3QBTA

Crystal structure of ocrl1 540-678 in complex with rab8a:gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
total genus 59
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qbtA00
4IDOA 5EXTA 4A92A 3MJHA 2AXPA 3WNCA 2YC4C 4JBYA 4PR0A 4ZIRB 1N6NA 2ZR0A 4JL5A 1NN0A 2CHVA 4RFSB 1ZVQA 1AM4D 1VCNA 1U9IA 1NKSA 1JEDA 1ZC3A 3CKLA 2QQEA 3RNLA 4LY6A 1VHLA 1P62B 4DHEA 4OI2A 2H8KA 2WMNB 3KKQA 1TU3A 5JWOA 2F43A 2RHDA 1Q57A 1DARA 3B7GA 1D5CA 4KU4A 2QTVB 5DGXA 3T34A 1FUUA 5L3QB 1NVVR 3U6KA 1YJ5A 1XTSA 3DPUA 1G7SA 3QPVA 4HAWA 4A0FA 2BVNA 2IL1A 1P73A 2X1VA 2ZU6A 4R7ZA 5JJIA 3K0AB 2ONKA 1GWNA 2CE2X 5DHFA 4O3MA 1G4UR 4ZKDA 3MSXA 2FMXA 1JPNA 2ZS8A 4OHVA 4RVCA 1CKEA 5EE9A 2GDJA 5UKDA 5LDDC 1N5IA 3AKCA 2VP4A 1JR3E 5FL7D 1EWRA 3NTUA 5KSYA 2JEOA 2D62A 3PUWA 1P2VA 4DJTA 5FOUA 1J99A 4DLZA 4CF7A 3BH0A 3BIFA 2BJVA 2ZJZA 1NNEA 2I4IA 4TL7A 2ZE5A 1T8UA 4DB4A 1RJ9A 4DCTA 4MDEA 5JS8A 3RYTC 3L8YA 2VSXA 5CLQA 3GEIA 3TSWA 4A2QA 4MKFA 1J8YF 5FBQB 4AYWA 2IYUA 3LW8A 4Q7LA 2V6JA 3KL4A 4TMXA 4MUAA 3DO6A 4AY2A 3WP1B 4IOKA 3GJ8A 3SYKA 3CR7A 1LTQA 1NVVQ 5EUMA 3SJAA 3PJRA 1W0KD 1P9NA 1W4BA 3M0EA 2YWHA 4TLCA 1P7CA 1E2PA 1BYIA 1OXUA 3IQWA 2R6FA 3LLUA 2RMKA 3PQCA 4G0NA 1L2TA 3UWOA 3GLGE 3A1TA 3ASZA 1ZU5A 1KTVA 4EQ6A 4BLRA 2HCJB 1FTNA 3RS7A 1E1QA 1KDOA 1IXSB 1SVOA 3DVLA 2B7CA 1E3MA 4Q02A 3TQFA 3UK6A 1SXJD 1I2MA 3T15A 4C7OA 4QJ5A 1GL6A 4RZ3A 2O8FB 3I5YA 1NBME 3QBTA 5JWHA 3QEJA 1W36C 3Q3JB 2JASA 3KDSE 1KNXA 5JSZB 4FMBB 1P61B 1HURA 1VYTA 1PUIA 2C98A 1ZD1A 4LV8B 1NKTA 1YKSA 2DBYA 3Q85A 3KQUA 2QAGB 3SJBA 4V0MA 4YMTA 1UBFA 1LNZA 4Q1FA 4R98A 1OB2A 2O8BA 4A8JC 1MRSA 4BQSA 2ZRDA 2FN4A 3SOPA 3AF0A 1E96A 4TTRA 421PA 1XEXB 3AVYA 2BM1A 4DZZA 2X8AA 1QF9A 621PA 4PQYA 1XTRA 4F4CA 3RSLA 3L0PA 1CU1A 4M9QA 1G3MA 1ZM2A 4IFBA 2BDTA 1Z08A 3UIEA 4DIDA 5G3YA 4PO9A 1KI8A 3G82C 5C2JB 1OFUX 2QGNA 3ND9A 4XOIA 4UNSA 4QGHA 2PJZA 2IXFA 1NMXA 5CB6A 1M7BA 2ZRLA 1W5TA 1VDZA 3U3KA 3CX8A 4WXRA 2IYVA 5DN6A 2J87A 3T1QA 1G17A 4B48A 4LBVA 5SZJA 4JZKA 3ZZ0A 2IYXA 4ESVA 1LB1B 4CEJA 4KFRA 4AC9A 3GLGB 3ECCA 3S1AB 3LO5A 5FTMA 5BYJA 3A36A 4LUCA 5AK0A 4YONB 4ZKEA 3TAHA 1NLZA 3WRYC 1OXXK 2GXUA 4KLZA 4C9BA 3VNVA 1SVLA 4MKIA 2IEZA 4LYJA 3UATA 3U6BA 1T3LA 5CITA 3FMOB 4LCBA 1PZNA 3P20A 2UVQA 4N1AA 1IJEA 4RD4A 4ABYA 1W4RA 1F2TB 4FCTA 3IPXA 2AK2A 2G6BA 2QMOA 1JECA 1FNMA 1NMZA 2ZQ5A 3NVAA 4E5UA 3O47A 4GOXA 5BQ5A 1UEIA 1UDWA 3EC2A 3NBFA 4AG5A 2ODEA 4HB4A 2ODWA 3CNOA 3TW8B 2MSDB 4KCGA 1NG1A 1KAGA 1D6JA 1U8ZA 4JBXA 5C1BA 2RCNA 1E98A 3FWYA 5EE5B 2A3RA 1N6PA 4AYTA 2EQBA 1RKBA 1E9AA 1UBCA 1PJRA 2XNDA 3QF7A 3T5GA 3KXIA 1MABA 3WMGA 1VG1A 1NI3A 1COWD 1HE1C 3B1YA 3BJIC 2A5YB 3U7GA 4JL6A 1ELOA 2GJKA 1II8B 1Q1EA 4EPVA 4Z1MD 2BOVA 3SFVA 1NF3A 2P3SA 3HU2A 4YC7A 3VFDA 4B43A 2ZI6A 2JLUA 3EPLA 1Z6XA 4B71A 3CPJB 5JMTA 1TQDA 3NH9A 4FMCF 4BECA 1YZQA 1KI4A 1E9EA 1U0HC 2EWVA 3CNLA 3CPHA 2ZSBA 4AYXA 1J8MF 3QXXA 2KJQA 1UJ2A 3K9GA 3X2SA 1AGPA 4XVUA 4TLAA 3CRVA 4URZR 2ZSEA 1BYUA 3ZVMA 5FOXA 2QPAA 4HSEA 2JIZA 4U5XA 4D6PA 2WM9B 3JZMA 4B35A 3AP1A 2R8RA 3M4YA 3AVVA 1S1MA 2XXAB 2AL7A 3IKJA 4ASUD 3F3YA 4LHWA 5FFMA 4W9MC 2EWWA 1D2MA 4P32A 1UBEA 2W2XA 3C16C 4KV9A 4M1OA 2IS2A 2GK6A 4G5GA 4GZLA 1VKJA 2CEAA 1Q1QA 4BRWA 1DTSA 3UXMA 4AG6A 4D81A 1Y3AA 3B8HA 2AKAB 2OCAA 5FPKA 1QHHB 4EPXA 2KSQA 3SHFA 1Z22A 1S2MA 1E9CA 4O2LA 3T35A 5EUQB 3AUXA 5AJVB 2IWRA 4AD8A 1JR6A 2J9RA 2HV8A 2RB4A 3TIFA 3DKPA 4OK6A 1IAQA 4PC3A 3QJYA 4H9GA 5FUVA 1E79D 1DAGA 3HU3A 3OIYA 5C4MA 2WJIA 4PQFA 2F7SA 3O8BA 2RGCA 2GBLA 4BZPA 1E2GA 5DN6D 1ZBDA 1UPTA 2JATA 5KYKA 3U4QB 4OHWA 5K8TA 2O8DB 5BXQC 4LC0A 4V0KA 4PPGA 2JA1A 3CONA 3AF1A 1X1RA 3UWKA 2Z5FA 3PCRB 2G0TA 4X8MA 2WIBA 3IBYA 3OE7D 3PEVA 3K70C 3GJXC 2Q0HA 2P65A 2J41A 1D8TA 4IJMA 2IF0A 4HUQA 3K09C 2FG5A 2VA8A 1CULC 4LI0A 1E0JA 3FDIA 221PA 3DOFA 4KLNA 2VHUA 2QE7A 4XVRA 5JI2E 3K9HA 1E2FA 4CT4B 2REBA 1KI1A 4DKXA 4HAVA 4KO8A 2WIAA 3GLIE 3MRSA 2XZLA 3QBVA 4DRZA 3IPYA 1JJ7A 2AHOA 3L0SA 1W44A 4L15A 1BKDR 1VG0B 2QG6A 3U3RA 5F9FA 1R7RA 3CWZA 1XX6A 1AS3A 4JKIA 4NCJA 2R6DA 2G3YA 2ZSDA 3FKQA 1RFLA 2F6RA 2WICA 2J5XA 2ZJAA 2Y8EA 2GILA 1NY5A 2XEXA 1P2SA 3LX8A 1CJTC 2GXSA 1Q21A 4NBSA 4DLXA 1XPRA 5K8LA 2OLJA 2E9SA 4US1R 3GQBA 3WYAA 5LPNA 3NDBB 4BLOA 4LV6A 4UNRA 1KJWA 1FOEB 1XEWX 1U8YA 1Z6YA 4MRSA 2D06A 2HLDD 3FGNA 4D4KA 3CRMA 4LJ7A 4QBGB 2ORVA 1NVUQ 2NG1A 4JVMA 5FPSA 2W58A 3SBDA 2QU8A 2O5VA 2XZOA 1ZNZA 4M22A 3W5IA 3VR3A 2V4ZA 1T3SA 4MUBA 4U02A 4BEBA 2F43B 2JLYA 1XEFA 2GJ8A 2BKUA 4JKYA 5CJ2A 2WWHA 1A2BA 1SVWA 3QOFA 4O0MA 4DLRA 1IY1A 5JECA 3O8CA 5IRCD 2IYQA 4TMTA 5FBVB 4NZYA 5CDFA 4KHZA 5FOWA 4GI7A 2BMDA 2GEDA 2NPFA 2I3BA 4DB2A 4A9AA 1ZINA 1W49A 1OYWA 5DH9A 5JEDA 4C0JA 1LF5A 1NL3A 1R0WA 3DM9B 4S35A 2BJWA 1EFHA 3Q5DA 3QENA 4W5JA 1EFUA 1RRFA 1ZNWA 5EP4A 2R2AA 2OM2A 4XD7D 1T91A 5J4LA 2ZRHA 1AS0A 1KK1A 2CL6X 4MGKR 3EPKA 1Z3IX 2GA8A 1E6CA 1RJ9B 2OSBA 1FMLA 3UPUA 2P0EA 4KSCA 4P4SA 1YVDA 2C8VA 4HDCA 1G6HA 3K0EA 3E1SA 2C9OA 1HE8B 4B34A 1RC8A 5FPYA 1MT0A 2FZLA 4Q1BA 5L3RA 3NBZC 1IM2A 2A5JA 4TQUS 3BB4A 3FE2A 1Z07A 4BFVA 