4TQGA 5KTYA 2KQUA 4EJFA 4IEEA 1NDHA 4LZWA 2R68A 4TLEA 2OOKA 4PVCA 1E89A 4FYHA 1QTRA 2IOFK 1W36D 3DMGA 2DC1A 3AFMA 1B14A 3IAS1 1SELA 4JHXA 1E92A 1VKOA 2Q50A 2PZ8A 4MRRA 4DXHA 3OX1A 1HTTA 2QTMA 3FW1A 1V5GA 1NVFA 2CLFB 4IJ5A 4LA4A 4M1KA 4AY4A 4K0KB 3W5VA 1DNPA 3K96A 5C34B 3JAWB 2W9XA 3JCZA 4XQ0A 5CK5A 1I33A 2ORED 3HLTA 1KOLA 1GPKA 3CNEA 2IPXA 3KL4A 3PP8A 1T9BA 4IFTA 4F3YA 1T4DA 3LY9A 5E4JA 2UZIR 4MV0A 4BJ1A 2WT4A 1UJBA 4Y30A 2A2ZA 1EVEA 3W3AA 1LCIA 4JK3A 2IGBA 2ODBA 4MVJE 4ETIA 3EQ7A 5C8ZA 5L3SA 1E1LA 2EGHA 2A1UB 2HGSA 4YMUA 4I5GA 5AVXA 4TT3D 4GWGA 1T9CA 2CYCA 3NVAA 4JC8A 1XTRA 1M2KA 4LI3X 2I3BA 2DR2A 3DVAB 3DWFA 2F90A 2HH9A 3KQVA 1PS9A 4TYMA 1U90A 4KCGA 1UKYA 3QE2A 1CUAA 3I5AA 1DLIA 2CDCA 2ARKA 3GJ0A 3PVCA 3RSSA 1C1XB 3SS7X 1WQ1R 1LX7A 2Z8YM 1G2PA 3G9UA 4B6QA 3VSDA 3VBEA 2HR1A 1YB1A 3QH4A 1NAHA 4P2BA 1BEEA 4YMLA 4XIFA 2Z8YA 2DVMA 3RK0A 4COKA 5SY6A 3ZI0A 2PCJA 1WXDA 3DYVA 4EYGA 2PH3A 1CLUA 2PBRA 4GPZA 2H63A 3H3JA 3L7AA 1NT2A 3EA5A 3IP3A 2AX4A 5AHOA 1U28C 4QIHA 5HKLA 3VPFA 1I0LA 4DRXB 1Q50A 1M2FA 1EE9A 4N6GA 4NCJA 4U02A 5TT0A 4K1LA 4YJKA 3PFNA 5I9TA 1JB9A 2G7MC 4YQYA 3OSZA 4D9EA 3IIMA 2QLMA 1AO0A 3OA0A 3CLUC 1OKKD 4KLCA 1BWPA 1HDZA 3ROXA 2V3WA 4YPOA 1I6KA 2G9RA 4TSRA 5IYZB 2VSOA 3VDMA 3KTFA 3T7CA 1Q0PA 3A9UA 5CDGA 1MC4A 1OGIA 3VZDA 3QSGA 4JYCA 3BFKA 2A33A 4R0MA 2WMYA 4HWPA 3SMQA 3VDXA 5KNDA 1EX6A 5AKYA 1XMXA 2JJMA 3DAPA 3PNBA 2VF8A 4KBYA 1O9HA 1UMDB 4MCIA 4ZYLA 3D8TA 3PTZA 3AR3A 4ZCPA 1Z8DA 1JJFA 1GGJA 5D5QA 3N2IA 1ADBA 3FKSA 3LOQA 4F2PA 3K3PA 2HPHA 2XI4A 2VQFB 3IR7A 4DLRA 5UKDA 3QEOA 2ETVA 4ID9A 3OQNA 5AK6A 2JFGA 2P5YA 4V1CB 1JH8A 5C5DA 5IRCD 1JBQA 3H11A 2IHYA 5FNVF 4X6XA 3UB4A 4O59O 3ONWA 2VBGA 4ZOAA 5JWOA 4UQOA 4JI0B 3FGNA 4FWIB 1K3FA 3HKEB 1RLMA 3DCYA 3DV0B 4O0LA 1C8BA 4PX2A 4OGWA 1JR2A 1RIFA 1EE2A 3PG5A 5EWLB 5KJFA 2DEUA 5IJ9B 2FX3A 2H6EA 3FR8A 3NNNA 3GEGA 4UXHA 4UBOA 1EHYA 1YBFA 