3K32A

The crystal structure of predicted subunit of trna methyltransferase from methanocaldococcus jannaschii dsm
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
191
Chain Sequence
LMDVHVLFSGGKDSSLSAVILKKLGYNPHLITINFGVIPSYKLAEETAKILGFKHKVITLDRKIVEKAADMIIEHKYPGPAIQYVHKTVLEILADEYSILADGTRRDDRVPKLSYSEIQSLEMRKNIQYITPLMGFGYKTLRHLASEFFILEEIKSDYEAEIRHILKERGESPEKYFPEKQTRVVGLKKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0690
publication title The crystal structure of predicted subunit of tRNA methyltransferase from Methanocaldococcus jannaschii DSM
rcsb
source organism Methanocaldococcus jannaschii
total genus 59
structure length 191
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k32A00
2YWBA 1WXFA 1O0CA 1I2DA 3L93A 3ZJUA 3KT3A 4EG1A 1VBKA 4CDNA 1QRTA 2A1UB 3RBAA 1IQ0A 4R0NA 1Q15A 4YP5A 3AFHA 1MOPA 2PFSA 5JBNA 1IQUA 4E1AA 1FYDA 2YXNA 2J5BA 1X6VA 2QTRA 4KR6A 4RPIA 1WKBA 1KH1A 3CVYA 2CT8A 2H2AA 1KH3A 4DDHA 2CV0A 3IH5A 4QBTA 2ZUEA 2QJFA 2V0GA 2NSYA 1XNGA 3LE8A 3ZJTA 1NP7A 4UZEA 2DUMA 1X8XA 4G5FA 5KWVA 3IVCA 1EXDA 1Q77A 3COZA 3KFLA 4I6JA 1NUPA 1WXEA 5EKDA 2NZ2A 3FHJA 3K32A 4JYZA 2R5WA 1QU3A 4JXXA 3A4IA 4ZT3A 2Z3VA 2EL7A 2X3FA 3NBAA 1N2IA 5KHAA 1MC1A 1N75A 2GM3A 3IMGA 4EG3A 3K9WA 1YIAA 4MVXA 1O97C 4MWBA 1O6BA 1JZSA 1T6YA 1O95D 3CLRD 4MW2A 2E18A 2JA2A 1NUQA 2QTMA 3H97A 4GRIA 3UC5A 1NUTA 1M8KA 1N2JA 3H99A 3IOEA 1PG0A 2PXHA 1JIJA 1QRUA 1WY5A 1GPMA 4MUIA 1I6LA 3CLUD 1Q19A 4KR9A 3HGMA 3Q12A 2X1MA 4J75A 3COVA 4NDAA 4XFDA 3IODA 3M5WA 5DASA 2DXIA 4L2IB 1MAWA 3PNYA 1MBZA 1V8FA 3CR8A 1M8GA 3FOCA 4MW4A 1OWOA 3ZJVA 1XNJA 3KT0A 1U7DA 2VTBB 4OUDA 4F4HA 3TZEA 2Z08A 1YUMA 4P2BA 4MAFA 5DB4A 1JGTA 1TYAE 4HJXA 5TEWA 4ARCA 2JANA 1ILEA 3SP1A 1WOYA 5KCMA 1IVSA 4A91A 2WB2A 1PG2A 4NZPA 4MUJA 3X1MA 1EFPA 4OUDB 1T9GR 1S4MA 4FZJA 1OBCA 1J09A 3L92A 3FIUA 4EF6A 2A4MA 4AS1A 3OP1A 3D6VA 4AQ7A 1QJCA 2ZP1A 1N2GA 5DEOA 1SURA 1GZUA 1I6MA 4ZCSA 1N78A 1PFWA 5F23A 3N05A 1HYBA 1NZJA 3ILVA 1U7XA 1JEDA 5TGTA 4MUNA 1KQPA 3GLVA 3IUBA 5J5AA 1KR2A 4NX2A 4KKVA 1R6XA 3VRHA 1GTSA 1QTQA 1R6TA 1XJQA 3Q4GA 4DDMA 3HMQA 4RUKA 4MUKA 2QTNA 3UY4A 1F7VA 1M8PA 1CT9A 3FWKA 1U0BB 1EFVA 1N2EA 4X0EA 1EE1A 2QJOA 2QUIA 4ZCRA 4PBTA 1LW7A 3N8HA 3A04A 4HPWA 2HMAA 4ZT6A 5K0TA 3RHSA 1MB9A 2AG6A 4MUHA 4MUGA 4KR7A 2D13A 2CUZA 4YP7A 4DJAA 1G8GA 3H9CA 3CLSC 1EFVB 1N3LA 4ZT2A 2DR2A 4YP6A 1J20A 1QNFA 1VBNA 3D6UA 3HL4A 2C5SA 1NSYA 1IRXA 2IP1A 2DERA 3OTWA 3QTBA 1UFVA 3TQIA 2HGZA 3DO8A 3NBKA 4K03A 1OD6A 5LFAA 3UK2A 4CQNA 4K0RA 4BWVA 4EG6A 1IHOA 2D5BA 3MUEA 2B7LA 3LOQA 1WZ2A 1G8HA 3TS1A 3Q10A 3CLTC 3FH0A 2J4DA 1YULA 3AG5A 4PY2A 3DV2A 2OQ2A 4MW0A 1JIKA 3HZRA 4PBSA 4U8HA 3A2KA 4EG8A 3ZIUA 5IHXA 1Q11A 4EFKA 4MW7A 1TQ8A 1VL2A 1K92A 2CYBA 1NUUA 1COZA 3P52A 4MWEA 2O8VA 2WSIA 1H3EA 5HUHA 4ZCPA 2V0CA 1U3CA 5BNZA 1NYLA 3RK0A 1KORA 3INNA 3ZXIA 1O0BA 1K4KA 1PFYA 2DEUA 3FI0A 1H3NA 4JXZA 2TS1A 4NAHA 3AKZA 4QREA 1ZJWA 2BTEA 2A86A 1OWMA 1OWLA 3FNRA 3BL5A 3IMEA 1GLNA 3ZUGA 4F3RA 4DE5A 2A84A 1WQ3A 3UMVA 5H16A 2XRZA 2GKSA 1LI5A 1G59A 1KKUA 5IJXA 4G5YA 4DDKA 3ZXSA 2CYAA 3AL0C 3IDFA 4ZT5A 3HV0A 3TNJA 3X1JA 3P0JA 1MRZA 3U1VA 1EUQA 1O95C 4MUEA 4DLPA 1F9AA 1JMVA 1K4MA 1MB2A 3DPIA 5FNZA 5AHWA 1YIDA 4EG5A 1TYBE 1NUSA 5J59A 2HZ7A 1EFPB 1WQ4A 2E0IA 1K97A 5FO1A 1RQGA 2AZXA 4MUFA 2OV4A 3KT6A 3ISJA 1IFXA 1WXIA 3COYA 1O94C 1KH2A 1WXGA 1IQRA 3IOCA 4ZCTA 2CFOA 2A1TR 4MW5A 3AG6A 3SZ3A 1YUNA 1GTRA 1JIIA 2CSXA 3JXEA 4YMIA 4MW6A 1R6UA 4GU5A 2PZBA 3AIIA 1M1ZA 1OBHA 2X0KA 3GUZA 3SEZA 2E21A 3ELBA 3SDBA 2EJCA 4DNXA 3ND5A 2BYTA 1XNHA 3E27A 4NATA 5TEVA 3TQOA 2Z09A 4ND7A 3DLAA 1T6XA 2X1LA 4EG4A 2DLCX 1JHDA 3ND6A 2IELA 1I6KA 4Q16A 1QRSA 2J08A 2CV2A 3CLTD 2JAXA 2A1UA 1N2HA 3FG9A 1QQTA 2A88A 3MLAA 3CA8A 1O97D 2E89A 3QTTA 2YY5A 1T6ZA 3IOBA 3GMIA 4ZT7A 4I6GA 1IH8A 3MMXA 2J09A 2O5RA 4MVWA 3MXTA 3MLBA 2D54A 2RD2A 1WJGA 3TZLA 1WXHA 2H29A 4MQ6A 3N2YA 2VXOA 2QUKA 4YBRA 1ULHA 3PXUA 1G8FA 3FETA 1FFYA 2I1LA 3X1KA 2DPLA 1M8JA 1TYDE 1PFUA 2GOYA 4MWCA 1B6TA 1N1DA 1J21A 1BS2A 3CVWA 1GN8A 1P7PA 3N9IA 3VGJA 1QU2A 1NURA 4J76A 1O5TA 3ZGZA 2WQ6A 3RK1A 3RJZA 3COWA 4WSOA 2IJGX 4JZYA 3I05A 1N2OA 5DK4A 1TEZA 1YI8A 2A7XA 2PZ8A 3G5AA 4ZCQA 2RE8A 5FO0A 4G6ZA 3QE4A 3SEQA 2ZUFA 3CVXA 1ZH6A 1KP2A 4MVCA 1Y42X 3H05A 4MLPA 2J07A 3F3MA 2PIDA 4L2IA 1KAQA 1KP3A 4CDMA 1N77A 1F4LA 4KPUA 3CVUA 4NAUA 3IVXA 3UOWA 5LLTA 3SYTA 4EGAA 4MULA 2DETA 1EJ2A 4ARIA 3CVVA 4XFJA 1NI5A 4UZFA 4XSVA 2VTBA 5K0SA 1J70A 1N2BA 1VLHA 1O94D 2QJTA 5TS2A 3RFFA 4KPUB 4EG7A 4I6EA 1VBMA 1T9GS 2CV1A 1KAMA 1GAXA 4Q93A 1ZH0A 1KQNA 4ND6A 3H9BA 2XRYA 3CLRC 5J58A 2CYCA 1JZQA 1ZUNA 2QUHA 4PBRA 4R2MA 2G36A 1J1ZA 4ZT4A 4TS1A 2QUJA 4HJRA 3LCJA 1OWNA 1LI7A 1D2RA 1U3DA 1JILA 2PG3A 1O96A 4WNYA 3CLUC 1KQOA 1J1UA 1EUYA 3G6KA 3FDXA 3IMCA 1DNPA 3HFJA 1PFVA 5HG0A 1TFUA 1V47A 3CLSD 2A1TS 5LM3A 4CT0A 3PRHA 4R2LA 4U63A 2WQ7A 1MJHA 1O96B 3P0HA 3ND7A 3A05A 3PNVA 3VU8A 2AKEA 2YWCA 4HK4A 1M8FA 4QRDA 5H7XA 3IUEA 2PZAA 3NV7A 4MW9A 5HUJA 1H3FA 4OJMX 1JEEA 4S1OA 4MWDA 3KT8A 3S3TA 1F7UA 1OWPA 3FY4A 4MVYA 4U7JA 1A8HA 1JECA 3P0IA 4MW1A 1M83A 3IVGA 4JFAA 3G59A 1H1TA 3SZGA 1TYCA 3C8ZA 1MAUA 3PNBA 4H3SA
