3K32A

The crystal structure of predicted subunit of trna methyltransferase from methanocaldococcus jannaschii dsm
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
191
Chain Sequence
LMDVHVLFSGGKDSSLSAVILKKLGYNPHLITINFGVIPSYKLAEETAKILGFKHKVITLDRKIVEKAADMIIEHKYPGPAIQYVHKTVLEILADEYSILADGTRRDDRVPKLSYSEIQSLEMRKNIQYITPLMGFGYKTLRHLASEFFILEEIKSDYEAEIRHILKERGESPEKYFPEKQTRVVGLKKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0690
publication title The crystal structure of predicted subunit of tRNA methyltransferase from Methanocaldococcus jannaschii DSM
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 59
structure length 191
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k32A00
2IJGX 4KR6A 1N2GA 3AG6A 1IHOA 1NP7A 1GPMA 1I6MA 3IMCA 3NBKA 2Z3VA 4WSOA 3QTBA 1EE1A 3P0IA 5LLTA 1QRSA 1TYBE 2IELA 3FHJA 3H99A 3IVXA 4DE5A 4F4HA 5K0SA 4XFDA 1G8GA 1WOYA 3P0HA 5J5AA 2AZXA 1J21A 5LM3A 1LI7A 2QTRA 4MUEA 1K4KA 1GZUA 2E0IA 4L2IB 1B6TA 2A88A 1JILA 4EG3A 2GKSA 4NDAA 3GLVA 1T9GR 2X3FA 1NI5A 2PFSA 1OD6A 4KR7A 2QJOA 1COZA 1NUUA 1KAQA 1S4MA 4YMIA 4E1AA 2BYTA 2ZUEA 3N2YA 1I6LA 2Z08A 2X1MA 3Q12A 1O0CA 1I6KA 3MLAA 1GTSA 1M8FA 2YY5A 4MUNA 3SYTA 2VXOA 1F7VA 2DXIA 1JEDA 1M1ZA 1P7PA 1JIJA 4RUKA 2RE8A 3KT8A 3N9IA 4OUDB 3H05A 3COYA 1XNHA 4JXXA 2CYBA 4DDHA 2X1LA 1PG0A 1T6XA 2PZAA 2GOYA 5EKDA 2EJCA 1F9AA 3S3TA 3ZJTA 3AL0C 1ZH6A 3HZRA 3MUEA 4DJAA 1O5TA 3NBAA 1QU3A 3CLUC 3SP1A 4YP7A 1EUYA 3PXUA 3PNYA 4G6ZA 2H2AA 4AS1A 1DNPA 1J70A 4P2BA 3ZXSA 3HFJA 1GTRA 1WXGA 2I1LA 4EG8A 1T9GS 4U63A 2E89A 1O97D 1WKBA 3ZJUA 1O6BA 4ZCPA 2RD2A 2HGZA 1IFXA 1N75A 3SEQA 1J1UA 3Q4GA 4J75A 4MUIA 2PG3A 5KHAA 2DUMA 2PXHA 4A91A 5J58A 1O96A 1QQTA 1ZUNA 4XFJA 2CV0A 3BL5A 2DPLA 3X1KA 3DV2A 1H3EA 4DDMA 4UZFA 1JECA 3OP1A 2B7LA 5F23A 3CLRD 2DEUA 1GN8A 1WQ4A 4MVXA 4MUHA 4JYZA 3E27A 1H3NA 1VBKA 2PZ8A 4NATA 5H16A 4R2MA 1YI8A 4DNXA 5DASA 1YUNA 4MLPA 1OWLA 3G5AA 3VGJA 1YIDA 4EG4A 1F7UA 3IUBA 1N2HA 3FNRA 1N3LA 1JHDA 1JZSA 1MB2A 4KPUA 1O94C 1LI5A 4EGAA 2A1UB 4NZPA 1TFUA 4ZT4A 1FYDA 5TEWA 3FETA 3ZUGA 3UMVA 1JIKA 3CR8A 1N2BA 3N05A 1KH1A 1TYDE 3DO8A 1MOPA 1O95D 3CLTD 4GU5A 4X0EA 3IMGA 2VTBB 2CV2A 3ZJVA 3DLAA 4MVWA 1YULA 1YIAA 2O5RA 2XRYA 2YWBA 4S1OA 5HG0A 1KAMA 3FWKA 4UZEA 4CQNA 1KR2A 2AKEA 1H1TA 1TYCA 2QUHA 1R6XA 1MB9A 2CYAA 1KKUA 3ZGZA 1EFVA 5FO1A 4JXZA 2YXNA 5IHXA 3TQOA 2WQ7A 4ZT5A 1U7DA 3K9WA 1MRZA 5HUHA 4MW2A 3QTTA 4HJXA 4JFAA 3RBAA 3ND6A 4TS1A 3N8HA 4QREA 3UOWA 2DLCX 5AHWA 1UFVA 2ZP1A 4ZCSA 4PBSA 4XSVA 1NUPA 3TZLA 1PFVA 1OWMA 2JAXA 4NAHA 5IJXA 4DDKA 2YWCA 2QUJA 2V0CA 1IQ0A 4NAUA 2Z09A 1TQ8A 3L93A 2HMAA 1EFPB 1NSYA 4PY2A 5HUJA 2C5SA 2J07A 3HL4A 3Q10A 1NUSA 3A05A 3ZXIA 1VL2A 3FDXA 2QUIA 3P52A 4K03A 1LW7A 2QJFA 1D2RA 1KQPA 1PG2A 3CLSD 1EJ2A 3L92A 1O0BA 4OJMX 2J09A 1XNJA 3D6UA 4MW5A 4Q16A 2QTMA 3SEZA 3IODA 4HJRA 1PFYA 2X0KA 2JA2A 2DERA 3D6VA 3JXEA 4MWEA 5TGTA 3TNJA 3MXTA 1J1ZA 1NURA 3COWA 1QJCA 4L2IA 3X1MA 4MUKA 4ZT3A 1MJHA 1Y42X 3ISJA 4Q93A 2CFOA 3CA8A 2OV4A 4MUFA 2WSIA 4MW0A 4R2LA 1KH3A 2D54A 3A4IA 1VBMA 3HGMA 3U1VA 3GMIA 4JZYA 1KH2A 4CT0A 3RK0A 3SDBA 3CLUD 5DEOA 1WXIA 2A84A 1U3CA 4AQ7A 1MBZA 1K97A 3HV0A 4OUDA 3CVVA 4MAFA 4MQ6A 1G8FA 1V47A 4EG7A 1J09A 3PRHA 2A86A 3G6KA 1N2JA 3AIIA 1KQNA 1R6TA 1WXEA 3ND7A 3CVXA 1VBNA 3C8ZA 4MW7A 2QUKA 3TS1A 1N2IA 1K92A 4PBRA 1JZQA 4MWCA 4HPWA 5H7XA 1BS2A 3CVYA 4YBRA 3A04A 5DB4A 2R5WA 2E18A 1VLHA 3VRHA 4MWDA 3CVUA 2D13A 4DLPA 1WY5A 1XNGA 4EF6A 4CDMA 1TEZA 4I6EA 1O95C 3COZA 4HK4A 5JBNA 5KWVA 3AG5A 1I2DA 3X1JA 1WQ3A 2A7XA 4ZT6A 3GUZA 4G5FA 2PZBA 3K32A 2GM3A 2DR2A 3F3MA 1NZJA 3COVA 3UC5A 4PBTA 5FNZA 1JEEA 1A8HA 1ZH0A 4KR9A 1O94D 2J08A 2QTNA 3FI0A 3UY4A 3IVCA 4GRIA 4RPIA 1Q11A 3ZIUA 2TS1A 1NUTA 2J4DA 1JGTA 3IMEA 4ARCA 3MMXA 3RJZA 1G8HA 4ZCQA 4BWVA 3KT3A 4EG1A 2O8VA 1MC1A 4QRDA 4F3RA 1OWNA 3P0JA 1H3FA 4J76A 1M8PA 3ELBA 1QTQA 1M8GA 1N2OA 4YP5A 1J20A 1WZ2A 1ILEA 2OQ2A 3FH0A 4MW1A 3RFFA 1N2EA 1M8KA 2E21A 2AG6A 1IRXA 3QE4A 2NZ2A 3HMQA 4U8HA 3VU8A 2A1UA 4ZT7A 1EUQA 1KORA 1OWPA 1IH8A 2DETA 3KT6A 1NYLA 2VTBA 1M8JA 3NV7A 3ND5A 4I6GA 3RK1A 4ARIA 1WXHA 4MVCA 3KFLA 2G36A 5DK4A 3TQIA 3PNVA 1N77A 3AFHA 3CLSC 4I6JA 1RQGA 3A2KA 1OBCA 4ZT2A 2A1TR 3LOQA 2JANA 1V8FA 1M83A 1O96B 3H9CA 4MW9A 2PIDA 2V0GA 3H9BA 1U7XA 3DPIA 5J59A 2EL7A 4MW6A 2CUZA 2BTEA 1FFYA 3IOEA 5BNZA 1F4LA 1QNFA 4G5YA 3OTWA 3FOCA 2WB2A 2CT8A 4KKVA 4FZJA 1O97C 2CV1A 1EXDA 3IOCA 1QRUA 4MVYA 3INNA 1IQRA 2QJTA 3IDFA 3KT0A 3AKZA 4WNYA 2ZUFA 1WXFA 1CT9A 3IVGA 1KQOA 4R0NA 4CDNA 1N78A 1IVSA 1JIIA 4YP6A 2CYCA 1QU2A 4ND7A 4U7JA 1EFPA 1IQUA 3SZGA 2H29A 4EG5A 4KPUB 3CLRC 3M5WA 1WJGA 4ZCRA 1Q19A 5LFAA 5FO0A 3FY4A 1MAUA 3H97A 1U3DA 1OWOA 3IUEA 2NSYA 1SURA 3TZEA 4MULA 3IOBA 1GLNA 2A1TS 1KP2A 1Q15A 1OBHA 1KP3A 4H3SA 5KCMA 2CSXA 1TYAE 1X8XA 3LCJA 4NX2A 3LE8A 3RHSA 1R6UA 1EFVB 2HZ7A 4MWBA 3FG9A 4ZCTA 1ULHA 5K0TA 5TEVA 1HYBA 3MLBA 2A4MA 3FIUA 1N1DA 4MUGA 1T6ZA 2WQ6A 1YUMA 3CVWA 1ZJWA 2IP1A 1MAWA 3CLTC 4EFKA 3PNBA 3SZ3A 1K4MA 1PFUA 5TS2A 3IH5A 3ILVA 3G59A 4QBTA 1PFWA 2J5BA 1QRTA 1JMVA 1GAXA 1XJQA 4ND6A 1T6YA 4MW4A 1Q77A 3UK2A 1G59A 3I05A 1X6VA 4EG6A 1U0BB 4MUJA 2D5BA 2XRZA 1NUQA 4K0RA