1NLUA 4L08A 1XQWA 5JNSA 2HJWA 3JQ9A 2FW9A 4HNAB 4UASA 3DLIA 4EYQA 5B12A 4EO9A 5K7SA 1NJ8A 1XYVA 3EEBA 2IRWA 4TM8A 1QGOA 2JC3A 4UM9B 1DXOA 4Q12A 3HRKA 2ZSEA 3A10A 1JWLA 4ARUA 1V71A 1RXCA 1SIBE 3DGEC 5FBQB 2VJBA 2XBUA 4LRQA 3LY8A 3LKVA 2IYSA 2XECA 1XK6A 3PICA 3H19A 3C6ZA 1IY9A 1KVTA 1XHLA 5JAIA 1Y37A 2VDMB 3TR6A 2I6XA 1EIWA 4MVWA 1W35A 1Y5RA 1QWSA 1QPGA 2K5UA 1ZOIA 2I4MA 4ZYWA 2DY0A 3L6DA 2PU5A 1Y9DA 1YS4A 1KYVA 1Z5NA 2VRCD 1MAWA 2RHMA 2YIMA 3GHYA 4R2WA 3T5TA 3S2FA 2VPZA 3DBRB 4HLUC 1FF9A 2FE4A 1U1FA 2WPNA 3IE0A 1E64A 4LNHA 4FGKA 2RHLA 2DRIA 4RF4A 1RE1A 4GZ5A 1EFDN 1RABA 2A84A 3LPMA 1N5MA 1RJ9A 5FI5A 4NLLA 4G1VA 2O1XA 1A95A 2IT1A 2BRUC 4ZRDA 3T38A 1T2DA 1X3SA 3GJ3A 3D4PA 1E5QA 4MYRA 1X87A 2D5IA 1C7JA 2B9EA 2QGZA 3K0CA 1HPLA 4FC7A 4HQ6A 5ALWA 5FP0A 2BELA 4A2WA 1Y6RA 2QW8A 1EHCA 3R3YA 4Z49A 4EHFA 3NX4A 4AQDA 1NPTO 1L0BA 1ZBDA 3ITEA 3L1KA 1UOPA 2W7TA 4Y98A 2QRQA 1DAFA 3A1DA 3NXKA 1P75A 4B6FA 4OK3A 3UB2A 1AV6A 1HDIA 3IEUA 1K63A 2L19A 1XDZA 4XD7D 5I8WA 1RMTA 5TGTA 2FW1A 2OGTA 5IAJA 2C2MA 2DH6A 3RROA 5KTRA 1PUIA 2V1UA 1EA5A 3DTYA 2CF6A 4NH4A 2JJ1D 2VIIA 1K7XB 3EY9A 2QJFA 3FNFA 3T5GA 1VCOA 1C3VA 1GL6A 2QY6A 1Z74A 3HP7A 3EX7C 3C3EA 2FP4B 4X44A 1OZHA 1SNYA 3L4JA 4LFAB 1OPRA 1T24A 1WOYA 5DMXA 3REQB 5BR4A 4WIAA 4S05A 3D6UA 2FJUA 1YRHA 4EELA 4H60A 1UEIA 4H0FA 1ZUNB 2Z2XA 4OB8A 3MUNA 3GP3A 3KZMA 3V4RA 5K6RA 3CEMA 5J43A 1G4AE 4P35A 5LB4A 4LOHA 2SHKA 1OILA 3ZDAA 3VJRA 1EINA 2VZEA 4IH1A 4BNMA 3IPCA 8LDHA 1IN8A 2SECE 4YJ3A 1TA9A 4MJ3A 4MS1A 3A1VA 3EF1A 1FDUA 3P9NA 1KJNA 1NY5A 1T43A 4B76A 3D6TB 3WYCA 4NONA 5IH3A 4AICA 4UHDA 3R9KA 3WV5A 1RYMA 4ALJA 4PN3A 1B4DA 1V8OA 5JFTA 4Z4QA 2JBAB 2VDQB 4TTRA 1YQXA 2J4DA 3BSYA 1DKPA 4YJGA 1VJ0A 2ROQA 2WDZA 1J49A 4AF7A 2AYXA 2PE5A 2WFLB 4Q4AB 4WFJA 3OA2A 4D42A 3ZGXA 3GNSA 3H2KA 4C7VA 3DLHA 4DJAA 4LZPA 5LFAA 4CE6A 4KHZA 4I55B 2C1XA 3IXMA 2V7QA 3B1ZA 3I28A 4FI3C 5EP2A 4QL3A 