chains in the Genus database with same CATH superfamily
2Y4NA 4B7XA 5JMOA 2PWPA 4G97A 4QG7A 4HDRB 4R84A 3KYDB 4JLUA 4OHOA 5E6SB 3SMVA 3MQ2A 5C7YA 1GZ3A 5KQLA 4U7DA 1G21A 2HDHA 3OSUA 3IP5A 4LDAA 5IDXA 1M0SA 1CJKC 3ZX5A 4R3UC 1GLGA 1G8KA 1NTRA 1VTKA 2CVFA 4R0NA 4RPHA 1CY7A 1O4VA 2X22A 3K1TA 4JUFA 2OYRA 3KZXA 3VPAA 3D0RA 1ECBA 4G1UC 3E15A 5AQ1A 3P2YA 2YNMC 4GAEA 3DJYA 3RF7A 3UXYA 2DKFA 1NLUA 1H1LA 4O1IA 1NVUQ 3WGYA 4JLBA 3HXQA 1LFAA 4O08A 2JFVA 3FIJA 3FLMA 3L1KA 1QC5B 5HCNA 1Q95A 4HWOA 3RJMA 4A3SA 1MN6A 5EKUA 2PD3A 2ZRMA 2CDAA 2QX6A 2P77A 4OQFA 1LRJA 1Z7EA 1XDZA 2DT8A 1YQEA 2QZPA 2QTZA 4YC7A 3WXBA 3LX8A 4Y6GB 4CMIB 2ZBRA 4L4ZA 1ZJ6A 1P45A 4L6AA 2ZBQA 4JJ4A 3N28A 4P7BA 1CERA 1BHQ1 3TX2A 2I8CA 4Q02A 1XA3A 3IT3A 3LV8A 4WXEA 4F7DA 3TLBA 3R7LA 5KVAA 3H1PA 4OM7A 3OOEA 1H22A 2QVLA 4ZT3A 3CHYA 2IYSA 4GBED 4S1NA 4BMZA 4LPKA 1KEEB 1FS5A 1PJ2A 5CRIA 1ZNZA 2FDXA 3F90A 4URVR 1EAYA 3N59A 3WBBA 3C4QA 4WXRA 5F9HA 4MW2A 2X23A 5JY1A 3ZE8A 2BGJA 3U3MA 1XRLA 2WV7A 4OXKA 1DTWB 2FUG6 2QMQA 3H99A 1LBHA 3BZBA 3IOEA 4G5SA 1UKZA 2K2QB 5ALEA 4ZHQA 1U2PA 3PX3A 4LJ6A 4MCJA 1ONSA 1ZU5A 4LHYA 1XTBA 4XR4A 5FBHA 3L4KA 4LYEA 3LC2O 1T5SA 1NDQA 1CRLA 3EIEA 3WV5A 4HV4A 3NEPX 2FN4A 2BGIA 4OGWA 4JT8A 1QDEA 5SV2A 1R88A 3CUEF 4BQIA 5A4FS 4JI2B 4HNSA 1QG4A 3H65A 2FTKE 2W2MA 3NDRA 5EWJA 4ODIA 3U3XA 1HG1A 5A2GA 1L8AA 5JS7A 4H59A 3UIEA 1P17A 3M5PA 2BH9A 4IUYA 5EMLA 4U3JA 1PK8A 1VM6A 4BGIA 4BFUA 1HR0B 3QVSA 3IHKA 3RRJA 3HBAA 4P2BA 4MAFA 4BUCA 1VJCA 2O4CA 1DDOA 3E1GA 5BO5A 4TTQA 2V7TA 4TYMA 2FF5A 4DMRA 4Y2RA 1UFRA 4UUOA 4E08A 4QATA 4CTNA 5CBPB 3IVRA 1M54A 2HHHB 1HBJA 2W6CX 5TVKA 5MHTA 1J8DA 3O03A 1ONBA 2P3OA 3LECA 4XVQA 4FYKA 5JVDA 2C31A 1QORA 5JPIA 1F3OA 3C8UA 3D3KA 1ZVMA 2UYHA 4AJ4A 3DOJA 2WP8J 5T6BA 4N03A 1QO0D 2GT1A 4IHQA 1ONNA 5BQ3A 4KBYA 4LWZA 3AM1A 3JWHA 2V45A 3R44A 1E92A 1ZH4A 3BHMA 3BXXA 3B2QA 2X3UA 3L8ZA 4Z8XA 1AU9A 4CM9D 2PGIA 3IUSA 5C46F 1XI2A 3IO3A 4PPYA 5CYFA 4MR7A 3C6ZA 4I14A 4YEDA 1E7SA 2YC4C 3L41A 2FJ0A 4PRYA 3O8NA 2VYNA 3O0DA 1SURA 4P1ZA 1VB5A 3GJRA 3ZYCA 4KXWA 3JATA 5INTA 5IEJA 1MH9A 3RUDA 2Z6QA 3N05A 4J0QA 3OFND 1H4SA 3FNHA 2NIPA 5MF6A 3N87A 4FW9A 4F2GA 4AY3A 3AWDA 4BNGA 4C5BA 3PHHA 3HB5X 1D6JA 1SU8A 3KKZA 4FNAA 4Y2XA 3VH1A 3FROA 1E9DA 1JDZA 4PHGA 4HDNB 4ID9A 5FLEX 2H48A 5KIAA 2DWOA 1T15A 2OECA 3MERA 4ZO8A 4DDMA 3KFVA 3NVDA 3HO6A 5GVRA 3V4SA 1F6WA 3EZLA 4AF6A 3FOFC 1LW6E 1RD4A 2NQ2C 2W83A 4YJ3B 3E9EA 4HZUB 2GXQA 3HB4X 3TCXB 4LYGA 3EEOA 4MDYA 5K3OA 2VQ3A 4G5GA 3WWEA 5C1PA 1JFLA 3ROFA 3UKJA 3EXEB 4V0NA 4CM6A 4ETNA 1L4FA 5A62A 4OLAA 1GD1O 4KR7A 2RH9B 3MFYA 1XAHA 2ZRLA 4BDTA 1GHTA 2VPPA 2VF8A 4G0WA 3W5UA 1N3LA 1ZCAA 5DJ5A 3ZHCA 3A6PC 5AH0A 4G5HA 1V25A 1TE2A 3DEIA 3BMQA 3VYRB 5I7HA 4YI5A 4BVKA 1TCVA 3M49A 4UHEA 2YHUA 3WK4A 2E4XA 2IF2A 3BE5A 4WEQA 5JXHA 5AKYA 5I4IA 3G02A 4GBGA 4MGHA 4X97A 3QTBA 4G1VA 3SHOA 3TQIA 4RJKA 4JJ8A 2IZ5A 1Z7GA 5HFAA 1CUJA 3RV4A 1PN3A 5DSXA 1YJAA 1RYFA 3E70C 3C3KA 5FWNA 3C16C 3ESQA 3GFRA 5CK5A 1WCIB 4AQYB 2YZGA 3K3PA 1PX2A 1YQDA 4KWTA 2GFQA 1TD9A 3B1XA 1JDBC 4PPGA 1XZMA 2FSIA 3HJUA 5HRAA 3AOGA 4FOSA 4FR0A 3I64A 3NHWA 3CO0S 5AJXA 3VO9A 1ZINA 5KJCA 1JVBA 3UAWA 1J9ZA 3KHKA 1GG5A 1G98A 2HQ1A 3FDIA 3C7KA 1KJ8A 2I2DA 1M2VB 1JU9A 2WPDA 4RY8A 3RGGA 2BP7A 4FX5A 4N6GA 1K8QA 5AQEA 2WJAA 4I0WB 4JB2A 3W3AA 4LMPA 3BXEA 3LF2A 4TRJA 3B1FA 1K92A 3T3PB 3RC8A 5FADA 4LK2A 1VSUA 1MEEA 4UBOA 1A77A 2I5PO 2YHIB 4CL2A 1M2JA 4FCTA 1TMOA 3D43A 1QHYA 2QN2A 1B43A 1UQTA 1THZA 2X4IA 5U9CA 1LBEA 2CKDA 2ZI9A 4BTLA 1ZMXA 3TPCA 3JYPA 4X1YA 3DOFA 1P2FA 2H7VA 3AWIA 4GI5A 2VAWA 4QFDA 3K6SA 4CMHA 1PZMA 4NFHA 5CFPA 5CLJA 2OMKA 2BTEA 3FPKA 2VHCA 4AKIA 4WTOA 3A3YA 1U8UA 3IMEA 1LS1A 1XMIA 3ETHA 2OV6A 3EIOA 2VWGA 3F7MA 2R97A 4NHEA 4CQMA 1MF7A 2F8TA 4Y2UA 4BU0A 4COOA 3VJLA 5H3HA 4C7OB 2JBHA 3VSEA 2HD4A 2H9IA 4DT1A 1ZSNA 4O4IB 1M5RA 4ILKA 4BPRA 2A9OA 1QHEA 3C6MA 4Q1AA 5HIKA 4F6LA 2OV1A 4G5YA 2OHIA 4DDKA 1GYRA 1F2TB 1L5YA 2RGNA 4O2AB 3G9UA 1H8ED 1YA4A 3IUJA 2FU5C 5EXPA 4V0OA 3LYLA 4K6OA 3GBPA 3MF4A 4W8OA 3VDMA 5JS6A 3T15A 2Z9CA 821PA 1AZTA 5CNKA 3FJYA 5JDCC 2HLPA 4YAKA 5AW4A 3SPXA 3HXTA 4V2UA 1TMYA 1Y6QA 3RQIA 1Y9AA 3ZHUA 4DCUA 5AUNB 4F4CA 3A6DA 2LR0A 4OK6A 3OF3A 2Y77A 2CDNA 3TW8A 2RHTA 1RPAA 2QGNA 4FPXA 4K1XA 1V4VA 5FNZA 3V1LA 2PDAA 1GGJA 1VECA 3FKQA 1NOKA 1V0JA 2NAFA 4NF2A 4BKQA 2ZUVA 4EPVA 1PW5A 4RAOA 4R5MA 1Y8AA 