3K32A

The crystal structure of predicted subunit of trna methyltransferase from methanocaldococcus jannaschii dsm
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
191
Chain Sequence
b'LMDVHVLFSGGKDSSLSAVILKKLGYNPHLITINFGVIPSYKLAEETAKILGFKHKVITLDRKIVEKAADMIIEHKYPGPAIQYVHKTVLEILADEYSILADGTRRDDRVPKLSYSEIQSLEMRKNIQYITPLMGFGYKTLRHLASEFFILEEIKSDYEAEIRHILKERGESPEKYFPEKQTRVVGLKKEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0690
publication title The crystal structure of predicted subunit of tRNA methyltransferase from Methanocaldococcus jannaschii DSM
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 59
structure length 191
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k32A00
2GM3A 1V47A 1F7VA 3TQIA 3H9CA 1VBKA 3K9WA 4MW7A 2J5BA 3KT3A 4ARCA 2A88A 3AL0C 1KQPA 3RJZA 4BWVA 1KQOA 1TYCA 1PFWA 4E1AA 1N3LA 2CV2A 4EG6A 2OV4A 3IMGA 3CVUA 1EUQA 3HFJA 1OWOA 4OUDB 2V0CA 1IRXA 1PFUA 4HPWA 3H97A 1EFVA 1H1TA 4MW2A 4XFJA 1TQ8A 4JFAA 2Z09A 4DJAA 1YUMA 2HMAA 1MB9A 4J75A 3G6KA 1K92A 3KFLA 1ZUNA 4J76A 3CLTC 4MVWA 1O0CA 3COWA 5BNZA 3A4IA 3PNBA 2D54A 4A91A 4L2IA 2E0IA 1OWNA 5J5AA 1JMVA 1KP2A 2IJGX 2CV1A 3IVCA 3LCJA 2A7XA 1U3CA 3IUBA 4MUKA 4ZCPA 3E27A 1NUSA 5F23A 4K0RA 3CVVA 1EFPB 5EKDA 1H3NA 2EJCA 3JXEA 3IOCA 3LOQA 1NURA 4MVYA 1N75A 4MQ6A 1I2DA 3FHJA 3IH5A 2A1UB 1N2BA 1TFUA 2ZUFA 1VBNA 3ILVA 3VU8A 1N78A 2H29A 1JHDA 3ZGZA 2I1LA 4WSOA 1QQTA 5J59A 4EG1A 3HZRA 4NAHA 3RHSA 1EJ2A 2J07A 1XJQA 4ZCRA 4YP6A 4CQNA 1I6MA 1M8FA 2J09A 1MAWA 4NDAA 2A1TS 2PZBA 3ZUGA 1X6VA 1R6TA 2A1TR 4HJXA 4NATA 1IQ0A 3FIUA 1QRSA 1O94C 3CLRC 4R2LA 2QJFA 3N2YA 1O97C 1IVSA 1EE1A 4I6GA 4QRDA 1NUUA 2BTEA 2QTRA 4XFDA 2VTBA 3COYA 2PIDA 3FI0A 2E89A 1J21A 4EG7A 1M8JA 3INNA 3UC5A 1GN8A 1N1DA 1IQUA 4X0EA 4I6JA 1K97A 2J4DA 2DEUA 4QREA 2CYAA 5JBNA 4EGAA 1O95C 4CDNA 2CUZA 1JIIA 3Q4GA 1N2JA 1NUQA 1O6BA 3CR8A 1WOYA 3DO8A 3OTWA 5FNZA 1GLNA 3CLSC 1MBZA 3UY4A 4Q16A 4JXZA 1J70A 3N05A 3LE8A 3AG6A 1JILA 3IMEA 3AKZA 1YIDA 3F3MA 1EXDA 4MVXA 3L92A 1XNJA 2GKSA 2QTNA 3KT8A 1NYLA 4UZFA 3IOEA 1M1ZA 3HL4A 4ZCQA 5TEVA 4EG5A 2YY5A 1A8HA 3P52A 1UFVA 1MB2A 3IVXA 4R2MA 1T9GS 2PFSA 1MRZA 2YXNA 2O8VA 4MUJA 4YP7A 2JAXA 1IFXA 1JZQA 1F9AA 1KAMA 1O96B 4PBSA 4U63A 2O5RA 2IELA 2QJTA 1J20A 1VLHA 3U1VA 2QUJA 1PG2A 3PXUA 4DDMA 1KP3A 4MUGA 4AQ7A 1KH3A 4EFKA 3FH0A 3N8HA 1B6TA 1QJCA 1H3EA 4RUKA 4MWBA 1ILEA 1O5TA 4KPUB 3ND5A 3Q12A 5FO0A 2DXIA 3X1MA 4MVCA 5TGTA 3DLAA 3ZJUA 4HJRA 2R5WA 5K0SA 3FOCA 2EL7A 3HV0A 1FFYA 1IQRA 4F4HA 1I6KA 1WY5A 2AG6A 3I05A 2QUHA 1JIJA 4KR7A 3DV2A 2BYTA 1VBMA 1M8GA 4H3SA 3NV7A 4ZT5A 2CSXA 3VRHA 3CVWA 3P0IA 5KWVA 5TEWA 1F4LA 4MUNA 4DDHA 1N2GA 1Q19A 1OBHA 1VL2A 4ND7A 4P2BA 4XSVA 2WB2A 2NSYA 3ND7A 4U8HA 2HZ7A 2A4MA 5DEOA 1CT9A 1ZH6A 2CFOA 3TNJA 4MUHA 2JANA 4ND6A 4CT0A 4ZT3A 1PG0A 4ZCSA 1N2HA 1WXEA 1G8GA 1I6LA 1YI8A 1QU3A 1EUYA 3PNYA 3MXTA 5HG0A 1M8PA 2WSIA 3FWKA 1WKBA 3PRHA 4G5FA 3SEQA 3QE4A 1G8FA 1OBCA 4DE5A 1NUTA 2ZP1A 3M5WA 4MW6A 1EFVB 1QRUA 1WXFA 2CV0A 1TYBE 5AHWA 5H16A 1K4MA 2DERA 1WZ2A 4FZJA 1IH8A 4F3RA 3IUEA 1WXGA 1K4KA 1J1ZA 4QBTA 4GU5A 3FG9A 4MULA 1O94D 3CLRD 3MMXA 4MAFA 1LW7A 4YP5A 2AZXA 4JXXA 4KR6A 2HGZA 5HUJA 4NZPA 4L2IB 3CVYA 3G59A 3P0JA 5J58A 1U7DA 4MUIA 3MUEA 1N2OA 1O95D 4MWCA 1QU2A 1V8FA 5FO1A 1Y42X 3RBAA 2E21A 4MWDA 4DLPA 1PFYA 4OJMX 4GRIA 2AKEA 2DPLA 2DR2A 4U7JA 3TQOA 3IMCA 1JZSA 3PNVA 3A2KA 2DUMA 4Q93A 4EG4A 4MW5A 1BS2A 1Q15A 4MUFA 3QTBA 1YIAA 3GUZA 3ZJVA 4PBTA 3CLUC 1F7UA 2PZ8A 3K32A 1NI5A 2IP1A 1KR2A 1P7PA 1T9GR 1JIKA 3MLAA 3RK1A 1J09A 3L93A 3X1KA 2G36A 1Q11A 4DNXA 5HUHA 3UMVA 3KT0A 4R0NA 1GAXA 1TYAE 3MLBA 5LFAA 1QTQA 2DETA 4JZYA 1GPMA 1M8KA 3TZEA 2VTBB 2CT8A 2D13A 4MW9A 3HMQA 4NAUA 3NBAA 3FDXA 3A05A 3SP1A 3ZJTA 1KKUA 1S4MA 4G5YA 4YMIA 1GTRA 1MOPA 2RD2A 1OWPA 1T6YA 3DPIA 4KR9A 2A1UA 1MC1A 2WQ6A 3COZA 2PZAA 3SZ3A 1N2IA 3G5AA 2CYCA 4MUEA 2VXOA 3FETA 3TZLA 3SZGA 2J08A 2YWCA 2Z3VA 3ELBA 3IDFA 1KORA 1WJGA 2XRYA 1ZJWA 1KAQA 1KH1A 4MW0A 1T6ZA 4MLPA 1MAUA 3SEZA 4ZT7A 3CLTD 3NBKA 3A04A 3UOWA 3ZXSA 3ND6A 2V0GA 2Z08A 2QUIA 3VGJA 4RPIA 4PY2A 3Q10A 1QRTA 3FNRA 2OQ2A 3AFHA 1OD6A 5DB4A 3H9BA 3COVA 4WNYA 1WXIA 1XNGA 5KCMA 1DNPA 4S1OA 1IHOA 1JEDA 1X8XA 5KHAA 1ZH0A 3BL5A 3GMIA 1WXHA 2X3FA 2TS1A 5IJXA 4I6EA 4KKVA 2C5SA 3ISJA 1WQ3A 1KQNA 2H2AA 1LI5A 1YULA 4EG8A 3SYTA 1N77A 4HK4A 1YUNA 1COZA 3CA8A 5IHXA 1U7XA 4MWEA 2RE8A 1HYBA 5LM3A 1LI7A 2PG3A 1QNFA 3ZIUA 3RK0A 1SURA 1O0BA 2X1MA 3TS1A 5DASA 4G6ZA 3OP1A 1R6XA 3ZXIA 3C8ZA 4CDMA 3UK2A 1MJHA 2DLCX 4ARIA 1N2EA 1U0BB 1O97D 1ULHA 2NZ2A 1G8HA 4PBRA 1M83A 2WQ7A 1WQ4A 1U3DA 1RQGA 2QUKA 1JGTA 1O96A 4JYZA 4MW1A 5LLTA 1NZJA 2A86A 2ZUEA 3RFFA 3D6VA 3GLVA 3IVGA 1G59A 2E18A 3CVXA 4AS1A 2GOYA 1NUPA 2YWBA 4EG3A 1T6XA 2A84A 3IOBA 1GZUA 3CLSD 3FY4A 1GTSA 5DK4A 1JECA 4OUDA 5K0TA 1KH2A 3S3TA 1H3FA 1D2RA 2X1LA 1XNHA 4ZT2A 4KPUA 2X0KA 1FYDA 2QTMA 4UZEA 4DDKA 3QTTA 4NX2A 1PFVA 4ZT6A 1OWMA 2XRZA 5H7XA 4EF6A 1Q77A 4K03A 3AG5A 2JA2A 5TS2A 1J1UA 4TS1A 3CLUD 2QJOA 1TEZA 3SDBA 3H99A 3N9IA 1NSYA 3HGMA 4MW4A 1OWLA 3D6UA 3IODA 4YBRA 3P0HA 3KT6A 1R6UA 1JEEA 2B7LA 4ZT4A 2D5BA 1TYDE 2PXHA 1NP7A 4ZCTA 1EFPA 3H05A 3AIIA 3X1JA 2CYBA