chains in the Genus database with same CATH superfamily
2Q5CA 1P1JA 1O54A 3G0OA 2F3QA 2UUPA 3ZE9A 1PTJC 2FI1A 2D06A 4S2EA 2AFHA 4MHTA 4RSMA 5F5XA 3HDVA 1WVMA 1XPUA 3G9QA 2R3SA 1M1YE 1U04A 4IWNA 4YMTA 5KTTA 1ODSA 2NUAA 2HHAA 4LVNA 4RS3A 1AZWA 1MFZA 5JQGA 4LYJA 3B9BA 5J4YA 4J1TA 2GAAA 4MPRA 1FUYB 3HVIA 3VYSB 1O6ZA 3GCZA 4WINA 1CJMA 2C04A 3ZDZB 3A32A 4ED9A 3NXKA 2W83A 2WJHA 2R8PA 3LLSA 4GKBA 1DLIA 3F1KA 2I6XA 5EHGA 4QBKA 5FTWA 1JF8A 5AKZA 2VP4A 3QKRA 2OY0A 3S0JA 1SPBS 2E85A 4C05A 5LM3A 3HJNA 1RRCA 2XUDA 4QG7A 1ZU4A 5DGXA 1P1CA 3SIPA 2A7QA 1UJBA 1BJTA 2QIOA 1GJRA 1LX7A 3SQXA 3IQFA 3V6LA 2WJ6A 1E18A 4NDAA 1IZ7A 3RS3A 5JH7A 5DNAA 1S4MA 1HKUA 3NV9A 1E2MA 4WK6A 3QVGA 2XUQA 2P8JA 3P0FA 1CUEA 2PGIA 3WGGA 1NN0A 4C4OA 4EX7A 1V1RA 5DM4A 4ZCLA 1FYXA 1GCGA 4QJ4A 3KVRA 4ZQHA 2GD0A 2FXVA 4TLEA 1G8JA 1TO1E 4J0DA 3UICA 1JT9A 2HNAA 1S8NA 2J6BA 3DHYA 1XCLA 4R1PA 3CR3C 4FOSA 3LC7O 4TV8F 3JR7A 1I2BA 5CIQA 2JDIA 2KQUA 3BXOA 2IRWA 1R1DA 3OY7A 1JR3E 2LPMA 4IGKA 1QZZA 2IK8A 5DXJA 1NIJA 1X1EA 3HJRA 2M32A 5KX5A 3S5JA 3A14A 4ND1A 3HP1A 1VG9B 5DHQA 5JZ9A 4QT0A 2R8EA 3HZRA 4HGOA 1TMYA 3NBXX 1PVOA 1L4EA 2GYYA 3GO4A 3AERB 3QYPA 1AMNA 4N7BA 2OO3A 4QYTA 1I24A 5TDHA 4PGGA 4I1PA 1R5OA 3K0AA 4MB6A 1RXSA 1X7DA 4GXRA 1UJ2A 1CQIA 2X41A 4H6VA 4Y0NA 1XRRA 1QP7A 4DSOA 3S2YA 5ITWA 4DR5B 2H2AA 4G0PA 3NRJA 1LPNA 2YMMA 4K2HA 5J23A 4JGBA 5LQUA 1U0NA 2ANCA 1GITA 2QUBA 2X8LA 4NFSA 4IX1A 5C37A 3ASYA 3V8BA 1L4YA 4OTZA 1C9JA 1XVLA 3W5IA 4DIFA 1RLOA 4DCPA 2IS2A 4R2IA 2J1LA 4KQ2A 2PG3A 4L8WB 4AMBA 4ZVRA 4RFVA 2OXTA 5DX1A 3ABRB 2BGTA 3B2NA 3ONWA 1ZK3A 4OHKA 1QQTA 1RMQA 2OG2A 3N2ZB 2HM7A 1ULTA 2R5FA 2JJ8A 2C4WA 1FFXA 3H2HA 3WIUA 4YJ2A 4D56A 3AEKA 3MGAA 3N0WA 3OP1A 4MAAA 3BSSA 3WK7A 1CRWG 1AUOA 4JSYA 2F8SA 3E23A 3Q0EA 4L5YA 4GX2A 4GBED 4R0VA 2GSDA 1ZUIA 3C5WP 2GRAA 1HTTA 1N2CB 2VRCD 2WUFA 3C6YA 1W88B 3NC4A 4JP5A 1Q14A 2B4QA 4BP1A 3GQVA 5IJ9A 2C9ZA 1B14A 4X00A 1AK2A 2FPIB 1P1HA 4NIMA 2F67A 2WHPB 3K9LA 4NZNA 3E8MA 3ZWWA 2GEKA 1H2HA 4B3DA 3ZU2A 2CLDX 3JQAB 4BU1A 4DNXA 5IULC 1FC0A 1K9SA 2W2OA 2ZLBA 4OKNA 3TIGA 2GBCA 4JCCA 3SIRA 5CA0B 1MX1A 2OO5C 3ADPA 3DZKA 1N2SA 1K5HA 1VA4A 1ZMRA 1Z6QA 3FR8A 3ICPA 4FFOA 4HVTA 1SHLA 2BIFA 3FNRA 2AOUB 4J03A 4MGIR 2AMFA 1YDGA 3PQEA 4OGFA 3GFGA 3O83A 4CKEB 1RI2A 1NE7A 2LDBA 2FG6C 1ZN8A 4YJHB 4YRCA 1KO7A 1GZVA 4YHBA 2MSCB 4YJGA 1QGAA 7ABPA 3HB9A 3BT7A 2DPGA 2YVAA 3RS0A 5K20A 3QIAA 4KDEA 1P4AA 1UL1X 1EE2A 1H5NA 1DT3A 2XA1A 2XCIA 5AXAA 3UHPA 1KXZA 4F7WA 3E70C 1DC4A 1H65A 1QQ5A 1SQ6A 5EIBC 4V0NA 2VUTA 2W5UA 2ZWAA 4I50F 2OHFA 2VF7A 1T0JB 4Y2HA 3IERA 4ZV9A 5JS2A 5C1IA 3FYHA 3KYDA 1E1NA 4EA9A 2ZXEA 2I8AA 1EFVA 1DAKA 5NULA 1N4AA 1Q0HA 4BVBA 4CLEA 2NO9A 4JXZA 2BD0A 5KNBA 1FFGA 3IQIX 4QDXA 5A1TA 5F7OA 2ALJA 4L0MA 5L53A 5PGMA 3S8YA 3LO8A 1FJHA 3IEUA 4ZOEA 2QP3A 4QOFA 3R3JA 5LP6A 1CUCA 2A9RA 2VQEB 4PO1A 2ONYA 2COUA 3ABZA 3ZGLA 1CZUA 4YR7A 1DB3A 1B3RA 3FWZA 4R83A 1Q92A 2AJTA 1ML3A 1TC2A 2PWZA 2ZYSA 3UOWA 3FSGD 1EAMA 5LBTA 4KB5A 2Q9UA 1P7VA 3G85A 5AWFC 4XSVA 3ED1A 3ZG6A 1QE3A 1PJZA 3ZD9A 4EHHA 3P7MA 3VR4H 1XL1A 1SXIA 3NTUA 5ARBA 4NV1A 4AU1A 1KI9A 1RRKA 3AFNA 4H60A 4IZOA 3SICE 1VJRA 3STWA 3IP5A 2RHMA 3IUNA 5BWNA 4CEHB 3FTEA 2UYCA 1JTEA 4IJMA 4C5AA 4UM8B 1IQ0A 4PC2A 2GILA 3Q1KA 4GZMA 5J5CA 3ROTA 3X0DA 3NZEA 1TO6A 3QVMA 4ZQCB 3GJ3A 1STOA 4YLGA 1KEKA 4ZTUB 2C00A 2ZPTX 4MA0A 4IDDA 4QTTB 3VTAA 4F2HA 1YQ9A 2WLSA 4O2AF 3VDMA 3P94A 4TL6A 4NARA 4ZRDA 4JB8A 1XELA 4DIEA 4AJ9A 1HEYA 2EBWA 1EM8A 2LDXA 1U1EA 2QNIA 4JL5A 5KTSA 2VDRB 2C78A 2ACWA 1PS0A 2NTEA 3N2NA 1KAGA 2DPMA 4HCJA 1QPGA 3QYJA 4MA4A 4B3TB 3RSZA 3DMDA 1IJKA 2VQ3A 2B3TA 3H2IA 1I10A 5EQJB 3R23A 3B8HA 1ECBA 3HPRA 1VMEA 4WCFC 5ICSA 1PFYA 2KLBA 4HBGA 2DERA 4JV5B 2ZSAA 3T12A 1CYEA 2AEEA 5FRDA 3TNJA 3GV0A 2OHIA 3ZY5A 1U81A 3UJ9A 1FRVA 3E7FA 2Q6IA 1Z0SA 1Z33A 3E2IA 2VHVA 3L41A 3ROPA 3TN7A 1BMQA 2G25A 3V4FA 1JB1A 5IJ0B 3X3HA 1KERA 3F5FA 4PX2A 3CKKA 1NV8A 1VBMA 1OPXA 5U4QA 3AHGA 3D8BA 4HMPA 1Y3DE 5FL3A 1M1NA 3TFWA 1T0BA 4IDQA 1DBVO 3PQDA 1U2GC 5A9TA 3MXOA 1J9EA 3P1JA 4UMFA 4EHFA 1NY5A 1YFJA 2ZAIA 1ZH4A 1U2QA 2C83A 2QVXX 3ZIAA 1MX5A 3FX2A 3ZV7A 3UAVA 5D1HA 2VHQA 4F96A 1QLHA 1QWOA 2FPRA 2O0HA 1PT5A 3ON5A 3QWFA 4JI5B 4ZGBA 1C3OA 5D5HA 5KVCA 1EFHA 1W0KD 1U7WA 1BHO1 4QPZA 3OPYA 3IDSA 2O07A 2LIVA 3B3FA 3TSYA 2DFLA 3G0HA 2X14A 1Z38A 2VK4A 3E9CA 1CUWA 1UKZA 1YJ8A 2GPSA 2PVCA 4FZ5A 5EJGA 4ECAA 5ADVA 1KQNA 2FQXA 3UHOA 5EQTA 2WG1A 4P4LA 5KQLA 2V1XA 4DJDC 2RK4A 4JOCA 3RR2A 2GNPA 4QO7A 4JBIA 4OLHA 4BQNA 3DOHA 3JQ9A 3KEQA 4JBWA 4DN6A 2OCGA 1G63A 2WQZA 1HQYE 1NG1A 1J42A 4D3YA 3GN2A 3HDHA 3E2MA 4Q3DA 4TWIA 3IO3A 1X8KA 1RJDA 1X7WB 1T9HA 1UXOA 3SJZA 3R5KA 3RAEC 1NN5A 4QPNA 4D1YA 2X8WA 4UUOA 5CXSA 3LY9A 1GA1A 3GA5A 2YC2C 1U0FA 3HKBB 3LCUA 3L7BA 4Y98A 1FDWA 1GL6A 1ZJ4A 1A9SA 1CRLA 4YFVA 3EIFA 5JCOA 1RTKA 4RQTA 1JIVA 3B5EA 5FLEX 2YIMA 1XNGA 2QVCA 1WU7A 2BKXA 1II0A 1I94B 3PXCX 3KKMA 4WNIA 1WABA 3EAQA 2Q6LA 3WZMA 2I6SA 4Z54A 1I2DA 2PT7A 1D4OA 2W8BA 3IDZA 1PUIA 3AXTA 4OFBA 3I6MA 2NUBA 2PU7A 4MUBA 4ZT6A 1XZKA 2Q3EA 1SGWA 2C3UA 1GYQA 3HI6A 1ST2A 1NRXA 3MQ2A 