5BV1A 2J9GA 3VR3A 1FNMA 3OPQA 4NQRA 4WOPA 1I6MA 2YCLA 1RZUA 2I2XB 3R3SA 5A4KA 4MO9A 4NYMR 3UYKA 3KQLA 1A76A 4KXLA 1NMXA 1XZKA 3AETA 3SNHA 3W1WA 2WWTA 2PD4A 2CJFA 2FLVA 4PN7A 3OE1A 5JLJA 1OREA 1MD9A 2TYSB 3GLTA 3OHPA 1U7WA 3I8OA 5JZBA 2WFAA 4F45A 4B6EA 3DR5A 4R8RA 5LQSA 1J8VA 3EEYA 4JP1A 2J6CA 1MOZA 1ZGJA 5KYUB 1Y5NA 3SIWA 2ACEA 4DM3A 1JPNA 3EVAA 1QFXA 1MQAA 3D0KA 4DN6A 1A9XB 1NVVQ 2BF4A 2P0AA 3V55A 3I6QA 2FJPA 3CH6A 1N7JA 1FDOA 3VNBA 3WZMA 2VEOA 3QIVA 1R8YA 1GPMA 4D0LB 3TZBA 4B4DA 1ESEA 4V39A 3LCCA 4ENTA 1NNSA 1N4AA 5EZYA 1J20A 2XOXA 2XYVA 3D4LA 3GF4A 4OQEA 5EWJA 4DDWA 4IF4A 5C8YA 4LVUA 4UAGA 3Q10A 4XLZA 3BRSA 1DJOA 2GLTA 2NACA 3MCWA 3MRVA 4F5EA 1YGYA 1P4SA 1GZVA 1K8RA 1XHFA 3BRWD 3PDWA 4FP9A 4ZD6A 1RJFA 5T6BA 2OPBA 3QKSA 4DV6B 2QZ4A 1JKXA 2ETXA 2ID4A 2P9EA 4FOTA 4OMDA 4F6CA 5IM5A 3P2JA 2Q8PA 4LS3A 2GM9A 5G2OA 1I7LA 5AVKA 4Y2GA 3WIEA 5LQAA 4Z3OA 3FPCA 1HE8B 3IQDB 4QUAA 3UHOA 4WKGA 3EODA 3QVVA 1ZD9A 5TGDA 5BXQC 5LZ4A 2C5GA 5IVHA 3AFIA 1PBNA 1BMFA 4YTEA 2OT3B 4GOOD 5D51S 5DNVA 5JANA 1E7WA 4O4JF 2HDOA 5E9AA 2ZOSA 4TL9A 2JARA 5IN5A 5T4HA 3TKYA 2ZBUA 2AEMA 4FW8A 2XGGA 4FHCA 4RA9B 3VJLA 2QX7A 3G85A 3K7EA 1XPJA 2ZQZA 4HNHA 4V0KA 1RI5A 4J2OA 3GFOA 2PJZA 2BMFA 1TQ8A 4FNAA 4L5AA 3I0NA 3KV1A 4JD5A 3CMMA 1EK2A 1I5EA 2P9QA 3H2IA 4YLYA 5DW0A 5TEWA 2WWFA 2O0JA 3X1KA 2Y4NA 3KYIB 5F3RA 2JI4A 4QYMA 3AHGA 2GESA 4KB5A 4BRWA 1RHJA 1BDBA 3CU5A 4YRSA 2XMCA 2I6FA 4PBTA 1XUOA 2CHGA 1CZNA 4IM7A 3GARA 3C5EA 2PLWA 3KPVA 4YJFA 5DWVA 1QK4A 1IN1A 3UGQA 2GPSA 5BO5A 4BECA 2IF0A 3FMPB 2FETA 2BPOA 2Q2OA 1IVYA 1UBGA 1UOOA 3CSUA 3OWHA 3PR3A 1M1YA 4UDYX 4A91A 4PLZA 3SZMA 1W4ZA 3HM9A 5JO0A 4ED9A 2QG6A 3PKZA 5BSFA 3DTNA 2X5JO 2DKNA 5KSPA 2WU4A 4K9DA 5JFOA 3M3DA 3B6ZA 1M2OA 1VPTA 2GAJA 6CHYA 5JJ5A 1HQKA 1OCEA 3ABIA 2LBPA 3MGKA 4CM6A 1N0WA 1NXWA 1OLSA 2EZ8A 4N3BA 1D0IA 2JHCA 3SR4A 2QG9A 2VT3A 3F8WA 2P30A 4UHKA 3VKFA 5CVEA 