4MYTA 2NQ2C 3HYRA 4Q47A 1FX0B 1YHNA 1MH1A 2OBLA 4EQ6B 1W36D 1XP8A 1H65A 1ZRHA 3B1VA 2VHJA 3R20A 3TAUA 1KMHA 2FV8A 3KKMA 3NH6A 1CRPA 2P6NA 4QHSA 4LRWA 5IK2A 4B2IA 1BOFA 3TGPA 2WJHA 1U2RA 4PO8A 4F4JA 4C7OB 1XB2A 3ADKA 2QE7D 2XAUA 5KO2A 2RGNC 1Z0AA 4NE2A 1YU9A 1W1WA 4DCSA 1MR3F 4BFTA 1XTQA 4R71A 3KQKA 3QKSA 2E1RA 4RD1A 1OXTA 3K0CC 4IOMA 1HV8A 3AVOA 1MO4A 1TUIA 1BH2A 3REGA 1LY1A 1MOZA 1RRPA 1Z29A 2PZEA 4BFWA 4DBLC 2O8BB 4LHYA 4LPSA 3IDQA 3PEYA 1AIPA 4QJ4A 3K53A 2Q3MA 2GEUA 3I62A 3AQ4A 2CLCX 3BFKA 5KNDA 4YMSA 1YR8A 4Q9HA 1KKLA 1XCMA 3EIEA 4GNKA 3VX3A 2R65A 4ZO4A 1EFRA 1KO8A 4Q1CA 2CE7A 1KY3A 1G5RA 3KB2A 5GVRA 1M6NA 4M9SA 3DMNA 1YQTA 4Q48A 3W6PA 4L9WA 3CPEA 4C0BA 3SQWA 3L43A 4NYJQ 4UXIA 5BN3A 1Z0JA 4TYWA 2VF8A 2XB4A 2DFTA 2BM0A 2V7QD 4LBYA 3CRRA 1KO5A 3LW7A 1PUJA 1DPFA 3TUIC 3EZFA 2ZRKA 4CEJB 5B57C 2MSCB 4PTLA 1TAGA 3V00A 1KDTA 5CK4A 4MA4A 4NP6A 4BFZA 4LYHA 3GP8A 1UKVY 2KBFA 1E2LA 2W00A 4DLTA 4POAA 3X1WA 4A6XA 3QIAA 5CM9C 5AR1A 4KAXA 3CZQA 4H1UA 4LJ4A 1OHHA 2J0SA 2WJVA 3A37A 3DDCA 5FTLA 3CLVA 1W0JA 5HR5A 5KDLA 1PLLA 2JDIA 1IN6A 1I4DD 2WKQA 2W0MA 3TVTA 5FI1B 2DPXA 3UKDA 1Q0UA 1CJKC 1Q44A 1K6MA 3GFTA 3LBIA 4FI3C 4E09A 1SZPA 5B2ZA 3GJ3A 2LCFA 2V9PA 3W3AA 4EPWA 4YLGA 4UXJA 5B64A 5HZKA 5J4YA 1NSTA 1IN8A 4L9SA 4LDJA 1QG4A 1Z2CA 2JGNA 3TH5A 4E22A 1G4AE 1BO6A 1GKIA 2OAP1 3THYA 2OLKA 1ZD8A 3KFXA 1A2KC 2FGKA 2IYTA 3KKOA 2B7BA 2BBSA 4UKDA 2J3EA 1EFCA 1GRQA 2JJ8A 3BOSA 1SKQA 1MABB 1LF0A 3GJ6A 3P4XA 5G3ZA 1T4GA 5D3QA 4EPYA 4BFUA 1T9HA 4UNPA 1SVIA 3Q8XB 4YMUA 3UG6A 1G7RA 2FH5B 1T0HB 1Z0DA 4OQXA 4OBEA 1Q20A 5DIFA 1G3RA 1X1SA 4JVLA 5EE1A 3VKWA 4CVNA 1YRBA 3QQ5A 5FOSA 4JS0A 2YHSA 4QRHA 5GJVC 2DFNA 3DZDA 2BCGY 1VMAA 3CF2A 4MKHA 3KJHA 4DVGA 4MGYR 3B13B 2ZRBA 1SVSA 2AK3A 1XD8A 1CF4A 4PAQA 2XGJA 3RWMB 1SHZA 4TTQA 2GHIA 4LGMA 1RVDA 2A30A 5TB5A 1DO0A 1SVKA 1IOZA 2XX3A 2ODNA 3MJRA 1N6OA 1E0KA 2WOJA 4II7A 3TUZC 1ZUNB 2JJ2D 2W83A 3BH6A 5FPTA 1KI9A 1VPLA 3MWKA 3AP3A 1EFRD 1OIVA 4LZZA 3W8RA 2DWOA 1NY6A 3I1FA 2QSZA 3LBNA 1W0KA 1ZCAA 3QPUA 4BASA 5EQTA 4US2R 2G88A 1XXHB 4LJYA 2QPOA 4B3XA 2EVWX 2BEKA 4AIIA 3B1WA 1YR7A 2AFHE 3SYNA 3HYTA 2QM7A 4HB0A 1Z0IA 4W5WA 3FKSD 4JLAA 3VHXA 1SXJA 1OE0A 4OQFA 4HLQB 4S2EA 5CYOA 2DB3A 1U8AA 2FWRA 2XOKD 1N0VC 121PA 4M1MA 3BXZA 3CIOA 1W36B 1F6BA 2RGAA 2B92A 3FPAA 5CDFE 3C41J 4HUQB 2RH5A 5TDHA 2ORWA 3GLFA 2D74A 2FSFA 3E5HA 1X3SA 2AXNA 1N6IA 4NYIQ 1KO1A 5LD2B 2XB2A 2WWFA 1GL9B 4DDVA 4Q03A 5K8IA 3N5CA 2GCOA 3IGFA 2IK8A 2IYLD 1KZGB 1R0YA 1E2JA 4QC2A 5JLJA 2DWQA 2OV2A 1G8HA 4B32A 1XMJA 1FQKA 4FWTA 5TVKA 2PJRA 1GM5A 3FMPB 4C2UA 4CEIA 2HT1A 2UZIR 4Q9IA 5L8VA 1AK2A 2ZJ8A 2PT7A 5CB8A 1WBBA 2ZE7A 2O8EA 2CCGA 3K8YA 4DLYA 1T3HA 4YXWD 1P2TA 3T06B 2GZDA 1HUQA 3IILA 3FOZA 4OHYA 1GNQA 3Q7QA 5E7MA 3NEJA 4MITA 3NIBA 4EJSC 4PSAA 2FFAA 4TQ9A 3GCGA 2IUTA 1KI7A 3B9QA 3SJCA 1VIAA 2QENA 5A0FA 4A4DA 4WZBE 1T5IA 1G41A 4C0HA 4D4MA 1QDEA 1I4TD 3D8BA 4P0TA 1G1MA 2A5GA 4R2HA 1E99A 2HYDA 3L0OA 3IEVA 2QORA 1Z06A 2FU5C 1XEWY 3TSZA 1X6VA 2X2FA 4GDFA 1NN5A 3CM0A 3GPLA 1K5DA 4LYAA 5IT5A 1KGDA 2OBNA 2WV9A 4CRWB 4D0GA 1OXVA 3ZLJA 2RGXA 5FL3A 1ZW6A 2WPDD 4FMDF 3PG5A 2ZYUX 3LXRA 1E4YA 2OFOA 3N2EA 3ZH9B 1GL7A 2FE4A 1MKYA 1Q3TA 1P2UA 2H16A 1YZKA 1Z47A 2NIPA 3OAAA 1NIPA 2CDNA 3QG5A 4NYMR 5FTJA 1M2OB 3LRPA 2VL7A 1V5WA 3MWLA 1GTVA 1XDBA 4M0LA 4A0HA 2P2LA 4B2PA 3U60B 3DM5A 1M7HA 2J0UB 3U44A 1QHXA 5EZ5A 4HAXA 2OT3B 1DS6A 1IXZA 2R9VA 1FX0A 2ZYVX 2QM8A 2OFXA 4OQMA 4P4SB 4B3CA 5GVSA 1NLFA 1COWA 1XBTA 1CTQA 1GZSA 3MD0A 4U00A 4JJZA 4QHTA 4Z1MA 2JLQA 2BBWA 1PLJA 2YNMA 3IIKA 4ZDWA 4JT2A 3BBPA 1Y63A 4PHFA 3WY9A 4PHGA 4DDUA 1KKMA 2NZJA 2EFEB 2ASEA 1HY3A 2EYQA 2W6JA 3OIWA 2GETA 4BE7B 1Z28A 1JXMA 5HCIA 2ZSAA 2IYSA 3PENA 2J1LA 5CIWA 2OUKA 3UMSA 1KYIA 4I1SA 4HB3A 4OK3A 3PVSA 3EPJA 1KMHB 3AF4A 3CR8A 3LWNA 2FF7A 1GVNB 1N6RA 2PBRA 4URWR 1RRGA 1M7GA 1NSFA 2PEZA 2VLIA 4JLDA 1GKUB 3T5DA 5G40A 4QJ3A 2FNAA 3D31A 4NYMQ 4JSTA 5JJKA 1VCIA 3V4FA 2OCBA 4ESHA 3FVQA 4ASUA 1IN5A 4IOLA 2FPMA 5C46F 4RJLA 3V9PA 2WOOA 4DSOA 3QKSB 4KI0A 4TLDA 2QBYA 1G19A 1VYVA 4G1UC 2GRJA 2O0KA 3R9XA 3ZD7A 3SFZA 1UKZA 1KI6A 1R2QA 4C2TA 4PZYA 4QGAA 2FSIA 3GEEA 2DYKA 2J7PA 5JCZA 4PAOA 2ZRPA 4BFSA 2FA9A 2ZUBA 4L16A 4NONA 4JSYA 4JT4A 1JXOA 1TF2A 3GLHA 2F1RA 3B82A 1CR2A 2SHKA 3CH4B 2HF9A 3QF4B 2D7DA 3DEFA 1E79A 1US8B 2RKOA 3TE6A 1XD2A 1ESNA 1N6KA 1JPJA 4Q7KA 1W4CA 4LX0A 4IXNA 4PPNA 4E07A 3SDZA 3LAWA 3KZ1E 5FBWB 4GP6A 5LB4A 3CRW1 4Q9LA 2CK3D 2IWHA 4GSYA 1R5BA 3TKLA 2OCYC 1GUAA 2ZE6A 2H92A 3OE7A 4NCKA 3SYLA 2BWJA 1NN1A 1N6LA 4M1TA 3THWA 3KKPA 3OFND 2EU8A 3LQRA 1Q1ZA 3KXLA 2L0XA 1GNPA 2W0SA 1M74A 3RHFA 1N5JA 4JLMA 1MO3A 2CLSA 3A8TA 4QM6A 4Q9JA 1W7AA 1GRNA 5AJWA 4B73A 4ZI3A 1LS1A 1BIFA 3TVDA 3H0KA 3PUYA 4V0NA 1HYQA 3FHTA 1DG3A 2WVJA 3FYHA 1XD9A 2J45A 1EESA 2A9KA 3QNUA 3VX4A 1Z6AA 4WAUA 2KBEA 4CZ2A 2YYZA 3IIMA 2VYFA 1KDRA 1U81A 2IYZA 3OAAD 1KNQA 1WRBA 2VRWA 4FW9A 2PX3A 4BLTA 1WXQA 4XH9B 4Q1EA 2VHCA 1OXSC 1CR1A 4HYYA 4NCHA 1XTJA 2ZI3A 1AKYA 1UM8A 3PUZA 5HCNA 4OHZA 4JBWA 4Q01A 4V0OA 3MG9A 4OK5A 1XCGB 