4PNHA 2XDQB 1Z08A 2DFNA 3QELB 4PG6A 1LFDB 1WXIA 2PL1A 3COYA 1JV2B 2VHQA 3NHYA 1GVNB 2D1SA 3OOYA 4EHKA 5KKAA 1JHRA 1YR9A 3KTFA 3AJDA 3W2IA 5C5EA 1Z47A 5AVWA 1RWVA 1W85B 3W8DA 4QYIB 4XOIA 3VX4A 1NF8A 1NG1A 2COEA 1UADA 3FSGD 5CB4A 4UFNA 2AZMA 4G07A 4Q39A 3GUZA 4L4YA 4JCCA 4YRNA 3ELBA 5C8ZA 4NVRA 2HLDA 2EJCA 3KLOA 3KPYA 3P9NA 5KTKA 1TO1E 1IWBB 1JMYA 3AZPA 5DF1A 3CTMA 4DCOA 5KOJB 1UAYA 3F7OA 4XGIA 4L8FA 3UA4A 4IHKA 4BB5A 2GK4A 1HNXB 2DQSA 1T6XA 3EBOA 1HO3A 4N8DA 3DEFA 4E32A 3OM9A 2D0DA 2WYHA 2C77A 3TPZA 2PQMA 3ND6A 5LP6A 4CXMA 1I6KA 1QHSA 4N5IX 2QTWB 1XP5A 2CJPA 2WB4A 2WUVA 3KE8A 3W06A 2JAXA 1F0NA 2LDXA 3CS3A 2ZQ5A 3HLTA 4ZU3A 5EIEA 1BYIA 3INYA 3QX9A 2GD0A 3OQHA 3SS8A 3NH6A 4XB6B 5LMUB 1Z74A 2PL5A 2F3UA 4UCWA 1ZN2A 4JVSB 4BNMA 3ELYA 3IPYA 1PL7A 2Z56A 4NQZA 1ZNYA 2HJ9A 3BOSA 3R5SA 4Q05A 4JBNA 1CZOA 5JJLA 1RHRA 4IRXA 2GLTA 1GGEA 1IWPB 4X00A 4N3GA 4Y7CA 1JHPA 1FUKA 1C9JA 1P73A 4N3BA 3TZLA 1F51E 1IDN1 1NJSA 1BROA 3H1TA 3LWZA 3NNNA 4FX2A 3ZJYA 3VTFA 5B30A 3PL5A 1ULHA 2R1UA 1AS0A 4O02B 1GILA 4M22A 1RI4A 3C3JA 5K0FA 4LXIA 3SS9X 1GOTA 1RRFA 3C15C 4TLDA 2NV6A 2Z9BA 1X7GA 5JYDA 2B4TO 1GG9A 1KEPA 2BFOA 4YK7A 2F64A 3B60A 2ZIXB 4GSYA 4ZRNA 4Z2YA 2IITA 2WTAA 1RMTA 3L5KA 1GM5A 4B3TB 1U2EA 3ENQA 5FBQB 2P27A 3WLPA 2C82A 3LHSA 2AYYA 3CNOA 4KBGA 2PT5A 3I8OA 2OZVA 4ZODA 3ZGVA 5D3ZA 2WY2D 4DA9A 1R8JA 4UTXA 5D51S 2Q6OA 2I3DA 4LN1A 4MCIA 4E2XA 5HKKD 1T3HA 1VJTA 2C59A 2CZGA 1O1YA 2Y1OA 3DZBA 4IUCS 1K27A 1IIRA 1K9SA 2ATCA 1YQ9A 2F1KA 4UOZA 3QH4A 1YJXA 2WICA 3IEUA 2VLBA 4GLFA 3GD5A 3HI4A 2PL3A 4NXMB 2NZUG 3G0BA 2FEMA 2VNSA 3DZGA 1DFIA 4R3NA 5JE8A 3C3AA 3NETA 1QX4A 3CWCA 5TSDA 2R2AA 4X3PA 3P2JA 4J03A 3DEZA 1U1GA 2ICAA 3ZD6A 1XXHE 2I4RA 3P9PA 5DEIA 2IOYA 1XCMA 1C7QA 1EU1A 1LSJA 4PAMA 2HB6A 4GXQA 1JBEA 2Z2IA 4YJFA 4PFKA 1XZHA 3VR6A 1X7DA 3M1AA 1XEAA 3PDUA 1GRNA 4EGAA 2HF7A 3DMTC 3QBVA 4S0XA 4OLHA 3BJEA 1IOLA 5FWAA 4I4CA 5KINB 4X8HA 4J7UA 1I32A 2FEPA 4II7A 2PKQO 1DRJA 3INGA 3TOXA 2B4AA 4P82A 1L1FA 2E2WA 4G36A 4C4AA 5AVSA 4HEA6 4J4TA 2IV2X 2WR8A 2VDJA 3NOXA 5IWCA 4LXUA 4B8ZA 4LGCA 3HWWA 1GZ4A 5G0WA 1E3TA 2VPQA 4KPUB 3HG7A 4RKWA 4ZEXA 3ROPA 1QV9A 4K6KA 1HOXA 1C3OA 4BIIA 2DYKA 4O59O 5JC8A 3JQAB 1ZQ1A 1S3FA 4Q93A 3TVYA 4QKQA 3IKTA 2OSBA 3MAJA 1ZI8A 1HQCA 1ZY2A 2FJPA 2GBLC 4FD2A 1TMKA 4US1R 5FOXA 3T1VA 3JAWB 1NQAO 1ZUNA 2DY1A 4HDSA 5AVVA 1USIA 1T3GA 2F9LA 2QW0X 5FAKA 4EZBA 2YVKA 3TQSA 3WLOA 1OWNA 2PH3A 5E3JA 5JQGB 2AN3A 1J0BA 5I7SA 2OAGA 3T7RA 1ZGZA 3ZS9A 1I7QB 1Y0BA 2C97A 3SM9A 3QW2A 4TZTA 1B0ZA 1FTWA 1MOSA 2F48A 1DNPA 5HWSA 1A5AB 1U7TA 5I7VA 4BY9E 3W9BA 3VBCA 2CXQA 3IIEA 4TS3A 3QVKA 3LDAA 4BN4A 3NOVA 2Q4DA 4U63A 3HUEA 3A9TA 1KJJA 4LY9A 3RUEA 4CJXA 3SX2A 4ZI7B 5AVYA 3KOMA 3R7DA 3EYAA 2WSMA 1R3UA 3LYAA 4A73A 4OA5A 3WKDA 4Z4FA 1EFUA 3I04A 5BPHA 2OXRA 1QAMA 2ERXA 1GEGA 4XX1A 4BB6A 2YDXA 2OQVA 4CCYB 5EEGA 1ZG3A 1VPLA 4C20A 1XWIA 3GJ5A 2R8XA 1QCYA 4XGNA 2FV8A 1HE2A 1H0RA 2RAUA 1K2WA 2P5TB 1H3FA 2C8KA 2PU5A 2ZJ3A 3CF0A 5HKAA 5KC9A 2VJMA 4XA8A 1QIMA 3NORA 3TOVA 3UJ3X 3QY9A 1P1HA 1PJZA 1QVZA 2NV0A 1CUFA 2PLRA 2R1TA 3GWZA 4YVFA 3RSOA 5C51B 1BCSB 3B6EA 1Z15A 5L40A 5HF6A 1H9CA 4PS0A 1UBUS 3E3AA 3IVGA 1YJ8A 3NHKA 3G59A 3KVOA 3R0QA 5F51A 3SZGA 3TQHA 2AUMA 3QKSB 4R9VA 5FI3A 3RS0A 5I4KA 3C8ZA 3UPUA 1TJ4A 2AQHA 1SXJB 2Y0PA 5CIYA 2WF7A 4HNVA 3Q85A 5EXXA 1XNQB 3EISA 4NQRA 3F71A 1TRHA 1WAMA 4TWAA 5HBRA 4W5OA 1E6UA 2JW5A 1QRTA 5FLXA 4PAWA 4N6OA 1L4UA 3ZE0B 1K7CA 2W93A 3KQWA 5G1PA 3NG1A 2WTUA 4LBWA 4AKHA 2B8WA 1UMBB 2FWIA 3CLVA 4GQAA 4DMGA 5IN4A 3R3JA 1O6ZA 2JGNA 1Z8HA 3CE6A 4CZ2A 5CB8A 4QNRA 1Z35A 3ZE2B 2YNMA 3HA5A 3JU3A 4KR6A 3DMDA 2CT8A 1G9TA 3ETLA 4HH1A 1GGFA 1MOQA 1SVMA 3OIYA 2IIPA 9ABPA 4DANA 2B98A 1P39A 4HGPA 3KETA 3I6YA 3K05A 2L0XA 1NOIA 3HFGA 4PONA 1VE3A 1OVGA 4MR9A 1G64A 1YS7A 1D2NA 2G0TA 2IIBA 1SU4A 4K28A 3C74A 4ROSA 2NTYC 2OO7A 3TZHA 5JSZA 3B3GA 3PEVA 4OB8A 4IG9A 3FYHA 1NNI1 1Y3HA 2BM8A 2WM8A 4Z6KA 3WWDA 4FGUA 4LXYA 1RWXA 3H8VA 3L01A 4L8LA 4KMOA 4LQ4A 4MB2A 2PV7A 5DIFA 1IPHA 1TU3A 5ISMA 3SXUA 2DPHA 1DCMA 4QELA 3UB2A 5BSHA 4UD6A 1VOTA 3DOCA 1L5WA 1OIVA 4LZZA 4U5QA 5KHAA 8OHMA 4ETIA 2PR7A 1O97C 3HCBA 1T24A 1E2BA 3MC1A 1FYVA 1JZSA 2AKAB 2RHWA 1O95D 4F46A 4YAJA 2PCJA 4JBHA 5TC4A 3KWJA 2BLLA 4L76A 4H6XA 3S5UA 4Y7DA 3EMBA 1AVTA 3HVIA 5LQCA 2EKBA 3GL9A 1JJAA 1ZEMA 2OTCA 2Q1UA 5AW9A 3BAFA 4ZV9A 2II6A 1FFXA 2ZRIA 2ZJYA 3L7AA 3BERA 5KVQA 4IDHA 3BHNA 4AJLA 3DKPA 1C9DB 3N2NA 4UXJA 3EXG2 3PE6A 4BJ3A 2CHVA 1TK2A 1KXJA 2R6JA 3KR9A 2XDAA 1RI2A 1EZZA 5A9SA 1Y33E 3WZ2A 3CUYA 2CMDA 3SLGA 2ZBGA 4B43A 3ONNA 3Q3CA 4FONA 1HMYA 1V4NA 1ZICA 2C9CA 2H1CA 2YYZA 1C50A 1US8A 1GUZA 4IQGA 3WLFA 4KNYA 3FCYA 4JQZA 4L5CA 4V1CI 4F3TA 3B82A 4R1NA 3IAM1 1GQSA 3KPJA 3OSZA 2WHPB 3C24A 2WVJA 1FP4B 4M53A 1GGHA 