4DPKA 4XSVA 1YI0A 2VFAA 3TQRA 1TL7C 4WD3A 2NP6A 3M6XA 1UKAA 3PE4A 3UPTA 4OLFA 2ATEA 4XQEA 1S01A 3KKMA 3O4JA 3TR0A 4M0PA 4NAHA 1XEWY 3IT3A 1TAHA 3LKBA 4KR7A 3C1AA 1VG1A 1G20B 3QWBA 4FBLA 1PEYA 2H9AA 1S2GA 2FEOA 1T9KA 4LDNA 4A1FA 5HBRA 3VKWA 2FB9A 4NU6A 4MYUA 4A5SA 5K4HA 3I4CA 1CY1A 1WNFA 4O4LA 4OHVA 1DOZA 4G4SP 3DOCA 1U11A 1DARA 3ZHVA 2I87A 2R2GA 2WUFA 2H16A 2PX3A 2XDQA 4JELA 1T8PA 4JR0A 1UJ4A 3V8RA 1LFAA 2VA8A 3IMFA 1NHWA 4E33A 3BK7A 3FNQA 4BGDA 5EXXA 4P93A 4G5RA 2ZIXB 3MB8A 1RWPA 4OQPA 3W5IA 4CCSA 1U3GA 2HTEA 1XZJA 1UMCA 1K92A 2W2LA 2QUJA 3DG9A 2P91A 5K8IA 1OB5A 3CZ4A 2MSKA 1XCMA 1AJEA 2GM3A 2YASA 4TLBA 4Z7QB 1NJ6A 1WDWB 4I1RA 5GJBA 3BYZA 1FVFA 1X2BA 1U99A 4QUKA 2ZI6A 1Z2PX 3H99A 1JQDA 2A57A 3DNFA 2E87A 3CHYA 4CEJB 1OIWA 3H2HA 3PU6A 4KP7A 2OLEA 2QR3A 5JR3A 1P2SA 1QBKC 1DINA 1Z18A 2FK7A 2GDZA 3IIKA 4R5HA 3QYFA 3LHFA 5JS7A 4K87A 5ALNA 1Z25A 1TTHA 3FRJA 3PGA1 1E2LA 3G0DA 3GH1A 5ALVA 3I6BA 3P2YA 1Z2AA 4BNFA 5JCZA 1T15A 1DZ3A 3UGTA 4REQA 4HUQA 4EL5A 5KJCA 3CLSD 2O0KA 3S1AA 2I62A 2DQSA 3FFBA 5CFMA 3K1JA 1GQYA 3G8BA 4CL8A 4UM5A 3ROTA 3KLNA 1Q2XA 2IYEA 3OETA 1F3LA 5B37A 2G77B 2FW6A 1NJSA 3KYCB 1V4NA 4IJWA 1J2EA 3EXHC 1RQ7A 3UAWA 3AKYA 2C4HA 5A5EA 4KUEA 4HNRA 4JEUA 4CKZA 2WG2A 4C6RA 2YVAA 4DA7A 4EJ2A 2EJCA 4CXMA 2ECKA 4TWRA 1YV9A 5CCEA 2QMQA 5K8CA 1E4EA 1QR2A 1J33A 3KE8A 4DIOA 4NR0A 1PFYA 3MWFA 2M98A 1ULHA 3M1AA 3F46A 4Q4JA 2LGJA 2P2YA 4B83A 3ZCTA 2YV4A 4OIFA 2OGZA 2E4XA 1MPXA 2OYCA 1XTVA 2Q3FA 1XZQA 3QEBZ 3GAFA 1JR3D 4U7HA 3R7WB 1WMBA 1R0YA 4R2MA 3FLEA 3TEMA 4E51A 1YRBA 2VXCA 3WGKA 3UJNA 3LCMA 3PL5A 4RETA 2JZNA 4XCXA 1SRQA 3D0OA 2IV3A 4US2R 3DCJA 1J5EB 1IBCA 4FCWA 1Z5PA 3KAQA 4HN2A 5F76A 1V5FA 1ZGGA 3A28A 3OOSA 3QXXA 4N3CA 2W6CX 3A6EA 4XB6B 5B36A 2A0XA 3K8QA 1DEAA 4UUOA 4E11A 1MNQA 2BL4A 1F5SA 2BI4A 3JXEA 1FP1D 2VHZA 3F6BX 2JEZA 4L27A 1G18A 2OV1A 2FTKE 4MWOA 2VHUA 4TSFA 1D03A 2YC2C 4EQZA 