chains in the Genus database with same CATH superfamily
1GSAA 1PL0A 4BNMA 3F49S 4RSMA 1KOLA 3VYSB 2G25A 3F6PA 4G63A 3NWEA 2I55A 1BS9A 3M3DA 6NULA 3W3ZB 1NZDA 2OQRA 5L53A 4BIIA 1E2QA 2EZ4A 4EECA 4MW7A 3U3KA 4EY3A 2GR9A 2W2TA 3CY6A 5FYDA 4EEXA 5GZ6A 5ENZA 3I8XA 2C00A 3U3JA 3HH8A 2OR3A 4NOKA 4Q21A 3P2OA 1WA5A 3N6RA 5BNTA 5KQPA 1ZNZA 3K0FB 5T7BA 1Y5LA 2P4SA 1VCIA 3A6KA 3VOAA 3T12A 3RS3A 5BW6B 1VPLA 2JIDA 4MQ5A 2O05A 3MJDA 4TMXA 2X0DA 4J29A 3SVZA 1OWOA 4KQ9A 4I14A 1V8BA 3A3YA 3WGNA 3B89A 3WL8A 3NIGB 3U4MA 3AR4A 2ZR8A 4IQ0A 4NE9A 4JFAA 4R7ZA 5DOVA 1QIJA 5FB3A 3ZQJA 2PRSA 3OOYA 4FJ2A 1MB9A 5HF6A 3USZA 3ILHA 3UA3A 3DMYA 4NCNA 1O5IA 2CNWA 3UAYA 4RH1A 1PHRA 1TCCA 3ESAA 3X1XA 1FQWA 4ILEA 3ZLVA 3ZBUA 3OKFA 1ZRSA 3OE7D 2X15A 1KSJA 2XTMA 3ID6C 3QELB 5C3UA 3RIGA 4G41A 4F9EA 1Z4KA 4PAQA 1L1FA 3KOUA 3U4AA 3P2IA 4L2IA 4PSVA 4BB0A 1N92A 1OLUA 2OVBA 4UXIA 2JIZD 4HG2A 4X95A 4BLTA 3IAUA 2BKAA 2WK1A 2BEJA 1HKHA 1WBDA 4GMHA 3RVMA 1RS0A 2IK8A 3L7CA 5FF9A 3MBOA 1KVRA 1ZSNA 3H4MA 4MS1B 5AXDA 1IRIA 1G63A 2WWFA 3ETNA 3D4IA 4R9SA 4UARA 4AMVA 2WVGA 1Z4MA 2IHZA 3ZHVA 3KWJA 4GQAA 1PWHA 1WU8A 1V11B 2X4LA 2WHEA 3M5DA 1EX6A 1FFDA 3MWKA 1K68A 2XMPA 3BULA 3FUVA 2PDAA 3AYXB 2ZAYA 4YJKA 4AJ4A 5HBGA 4D80A 4X7PA 2YY6A 4TGLA 1N78A 2Y0CA 1NGSA 2Q7DA 3AUKA 4ZI7A 1PZHA 2HYIC 1YQDA 2AR7A 1IATA 3L8HA 2AFRA 1JI3A 5A9SA 4YRJA 4MVJP 1TK9A 2RC6A 5AW4A 5ARBA 4QU9A 1XJQA 1V6CA 3IOYA 1WMSA 2CNDA 1SY7A 3D4OA 2J09A 3UKDA 5GIPE 2J32A 1X1BA 4YCDA 3BFPA 2CL0X 2ID9A 1UBRS 1KEEA 1WUIS 1UUFA 1OAKA 5F78A 4I9NA 2ST1A 3UN1A 4FBGA 4CM9D 1XVAA 3JD0A 2QJFA 4M2LA 4D4HA 4C2UA 1YBAA 2B6HA 2WUWE 3D31A 3LLUA 2C2OA 1GAQA 1CY0A 3BIXA 4ERXA 2Q49A 2YXBA 3O7WA 4NYIR 3T99A 1XL0A 4C1NA 1SKYE 3MJHA 4Q82A 2C3OA 2ZSBA 4JROA 1Q0LA 3IESA 5J47A 4UKDA 3EC7A 2PYZA 1IXRC 1CF4A 4X0EA 4TKUA 1W35A 4UHCA 2PMKA 1NN0A 2VP3A 4H4DA 2FSHA 2QAGC 3U9SA 1GEEA 4H7DA 3BCHA 4Y9RA 3Q2KA 5GJBA 2V6IA 2HX1A 2P90A 1R27A 2ZCVA 4OQQA 1LD3A 3RWBA 5TE9A 5DNWA 3M1AA 2XYGA 3HYRA 4HRAA 1QF7A 3ETLA 3V8MA 2NV6A 2QTTA 4L1KA 4M7RA 4U3JA 5HVNA 2UXDB 4RGYA 1JKXA 3CLSC 5THKA 3PNQA 3S2YA 3OX1A 3P26A 4KOAA 1G5FA 3E1GA 4BNZA 5DTMA 5I47A 1HLFA 2XH8A 4M6WB 4BLRA 3OZRA 5C34B 1QZ3A 1ZIOA 3F5SA 2Y92A 1JEYA 3H87A 5FAKA 4JQOA 1NVDA 8OHMA 3S27A 4KRYA 2HD4A 3M89A 4PNPA 2NTVA 4TKLA 3VR4D 1YBHA 4LCEA 3D1VA 3I73A 3WDMA 1QLHA 2J9ZB 5IAAA 1P7CA 4OOEA 1W9HA 1E79A 2QIOA 3HYLA 3IVXA 1RM5A 1L5FA 5AMXA 1QVVA 5HIJA 4YP7A 2HU7A 4JWKA 4PG8A 4E12A 4PTZA 2JAXA 3OLCX 3MTBA 5HJ2A 3PHJA 1T1EA 4G01B 1IEXA 2FSFA 5AVUA 3QITA 2VDVE 4L08A 5EJ8A 1AB5A 2PH1A 2MHCA 3WLRA 2CE7A 1FTNA 3GRKA 4L9RA 1AKWA 1M34B 2OHOA 2PHZA 4HQNA 4IH4A 4OQEA 5LJIA 3ZNPA 4M99A 3U1VA 4LHYA 4HLCA 2GN6A 4JI3B 4FUQA 4XM1A 3K4PA 2LCFA 3UW1A 1R6VA 5IC5A 1NW5A 1XEAA 3QRWA 4NZOA 1X7XA 1THGA 4K5QA 3SJCA 3UB2A 5FBLB 3U3XA 1FDOA 1ZIPA 2OO5C 1W34A 3II6X 4C4TA 2JARA 1K8ZB 5KOJA 2V8OA 5ALDA 1OCEA 3ZV7A 3QKWA 1XG5A 1N5MA 3R5XA 3JQFC 4FSXA 3AV3A 4OHCA 1W2GA 1QQ6A 4IDDA 1NMZA 4FU0A 3JWGA 4HJRA 4K8RB 4YYZA 5K0SA 3TRDA 1CUWA 2BM8A 3C45A 4IH1A 4F7WA 4QBGB 4ZVSA 4KCGA 4OYYA 1I6KA 3CF4A 1UXKA 4XW2A 1Y1PA 3TB4A 3ZV4A 1JHPA 3M6FA 1RLJA 3EGDB 4JQCA 3TRJA 1DKNA 2R68A 1M1NB 3OPVA 1K08A 4XPIB 4B7AA 3TZQA 3W2FA 2PUCA 1AGPA 3DAOA 2BUCA 2ZITA 3ZCQA 2I9PA 2GCIA 1I9CA 2PLAA 2BWJA 1RWNA 2OGTA 3PA8A 4B35A 1P4RA 5JDCA 4MS3A 3ETCA 3FOBA 4KGXA 3KZXA 2V5AA 2XITA 1MOQA 3OD5A 4TSFD 3HC7A 5EEHA 5GONF 1KMCA 1B1CA 4BO0A 3FNBA 1MXFA 4W9NA 5ARDA 3HUFA 3R7AA 4NCBA 2H63A 4MUHA 4ARZA 1BO6A 3EQ8A 5LYJF 3QKSA 2GD0A 3EEFA 1NXSA 2JVKA 2O8BA 1I6LA 4WA8A 1V7CA 2FNAA 5DE3A 2H1OA 1FFHA 1G20B 3W05A 4QDKA 1TF5A 4BMNA 2A0WA 4V1CA 1T34A 2EHJA 1JDNA 4XRRA 4NJMB 4ZOQI 3CUWA 2G17A 4HUQA 2E4YA 3FWKA 1GARA 4L5CA 3O21A 2J3LA 1WKBA 1C80A 1GUZA 1RYDA 4NOMA 3TBHA 5ELXA 3ONFA 3PRJA 4FMCB 3UH1A 1Z8FA 2FKAA 5LB4A 1KE2A 3BORA 4HS9A 5EEGA 3ZW8A 2J31A 3G7UA 4C7BA 3CUSA 4C1BA 1E1NA 1VJCA 5IC4A 2P5UA 3RSHA 3SQNA 2CV0A 2EKDA 3DAYA 5BNIA 5KTYA 3DJFA 4GXTA 2VO1A 1BVRA 1MZVA 4ZTBA 3CZMA 4X6LA 1PEYA 1Q20A 5ERXA 1R4ZA 3BA1A 5CX1A 4Q4CA 1J1ZA 1MO5A 3TD2A 2V7UA 4YRFA 1GGMA 4ZJZA 3I34X 2VYNA 2JBWA 5EHGA 3MS2A 5EQDA 2AZXA 3IFSA 4JP2A 4BUZA 1E3WB 2NVOA 1B4DA 3R6WA 4TTIA 1KETA 1BGWA 1STOA 2RB5A 5JD6A 7REQB 3G1UA 4TWRA 1US8B 1NF8A 4D56A 3ICVA 2O8FA 5JUWA 1XZ8A 3BTSA 8LDHA 3CX3A 4ZQEA 2XBLA 2IGTA 4LMPA 5DMXA 1HEIA 3V7YA 1MC4A 2OC9A 4YQZA 1HG0A 4MTCA 1C2TA 4X45A 4M1MA 4AJ1A 3T9BA 5EPUA 3N2GA 5JAIA 1BRTA 3DV0B 3B7PA 4G65A 4QLBA 2DPLA 2G63A 5BSVA 1OIWA 2ACEA 2ZJZA 4UOQA 3ADBA 2IYPA 1VPEA 1J49A 3EOAI 3QVGB 3ME5A 1B3RA 3NHFA 4I19A 4MGHA 2DU8A 2YDYA 1Q15A 2BFEB 2C0CA 2NZ8A 3WHPA 4YV7A 3CCBA 2J0SA 5JI3E 1A8PA 4UVGA 2WT9A 1VE3A 3HGTA 1FP7A 3H13A 3MTEA 2VOJA 5EE1A 4YJ3F 1NRJB 1UXJA 1RAAA 1EG7A 1PYOA 4LMBA 5TNXA 1FP6A 2Q4OA 3CRRA 5ED4A 5K0JA 3P5SA 3JPYA 1GYQA 2BMEA 3O26A 3C3DA 5ITSA 2V4UA 3GV0A 5J9FA 3KT0A 4R0NA 1UDBA 4OFWA 4OL9A 1WUKS 3N07A 2HCFA 5BWMA 1JWBB 5AUQA 3V55A 3HK2A 1M0EA 3LW8A 4K9OA 5F5NA 1IN1A 4DV0B 4GDMA 5JSHA 1GJRA 4TM7A 3HLYA 4IP0A 2OXTA 2IPAB 2P27A 2YJZA 3PFHA 1CG6A 3QA9A 4DIUA 3RUPA 2HSJA 