4V0LA 4MV5A 3SAJA 3KQLA 3QBTA 2PNJA 3V4PB 2K7ZA 1N2CE 1CQZA 4ZRDA 3UCEA 5F2NA 5F3WB 4LZPA 5DHSA 1EA5A 4MB0A 2AOUA 2WSSD 2XUAA 4NBRA 1WEHA 2B83A 4EUSA 2RH4A 4P4UA 5BW6B 2NU7B 1VKJA 5LQSA 4BJ6A 3R9KA 2C42A 3GPIA 2VHUA 2XNCA 1DT5A 4G8BA 1ZGGA 3PS9A 5EPUA 1HKUA 4BO1A 3DBRA 1U0JA 4K2AA 3FPAA 4JBIA 5IUKC 3IULA 2Q5IA 4IRMA 5CBKA 4LX8A 4PLPA 4ZIRA 3H8SA 5KYNA 2VP3A 1OBFO 3CT4A 3IXQA 1ZJYA 4XIGS 2TECE 2J0EA 1LVUA 1JALA 1YNOA 1VMIA 3WL8A 1RE0A 3FVVA 1VXOA 1Q0RA 4J1SA 4QG3A 2N1BA 1C80A 3SQWA 1KR2A 2CY0A 1E2MA 1R6XA 3VNRA 2YMPA 2Z9DA 1QPBA 1XLVA 4AKSA 4US2R 3F3YA 1D1PA 1DJPA 3AQIA 3LC7O 4R1TA 1M1XB 4E3ZA 4MTCA 1G63A 1USWA 2X6TA 5LPNA 3W6UA 3CB2A 3EMVA 2XVMA 1EE1A 4DLRA 1PIWA 2R751 1NR7A 3A2MA 2FE4A 3OZFA 3QWHA 3UJHA 3R6WA 4BMPB 2YHSA 2O1SA 2EKZA 1Y4ZA 4BMOB 2CHFA 3N8GA 3QPBA 3W5JA 1YR7A 4UM8B 1FX1A 1OTYA 2FQXA 2AVNA 1BKSB 2ENUA 2P69A 1MB9A 1NXPA 3DHVA 3P9KA 4QYWA 5HF8A 2JD1A 1Y81A 3E3MA 4KOAA 2G08A 3TBHA 2A1IA 1ILWA 1C1DA 4DJAA 1D6NA 1XK6A 4ZGBA 2CD7A 1EVIA 2YMLA 3CLSC 3ZHZA 1T4GA 4MQLA 1R0ZA 1IXZA 3E9YA 1CJCA 2CK3A 3ZQUA 4EHJA 3H3XA 2WIFA 1ZX1A 4GKKB 1P0QA 2NVOA 2OOKA 2P1RA 3ZUPA 3PFIA 2Q6VA 1ZM9A 1Q74A 2ZIUB 3I9V1 1G5FA 1IRXA 2B0CA 2IP1A 3D3WA 3JWPA 2GPYA 1TU0A 3GT3A 3RU7A 2DHEA 1Y7TA 3L84A 1TJ5A 5B3AA 1EUCA 2ACEA 2GBFA 3FSRA 2UUOA 3HQ4O 4OMCA 3GLFE 1E0AA 1UXKA 3AESA 4BZQA 1T5IA 3EFHA 1CUYA 2HK8A 1XRPA 3GNSA 4XIYA 3TDNA 4C5AA 1E5QA 1Z5PA 5BWCA 1CQJA 2XUIA 4GKBA 2Y1EA 5ES4B 3GDGA 4GOKA 3NOOA 4I5IA 2X7HA 3KUDA 2WJHA 3ETDA 3PC4A 3WKEA 3WWPA 4E21A 1GUFA 3RD5A 3TZBA 3KDPA 3S44A 1UWVA 4DQDA 1X7WB 3P9YA 2RHJA 3PEFA 4HYYA 4TV8A 3MTBA 3OCJA 4I55F 2O2XA 3KKNA 4JI1B 1NYRA 4QDUA 5JS8A 2DBQA 4RL6A 1JLMA 2AMVA 3BWDD 4L5YA 4MW7A 3T0GA 3S8EA 4O4LB 5G02A 2ZAYA 3I9OA 3ZCVA 4C06A 4B6QA 1H3EA 3ZVLA 2WU4A 4HLUC 5AVUA 2B1JA 3GRAA 6PFKA 4NONA 2D7CA 1M1NA 1CJVC 3QOWA 1XNRB 2G25A 1X8LA 2IKSA 3HCWA 1SBHA 2GK6A 3LRXA 3WRYA 3WQHA 4C08A 4DUGA 2DEUA 3R5JA 4EEXA 4MS1B 1YVRA 5EC8A 2C2GA 4EVQA 1YKFA 1Q3HA 2B34A 4TSFA 1VP9A 2N75A 2P2LA 4ZMBA 3M3PA 5AWFC 3URMA 4R7TA 3BL5A 4PZCA 4YGYA 2ZPAA 3EPRA 4HB4A 3FGOA 3RROA 2I4LA 4ARBA 2HK9A 1BFKA 1IOWA 3DUWA 1NA5A 4UM5A 1JEQB 1NMZA 3LA8A 4N3AA 3T35A 3RGWS 5DBIA 1ZSVA 2VKTA 3EQ2A 2XKKA 2PS1A 3PVSA 1LLQA 5H0IA 3TTYA 3PDJA 1V35A 4OXRA 3DPUA 2W8ZA 1XVLA 2I71A 1NMSA 2VC2B 5CLHA 2EP8A 2VO1A 1A5BB 3GFFA 5KSWB 5AK3A 4B71A 3HFSA 4K5QA 4B46A 1NFRA 4CNQA 1AO0A 5CP8A 1IBLB 1MRZA 2C7VA 2FNAA 1QDLB 5KYXA 5JDCA 2ZVDA 3LGXA 4RHFA 1W5TA 3OX3A 3WG9A 2VHWA 1UKCA 1X39A 3OZTA 3E23A 3AEXA 2JAQA 3DNFA 4J07A 4I50A 4KN8A 5K0NA 3TDKA 4DLPA 4Y9TA 1K4MA 5AVTA 1ZK4A 2B2CA 3JYLA 4UTOA 3RSHA 3ZCRA 1NUSA 2O50A 5DSZA 3T95A 1LRKA 3G6WA 4DA6A 1L5SA 4FFSA 1IZ8A 2E9SA 2OMEA 4DLUA 2R6GA 1XZFA 2VDMB 5DYGA 4ZOAA 1GNLA 3F5MA 1SUBA 4N5LA 2P35A 4KE7A 1E0JA 1PQYA 2C3UA 1YRYE 2QAGC 4S12A 1GPAA 1P6QA 2GVNA 3KQNA 2W2XA 2C0QA 1HFJA 1Y3BE 3LIPA 4U4AA 2AQKA 2XTAA 3FAKA 3HDQA 3JALB 2XUQA 3QMWA 4J7XA 3WKAA 1XQYA 4M6WA 5CGZA 3L18A 1YUNA 1BE6A 1FYXA 4Q4JA 3DM5A 4WT7A 1HLFA 1FF9A 4E5SA 3HJRA 4L6CA 4UBJA 4F21A 2QXYA 3VR0A 1R6UA 1G2IA 1I1OA 1V8DA 2AWOA 2BMWA 3BE6A 4NNJA 4HEHA 4UAUA 7AT1A 1MGPA 2Y4OA 3LO8A 4S3MA 2WMNB 1LY1A 1SZDA 1NPDA 3BDVA 4FKMA 4X60A 3PGMA 4NATA 3O8DA 3PT5A 3NWJA 3KWMA 5EHNA 3L8CA 1ZJ4A 3VZCA 2O8DA 5J4KA 2O2JA 2QP4A 5AKGA 4GRAA 3EH1A 1SOUA 3GPDG 1DIBA 3WOVA 1UBEA 4BO4A 3K4HA 4B9EA 4BGEA 5REQB 1PX0A 2B6HA 4CLEA 2WWYA 1GGKA 2M98A 1F2UA 4UNIA 2L17A 2NZVG 5DX8A 2A88A 2DWUA 4EYOA 2OKGA 3M4JA 4ARAA 3AYZB 3BIOA 5ALNA 5JCJA 2GB4A 1JFFA 1JTEA 2DY0A 5HMLA 2RB4A 1XL0A 1RP7A 3E81A 3WL4A 1B8NA 2YYAA 2CFIA 1GDDA 4OKSA 3LI2A 5C9ZA 2IDZA 2CBZA 5HMMA 3KP1A 4LRWA 1P9NA 3L0DA 4CEJA 3WGUA 2FFQA 5AW6A 1REQB 1TOAA 4N7MA 1E8MA 4H6VA 3Q7PA 5B37A 4OV6B 4P84A 3AUAA 1UZLA 2WT8A 1JEJA 3QQ5A 1VG0B 1D2AA 1A9QA 3LHFA 2QZ4A 3UJCA 4KYTA 1ND6A 1AIPA 2UKDA 2ZYSA 2RKBA 2ZR8A 1C8VB 4U7FA 2AOVA 3MOSA 1MG5A 3CR7A 3LCUA 3GJ3A 1QR6A 2PX8A 3K8ZA 3LT4A 4HXFB 4EPWA 3CVWA 2JCSA 2D5IA 3MFQA 4YV0A 3OIVA 3R6TA 4JXJA 3EAGA 3EFOB 5JSQA 5K0JA 2NO1A 1A8PA 1KMQA 5CEEA 1VYUA 1W8DA 2PS0A 3K53A 4GNKA 2OPBA 3SLRA 1A4XA 1LD3A 2YMQA 4IMIB 4DIDA 2LZ0A 4EHFA 3TQTA 1KSJA 3KXLA 5FF9A 4FS3A 1YTUA 2A14A 2W6NA 4BNVA 3QZUA 3UBTA 1L5RA 3I05A 3WL3A 3AB3A 3BWYA 1BD3A 5DK4A 3FDZB 1YI8A 3LFUA 3KOYA 2H3EA 1TU4A 3NJRA 5B53A 3MGAA 4B34A 3R9XB 4BZZA 3QMVA 4D9FA 3BL6A 1TCUA 5ERYA 4NBWA 1P5ZB 4RGBA 3S0JA 3F2VA 1ZH6A 1PJLA 2ZJ6A 3DQZA 4ZDIA 1QMGA 4JAVC 4F4JA 3ZHBA 1CRWG 4L2IA 2JD0A 3IJ5A 2ZJFA 4CDMA 1A95A 2OQRA 4OJKA 5I3CA 5CPFA 1VLQA 1Z28A 1YZYA 1C3JA 2QL7A 5C1DA 4E2WA 1TVEA 3QW4B 3EQ8A 3TXYA 4AMUA 2I9PA 2PSJA 1FBNA 1QGOA 3DMTA 3EVEA 1W19A 4LV6A 4PLZA 4WADA 3X2FA 5B6JA 2CNDA 4ZZ1A 5K0SA 4Q3AA 2G1PA 1V5IA 3WIEA 3ZQKA 4XASA 2XMDA 5I9MA 2JLXA 