4OMDA 1E9EA 2GM4A 4LISA 1Q0PA 1AOXA 3DO5A 5TPZA 4AY5A 2YHIB 1IU9A 1X13A 3MOSA 2QW1A 2XJ4A 3SPXA 1JEEA 5BW4A 2FGJA 3AUTA 1JLRA 7MHTA 2X7HA 3NGXA 2ZBEA 3KR1A 4IEFB 1KZ6A 3HY6A 2RHLA 3HLTA 5AJHA 1DRVA 4RHUA 3H5WA 4KFTA 5LQRA 2VPIA 4YUWA 2C20A 2FMFA 2VUHB 2TS1A 1OAKA 2YIDA 2GJAA 2BFDB 3BILA 3IMEA 3PHLA 5GV8A 5TIIA 5JJBA 4ARCA 4KIUA 2VJOA 3QI7A 4GMKA 4HB3A 3EPLA 2BUCA 4Z7QB 5BSEA 4MPPA 4BS9A 2LUOA 4G4SP 3L1IA 1IPFA 2QRVB 5ILOA 3WXMA 2O1WA 4IYRA 3URKA 1EPUA 5HKLA 1IXYA 2P2YA 3O74A 4TS3A 1UEXC 5K7SA 1AHHA 1UDWA 3OFSA 5AW0A 4AN1A 2H08A 2CVPA 1ZGZA 2Y93A 1WZ2A 3VSDA 4PTYA 2ZFUA 1QHFA 5I51A 3M9LA 2IDMA 4X8OA 5HJ2A 2C5HA 4HS4A 1J8DA 3MPOA 2ZZKA 5DWDA 1DO8A 4P4GA 3HMKA 5CYFA 3RU7A 1ZBDA 5A9SB 4B3GA 3I3OA 1ZKMA 3AXSA 3OFJA 5LZ8A 3RC1A 3HCAA 3ZQKA 1KI1A 3ADCA 2R6GA 2SNIE 3KV3O 1FP1D 3FMGA 1CKEA 2OHJA 4G1MB 4IIFA 3K9BA 1R9NA 4IJVA 1QP8A 3AKDA 2PKRA 1NVXQ 2HRBA 3MUOA 4UTOA 4ZZ3A 1WUYA 1UJ6A 1Y7IA 2QL6A 1RFLA 2ABWA 3DT9A 3EXHA 2EW8A 2XWPA 4Z3OA 4HDRB 5AVZA 1F48A 2VP9A 1Y1QA 4N5MA 3OZUA 4QGFA 3H04A 1OKKD 3LOQA 5B6PA 4I5DA 4OL9A 4AX8A 1GSHA 2V0GA 4HG2A 4ZZ0A 1TCAA 1RKXA 1VPLA 2CUZA 5JG7A 4DNFA 3ABSB 4FMPA 5JAQA 4EAQA 5GONF 3WKAA 2WQ7A 2BPOA 5MDHA 4GW3A 5JS1A 3O3CA 4F9EA 3DL4A 4OO3A 4DLAA 3NANA 4YCAA 4GI5A 3WYAA 3C3EA 5A4JA 4A73A 1X1DA 4CDRA 3MBIA 2D5AA 4JVOA 4JDPA 1L0BA 1HNZB 4BE7B 1LLCA 1K5DA 4ZVOA 1HNNA 4U00A 2HA5A 4GP9A 2OZEA 2CLLB 4I1YA 2IYTA 4YXWD 5JT1A 1E6KA 2BZGA 3KT0A 1NF8A 5E7MA 4BV8A 2PAFA 2ZUFA 2EGHA 2CL0X 2O23A 3AINA 2P90A 4WDRA 4BMXA 4UE2A 4BNYA 4EY7A 1QDUA 2DP4E 1OBVA 1ZNQO 2H63A 4AAYA 3I61A 2YXDA 5ESWA 2O0JA 3JAWB 1A88A 3VR6H 2F4VB 3A1NA 4XIIA 2Q3FA 1YFKA 4MP3A 1PV4A 1C0PA 3BMCA 3KDSE 4Q3LA 2JJYA 4BO0A 1DFGA 2OV8A 3X1XA 5IU6A 1KTIA 4BLSA 3H7AA 4RL4A 1Q19A 2I29A 3PR3A 2DJIA 3WGQA 1W46A 3N87A 1Q44A 3HH8A 4RSGA 4TLAA 2WAMA 1EBUA 1G291 1L8OA 5JVDF 1ZVVA 4BWGA 3TRIA 1HL7A 2MJLA 4TLDA 4DLWA 5LYYA 1CY8A 1PP4A 4U9HS 4FWBA 5BYJA 4CF5A 3DHVA 1V11A 3EXEA 4FHDA 5A9RA 3QVUA 1JFVA 3KLOA 3T3IA 2GBLC 1CRZA 2WUDA 4CNBA 4NS4A 4DCSA 2A3NA 4UBLA 3AB7A 2ES4A 1YHZA 2WZQA 3LM8A 4NYIQ 4EMUA 3BB1A 3BIJA 1GFIA 5K0TA 5IWAB 3EPJA 2EW1A 4AQDA 1IRIA 1WMDA 2PRYA 4WRRA 3DULA 1G6Q1 4KI7A 4B6PA 1FX1A 1T5LA 5NLLA 1HDCA 1U0JA 1Y3FE 4LF6B 3IB3A 4V3BA 4KRXA 4FFVA 4BO5A 3N3AC 2ZSJA 5B58C 2O2CA 2VDLB 1L7RA 4RESA 3EZGA 3MQ4A 1PT7A 1YE3A 4RK6A 5KAMA 1RJ9B 1LNZA 1VCNA 3FUWA 3OCVA 2IUUA 4EB8A 4AROA 1X1SA 5HWSA 4MW4A 1Q77A 4MUMA 3OIVA 5JBQA 2FMUA 4CCSA 4UHHA 1A4XA 3RAPR 3VZDA 1MDFA 2AQKA 1BMDA 1WTCA 3AC0A 2WTUA 1N6OA 1C1HA 1U8YA 2QZPA 5TQVA 1WW2A 3DE0X 1GZ7A 3FMVA 4Q03A 2XMSA 4B71A 5EWLA 1Z68A 4ROSA 3NAQA 2E1PA 3FF1A 4C7KA 3ADBA 4EA6A 4PYRA 1T8SA 4L78A 2OV2A 3IMCA 3KWFA 4L1KA 1F60A 1JLLA 1UOOA 2HQ1A 3NBKA 1QUEA 3LL4A 4RS4A 3MJRA 3WYFA 4RF3A 4B7CA 5KYNA 4G0ZA 3SG0A 3FPLA 2RDMA 2DBZA 3QBTA 5EIBD 2P78A 5IBCA 1QAMA 2IHJA 4US1R 3OSZA 3UB4A 1ECCA 3DNMA 5ES3A 1ZK2A 3I92A 4TZKA 2QN7A 4AY2A 4JWKA 2FH5B 2JLSA 3UTCA 4B4WA 5AM3A 2YWGA 5J5AA 2BP7A 1N1EA 1K86A 1RWQA 2ZAGA 5FJIA 3SYNA 4K8RB 1BDJA 4UXHA 4QU0A 1J2YA 2D4HA 4UEKA 1Z5ZA 2N46A 4DQVA 3EG9A 1JG1A 1ZWKA 3M1YA 4H27A 1CLEA 1SKAA 2BELA 4TVKA 3RD5A 4HUJA 1VXRA 1TJ5A 1B0PA 2QJOA 4MNTA 2OR3A 2B98A 3Q7IA 2G07A 4LOAA 2V6FA 2XCOA 1NYQA 4YMGA 2L18A 4MHSA 4NENB 1NTOA 1NTRA 2IYUA 3FOBA 3AP2A 4MKXA 5ER9A 1OTYA 3W5AA 2NXWA 2OB1A 4MRVA 1UKVY 4DA4A 3Q5GA 3ZWYA 2HA6A 2YY5A 3HCNA 3LGAA 1XU4A 3IPRA 4H1HA 4LYHA 4ZAXA 5K1ZA 4BNWA 1GGHA 2I2FA 4JXXA 4RO0A 3ESQA 4JJ7A 4NPCA 3HN6A 3H05A 4JYAB 3UH0A 4LTMA 4KDRA 1TMGE 2GKOA 3AETB 4C0HA 4XWOA 3C24A 5DZSA 3F71A 3QPWA 2RGBA 3M4YA 5FWAA 2EJCA 1C7ZA 1U4OA 4MMYB 2IV2X 2E5FA 2XUZA 4RQBA 3ZBUA 5MFZA 4L0CA 2AA3A 4L3WA 3CW8X 4BLQA 4RTLA 4X1IA 2MT9A 2Q3CA 1Z4NA 4FINA 3UWMA 3EVAA 1JKFA 2JVJA 2JASA 2R1TB 4WI1A 5BRNA 3OT4A 3Q3GE 1HEIA 5LXTF 4CI0B 2QZJA 2GYWA 2AFVA 5F78A 1Y8RA 3A0RB 5JNUA 1A5BB 2B7BA 2MSWA 1A71A 3DOFA 3QF4B 4PAOA 4QHTA 5UKDA 3WA7A 1WXGA 3JYQA 2B8NA 1KI6B 1N5DA 1TL7C 1C9EA 2XY4A 3PDHA 5BWMA 2QM0A 4Y6OA 3M6FA 1FDVA 3L7KA 3SIXA 3WAGA 3BIWA 4W99A 5HIAA 4ZOLB 2A4KA 4G25A 3NG1A 2DCUA 5LWHA 1TF7A 4PVDA 5KHAA 3PNOA 2PXHA 2H7YA 2W2LD 3D3KA 4LHYA 1XTZA 3WNQA 1BE0A 1NDHA 3WVNA 4ALIA 1BDIA 1RAEA 2HF8A 3DE7X 3BFXA 4AY4A 1R3UA 4RA6A 2HFJA 3B12A 1Z4PX 1SXGA 2XIJA 2ZRGA 2EKPA 1JSLA 5TMEA 3S4YA 1S7CA 1DADA 4LSWA 1HDIA 3DZGA 3UUEA 1Z6XA 4IIDA 2VYVA 3AVXA 3SIWA 3AUAA 1XCBA 4KQMA 2UZIR 4GR5A 3ESAA 4MQBA 4OVKA 5CR9A 1FDSA 1FL9A 4JYZA 1WP4A 4RLSA 2PZ8A 1S9DA 2R6DA 3GAZA 3DHEA 3DEFA 2GZMA 3WG9A 4ALJA 4DCOA 1J5XA 2QSYA 2YVLA 3A9UA 4A6DA 3AF6A 2V55B 2EJBA 3BWCA 3DKPA 1C9NA 5ECDA 3RFUA 4J0GA 5LUBA 1TGYA 2YY6A 4YRTA 4FX2A 4P7KA 4C4YA 1XHEA 1UJMA 4TKVB 2Z1MA 4Z1OA 1CV2A 1JR4A 1Q22A 3JY6A 1G7SA 3ZV4A 4EYEA 1T4CB 4OJNA 4KXQA 2G6TA 2B78A 3GA7A 3K6RA 4IG4A 1MIOB 1CHNA 1Z37A 2FJ0A 1W4CA 1UKAA 2WJPA 3RTAA 1NFRA 2H1VA 2J4FA 3UENA 1U7HA 2P4UA 3NT2A 5JASA 4MROA 1E1DA 4G01B 3FYUC 3FETA 3HR4A 1T8UA 3CXUA 3LF2A 3LRPA 4M46A 4UJ3A 5FPQA 3ZUGA 2ZSKA 2EJVA 4E5VA 4EUHA 5LDDC 4DDVA 5GJBA 4QOSA 3T3OA 1FEZA 1E79D 1YBFA 4QODA 5C1PA 1MJGM 3RYFB 2HLNA 1P6XA 1B2RA 1SHTX 3NT4A 5TMPA 