2YS6A 2Y68A 2H1RA 3VR2A 4LHZA 4XWGA 3WWZA 2R00C 2DM6A 4RKFA 4TRRA 4KLNA 4X6YA 2UUBB 1K7YA 3LNTA 2O06A 4UM7A 4DYHA 3LW7A 3F3SA 1CY6A 4DIEA 1P5FA 4AVYA 1MT3A 3EGXB 1F0PA 2R1VB 4IIYA 2VJLA 3SJ7A 4AURA 4R8RA 3GDFA 3BFXA 1Z4JA 2PGNA 2VRBA 4WZAE 3T1VA 3VYVA 1XQ6A 4DCOA 1AMUA 3W2EA 4QLAA 4ZPJA 2OCDA 13PKA 4K6MA 2NO9A 4UEOA 1U0LA 4A2PA 1Z45A 2FE4A 4Q9HA 1I3MA 1CRPA 3U26A 1N8TA 4O02B 1ZGZA 2MT9A 1KH1A 1WKCA 3BBPA 4LOIA 5AJHA 3RS0A 4EJSA 5A5VA 3K94A 3UF0A 4LSZA 4BKPA 4P8RA 3UBMA 4XYLA 5I9NA 4GWLA 1W88B 3R23A 3O94A 2BFDB 2X9QA 2VSNA 4QTTB 2PSHA 3B9BA 3FHLA 4OOFA 1AUQA 4AZSA 4MA0A 2WA2A 2Z08A 1GZDA 1KOFA 3LPLA 5KTOA 5CH3A 2QRKA 2IF0A 3AFHA 4PIPA 5ALRA 3AYZB 1DRWA 1HXHA 4Q7EA 4OGGA 3H9BA 1Y3CE 2P4UA 5ALFA 4DBLE 3UBTA 4L6IA 1WABA 4HS4A 1R1DA 3A3KA 3AO0B 3IJ5A 3HBJA 4JUAA 5AVVA 2CVZA 4Q24A 2B4AA 1IVYA 2IU0A 4CM7A 2HBZA 5JCZA 1K2VN 1CULC 2ESRA 1QFMA 3PC8C 3R5SA 5FL7A 4F9FA 3GPLA 2BGWA 2RG1A 1M7HA 3HKEA 3HKBA 3P9PA 4LJ4A 4RK4A 3FDZB 5DLPA 4CIXA 4A15A 2NO1A 2ZJ4A 2QSUA 2P9BA 1K06A 5F7ZA 4FNOA 1I8TA 4L9SA 2Y6VA 2HMVA 4LX8A 5DU2A 2MDTA 1ZCFA 3PD0A 1SURA 5DKFA 1VJTA 2QU7A 2Q07A 3MJVA 2PGXA 5AHKA 1FDWA 1RWPA 4WNAA 3PI6A 1U0RA 2APJA 3KOYA 4BLUA 4BNTA 2HA0A 2ZRBA 4LY6A 3TIGA 4DC9A 1B8NA 1A8SA 1GEGA 2ZPAA 1E2EA 3V1KA 2YYYA 3PRKE 3BYZA 3I5AA 5F7JA 3FSGA 2JF0A 3B6KA 1ECPA 1M1UA 1XJ5A 3QLUA 4TMWA 2I4RA 1O87A 3K4HA 3PD7A 4IV0A 4HZIA 3SYLA 4DCUA 3O4FA 5KWEA 2F55A 4UPDA 3W2TA 5EIFA 3GJ7A 5BURA 3AX6A 1HWYA 2LKDA 4O8ZA 4EHKA 2W70A 4EA8A 1NBME 1NY6A 1W19A 4DARA 1W46A 4HV4A 3QPDA 3TOCA 1SRRA 4ZDWA 1WY7A 3A2LA 1RW4A 2B1JA 1PQ4A 2ERCA 3QF4B 5CA1B 3Q41A 4LDJA 4TYPA 2X13A 3WLFA 5M2QA 1XN1A 2AR0A 4JUCA 3SQDA 3L8GA 2VNIA 1Z13A 4GP9A 3QP9A 1UWLA 1YASA 3AQ4A 1WEHA 4WY8A 5C35A 3EXIA 1R9JA 2Y2UA 3CSUA 5AI9A 5ADHA 2IEZA 3AJAA 3GPCA 4BFLA 2DHCA 1GUAA 3K0CA 3RV4A 1XZPA 3BWVA 1DWQA 1D0VA 1UIMA 3KKMA 2VYVD 5AOBA 3DSRA 4O5OA 1M3SA 4OYRA 2PT9A 4RHXA 3HJGA 3IMKA 3JASB 2HA2A 3ELWA 4QULA 3VPHA 3ND8A 1K88A 2SCUB 3CJQA 4LX0A 1VPVA 4MGYR 5K3FA 3GLFE 1BHQ1 1CLEA 3UG6A 2DKOA 2GA9A 4YXWA 1XWIA 2BZSA 3AVPA 3VX4A 2AQKA 5EWLB 2BJHA 2J33A 3IAS6 4GQBA 4LXHA 5BMOA 4KQKA 2ZIXA 3DUFB 1UL1X 3FNHA 3DH0A 1T1IA 2FUEA 5AKZA 1R4NB 1YR6A 2PUTA 3VU9B 1QTRA 4E0BA 4YRTA 1P5RA 1RU3A 2ODTX 1TVCA 5CDHA 3NKVA 3SHVA 3N7AA 3P9KA 4IDHA 4OLHA 1L4BA 4C4XA 1V9LA 1PQYA 1UK6A 3UK7A 2AW5A 4ANFA 3EULA 2ISCA 3RUHA 4FWTA 2RHWA 3O75A 2FYTA 3ZH2A 5TJHA 3SFZA 1P1HA 3O0TA 3PGXA 3LO5A 3NB0A 1G7RA 1KI8A 1S7CA 1TNDA 5AJWA 4REMA 3SFTA 2PQ0A 2OGSA 1AGYA 1TT5B 2YW2A 3WG9A 2E7ZA 4CQMB 2ATXA 4ZTZB 4O4LF 1KQPA 3RJZA 3SC6A 3WLPA 1XHFA 1VHJA 3SQMA 1LC0A 1HQYE 1PFWA 2FETA 3SX0A 1PF7E 1J5XA 2BHLA 2YZKA 4AJNA 4ZYYA 5TIIA 2VDRB 2FPPA 1N3LA 2YFKA 1U3UA 3KSAC 4PHTA 3LDFA 3PWTA 4DB4A 3R76A 1BCRA 3JAKB 2FN7A 4GE0A 3RKUA 2QNRA 5TMEA 1M66A 3AR3A 1JTVA 1KEPA 1SWWA 2C94A 3HBNA 3QU2A 3TLXA 3V00A 2I9KA 1Z4PX 1I0ZA 4UMFA 3CGGA 1ZWKA 4DNFA 4PNEA 4YJ2A 1D7AA 3ABRB 2ZRFA 2C7OA 4EJ0A 1N8KA 1U6JA 2GBLC 5C32A 6YASA 4CV3A 2EP7A 2PX3A 2PH3A 4J75A 1YHZA 5EIEA 1YZQA 5KMGA 2E1PA 4HQFA 4TMFA 1OH8A 4JMPA 3ISTA 3K8OE 1BXRA 1QVAA 2XXJA 1V2HE 1DC3A 2F8LA 2VKTA 4CG3A 4BO2A 4RD4A 4AX8A 1RPJA 1R5BA 1CS4C 4NE7A 1CNFA 1IHXA 4DBVO 3N3BC 3HY3A 3QYPA 2I71A 1OLSB 4MCJA 5ED0A 1RM4A 4RENA 3BN3A 2O6HA 1U2PA 2Y66A 3OESA 1TRKA 2HEIA 4MR7A 1NSFA 2IYEA 4I2VA 1PS8A 2GS9A 4I1VA 2FE1A 2WNSA 1AZTA 3Q85A 4US1R 1L6IA 1TUIA 1RYEA 5HF9A 1R74A 1UBCA 4E2ZA 1A9OA 3TKYA 5LR6A 1K0FA 4UEKA 3IH5A 4V0NA 4FSDA 4CCWA 3RT1A 1TZCA 2HRZA 1ACLA 4IF6A 5BSKA 4Q05A 2AJTA 4EG1A 4XUCA 2LE0A 3LQRA 3I5XA 4QARA 4DZTA 2ZB2A 1H0HA 3ZIDA 3FOWA 4CQNA 3EDOA 5CVUA 4DA9A 1MTOA 3IEKA 4OVKA 4B5LA 1PV1A 4HAZA 3STXA 2ZR7A 4XWYA 3VA7A 3BHNA 2H0AA 3EDQA 2KBEA 3O1IC 5EYPA 4AG3A 1NLZA 1HE4A 3A0UA 5E7IA 4BNHA 1QDLB 4AKSA 1RVDA 4M1YA 2JGJA 1RAGA 1EZ4A 1V35A 4IGIA 5F2EA 3NNSA 6LDHA 4QJ5A 1EFTA 1X70A 2Y9PB 3IMFA 1L5LA 5JADA 1SXJC 1X80A 2SNIE 1FK8A 5DHPA 4P34A 5EQTA 2IDKA 2ZYDA 1UBJS 2YFQA 4TUYA 5BSTA 3V1YA 3MCWA 3INNA 4DW8A 2G71A 1ZUNB 1TM5E 3ZCPA 3W1VA 5MFZA 3T7IA 3K8QA 3OCJA 3Q9NA 2ZXFA 5B37A 1GU7A 3FKJA 1SUWA 3O8CA 1IUNA 1PEKE 1T5BA 1K63A 1WCYA 2JGMA 2P6PA 4TZTA 1OAAA 3UGKA 4M0UA 1RC8A 2FA9A 1NUQA 4KIGA 4WKOA 3DF7A 3OI7A 2IZ0A 1AXGA 2YHIA 3KK0A 5KVSA 1H8HD 2IV2X 4QUDA 5IDYA 4G8CA 2ODWA 3NBMA 3RJ9A 2IE0A 2G1JA 4MHOA 5EVCA 4C6SA 3D2AA 3GFPA 4PPNA 2BFAA 5NLLA 4IDFA 3VZCA 1GDTA 1MO2A 4WZBA 1O08A 3GFFA 5TMBA 3P1JA 4NABA 1T6BY 3KV1A 1NLUA 4UD6A 1FC0A 5IVIA 3A2MA 1AKRA 4K1LA 4D82A 2YZ7A 3EODA 4D3YA 3OLXA 4QUIA 1ORHA 4EG0A 1YQ9A 2FMIA 3KO8A 1HOXA 2RHJA 1WETA 1KZGB 2ZI6A 4FZ3A 4CQMD 1KAEA 2G3YA 2XUZA 3C7KA 1RIIA 2C8LA 1GXSB 2XQGA 4HWPA 5EJ2A 2ZS7A 5E1OA 3GJRA 3WX0A 3EIFA 3QY0A 1MLDA 2B4KA 5JR3A 1O96B 1PJAA 3JD1A 3RTEA 1CNMA 2O5RA 1YC5A 4MMZB 3FCSB 3HEBA 1TM4E 3U4CA 3VDQA 4FYXA 3PC2A 2F1OA 1R8XA 3KSZO 3RS5A 2XBMA 1AQYA 3PXUA 2NTYC 1ZUIA 1H9CA 1WXXA 3H3XA 2O8CB 4A4DA 1PDWA 1QAMA 1T2EA 3SG0A 1YC2A 4BGVA 5LB2A 1E5QA 1VLMA 5U4QA 3WTBA 4DPLA 1EK5A 2QSYA 1JHUA 1XD2A 4EHFA 1H1LA 1CR6A 1FPMA 1NP3A 2GRAA 2Z83A 3PV0A 4F6LA 3L07A 5KKCA 5CYOA 1QB7A 2G9UA 3BL8A 3K20A 4ZYTA 