3KPVA 3VPFA 1M34B 1PSDA 2P2ZA 3G23A 1CFJA 3D4IA 3JZMA 4BVJA 3GLTA 3GGGA 4OG2A 4HWTA 4LS3A 4NYIQ 2V7GA 1ZGJA 2ST1A 4KSYA 3CRVA 4AZ0B 4L6IA 1GSAA 1RPJA 2OFFA 1FFCA 2VRCD 3S2FA 5LWQA 2JG3A 4RO0A 2GBLA 3NHFA 3ZV7A 4R2MA 3GROA 1N6HA 2Y2UA 1KIFA 1ZS9A 3KYBA 5TQ2B 3GWGA 4WNAA 4ZO4A 1QVVA 2E82A 2RJ3A 1HOTA 4HZIA 3U48A 4RANA 1MC8A 3HJAA 4EQ6B 4WNYA 5AM4A 3TMYA 1U0GA 3COPA 3H19A 3LT5A 5I4BA 2FZWA 3U4QB 4UNPA 1ULTA 2XTZA 1IY9A 4PGMA 4U2CA 3I58A 3FBGA 3OE5A 3C5CA 5MGNA 2PUDA 1OCEA 3GLUA 3SZUA 4BNKA 3QLJA 4NS1A 4CKEA 5ILOA 1YRLA 2GHRA 2QL9A 3F1KA 3CXUA 3CEPB 3HVKA 4NDNE 4BZWA 4OBEA 2XLBA 3UJBA 4W63A 4P53A 1N5DA 3P9QA 3KOOA 2ECQA 2XSZA 2FAXA 3NTVA 2O2GA 3YASA 4B7UA 2AKEA 2HK6A 4QGBA 5KHOC 3HLYA 5IJ9B 1VDZA 3IT2A 4EBFA 4RDCA 2K5UA 4MA4A 2P4UA 3Q7IA 1E3SA 4DJJA 1G9SA 4OP3A 3GPCA 4R54A 1QG2A 1EXVA 2JKZA 2OOSA 3C1AA 4MAMA 2ATXA 5AW5A 5ABPA 2IZ0A 4RGYA 3MT0A 4IZIA 1W0JA 2IYXA 3X2SA 3LXXA 3OD5A 4XYMA 1JEEA 1GQFA 5A0TA 2MHCA 1MB4A 1P91A 4PQEA 1R1DA 1MO3A 2JEYA 4BQQA 4I1UA 1YR8A 2DWCA 1E3JA 4FFVA 3LCMA 3VVLA 3ZZTA 3G17A 5GP1A 2RGAA 4DLZA 4W9NC 1U98A 3H6GA 1CUVA 1Y9JA 4L0QA 1S8OA 4Q3EA 2RDMA 3AEZA 3AR5A 2ODAA 2V4ZA 2ZU0C 3PNBA 4OI2A 1T35A 1Q1NA 2BL4A 4WXMA 3WIDA 3VHQA 3QVTA 2GZDA 4HAVA 3IEVA 1D7AA 3PKJA 3QBDA 3VPBA 1YQUA 3EQ7A 4NOLA 1V45E 1PSWA 2XUGA 3QNUA 3WNDA 2P4EA 1WMEA 2ECPA 2JGDB 1CG6A 1U3UA 3QE3A 3R5KA 3RBAA 1J8QA 1XP8A 1E1QA 1MA0A 4Q4HA 2ZWAA 2BZSA 1YJBA 2X5KO 3WYBA 1K89A 1XELA 3EF3A 4IR7A 4D3YA 5AK0A 3M1YA 4W1SA 1FYDA 3O2QB 3DLCA 4QGAA 1FDOA 2HXGA 4G0MA 4RPIA 2G5CA 2GCOB 4Q01A 1U8XX 1GAQA 2Z1NA 3F98A 1ZA1A 2O54A 5HRUA 4D8WA 3T1OA 4JP2A 1LJ8A 4ER0A 2R87A 4ZI3A 3IT0A 1W36D 4EPRA 3TTUA 2WM9B 3O95A 2Q6IA 5A4DA 1W75A 2WWHA 1AK2A 2J0UB 2PRIA 3HWX1 1B93A 5HJ2A 4QARA 2F8SA 4TGLA 1EG2A 1YS2X 2D3WA 4TKMA 3F8SA 2WIBA 4HNGA 1QS0A 2GAAA 3EC1A 3DMRA 4XPZA 4KX5A 3PJDA 2RC6A 1MH1A 4EJMA 1NBEA 1I51A 2XCQA 2IEAA 1V9SA 2QPAA 5B2ZA 4JUBA 4NAVA 1PFGA 4Z0PA 2O0MA 3RYFA 3GLGB 2OHJA 3RTAA 5TLSA 1CJUC 5ECGC 5I9BA 1G0OA 3GIWA 2CN1A 1ZIDA 2QP3A 2SHKA 1JQBA 4Y2GA 5I7OA 4B3SB 1UXOA 3ANMA 3R77A 5AVOA 3Q12A 2QMEA 5M2QA 1VE1A 4KO2S 4XGQA 2VAVA 3MT9A 3PJFA 3V4ZA 3C6YA 4DNQA 1COWD 4TLAA 2WT4A 5DGXA 3RSFA 5BR8B 5E0KB 1A9XB 1DLJA 2CGEA 3C6KA 1AGYA 2Q6KA 3M0EA 2RJOA 4HQOA 1J06A 3NHRA 3TE6A 4C29A 1N34B 4LF7B 2VTBB 4B8YA 1PGPA 1T1IA 1ECGA 4CMJA 3G2QA 3ROXA 2DG2A 3H1BA 3I92A 3TLMA 4CGYA 3C3DA 1A76A 1SEVA 1VKRA 3EZ9A 4FN4A 4LDNA 3TDMA 4OAQA 4Q48A 1FJGB 3GJQA 4A91A 2LIVA 2YWXA 5CM8B 1WXDA 1UC9A 2WF6A 2FEKA 2EP7A 3CINA 3SYLA 5FOQA 4W7HA 4ND8B 3AM3A 4WUVA 4CF5A 1WLYA 2Q8NA 4J4BA 1NQUA 2ZK7A 3ENWA 3JAKB 1CIPA 1W0CA 1NWCA 2WMYA 3ICWA 3W6ZA 4KE6A 4WEOA 1EEHA 2BELA 1UDBA 3I01M 2CHQA 2FGKA 3HO8A 3PQFA 4GKAA 1QH1A 2PXXA 3T4XA 4FHZA 1E2IA 2W6ZA 3A6JA 4CWAA 2J67A 4BVBA 1Y37A 1E6WA 3G85A 3PQ3A 4REQB 4B33A 4ZOCA 3OEWA 1AB6A 1WZCA 3AMVA 4Q34A 3VOTA 4E5DA 2PJRA 5KYYA 3EVFA 4R9UC 4XIJA 3BGSA 3H75A 5A3VA 1P2BA 4X7MA 2XWPA 1SJ9A 3S2IA 1NZJA 2ZTHA 2I1QA 2BGNA 4QO7A 1L6IA 1TJ3A 1XLWA 3DLPX 3G5LA 1YZ3A 3BMNA 3OOHA 3USES 1DEXA 2B25A 1OFUX 4YDSA 1AGNA 2WWTA 3VA7A 5IRCD 2JFPA 4URUR 2R1ZA 4BWFB 4AJHA 1XJQA 3AI1A 5EINA 1AKNA 1CYDA 4BUZA 4HVCA 1BJTA 1L7MA 1SA0B 2PY6A 3ETJA 2AG0A 2QEQA 2WDPA 1KO8A 4KQKA 4M1QA 1Y9DA 4IWYA 3ZWNA 3FRIA 1M6HA 2JZCA 5SYNA 3PHLA 2W2KB 4HN2A 5CUQA 4F12A 4ZCRA 1FL9A 1QVAA 1RXSA 3IUYA 3SDSA 4PC2A 4GHWA 1QUEA 1DBRA 4Z9FA 4KXQA 4WXHA 2BAGA 4AZSA 1I33A 1LTQA 5GGYA 4BX2A 5KQGA 4AF7A 2BEVA 2WHXA 5DGHA 3NYIA 2NUTA 1PT5A 1W87A 3ZDAA 1FLAA 5IFKA 4QPJC 1OLOA 3AT1A 1Q1QA 2AV6A 2P7IA 1RZ3A 2D00A 3VBEA 5DMXA 4E1BA 4ZT2A 1G4HA 1EA7A 3HKCA 2WT9A 3TH5A 1NV9A 4QQ8A 1ORTA 4ZZ2A 3WTBA 2Q9CA 4DZRA 5B55A 4JI0B 3P9RA 4CMCA 1I1HA 5KDOA 2XVAA 4JT2A 3U17A 5L53A 4I55B 3U7IA 1R4AA 2VG8A 4ZO9A 4ALJA 3EARA 4R2HA 1L4HA 5A3QA 1NVEA 2H11A 4K0RA 4RGVA 5AHKA 3W6OA 1ZLXA 1JSXA 1AUPA 3U3KA 1CB0A 1WZNA 3BJRA 3LOQA 4Z4HA 1MJGA 1TF7A 2AFHA 3FJ1A 3P97A 4GMGA 4RF3A 4MZXA 1YQWA 1C30B 1DDIA 1P1IA 2GFHA 2Q46A 2QN7A 4GGMX 4HNHA 4RPLA 4UHBA 1E60A 1I7NA 2YZMA 5ICFA 3T6KA 1IJFA 4IEFB 2HH9A 3DV2A 3WP1B 3KTAA 3O83A 4MGEA 1JHVA 1T8YA 2O0HA 4RZUA 3H11A 4K9MA 3DULA 3RM3A 7GPBA 3HSSA 2XI4A 5J3JA 1E0DA 4OBBA 3FPEA 4LJKA 2DLDA 3T9EA 4LUCA 1F20A 1SCIA 1T9ZA 2C3OA 2R85A 4IDDA 1NUUA 5IZCC 5A6SA 1STOA 4DLYA 4B76A 3W8RA 2KWIA 1BKYA 2PX0A 2ZIWB 4PC7A 4V2IA 3UW3A 2V0CA 1PFQA 1U3CA 2PUFA 4TZ6A 1UBHS 2ZYVX 5L6LB 1GFZA 4MYRA 3B20A 3EHDA 4HLUA 3ZXIA 1MTZA 3BIWA 1K4KA 1E4YA 1XRSB 3EDCA 4D56A 4I4IA 1U6KA 1T4CB 1U04A 3VMFA 3RQSA 3MT7A 1NATA 1LLDA 2UZ1B 5AJUA 2SCUB 1FU4A 3CCBA 3O73A 3FNRA 2ATVA 1GRRA 3I6IA 4LBYA 5AD1A 3BT7A 1TM1E 1TLTA 1LI4A 1SKBA 2P11A 1P75A 2ID7A 2WILA 1N6IA 2QUZA 4KAJA 2FMTA 2QSZA 3FJOA 1MNAA 2XD4A 1XCBA 1T0IA 2X13A 4H7JA 4PC6A 