1Q91A 3PWTA 4F9FA 2XA9A 2E89A 3RSLA 3P9QA 4BMSA 4N0DA 3CLTC 3KQOA 1TK3A 1CUHA 1R6AA 1JPUA 4WBNA 3HJRA 5DLYA 5H81A 4TTVA 3RWMB 1WZIA 3MXOA 2EKQA 3ZU3A 1BGVA 3DV2A 5EGNA 1UFQA 2LDXA 4IVNA 4ALIA 1W581 2P3OA 3RHFA 5TPZD 3WGLA 1I30A 1SBCA 3CZAA 1LFDB 4B7XA 1DLJA 2AOUA 4RD1A 5E38A 5FPSA 2I2AA 3TM5A 4N9WA 5I9MA 1TT7A 4HL6A 3M70A 2B99A 3CB4A 3AVXA 3F4BA 4F3KA 4JOCA 1O95C 5KX5B 2J9FB 2I4OA 3LPDA 1V43A 3LBFA 2J3MA 3NETA 2YFHA 5AOCA 1LRKA 3AUSA 1YZHA 5B2EA 4NK4A 3Q12A 3LJKA 2I22A 1JLLB 3TUZC 2Q1SA 3ABZA 3DVSX 3SEZA 3TQSA 3V1MA 2HXGA 4DBLE 5T67A 3AJDA 5KPJA 3PNYA 3QK7A 3N8HA 3AM1A 1PZMA 3IVXA 3JQEA 4UZSA 1UKZA 3MJ4A 4RY0A 5ILQA 1FQWA 5HF6A 3CRQA 3E7WA 5CB8A 3WYDA 3CE6A 5HKOA 2O5RA 3I8XA 4MYCA 2ECFA 1O87A 2NSYA 4RHYA 1QR6A 1Q83A 1PRYA 2ZCJA 1SWVA 3TLXA 1N9GB 4NBKA 2X40A 4B1FA 2R1VB 1U1IA 3W3ZB 5B3JA 4KHPB 3ZKWA 4KI7A 2B6HA 5TS2A 3TW4A 3X1DA 1NG1A 3C45A 2R8ZA 4G26A 3PUWA 4XWGA 1ONNA 1QAMA 2FN8A 2FUKA 5AI9A 5KVCA 1QKJA 1RRPA 4FEYA 2IVZA 4FUQA 5IHXA 4J4TA 4BZWA 1OWNA 5TVKA 2RH8A 2J8ZA 3CCFA 1PK9A 1MC1A 1OC2A 3DGFC 3H8SA 4ARZB 1YVPA 3KVVA 1E6UA 1EHIA 4QYIB 4PZLA 5CLLA 3QPWA 4QUEA 3T3MB 4Z4FA 3SC2A 1MW9X 2X3YA 1YZNA 4A0QA 1F6DA 3HWRA 5AVJA 1CUDA 3HM2A 2W6OA 5EC8A 2G3YA 2O23A 1UWLA 2H92A 4M46A 4YJHA 1DQNA 2A7XA 2BKLA 3ZNPA 1JDTA 4ABYA 2QTTA 5FUMA 5DNWA 3PQ7A 4UTVA 1G0OA 1SIOA 4ZI5A 2WQ7A 4GX5A 3OIYA 1SULA 4JFAA 5DBHX 4EJSB 1JHVA 1IAQA 1EFVA 1XD8A 3P0JA 2BFAA 3L41A 4I81A 4FZ3A 1ABEA 3VH1A 4LAFA 4ALMA 3ZVKA 4KQHA 4LF6B 1SFRA 3JRNA 3PTAA 2PXCA 1ZSVA 1IB6A 1JG7A 2QX6A 1M0SA 3PNSA 3VJMA 1YQTA 4HMQA 3OUUA 4YACA 1NSFA 1RYHA 1Y48E 1KVQA 3DMRA 3ONVA 2HBQA 2AXPA 1GA6A 2BTQB 1A8PA 1XMVA 3OIUA 5BMVF 1QUEA 1TM4E 1LQTA 2K7ZA 3T3OA 1RCUA 4C3ZA 3OF5A 4E08A 2BFDA 3WTBA 1S7GA 2EZ9A 4HAVA 4NEGA 1GZSA 3G7UA 1ZOLA 4BY9E 3L6EA 1WY7A 2VTEA 4YYEA 4U0KA 4X1OA 2A14A 5AOBA 1YK0A 3LT5A 4KO1S 4D82A 2WQ6A 1KPIA 2ZRLA 3BH6A 1RRKA 2ODAA 