2LCIA 4GAEA 4R0MA 2DBZA 1D1PA 2Z3ZA 5NULA 3NRBA 3WSTA 4IUCS 4WCVA 3ZXXA 3BMNA 1OGYA 1AJEA 3O90A 4E51A 3I4LA 4LTNA 4CN9A 1P72A 3NTVA 2XDQA 3OQ1A 1XO1A 2XGOA 3EB9A 4OYLA 4MV8A 4TS3A 4J7AA 3ZCXA 3DP9A 1LLQA 1SIUA 3I9KA 5FADA 1FL9A 2GT1A 2AI2A 3ETGA 2HWYA 2EQAA 4MHSA 4OIMA 4ZT5A 5K9ZA 3CC8A 3AONB 3JWIA 3VXKA 2EQBA 4YT2A 1A5BB 1B23P 1JR6A 3KKNA 5IJ9B 4BMSA 1VL2A 2J6IA 4KSBA 4BZPA 4MV7A 4P2BA 1W36B 3J7AC 5FA5A 3QJYA 2ECKA 3O31A 3PDCA 4KGVA 4Y2TA 5DOZA 4CTJA 1JSXA 2AMVA 5FLXA 1F2TB 2ACWA 5K8VA 1A97A 1E3IA 3L6BA 4M49A 5T6BA 3SHOA 1FLVA 4UVEA 3VBEA 3WV4A 5IM4A 4RPLA 2Z9DA 3W5AA 5JEEA 3R9XA 2AW3A 2O2JA 4R40A 4XGIA 5FPYA 4FYMA 4RACA 5LCXA 3PPIA 1B6SA 3AY6A 1G5IA 1YI8A 4KVGA 4TTAA 5EMJA 1T4GA 3K8YA 1NIJA 1T24A 1P9OA 3GZNB 3F6YA 5JD3A 2HIGA 3ZD8A 4ENWA 4JS0A 4WIAA 1DJLA 3TMAA 2NTJA 3PLAE 3VR5D 1KJWA 2IH2A 2VHTA 2J3JA 3DKRA 4ZI2A 1QQ5A 3ZJ4A 1UBNA 2HB6A 5B4UA 4MV0A 1NBWB 4HYQA 4G5FA 5FOSA 1W5BA 4CTNA 2OECA 4KBYA 3ET4A 4AJ2A 4ZJPA 3ZWMA 3H2ZA 1LQUA 2JI6A 2L42A 5JQGF 1XF1A 3DOOA 5GVRA 2YIVX 4L76A 3BB1A 5JMPA 1FQKA 2PGIA 1P6XA 1Z4QA 1RJDA 1FJ2A 1NFFA 1UDWA 3EWAA 1BU8A 3JQ7B 3NBUA 5CW2A 3UXYA 2H4FA 5JNRA 1X7ZA 3MCTA 4WD3A 1Y98A 2ZIFA 1LPNA 1ARZA 3ZCSA 4DCCA 4CTMA 3BDVA 1U98A 3IO5A 4F3RA 5CA0A 5CEEA 3AOEA 1N6KA 4JI7B 4B3RB 1Y8QB 3B1XA 3U44A 3AVWA 1V5IA 1J2UA 4II3A 7GPBA 3TTTA 2XYRA 4PWYA 1KHTA 3DHWC 1F0KA 4WDQA 2JJYA 1KZ6A 2ETXA 1N6OA 4YDHB 3NJ8A 3RT7A 4MV5A 1KKLA 1AS0A 3JY6A 1U8AA 3PG5A 3QVMA 3EA4A 1E1RA 1UK7A 2OSBA 2QE7A 3JALB 3PQ6A 3IJRA 4B6JA 4EITA 3MUEA 4X62B 1PEDA 1RYHA 1NT2A 4KL8S 5CDTA 3FROA 1FSZA 4UUOA 3VHXB 2R7AA 4JBIA 2DFTA 4U9IS 3G89A 1PFYA 2Z4RA 3MQ4A 3MWGA 1JQAA 3ESYA 3T3NA 4CZ2A 3FB4A 3G0BA 3PYLA 4PX5A 4LSMA 4S1PA 4OFXA 4ENQA 5HJEA 1L5VA 3JAWB 3TQOA 5GIOE 1L7OA 5IX8A 3A2KA 2JRCA 3ANYB 1E3SA 3HCDA 2PLWA 5JAUA 2GN0A 2O7VA 2C20A 4NTZA 1H65A 1ESCA 2VWQA 4YCJA 1AQJA 5U9CA 3P19A 1AIPA 3L8DA 2GZ1A 1JDZA 4FCWA 1F14A 2PGLA 3U31A 1KR2A 1MO3A 4BIMA 4JSTA 2G5PA 4L5BA 4WTOA 3UMGA 2ZYGA 4L7QA 2WWVD 5KUTA 2NXNA 3JQCA 1Q11A 1RYYA 4DNXA 1ONOA 3IPCA 5L51A 1G7SA 4I99A 4RGVA 4PVDA 4NZYA 3S8MA 4DL9A 2PVSA 1LSUA 5FBWB 1JBKA 1QVWA 3ORQA 1KGSA 4G5GA 2OE2A 3L82B 1TLFA 2AMJA 3DEZA 3W5JA 4M8SA 1XD8A 1OB5A 1B6GA 2Q2QA 4OBXA 1U2DA 3ZKWB 3NBAA 3T4XA 2BEVB 1N3YA 5AW1A 2BBWA 3CPEA 3W6UA 1BGVA 1IVNA 1RZVA 1E3EA 4B0PA 1NVVR 5FTKA 1EFHA 1MOPA 2F3UA 2HLHA 2CLIB 3DBVO 5IMSA 1IB0A 1MHPA 3KYIB 5EGNA 2W5UA 2W48A 3GHYA 1KVQA 4QHTA 4ND5A 2YNMA 2ZWPA 4ZAFA 2ZXUA 1ONSA 2PZAA 4ZAWA 3IKMB 5B3JC 4PYMA 3CNBA 1U9IC 3O8QB 4R2KA 3GMDA 1VIMA 4IIBA 1W36D 4Y2PA 2H1SA 2CY0A 2QTWB 3ELBA 3TRFA 4EGSA 4YRCA 5KNBA 2PUEA 4N76A 4H7EA 2YQ4A 1QMPA 2HJRA 4ADSG 2PYDA 3QHQA 4LQ4A 2ZIZA 3N8NA 5GJVC 3I5UA 5HRAA 3SCZA 3QPCA 4YRDA 3CF2A 1QH9A 1NVKA 1ZBDA 2R6ZA 5T3UA 1A88A 2CL6X 4YJGB 2WZBA 2XEXA 3FNFA 1P45A 2QVZX 2VK8A 5K0EA 1AKTA 4L5IA 4MPJA 4YRMA 2REQB 2OCBA 2OO7A 3S1LA 3WYDA 4JLNA 2REOA 3TI9A 1XRQA 2IP4A 3AEUA 4JJ7A 4ZPXA 4UVDA 1X9HA 2DBQA 3BH7A 3D8BA 3G2LA 3O4HA 5DB4A 2ZANA 3H5LA 3BWEA 2IS2A 1QM5A 3PHHA 5CNIA 1IBLB 4II7A 1JEDA 2AUTA 1E8DA 2CB0A 3KKLA 1TVMA 1EWQA 3BJMA 4O1IA 1RXUA 2PYIA 3UK6A 1TVEA 1E3MA 4XJTA 2O59A 1GZ5A 1XVIA 1PGJA 3AEXA 4Q1AA 2IVFA 1KK2A 1YZUA 3WV5A 4DLBA 3V4OA 1KEUA 8ABPA 4I6EA 4XWKA 1HYQA 2VDPB 3CEPB 3F4KA 4X7MA 1AGRA 2EERA 1FNDA 4N5MA 5ALYA 2YJTD 4MDYA 1JJVA 1KMQA 3F1KA 5EWMA 1J9ZA 4MGIR 2TMYA 1RC0A 5H70A 3G82C 3KZKA 2H5LA 4X7RA 1RCFA 1J2TA 3ZIUA 3DBLA 5I9IA 1VIYA 1H94A 1DEHA 1MX1A 1ZXBA 3NWBA 1GZ7A 3OJLA 3PPVA 3ZDRA 2BGNA 4XD7A 4BX8A 4C7XA 4E46A 1F5NA 2G0TA 5EY5B 2ZRMA 4MDHA 4E11A 3IE1A 4Q4AA 3C8HA 4DT1B 4HL6A 4PSKA 3SSAA 3O8RA 1GSHA 3FMGA 3GP3A 4IWNA 2ZJOA 3S0JA 1R0YA 1W25A 2GHTA 2AFIB 1JEQA 1T9BA 3BMQB 3SX2A 1R00A 3HZOA 3AHIA 1D5CA 3VC3A 3WLIA 3I6MA 3GGPA 3ODPA 2JGLA 1U3DA 4OGWA 2R0QC 5FR2A 3OJEA 1Z22A 4LV8B 4MVJH 3K70B 3CEMA 2BTOA 3GGOA 4HX2A 1D2AA 1P2TA 3N2KB 2WM2A 1VE6A 2C4WA 4J2TA 3ZWXA 1PFKA 1C7QA 2GD6A 2AI3A 2LZ0A 3D5EA 3HA7A 4P7GA 5DISB 5BMVB 5LU9A 1K7SN 1M2WA 3GFOA 3PIDA 1S8OA 4ZOBA 3VR3A 4X64B 4BVLA 5ABPA 5KBYA 5EZ6B 3OKPA 4PTLA 1GFIA 3L84A 3DZIA 2IHUA 3D6VA 1UDXA 3K0BA 4KWEA 4XGKA 4M7WA 4F8EA 1IBCA 1YJAA 3HXLA 2C4NA 4LZAA 3UJAA 1NYQA 1DIOB 3PI7A 2FMUA 2XE7A 3KX2A 3IPYA 3OJFA 3U17A 4UU7A 3WNZA 2IYZA 3DMNA 1NYTA 4HFJA 2BFFA 4ZT2A 1D0SA 1MFPA 3I9MA 4RBNA 4PG7A 2W43A 1RM0A 3KTFA 1TD9A 4YACA 2OYCA 1B0ZA 1IUKA 5DTIA 2QTVA 1XA0A 5KYYB 1H4SA 1V95A 3L0YA 1UK9A 3MWFA 3T0FA 2LXNA 3R9IA 4HZUB 3JSXA 3JCZA 3NDPA 4BVGA 4HDSB 4CEHB 1ULAA 4YMSA 4ARIA 1J1UA 2C1XA 2V59A 4JC4A 3OZXA 2BI4A 1TEZA 4RGBA 3SNHA 1VSVA 1UPXA 4DA7A 1FLDA 3B7GA 3AUJB 1XBTA 5B5SA 2YJ5A 4ZQFA 3ZDYB 1E9EA 1FX0B 2A94A 4AO7A 3ADDA 2G5CA 1XXHB 2B8JA 1K2WA 5A06A 4WLVA 4PSDA 4XB2A 4ZCTA 2WSSA 3CFYA 1HORA 3ZE1B 1FY2A 2HSWA 4ESOA 1HT0A 2UKDA 2QTGA 4M9RA 3T1NA 4GBED 4KFUA 3GBSA 4EY6A 2OM2A 1PJTA 2ZVQX 3QMVA 5HQ3B 2H52A 2VNAA 5GTDA 3KVOA 5D8DA 3LHSA 4RDHA 2Q4RA 3HP4A 3HUEA 5EJ9A 1NMQA 1P61B 3VKFA 1P0MA 5H9VA 4FX2A 2IYQA 4I5DA 4WW0A 4WK0B 1ESNA 1T3SA 1W2WB 5EJ5A 4A26A 5LQAA 2XIQA 2ECQA 2H2GA 4TV9F 2IPLA 5DVZA 2W2PA 1KZYC 1AF7A 1SOUA 1OFIA 1Y3IA 