4S1OA 4HDMB 3R74A 4DYVA 2P67A 3E2PA 1SD2A 3BEDA 3K16A 2QVYX 3ESYA 1N0VC 2QUHA 3HCFA 4W9RA 3DAFA 3WKDA 3GL9A 2CYAA 2X5OA 1H2RS 4KR0A 5C7OO 4D6YA 1GUBA 1K27A 3J80A 4DR6B 1H1LB 2YDXA 5CA1B 3ESCA 2WJJA 1PDWA 3Q11A 4C04A 4EYQA 2FDRA 1BD3A 1UK8A 3DAGA 1CW2B 3DE4X 3NUQA 2GD2A 3CCBA 3INRA 4LWOA 4RPLA 4CU5A 4EW1A 5MF6A 1L3BA 1RKQA 3WLQA 1GYPA 4AUNA 1ND5A 1ZVQA 1XLTC 4G65A 1UFRA 1EZ1A 4R84A 1VZ3A 4P84A 1QJ4A 2VP6A 1RLUA 2WDPA 3LUPA 4LPKA 1R4ZA 1WSAA 2G5GX 3DYBA 3LY7A 4AC9A 4ZIRA 1ZRSA 4N48A 1AKTA 3ENQA 3IRUA 2TSYB 4OFXA 1XP8A 2HJVA 1PJTA 2HMUA 5GVSA 4HUTA 1KEEA 4MDEA 2UYYA 4ZV7A 2FEWB 5FF9A 1PNTA 3EEQA 2HA3A 2Y1KA 3B9RA 3LQYA 4XRRA 3BAFA 5I7VA 4NAHA 3W9BA 1LQ2A 3R2JA 1HXHA 2ZRNA 5D85A 2SECE 4OHOA 3S1AA 1IG0A 2ZWPA 2NO1A 2EZ9A 1IZ9A 3JQFA 4A03A 1KBZA 2QTLA 3AIOA 3I09A 1CEXA 1GQSA 1MW9X 1NI4B 3HA7A 2WFLB 3OG9A 3Q10A 5KREA 1RYZA 4J43A 1C14A 2VJMB 1PR5A 2ZRMA 3V2HA 2H65A 2IBMA 3O2QB 3UJAA 3BCRA 5KTOA 2O8CA 1OROA 4QXMA 1LTKA 4B09A 5JJLA 4G0OA 3R41A 3DBRA 3ILYA 1QONA 5I4IA 1HC7A 4DM3A 4P0TA 2PLWA 3ZLJA 1U9JA 1V1MB 1RCTE 1WB6A 3PWKA 5DT2A 3WLKX 2PXCA 1TJYA 2WMOB 4D4JA 1D4FA 5JQWA 4B3IA 4UAUA 2BHTA 3L8ZA 3D6MA 2WHRA 2RIPA 4FOTA 1Z88A 4LRWA 1CEQA 1BGVA 1NHGA 1XZQA 1Z2AA 2EEPA 2RGXA 5F2KA 4CZ2A 2ZIXB 1OGYA 1G16A 1GCUA 5C5CA 3GROA 5ETJA 5HK8A 1EP2B 3U60B 3JWJA 3ICQB 4W5NA 1DG9A 4BNDB 3IKJA 3VZCA 3CUWA 4EJMA 3OO1A 4OG2A 2O05A 2OV4A 2VHYA 3U9TA 5EGNA 1JLHA 4H1TA 1DZIA 1TQDA 3C85A 3LC1O 4DL9A 4F04A 2F3PA 2YOHA 5I7UA 1W30A 3B6ZA 4NNOA 4WD3A 3WLPA 5BWLA 5REQA 1D0IA 1EK6A 4AJHA 2Z5GA 2W8BB 2YMQA 1VDMA 2YN4A 3KKNA 3BK7A 3HK2A 4OHYA 1AJEA 1U3CA 2O8DA 3K1AA 1C29B 1WKVA 4L5BA 1E4YA 2HK6A 2NTYC 2YDYA 3K9NA 3KYJB 4PYIA 2JLZA 1FTGA 2ZROA 3IBSA 3O7MA 2ZIEA 2A86A 5DXFA 4Q7QA 2MDTA 3D8UA 1XF1A 5I9IA 3F7OA 4PRZA 4ESHA 2XX3A 1QIDA 1X19A 2ZIUB 1ZA1A 4R51A 2WFZA 3K4QA 2WA1A 5E6RB 7GPBA 5EHZA 1QV9A 5KJEA 2FWBA 2HSEA 3S70A 3TLZA 2WJWA 3KCNA 5EXPA 4FNAA 4MV3A 1P5HA 2RBKA 4NU5A 4O4IB 5FOWA 4O4LF 4TMTA 4Q0MA 4JUDX 3P9SA 3L82B 4H6PA 1XAIA 1KJ8A 4LOIA 1P5RA 3GBPA 1JWAB 4NBNA 2XBLA 4UVHA 4K88A 5EWJA 3GJ5A 1J2TA 1ADGA 4C6RA 4S04A 1ISRA 1BS2A 1KPGA 1KYWA 2C59A 3MEQA 4M2LA 3VHXA 5KOYA 2MSDB 2ZR8A 4TOIA 4UUBA 3A04A 3HVJA 5K3SA 3K6SB 3WDLA 1CYDA 2FN7A 1ZM9A 4FYPA 2BGNA 2R5WA 4D96A 1LJUA 1PJ3A 4BRSA 4EYOA 5CXUA 4ZTZB 4G0MA 2C0QA 2R2AA 3M5PA 1FP4B 4BECA 1B8OA 4URWR 1E8NA 1GP2A 3EUWA 1P5ZB 4KQGA 4UPDA 1XKXA 1F1BA 4MVJG 1XMSA 2FRVA 1POWA 3AWDA 1I4EB 2JLCA 3K8YA 3R0IA 4LJ9A 4XPIA 1DRKA 3W2TA 4BFTA 5BMVA 5T7BA 4RANA 4N12A 3ZE1B 1JEYB 2OQVA 2IU4A 4REQB 2HADA 3EFEA 5JAMA 2WNHA 3DMFA 1R2QA 1SCDA 3I8XA 5T6BA 1KNQA 2XVMA 5EXDA 1Z6GA 4MVJM 3CWCA 3L4BA 2BRUC 2OCBA 3GNTA 4GFDA 5EJ2A 2YRXA 3W2HA 2FK7A 1GGEA 4UC0A 5FNVA 5B1YA 5EJ8A 4LGMA 3IDOA 4Q19A 4KR7A 4JOSA 4RJJA 4LZWA 5FFMA 5HR5A 3FPSA 1VLMA 1YFZA 4P08A 4AM8A 1GNPA 4RJKA 4Z4QA 1LKZA 4LF4B 1U3TA 3AVOA 1QFXA 5FEUA 2C1ZA 4PVCA 1GKUB 4D99A 1M1UA 1NQWA 1OYOA 3T5AA 4DUYB 1L5RA 1XOIA 2B1IA 4RTJA 3W6ZA 4KWIA 1ETHA 1UT6A 2PCJA 2ZI3A 4TLLB 1V5EA 4Z7JA 1HRDA 2AR0A 3AVWA 2J3EA 1A27A 2R7KA 3CMMA 1L8LA 4FUTA 2P9YA 2PKYX 4R9RA 3THYA 3EOZA 3AVYA 4TTJA 3ZWNA 5C53B 4B6SA 3C0KA 5DM60 4HWOA 3GCWA 5EKXA 1ODCA 1P3DA 4DMLA 3OCXA 4ZAFA 5JBIA 3B53X 1M8KA 3WB1A 2AG6A 1IRXA 2VQDA 2QTBA 3OCCA 4ZT7A 4IUYA 4LQDA 1HTBA 4C7MA 1LJLA 4PRKA 4Y7CA 4ZA2A 4RDXA 1RD4A 3DZDA 1W9HA 2FQQA 3UJBA 2EWWA 4JKOA 4PZDA 4QU8A 3ZS8A 1Z8FA 5BR4A 3DLCA 4HNRA 3H2ZA 1LNSA 1WXHA 5AVJA 3NI2A 3T0IA 1JSZA 2G8LA 1SIUA 1XCPA 5KMGA 3OLXA 1LPBB 3OD1A 1M0SA 2O7QA 2YYZA 5EEGA 4WWHA 5AKJA 2A1TR 3TLMA 3GH3A 4NDNE 4ETWA 3CUKA 5ALLA 2CMHA 5IC6A 5CEJA 1M83A 2O8EA 2YFHA 1ZUNB 2YJ6A 1SBIA 3GDHA 3QIVA 1OXKB 1Q7GA 1U7XA 2NTVA 4MYRA 4XLTA 4ZXPA 5JOQA 4DKJA 2QXTA 2PKEA 5MGNA 5LYJB 4C3OB 2HXGA 3RB8A 1GGFA 3DL2A 2C57A 1YONA 1UWCA 3E9DA 4LXQA 1U3UA 4GSLA 2IEGA 5KYYB 1C7RA 1JR6A 3NHKA 3LZDA 2ZJ4A 3WK5A 3L6DA 1UP7A 3UVEA 2PGJA 4WFQA 1NW3A 3LUJA 4P32A 1NBAA 2YZMA 4I5IA 5L4NA 3JAKA 3JQ7A 4ZKEA 1QV6A 4MVYA 1U2RA 2D8MA 3P2EA 3DG9A 1WUKS 3PCXA 1CR6A 4RZUA 2IDZA 2FW9A 5DKFA 4EJ2A 5DLYA 5CJJA 1O0SA 3GELA 1DCKA 1E7MA 4Z7OB 1QV7A 3R0VA 1NA5A 2IUSA 1N78A 3H17A 1ISIA 4DLYA 1XUOA 1IM2A 2ZS7A 1FP7A 1TD9A 3PDIB 5KDLA 3T06B 1BFUA 1DQPA 3VR3A 3HYRA 4GVLA 3FHLA 4DA8A 4FYMA 5C8VA 2O59A 5JAUA 1ZNYA 1N7HA 2WKPA 2R79A 1DX4A 3MA0A 3ZWKA 3VZSA 5HK9A 5HEKA 1SMKA 1MQSA 2B0CA 1H2XA 3ZYCA 4QSHA 1E59A 2FKNA 3UH1A 5FO0A 4IHKA 8OHMA 2DHDA 2C03A 2B8TA 1CDOA 2CNOA 3NM5A 1MR3F 4NEGA 3PC8C 3USCS 1OWOA 4G5GA 1VB5A 2DH6A 1ORWA 1GPBA 2IYSA 4C03A 2XQJA 2OKCA 3M83A 1M7BA 2G06A 1SC6A 3NIBA 2VAPA 2VNAA 2I2AA 4JC5A 3KKZA 5EJIA 2J9ZB 3CXRA 3OTIA 5IDWA 3MJSA 1L8AA 2WAAA 4C22A 5D3KA 3VNVA 1C0EA 1XN1A 3P8ZA 1MXFA 1HSZA 1OI4A 3OPNA 1CQWA 1Z28A 2DY0A 2I4IA 3EZNA 4IIVA 2PBLA 4P4TA 2A4MA 1R0LA 2Y6VA 3K0HA 1T24A 1BX0A 4JSRA 3NHBA 1G20A 1P4JA 3KV1A 3KOYA 3OMLA 4UHBA 2WQ6A 1V25A 2QYTA 2QD2A 2BI4A 2W8ZA 4H0FA 1Y6FA 2R1VB 5CGZA 4KOAA 4M86A 4L5CA 3WNZA 3T3NA 1JP7A 3PDUA 1XDUA 3QHPA 4BNGA 1CY7A 3GC6A 1PJLA 4C6TB 4YRGA 1RNLA 2WKRA 3K9CA 2W9XA 4MB0A 4D8XA 5EMLA 3ZI0A 1T0HB 4F71A 1Q12A 2P2NA 1DARA 10MHA 