2GEVA 4E03A 4B74A 3BE4A 3AGQA 4JLVA 3THYB 4JJKA 4AKHA 4DUGD 3R8FA 3I8XA 2FOLA 1S4QA 4G5OA 4IVQA 4TYQA 1TQ4A 1OIWA 3RRNA 1ZP6A 2NTYC 2VP2A 2RGGA 2HLDA 2QSYA 4GMXA 1N2CE 2XTZA 4XSHA 2W6JD 1XTKA 1SXJE 4EPRA 1CRQA 4LWZA 3KXKA 5BN4A 2C2HA 1UKYA 1FQJA 2AN9A 4F93B 2I1VB 4KYUA 4ON9A 4BLSA 1UEJA 2BIFA 2YKGA 2CHGA 4JMPA 1E2IA 2JCSA 4LV5B 4R2IA 3VAAA 5FUYA 2AD5A 4CDGA 1GRRA 3EIQA 1UDXA 1JALA 1JQJC 3ZS9A 2QT0A 2YC2C 2PT5A 4RD0A 4V0LA 5FR2A 5GADl 4IDQA 1XZQA 4TMWA 1CXZA 3NC1C 1G64A 3NKVA 2VPPA 1YR9A 4YQFA 1FTSA 2VIIA 3NHBA 3LD9A 4XD7A 4ARZA 2BMEA 4Q7MB 2J7PD 3C4JA 4LJ8A 3PUVA 4M2LA 5JZVA 3SJZA 1S9DA 2ZYWX 4M21A 4TYPA 4Y0VA 3MWYW 2QAGC 3QE0A 1XXHA 4C3ZA 3A1UA 1JQLB 1BMFD 5AJZA 1W5SA 4CT5A 4RD2A 2C77A 3Q9LA 4TSFD 3ASYA 4QOSA 5ELXA 2VH5R 1K8RA 1WDTA 1OKKA 4GRAA 1KO4A 1OIXA 2CJWA 2QPTA 1OT3A 4D4LA 2RHMA 3EZ7A 3F8TA 5JJLA 4M9ZA 1ZU4A 4W5HA 2AD1A 2WKRA 3FMFA 1DO2A 3BB1A 4Q9KA 2GJAA 3AP2A 5HZHA 3FHOA 1KAOA 2GCPA 1D2EA 4DCUA 3AUYA 3NHAA 1SXJB 1N6HA 4D80A 4KBFA 3QEOA 2WMOB 2ZUDA 3ADDA 4A8JA 3SU8A 1OH6A 1LV7A 1E9DA 4DT1A 5CM8B 3SBEA 1YRAA 4DLUA 3KKNA 2ZJBA 3A4NA 1DADA 1KJYA 2VP9A 2C04A 3GLFB 3J81k 1DG1G 4KFTA 3W9YA 1XU4A 2J46A 1OH8A 5EE0A 4JLBA 4GOJA 1KMQA 1NVXQ 2EFGA 5H68A 3WHKA 2G1KA 2ZROA 1MO6A 1QHSA 3I4LA 3P27A 2GCOB 1NRJB 1KSGA 3X1DA 5AUOB 4A0GA 2CNWD 3SEAA 2IXGA 5EXPA 2C96A 4NTZA 1RZ3A 1Q12A 1R10A 1D9XA 4UJ5A 4IRUB 2R62A 3CBQA 2ZE8A 4PC2A 4Q4LA 3U7EB 4DSNA 4F38A 4CEIB 3RS5A 4IEEA 4LJ6A 3T1TA 2F9MA 2O8EB 3TMKA 1U94A 4Q4HA 1UAAA 3LLMA 1VHTA 1SGWA 5F98A 3EA0A 2OAQ1 4Q4JA 1WB9A 3MLEA 4MH0R 1NN3A 4AKEA 2V7QA 1GG2A 4LHZA 2J7KA 4PPFA 1E9SA 5CLLA 1S0UA 2Q9CA 2H5EA 3WNBA 1NLYA 2BBOA 5DSZA 5HE9A 3EXAA 2WZQA 3EG5A 2VEDA 4JLOA 1G16A 1IHUA 2PMKA 2XSZD 4M1WA 4V0ME 5KUTA 1FW6A 5CIQA 4MGZR 2WHXA 1JBKA 1IN4A 4MRPA 4TQAA 3G5UA 3KUDA 4TL6A 2DFKB 4AKIA 1E0SA 3LQQA 1G6OA 4OYHA 1QG2A 5DI3A 3U2QA 4I4LA 3A4LA 4KSBA 1KHTA 2JLRA 4LK2A 1OYYA 2JAQA 3WHLA 2YINC 4QXAA 1E9RA 8OHMA 1Q1BA 4DC9A 4JVNA 5DISB 2J0UA 5E3HA 2XJ9A 2HXSA 1F48A 2EFHB 4B6EA 4KITB 2A7QA 2C03A 3N70A 3P26A 3CB4A 3LBHA 4D2IA 4RKEA 3T61A 4QM7A 4JLNA 1YZUA 5EE3A 2BV3A 3CH5A 4DEXA 3QVVA 1OKKD 2H57A 1KK3A 4HAUA 5G41A 5H1YA 4C30A 3U44B 3PUXA 3HWSA 1QZXA 2B6HA 3O8DA 4F91B 5TMPA 4PC1A 4D4JA 3AVQA 2HT6A 2WBLC 2Q9AA 5FOVA 1LFDB 2N46A 4IEIA 3I72A 1ZUIA 2WSMA 1TNDA 4G5QA 2GVZC 3CW2A 1T6NA 2D7CA 2CVFA 2XNSA 1P6XA 3IHWA 3RRYA 4JLPA 3CNNA 2OXRA 4IW3B 4NYJR 4QBFA 4C0AC 5IF9A 2V3CC 2P6UA 3KJGA 4B75A 1P5ZB 1QRAA 4GZMA 3DZ8A 4QBIA 4XWKA 4OI0A 3GJ0A 1XF9A 3AVUA 5AUQA 4TT3D 1ZC4A 4HLUC 4B44A 3R9WA 3SS8A 2QUZA 4PO1A 4IKEA 4DIEA 1L4YA 1E1RD 5JS7A 3OHMA 4B2LA 2QTHA 5J4KA 4CEHA 1R5OA 1GP2A 4NMMA 3ZVRA 1HT1E 1ANKA 2CCJA 3B9PA 3H1TA 2Q9BA 4N0EA 4UNQA 1SULA 1AN0A 2NO6A 4LJ5A 1C9KA 2QAJA 1DVRA 2VSFA 2ZUCA 3TBKA 1GNRA 1SQ5A 2Q3FA 3LXXA 5KOYA 4X8LA 2IW3A 2QBYB 2JJ2A 3K0FA 4WXPA 3KUCA 2Q6TA 1Z5ZA 2ZPTX 3QF4A 1G8YA 2DR3A 1KI6B 1US8A 2QT1A 2ZRAA 2YJTD 1U90A 1R6BX 3EA5A 4BRUA 4DLSA 3L2OB 4PAMA 1GFIA 1TQ2A 2G77B 1QBKC 5F9HA 2YV5A 4YMVA 1VG8A 1GDDA 4LBWA 1OB5A 2DWPA 5JHHB 5JRJA 3GLHB 1SKYE 1VIYA 1Z6TA 5CYPA 4B3DA 4PHTA 3ZYCA 3K09A 1XD2B 3B1XA 2WJYA 3K0SA 1K5GA 2AX4A 3P4YA 1HQYE 1XNJA 3WBJA 2JJ1D 3FKSA 4BPBA 1CR4A 2CMKA 4PC7A 3MGCA 2BC9A 1R8SA 4XTRA 3SN6A 2XOKA 4DLVA 3U61B 1NMYA 2WJGA 1IJFA 1VCMA 2ZRMA 5EP2A 3I92A 3THWB 1E2QA 1Q3HA 1SHKA 4ZDJA 4BZQA 5E4FA 2D2FA 2R6CA 1WQ1R 1EG7A 1U9IC 2A5DA 3AEZA 2ZJ2A 1ONBA 1W46A 2REOA 5BW8A 2ZR7A 2EW1A 3RDPA 1CJMA 2IC5A 3PV0A 1G20E 4F7WA 5JWRA 2IT1A 2NGRA 3A1VA 3IHLA 2ZJYA 1D9ZA 1V43A 1NBMA 2OG2A 3RC3A 1F5NA 1CLUA 1XXHE 1E69A 2WWGA 4LPKA 3THOA 3VHLB 4A6PA 4DXAA 1PV4A 2CLDX 1YZLA 2CCKA 3ETLA 1KY2A 1WCV1 2YZ2A 1QVAA 3TUJC 4YXWA 2QROA 1CIPA 4EJSB 2EFDB 4TYNA 3AVXA 1IY0A 2RGEA 3GFPA 3QG1A 2QN6A 1DBSA 4Z8YA 2FGJA 4NDZA 4IDPA 4PFSA 2QQ0A 2LKCA 1SKYB 2IS6A 2BHRA 3BGWA 1YE8A 2YOHA 3CZPA 2ERXA 3B5JA 3QKRA 1GKYA 2NZ8A 2GZHA 1RYHA 1ZD9A 3U7HB 2BMFA 3KQNA 3ZQJA 5HKKA 2GXAA 1II0A 2IX3A 2PZGA 4EFLA 3DMDA 5JEEA 1OH7A 1TU4A 4QG7A 1AKEA 1A82A 1G8FA 3BD9A 1E2HA 2GNOA 5EP1A 3PITA 2XITA 3TRFA 1B23P 5HTKA 1OH5A 2YOFA 2WPDA 1NVWQ 3EZ9A 1F2UA 1JJVA 3TSOA 2F1IA 1AZSC 1GSIA 2G1JA 4K8OA 5EXXA 3RABA 4F4IA 4G5SA 3VU9A 2Z43A 5AUPB 1IXRC 2BEJA 3IO3A 1AGRA 2ZEJA 4NYIR 1JR3D 3W34A 1OPXA 3IEUA 3M6AA 4ARZB 2W6ID 3BORA 5GJCA 1DAIA 1H8ED 2QTFA 2PCJA 1OFTA 2A5FA 1PVOA 1KSFX 3K70D 1OSNA 3BK7A 4AKGA 2OILA 2QP9X 3KQHA 2Q21A 2O8CA 3B2EA 4R9UC 1ESMA 5AUNB 2VP0A 3T1OA 4B3GA 2CJWB 3A1SA 2RGNA 3C5CA 3WP0A 5JI3E 1XJ0A 3R8CA 1RE0A 2RAPA 2ATVA 2X2EA 3OEED 4KBGA 4CYMA 2FZ4A 2VP5A 2X77A 5D3MA 3CX6A 2P5TB 1CJUC 2Z6VA 3K0CA 5KSZA 1TADA 4LHVA 1KJZA 2C9YA 4NH0A 4V02A 3QSYA 4OI4A 4ZDIA 2ZXUA 4JIMA 2J0QA 5P21A 2HXYA 3UMRA 2ZRIA 4A8JB 1G18A 3U3JA 5FBRB 3W5JA 4DT1B 4NHOA 1P75A 1WBDA 3NBXX 3D6TB 4DEYA 4BLPA 1XTIA 3BERA 3X1YA 3C14C 1EK0A 3VR2A 5KPJA 1XPOA 4JL8A 1NBMD 2G83A 2GK7A 1WMSA 4BZXA 2XZPA 2YWFA 1OV4A 1E32A 521PA 4TZ0A 3QI2A 2FEOA 1QHIA 5GJWC 1XJCA 2O0HA 3CF0A 4AURA 4HDOB 2A78A 2ZRJA 5L3VA 2QA5A 1OFHA 1GITA 3A1WA 1XFAA 