2C95A 2F1IA 2VF2A 3DZDA 3GAZA 3A7EA 4HSEA 3W06A 2J67A 4JP3A 3N8DA 2A8YA 2GTIA 4AQDA 3K9BA 1M33A 3IKLA 2WVJA 1Z0SA 1S2MA 3FPKA 1AV6A 2CMGA 4D9KA 4Y2QA 1CB0A 3DB2A 1M7GA 2QYSA 1XB2A 4MI9A 3RUCA 1JW9B 3EIOA 1AK2A 1NQAO 1CZNA 1X94A 2R6CA 3BL6A 3ICCA 1E96A 3NALA 2W37A 4LY3A 1EBFA 1WU7A 2O8NA 3CE9A 3VQTA 3C3YA 2I91A 4OSEA 3L1UA 4HAOA 3W6PA 3KWMA 1M5TA 2YHBA 3TJRA 4YA6A 3AVQA 3KFLA 2WAOA 4JV5B 4Y18A 5DNVA 4ZQBA 1UK8A 4F5DA 1T36B 4C07A 1J2RA 5AM3A 1FDVA 1ZBQA 1GY8A 2W7TA 1FDTA 2HLDD 3DNFA 1ETUA 1KZ4A 1QO0A 1ZITA 1F6DA 2GZ2A 3C48A 3KHSA 4PZUA 4EGCB 1L5OA 5CDYA 1UPUA 4LYEA 3SXUB 1J8DA 5LP6B 5FNVB 1QP8A 1RWWA 1K0UA 2QLBA 3AR5A 4RPCA 5F76A 4BO6A 3KUXA 1RXIA 4C7JA 1MEJA 4YRIA 5JNLA 3E27A 5F23A 1EGHA 3DT6A 3RUDA 1LBIA 5AQEA 3WI7A 1S3GA 2EJCA 3VVLA 4OO3A 1Z62A 3M0EA 3CMMA 2XMDA 1M6HA 1Z6GA 3T3GA 3CRQA 4AY4A 3N28A 2H07A 1K6XA 2R8YA 4MQ6A 1DV2A 3ZWNA 5H4HA 2A1UB 4QYWA 2ZUFA 1U1FA 3THWB 4GGMX 1M6NA 4RABA 4F93B 1RRGA 1IY9A 2C5EA 2YZGA 1BEEA 4I5IA 3D02A 4LGVA 3OAAA 4ZDKA 2NG1A 3K70D 2FWMX 5G4KA 4EHHA 5K8LA 1MMFB 2JD0A 4QOFA 4Z0PA 2XDAA 3TFOA 1MG5A 1GRQA 5DYIA 4OJQA 1GKIA 4G9EA 4BNDB 4DKJA 1TZJA 4LZPA 4CVNA 4D4MA 2QD3A 1S2LA 1X6VA 3NDIA 1PO7A 2CK3A 1I2MA 1MVNA 3KL4A 3WFJA 1UJNA 4ID9A 4KXWA 1QK5A 1AVTA 1YF3A 1QRSA 3H6KA 1NJ6A 4Z1MA 4GHWA 2AFHB 2EKZA 1GT91 3GUUA 4I6GA 3AR8A 2Q9AA 3JYHA 4INAA 1VL8A 3CXRA 3B5JA 3L8FA 4BBPA 2E89A 4Z0NA 2J48A 2AH5A 3L40A 5E6SB 2Z56A 4B17A 3FMOB 1CE8A 2WSLA 1L7BA 3LT0A 5KJEA 4A0GA 1RWVA 4XVQA 2FQYA 5AJZA 3ONVA 4GMGA 1P1FA 3L1JA 3LC0A 4BVKA 4WCFB 4P86A 2NADA 2C7PA 2R3SA 3A6ZA 4U02A 5FUMA 1EFUA 3WAJA 2FUG6 1GPAA 4YPFA 5K2OA 1YS6A 1GPH1 2B3TA 2I03A 2W11A 3HDVA 4V0QA 3WL3A 4MUXA 1ZCJA 4NENB 4N0EA 4V1CI 3GA5A 2NXWA 1BYUA 1XXLA 3OIDA 4E5UA 4MR8A 5JD5A 5CPFA 2LGJA 2JHAA 4JEIA 2AVNA 4E6PA 5J3JA 1F2UA 4IDEA 4IOMA 2PQMA 4I46A 4ZOLF 1J23A 1L7NA 2MYTA 4PO8A 5CLQA 4MQUA 3U1BA 1MOSA 1T0HB 1ZCBA 6GPBA 1SC4A 2OO5A 5AW3A 1TM1E 4L78A 2H7VA 3DZ8A 5PGMA 1M0SA 4N6GA 2FPUA 2WT4A 5C8DA 3LD9A 1ODKA 3BILA 4IV5A 1MRZA 2GWRA 3JQFA 4YAIA 2YJGA 3DMHA 3H2JA 3ZDXB 5C46F 1A50B 3STUA 5ALEA 4XPZA 1HURA 4TTQA 4ZZ2A 4FMCF 5KYWA 1OB2A 1SC6A 1YZVA 2UZ1A 3AHFA 1ZONA 4LDZA 1JFLA 2B78A 2JAOA 3AMVA 1UOPA 5BORA 2B3DA 2HTEA 4MYHA 1MX9A 5DIZA 2VQEB 1SOMA 2CXHA 2R86A 3KFXA 3MVEA 3CLKA 5AW7A 5DFAA 1UZAA 4TV8F 3OC6A 2ZT5A 4MZDA 1H2BA 4YT4A 5ILGA 1KEVA 2RHCA 5KYTA 2XA9A 1TB4A 1EFCA 4PFJA 1QO9A 4RA9B 5C31A 4LBVA 4NNPA 1QPGA 1FLNA 1VE7A 2YZNA 4HDRA 4UBMA 2WIJA 1H66A 2GH1A 4PF1A 4KPUB 3BXOA 3F78A 3THOA 3WQRA 4EFMA 4IVQA 4LV5B 4DYDA 4LTMA 3BSYA 5JWRA 3ZJUA 4MROA 1E1QA 1XKTA 1IOWA 3ADPA 1TF2A 3EAQA 4R2IA 1D4OA 1F17A 1JDTA 3HJCA 3NONA 1KAOA 1GN9A 2GHRA 3U3RA 2CD7A 3RKRA 3N2ZB 2JLWA 5CYFA 1UODA 5JFTA 3L7DA 3UV7A 1WUJS 3O9ZA 3PF9A 4AMZA 1U31A 3UH0A 4XGQA 2OSVA 1SB9A 1WZIA 3CPHA 3P0IA 5AVZA 2EF0A 1OBHA 5C8YB 2O2XA 5I5GA 2AL7A 3C5VA 2C2ZA 1R5JA 2JJ8A 2J0UA 1XP8A 1CF2O 3FVRA 1PW5A 2QVBA 5FQNA 1XMPA 2JJMA 4URZR 4U2KA 3DMDA 1E2NA 1Z16A 4KTTE 4XH9B 5G53C 1BW9A 3EIWA 1D5WA 4B75A 1GADO 3MWDA 5IPFA 2WD7A 1RPZA 3PNYA 4KK3A 2OB1A 1FQOA 1GHTA 2X3UA 5DNAA 1UKYA 5GONA 1Z88A 3G5UA 2FQ1A 3K0KA 5BPFA 5C7LO 3FYSA 4RXTA 4XJSA 2SHKA 2JJ2A 4MQLA 1VP3A 1HX7A 3UGTA 1GA1A 2QWXA 1V1MA 5DN6A 3UFXB 1TI7A 5LYJA 1MJ5A 5JNTA 1H6BA 1CYEA 4IBOA 3A9CA 5HMMA 1TTPB 4ZFNA 1NJ1A 2FPXA 2YXEA 1ZSYA 3QKRA 4C14A 4AJIA 1YT5A 3TR6A 5H02A 4NULA 1JHYA 3D7MA 2KWIA 2X4IA 3MNFA 1EK2A 4N4AA 4PPFA 2BUBA 1ICIA 3M5PA 4S2EA 4IPTA 1NQUA 3EGEA 1P9RA 4TLEA 1SZDA 5JARA 3GT4A 1E9DA 4MV6A 2Q5EA 4RK5A 3VKHA 3FG9A 2JGIA 5IWAB 1XR3A 9MHTA 5G1NA 5C1OA 2KSQA 5D86A 1DHTA 2XVZA 4M0PA 4KLZA 5A0TA 2QVGA 5K2MA 2I4OA 5D1NA 5KTSA 1MAAA 2WIGA 4EW6A 2VSQA 2FSIA 3LUFA 2IEIA 5F33A 1U2RA 2OXIA 2XI4A 4X8OA 1Z39A 5IBPA 3CUKA 1NW8A 4GFDA 3DVSX 2CFSA 3ZVKA 1UBOS 2CMKA 2O6LA 2HQSA 5JJLA 4NV0A 5EIWA 1GTVA 2HPZA 4R8MA 2ZUTA 1FJXA 2ZJAA 2R8ZA 1L1RA 1P7VA 4WI1A 1IEWA 3M70A 1WB9A 4R68A 4QUKA 3RAEC 1KOJA 1NWCA 3ZHQA 2GAAA 3QNWA 3AR2A 4DPMA 2JAQA 4F9GA 3ZDFA 4EL0A 4D26A 1L8XA 2CLSA 1N57A 3FCOA 4PRYA 3W8DA 4N40A 4NCJA 1FNSA 4KQ6A 3P9XA 1YIAA 1Q0QA 1XZKA 4YUWA 2QTBA 1UAAA 3L9WA 2WHRA 4R81A 5DYNA 4ESHA 1VZ2A 3ZY2A 5JSYA 1Z33A 5C8VA 1LSOA 1RCTE 3BAFA 3MLAA 1DTWB 3ZQUA 1K6JA 5JH7F 1V8PA 10MHA 5AIBA 4P4UA 3S5JA 1DADA 2D2VA 2W2OA 4ZXFA 5HBRA 3I01A 4ENPA 4AY2A 2ODNA 2A58A 1GNQA 1JV2B 1N0WA 4MP6A 1UADA 2C83A 2JIMA 4LN1A 5BQPA 3LQFA 2HQOA 5H83A 5KC9A 1P33A 2D1SA 3E8SA 1KFJB 2PWBA 3DXXA 1YBVA 3N8IA 1Z68A 5LFAA 1BD3A 3GVHA 4JZYA 1HLGA 3OTQA 2A9OA 1QHNA 3QPBA 4PZ0A 1EU1A 1R88A 4YBZA 1V39A 1ZZGA 4YJ3A 5D2CA 821PA 3O1HB 3DKVA 4H6VA 2HAEA 1Q0PA 4ZO9A 1PR5A 4L73A 4L02A 4QUBA 3A05A 4Y67A 5D51S 1GUDA 3G88A 1N9GA 4DQLA 2RK3A 3R3VA 2GCPA 3CF4G 1FCJA 3H9EO 2RD2A 1S8NA 2XNDD 4RZSA 3DDZX 5UKDA 3FA2A 2Y4NA 3EC2A 3OZCA 4QVGA 5B4TA 2H7XA 4I9UA 1E64A 1II8B 3RIHA 2ZRKA 1FB5A 1LJUA 2OD2A 5K20A 4CXMA 1P91A 3MS4A 1ODJA 3VZSA 2DKNA 4IF4A 4CFSA 3SD7A 1NFQA 2CZQA 3SJUA 2N75A 1PNTA 1I3LA 1MPXA 3IEIA 3NR2A 4FEEA 1K98A 5ELMA 3T7TA 1N8SA 3FETA 3GN1A 1TRHA 4MX8A 4BNWA 3U7GA 4JJKA 4ZZIA 3IDFA 3PC8A 4FSHA 4M89A 3ZR4B 2YH2A 1XZMA 