1UINA 1H94A 1X6VA 3EA4A 3I52A 1G7CA 3FLAA 1XI2A 1XPJA 1QHEA 3TIXB 3U48A 4G5HA 3IE1A 3DQPA 4R8SA 3OEEA 2FGKA 4LF9B 4ODIA 3DTVB 1HGXA 4Z1MD 2BY4A 4FI3F 1XEFA 3MD0A 4M9UA 4NCXA 1I6MA 3SF8B 3LF1A 4P82A 5IW8A 3B51X 3GZTB 4I1VA 4U3JA 4YQFA 1FSGA 2WM8A 3K53A 4WSOA 1JB9A 3BXHA 2NSJA 1M2NA 1TW2A 3DDWA 3TZCA 3U7IA 2JF0A 5IZ4A 2XMQA 2GDJA 4R31A 4K6KA 5EJ4A 3SXJA 3CO5A 3UANA 2HDNB 4MRAA 5AI5A 1PJSA 3I9NA 5TVGA 3QVWA 3L7IA 2Y1EA 4K9SA 1P5JA 3DEHA 4HUQB 4F4HA 4DR1B 3KZVA 5CLIA 1Y1PA 2YV1A 3MERA 2AZXA 3AHEA 4UCQA 3NBFA 3TSAA 3QTLA 2PNFA 1XVUA 1YZGA 1QHIA 1YB6A 2BGUA 3D4LA 1J8MF 3IQHX 3K0EA 2J32A 3ACBA 3OFNA 2RG7A 3QPUA 4BVHA 4JBYA 1SBQA 3KJFA 5EFZA 2WV7A 4KU4A 5JO9A 3MGKA 5C51B 3PSHA 3A2MA 1FX0A 1T9GR 2PUDA 3GU3A 4AJLA 1ZMXA 1CJUC 2FFBA 3N2KB 4BB6A 1P8AA 5LB2A 2Q3JA 1YZHA 3TFQA 4C07A 2Y4NA 1RXVA 5D51S 3F3YA 2G9ZA 4Q7EA 2KI5A 3ZHUA 3UPTA 1HT3A 1T2NA 3OJOA 4LFBB 4RVSA 3UIEA 4ZVNA 3K1TA 1YJCA 1GZ5A 3AF0A 3T99A 1HTWA 3E1GA 1DEXA 1Q84A 3CH7A 1ZVKA 3COYA 3L6CA 2X22A 2H4JA 1MAHA 3DJFA 1SXJE 3Q5EA 5JJCA 3N5KA 5EKDA 3M6WA 2DPXA 3CJQA 5TARA 3JTMA 1J99A 1P4SA 2I4MA 4IKEA 1G1AA 2PBRA 3FB4A 2ZRPA 4E3ZA 3UV7A 1E0DA 1LQUA 1B15A 3O8DA 5BQFA 1ZY2A 2DE0X 1Q7RA 1CR4A 3LQRA 1NUHA 3ZDYB 4ITVA 16PKA 1JHQA 5C4MA 5JAHA 1KZ9A 4LYFA 2EOAA 2WYOA 3OKCA 2VDOB 2WT8A 2AN4A 4W1RA 5F23A 2WUVA 3HA2A 2J5KA 3HS3A 4RVGA 1UXIA 1RWNA 1NNUA 4N8SA 5AKGA 1R8SA 2I0FA 1MVOA 2A78A 2XSZA 4UOEA 2Y1DA 2ZYRA 1U1DA 3KQHA 2GZ2A 4EL5A 4OAOA 5JJIA 3DEZA 3OZBA 3AH8A 5CG2A 2AT1A 1GUAA 2QI9F 4RXTA 2UXDB 3VYUB 3MTBA 4D9BA 4EZIA 1K98A 2R44A 4U63A 1E5LA 4AZVA 3G9UA 3H0EA 4OU5A 2VDPB 4ZO6A 1O1YA 2C7VA 1X2BA 1MNAA 3I6YA 4ZVLA 5IYZB 1E2LA 3FWHA 2K87A 1DG3A 4AP5A 4MVJP 4MUIA 4LHWA 2G76A 3C7CB 4C4XA 2V54A 5HF5A 3FCYA 4XWWA 2ZYGA 4IDPA 2ODPA 4FC7A 2G9UA 3BA1A 1O9GA 2BGKA 3ZY2A 2R6AA 3U81A 5LVAA 5ALJA 4KUHA 1DDIA 4YROA 4I5FA 4EKDA 2PLNA 2BKLA 3PXAA 2JH8A 2NLOA 3FR7A 2COKA 3G2OA 4M0FA 4TXMA 2EYQA 2L42A 3SY8A 4TVSA 4CF4A 1A2OA 4AJ2A 3NVDA 3A7EA 3ZNQA 4RTRA 1MGOA 2P1DA 1HETA 2AJBA 1VCOA 3ZY3A 3VVBA 3BBPA 4PAWA 4RPGA 5JI2E 3RVJA 3FD8A 3JARA 3P9KA 4PFJA 1VBKA 5SY6A 1QFMA 5DTJA 3C16C 2OFXA 1JEJA 4HKTA 1JE1A 3I53A 1P4HA 4I9HA 4OH1A 1RVV1 1UC8A 4U6NA 4QRHA 1QO0A 5EZQA 5SZIA 1U0SY 3UMBA 4EW2A 1ZQ9A 4HNTA 1OGIA 3GJZA 2CB0A 3JTEA 2IVFA 2WWGA 2HBQA 1EBBA 4GMHA 4EHJA 2JBAA 4EZBA 3E58A 5C8DA 2GTHA 2FZWA 4CN8A 1N2HA 3IUYA 3TLGB 2QVZX 5G4KB 3HPQA 2FLVA 1ZCJA 1RJFA 4BKRA 4KPUA 3N7UA 4QAQA 3HDQA 4FEGA 1EGQA 1GR1A 2VDJA 2AG0A 1DI0A 2IXFA 4MMXB 3WO0A 4EGAA 4TUYA 4RELA 5JNRA 1N9GA 3O6VA 2DBRA 2RGNA 1RBZA 1ADBA 1I0ZA 2Y1WA 3DO8A 5HMLA 1U80A 2C61A 3C3JA 2VTBB 3D3NA 1O6CA 1AA9A 4O1IA 4M7OA 4Y1GA 3BWXA 3K2BA 1NG9A 3K3PA 3ZE7A 5ES4B 4Q1FA 2WBLC 3BWVA 4KFRA 1XWIA 1EG7A 1IJEA 3MJEA 5EJFA 2WHYA 4DYHA 4BLVA 2XHZA 4KWTA 4R7TA 2ET6A 2MWMA 3CF0A 4HYTA 4B75A 1YJXA 1DIOB 3QMMA 1OLSB 2YXNA 4WMLA 3QM1A 3RYHA 3HM9A 1HFWA 2CNDA 2CHQA 3A25A 3PV0A 5F5NA 3QJYA 4DAEA 4M3NA 2V5UA 3IP3A 4AULA 3K9WA 1XD2A 3KLMX 2EX0A 4OB6A 2A9PA 1JH8A 5I5GA 1RZRA 5IVPA 1NDQA 4A8JB 1XK7A 3I37X 4UHDA 3IUJA 4E2ZA 3N07A 1S1MA 4HRAA 2F8LA 4M8LA 1OH8A 1H4SA 3VO9A 2A9FA 3FNIA 4E22A 2F6RA 4TYYA 3B1XA 2P40A 3BFKA 1BXRB 1M6VB 5EMKA 3I0ZA 3AR4A 3KLBA 4H7KA 4QL3A 5IJXA 4MS3B 4Q4AA 4U9UA 3PJDA 1SKBA 1QHNA 1JA9A 2EYUA 1RM0A 3U26A 1BVRA 3F5SA 4WJZA 4MEBA 4NAUA 4AMZA 4BGIA 3PQ6A 1YMVA 4MWGA 3PWSA 1USVA 4JX9A 2Q5HA 1U9CA 2I5PO 5EZYF 4G0VA 2IYPA 3ZXIA 4P81A 5EWMA 4ZDIA 2NO0A 2RGUA 5C1DA 3ABIA 2IBSA 4ZARA 5K8CA 2W48A 3L4SO 1NMSA 1AQUA 3PIRA 3JAMA 2CHFA 1IHPA 4I0WB 5KCZA 1VKZA 2W0SA 1C50A 3I1YA 2IPMA 1VI5A 3OF5A 2QY9A 4OJMX 1P44A 5F77A 1GADO 3URMA 4TQ9A 2EKDA 4MKGA 3W4KA 2J0UA 1JFFB 1QBGA 1QZ3A 3IXLA 4LDJA 5BQXA 3WFZA 5IK2D 1E63A 2NXNA 4J16C 1LK0A 2IIQA 5FORA 3N58A 1FQJA 1TNDA 4C4SA 3ZC3A 4HGQA 3TVDA 1SELA 2ZSDA 5G53C 4EY4A 4Q4CA 1UMBB 4Q3AA 2ZK7A 4MJ3A 4RZ2A 1CUHA 4AUKA 2BISA 1GGKA 2YJ5A 2YNMA 2Q3MA 5B3JC 1I7DA 3CA8A 3WKBA 3L79A 1Y3HA 3H16A 4MW0A 5D87A 1OOEA 3UJCA 4OXYA 4R2LA 4BMZA 5KNCH 4YUYA 4CI9A 3AR2A 2QLMA 1GRRA 4JZYA 1XP5A 3PEFA 4S1TA 4Y9UA 5EE3A 5B4TA 3U56A 2KMLA 3EVCA 4B85A 2GLXA 4EHBA 3OZCA 4TYNA 1CR1A 2Y2VA 4HX5A 1C3XA 1G19A 4XCXA 1E9DA 2Y1CA 5JW6A 1U7PA 1SKUA 2RHHA 3H3XA 2BMFA 3DFIA 2A0WA 1PS9A 1DS6A 1KMHB 1MBZA 2X9VA 4FDUA 2G1JA 3U7FB 3HG7A 1G8FA 5B30A 1ELOA 1Y5RA 3TK1A 1WUHS 4GEKA 4WLEA 4V0RA 3AIIA 4V0SA 2GZ3A 2H2HA 3E5NA 2XXAB 2JVKA 1I5OA 1TQHA 3PI6A 1I36A 4HPJB 4WY5A 1LDYA 1NT4A 3CVXA 4B5LA 2DLNA 3H1AA 3OU7A 2YN2A 4ZRNA 3DNPA 2QUKA 1BJKA 2FSVA 4RABA 2Q5OA 5CRIA 1CUIA 4JBHA 3A7DA 4HGNA 1QC5A 2OZLB 1MC8A 2I7XA 5CLHA 5IARA 1MJGA 2RGYA 3E61A 4EO9A 5EJ9A 2X9NA 1OPRA 4IDGA 4ZFNA 2ZI7A 4H7DA 2UXCB 3OPYI 3CVYA 2C1EA 1X86B 1L1QA 2VXYA 3R5SA 4CIYA 2CLOB 3OFKA 4MS1A 5JMOA 4BO7A 2E18A 1T8WA 2VHUA 3Q2OA 4RM3A 1KZYC 2FEAA 5EXXA 3U19A 5M7EA 1W75A 4JLOA 4D4HA 2FR8C 5BOSA 4YUAA 4NZ9A 2VBFA 1OJ7A 3GJTA 1QH8B 2QAGC 3PGVA 4O4HA 4PPQA 1W85B 2OWEA 4LE1A 4G0UA 2BVNA 1KL7A 1BCRB 4MV9A 4PQGA 4BO2A 4F4FA 1CIVA 5CDFE 3T1VA 1E4EB 3N0TA 3BERA 4BTLA 4RKFA 3HDYA 2A7XA 1R4MB 4QJIA 3KOMA 5AI9A 4FPXA 2JI6A 3GUZA 4OSOA 1PN3A 4H0CA 4M9CA 