4CGZA 1WF3A 4A15A 2F1HA 3QXJA 1U0JA 2BBTA 2PMDA 1DEKA 3SHWA 3W6NA 1KO7A 3L0IB 2CVHA 3RRMA 4JLKA 4TN1A 3LA6A 1X8JA 3L8ZA 4LOAA 1AZTA 4Q4HB 4A2PA 3PEUA 1AJEA 4TLEA 2KI5A 4LC1A 2CK3A 5J5CA 1G7CA 4Q4JB 2JLXA 4HLCA 1BS1A 5FTKA 4OJQA 5BWMA 4L8GA 3OFNA 1FZQA 4DDTA 2OXCA 5TY0A 4HATA 4Q1AA 5HKKD 1OFIA 2PL3A 1NJFA 1X8KA 2GAAA 3LX5A 3KQLA 2PZFA 5AWFC 5DO9A 1TTTA 5L3SA 1N0WA 2WSSD 2PX0A 1QHYA 2GVDC 4D82A 1R4AA 4M8NE 1ODFA 2FFBA 1UFQA 4PZLA 2PLRA 1TQ6A 2XTMA 3OEHD 4HB2A 4IVPA 3MCAA 2FPLA 3IBGA 4FMCB 4RZ2A 3ZIAA 4IOJA 4FIDA 4FCWA 5DI3B 5E95A 3P1JA 3H2YA 4O2RA 5DHAA 4PC6A 4URXR 2JLWA 2IYRA 4M1YA 1A7JA 1FFHA 1WP9A 4I1OA 4AK9A 2LWIA 2YOGA 4G5RA 4BLQA 3U3MA 4BUJA 4ACAA 2GF9A 3JZAA 1NP6A 2O52A 1JNYA 4HLDA 4RZXA 3B1ZA 5LB2A 4JVSB 5C4GB 2DCUA 3LV8A 2F9LA 4PPQA 4Q19A 5JCPA 5EJEA 3GLIA 4DUGA 3CX7A 3H86A 1S9HA 4URYR 5DYGA 4EUNA 1CR0A 3JVVA 4CIDA 5FH9A 3ZJYA 2IS4A 4HZUB 5JHGB 2DY1A 3RANA 3B6EA 1NJGA 3DKVA 4Q5IA 2H7VA 2VO1A 3L82B 4LSGA 3GMTA 2HJVA 2NO1A 2V1UA 2ZSFA 5AJYA 3SE0A 3GJ7A 2EFCB 2XTNA 4PXAA 1GILA 1H8HD 4DSTA 1Z63A 2IHBA 2PH1A 2Z83A 1C4OA 1Z2AA 4KVGA 4LJAA 2CXXA 2ZM5A 5H8WA 1W48A 2NOAA 2OHFA 3DHWC 4WOPA 4PHHA 2GBLC 2GCNA 3TR0A 4KVAA 4H1VA 3UANA 4N3NA 3KTAA 2F1JA 1JEEA 2TMKA 4DSUA 1WE2A 4CEHB 3EPHA 5DI9A 3KFVA 4OQNA 5DE3A 4UQOA 2RGDA 3ZD6A 1ZAKA 3SI7A 3ZZUA 1DAHA 2JLVA 1N3BA 2Z0MA 4EFNA 4HI0E 3FTQA 2H17A 3C8UA 3K0FB 5LD2C 3LVRE 4EDHA 1BMFA 4ZCMA 1OW3B 2HEIA 4RD6A 5KPDA 4RKFA 4TSFA 1PLKA 3C7KA 3T1VA 4A36A 3EWAA 5KTYA 2PLFA 3DL0A 2WWXA 4P31A 1IY2A 1E2NA 1TMKA 1GOTA 1VTKA 3Q5EA 1P4SA 1OF1A 2QRNA 2F55A 3K70B 4HZIA 3WYFA 1KI3A 3KJIA 1TF5A 5KU1A 3QKUA 2BMJA 4XWAA 2G0NA 3U5ZB 4L5BA 1XWIA 4KYIB 2AWNA 2CL7X 3B78A 4DLWA 3E70C 2HJGA 1HA3A 3AF3A 3EAQA 1XCPA 2WAYA 4X8OA 1TUEA 3WRXC 3CF6R 3V4RA 1C1YA 2ZS7A 3I3SR 1U0LA 2ZU0C 4XVQA 2IEYA 3NEYA 4WZAE 3ZIAD 2NPIA 2CL0X 3P32A 5AJXA 3PEWA 2C99A 1E2DA 1ZCBA 1VG9B 4NPHA 1T5LA 3IO5A 3NXSA 2NO0A 2ECKA 1LVGA 3H4MA 1IQPA 3EX7C 3SR0A 2CNWA 1I2DA 2OE2A 3OIUA 2QI9C 1CBUA 4Q00A 2ZR9A 2QMHA 1W2HA 1TF7A 5KNBA 2WWIA 4EJSA 4GOKA 3WMFA 3OF5A 2J0VA 3ND8A 4Q18A 1MO5A 3QXHA 1IN7A 3WMEA 2IBMA 1FP7A 1R5NA 2V6IA 3BAFA 3KJEA 4C0LA 4OHXA 4FN5A 4RY2A 1G8GA 4LYFA 3IIJA 2HDNB 3OIVA 1RW4A 1L7VC 4J0QA 2QMEA 3BRWD 5FOTA 5J40A 2QP3A 2FFHA 1UADA 2O0JA 4GFDA 4QNMA 4MGIR 1Z0KA 4KODA 3ADBA 5F3WB 2REXB 5FPHA 1TEVA 1XJQA 5HPYB 2ZJOA 2IUUA 1E2EA 3AKYA 3GLFE 1M34E 5A4JA 1E1QD 1D2NA 1U99A 2X19A 1KDPA 2XSZA 3QXCA 1AA9A 4IDNA 4TL8A 3QKRB 4JYBA 4EKDA 2FX3A 1P9WA 4DCVA 2ZRNA 2IYYA 1QHNA 1N0UA 3VKGA 5F2EA 3EC1A 4NL4H 4RZUA 4BEJA 2ZYTX 1KZ7B 2VTKA 1CP2A 2D2EA 1Z6GA 4TMKA 4EFMA 1M1YE 4B47A 4NKRA 3LH5A 3UG7A 3BFVA 4XSGA 5ANRB 4G01B 3WNDA 1I4LD 2KE5A 4B76A 4URUR 2FSHA 1F2UB 3RRZA 3THXA 4TWZA 1UF9A 1GIAA 4ITRC 2YWGA 3K9NA 3VR6A 1CEEA 2KB0A 2OFWA 3VU9B 5SZKB 3X1XA 2V54A 4BFXA 2K5UA 1YZGA 4M4SA 1W47A 3GJ5A 1AQUA 1ZNYA 4OL0A 3VNUA 3C5HA 3HJNA 2R6AA 2VQSA 2DFLA 5SZHB 5EZ6B 1RYFA 2G9NA 5FUXA 3RSOA 1P72A 5C18A 3NWJA 2VF7A 3HPQA 3LY5A 1XMIA 4MRVA 5BN5A 2O8CB 3ICEA 3B85A 3QY0A 3RWOA 5SZIA 3VR1A 2I1QA 4HUTA 4TL9A 2J59A 2N42A 4ZDKA 3EZ2A 1ZJ6A 3VMFA 1G9XA 4C0SA 3F0TA 3AH8A 4Q4AA 3T12A 5DYIA 3SNHA 5B58C 1G5PA 1HTWA 4P4UA 1Z83A 3FFAA 3MWJA 4KJZA 3PR1A 821PA 4TT3A 3I8SA 1WA5A 4B3FX 1UBGA 2B8TA 4D0LB 4GPTA 5D3MB 5JRZA 1YR6A 4P33A 1ZM9A 1G3IA 3EWSA 1J7KA 3EIHA 4FINA 1E1RA 1JAIA 4Z8XA 2QNRA 4I1UA 3QUSA 4MDFA 4IXMA 2HCBA 2ERYA 2ZRGA 4LBZA 4I99A 5G53C 5FBLB 3W8NA 5K8UA 1P3JA 3OZXA 3AKDA 5DLQC 2BCJQ 3FHCB 4TZ6A 4A82A 2CHQA 1FUKA 1Z0FA 4D26A 1E9BA 2WJJA 3C15C 1L8QA 4B3BA 1VYUA 4BGDA 1EWQA 1DAMA 1S1CA 3CO5A 3CUEF 3AVWA 5KDOA 4Q21A 3AGPA 4A2WA 2C9CA 2XJ4A 5KDDA 2NMVA 5FTNA 2LKDA 1MV5A 4F92B 1ZNXA 1DOAA 1ZYUA 2DHRA 2V8OA 4ZPXA 4MQBA 4KFUA 4P4TA 3ZZTA 2N1BA 3K1JA 4XWOA 2R44A 4ZIRA 1TPZA 2ZANA 2OCPA 2XNDD 2GJ9A 1G8PA 4RFSA 3RS2A 3TLXA 4D0NA 1OJLA 1QVRA 1S8FA 2C78A 2JJ1A 2NO9A 4UXHA 3SZRA 1IONA 5HE8A 1DELA 1ZM7A 3R7WB 2V1XA 5TXGA 1CJVC 5JFGA 4WBSA 1A5TA 721PA 3KX2A 5E7JA 3FFBA 5L3QA 2CBZA 3N2IA 1QHGA 4G3XA 2ZI5A 3D3QA 3U3OA 1KK2A 5CK5A 4LHXA 2BKEA 3K0AA 2JLSA 3LFUA 4M1SA 5EP3A 3AM1A 2AWOA 4W7SA 4C4PA 4QKQA 5L3SB 1UKEA 2GF0A 4QGFA 3BB3A 4PZZA 1G5TA 2GJSA 4FD2A 3O8RA 2GESA 3HPRA 2AFIE 2JIZD 3EASA 4XJXA 1N25A 1EGAA 4C0KA 5EXSA 3WXMA 1KK0A 3GD7A 3MAAC 4Z54A 3MMPA 3WYGA 3AVPA 3AV0B 3ZQ6A 4ZCLA 3REFA 1G7TA 5FR1A 2OEPA 5BYKA 3GLHE 4ERNA 2ZTSA 3RLFA 5H70A 2VBCA 4OQLA 1HH4A 5JBQA 2GKSA 5LBIA 2QY9A 1E2KA 5CJPA 2ZI7A 4BWYA 1FNNA 4WVFA 1E9FA 2JLZA 2P5SA 2D4HA 4HZUA 4ILEA 4QGGA 4D25A 4GBMA 2OZEA 3GLIB 2OO7A 4WIAA 1LW7A 3R9IA 2FSGA 2P6RA 2OBMA 3H84A 4CW7A 3ZVNA 3EZ6A 1B0UA 3VKHA 5J4VA 1S3SA 4MRRA 4GT1A 1W4AA 4TYYA 3AKEA 3NDPA 3IQXA 2ZVQX 1EFTA 3EARA 1KIMA 1EXMA 2F3RA 3AB3A 3HP1A 5KSOA 1W2GA 1P9RA 2QP4A 4GP7A 4YMWA 2QL6A 3F5FA 1E0AA 5J47A 3TW4A 4M1KA 1FL9A 4UJ3A 3WBKA 4PANA 1VECA 3ONWA 3ZDQA 3A4MA 2O8FA 4KFSA 3BH7A 3NG1A 3W90A 4DCNA 5JSZA 1JAHA 5KNCA 1DAFA 1S3GA 2ZI4A 4KXFB 1TL7C 2FEMA 1XMVA 2QAGA 1KSHA 2C5LA 1EX7A 1SXJC 5DNYB 1L4UA 3QVUA 4PX9A 4V03A 3A6PC 