1YRQA 3BCSA 5FWAA 3SOPA 1LQTA 5F9MA 1NNEA 3GA7A 5CU7A 1EVLA 4LFCB 4DM7A 1E58A 5J2TB 3BD9A 1HDRA 2AOUB 1OBVA 2W2KA 4HTFA 5ESRA 2NOAA 2V98A 2AZ4A 3HL0A 3LWBA 3WLQA 2I4MA 5K51A 1OSNA 4QD3A 2UYOA 3SYMA 2H1LA 5K99A 2PSJA 3SOZA 4X1KA 4J49A 4LAFA 5FWYA 3DL0A 4LWPA 1XRLA 2HWXA 4JYMA 1I30A 2FW9A 5ES3A 3WWPA 5I7OA 3LY5A 4HRVA 2YV4A 4RV4A 1O0SA 1UKCA 4CBVA 4F6RA 4ZYWA 5FBHA 1A7KA 4EVIA 2I65A 3I6IA 3ED1A 1CUVA 3MXOA 4MCHA 5DIFA 4ZC8A 3SF8A 2H6EA 5I9TA 4Z0HO 4PQRA 5CFPA 1Q5PA 2ABWA 4DRXA 4HWRA 3K2EA 3UHJA 3JZDA 4LRWA 3U7FB 2X3FA 4EO9A 1QIIA 3OECA 3RKSA 4C0WA 5FYQA 1NTRA 4XIGS 4DN6A 4A0RA 3JAMA 1J42A 4DMKA 5CDUA 4R1UA 2XA2A 4I1OA 1FS4A 4Q6WA 4XQGA 3V2GA 5I7HA 4KYUA 2DQKA 3NPAA 4MS4A 5EXEA 3T15A 4XYMA 2ZS8A 1KDZA 2IUYA 3V7FA 4CCSA 1WMDA 2I34A 2RE8A 3IBSA 3AEKB 3NQ41 2HN9A 2PX2A 2NYAA 1BNCA 1E0SA 2EIHA 4GYKA 4IUYA 4M7PA 2ROQA 3TLKA 4D81A 1QC5A 2XVXA 4HLNA 2FW0A 4BQEA 2C2HA 1RYFA 2PGOA 5FOTA 1QOZA 3W8NA 1WXQA 2I4IA 3PHLA 4QXRA 4WASA 4BV2A 4CMGA 1L5HA 3ER9A 1XNRB 1U4SA 1U28C 2GPYA 2YICA 4EHLA 1SQGA 1B16A 3Q88A 1M83A 5H82A 1G7TA 2QT9A 1JMKC 3RF7A 1JXQA 4NC9A 2RK4A 1AQLA 5DGCA 4J0IA 1ENYA 1YR1A 1Q0TA 2YVKA 3EZ2A 5HKOA 4HKTA 3MJ4A 3HJAA 4B43A 3KQVA 4ME6A 3MMNA 2X3YA 2WPNA 1JI0A 3RJTA 1XQVA 2XNKA 4XX0A 4YN3A 2G6BA 5AW5A 3C5CA 2A35A 3RS2A 4F56A 1V4VA 2B34A 4GLFA 4R8KA 3RSSA 4AS1A 2QRVB 1OGJA 3LC2O 1V7PC 1YE5A 2VRCA 4CM4A 4DQUA 3CLVA 4N6NA 5KQLA 2O5CA 1XHEA 2B37A 3GZTB 3NOVA 1KH2A 1DHRA 2RHDA 5KDLA 4HYTA 4UNPA 1YD7A 4IIFA 4XM2A 2DMRA 3SSNA 2R2AA 1E3QA 1PT8A 2XKAA 3HCNA 4JVMA 3QTTA 2OV8A 3D43A 4EI8A 1KJZA 1RZUA 2QTHA 3GEHA 4ND2A 4IVPA 3HB5X 4E22A 3AKCA 4GLOA 4KNVA 5CIQA 1UOOA 3OQIB 4R7GA 1E3LA 1XCOA 2D74A 1FDUA 2HQRA 3CUEF 3FNIA 3H75A 1Y8RB 3KCNA 5F1YA 2MCFA 5TS2A 3RG2A 4KR0A 1Z63A 1TTHA 1Z73A 2Q45A 4AYXA 4FW8A 2VTDA 3ADOA 1YQQA 1HMYA 3AV0B 2FMXA 4NU8X 4P35A 3TFWA 3TIIA 1DZ3A 1XMSA 4JFRA 3TNYA 1P3Y1 1JSLA 2DLNA 3AI2A 3BXZA 3IGFA 3MGBA 3D6UA 3E0QA 5CLFA 4WA7A 4N7MA 4RM2A 2EW2A 5IT5A 1NQVA 5CNJA 2J9FB 5IK2A 2R65A 1J2YA 1XZCA 2WJ6A 3W7VA 3IUSA 2WEKA 1UMDB 1E0JA 2R8OA 2OHXA 4MKIA 2FB9A 2G7ZA 1CR4A 3B2EA 1P77A 3S7TA 1PE0A 1QX3A 3QMPA 2XY4A 1MDBA 3AP2A 3TO5A 4B85A 4DFDA 1KY4A 4FGKA 4N0PA 3DBRB 3R3UA 3T7JA 1Z18A 1Y4SA 3OOHA 3D7LA 1XRNA 5JHHB 1F6BA 3ZU5A 1ZM3A 3IBTA 3UUEA 3ZCVA 3RODA 3L3BA 5COBA 1G17A 2A88A 2XQIA 3I9LA 4BC1A 2JKZA 2LDBA 5E1MA 4Z6KA 3TSZA 2DFKB 3U49A 1EA5A 3OTGA 4KLAA 1J0EA 2VSYA 3MQFA 4KRFA 2BD0A 4NI5A 2GZMA 1SD5A 1TVKA 2OL4A 3AZQA 2VTEA 2BEUA 5GPBA 1RXVA 1KPHA 4MUAA 4G1VA 2OZLA 4JOQA 1N33B 2JPDA 3GRZA 3O95A 5HCNA 4PZLA 1LW6E 3FGZA 1XDGA 4URXR 3G5MA 5KNDD 4MW2A 5ALSA 3QX3A 2R2GA 2WD9A 1W0KA 4MYDA 4F11A 4O4LA 2LVBA 4QQNA 2FOLA 1X1SA 1FP4A 3DFIA 4DA8A 4E15A 3TLMA 3TSWA 3L7MA 3AVOA 1XDUA 3UY4A 1CK4A 3KV3O 3BXXA 4EIWA 2HWWA 3GRFA 4DLWA 1Q1BA 4WZBE 1G3IA 4YPVA 3PE6A 3PXAA 5B1EA 1CVIA 1E63A 2IZ7A 1IEQA 2YCBA 3FVQA 4OMUA 5H80A 4MVJG 4NOLA 1NI4A 1RWXA 2FFRA 2IJGX 3EW7A 3AB3A 3GT0A 5FUBA 5AW6A 5BSHA 4N41A 2Q0SA 3FYUC 1ZMOA 2ZYHA 4PZCA 1QDEA 3OG9A 1NUSA 3ILSA 1I5RA 1TX4B 4QFMA 4RTOA 1EFPB 4MPDA 3C85A 1ZM7A 3ROKA 1CVLA 1T3GA 1J0XO 2DTDA 3CV3A 1SXJA 4UTZA 1E92A 4OX9Y 3TW8A 1I2DA 2NQ8A 4LOAA 2QT1A 1GAJA 5IFLA 4K1XA 5LZ2A 3QXSA 4IXDA 3K5IA 3WRYC 5JSUA 4XYEA 4GF5A 1A9ZA 1YB2A 1ZOIA 1EEHA 1ADJA 3L6CA 3DMRA 3KJNA 1XQ1A 3P32A 3PHBE 1YACA 4QBHA 1R4MA 4QPJC 3UT5A 2W2LA 2XYHA 2G1UA 2PJUA 1RM3A 1B15A 1DBVO 2JDIA 4TTRA 4DIBA 2TMDA 3EF0A 1TUGA 3DLCA 4MICA 4B46A 1P4HA 3LUBA 1FW8A 1O9GA 1I6MA 1E4EA 1O89A 1TUBB 4JELA 3WZMA 4B3DA 2QRMA 4A2CA 4DMCA 5C1DA 4H1VA 2V6MA 3RE1A 2W90A 4OX9B 3F47A 3Q5DA 4UM9B 3GYBA 4NATA 1RHJA 2Z8YM 4JUDX 1KDRA 1PUXA 4RKQA 1KYXA 2DG2A 5KYNA 2X9GA 1U9ZA 4FR0A 4U6QA 2DX7A 2H1FA 3LQKA 4B3MB 1E4VA 1PR4A 1VJRA 1X1CA 3EY4A 5HIMA 2X42A 4DBZA 1JT9A 1M2OB 1PGPA 1N5RA 2F43B 4B3XA 4MRMB 1LTHR 1NV8A 3BRSA 4YAOA 4B6OA 3IB6A 3NEYA 1JWAB 3EEIA 3O4IA 3W3AA 2FZGA 4D44A 4DQ0A 2PKWA 5E4TA 2HU5A 5MDHA 3ZVRA 4II2A 1TKCA 3IQWA 1AO0A 1U6KA 1OC2A 1UEIA 3NM5A 4FGZA 2C2WA 5LDDC 4MQ4A 4I9GA 2PO5A 4RFSA 1O6BA 3BWYA 3WRWA 3AP1A 3CZ5A 5DLDA 3I6YA 1MAHA 3IT1A 5HKKD 1QHIA 3BB4A 3VOTA 1VKHA 2J3IA 1CJTC 4BFUA 1R8JA 1YU6A 2ZQ5A 3M4NA 2WMNB 2FPIB 2KJQA 3BJEA 3C1AA 3WKEA 1V4NA 1MW8X 3C3EA 3K1AB 1GPDG 4IZIA 4A8PA 5JJBA 1ZJ5A 2BH9A 3NC1C 4IDCA 4L3OA 4JP5A 2BGIA 4LF6B 2QTNA 4B2YA 2V7EA 1UBKS 1A9YA 3R41A 4FMDB 4UZFA 3TWOA 2OFWA 1BG6A 1EBBA 1QB8A 2RSLA 1M1ZA 1T15A 2EC5A 2WFLA 3FMVA 3S55A 2MJLA 4EB6B 1V1RA 2J9YB 3FHCB 4Q18A 2ZI4A 3Q3HA 2P3OA 4GRAA 1M2HA 2YZMA 4J6EA 2O1EA 4NCIA 4DGQA 1Q1ZA 1P0QA 4CCYB 4EI9A 2OBXA 3SWWA 2CKDA 2P8SA 4DCSA 1JPUA 1YKSA 3KUKA 2FEOA 1Z3CA 3MTQA 5D84A 4ZZ1A 1YQWA 2HREA 4L07A 1J99A 2W2MA 1ZS9A 2ONZA 2WTXA 3L8EA 4J1QA 5LJLA 3PIRA 4MI6A 4U63A 4FFBA 2P4HX 2GXUA 5FI1B 2UVQA 3GWGA 4Y6PA 1X42A 1PG2A 4HC4A 4GC5A 3MOIA 3LY8A 3WY9A 3IE2A 3BZBA 3KZCA 4GS5A 4K6FA 5FORA 2JZCA 3HBAA 4MUYA 3RUIA 2FPWA 3G0GA 3BREA 3QG1A 5DBIA 5TQ0A 2Q1XA 2VDMB 4J0DA 1I2CA 4UHBA 2BIFA 2DFVA 2GCOB 1E9VA 3AHCA 4FLFA 4XUGB 5TY0A 2X0FA 3S70A 3BH0A 4RK7A 1K8XB 2XTAA 2Q7XA 3GN2A 3R8CA 1EVEA 1XDBA 1KS2A 4RA6A 2PWZA 5BW5A 3ZIAD 1RRFA 