1HQKA 4KWHA 3HUFA 3GGSA 4TM7A 4NSNA 1IBKB 4NMHA 3LS2A 2H06A 1KK1A 1LX6A 2CYAA 5B6IA 3L7CA 1NKVA 3IDFA 1K7YA 3WHLA 4EK9A 3TNJA 1X14A 2I4MA 1JLKA 2BDTA 3TZQA 4LOIA 1A9TA 1KIAA 2CXTA 5F77A 1L7PA 3U1VA 3HJFA 2AFIB 1H1DA 1UBSB 2VDUE 1RM3A 3F2IA 4I9GA 3AZOA 4DDWA 1NULA 3KHUA 1HWYA 3I6QA 1JFSA 1JMVA 2JKVA 4UUAA 1XD2B 5KHLB 4IJWA 4W99A 3VISA 2XXJA 4F9EA 2JGEA 3DMNA 2AEEA 1JTFA 3W2TA 1PYOA 2F3RA 5BV1A 3TQQA 4G84A 3QFFA 1V39A 1XMPA 2J48A 2PJDA 3N3AC 4LJ8A 4ENUA 5FEUA 5JH7A 4D43A 2RGRA 1AKQA 5EJAA 1XQXA 4RXTA 1UEIA 3QOXA 4B48A 1ZN7A 3A3KA 5GM1A 4EELA 2QAGA 4E51A 5DNUA 2RGDA 3TSZA 2X2EA 3Q41A 5LYJF 1YCFA 2PPLA 4QFMA 3WB1A 1Y8RB 2A1TR 2PNFA 2HCTA 3RVMA 4H6WA 4R1SA 2GD1O 5C0OE 4AC9A 2ODWA 4JSYA 2DUJA 4JLJA 2DBZA 2YIVX 5HKBA 1NT2A 1Z75A 1JBQA 1JDTA 4OA8A 2HMSA 3VVCA 2AGVA 2NMVA 1QCZA 3VSCA 3HKBB 3ESXA 3LIIA 2G80A 3BJZA 3GYBA 3BFJA 5JO9A 4K6CA 3SSMA 3TEFA 1JSZA 2YBDA 1J4AA 1J2EA 1KY5A 2NO7A 2WFZA 3GDHA 3RAPR 2FPGA 3T06B 4DPMA 3KHTA 5ANRB 5KVVA 1TZCA 3PLRA 3OIDA 2EBHX 1GQRA 2HDWA 1LZLA 3IHWA 1SHUX 2X9QA 4EVRA 3GPLA 4JIGA 2VSFA 1LPBB 2DUWA 1C2YA 4JLKA 4A8JA 1QRSA 4LX0A 1KDZA 1G20A 1GPYA 1IG0A 4HQRA 4B2IA 4F45A 1JR3A 2PLNA 3CA8A 3GNLA 4GYJA 1IDOA 3KQKA 2YIMA 5D3MB 3TLEA 3QJ5A 5J4HA 1KP9A 2B36A 4RABA 1G1MA 2OAEA 3FBTA 5ILGA 1ETHA 4CFYA 1J5EB 5AKJA 1KHTA 2QQGA 2YZ7A 3K2EA 4UDNA 4W8HA 3GV0A 3OZ7A 3I2JA 4MRMB 1V7CA 1WJGA 3MTAA 2QRVB 4GLBA 1NJ1A 1EP1B 1T2NA 2J32A 2NXWA 4LYJA 3VH2A 3VQTA 5DNAA 2GPBA 4KO3S 4P2GA 1Z18A 1MO6A 1RXUA 1JJFA 4S2EA 1YS4A 5B7QA 3ACCA 3VR4A 3Q0IA 2K4MA 4DQKA 4KFSA 2Z8YA 2GOYA 1EBBA 4NYIR 3AJ8A 3RRYA 1NC3A 3IAXA 1P2TA 2JZOA 4OQDA 4O29A 3V7FA 4I1SA 3CX4A 4TSFD 3K0EA 5F52A 4PW0A 3M89A 4RJTA 3N9IA 1CZUA 1PYGA 4U0KA 3O93A 221PA 2GHTA 1NURA 1EIZA 3DAFA 3KB6A 4EW1A 1TA9A 1U0OC 4Q1DA 3W79A 2C2YA 2AD1A 3VU9A 2AF4C 4AECA 4ZHSA 2BFCB 1Z0JA 2WE7A 3MINB 5A4MS 2ZPTX 5AJVB 3OM1A 2EF1A 1YR3A 1KF0A 4YRAA 3NIWA 3KYCB 3RFCA 5TNXA 3EW7A 4WBSA 4K3UA 3WDMA 1CHNA 1JKXA 3NXKA 4IX1A 4YHHB 4P8RA 4OREX 5PNTA 2O19A 3E4CA 2GLXA 3EPKA 3CTPA 1E9AA 1L7VC 4DREA 3B1WA 5EIWA 4O0LA 1E2NA 2GM4A 3QUAA 4WGFA 2QRLA 3IAEA 3NU1A 2MT9A 2Q3DA 5TRTA 3RB8A 1DAHA 3NWBA 3U16A 3BJIC 2A57A 3B6JA 4L8GA 3JZAA 1D2GA 3PWTA 4RD4A 5SYMA 3RSSA 5B4TA 1RZRA 4HLCA 4M38A 1GPJA 1XZLA 2ESRA 2X8BA 521PA 5CYOA 4ZDJA 4D9GA 5A7HA 3GEPA 2UUBB 3ABOB 2IGTA 4XCXA 1BMTA 1V1JA 1VIDA 1YGYA 3U4HA 3LY8A 3TECE 1G8JA 3KQHA 3KQQA 1Q50A 2OG2A 5K8LA 4DRXA 4UNRA 1XQWA 3ASUA 1M6VB 5KNBA 2XNDA 1Y8CA 2XUHA 1XZPA 3VKUA 1DX4A 2D7DA 4ZC1A 3NW9A 3OTHA 1Z0ZA 4DQXA 3WK5A 3RS2A 2HZBA 1I8TA 1QGZA 5E6RA 5AI5A 3RADC 4GBMA 2HWUA 1KQNA 1S2LA 4BQNA 3GW8A 4TVKA 3SQDA 4LA4A 4KDFA 1KYIA 5DHAA 2ZS9A 4GVLA 1C8LA 3IQEA 1BXZA 3FFXA 3GCWA 3UEOA 3CM0A 1T10A 4P98A 5CH3A 4HN9A 1HYQA 4OJQA 5AOAA 2QUJA 2ZBFA 2VTEA 3O75A 4E94A 2G0NA 4EHNA 5MN5A 1WBDA 2Y1KA 3TZKA 1FA9A 2F9MA 5HZHA 3WK7A 3V8VA 4M4SA 2Z2KA 1G8SA 1KQOA 4GPEA 1HXHA 1J1UA 2INGX 2BI4A 3OMXA 4QOHA 3AF4A 2FPIB 1K7FB 5ETJA 3T9BA 5JAHA 4TWZA 2AQIA 3AY3A 5HG0A 3SHFA 1AQJA 2QT0A 4H18A 2JIPA 1QKJA 4YALA 2FLVA 2QJRA 3D59A 1XTKA 3IA7A 4MPRA 5KMGB 3FTFA 2CLCX 4RJJA 2VSQA 3ZWVA 2TMKA 3V8MA 4G0QA 2PRSA 2WQ7A 5C5IA 1YFLA 1HYHA 2JK0A 2PO7A 1NG9A 3M6IA 1M6YA 1E5XA 3EGDB 5FTMA 3DHEA 4Y9SA 3TB6A 5CA1A 3L6BA 5BN5B 5LJIA 4TZ0A 3FPBA 1PWZA 1SM4A 1XHLA 5T8KC 1QFYA 2HKIA 2WAXA 3WK9A 4K26A 1WZIA 3KXDA 4HK4A 4EB3A 5IXSA 3PLNA 4BO3A 1MTOA 1SXJC 2NUPA 1MHTA 3OCWA 4YRLA 1JE1A 2CMHA 4CU5A 4RIEA 4DPLA 3OQNA 2Q0HA 4O4JF 1MAAA 1PHPA 1Q7EA 3B2NA 4HDOB 4Q24A 2SNIE 4TL9A 1NW5A 4OJMX 4BTVA 3OBBA 4EM6A 3KYDA 4B81A 2ZRKA 1U8FO 2O0KA 2VPWA 1DRVA 4BEWA 3BD8A 3BQ9A 2C2WA 3C8MA 3OD1A 3AUKA 2O3SA 4Q9NA 4UMFA 3VR6H 1SK9A 1XDUA 4F9FA 3EZGA 1XA0A 3PDIB 1XZ8A 1ZNQO 4MMYB 4W9NA 1UKEA 2XH8A 1DKRA 2VP0A 1GCIA 2YDYA 3QJGA 3QPWA 4MKIA 4NU0A 5C7LO 5JSUA 4M1MA 4RTOA 3NKVA 4JVOA 3TOCA 4ARZB 5ARBA 4Q7LA 2MYPA 3ZJUA 3PFKA 4FDLA 2IL1A 1E77A 1L0BA 5C35A 4RIIA 1P60A 1SO8A 2AN4A 5C4IA 3RV3A 4DV3B 2EAUA 1NZDA 5H68A 4A8HA 4HT3B 4ABTA 4D2IA 1UT5A 1CUHA 3NRJA 1OH7A 4QICA 3N7TA 1E4OA 421PA 3LLVA 3NPAA 4E1AA 1J5PA 5ER6A 5BOSB 2BTQA 2Z4SA 1V8OA 3GOQA 1ZOSA 3P2OA 2CLDX 3QEMB 2F8LA 4OO3A 5KNLA 2CLHB 4XX0B 4M9UA 2WAYA 3IH5A 1KEEA 4JELA 4HS4A 3O3MB 4HD8A 3EG9B 3RCBA 1NV8A 2DUMA 3BTSA 3NHJA 1Q7CA 3G7UA 1CEEA 3ADDA 1EXDA 2W6QA 2WUDA 4I9UA 1P3DA 2ZJ1A 4QYMA 3WGGA 4AMZA 1JYEA 4LZOA 1NUPA 4N0QA 3E0XA 3FHJA 2PGJA 3SZLA 1PR3A 3L1JA 4MB6A 2V4UA 3QOFA 2Q41A 4GX5A 5BQPA 5K8VA 2AJCA 1Z0UA 2CD9A 4HL6A 1Z5NA 2EL7A 2Q2NA 2QU8A 1NDHA 2G9QA 2WVHA 3CLHA 3FYCA 2XTJA 1ZL2A 3D3NA 5BSEA 5EUBA 3DLHA 2X2PA 1V6SA 2C04A 4P0PB 4EG3A 1JSCA 1KOGA 3EGXB 3H86A 1O6BA 2WA2A 3CZMA 5COBA 2XX3A 5JSYA 1T5OA 2JGAA 4WLOA 4GRIA 4WACA 1RI5A 3H2KA 1OFGA 1K5DA 4RFLA 3C4JA 5AM1A 2OCDA 1II8A 