3KTAB 2NO7A 3ADCA 3SQXA 3FB4A 5KSPA 3RS4A 1XEXA 2A2ZA 2ONJA 5IHPA 4ACBA 3KB1A 1JR3A 1RRCA 2W6IA 1ZIOA 1GAJA 3LNCA 4ZV4A 1H8EA 1J90A 3CRQA 2MMGA 2P67A 3RC8A 1OLOA 4BFYA 1KSJA 2Q3HA 4M9XA 4IDHA 4TTPA 4YDHB 4TLBA 1G3QA 2ZVPX 4MYUA 4C0QC 1O3YA 4XTCS 4FXPA 1TX4B 3QXSA 2WWWA 2GTPA 1FP6A 4PSVA 3W3ZB 1E2MA 2QZ4A 1HQCA 1M8PA 2VSOA 1G3UA 1R0ZA 1A4RA 2YWEA 4RSGA 2PCLA 2VHTA 2QMUA 1R8QA 4QL3A 5E7IA 3GLGA 4NCIA 1G291 4K46A 3OEEA 4QNRA 3S1AA 3JVUA 1AQYA 3IUYA 4Q7JB 4Q1DA 2PEYA 4URVR 5B30A 4RCYA 3GFOA 5TARA 1XPUA 1A1VA 2WAXA 1MRNA 2WWYA 1XRJA 1F2TA 1TEXA 1NIJA 4YDSA 3X1ZA 3PIRA 3HR8A 4L4UA 1E94E 3LVQE 2V55B 1DE0A 4HDQB 4WZ6A 1F60A 1RIFA 3TR5A 3GJ4A 5IDVA 3QKTA 2IHYA 4QHYA 4U7DA 4EAQA 3I61A 2FPKA 1RPZA 5J4HA 4TMVA 5KHOC 1O87A 4JLJA 3I73A 3PXGA 4AI6A 2W2TA 4LJ9A 1Q22A 4DWJA 6Q21A 2F3TA 2WKPA 2YVUA 1ZUHA 3QPWA 4FMDB 1P60A 2HF8A 3A58B 4QFMA 2ANBA 2H1LA 1DAKA 1N5KA 4P3YA 4B6FA 1II8A 2IUSA 3BC1A 3E2IA 3B60A 4MYCA 4QBHA 3NBYC 4XIGS 2ATXA 4TMZA 4OI1A 1E4VA 4PSKA 3ZS8A 4EIWA 4Q66C 1JB1A 2R6GA 5TV2A 3M1IA 3VTKA 2FJUA 1G21E 1T0JB 4FCVA 4DDWA 4JYCA 3DOEA 3LDAA 1X86B 3Q72A 5GJBA 1ZM3A 2W2VA 2B21A 4RD3A 2WSSA 2IXEA 1KI2A 5IK2D 4HAYA 2ZJ5A 4AWXA 3MFYA 1Z8FA 4M53A 1XMSA 3VQTA 4HAZA 2VP6A 2ZREA 2AKYA 3OEHA 4PQRA 4US0R 4WA7A 2XXAA 3AF2A 2FDCA 3MUFA 4X8HA 4GL2A 3CWQA 2ODBA 2ZIAA 1S96A 3HR7A 2MMCA 3D7MA 2IYWA 1LS6A 3GEHA 4RCZA 5FL7A 3RS3A 4A1FA 1J70A 2VHQA 2UZ3A 2MSEB 2ZS9A 3THXB 3BS4A 2Z4RA 3TK1A 3ZGXA 1QHHA 3RVBA 4OJKA 1VCOA 2HYIC 3EW9A 3ICQB 4K81B 2GXQA 1ZM4A 3FMIA 4NCNA 4HEJA 1IBRA 3VR4A 2ZRFA 1U98A 1JI0A 3HU1A 2C95A 2FFQA 4OKSA 4UNNA 3UMFA 2Z4SA 3I32A 2ZAOA 5FI0B 3G0HA 2WTUA 2IF2A 1N5LA 3ZVLA 4IHQA 1F3OA 2GZAA 3TQCA 3TNFA 3OESA 3K9LA 5A5GA 4IVRA 2QEQA 2HUPA 4HLUA 3U4QA 1ETUA 2D3WA 2O8DA 4I81A 1X8LA 1KOFA 2B8WA 1AS2A 2QGZA 1DAEA 4IFEA 4MRNA 3RAPR 5M04A 1T8TA 2ANCA 1H8HA 2E87A 3AVTA 2GWHA 2IS1A 1J2JA 2ORIA 3VR5A 4Q4AB 4FWIB 4Y0AA 2UKDA 2ZAMA 3BWDD 2QRZA 4GMDA 4ZCIA 2ZRCA 4EPTA 3TJZA 2IA5A 1HT2E 3W6OA 3RS0A 3HDTA 2EYUA 1OHHD 1NG9A 1FMJA 1HEIA 2GAOA 1W0JD 4I1VA 4MKGA 4ZI2A 3Q7PA 2JDID 2RGBA 1FPMA 3SC3A 1EX6A 3I5XA 4MYHA 2H18A 2OESA 1ZMXA 2ZETA 4N0DA 2KWIA 3U7FB 2ZI9A 2ZITA 4Z51A 4NU0A 1II9A 4A0RA 4O25A 1ZIPA 5FUWA 4RFVA 3PFIA 2AR7A 1CS4C 3NC0C 4WW0A 4B33A 1R0XA 1SVMA 1XZPA 3R7WA 1YZNA 1YZTA 3BFXA
chains in the Genus database with same CATH superfamily
1JBEA 4DV4B 5EXTA 4PNPA 5JH7F 4ETMA 2UVDA 4A92A 4MV7A 1JWBB 3NM6B 2AXPA 3WNCA 4JBYA 1F20A 4ZIRB 1N6NA 5DTIA 4JL5A 3TPCA 2QVLA 4M1EA 2VCYA 5JE8A 3L93A 1WUYA 1AM4D 1CUZA 1U9IA 4H7EA 3DFFA 1HNWB 1JEDA 1ZC3A 3CKLA 1U0EA 3KXPA 4TS9A 4DCOA 2I54A 4DHEA 4OI2A 3NT2A 2FQQA 2H8KA 4BDSA 2BEUB 2RHDA 4BUCA 1DARA 3B7GA 5L3QB 1FUUA 4E6EA 1OLUA 3PSAA 4HAWA 4LI3X 2BVNA 4A0FA 2IL1A 4Q3BA 5H59A 4BCDA 2HW8A 4MWBA 4R7ZA 2JW5A 2UZ1A 4HBGA 5GMOA 3WWYA 3WZLA 5JJIA 3L07A 3Q4GA 3N87A 4ZGWA 3N8KA 3GBSA 1G4UR 1NUHA 4D9KA 4OHVA 4RVCA 2FVYA 2JRCA 2Q4DA 2VK2A 3H9CA 2DBRA 2BTQB 2GDJA 1XAHA 3B9RA 3DDUA 5DLEA 5UKDA 4B45A 4KE9A 1U6KA 1N5IA 5LDDC 4G8DA 1P5FA 4BTEA 2B1IA 2QLTA 5FL7D 4ARBA 4EG4A 1EWRA 3MTAA 4L78A 2QMYA 4DLZA 3WYNA 4GI3A 2OAEA 2CZCA 4R0NA 2IOQA 3V1YA 1UC8A 5FOQA 5INTA 1CS0A 5JDCA 1NNEA 1NQUA 3H87A 5CHYA 1L1EA 4R8VA 2YFYA 2FUNB 1ISGA 4A2QA 1L4KA 1QMGA 1CZOA 4AYWA 4M3NA 4R1MA 4QWMA 3KC2A 3ZXXA 4XX0A 4BL5A 2ZIEA 4LOKA 4MUAA 4C4ZA 1PHRA 2VPXA 3PIIA 1YKFA 4YAEA 3C5VA 4WDQA 1J5PA 1V4BA 3FPBA 3FMVA 4MRMA 3S2ZA 3WSVA 1Z5VA 1NGSA 2HRDA 3BRWA 1LTQA 4PG5A 5EUMA 5LR6A 4UBNA 1W0KD 3M0EA 2YWHA 1FU7A 2NN3C 3UWPA 5E38A 3LLUA 2DECA 2R6FA 3UWOA 2A94A 3ASZA 3JQGA 5A62A 3I9MA 2C1EA 4KLRA 1G0OA 2HHLA 4FYXA 5IAGA 1WCXA 3RS7A 1LLDA 4E2FA 4YQZA 2QJOA 3A6FA 1O94D 5B36A 3CRNA 1I1QB 4AP9A 2DLCX 1JRLA 1XEAA 1I2MA 1DXYA 4M7WA 4N3BA 2QLMA 3KQYA 3H0EA 1V3UA 3CINA 2YMLA 4QT4A 4YDRA 2PVCA 3FYUB 3I5YA 2B35A 2J67A 2XTJA 1U6IA 2IY9A 1W36C 1RHQA 1NR7A 3AK4A 2DTEA 1VMKA 4H4DA 4EI2A 1Y3CE 4QODA 4UOZA 3ZJUA 2C98A 1PUIA 1NKTA 1P7ZA 1YKSA 2P78A 3OWOA 3TFOA 2QAGB 3SJBA 1OB2A 3QLEA 3BEDA 4KX3A 4L4XA 4R98A 1W93A 2AEJA 4P6VF 3FCXA 1GG5A 3HJHA 3GL9A 1A04A 3I9KA 4A8JC 2ZRDA 4MICA 2XRFA 5HF5A 2W6OA 1S2NA 3SOPA 1GUDA 1CYEA 5HF8A 1XEXB 3AVYA 2X8AA 5J2TA 1H0SA 5FJIA 4OFZA 4PQYA 3ZDRA 1B6GA 3BGIA 1YWGO 2JBWA 3RVRA 1UDAA 4HWGA 1JP7A 1ZJYA 4E4TA 1DX4A 5E2IA 3FCSB 4EVIA 3UIEA 3LUAA 4AUKA 1KI8A 5C2JB 5F9MA 1NFQA 2QGNA 4XOIA 1YHYA 2OBFA 3HU5A 4M0DA 2IXFA 1OX6A 4Y6PA 1XVUA 4NOMA 1SA0A 1A5BB 1NMXA 4MQ5A 3F90A 2J3QA 3D0RA 1M7BA 2ZRLA 3MVEA 3QUCA 2WPNA 4FE4A 3F1LA 5H3LA 1VDZA 3URMA 2KX7A 3M6XA 2IYVA 1VIDA 3QUBA 4I5FA 2GEBA 3T1QA 1G17A 4CEJA 4LBVA 5SZJA 1KQPA 2IYXA 1SWWA 4KFRA 3JR7A 2VNJA 3ECCA 4OP1A 2CVOA 2PT6A 5HSGA 4OPMA 3ETJA 2Z2IA 3WYEA 4LXTA 3H19A 3WL7A 5ALMA 5CRIA 2NXNA 1J39A 5FPPA 5IT4A 1DB3A 2PO7A 1JQAA 3FSEA 5CH5A 5AIBA 1ID8A 4RZSA 1MG5A 3QYJA 2OD9A 2VPWA 3UATA 2Q3CA 3FDXA 4AG3A 1LTKA 3UB2A 1T3LA 3P20A 3OPYB 3I12A 1OVGA 2BFDA 3LDUA 1F2TB 3FFXA 1EH5A 1T8PA 4I2NA 3IKVA 4JX8A 2O7NA 1PDVA 3V7WA 3NRCA 5C1IA 3L04A 5HA5A 1A7UA 2HK8A 2YIVX 4DEVA 5AM5A 4FDUA 