1W36C 5FO0A 3TQRA 4DIDA 4MQBA 5EJAA 4IX1A 3LHKA 4Y9UA 4DCGA 4OLBA 1XRSB 1JAXA 3IKJA 2QUZA 3I2KA 3CRW1 2B2CA 4JVSB 2GF2A 3ED5A 4I4TF 1DPFA 1GFZA 2MSNA 4E5SA 1E32A 3NS7A 1ADBA 3DCJA 1D1SA 2Z4SA 3EFOA 4J1SA 3HDYA 4JC8A 4RIIA 4AG6A 3C6ZA 2XWSA 4BQNA 3B9PA 4KXLA 4L8WB 3P4XA 1FU4A 2FN4A 4GPD1 4F3TA 4Z9YA 1I24A 1NMXA 3BDAA 5DNUA 2H0QA 4J4TA 4OU4A 1F4LA 3L06A 2CMDA 1KRHA 3WWYA 5EIOA 3RBXA 4X1OA 1T43A 3HJNA 1PUIA 2BI7A 4LY0A 1QKKA 3BMOA 4RFVA 4IINA 1BE6A 3A27A 4U39A 5DSZA 5KU1A 3BGIA 1JLSA 2OK7A 2DB3A 4HDKB 4WXRA 4MQFB 2HSEA 4I3HA 1I3KA 2OXEA 4ZT3A 3O2SB 3ST7A 2B83A 5EPOA 2OLKA 2XQKA 3FHTA 3B1KA 1I4EB 1GL6A 3M9XA 4UM9D 5IXSA 4DB2A 1EUYA 1KI9A 4ENSA 3MXTA 3OM9A 4WJZA 5CXXA 5ENDA 3ONNA 4BBJA 5H9WA 3CSDA 4KJXA 5I4IA 2DY0A 4UMEA 3OCUA 1TJ3A 2YJ6A 4KSCA 3ORYA 1L5QA 2GN8A 3PCTA 4XVCA 1VQ1A 1Y9ZA 3DR3A 1M73E 3DZBA 1WG8A 2OYSA 1P1BA 1TPZA 2Q3LA 4PPQA 2ZR9A 2BF4A 2VZ8A 4D98A 2XGMA 3CUVA 5H16A 3WMFA 1N2SA 1DKLA 2CZGA 4QYTA 2C29D 5CAEB 3EPLA 1FSSA 3CEHA 3MJEA 4PM4A 3IUMA 5JZMA 1C7FA 3GK3A 1KAGA 4EI2A 3HCBA 1U5BB 1L4LA 1XEFA 3VKUA 2XDWA 3BJRA 2HDOA 2X2EA 5AK3A 3T38A 5I7SA 5JQGA 1C7EA 1CJMA 3RC2A 4D3SA 2WJ3A 1N0HA 3RABA 1MJNA 3ZHUA 2OPBA 3HCOA 1UKZA 1L4MA 1Z74A 2HIHA 2GJ8A 4EUSA 4KBGA 1UMCB 5F9HA 4F5YA 3OEHA 4P4SB 5FTNA 4ZZ0A 2LUOA 1IYZA 5FO1A 2C2BA 3B2QA 3OSZA 3IXMA 2YHUA 3I76A 5CP8A 2P9QA 4HNUA 2HBQA 3H7IA 3ABQB 3JS5A 4F2GA 3B38A 1EFLA 2V9PA 4BNVA 2VSXA 3BE6A 2RH5A 1SCNE 2QMHA 3O5AA 1MDFA 4G1CA 1E2BA 4BX2A 3DLTA 2ZTLA 5EMMA 3RVNA 3EVDA 1ULBA 5GINE 1LBHA 2G8NA 3ETEA 3OX3A 3SBOA 4LSGA 3VHRA 4DR7B 2HZBA 5JTUA 2W6NA 1IDN1 5DRTA 2O20A 2BGLA 3SX4A 4EPTA 4O2AB 3EY9A 3JRNA 4JJFA 2AOWA 6Q21A 1IK6A 1T26A 4RVNA 2ORWA 4IYRA 3WJ1A 1OV4A 4Z8XA 2W6JA 3QI2A 1J8QA 3LTNC 3KZVA 3O4GA 1TD1A 1OX4A 1S1MA 3Q9UA 1TA4A 1AN0A 4DSZA 2I8LA 2O0HA 1VLLA 3ZCRA 5CBPA 1BDHA 1EVIA 5G0UA 5C5CA 3SXJA 2ZYSA 4DCVA 2AOTA 1UPBA 2OYRA 3R5FA 2AC4A 4YT8A 1LY1A 4PANA 4IHJB 4UATA 2FDXA 1Y5NA 3G9QA 3V4LA 3F74A 5DN9A 4B2PA 4TLLB 2D13A 1TKBA 2QZPA 4UXHA 5CB8A 4C04A 2K4MA 2Z98A 1N2ZA 2JFYA 4AIRA 3DF9A 2P11A 3MUOA 4PC3A 4AMBA 2XAUA 3OUZA 3OQBA 3QVXA 4JCOA 1KGDA 2WIBA 2EEZA 4DMFA 5LOVF 3ZJTA 4N5NA 4NFSA 4M1KA 3SR3A 4NP6A 4LXGA 4Z4GA 1NE7A 3SI7A 3T1YB 4UCXA 5FUYA 1LEHA 2X4DA 3HTXA 3L7BA 2H08A 2WQ6A 4Q7JB 1ORVA 3U7RA 2XF2A 2OV6A 1UCFA 3DMFA 3O84A 1A96A 5AJYA 3ZBQA 5LUAA 1Q57A 4ARVA 1BHJA 4MITA 4CM1A 2PL3A 5A3JA 1HUQA 2ZSAA 1USIA 2A57A 4BQPA 1K7EB 2VXOA 2QQGA 1BXKA 3ACCA 3LECA 1ZGJA 3CZPA 3I3OA 4H08A 5JSKA 4DQKA 1PV2A 1V9SA 4U2BA 4JJ8A 4RQBA 4DIKA 5JMTA 4PW0A 2UXCB 3I9OA 4IOLA 2O8EA 4LYDA 1IUOA 1ORTA 1E4YA 3NUZA 4G89A 4OP3A 1VXRA 2XMGA 1NBIA 1IULA 1SUEA 9LDBA 4C0KA 5L4NA 2EX0A 4RTRA 3JQBC 2OZEA 1V3TA 5B53A 4NECA 2C4UA 1J9EA 3A2NA 4HDOB 4LJ5A 2H3EA 4GL2A 4L4XA 2QAIA 3RANA 3NBFA 4RTLA 1TOAA 1WDWB 1H42A 1PVDA 2OQ2A 3TXYA 3P8ZA 3ZE7A 5E2AA 4QGSA 3S1SA 4KN9S 4XLLA 4CM9A 1G4UR 1XVUA 2RK6A 1FNMA 3COVA 3AHGA 4U2GA 4GMKA 3EYWA 4JT4A 5THXA 5K03A 5AUOB 3KUDA 1SD1A 3MGKA 4JYPA 1ZLYA 1OPRA 3ZK8A 2C4HA 3C1TA 4GOLD 4V02A 5CK5A 5A7FA 5GZ1A 1ES9A 3GGGA 2YY7A 1YR8A 1YSCA 1HE2A 4MCAA 4U6NA 1A4XA 2C5SA 3D3NA 1FTGA 1GR0A 2H2AA 2YCLA 5L3RA 3LWDA 4CU5A 4EG8A 3K70C 3O9VA 2G1KA 4MINA 4FXPA 3CA8A 2XLCA 1Z5ZA 5JPCA 2BR3A 4B8WA 4UTRA 3E0XA 1TTTA 4R9UC 2YWDA 1XCPA 3ZN2A 3TUJC 1E7RA 5A4KA 3RYCB 2F8TA 1U0FA 3WGZA 3TS1A 3C7TA 2TSYB 1NVXQ 1UBMS 3C14C 4G07A 1C1DA 1R6XA 2BDUA 1I94B 1MJHA 2DLCX 1AB6A 1BWPA 1DFGA 1GT6A 4QGFA 5HK9A 1HE3A 1GGVA 2NZ2A 3EH1A 3AK4A 1OI4A 1ZUHA 2IU6A 4KDFA 1P74A 5ER9A 3RVJA 2XE8A 3N7TA 5CMLA 1LBQA 1N0IA 4B4DA 4EVRA 4YUXA 2C5FA 3TH5A 4WFKA 3VR4A 4A0HA 1QF9A 4R3NA 4LJAA 1ZXLA 1VFNA 1M74A 3EHEA 4QEZA 3VJLA 4UE3S 5ALZA 2GN9A 1Y37A 5IKOA 1OHHD 2YN0A 2ZZNA 3NCTA 1YQGA 2GM9A 3DT8A 5AH0A 3OPNA 4IQ8A 5IT9A 1BFDA 1KYYA 1VGQA 4HF7A 3A9VA 2ZETA 2XVAA 1GCAA 4FHZA 1M6YA 1NUPA 5B1YA 4Q66C 4IFBA 4L22A 4M9SA 3LZ6A 3FOAA 4KAAA 1VG0B 5AFSA 2VHVA 2PTGA 2Q9CA 4IXMA 3UIEA 2A3RA 1DAMA 3CKKA 5LC1A 5C3MA 1F0YA 2ORED 4OQLA 4DYVA 4RWZA 3NAMA 2CMFA 1GZSA 5FNVF 3KB1A 2VSOA 1ZYUA 3MTDA 5FPKA 3OURA 3D6TB 3RPEA 3WQQA 3SJBA 3SKVA 1Z6XA 4UU8A 1U65A 4HFNA 4PIVA 4Z4CA 5H7XA 3OT1A 3CMCO 4U0KA 3KQHA 2NAFA 4YR9A 5DNCA 5HZHA 1EGQA 1U04A 1U8ZA 1OILA 3QELA 1RJWA 4WX2B 5IUJC 3GLIB 3L0BA 3BF8A 5L4SA 1QRRA 1ZEJA 3EZ9A 1PJ8A 1XE3A 3H99A 3B48A 2EL9A 2OOKA 1MEOA 4BJ5A 4NH4A 3R0XA 3B51X 3DOEA 2OV3A 3M9WA 1I7PA 3BDIA 5K3BA 2FSPA 3V4FA 2GFIA 2MSWA 3MINB 4GXRA 2DPYA 3M83A 3PNPA 3TAUA 2C92A 4YDQA 1NBHA 3ABIA 3D8UA 4QYSA 4TXHA 5JFGA 4K87A 1RHUA 1NC3A 4KZKA 2OAGA 1V11A 2HCBA 1KK3A 2C31A 1JE0A 2NZUG 3KOZA 4P82A 5BW4A 3QNMA 2CUKA 4I4LA 2B4RO 3K9WA 3IAHA 5DT2A 2RMKA 1WR8A 4LHXA 3LRXA 1W581 3UW3A 5EIAA 4LWOA 2DUJA 4HOYA 4RLQA 4YRBA 1I2AA 4YASA 5JXGA 3MTIA 3HFJA 4QEKA 1T5LA 5HIIA 5DHUA 3WB0A 4D97A 4OSOA 1NJ2A 2WLSA 3KEQA 4P7FA 3OLZA 3GVIA 3JQ6A 3L4BC 3UWDA 1H1TA 1GG2A 3PF8A 1DJPA 1OXMA 2IIPA 3O8OA 4TV9A 3UO8B 2GJ9A 1Q84A 2IT1A 2MWMA 2OGZA 3M8KA 1YUMA 4TVBA 3ZG6A 2IHNA 5A6VA 3SQXA 4KODA 2AYXA 4Q7KA 3X2EA 1DXYA 2HNKA 4Z9BA 1J06A 1E20A 3R77A 2HXYA 1X38A 1E2UA 2ZOSA 5JRDS 4UBKA 1RQPA 1T3ZA 1Y9JA 