2QVZX 2AWNA 3RDPA 5C18A 3DBLB 1BFDA 2IEDA 1KO5A 2WRZA 1HDCA 4CBVA 3FPCA 4M55A 1QGAA 3QEOA 1C9MA 2NVUA 3FUXA 1E9EA 2F00A 2IUSA 1PJ8A 2YJ5A 3AJ9A 2YVAA 1T5LA 3GUYA 3MTQA 3ONFA 2WC1A 3DL7A 1BE1A 1DG1G 1Q19A 2EP5A 3GQBB 3PZRA 4M3NA 4PCUA 5D7BA 5DHRA 5EP1A 5LXTA 3HYSA 4DKJA 2VA8A 3BXHA 1MAWA 2QN6A 1PS9A 3AHGA 1BCRA 3WGTA 3ZDZB 4L5AA 3FOCA 3ZEAA 5HJEA 1SOVA 4TV9F 3HKEB 4WFQA 1HDXA 2C1EA 2WOJA 3EOBI 3SJUA 1C14A 3EZ2A 1B42A 2VOEA 4FHFA 3GFSA 4AQDA 5C8XA 1NF9A 3FFTA 5EI5A 1N5OX 3E5HA 4CF4A 1LU9A 5C2JB 3QG1A 3KK0A 1AZWA 1QOQB 1E1RD 3SHQA 4RKRA 4I66A 2V98A 4DIMA 1PVOA 5H8WA 2ID4A 4FJ2A 4RCYA 2H92A 1W0JD 2I6XA 5GY7A 3TSYA 1JFRA 4R83A 5JCOC 2J45A 2VUIB 2RJNA 4WDQA 3RC9A 1A4UA 1VHDA 4X66B 4UDOA 2O5EA 1A4IA 2L19A 2QYOA 4PGAA 2IODA 4DC1A 4P7JA 2Z4TA 2ZWVA 1JHMA 2ASVA 1LNZA 1T3LA 5FR2A 2D4HA 1XD9A 1NW7A 2XT0A 1N0UA 1VMKA 3L92A 2GN1A 3NHAA 4QJ4A 5BT9A 4BIMA 1NN3A 3GRZA 4YQZA 3D3QA 2BMFA 3S7ZA 2L18A 3P0EA 5ELMA 4F3NA 5AKIA 4BU1A 1PTJC 4RF2A 2AEMA 4X3OA 4RZHA 4OYRA 3BN3A 2P3QA 2AB0A 2QPLA 5DX0A 4M8KA 4AULA 1OAKA 4N0MA 2HPZA 3B52X 2WTXA 3FNQA 3GO4A 1SBYA 2Y1DA 1NLYA 4C7MA 1U6IA 4HNUA 5BSVA 3N53A 3OQVA 3EPHA 3KELA 4J91A 4UBIA 2FDCA 4NX2A 5DNWA 1QTQA 1L3IA 1U7OA 3EXEA 1RXVA 4DSAA 2AS0A 2EERA 4KYIB 4N1AA 1WRBA 5CT4A 3G13A 4DJEC 2XOKA 4YRSA 1ZGHA 4M8LA 3RVKA 2QLMA 2XGJA 3M4YA 2V6BA 3M9WA 5KVCA 3ZHYA 1ZMTA 1TRKA 3Q3JB 2GPNA 3BH7A 5DRTA 4CQJA 1K86A 3UJPA 2O5VA 2DQZA 3DEJA 1J2JA 2OGUA 3DWGA 3L1HA 3SIXA 5FPYA 5AHXA 3VYUB 4C2AA 3H84A 3L7BA 1Z4OA 1P3Y1 2OAQ1 4X20B 1FFWA 3DVAB 3L49A 4ZT6A 3CUTA 1PG5A 4PYOA 2PX6A 1JKFA 1OAAA 1TKCA 1W48A 4PXAA 4CKXA 5A0VA 3W2FA 3FB1A 3I2GA 3R3UA 3OZGA 1MIOA 1N5KA 2QR5A 5FUVA 1E79D 4YQEA 3GUVA 2B4RO 5TF4A 3ROZA 5J4LA 2GEJA 3O90A 3TIFA 5G2OA 2QV7A 4LHEA 2Z2JA 3FOBA 3QNWA 2Q7DA 3BHJA 1SC9A 1VLVA 4N7RA 4TT3D 2ODQA 4YWJA 4F38A 1KEVA 2NPFA 1KK3A 2PKQP 1ZA2A 2AXPA 1P1RA 2B94A 4YP6A 2DR2A 1G8AA 1GKLA 2BGMA 2B4YA 2DGDA 5I4CA 3EPPA 4DJ5X 2AFHE 5BP7A 4GNRA 2GXUA 3MAAC 2VHVA 2ZWMA 2XYHA 4FNMA 3ILSA 2ZZNA 3R0ZA 4CG1A 2GCGA 5HFNA 1MRNA 4ZAFA 5ESWA 4KE9A 3V5NA 1D9XA 1TW2A 2HA3A 2JGFA 3RH0A 5JNUA 5ALRA 4TTTS 1HDIA 4CQNA 5JWOA 4CTMA 3ZGYA 1IHOA 1THGA 1TZMA 2R7NA 3MUEA 4DIEA 1ABBA 1Z29A 1M2OA 5CGQB 4DMUB 4D46A 4JOBA 1OLUA 4TYPA 5JMTA 1I3OA 5YASA 2YHIA 1PWYE 3V1TC 2HW8A 2VOJA 3AG5A 1GZ5A 4W8GA 4DV2B 1WMFA 4I9NA 4KUHA 2O8BA 4ZQFA 4C14A 3ZEIA 1JIKA 3Q3GE 4WIAA 3PC6A 4G26A 4CM8B 4IL5A 4IGAA 1CZRA 1ZO8A 4CVNA 4EFKA 1VI6A 1UWCA 1JAIA 2YJTD 2WYIA 1R16A 1NLMA 1RFGE 3CU5A 3OKCA 1CK4A 4L22A 1CZNA 3BH0A 4XUDA 5EN4A 3L1IA 1DC4A 4NR0A 4ZQEA 3BG5A 4JP1A 2BH2A 3JYQA 2I54A 3CF4G 2OO5C 3RK0A 3C14C 4JA2A 16PKA 1SCBA 1F5SA 4IVPA 4KXNA 1PFYA 5KNDD 4OXXA 1WW8A 2W2OA 1RYEA 2VF5X 4GX2A 3FVWA 4O2AA 1Z56C 4BVEA 1U1EA 2PM8A 2EFCB 4JLVA 4CL3A 4GC9A 4WPGA 1VCOA 5FWXB 2WUGA 3MIZA 3IURA 4P5EA 1JKJA 1RJDA 3SF0A 3QPCA 3UJDA 4XVUA 2JH8A 3WLAA 5DCWA 2ZJBA 2R66A 1Y7IA 2EWVA 2P2SA 4M0FA 1RLIA 2OGWA 1O5OA 3D6MA 3ZQJA 4DXAA 3MLEA 3NGMA 3RC2A 1DRWA 2O3UA 3AM5A 2J0VA 1GTZA 3G2IA 3B1ZA 1PT8A 3U2QA 1FSFA 1ZI6A 2XT6A 4G8JA 4X71A 3WGJA 4PV7A 3X1JA 1MO5A 1QB8A 2GILA 4L4SA 5EMKA 1NJ2A 2Q6TA 2H4JA 4ZVLA 1QGED 3R7SA 3UYLA 3WGIA 3AVYA 5A9RA 4P4SA 3WQSB 2ZCJA 1V41E 2XF2A 1W25A 2NU9B 2XDQA 2WD7B 1C0IA 3FA2A 3JQDA 3H7IA 1EFCA 4RV4A 4U7TB 4M76B 2XUKA 1Z0FA 3OY2A 4F60A 4Y9RA 4N5MA 1CZHA 4EKGA 5IK2A 4C3OB 3NBUA 5HCUA 2AX3A 3AXSA 2NW6A 3ZCSA 1E59A 4QYIA 1NXVA 3DTVB 1YA8A 2GN8A 2H1FA 2XV1A 3C8DA 4FWBA 4O8ZA 4BN5A 4JUAA 4EF4A 4RDXA 4WFJA 1DIGA 4FM9A 1KAHA 4EJ2A 3V9PA 1ODCA 5DOVA 3U7HB 2J41A 3HCCA 3T3EA 1X9IA 4H7FA 3QXGA 3OZEA 1J6UA 2JFOA 4NCBA 3A6ZA 4P3NA 5BN4A 1NZFA 1B16A 2I2FA 1YCHA 1BTOA 4JJFA 3CSDA 1W2WB 2YYSA 3PHCA 4AAYA 3O8QA 3PF9A 3VU0A 4JBXA 2XUFA 1OA1A 1OFUA 2FPSA 1Q2UA 3JXEA 3RS8A 5ENVA 3FOEC 2QBYB 3FB4A 4G1EB 5E3HA 2PZBA 4LEIA 5KTNA 2LIPA 3FPJA 4I3GA 3TM4A 4D9EA 1DDGA 2AE2A 2FOLA 3BHIA 4F06A 4JYAB 3BK7A 5EKXA 2G3YA 1BHO1 4BYGA 4D97A 1JR3E 6REQA 5EJ5A 5CURA 1C1YA 3ND5A 3ENNA 3MS2A 3E27A 2C2KA 1K5GA 3QY0A 4B0OA 1W0KA 2O3RA 2PUBA 4Q1BA 2IEBA 4P4GA 3PKZA 2A9KA 4QRIA 2ONJA 3MHTA 4AIRA 3WLNA 4EQZA 4TX1A 4G41A 2IELA 1GCUA 4HB2A 1B26A 1XVIA 4Q16A 1HT2E 1WHSB 4RE6A 4AB1A 2PUAA 2BBSA 5IC5A 3RIXA 3K6KA 1Z3CA 4J2TA 4YO7A 3NO4A 2MYUA 4LHVA 2ZKIA 1U5CA 4TL7A 5F1OA 3T5CA 1QYDA 4YB8A 4D99A 2VQFB 5HF5A 1J33A 1V8ZA 1FDIA 4D42A 4MQEB 1RYYA 1SUWA 2AJ8A 4X63A 4UEWA 1P2SA 4N01A 4PQYA 3I5YA 2VJAA 3X3HA 1ZWLA 5JCZA 5JHHB 4JKYA 1EX7A 1XEWY 2DPYA 3D6NB 4I7EA 5EPEA 2UYYA 4FOOA 4IDQA 4DIBA 4KR0A 3HBNA 3H5TA 2Y8EA 5FUBA 1ADGA 2A9JA 2C1ZA 3V6MA 3FCCA 4JS0A 3FETA 2E5WA 4KN5A 3D7MA 4JI5B 1S7CA 1VL0A 3ZDQA 4LE1A 4CMAA 3GRUA 2AR7A 3JR7A 3K5PA 4TL8A 1LDGA 1VCIA 1N7HA 2ECFA 2O6LA 2WEKA 2CNBA 3M33A 3ZHVA 1Z4NA 1BU5A 2EFGA 