2VJKA 3AM5A 3OTHA 1UEIA 1UDWA 5DT9A 1M5UA 1QH8B 2PTGA 3TW8B 4LKRA 2IYFA 4KGXA 5LQDA 1NG1A 3PLAE 2XBUA 1N9GB 5ALJA 1X94A 1Q0PA 1O9HA 1RCUA 4JBXA 3SIPA 5CDHA 3ZDEA 4FDLA 1MX9A 2I29A 2PSJA 1DQPA 5EE5B 1N6PA 3S5JA 3UCEA 1TVKB 4OD0A 2WJAA 1UBCA 1PJRA 2XNDA 4NRDA 3T5GA 4B4KA 1MABA 1NTOA 3PHLA 3WMGA 2CN1A 1COWD 3PP8A 5AVVA 3BJIC 5FNVF 3M1LA 2ZJ4A 1XNQB 2QZJA 2JIDA 3D1JA 1E6WA 1JIUA 1N7HA 2ROQA 4EHHA 1NF3A 3HU2A 4I5DA 4B43A 1NYRA 4BO3A 5KMGB 3GUZA 5AP9A 1PJ4A 3H5NA 1OOEA 3DTTA 1ZHHA 3UFXB 4B3IA 3Q7IA 1PE0A 3GWZA 2XUAA 4FMCF 1KI4A 3KJQA 3R3ZA 3C87A 5HS4A 5BSKA 1AGPA 4URZR 4I8IA 1DKUA 2HNBA 1RKVA 1ZJJA 3HJUA 3OEWA 2F90A 1Y7LA 1SBTA 1M2GA 1PZGA 1SCQA 5FOXA 2HX1A 2JCVA 2QPAA 4XLTA 4BO0A 3IUQA 1WDKA 1C8LA 4FUTA 2JANA 4JUAA 4WT7A 4BBAA 5B3KA 3AP1A 1TMYA 2FR1A 3PNQA 3K2IA 2BW0A 3BMQB 2OP1A 1S1MA 4ETWA 2XUHA 2IHVA 4OJMX 3IKJA 4EYGA 4U2DA 3F3YA 3CF4G 5FFMA 3COPA 4FWBA 4P32A 3VVBA 4CFZA 4B3MB 3T94A 4LZLA 4YECA 5ALSA 4KV9A 4EW1A 4CTMA 2IS2A 2PGXA 3OQOA 4GZLA 1BH6A 1UPUA 5TNXA 3RC9A 4RTQA 5JPDA 3GVPA 1KC3A 3DYBA 2HWKA 3G0BA 3K35A 3BXGA 4DN6A 3AETB 4OATA 4D81A 1GRVA 1I2AA 2IZ6A 2OMKA 4LK3A 1LW6E 4Q39A 3ZKWA 4B85A 3BKXA 4N7JA 1J8QA 1O6BA 4HQLA 3EB9A 3IA2A 4BDTA 1Z22A 1RLMA 4O2LA 1JTEA 4I5GA 2V9ZA 2JFXA 3EGXA 3FPCA 3PCTA 2O1EA 1ZMOA 1Q92A 4PS1A 4RNDB 4B0OA 2AMLA 3OCZA 2PXHA 5BR8B 2HV8A 4IJ5A 2HMVA 2X6RA 4LF8B 1IAQA 1EZ1A 3S2EA 3HDYA 4Z0NA 3RG2A 4A8HA 3UTDA 3M6WA 3HDVA 5TGDA 3BL6A 4ZARA 2C57A 5C4MA 2WJIA 2E2WA 1NXVA 3G79A 3TECE 3HVRA 2GBLA 3P5BA 2YV3A 5A1TA 1Z56C 1ZBDA 1ZPDA 3F9RA 4TM7A 2XNHA 4MAFA 1ID1A 5K8TA 4KXQA 3QX3A 3E5RA 4KQ2A 3CONA 4XW2A 1U6JA 1GQFA 2G0TA 4Y2XA 4X8MA 4EEKA 3VGPA 2ZULA 1GZVA 3G2KA 3AWDA 3A14A 3OE7D 4UCFA 2NZYA 2P65A 3KQOA 2FKNA 1D8TA 5DP1A 2YBDA 3CZ5A 4DIMA 5ES4B 5BR7A 3AZPA 3QX9A 4BJ6A 2AZTA 3WKAA 3FDIA 1U3GA 5JU6A 1JL3A 2HBQA 1XZNA 2FSVA 3C0KA 3PD7A 3LCMA 1JMVA 1VE3A 2HU8A 3K32A 3QRWA 5JI2E 2K7FA 2A84A 3TCKA 3O9VA 3ZLBA 4MVWA 1KI1A 2Q1TA 3ZWBA 4OOEA 4DKXA 1OZ0A 3V4VB 2DX7A 2Q5JA 5JD6A 3MRSA 3BCHA 2XZLA 4ERXA 3IPYA 4KG7A 2W37A 1U5AA 1W44A 3L0SA 1KMMA 5K01A 3G13A 2GRAA 4YX9A 3HABA 4KGDA 3CWZA 1OLXB 1XX6A 2L69A 4MV8A 1NUPA 2ODPA 4K88A 5EJMA 1GTJ1 1NASA 5CMLA 3FKQA 2G3YA 5IZCC 4QQ8A 2R1UA 2VYND 3IULA 2WICA 1QNLA 4KR9A 1KH3A 2GILA 1NUSA 1P2SA 3LX8A 4DLXA 1PGNA 4OCZA 1PQYA 1AKQA 3LKZA 1R6UA 3LXMA 4YAOA 3GQBA 5LPNA 5EYPB 5TX7A 2HBYA 4QOJA 5JMPA 4BLOA 5BN1A 3NDBB 1KJWA 1XLTA 4F1KA 4F56A 1U8YA 3ZKAA 5IJWA 4HXGA 2BEWB 2FI1A 4MLDA 5ALWA 1PF7E 3WRXA 1ARZA 3H0CA 2D06A 2QK4A 3DHNA 3O95A 3FNGA 8ADHA 3CQ9A 5A9SA 3PXBA 4MJ3A 4D4KA 3CRMA 1ZCFA 4D9IA 1QV9A 2AC2A 2ORVA 1YH3A 3L4SO 4JVMA 4WFQA 1AK9A 2W58A 2FMUA 2QVXX 4U7JA 2NU8B 2O5VA 3IIEA 4M22A 2AN3A 2GI4A 3PXDA 3VR3A 4QYIA 4BEBA 5CJ2A 4JKYA 2BI8A 2WWHA 1NRWA 3EXHB 2DEUA 4NXNB 5FPQA 5IZ4A 1JDVA 5IRCD 2NYRA 3RJZA 3AB7A 5CDFA 4KHZA 2NPFA 4QJIA 1PFUA 3PKIA 1PG5A 3H5IA 3SVLA 1ZINA 5DH9A 1OYWA 3QJGA 4ZYUA 2XRMA 1XZEA 5BPHA 3HH8A 3ZW8A 4O02B 3DM9B 4FFVA 1EFHA 4HHEA 4QVKA 1I3MA 3DBRB 1R12A 4YJ2F 3VTFA 2HAEA 3ZE1B 4Z7NB 3S81A 1RRFA 3AJEA 1D0VA 1M2OA 4L08A 4R1NA 4XD7D 1K6JA 2Q9UA 2B7LA 2ZRHA 4C01A 5J4LA 1AS0A 1XL1A 3M6LA 2CL6X 1SKMA 1C3VA 1XQ9A 3S1SA 4A8TA 2OSBA 4UUMA 4MVJM 4IDCA 3BF7A 3TL2A 3VV2A 1CY1A 1FS4A 1HTTA 1YVDA 1VRVA 4J1TA 3G2OA 3UA3A 2IOFK 1Y34E 2GUWA 1HE8B 2PLNA 4F3YA 5C35A 5CH8A 4C22A 1QZZA 5IMBA 1APBA 4GQBA 2CB0A 3HXOA 1GEGA 1PI3A 2ZPUA 3E4CA 5F4BA 2F8LA 2IP1A 3CLHA 1Z07A 1NVTA 3DZIA 4MYTA 3JPWA 2C5GA 3TX6A 3WBFA 6CHYA 5IASA 2JFHA 3F78A 3G2HA 3JQ8B 3NP7A 5GPBA 4EY5A 4EQ6B 4L6IA 3QXGA 3CLUD 1XQ6A 3STWA 3K6JA 5B2FA 4CKWB 1ZRHA 1JEJA 4AULA 4DVJA 1E7QA 1DIGA 4ZZIA 5A4IS 1G8SA 1T0BA 2FV8A 2Q5QA 3K15A 1D6SA 3KKMA 3RKRA 1K2WA 3S8EA 1BE8A 1QX4A 3L7BA 4NZPA 4PO8A 4F4JA 4C7OB 1ZW1A 2O3UA 2N0SA 1CZKA 4LRXA 1ZITA 5KO2A 1EQ2A 5BNWA 1H3EA 4BOYA 3PQ5A 2PZJA 4Z7QB 3LT2A 3RB8A 4EECA 3FPHA 3K94A 3SIXA 3COYA 1MR3F 5AHOA 3ENQA 3KWMA 1CY7A 1GPBA 1GKLA 1OXTA 2I2AA 5ALFA 1T8SA 4UUAA 1M66A 2P4SA 2AF3C 3D64A 3K0CC 3SOZA 3DMFA 1K63A 3QWBA 1WUTA 1BH2A 3MOSA 2X14A 1RRPA 3REGA 2PZEA 4PYQA 2G70A 4GPD1 4JHLA 4WUTA 4BFWA 4LHYA 4H16A 1EQAA 3OZBA 4MMZB 5HIJA 3T1NA 5L6MB 1AIPA 1V7PC 2AJDA 1UM9B 3ESBA 3G5MA 1LPPA 4QJ4A 1LI5A 3KKLA 1NBIA 2VQDA 3KCQA 1YFKA 3FHLA 4O08A 1O4VA 4PRYA 1KR2A 1JJFA 4GNKA 4AZ3B 3QE9Y 1OX4B 5GV7A 3NWEA 1QYCA 2MDTA 3E22A 5DZSA 2NXJA 5EMMA 1KO8A 1N1MA 4JWKA 2YS7A 3ETNA 4IIEA 3VR6H 1JHPA 4ZA2A 2GHQA 2IDMA 5JSHA 3A9CA 4MW9A 1U8FO 2P1RA 2QPLA 4Q48A 1YVUA 4L9WA 5JIBA 4C0BA 5HZMA 2FR8C 3D2AA 4TYWA 2BH2A 1SRRA 4ZI5A 2FWBA 5KX5F 5K4AA 2W5UA 3P9XA 2BM0A 4LBYA 4TZKA 4YRDA 5CT4A 2IV7A 4DRXB 4ZVNA 4G8JA 4P81A 2DR0A 2MSCB 4E08A 3C48A 1DJLA 4FBGA 1KDTA 5LQAA 1CR6A 3FPGA 2QRMA 4XQ0A 2IYOA 3GP8A 1UKVY 1D6NA 1VC2A 3LBYA 1V7CA 3SM9A 3T7EA 4POAA 5EAIA 4MV4A 2X8LA 3CH7A 4FE3A 4R1QA 5CVCA 4A6XA 3ZR4B 5BV0A 3FB1A 3CZQA 2PYDA 4XIFA 2J0SA 3O03A 2WJVA 3EUWA 3F4LA 2FE1A 1W0JA 3E9CA 2C7RA 3WIOA 1IN6A 2EGHA 2WKQA 3W1WA 1ATIA 4J29A 4J90A 3ZWMA 3DTVD 3HXQA 3H5VA 4Y8VA 5IP5A 1Q0UA 1CJKC 