3CLTC 2ZSIA 3W5BA 1FUYB 4HYYA 3UA4A 3WL6A 1MQSA 4IIDA 1I5EA 2CXRA 3KKEA 4NHOA 1DAOA 2P9TA 3G0DA 3O6VA 4RIEA 1EEXB 4NIMA 1RYMA 1IWBB 4GGOA 5J5AA 1S4QA 2H2WA 2ZLBA 2F64A 3WZ2A 1CUAA 2VZ9A 4G0QA 3DTVA 3HVIA 4WKCA 4GZ3A 2X2FA 4KWCA 2XDYA 4ND1A 5I9LA 2DFNA 2FW6A 2SKCA 4Y6SA 2BLNA 1ZM9A 2LNDA 2NXCA 1BTOA 2OCPA 4YROA 4DSTA 1ID8A 1QV7A 1P18A 2Q0XA 5LN1A 1JSCA 4C5BA 3QFHA 1Y3BE 2I1QA 1EUCA 4QG3A 1NF9A 3DD1A 3CKLA 3FHJA 4RF2A 5EL0A 4GMXA 4Z7NB 3GF4A 2CXNA 3H17A 2HK9A 3ON5A 4I8IA 3ABOB 5JCOC 1QQTA 1HLPA 2DUUA 3H8VA 4CF3A 4EO4A 2X22A 4BXOA 1FZTA 2P7IA 1EJ2A 1SUCA 2IEAA 4Z99A 5G3ZA 1K8QA 4IJUA 4O4IF 5C4GB 4CMHA 4C7OA 4EJ6A 4C0LA 1PSWA 1SUDA 1WB4A 1YI1A 4KYVA 2FOXA 2NVWA 4QODA 5ITWA 3R6GA 5E6UA 1PIWA 4NDAA 2WE7A 4WCFC 3H2IA 2YWHA 5EXXA 3ZUGA 3ABSB 5KTTA 1VKRA 1BAPA 5KAPA 3MK31 2FEXA 4H31A 3S2SA 3L7LA 3SR0A 3CNQS 4C29A 2CXQA 4BVAA 3UAZA 2AEFA 3CE6A 3OUTA 4JOCA 2H54A 4IEEA 4BX3A 1IN5A 1OROA 3OLYA 2BR4A 3L8MA 4WESB 5ALUA 3TSYA 1K4YA 1DX6A 1U0GA 3OZIA 4F6RB 2VTBA 3O47A 1TIPA 2X7XA 5A05A 1E3DA 2J3MA 1AK9A 2B9EA 2I2FA 2Y1DA 3UC5A 3FUXA 1NKVA 2FN3A 1ODFA 3MC1A 3O93A 4KEAA 1TEXA 2KLBA 3M33A 4Q5IA 2KLHA 4XWTA 5DBGA 3I2FA 1L5GB 1TADA 3MCAA 4GP7A 1R9MA 1UQTA 1E5VA 4QFBA 2Q28A 3NT4A 1DJMA 4N18A 1JVBA 3GLQA 1KFBB 2WG0A 3CO5A 3BGVA 2F9LA 3CR8A 3PNMA 4LBWA 1WOYA 4NU6A 4A2QA 4B79A 1J8MF 3FCEA 3PEVA 4FFVA 1N5IA 3DD5A 5LMCA 2I62A 5C8YF 4KFRA 4ZU6X 4EBFA 3JQAA 3RADC 3LVFO 2EJVA 2WC1A 5DW3A 1YR7A 5FPPA 4BNGA 3AKZA 2IVZA 3EGDA 4LNUB 2GK4A 5AHXA 3SN6A 1M1NA 4HR7A 3AVYA 1VMKA 4RJJA 3WP0A 1N7HA 4CDGA 1RPTA 3GAMA 1BSVA 2YY5A 4WBSA 3DDCA 1UKVY 4KO1S 2P5YA 2AWOA 4RPGA 3TYXA 3NEPX 4R2MA 4BEBA 2PX5A 1WV1A 2VHZA 4DA6A 1YA8A 1I1QB 3HQ4O 1J56A 3D3WB 4E14A 3DV9A 5BN3A 5EJ4A 1NDQA 2PPLA 2QUBA 4NMLA 1LF5A 3RO7A 1OFUX 1G1AA 1I1OA 2WHPB 4Y9SA 2QN7A 3L7NA 3S4YA 4OFZA 4BN4A 3UYKA 1TMYA 3IL2A 3AIMA 3R4CA 3JWEA 3MJFA 3PFKA 1MO4A 1SKQA 2JASA 1M6EX 3PQ3A 4CIWA 3N5CA 3DLBA 3NP9A 1C2YA 4X8HA 4NJMA 3UNXA 4BZWA 3QVWA 4WZAB 2AYZA 2V8BA 3EDCA 4EFKA 3IC5A 4TLAA 1J1IA 1YUBA 4DQVA 5F7OA 2QM0A 4TTTS 4RUKA 2PZGA 2ZG6A 4Q9AA 3OLVA 4QYIB 2Q5OA 1U8TA 2B1QA 1NN5A 3PQ7A 5E3JA 4BO4A 2ODPA 4IIJF 4PCVA 5EJEA 2HRRA 2FWNA 2VHEA 2ZRGA 2X40A 2JATA 2WM3A 3QX8A 1NFRA 1I4TD 4MNTA 1C30B 3NC4A 4J0EA 4ZU1X 4E1BA 5A2QA 4TV8A 2AVDA 2J6HA 5KYVA 5JYBA 1XF9A 1T4BA 1HE1C 1WWKA 2X7JA 5HXAA 2OT3B 4JBWA 1OFGA 3VNAA 1ULSA 1CQIB 2UV8A 3TTUA 1TL7C 3FWZA 3BWDD 5WRFA 4PCLA 1E3WA 1TYZA 3DP7A 1L7XA 1QYDA 2ZSJA 3SC2B 3IR5A 2BYTA 1L5RA 1CJKC 2PXXA 3RCBA 4X9XA 2GNOA 3TDMA 3CVWA 3DAHA 3X44A 3F71A 2ZWAA 5TEWA 4PCUA 3TG8A 3K73O 4XIIA 2ZJFA 3L8CA 1D2MA 2WJHA 2IRWA 4B84A 3U4QB 1KVSA 2ZBPA 5JANA 1X13A 2AC2A 4ZVTA 2QENA 4ETIA 3R3YA 1WCXA 2FV8A 2WP8J 2JANA 2YMMA 4ZEOA 3BUSA 1YK1A 1PW7A 3MT9A 2YVLA 4R51A 4X8MA 2FZ5A 3RH0A 3ROXA 4F72A 1XCLA 2D1TA 2GASA 1ZVJA 1WO8A 2HDWA 3GUVA 4EARA 1TJYA 4KB5A 3QSYA 2BFEA 1GVNB 3FYDA 1CF9A 2R48A 4ZGGA 3QK7A 1BVYF 5L7TA 2HFKA 1G8FA 1QV9A 4DNOA 1WVIA 3VAZA 3OPYA 4D8WA 1VIAA 1K7CA 5DWQA 1QDUA 3ELUA 4B6SA 1EFVB 4ZQIA 4BMZA 3TGLA 4I50F 1IZYA 1NLYA 3E9DA 4PLHA 3X0DA 1Y4ZA 4V3CA 2Y9MB 3HKCB 1CY2A 3IUNA 5IJWA 4DV1B 2Q3HA 3L7OA 5ADWA 1Z29A 2G04A 4B9AA 1J24A 4PHFA 1H5UA 1I4WA 2VYVA 3PS9A 2ZBDA 3FLAA 5TS3A 1N32B 5ECWA 2PUJA 1IWOA 1RJ9A 1SELA 4GXQA 1SC3A 4M8NE 3PBKA 1Q2XA 5HRUA 1QV6A 4LOHA 4BFWA 5D6OA 4OHFA 4KDRA 5HUJA 2WABA 3T7SA 4O3MA 3S5UA 4HQ6A 4BNKA 3KKKA 2WTBA 4C4SA 4AM8A 2VUTA 2I7TA 2A0YA 1GKLA 4HDNB 1GQFA 1W6UA 3BICA 3EGXA 4X24A 2R1VA 4D6PA 4NAVA 3GBVA 1TZ2A 1GV1A 2Q4EA 3H3FA 1P2DA 1UKBA 2NPIA 4QE3A 1XZQA 3PU6A 5EP3A 3TCKA 4CEJB 4PQEA 4A0SA 4W4TA 5BV8A 3EGIA 3FPCA 3BA6A 4BMCA 2JIPA 1CUXA 2YFYA 3ITEA 2FW1A 4U7JA 3P94A 3A9TA 1JFFB 3PTZA 4F4CA 3G17A 3RYHB 4BUCA 1AQ6A 2VLIA 1A2QA 2PBZA 2ZWOA 3KOMA 1LPMA 4GVXA 5DBEX 3VNQA 3GLFB 5EE0A 2VVTA 3AL2A 3I2IA 2I3ZA 1FRFS 2VPQA 3VKWA 4L8GA 2DP4E 3V32A 3WFIA 2WNIA 2UDPA 4UBLA 3TNLA 1OGIA 3IT3A 4WY5A 2XUPA 3SQLA 2F48A 4PG5A 2HCRA 2NUTB 1W76A 1B00A 1ZRNA 1GDHA 5E3HA 4F46A 4N47A 4QAJA 3QFFA 1U7TA 2DHDA 4X61A 3CZ9A 1PZFA 3KSUA 3DPUA 3DOIA 4D0SA 2CLEB 2QRQA 3H65A 3MLBA 3E58A 1KWGA 3AF1A 1F1JA 3W0LB 3W34A 4HAWA 2VIIA 1YDEA 3TZEA 3THXA 1CIJA 3VPDA 3GZ4A 3H0KA 2ZBRA 3HMQA 4FK8A 4OU5A 1F6WA 2V7BA 5LXTB 2BEKA 3DC2A 3DXZA 1A4UA 2P8JA 1C9NA 1OIVA 1V9CA 1YS1X 3O8NA 4OQ4A 4OB8A 4Z54A 3FDXA 4ZI3A 1QP7A 3FDZA 2R8PA 5JH7A 3WDLA 1KJ9A 5G1PA 4QM7A 3MIZA 4G5YA 1ESZA 4W6ZA 1KVTA 3VDMA 3KEOA 1CRQA 3SBDA 4X1YB 2FR1A 2DVMA 4LRTB 2AEMA 2WJJA 2Z2YA 3AL3A 1XMQB 3ZBTA 2VHCA 4REQB 4ZK2A 5JCJD 2C8KA 1NVAA 4TKVA 4BU0A 2QYTA 3FPFA 4Y6OA 2CF5A 4ZAZA 1OH5A 2LIVA 4X6XA 1YR2A 2HRCA 3BHIA 4RZXA 1Y7LA 2B25A 3QPAA 5JG7A 1USWA 3SZGA 5M29A 1IBRA 1E9CA 4ZARA 3M82A 3U37A 3ZCTA 1FXUA 4BO7A 4YCMA 4FOSA 5KNLA 4ZMBA 3EXFA 3HE3A 3N0TA 2BE7A 5EWJA 3VOSA 4V24A 1G21B 3SBXA 5BWNA 2P4EA 1QK3A 4NZMA 4JKIA 4AKIA 1LVUA 3GVXA 4CGZA 3PKZA 4G1EB 4IQGA 4BX9A 4HSGA 1DBIA 4ZCMA 4G84A 3HWSA 3OBIA 5ALGA 3WXBA 5LWHA 3QEMA 1MUUA 5I48A 3ZU6A 1WZNA 1SXPA 3KYCB 3C16C 5YASA 3JQDA 1Z5VA 3U3OA 5BR7A 5KDDA 4DV6B 1XTVA 3QVSA 1Z75A 5CD1A 3WNCA 5IDVA 3IHKA 4KFSA 3WISA 1EVYA