2YVKA 2CD9A 1X0VA 3K32A 5DGTA 3HCEA 3ZH2A 4PEVA 2E4YA 4JYPA 4EVSA 3QPBA 3KYIB 4I4TF 3RC2A 3SSNA 3FMFA 3MCAA 2M6SA 3N74A 2XR1A 4WEQA 1FFCA 5DGCA 4N0DA 4A8PA 4Q34A 5F9FA 3WWEA 2E37A 2ZVJA 3GYBA 1Q0UA 4PW0A 4MMZB 1NUTA 5IAJA 3BFVA 1CP3A 4OGKA 1CVRA 1FLVA 2A9KA 4M83A 3MM4A 3KJGA 3JZFA 1H2AS 2GJ9A 1E3IA 1G8SA 2RH8A 3QXGA 1R64A 4NMWA 4RE5A 4AMGA 1JKXA 1YB4A 4U8GA 2JLVA 1NWCA 2EQAA 4JT8A 3VHLB 1YO6A 4NVRA 3E03A 1UC9A 4JI1B 1YOBA 3DV0A 3HJHA 4KNVA 3RANA 2BEWB 3N28A 4YCLA 3OM1A 3VC2A 1T5TA 1H0HA 1QIMA 2GEUA 5EPOA 5EYPA 4HB2A 3LY5A 1F4PA 2AN9A 1R8JA 3EISA 4M6WA 1EUQA 4LI0A 3PI7A 3RTEA 1IEWA 3ASUA 2REQB 3EYAA 4L15A 3QG1A 5TXGA 4BMNA 3VNSA 4FR5A 2KBEA 1GZ4A 2SHKA 2HK9A 5FAXA 3N8KA 4PYJA 4HNAB 5AK0A 1T9CA 1IPHA 3OD5A 3BJMA 4XPZA 1SQGA 5CW1A 5FL7A 3ST7A 3T3DA 3B3JA 3IAS1 2CSUA 4HWRA 1N77A 2EFJA 2ZYVX 3NAZA 1ZU5A 3AESB 2FG5A 3DEYX 5EZ6B 2BWJA 4M9QA 1OBCA 1ZUHA 2LVBA 3U2QA 1RBYA 3PL5A 4Q7LA 1ZC4A 4FOOA 1TEVA 4JXJA 3HTXA 4C21A 1I3KA 2FEMA 3CU5A 5I7OA 3GA0A 1CJVC 3MF4A 1VYUA 3SJUA 1F4LA 1Z56C 3DBOB 4U6QA 5AXBA 4YPOA 2QB5A 5EUBA 4X9XA 2RI6A 2I3DA 3HCPA 2PH1A 4HO1X 2GSWA 1DAFA 4KKVA 5EPEA 3QHQA 1MX3A 3U7RA 3IEVA 3RHZA 1O97C 2X7JA 3KKKA 4W6QA 3H1EA 4TSFD 1FLNA 1RXCA 3M9XA 3I9FA 1VECA 1WG8A 1Y4UA 5IVDA 4ZYLA 1CY0A 1G8YA 1KI3A 1M74A 2MINB 3G1UA 4GPBA 1B00A 2XTJA 4FS3A 4LXGA 4MARA 4UU1A 1LK5A 1E92A 4F84A 3GB9A 4HQ6A 2HF7A 4WNYA 5I6DA 3GPLA 1SK9A 2FW0A 3WV5A 1AGYA 1TTQB 1TK3A 1AGRA 2BM0A 4MSUA 3TR0A 2YW2A 1RHRA 4M0KA 3L8HA 5T8KC 1N0IA 4MO2A 2Q4BA 4US0R 3NHLA 2EKLA 2EP5A 1S3SA 3UKJA 3PRKE 4MWTA 3FNFA 2FCRA 1AE1A 1F2DA 1NIPA 4KRGA 1FE8A 1UR5A 4HP8A 3JPYA 2XT6A 3FY4A 1L7BA 1MAUA 2N0SA 3SNKA 4B6OA 1EWRA 2MYTA 4E5DA 3FGZA 3KLNA 4LYDA 4QTXA 1SEPA 3LYHA 1KK3A 3R6WA 4X20B 1JFSA 1EMDA 5K8VA 3MCVA 3AW9A 3TIIA 5BOVA 3CX7A 4U2BA 4YJKA 5BXQC 2W2XA 2ZUWA 5IZCA 3IV9A 2G9RA 4PXYA 4RZHA 1A1VA 1F5NA 1SFRA 2GWHA 1II9A 1LLQA 1V7QA 4RD3A 1ZISA 2PU5A 5JYBA 1X7YB 4HDQB 3PEVA 3H1BA 1GR0A 3E4CA 4MVJA 3PTLA 2G72A 5FH9A 1X80A 2QYHA 4ACBA 1ZRMA 3B1YA 3D4PA 3JZMA 1VHDA 5TEVA 3FIUA 5TX7A 3KSRA 4OOFA 3VKVA 2BFOA 4FKZA 4GR9A 4LYGA 2IYNA 3H84A 3TBHA 3KUCA 3MAGA 1EWKA 5LOVA 1ZJWA 5E1DA 2GK7A 2XMDA 2XQKA 1JYSA 3NB0A 2P9BA 3DAOA 3PNBA 2AYXA 1K4MA 2OENG 4TLBA 1KYYA 4YJ3B 3H1TA 3VKGA 2EVWX 1OAOA 4LHXA 2JG3A 3R1IA 3QUSA 4WOCA 2J5BA 3UJNA 5E0KB 5EG5A 4PSVA 3JZDA 1XJQA 3VI4B 3RSQA 1UC5B 2ZVQX 1PFQA 4QVIA 1K8XB 3LCVB 3ROEA 4AMVA 1CRQA 4BJHB 2C4MA 2X13A 4ZK6A 3D31A 4W1SA 1IY2A 4K9OA 3WGIA 1Q3KA 2DTEA 3JSXA 1XHFA 1UMCA 4ZO8A 1UH5A 3EXG2 1YE8A 4D9KA 2G7MC 3TO5A 3FGNA 2J85A 3QLVA 3U7QB 4DDWA 2WJAA 1U2DC 2WSBA 3GOQA 3IALA 3ONNA 3VTFA 2IUTA 3VX4A 2PS9A 3N7TA 2Z58A 4HNSA 1AT1A 2Q2NA 2QD5A 2YV3A 3BH6A 2PLRA 1AKYA 1VLVA 2SKCA 3F6BX 4GMDA 4N5LA 1VIDA 5HIJA 3PFNA 3T9BA 2XB4A 1TYBE 3UXYA 5E4JA 5A1JA 1QRSA 2OE2A 3FUXA 4F2DA 4KYUA 5AVKA 1CIPA 3N8IA 4YRNA 4GD3Q 4I55A 3T9AA 3H5LA 4JOQA 1I7NA 3GZ4A 4IFBA 5A3JA 3A1DA 1GNSA 1UPXA 1E8MA 1R5JA 4WOKA 1L7NA 1EKXA 2ZT6A 3EVEA 3R7FA 3OUZA 3SC3A 1NXQA 2FEXA 3V46A 3I01M 3K6JA 4XIGS 5GP1A 3GVPA 4EJ0A 5JISA 2GKSA 5BP7A 2QVGA 3GAAA 1OD6A 3RLFA 2M9MA 3FTPA 3FN4A 3I83A 4C89A 1ZK1A 5CT4A 3UJ7A 2C5LA 2JGDB 2H4FA 2WD7A 5J5VA 2RHWA 5JDIC 1SU7A 3WXBA 4YAWA 3RTGA 3TJMA 5ALGA 1DFIA 4ZP1A 3MLAA 4DLLA 3TNFA 1DC5A 5A05A 1KO1A 4DC9A 5JYDA 1BTOA 4ITRC 4DT1B 1T35A 5AHOA 1PZXA 2JIZD 2EBFX 3SJ7A 1NVMB 1JN0A 1X7ZA 3D2CA 2PM8A 3NYQA 5ALUA 3VC3A 2RE8A 1XNHA 1XZLA 2WWFA 3O4HA 3THWB 1P9RA 3DGEC 1TAHA 4M53A 3WLTA 3OJ0A 3OU2A 5IJWA 1TMKA 1NC1A 3ESRA 3GUHA 1SIWA 3VO2A 4CF6A 5TT0A 3F3SA 3I3SR 4P33A 4CKCB 5MHTA 4G67A 5KVSA 2VWPA 1EDZA 1LX6A 3K70C 1EUDB 1NRJB 3LAWA 5KZMB 1Z83A 3PD7A 4GHWA 1IHYA 1XDWA 3CLUC 3CW2A 3GLUA 3EW9A 2PK3A 1ITZA 3TYXA 4NV0A 5B5SA 3G88A 3E48A 1TCBA 2DQZA 3LDFA 1V5FA 1DNPA 1ODTC 4NHEA 1J22A 3R7DA 4YMWA 3KXLA 3TIFA 4D92A 2EHJA 1J90A 3O8OA 2QQEA 1BHQ1 3MT7A 3RS4A 3M6IA 1R10A 1YC5A 2GPTA 2XW6A 3OMXA 4RX1A 5BO5A 3A6PC 3PLRA 5ESRA 3KTOA 3U4QA 3HXOA 2X8AA 4Z4EA 4LDZA 3IEKA 3MTEA 5EJ6A 4KBGA 3GVHA 4FWTA 2X5KO 1TCVA 1JDUA 2ZIZA 3GBVA 1Q17A 3KELA 4GXNA 1KJ9A 4I81A 4O1MA 4F4CA 4EELA 3GGDA 1K88A 2VZ9A 1DOAA 4IHQA 4LDAA 4TQAA 5H3CA 5K3EA 5J58A 2FEPA 1IY8A 5JZSA 1A9XA 8ATCA 2WJVA 1YR3A 3ME5A 4M1KA 1PEKE 4ZK2A 3L8YA 3OETA 1OFHA 4KXWA 4KACA 4YRJA 5ENZA 4E4YA 4DA0A 2C95A 1PR3A 3MTIA 2HRRA 2GF9A 3HGQA 1XZPA 4M38A 5AOVA 4J49A 3RVBA 2QENA 1ZIPA 3OP4A 1GHTA 1PEYA 1VKHA 1WQ4A 4IH9A 3OZRA 4AKHA 5J47A 1JJFA 2IE8A 5I7WA 3R0ZA 3SFTA 2HT1A 3R3VA 3RASA 4W8HA 5HUQA 1WB5A 4DJTA 4AP6A 4EGCB 4NOKA 4TV8A 1U28C 2IZ7A 4G86A 2XCLA 2ZDHA 3ENVA 4PAQA 1LF0A 1OYWA 1NXXA 4YK7A 5C5IA 3D5QA 1GAEO 1Z0DA 2XQIA 2XT9A 1W1IA 4B6RA 1ZBQA 3AJRA 5KQMA 4AYWA 3D4NA 4QXQA 3RUIA 2VSNA 2GLTA 5M2QA 5LC1A 3RG2A 3FCCA 4H16A 2DECA 4OGGA 4AO7A 4EJ6A 4RTPA 4DHWA 1SC9A 2NO6A 2AOTB 4KO2S 3FMOB 5TRTA 3JWGA 2H1HA 2WYHA 1GPUA 2NZYA 3QNWA 3UAXA 3A27A 3UMVA 1N2BA 2BEUB 1DWQA 4PZLA 1ACJA 2CV2A 2JAWA 3DLAA 3EPPA 3F96A 4QLBA 1A9QA 5CHEA 3HUDA 4BKPA 3QU2A 4PZPA 2LNDA 5HG0A 2XYHA 3IA7A 2HA4A 3ZVNA 2VHJA 1QG4A 3TTXA 4BMPB 1B6RA 5JSFA 3LP8A 2NWQA 2V7VA 2QQFA 3TX2A 4KE9A 3P20A 