4QXQA 4J0EA 1E1KA 3B51X 1SZPA 2W22A 2P11A 3UC5A 3W3AA 4EPWA 2V9PA 1PGJA 3NHWA 3BTSA 4YLGA 1T0UA 2ISQA 1JG1A 4P7GA 5DHSA 2YW9A 5AVKA 3BIWA 1C81A 3TI7A 1F0PA 2A0UA 2IU4A 2WFLA 4BWFB 4Q6BA 1QG4A 3ZDDA 3TIFA 4KPEC 2QRLA 4E70A 2BGGA 1V8PA 1ZIYA 3SHOA 2AI2A 5BV1A 3THYA 1A2KC 2C8LA 2FGKA 3IKMB 3KQWA 2OFFA 3X1KA 3GUYA 3BQ9A 4PWYA 3L8EA 1IFXA 4IUDS 1R6XA 3E8MA 4ZU6X 4CMCA 1GNLA 1GRQA 1ZGCA 3HB5X 4ER7A 1X39A 5KOYA 1QYRA 1LF0A 4JA0A 4JVOA 1O0SA 3L1KA 1ZH6A 2LRHA 2I33A 5F5NA 2VS1A 4EY4A 3N05A 1SVIA 2O7RA 3M2TA 3N5KA 4GEGA 3UG6A 5C9ZA 2Y6UA 5EFOA 1VL1A 1E61A 1EXDA 3ENKA 4PYRA 1C30A 2ETVA 4HUJA 1Q20A 1JAYA 2JD2A 3WQBA 3QQ5A 4EX7A 4JS0A 2YHSA 2DULA 4IWYA 2DFNA 3DF9A 3DZDA 3PR2B 3QVMA 2X1MA 2ZT6A 1VMAA 1E1YA 4FGSA 1WHTB 1A9XB 4QZVA 4D74A 3JD3A 3T3MB 2QRVA 3HBLA 3RJ9A 2PMEA 3TIIA 1SG6A 3VC1A 5H4HA 2EX0A 1KZ6A 5D8DA 5AKKA 2C7VA 2AK3A 1XD8A 2VF2A 2QUKA 4DXHA 1KEUA 3I9V6 2FZWA 3DEIA 2P6OA 3DT8A 1SHZA 5CIYA 2XGJA 1EVKA 1L4HA 1XAJA 2UYOA 3CSDA 2A30A 3MT7A 1TK2A 5IUJC 1XFDA 2Y1KA 3DXXA 3KBOA 3MJRA 4IINA 3JALA 1RJEA 4GZ5A 1F2DA 1TEZA 2ZDGA 4Y30A 5LZ8A 3DB2A 2ZB3A 4IQ4A 4R7TA 2IZ1A 5ICSA 1SIOA 3AOGA 1DJNA 1C3OA 2JJ2D 5JS1A 3G8CA 2PZBA 4MWEA 4K26A 1HFKA 4ND8B 4PNZA 4TMYA 2YN0A 4YJ3A 1XN1A 1UEXC 2M1XA 5KYVA 3IVCA 2GN8A 4FJ2A 3N76A 3P9RA 4PCLA 3WQHA 3FBTA 2M98A 5IH7A 3B6ZA 4DS3A 1NONA 4PIMA 5CU7A 4RAQA 1X19A 4BASA 4C14A 2XNKA 3Q6IA 3DVAA 1R4NA 1XXHB 3OPMA 4AL4A 2BKLA 2QPOA 4PCAA 3ZHUA 2YZKA 4CNBA 1YR7A 3SZUA 3O84A 2XPCA 4DUZB 2ZYIA 4CIYA 3HYTA 4N7RA 1ORTA 5I7RA 3FKSD 2OVBA 4QU9A 5ITWA 3HZZA 2XOXA 2ZXFA 4HLQB 4R1SA 3O4FA 4S2EA 2FWRA 5K0LA 3O92A 3K4QA 2Q28A 4M1MA 3BXZA 1NBWB 1F6BA 2ODQA 1HNNA 3PC4A 3TLEA 1GZHB 3KJZA 3TTYA 1OA0A 2ZUFA 1TU0A 2G80A 5I4IA 5AM1A 2GHRA 3E5HA 1T1IA 1HL3A 2AXNA 3FETA 3NETA 3MTDA 4IJVA 5HKOA 5LD2B 1IAVA 1DRWA 3TZBA 1UFVA 2OXEA 2WWFA 3I83A 2C84A 1CEYA 3LVFO 1YJCA 4Q05A 5K8IA 1LRLA 2WC1A 3IGFA 2IK8A 1FLNA 1DQZA 5KKNB 2IYLD 1KZGB 2XQVA 4QC2A 4UREA 2HJWA 2HSZA 3FLAA 1PFVA 2A67A 2DWQA 4I7EA 2PJRA 5D84A 4J0HA 4MWTA 3IH5A 3PEEA 1AHIA 1TCVA 3UYKA 1GXSA 2Y0CA 2GFIA 2ZJ8A 3ETCA 3MS4A 3TOVA 4BO9A 4CMIA 5CB8A 3B38A 2D5LA 3Q2IA 3X2FA 4YXWD 3SZ3A 4H59A 2GZDA 1WEKA 1NVGA 1P6UA 1TO6A 4PFQA 2Z2XA 5CAEA 3FOZA 1RFGE 4KPFC 4MS1A 5E7MA 3NEJA 4MITA 4V3BA 3ZZ1A 1PK7A 5ECGC 1PEDA 4W9NC 2IUTA 3RSSA 2DGDA 3NHZA 3SJCA 5FUMA 5ALHA 1VIAA 3Q9NA 3S7TA 5BRNA 4X60A 4WZBE 2YIMA 4Q1VA 2GS9A 2L17A 3HKCB 1QDEA 3O3MB 2HSEA 2WAAA 2G9ZA 4O63O 3VZSA 1I4TD 3ZCRA 4CV3A 2QRQA 4P0TA 5F7XA 2A5GA 1T25A 4WLVA 5J43A 3IFSA 1L5HA 5DBIA 3F6PA 3EMBA 4OAPA 1PR0A 5AKLA 3CZMA 3IR6A 1X6VA 2PWPA 1HLPA 3OICA 4HC4A 1WQ3A 4IUYA 5F3RA 3OP1A 3QITA 3OZ7A 4BC1A 1A2QA 1OXVA 2MYUA 3THXB 3KKKA 4U2KA 5F5XA 4DMGA 3JV7A 3KWFA 3CJTA 4FMDF 3IUSA 5KWVA 2ZYUX 4QDKA 3EEFA 2FE4A 1JQDA 1VL6A 2XCTB 3DV0A 1Q3TA 1SQ0A 4NC9A 4ZALA 1QQ6A 1WSDA 5IF3A 4CBVA 2JFWA 3TD2A 3OAAA 1NIPA 3LY7A 1XZCA 3KDAA 4PYIA 1XALA 5A3JA 5KJCA 2JIBA 3WGIA 2VL7A 1OFVA 2VBFA 1X7WA 4P7KA 4Q15A 4X63A 4EKIA 1GTVA 3FZYA 1KAQA 1ZOIA 4M0LA 2P2LA 4B2PA 2J0UB 4K1XA 3SSOA 2LCIA 4B3CA 4P4SB 5T5QA 1ZHOA 1XNRB 1CUFA 1ZWKA 1NI4B 1XBTA 2O1WA 4RE5A 5FO0A 3UOWA 1RRMA 2ZB7A 4FB4A 1TC1A 1S7CA 2JLQA 3KEOA 2E4VA 2WM3A 3E18A 3QBJA 4UASA 4OB6A 4UD6A 4DWVA 3CS3A 3F97A 4QPDA 2VJOA 4F97A 5DNAA 4PHGA 3W2FA 1JSCA 1YDWA 3U9SA 2ASEA 2W6JA 4D9HA 5L7TA 1JXMA 2ZSAA 2IYSA 5C5EA 2XMZA 4MS4A 3PXEA 2TMYA 2FWAA 1EFPA 1XN4A 3CJQA 3CN9A 3L84A 1XL0A 1KMHB 2P4QA 3PVSA 4U7TB 1MJNA 4IUCS 1MTOA 2FF7A 1GVNB 3RE1A 4DJAA 3D59A 5CR9A 4GM0A 1RRGA 3VJLA 1NSFA 2DKOA 4JLDA 3T5DA 4DFDA 4LF7B 4YCAA 4WZBB 5L7WA 3D31A 5JCJD 1PTJA 1PNTA 3V4FA 2B5OA 2W6NA 2WU1A 3H1FA 4RTJA 4EUEA 3AKZA 3HVJA 3AL3A 1H5NA 2X86A 1IN5A 3F5DA 4GE3A 5A3QA 3Q41A 4JNCA 3SLGA 4A26A 2LDBA 2FPMA 4I3GA 4KXWA 4Q82A 3V9PA 1ZO8A 1TA4A 3VR2D 4DSOA 2W8ZA 3QKSB 4EHIA 2QV7A 1ZG3A 5EIAA 3RV4A 4JNKA 5C53B 2GRJA 3HDQA 4N49A 1XOIA 5CA0A 1L7BA 1VXOA 1UKZA 2GZ2A 4R8MA 1HOTA 3DL4A 3WGQA 1R2QA 4C2TA 3Q3CA 2P9GA 4KXVA 2DYKA 4DNXA 3H8SA 2P2ZA 2ZUBA 1PQWA 3E7PA 1P8JA 1E9VA 3EEIA 4DNPA 3FZNA 4JSYA 2IHZA 2AQIA 2F1RA 3TXXA 4Z9XA 3TI9A 3QF4B 2C3MA 2D7DA 3DEFA 2ZVDA 1QU3A 4P4NA 1OTHA 5DCWA 2NACA 2WK1A 3M9LA 4LNUA 4U1RA 1ESNA 4MZXA 4Q7KA 5K8JB 3NYRA 4FJ1A 1L8XA 4E07A 5JT1A 4P8RA 4L51A 2Q49A 4GP6A 5LB4A 4Q9LA 1WV1A 1C14A 2IWHA 1R5BA 1AOXA 3GXOA 3TKLA 5BN3B 4G0UA 4BB0A 3D1LA 1B0ZA 1YL5A 3HBNA 5CEEA 2GBFA 1DRVA 1LPMA 2W8BB 3IT3A 1YE5A 3MUOA 4EYSA 1J42A 3CN7A 3QLJA 4B7XA 2JFGA 1Q1ZA 3DO5A 3KXLA 1TZKA 1GNPA 3EUEA 3LT0A 2G40A 3CCFA 1EDOA 3HJAA 3UWMA 1E77A 1PSZA 1WABA 5G0UA 2ABWA 4IZOA 1K7CA 3OHSX 2YDYA 2NUPB 4MP8A 3IJEB 2BFCB 3W0LB 4B73A 4M6WB 2QG9A 5I4KA 1ZICA 5FYQA 1UMCA 2FW8A 4XDGA 3TVDA 1PYOA 2I6TA 2WG1A 3U49A 5BQXA 2WVJA 4GR9A 3KYJB 5HK8A 1EESA 4JC0A 1LI4A 1WXEA 2CMGA 2V7EA 2VRCD 2YYZA 3QW2A 2DH5A 1Y6GA 2VYFA 3W5SA 2A5LA 3C3PA 3OAAD 1KNQA 1WRBA 2BF7A 3EXG1 5JVDA 4M0FA 5KTKA 2QTBA 1CQJB 5ADWA 1UP7A 2ZUVA 2VHCA 3W79A 3KOOA 1KZ9A 4LE0A 1CR1A 4ZVMA 3HVUA 4NCHA 1BXGB 1DUVG 2QHXA 4R69A 3DLTA 4OHZA 4V0OA 1ZI9A 4OHUA 