3FJYA 2AJ8A 1G5TA 1W1WA 3NEAA 5REQA 4YRBA 4HWKA 4GSLA 5HYVA 3G0CA 2HSGA 1S6YA 3C3CA 1R66A 2AVDA 3ZHUA 5IASA 1UQRA 4G9BA 3HCPA 3LXMA 4K9NA 5C5IA 1PD1A 4BFUA 3K5IA 2YZ2A 1VMDA 3FGOA 4U9UA 4C1NA 4OHYA 2OCPA 3I1JA 1IPFA 3QGMA 2FOXA 4RJKA 2A5FA 3ZV5A 5DI3A 2BEWA 2W0SA 4N3GA 2IYVA 5ALFA 2NIPA 2AD5A 1I10A 3KR2A 1C7QA 1Q2UA 3DE6X 5DT2A 3TPCA 4C0JA 2YV5A 3L7IA 3ZE2B 3ZDYB 2QMEA 2JK0A 3BIOA 1A7KA 1Q1ZA 1CY2A 4ZZ2A 1GG5A 1R6TA 1PKXA 4GXNA 1JU3A 1WBJB 1FXSA 4FMBB 1KC3A 3UWSA 5BR7A 4CKWA 1W0JA 1XNJA 3QUBA 5LL6P 1LPOA 3K70C 4W5NA 1FS5A 3UJHA 2WF7A 3P5SA 1XEXB 2HRQA 5HKBA 3BWYA 2X0KA 3HUUA 3K6SA 3ZCQA 1YRAA 2P68A 3Q2KA 5C80A 2XVZA 3AF4A 1MO3A 3GJ5A 1OU4A 4HFNA 2B9VA 3WK7A 5K8VA 4KK3A 4F97A 3A6LA 2B0CA 2G9VA 2WHPB 5JSFA 4XDZA 5BR8B 1NUSA 1SCUA 3ROPA 4R83A 4AJOA 2BE9A 2ZXEA 1BYIA 2NZ2A 4JNKA 1ULAA 4PSUA 4LZZA 1H42A 4M37A 4KFSA 3ZWMA 4KNYA 2O7VA 5ES4B 1LEHA 2CFTA 2PUBA 2QLJA 1AKNA 1U1GA 3GLQA 2ENUA 2O8CA 1LJ8A 2NXEA 3LYAA 2JHFA 3A7DA 1UJ6A 3M9LA 4HTAA 5G53C 2QTWB 2X0FA 4YRZA 2RGBA 5LP6A 3BIJA 3FDZB 2OHVA 1R0LA 1E3WB 3MCVA 4GU5A 4YP9A 3TJRA 2X3UA 3BORA 4U2GA 5AKGA 4EHAA 4GEKA 4ZEWA 1F0KA 4IS3A 1IOLA 1HSOA 4EHHA 1P62B 1YMVA 2YVUA 4QJBA 4R68A 3JYOA 4MEJA 2PJDA 4OXIA 2YYSA 2X19A 3NHSA 3PNKA 3EEQA 5IUJC 1JI0A 3MW8A 1VCHA 4M21A 4KGXA 5HILA 3ZH2A 3TRDA 4GI7A 4DCPA 3BCHA 1JLSA 3LOPA 5CFPA 3S1LA 5KOJB 3IEMA 2KW5A 1F12A 2E9SA 1LKZA 2VUUA 4U7WA 3RS0A 5HZKA 2D1TA 1TEHA 1C7EA 3WQRA 4KBGA 3WO0A 3L46A 5TMPA 1F2DA 3I76A 1M67A 5BRAA 3RUHA 1JP7A 1E7QA 5CJJA 3PHLA 4FFLA 4A2CA 4B3MB 1D2GA 4LYDA 4RD6A 5LXTF 5I8PA 2X2FA 1Y7HA 3SQDA 2HDNB 2IUSA 1MAUA 2OBNA 2WZQA 2ZRQA 3AUKA 3I2KA 4O4IF 5DTRA 1REQB 1CP2A 4BTVA 1QH8A 3GCWA 1V6AA 3UT5B 3UKDA 2IUUA 2UUCB 2AG6A 2F3PA 5H4HA 2PZLA 1UEJA 5LZ5A 1AS3A 4ZGWA 1EWVA 1T0UA 4ZJZA 1WW3A 1IZYA 1ODKA 1KTIA 1QLJA 4UNRA 3I9V6 2HA2A 2WWGA 4MR8A 1KRHA 2HLHA 5BXYA 3TPZA 4KR3A 3VTKA 4UBIA 3PHGA 