2R68A 1KIFA 2I99A 4HAOA 3NRBA 1JDTA 2PIAA 2WZBA 4QQFA 5ELLA 4B0OA 4JDUA 1L5WA 4RMGA 1H9AA 5AFSA 4BLRA 4CQLA 2G1PA 4QKQA 5JAOA 2B4KA 4FYYA 2ACKA 1FU7A 2DBYA 1KETA 3B2EA 1YF3A 1NUAA 1RM5A 2H54A 1C1DB 2Q5JA 3BS4A 4W5RA 2GCIA 2WJ4A 3PEUA 2IYEA 2ZCJA 5B7QA 4CIAA 4C87A 1PEAA 1X42A 2XVXA 4KVAA 2DR3A 3NONA 1ZGBA 4PZZA 3NEAA 4P36A 4HLUA 1XC7A 2AEJA 4FFBB 2ZSEA 1X92A 4I9NA 3GXBA 2BM9A 1ZVJA 4J1NA 1BW9A 2AFHE 4J1QA 2I65A 2WD9A 2YX1A 1O8BA 1OYVA 3HBNA 4HQKA 5AI6A 5FLKA 3FZYA 2PRSA 1LLDA 1ZIYA 2ZSUA 4PQFA 5EQDA 1WZNA 2WJIA 1B8VA 3HVKA 3UB2A 3C4QA 1TA9A 1PR6A 1UT8A 4L28A 4OHWA 4D9FA 3PE4A 4CV1A 3I6QA 3IBGA 2Q1YA 2Y27A 3JQBA 3OMWA 2OYCA 5LQAA 2HPHA 2AQIA 2QN1A 2VK8A 3NFRA 1OA0A 3CNLA 1RYDA 4Y6SA 2AVDA 1QTRA 1MENA 2TRSB 1HK7A 4A10A 1JALA 5HSGA 2QL5A 2BGRA 5F3DA 3ZU3A 3TD2A 1A04A 4O6VA 4L85A 3LPMA 5E2AA 4XJVA 2BFPA 3UT0A 5E6UB 5AM2A 3I45A 4QT4A 2QTMA 5CGQB 4GX5A 5DT9A 3COJA 2FX3A 3KEOA 5DOZA 4RULA 4N9WA 1G7TA 1ADFA 4HRVA 3SR0A 5IF3A 3QJGA 1IPEA 3ZZTA 3MXTA 2J87A 5TMBA 5HOEA 1BEEA 3SI7A 2HKIA 3ZNOA 2ZR7A 3GQBB 4HC4A 5JTUA 3CVOA 1V4BA 4MX8A 4A6PA 8ADHA 1ZMTA 1L7QA 4CDGA 4I7EA 2A6PA 4PGHA 3T4PA 4OAQA 1CEYA 3OLVA 1Y8AA 2ZSBA 5CFZA 5CFRA 1VE9A 2DF8A 3AJ8A 3GMIA 3NKVA 3I1IA 4YA6A 3PGA1 3TUIC 4B45A 4DY4A 1M2HA 2XZLA 4HWGA 1ZAKA 2CWDA 4NFLA 2AB0A 3T3PB 1C7FA 1WXIA 4FDVA 4RA9B 4Z6KA 2V97A 4B4UA 2AMYA 3FGPA 1M33A 4AKSA 2Q3DA 1BO6A 4JJ8A 3F6RA 5G0WA 2JGNA 1EXWA 1XB2A 2Y76A 2QTVA 2REBA 5AVSA 3M6AA 1GARA 2Q62A 2YYSA 4Q9IA 2IP4A 4OJQA 5AKXA 2ECKA 4C0XA 5JQGF 3U16A 4LCBA 3G6KA 3V3KA 4BRWA 5ALDA 2BGIA 1W6RA 1CXZA 1ZJ6A 3RRXA 4CKZA 2ZJOA 1KMIY 2OWDA 5C2JB 1A77A 4D46A 3GZJA 4AF8A 2P1ZA 3PQ8A 3V48A 1OXMA 2HWKA 4LJYA 5FJJA 1E3WB 4F2PA 4IPTA 4K40A 1USIA 4Q7MB 3TS1A 1HWYA 2OSVA 4XB1A 3CEAA 5DGHA 2IDJA 1JZQA 3D54D 2H1RA 4WZBB 1JQ3A 2F1IA 3W7VA 4R7GA 4CQMB 1LSJA 3ZWPA 1RMTA 5KC9A 2FYTA 1YB2A 1T1EA 2O1EA 2IZ5A 2W93A 3M4ZA 2AW5A 4F8JA 1I4LD 4YBRA 1JU3A 3WLHA 4XEHA 1JV2B 2WIKA 4RGVA 1MMFB 1A50B 1N25A 4KTTE 1LVHA 4RZIA 4YONB 2YHBA 5LNK1 2V9CA 2WPNA 4CIDA 2CJWB 4MWDA 3UFXB 2YL2A 2NZUG 1T29A 2VDWB 5FWXA 1QTNA 3EDYA 1KEWA 1TEZA 2QM8A 2QDKA 1G5TA 3G2NA 4AZ3A 4B7UA 3WJ1A 3GVXA 3SKYA 4B74A 5I4KA 2B8EA 3LTNC 3S29A 2UU9B 1L4GA 2FFRA 3EEYA 5JPIA 4YWJA 3SJBA 1DSSG 2O2JA 2FPXA 1E98A 5CITA 4DZTA 2IKSA 2QPAA 1Y4ZA 4NBWA 3DVRX 821PA 1D1PA 1BAPA 1CG6A 2GN0A 2BFNA 4D4MA 2DC1A 1E20A 4CMAA 4KO4S 5BURA 2VLBA 3M0EA 4BNIA 4PBTA 5KSPA 5KX5F 3O2NA 2VHZA 5P21A 3MT0A 5IRCD 4NSNA 2GPBA 3NCHA 3TLKA 4C7OB 2J08A 1I32A 1QIKA 4UAJA 1F38A 2P9GA 4QA9A 1XZDA 5C80A 3UAGA 1E1MA 4QULA 4WK2B 6REQA 4B6QA 5K01A 1UXGA 1ZVMA 3GFOA 2I71A 3E22B 4OQEA 4AQYB 2NVBA 1QVAA 4FB4A 2YKGA 4OXIA 4PWYA 3C4VA 5FBZA 1M2JA 3TKYA 4G07A 1NOIA 2X2PA 1P6UA 2KHZA 5DE3A 1H3FA 5EVCA 1XZ8A 2I6UA 3UJ6A 3GLIB 4UCWA 1FS4A 1U8CB 2J3MA 1XLUA 2FRXA 4V39A 5G3YA 1NJ5A 3DKKA 4NY1A 1FVXA 3G2KA 4KLRA 1X8LA 2GAOA 4MW1A 4BEJA 2RC5A 4ARVA 1WUTA 4L0DA 5B3KA 1ORIA 1E6MA 2NZ2A 4J0JA 1HE1C 1RLJA 4BJ3A 3W5JA 1BYUA 4WN3A 5AUOB 5B4VA 3WZ2A 5ABPA 4FVTA 3HDGA 4PZEA 3GCDA 3VZQA 1J06A 5KTKA 2XE8A 13PKA 3HN2A 1IH8A 4IP0A 5E4TA 4ZGGA 5CEEA 1QRAA 4GS5A 1IWPB 5JANA 1FRFS 2C84A 2EL9A 2PY6A 1E3QA 1TUGA 4QBGB 5DHAA 1QHGA 1VJCA 2GNAA 2FUCA 2ZAOA 3EC7A 5DK4A 5LWQA 1Q0RA 2IHTA 3AFHA 3NOOA 4QICA 1Z9BA 2V8BA 4UDOA 4D0SA 1REQB 1VG8A 5FHQA 5DHPA 1N5MA 4FFPA 5ELMA 1LDGA 3O73A 4B6FA 4UTVA 3F6CA 1T2EA 3MWLA 1UZAA 2O7RA 1CF4A 3OQMA 1JVSA 5DMHA 1FFYA 3KD2A 5AIAA 1FFWA 2OGUA 4DJ5X 5EKTA 3JQ8B 1KSJA 3LDGA 3VH1A 2WWHA 3A1FA 4TWJA 5TC4A 3T5TA 3G7UA 1E2FA 3WC4A 5HFNA 4A2WA 1P72A 3FPGA 5CTAA 3DGFC 3RIGA 1JHYA 2VPPA 1QR2A 5HRCA 1NX6A 1EXDA 2Q0XA 2RHCA 4XR9A 4B0PA 3OC6A 2HL6A 2WTMA 1LLFA 2ONJA 3K70D 4N3CA 1QRUA 1PT9A 2B36A 2P9CA 1R6BX 1N8SA 4J6FA 2A92A 4H17A 3U5TA 5FXMA 6GPBA 1ZGAA 1E1LA 1GCIA 4MHOA 3BMOB 2XTMA 2YZ2A 3ENKA 2BR3A 1OLUA 1YAJA 2P6NA 5L3QB 3G0CA 4KXNA 4GDFA 1BROA 1KEUA 3R4VA 1L1FA 1GZ6A 1TT5B 2NUTA 4AG6A 1W36B 3M6UA 4B48A 5IKXA 2AZ4A 2P0AA 3V33A 3DKVA 1HDXA 5JUWA 1L5QA 5B37A 3M4NA 1P91A 2ENUA 1PL7A 2AOXA 2CVFA 3BBLA 2AXEA 1Z4IA 2A5LA 4KQEA 3AI1A 3E7XA 4Z4IA 1AN0A 3H2BA 3ETEA 1VYHA 4GRAA 2RKWA 2JCGA 4WEOA 1P2BA 4RMJA 4ZYVA 2Q3HA 2ZRAA 3G49A 4H3SA 4LJRA 3GRRA 3QENA 1T3HA 5T6MA 4ZI7B 5LP6F 1Z0KA 3TE6A 1UBGA 4OL0A 3NTXA 4CCWA 3MGBA 4ZPJA 5I9BA 4EJSC 3TGLA 1Q0ZA 5KOHA 1XTIA 5KYGA 3MSCA 1HM5A 2HMSA 1EU1A 3QA9A 1ULHA 1CY4A 2XOKD 4V3CA 1NJSA 3GPBA 1YGYA 3FOWA 1XCOA 2FOIA 4IUCS 5IC4A 4ES6A 4LY0A 1D8TA 3T35A 1U5BA 1YJAA 2GFHA 1UZMA 3OZDA 3TW0A 1KWGA 4W9MC 4D9HA 4WXMA 3TXAA 3UMJA 1ST3A 2XE7A 4R1OA 5C7LO 3U37A 3H83A 3D2BA 3G5MA 1X7HA 3TRFA 4MIKA 5BN3B 4NFHA 4JI6B 1PFWA 1V0JA 2FLWA 4KL8S 1E1RD 3IV7A 2G71A 1S9HA 5JS6A 1M7GA 4BNLA 5PNTA 2BBSA 3KYCA 3LA8A 1F3LA 2XYQA 3OVMA 2BMJA 3EZYA 2OXFA 3QX7A 2E4UA 4KN9S 3NALA 1SBZA 1XROA 3CX6A 1JIUA 4PCAA 2RGRA 4AJOA 1SC4A 2HXSA 2ROQA 4XCQA 5DHFA 1H8ED 1B0AA 1N6IA 2GXQA 5F4BA 4U6SA 2BFCB 1K7SN 1OY1A 1YSCA 1TKCA 1P0QA 3I34X 2CEKA 2PL3A 1U2TA 2WSSD 4IDOA 1Z4JA 3HBFA 3GP3A 1V43A 3JRWA 5HA5A 1JQDA 2Y1OA 1Z0ZA 1JPVA 1EE1A 1R27A 3K35A 3QPDA 4F6LA 1V7CA 4BP9A 4PLPA 1TJNA 2P75A 2WTNA 