3VYUB 4NPAA 1OBVA 2FPWA 1W59A 3BK2A 2PS9A 2H52A 2O0LA 2NT3A 1QO0D 3WV5A 3I8XA 1P4RA 2FOLA 1CUUA 4HKTA 4YRIA 1OIWA 1J56A 2NTYC 4NJMB 3RRNA 5KSWB 2HLDA 2AMVA 1X1QA 3JQFC 4P0QB 2ZJFA 1K4KA 3NANA 4UHEA 3K6SA 2W6JD 2XODA 1YRHA 1Y1RA 4EPRA 1CRQA 1T34A 3KXKA 3P2OA 3P0IA 2C2HA 5DCUA 4YP5A 1Y3IA 5REQA 5BW5A 4KXNA 1K2VN 4F93B 3U4GA 1AGXA 2P69A 4ON9A 1I3KA 4BLSA 2EIXA 3WK5A 3ZE8A 2YKGA 2UVPB 1J07A 1RYZA 4EEZA 2O2SA 4JMPA 1QFSA 2JCSA 2R6ZA 3IE0A 1DXQA 4MTCA 1X7DA 4XVCA 1I14A 1ULZA 1R37A 3AI2A 2ZUTA 4RHXA 1JALA 5SY9A 3RFVA 1JPUA 5DEOA 3SC6A 1N1EA 2QT0A 4Z9AA 3UBTA 5FR2A 4CM7A 1PJ2A 4QTYA 2B25A 3UGJA 1VPDA 1XZQA 3ITDA 4E51A 1D2HA 2XBMA 1ZUNA 4UVDA 1XLWA 2FMKA 4JENA 1G64A 3NKVA 4I3HA 2IFTA 1YRQA 1YV9A 1J97A 4YQFA 2VIIA 3EVCA 3J7TA 5H81A 1LD3A 1MH9A 4GX0A 2P7HA 1DMSA 3C4JA 3PUVA 4FLFA 1GNSA 3UYLA 1TZ2A 5JZVA 2QSJA 4M21A 2FEXA 1MUUA 2BFAA 4KR3A 4Y6GB 2XGGA 2MINB 1L7MA 1M1NA 3E3AA 2MYTA 4HDMA 4WVLA 3A1UA 4E2WA 4BGUA 4PG6A 4EUKA 1S8AA 3SXPA 2I3GA 3FTCA 4GECA 4QBKA 1W5SA 1F8YA 4RD2A 4UTPA 4MV6A 3OLCX 5BSUA 4WN9B 5ELXA 4AF7A 4LVCA 3PD0A 2P0YA 4Y2GA 4K9KA 3EXG2 1WXXA 3EOAI 4GRAA 2EL7A 2X5JO 4EB6A 2HZ7A 2RHOA 3ILSA 4N8SA 1V1MA 4UUOA 2RHMA 3O4RA 3RF6A 2RHTA 3ZTWA 3K2BA 2JGJA 4W5HA 2Z95A 5JALA 2AD1A 2WKRA 2C2KA 3FMFA 1I0LA 5IG2A 4KUEA 1B3RA 1D2EA 5MGBA 4LTMA 2OWDA 3NHJA 4HX5A 4PNHA 1QRDA 1QIFA 2QUJA 2Q6KA 4H1TA 5F78A 2H06A 4KBFA 1UMDB 2WF9A 3ADDA 3SU8A 1QTNA 1OH6A 3VNSA 3HXPA 1B26A 4PLTA 2WNIA 3CISA 5ERXA 1OA1A 1WZUA 4WEOA 5H9VA 4C4RA 4NEGA 4KX5A 1NWCA 2QX6A 3P9NA 4D9MA 3EFOA 2H1OA 3GLFB 1MQAA 2AS0A 5FIUA 1EUDA 3B1KA 3J81k 4YRRA 2RI6A 3S8MA 2HQ1A 2G04A 5GQSA 3ZBQA 1RWKA 4ZCQA 2HIAA 2J46A 1SCAA 4HDNA 2AG6A 3DE5X 4I9FA 1EK5A 3IKLA 5SV2A 3WHKA 2LVBA 1CUCA 1K6EA 2HHCA 3I4LA 4YAKA 3X1DA 2GCOB 2YMMA 2IODA 4A0GA 1UT6A 2HMUA 2BI4A 2JFUA 2NQTA 3P19A 1KS9A 3P9CA 2HKIA 2C96A 2QD3A 1UDRA 3QIVA 1R10A 2ZT5A 1RLJA 3CBQA 4PC2A 3EPRA 4Q4LA 3U7EB 4DSNA 1FFBA 1XZLA 1W85B 3L9XA 3IPAA 3IRUA 3M9XA 3MQ4A 4N3AA 3RS5A 1WNFA 3O4VA 5A2GA 2FUG1 2CBGA 4YROA 3EPHA 1XZDA 3H5RA 4IYJA 1GNVA 1NPYA 1OPRA 3H5LA 3RBZA 5IMSA 2M9MA 2V7WA 1MZPA 2OAQ1 1RHJA 5J5AA 5JXGA 5LLDA 1ZD3A 1WB9A 2XCRB 3IODA 2V7QA 1NXTA 5LDGA 2FN9A 3ABIA 1S0UA 2GB4A 3HSKA 1NLYA 2BBOA 1L7OA 2G71A 5FA8A 5H7XA 4EY7A 5JNVA 4BNDB 4MCIA 1RWBA 2H07A 2VEDA 4A5OA 2B9EA 5ADVA 2XSZD 1YI8A 4V0ME 4MGZR 3BTUA 4B6GA 1IN4A 1NDQA 4TQAA 1JFLA 4L5YA 5HJ7A 4DKJA 1CUDA 2A4MA 1IEVA 2P35A 2RJ3A 3GQVA 3OJWA 2R8ZA 4OYHA 4WWHA 5KVQA 1GLGA 1QG2A 2PGJA 5LOVA 3D6JA 4O4JA 3JYHA 2BL4A 4GMHA 5CB4A 1WQ4A 3DW3X 4KSBA 3V8VA 1MJHA 2CDCA 3LWZA 1G2PA 1L4LA 2Q7OE 4LK2A 5AXDA 1ABFA 3WHLA 2JGAA 1OTYA 1Q5PA 5AXCA 3EXEB 4RMNA 4P7JA 1DC7A 2FQWA 1K0UA 4JVNA 4LX8A 5I9BA 2RE8A 3RAFC 3KYCA 4C08A 4D44A 4XRRA 2NTVA 2NV2B 3G2NA 1KQOA 2HXSA 3IBSA 3IPLA 3LCJA 5EVJA 2PX6A 1K0FA 4N7MA 5JCXA 2H5LA 3LBHA 1QONA 2CXRA 2VUSA 3N0TA 4D2IA 2RCYA 4TX1A 3RSHA 4A7PA 3T61A 4UW9A 4K9NA 4G0MA 1HXHA 5EE3A 1G60A 2BV3A 1A9SA 1EP3B 4LMPA 3L0CA 2Q1WA 3HZRA 1V37A 4ZVUA 1GZ4A 2X42A 1XRNA 5JRDS 3BFJA 4K7JA 3TG2A 4PG8A 3OQJA 4O3FA 4JA2A 4A23A 2HT6A 4FKMA 1A98A 4MVJG 1L5OA 4Q9NA 3ZTYA 1FYEA 4KHPB 1EDDA 5LNK1 3NVMB 1CVLA 4BX0A 3EEOA 1YZHA 3K6KA 4UEKA 4ZQCB 3TZHA 4BX8A 2WSMA 4PSUA 1WJGA 3CW2A 1RXWA 3LJKA 5BSWA 3UV7A 3PLNA 1RI2A 3QU2A 1KVSA 1QOPB 1P6XA 2W11A 2EC5A 1UBJS 2E4AA 2OXRA 1TLTA 3EXIA 3G2PA 3PRYA 4JLPA 4NYJR 5TPWB 4B75A 4JI7B 1QRAA 3A2LA 3ZHVA 2RSLA 1UQTA 3GJ0A 1XF9A 2IV3A 5FO1A 1JMYA 2ZLBA 4HLUC 1S02A 4QPCA 1U9YA 2PN1A 1N2XA 4X20B 1O95D 1RZUA 4DA0A 1GQOA 1SBIA 3LPCA 2PGDA 1YL7A 3K0BA 1JZQA 4GDMA 2KHZA 4CEHA 1YAHA 1GP2A 4NOJA 1C3LA 1HT1E 5DN9A 3ESQA 2Q9BA 3QFHA 1VM6A 1VJGA 1AN0A 2GTIA 1K9SA 2RHJA 1N36B 1FDVA 3FWPA 2VSFA 2VQ6A 2JPDA 1MB9A 1GNRA 2Q3FA 2X4GA 3LXXA 3ETGA 2W42A 1ZOPA 1JSLA 5B4TA 3R9XB 4R6XA 3F6YA 1C0IA 2B4QA 3KUCA 3AR9A 3EZYA 2Q6TA 3NGXA 4UCQA 4CCYB 2QT1A 1US8A 4F9FA 1GZ6A 1K66A 2YJTD 4G8BA 3LQYA 5C1DA 1C3JA 3DBHB 4E13A 3U56A 4Z49A 1TQ2A 2BELA 4ZYWA 3EYAA 5F9HA 2ST1A 2YV5A 1C0LA 4L27A 4YMVA 4CMKA 1JEOA 1FCJA 3BGDA 4KIWA 4OHCA 1ICIA 2DERA 3P0JA 3GLHB 1AA6A 3TGLA 4ND4A 1VIYA 8MHTA 1VHJA 4M38A 3WK9A 3ZYCA 3FCAA 2P75A 4FSDA 4EY8A 2Q50A 3B1XA 3GEDA 1WS6A 2AX4A 2PX5A 2XGMA 1XNJA 3E4DA 1QIHA 1TEHA 2ZYAA 3JD1A 1JEQB 1MG0A 3MERA 3B6MA 5BMVA 1XGKA 4LJRA 2YWCA 2D5IA 1S6YA 3HSSA 4ZVLA 3MGCA 3OM9A 1YZ3A 2BC9A 2ECPA 3C1OA 4XTRA 3SN6A 1B0PA 1HZZA 2YWJA 5AVUA 3U61B 2I6SA 3GLTA 1ZIXA 3GH3A 2RK3A 4PLGA 2A6PA 3I92A 4L1KA 4X93A 5JH7B 1C5KA 1Q3HA 1U5CA 4BU1A 4BZQA 2W48A 4F2GA 2D2FA 1J20A 4BP3A 4BQIA 1ZN9A 3A6GA 4OXYA 1WQ1R 3PZRA 2UUBB 3EMKA 1DBRA 1UDBA 2A5DA 2FB9A 3OZFA 2PKQP 4I1YA 4KH1A 1QRTA 3SBOA 2PNJA 7GPBA 5BUQA 4YHHB 2EW1A 4TKLA 1HT0A 5IEJA 1CJMA 1EHYA 4Q24A 1G20E 1ODLA 5DBGA 3A1VA 3IHLA 2ZJYA 4N54A 2Y3IA 5IAAA 1E3QA 3BGVA 4OIMA 1TVCA 2OG2A 1R15A 4HYTA 5DM70 1F5NA 1RWXA 3W2IA 1T3GA 2PH7A 3TTSA 3OMLA 1BXKA 1NX9A 3CXRA 5A1JA 3U48A 5DASA 3V2IA 3DFIA 1WMEA 2CLDX 5EWJB 2CCKA 3VHLB 1JJBA 3ETLA 1KY2A 1PZEA 3TRKA 5YASA 3EUFA 2OCGA 4FFRA 4EENA 1SUFA 3OM0A 2QROA