3TL6A 3G2PA 4MYDA 4QXMA 3HDGA 3MZ0A 1RI3A 4XIGS 1IZ0A 2C54A 2WYWA 4HH0A 3RVNA 5CBPA 4PTLA 3VC2A 5JAOA 2Y66A 4MWEA 2A0YA 5KHLB 2C7OA 5B58C 3PQ6A 3TB6A 1UJCA 5KWJA 4HUTA 1TZKA 4CTOA 4P4LA 4F1WA 3K72B 4V0ME 2BGWA 1UJNA 2OILA 1PHPA 2ZYIA 1QQAA 1ZZEA 4BDTA 5EPOA 2J0QA 2RONA 3BZUA 3SQXA 1I1OA 1E3IA 4EG0A 1GCAA 3RF6A 3ESCA 3UV3A 3EPKA 4GI5A 4N7JA 4N65A 1FTGA 1QHFA 4DYDA 3TD2A 4LGYA 3Q7EA 2OZVA 5HIKA 4D4IA 4YAKA 3A4NA 3GU3A 3X2FA 5J4VA 1Z4IA 2NYAA 2J7PD 1HLPA 4Y2SA 3P9ZA 4G36A 1QZUA 3EVGA 3I6YA 1I4DD 1U81A 4IXTA 3FXAA 3R7NA 4YMIA 3TB4A 3NBMA 3WMRA 2SKCA 1GPBA 2F2TA 3HC7A 3VFDA 4MW7A 1WBBA 4GOMD 3PEYA 3MJRA 3P0FA 4GR4A 1BTOA 3U9TA 1AN0A 1TRKA 3LF1A 1CQJB 2DJIA 3JD2A 1IY1A 2KI5A 4M76B 3PRKE 1P0QA 1K06A 1T2AA 2B35A 2W71A 4ER3A 4CMAA 1BE6A 4C5CA 3ZZ0A 4LTDA 1LLUA 2G5PA 5IHPA 2YY7A 4FD3A 4DY6A 1Z5VA 5EE0A 1QIDA 2IIQA 5CLFA 4UOQA 2XEXA 3WRWA 1TO2E 3GFVA 3GX1A 3NKLA 4LNUB 1H5NA 3QZUA 3GUYA 4XYBA 4OTZA 3NC1C 4IQ4A 1EVQA 1P4RA 221PA 2DLDA 1W1UA 3RGWS 1W5SA 1VE7A 4X0EA 3F6EX 1TXGA 1R9MA 3MTIA 4RVUA 2O8BA 3ENWA 3A05A 3RC2A 3DM9B 2IKQA 4JL5A 4DE5A 1J9ZA 3VYSB 1IK4A 5JD6A 1B6TA 4BGUA 5DHSA 3A3YA 2YRFA 4BMDA 1QB7A 3L4BA 2JS7A 4OB6A 2HCJB 1Q44A 4PG5A 4PFJA 4E1BA 1HZJA 2GD0A 2ZU6A 3BGWA 4OPMA 2BJHA 5AVQA 1LNQA 3HU1A 3LZDA 1ESZA 1WSWA 3GZNB 3FUTA 3VVCA 1FY2A 3FYUB 1OQAA 3AB7A 1OBVA 4MW2A 1XA4A 1T26A 2K4MA 1XTUA 2ONKA 2XUFA 1XXHB 1JBEA 2PAAA 4RKEA 4L78A 1HNXB 2J41A 3ZQUA 2HSDA 1U2EA 2QTZA 3A1EA 2PG3A 4K9PA 3GCXA 2PKCA 1PV4A 1SZJG 4UHCA 2Q5EA 2HK6A 5EE5B 5BYAA 5ALGA 3ZI7A 5JALA 2X5OA 2MINA 3F1KA 4A10A 1FSPA 3DMFA 3U4MA 3K9GA 4CU2A 2XWQA 2F62A 3SHFA 4QPPA 1VJRA 1BSVA 4MRVA 2BOVA 5IT9A 3MPOA 2XPCA 4PAMA 3KQNA 1ZJYA 4DCNA 1J8MF 4NICA 2WY2D 5KZMB 1J1UA 1HYQA 1OZGA 1ECBA 1WIWA 4Y6PA 3QU9A 1Z9BA 4CG1A 3CKMA 5JXIA 2WU8A 2W11A 5HUJA 4D9CA 1JG6A 4ZEOA 2AGVA 4L28A 1QFSA 2ZRMA 3NC4A 2AQHA 1MIOB 1PFKA 3OTQA 3OZVA 5HM8A 