2VRCA 1T5DX 2IELA 2XYPA 4CM9D 3UN1A 1G38A 3FYUB 1Q0TA 1JG6A 1FYFA 2X2EA 1PGPA 5EXSA 1XQXA 4L4RA 3J7TA 1WOYA 3WLJA 4OQDA 1JDPA 3ECAA 4E7OA 1J2JA 3PKZA 1ULSA 4B43A 5GPBA 1Z13A 4P0PB 2E0IA 4Q9NA 4L2IB 1EYZA 3P2IA 4JJFA 1EHYA 4UDNA 3N2GA 3OCWA 4JXKA 3RQSA 3WO1A 4GSKA 1OXXK 2QNBA 4AICA 1COZA 5K3FA 4E1AA 5EIEA 3U4QB 3DONA 3D02A 3NHSA 3RW9A 5IFKA 3VI3B 1SJ9A 1JQAA 3QUTA 1EJ6A 2Z08A 2D5CA 3I6ZA 5CX1B 4N9QA 4XYLA 3E35A 3FHOA 2JFWA 5EXTA 4IHAA 3K05A 1PV1A 4G1CA 5T3UA 4RZXA 4JJAA 2ZVDA 2CL6X 2ODWA 2FPOA 4IKOA 1F7VA 2Z5LA 1OBOA 2W90A 5LJLA 3RRZA 4RUKA 2PEZA 4Y2GA 1T2CA 3H18A 2D2EA 1JDNA 3CV3A 4KMSA 1YXMA 4YS6A 3V3TA 5P8WA 1QAQA 2B35A 1H4QA 4U7WA 3W4JA 3RWBA 3I1JA 3OE7D 3G8CA 3QMVA 4M1TA 1RRMA 1TLFA 4GOND 1JI3A 3LDAA 2KPOA 3BWDD 2VJBA 3MUEA 2BM1A 5I9LA 1JJIA 1GO2A 3PSAA 5AKLA 4QBFA 1LTHR 1T1RA 3W2GA 1YR6A 1EZ4A 2LCIA 3WKEA 2IS1A 4V2IA 3SP1A 4W8GA 3USES 3QXSA 4U02A 3K4PA 4EVIA 3ZJ5A 1UBHS 4YCNA 1M1YB 3E9QA 4IOMA 1K9VF 3PNYA 2ZSFA 3TEJA 3ZHSA 4BX8A 3L5OA 3L07A 4YREA 3ZGXA 4HDCA 3A1VA 3FSGA 4QXAA 5ISMA 2UUAB 5K51A 1O77A 2IHBA 4YPVA 3G02A 1XD8A 5HRAA 5JYEA 1S96A 4MRMB 4B6GA 4BRZA 1M0TA 1Z5OA 4DEXA 1GOTA 4PLVA 3FI9A 1ULAA 2OLKA 2Z8ZA 3NS7A 4RD2A 4DMCA 3HXQA 2ZB7A 4XGQA 4LW8A 5EC8A 1BIFA 2XUJA 3NW9A 2P3LA 3OWHA 4L3VA 1LDNA 3QVXA 4PX3A 4DHEA 1GXSB 3S6JA 1BS1A 2AYYA 4PYOA 2Q46A 2ZDGA 3HVUA 2IV7A 3ZKAA 4V0LA 4WLOA 4RC9A 3DT8A 4A91A 1E0AA 3CZQA 1VGQA 3OZSA 5ARDA 1I9GA 4BKUA 1S7GA 3LHSA 1NVDA 1C1XB 3HBMA 2ZPAA 1ZITA 1TZCA 5HDQA 3WBBA 1OF1A 2P41A 2VAXA 5GQSA 1KFEB 2IGBA 3FCAA 3OCZA 2ON6A 2PUTA 2C1XA 3RPEA 4DIUA 4YVFA 1NBMD 3ICOA 1IB6A 1IBLB 1PR4A 4YJFB 4ZDJA 1ND6A 5JJKA 3OY2A 2KX7A 2Y0EA 4NEHB 1PJCA 4AJPA 3KD3A 1PYDA 2YH2A 3EYWA 3M89A 4LRSB 3CSSA 2Z4SA 4KC0A 2BI8A 3KFXA 3N8NA 3BMQB 1TGVA 1EM6A 3DOUA 4QYIB 2NQ2C 2IIBA 3PUZA 1AKWA 4W1QA 4AD8A 3QEAZ 2C7BA 1L5GB 1IZ8A 5HW0A 4N8DA 3C98A 3WQSB 3WS7A 4D4IA 4DPLA 3UBTA 4GQAA 4Y2XA 2WTXA 3IS3A 3O4IA 1D7AA 5DLPA 4RTQA 5FDFA 1IBKB 1QHHB 2HIMA 1MH9A 1FQKA 1LPMA 2AUMA 2DGDA 2HZBA 1YR1A 4WNAA 1VKOA 1QZXA 2BMEA 5LXTA 2X4LA 3QOWA 1RRVA 4F6RA 3JYLA 2XUPA 3JQPA 2BGLA 4YMVA 1BWSA 1FOEB 1L4KA 2DJ5A 4GU5A 2VSXA 4OQMA 1L3CA 3GVIA 3RTBA 4CLOB 5JV5A 1NQTA 2JJ1D 1O5OA 3QVSA 3R5JA 4P4SB 5BMOA 2B2XA 2VH1A 3OAAD 1GM5A 3UYKA 1FJGB 4TQGA 2XXBA 1MTOA 4D8WA 4HEA1 1P2SA 3FUVA 5A5FA 3C3CA 1KQGA 3QSYA 1Q20A 3EZXA 1R00A 3QVVA 1D1SA 1P9OA 1E2PA 1JEOA 1XEWY 2EV9A 2G0AA 2H8KA 2JC3A 1P1KA 2Z9BA 4V0QA 5ELXA 4EQ6B 3GBSA 2H1CA 3IQDB 3Q7RA 4LFCB 1HE8B 3JQEA 4CGYA 3CNEA 1Z2CA 4MWOA 4A0FA 1CULC 1P81A 3KEMA 4JB3A 1SWWA 2A5GA 1L6RA 2QX7A 3ZVKA 4XYMA 4G5OA 4I50B 4XAQA 4LZAA 1KSHA 2C4UA 5DYGA 3JD3A 3L7LA 4PIMA 3O8BA 4DC0A 2P68A 1MCZA 4HMQA 1LZLA 1UOPA 4QYMA 1EP3B 4X45A 5IBRA 3V34A 4JB0A 5CD1A 1RFGE 3MWJA 1ZO8A 3ZBQA 5CNMA 3PHGA 1U8XX 4QUGA 1YOVA 3LV8A 4R2HA 2YXLA 1C4OA 3ZKWA 3VGPA 1DJMA 3PT5A 5AVOA 2XGJA 4B35A 3RYCA 3T1HB 3BGWA 4ONEA 3PR2B 2YWCA 5CUQA 1PO7A 4OI4A 2J31A 1S8AA 2GPJA 2NUPA 1A2KC 2M98A 3A37A 3PP8A 4FNMA 5J3JA 2Z09A 1G8KA 4ZVTA 3L93A 1NN1A 2L2QA 4KDCA 4S0ZA 4BO9A 2K6GA 2CXXA 3D3EA 3W77A 4B2LA 1MN6A 2GCOB 2QMZA 3AF3A 2ERCA 1G2IA 2WE7A 3DWGA 4KXVA 4MCJA 4XWAA 1WCV1 3GWGA 1BDHA 5ALKA 5EMNA 1WV0A 4XGKA 1XRMA 1Z0UA 1JKJB 4EO7A 1LB1B 3A9WA 2WJGA 2I78A 5D00A 2ZZNA 4KXUA 3D5EA 3B9QA 2EG5A 4W5TA 4Z53A 1S89A 3N7AA 4NYIR 3HB7A 1G17A 5E2BA 3UM9A 3M82A 4DSNA 1JWBB 1DQNA 4RTOA 1WB4A 3D6AA 4UHJA 4O2AB 4MYSA 3O4RA 4G1VA 5DNWA 4KAXA 4Q4JB 4MYTA 3OQJA 2R8ZA 4Y2PA 2JKYA 2O2SA 3L7MA 1V4NA 5TGTA 1LH0A 4BFWA 3ADKA 2JIMA 2ZJ1A 2WKWA 3BQ9A 4PSKA 5F4ZA 5FADA 3P4YA 3ISJA 4G4SO 4L0QA 2Z9CA 4WN9B 1QIHA 3ZCXA 1PWZA 1X1QA 3C2QA 3SE0A 3KOUA 4O1HA 4F60A 4RFSB 3AHFA 3H1FA 2PX8A 1DBSA 3ETDA 1G98A 5CBKA 5C0OE 2H1LA 2OPHA 2MHCA 5J40A 2SCUA 3T52A 1V41E 3BD9A 1SBHA 1GRQA 1WY7A 2BONA 3ZLTA 1OGJA 5AW2A 2RH9B 1YQTA 3D2AA 4MKRA 3E9EA 3WK6A 2NAPA 1MB4A 4ZKDA 3MB8A 3WLOA 4XSGA 1DPGA 4GI1A 2PMEA 5C1BA 2XVZA 2PNJA 1RSZA 2R4UA 2QZ9A 1TEHA 1PSDA 1ZD5A 1D2MA 1HY3A 3RU9A 1V47A 2X42A 3U7HB 2BFAA 4YQZA 4BMSA 1XQVA 1EZZA 3JATA 2I1QA 1C8VB 1KDRA 1N2JA 9LDTA 5IP5A 3S27A 3QE9Y 1UZLA 1F8GA 4ZAYA 1W0CA 3RSCA 4KYVA 3B5JA 2VHEA 1OKKA 4MXDA 4P7FA 4PIVA 2Z8YM 3HYSA 3ND7A 3DL7A 1VPDA 3FCOA 3GGJA 3UMMA 2NQTA 4PAMA 1U8FO 2NO7A 3I64A 1F06A 4LVCA 4X6XA 1AO0A 2PL9A 4AWBA 2EG9A 3QPVA 2AX3A 2EX4A 4GPAA 4PZYA 1F2UA 4BVJA 3ENNA 2PTGA 1RIFA 2OBFA 1R4NA 2ZGVA 5H7XA 1V5GA 4EI8A 3AFOA 3THSA 4BB9A 4O0LA 2GVDC 4HVAA 5F7ZA 4RV4A 5A04A 3HB5X 1PQPA 5HE8A 4PG4A 4JA2A 1VLHA 2WWTA 1WV1A 1AQIA 1I3NA 4F2GA 2YS7A 4G5XA 3NTOA 4N6NA 2V58A 1TM3E 3DLHA 3BREA 2CJFA 4HTFA 1QGZA 3DEAA 3F90A 1UM9B 4NFYA 1TJPB 5IM4A 1RQ2A 3W6PA 2GBGA 2ZRBA 2YMLA 3AG5A 4C0SA 2BJHA 3G82C 1YS9A 5BUSA 2YWXA 3FUUA 3RBXA 1IOLA 4AP9A 4MB2A 4MQMA 4X6UA 2JGLA 3PWTA 2FN9A 3LD9A 4G5FA 4DG9A 5TE9A 3RI3A 4FGZA 1IM5A 2IOYA 2QAIA 4KBFA 2Y6UA 2HMYB 1G21A 3OJFA 3DNFA 3UC5A 2O2DA 3AV0B 5F1PA 2VJCA 2RI1A 3PLNA 1CBUA 5ERXA 3DBHB 1ESDA 3NHMA 1O94D 4UMVA 4ENPA 3I28A 5TGZA 1OI2A 3C1UA 2ORED 1LW6E 3ZIUA 4B76A 4LJLA 1HR0B 1AVTA 1IXRC 2AE2A 2BKEA 2PJZA 3A3OA 4ZCQA 3CQ9A 2GA8A 2JB9A 1GPWB 5I7SA 4AXBA