3DZJA 4QTZA 2ZUTA 3N2GB 3T3HA 1J2TA 4DBLC 2FMUA 5AVVA 1E3DA 3N8IA 1O8CA 4PXYA 1R00A 3BHJA 4M53A 2OENG 1FDSA 3KE9A 4EHDA 5E6RB 5CFQA 1WABA 1YVEI 2YVKA 3JQFC 1L4NA 4YIHA 5K0BA 2QX8A 1FX0A 1GEGA 1UBTS 2B4YA 4TYWA 4A8PA 1VYHA 2ZAOA 4U7TB 2H0QA 2ZKLA 3ASVA 4YVFA 5C7OO 5EAIA 4TN1A 2RJOA 1U3VA 5K8LA 1PJLA 2LPMA 4PGGA 2O5VA 3KX2A 4MUAA 4OM8A 3WI7A 2VHCA 3L3BA 3LHSA 2JCGA 1QCCA 2XVMA 3L6CA 3X1YA 1JFFA 4UW9A 3CLKA 3DKIA 4N7RA 3IP1A 4I6JA 1N9KA 5DW3A 1D2MA 4KOEC 3G8CA 5G1PA 2W48A 4XLTA 2QDXA 4D4JA 1WHTA 3DWEX 1RJ9B 3SXJA 1OXMA 4G8DA 1ENYA 1S2IA 2VNIA 2ZYHA 1ZN8A 3O3MB 4JFRA 4JLOA 2BFMA 5IKOA 1DKUA 1GZ5A 1QGUB 2PRJA 3A7EA 1YI1A 4JEIA 1HZZC 4PGMA 2O7SA 1T5SA 5JEEA 5AQ1A 2D5LA 3KO8A 1HR0B 5GV8A 2BJWA 2IDZA 1W1IA 2BF7A 2J31A 2JI6A 2QW0X 4HDRA 4PAOA 4AK9A 3VU1A 5IM4F 3B6MA 4TLCA 3TFOA 2PY6A 4P84A 5DXFA 1KO1A 2C8VA 3K4QA 5ILOA 1R3UA 5JHGB 3V4LA 1O57A 1ISGA 4CMJA 3OU7A 1U0SY 1L5GB 4BN4A 5D6NA 1NY6A 3BWMA 3GXBA 3GA0A 4H7PA 4RY8A 3VU9A 5C9ZA 1EX1A 1W29A 3VVMA 1GPDG 3A1SA 2AS0A 1SBYA 3RPEA 3MTDA 4WJZA 1E2NA 4HVLA 2IBMA 1XZNA 6Q21A 1QTQA 5HQ3A 4QXOA 2IXDA 2Q6IA 5U1PA 2XSZD 1I6WA 1Z06A 3GG9A 4XAQA 3HZZA 2WVJA 4YCBA 2DBRA 4TL8A 2QXYA 4RZ2A 5JY6A 3NIGB 3Q5DA 1N3LA 1L5HB 1US8A 1VHWA 1E9FA 4LE2A 2WNSA 4GQIA 4JKYA 1XO1A 3SHVA 3C85A 1EVIA 2YQ4A 4RMJA 3OAAA 4OQDA 4BO1A 3ZLVA 4BRUA 4M36A 4QBTA 3H5WA 5A3SA 1A77A 4C0XA 3H9GA 2R4QA 4C4OA 5IAKA 2GUGA 4E12A 3FCOA 2NO0A 3QQ5A 1SM4A 1G1MA 4PFQA 1U6IA 1UDWA 2Q1XA 2VKQA 3I9V1 4TLMB 3MWKA 4RLQA 4KO8A 1U7DA 5T8KC 3GLKA 2JVIA 1AQIA 1Y6JA 1JT9A 3DHEA 4JT8A 4LJ6A 4ES6A 2Q8QA 4TXLA 3U9SA 1DC6A 4D57A 2ENWA 3D7NA 5BVHA 2ACVA 2J1LA 2XX3A 3DBHB 4D0NA 1EB9A 1W93A 2ZQYA 4U3JB 4NOKA 4GI1A 1ZCAA 1JDPA 5H0IA 3DBOB 3CNQS 1PK7A 4K9QA 3L0ZA 3WYNA 4G5YA 3LWNA 1QPBA 1TKRA 5FX2A 1DEKA 5ENDA 7AT1A 4ZZ3A 2XYHA 3TCNA 3HCDA 3O4FA 1FCJA 1T9DA 4YJGB 2AEEA 1KP2A 5DNUA 2GFIA 1ZJ6A 5AHRA 5GOZA 1VHLA 3O2JA