4GMKA 3AP2A 5KVSA 1EB8A 1ZK0A 1O7JA 2Q27A 1S2GA 2YASA 5FNVA 1AUXA 1PRYA 4B75A 3F7TA 1ADBA 4E2FA 2FZ5A 2AMJA 4EL5A 1TC2A 2DH6A 4DQ0A 3CRZA 4GP7A 4WQMA 1EH5A 2VSOA 1XTJA 4JROA 1TT7A 4JZYA 1K5HA 3OQOA 1RWQA 3BRQA 4MRRA 2VP2A 1GUAA 1GPNA 1ZIYA 1E7QA 2B4QA 2OWEA 3G5AA 1GGNA 3MVEA 4P4NA 3RUHA 3U39A 4ZCQA 2G06A 1NVGA 3WO0A 3PNKA 4G6ZA 3H1FA 3QE4A 4DNPA 2ZIGA 3TOZA 3K0FB 1OX4B 3LQRA 4MXDA 4BMVA 4MGZR 4MPDA 3N0XA 1OH6A 4AFNA 4KPUA 5JPDA 3ABSB 4JLSA 1DJQA 3MCZA 4LY3A 3EVAA 2VZ9A 5H02A 3JQAA 2OAP1 4DA0A 4UTPA 5I48A 2GYUA 4NBLA 3A1FA 4B83A 4C2BA 1DRKA 4JLNA 1LSOA 1CZLA 5G0SA 3OICA 2O9JA 5FUMA 1JG7A 3N75A 4N47A 3TLXA 4JT9A 4IQ0A 4FOTA 1K6IA 1N5JA 3QRWA 2IDJA 2I4OA 4YLYA 1X1SA 4QBKA 5G40A 5G3YA 3B5EA 3TCKA 3AHJA 2HBYA 3WA7A 4KR2A 1RSZA 2ZB3A 4HZGA 5H80A 4G65A 4D82A 5K6AC 5M29A 2RCNA 1A71A 3PNLA 1AF4A 2I2WA 3VJKA 3KQMA 2I7VA 3ZK8A 1BH6A 2E4AA 1K0UA 1LDBA 3HB1A 4TTVA 4IWXA 1D4FA 3PXAA 5HIAA 4NOJA 1FQJA 3DO5A 4V1CA 2X0JA 4ID3A 4IKOA 1NVVR 2DHRA 1DBIA 4RTLA 2XNJA 4TZKA 4V24A 3LCJA 5FCDA 4DBVO 1S3IA 5BN1A 3UJAA 5BRAA 3AONB 1U3DA 3R3ZA 5EEHA 3Q9UA 2JLQA 3K5WA 1EINA 4IOKA 1SHLA 3LHDA 4FYVA 4ZAGA 3A14A 4YJ2F 4RDIA 1VHJA 1HG0A 1FP6A 1XK7A 2R00C 4FSDA 5JAIA 4RD0A 1NRIA 3NALA 5EIFA 3BAZA 2C00A 4O4JB 3GUHA 4CCYA 3F78A 4R8SA 1IEWA 5LM3A 3BEDA 2AI1A 3U0VA 5EJIA 3PLAE 2FXIA 2FN3A 2CL7X 3AVVA 5L7YA 1R0WA 1T2EA 4AP9A 4L27A 3LYUA 3O92A 1EWRA 4OHXA 1YB5A 1E61A 1WOMA 4NYMQ 4LCJA 3ZY6A 4DG5A 5IKPA 1OHHA 1QH8B 1BCSA 4V38A 4OH7A 2OCAA 1DUSA 1Q2XA 4FE7A 4NCXA 1BG6A 5T8KA 5H7XA 4EW2A 3SDZA 2C7QA 3JQGB 1VLZA 2OXCA 2FSUA 1SXJA 2XJ4A 2PKYX 2HREA 3C5HA 2ZRNA 3ZE7A 2P5YA 5HUJA 3C43A 2BEKA 3TLAA 4YPOA 1KPHA 4S1WA 4A1FA 1AKTA 4NY1A 4Q9HA 4UNNA 4HDKA 4HNRA 4P81A 3A4TA 3TLYA 3HVUA 4DCVA 2F1OA 4PVDA 3PR2B 3KAQA 4WECA 3WGNA 4PAGA 4YUAA 2PEZA 4K6FA 4PX9A 3OKFA 1OZFA 2MSCB 1MVNA 5C81A 4QM6A 2XCRB 4BO5A 3JQ7B 1Q7RA 1E9VA 2QNBA 3KUCA 4IUBS 2J7PA 1F0PA 3E2MA 2TYSB 4FBGA 4LSZA 4MIKA 4BLUA 4CTOA 3P45A 3PD0A 2Y05A 4M9XA 1YL5A 3EZNA 4TKVB 1SWWA 3O4GA 2Z2ZA 2A1UB 3AEUA 1L8QA 1W4BA 2VDOB 2DSNA 3BCHA 4IVRA 3AR8A 2VK2A 2BFEB 3TYXA 3KQUA 3B1KA 1BGXT 3VR5D 1IB0A 2ZR9A 3OEYA 3S27A 1L4KA 2G83A 1OAOC 2WPNA 3AHHA 4B35A 5K01A 3IAAA 5A5FA 3LY7A 4KHZA 4XWAA 1B0UA 3VR3A 2F4NA 1WKBA 1U9CA 4N7BA 2ORYA 4L15A 3MS7A 3HACA 3CW9A 3EIXA 2PVCA 3TQRA 3K16A 4YY3B 2ZB4A 3KQVA 4QOIA 1CUWA 3ILHA 4X93A 5E2IA 4G0OA 2V0GA 2BMVA 1NP7A 3N58A 2J3LA 4NFLA 4H0CA 1SKYB 3M3DA 4G5RA 1AHNA 2H7CA 2ZI5A 1FFBA 4M1OA 5EOVA 2PH5A 4PVCA 3QHPA 4FEGA 3RIGA 3WLSA 2BTOA 5JZVA 2I3BA 3K0KA 4XYGA 2DR3A 4ZCMA 3QWBA 1W7AA 4RVHA 1SBQA 2RGXA 3FGNA 1QU3A 2VTKA 3NHUA 4UPEA 4RAQA 4RFSB 3I23A 4GVPA 4P3OA 2C4NA 4A1OA 2A4KA 1PEAA 2AT1A 2J3IA 1N75A 3OQMA 4NPAA 4MVXA 1AM4D 4Q4DA 3RYHB 3COSA 3DL4A 2E4UA 2PUHA 2JA2A 1WLSA 1G8YA 3H97A 4N9QA 3WC4A 2O3TA 3LUPA 3IQXA 3H0EA 1G0NA 2WWGA 4TV9B 2WD8A 5A9TA 2PHZA 3V4LA 3OUTA 4ZD6A 1KRHA 2BE7A 3OJXA 4KV7A 4RS4A 1JIJA 2PZFA 2IYRA 4RZ3A 2PLFA 4EKYA 1WY5A 4UTZA 4JUCA 5C8VA 5JUWA 1UK9A 5CFRA 2ZUUA 3MJRA 1YI1A 2A5YB 1O0SA 5J5CA 3VUFA 4CT4B 1YD7A 2CNOA 4EHAA 5HJ7A 3HCFA 2OP1A 4AX8A 5FPKA 1RBMA 2APJA 3Q3IA 4QEZA 3U7QB 2RGWA 3VC2A 4E6EA 4NDAA 4XFDA 5LA6F 3I5UA 1QE0A 1K5PA 2QE7A 3CG0A 4JITA 5JYBA 2E49A 3IO5A 1HFEL 3MSCA 1W52X 4S35A 1NL3A 2F90A 3K9LA 5U1PA 1PJBA 2WHPA 1A9OA 3DMPA 1YDHA 4O2RA 3RODA 3NVAA 1ZM2A 3TGWA 2VJNA 1ZRMA 1PU2A 4IDFA 4IDCA 1PNRA 5JD3A 3KEFA 5ALKA 2HYDA 2HJRA 4WK6A 4TMVA 3KAPA 1EB9A 3OQBA 2QLBA 3LWDA 5AI0A 1DPFA 4BZXA 5CDGA 4CIWA 1AURA 2ZQZA 4UMVA 1N32B 3VNAA 1JGTA 1F8YA 1ZM7A 4TVBA 1O8BA 3K0AB 2NU7A 5CNJA 4DSTA 3Q3HA 2XODA 5AI4A 1WOYA 1ZD5A 1NVMB 2P6PA 3CH7A 3E82A 3GJZA 3HP7A 1Z63A 2ZT6A 3STTA 2BEUB 3V3KA 5C80A 4F4DA 4G63A 1L2TA 1A69A 3GLIA 5JCOA 1XTSA 1Z22A 3ANSA 2BFWA 3WSVA 3X1MA 4F5WA 3NX4A 2WZQA 4FZJA 3N8KA 3UB3A 1KGSA 1U0LA 2Z98A 3MZ0A 3RIEA 3SFTA 5AXAA 3ZDRA 2FEXA 4XYEA 3CFYA 1UMCA 3I2IA 2JHFA 4U2EA 3ZWPA 3RS7A 2YJNA 4EA8A 1A5ZA 3BF7A 3NZEA 3DDWA 1S2OA 2CXNA 3EGWA 4M9ZA 3VDNB 1G17A 1W59A 3DF9A 5D84A 5FJIA 3CNBA 2AXNA 4BWYA 2FW9A 4OYYA 2NU6B 1N2GA 1CBUA 2OO3A 2UAGA 3GCDA 5DEOA 2ACKA 4GC5A 1PTJA 1UMKA 2XB9A 4H1HA 1P0IA 4MVJE 4KTVE 5BR1A 3IV7A 5K20A 1TUBA 4FINA 1B2LA 3SK0A 1Y5LA 1LZKA 5HM6A 1I5OA 3N0RA 4D3DA 1JDSA 1O94A 1UMDA 2QRZA 1QHIA 2YFYA 3GLVA 4H7IA 1RZUA 4LYHA 2YS7A 3OO1A 5HJ5A 5I5EA 1GR1A 1WKVA 5KQRA 1QV7A 3JQQA 2HAEA 5CNMA 1ZIXA 2IT1A 2XAAA 2V03A 3FHLA 3PQ6A 1KQGA 2C1XA 1YRAA 3CH5A 4J6FA 1ACJA 5DOZA 1RVV1 1W5SA 1JJVA 3JV7A 4GZLA 1D04A 3EEYA 1IVYA 3ESYA 4BFYA 1F7VA 3UGKA 2PZGA 4IDBA 5IASA 1SB9A 3ZKWB 2FPPB 3EUEA 1I0ZA 4PX2A 1DBSA 4XAQA 1T8PA 3GDOA 1GFSA 3OEHA 2A0XA 3Q0TA 1A4RA 2Q2VA 3QVMA 4HWKA 4RY9A 1B2RA 3B6ZA 2AG6A 3V8EA 1DCKA 5I7FA 4BPBA 5JBIA 3DG9A 4WZZA 5F64A 2A78A 3AVXA 2ZAIA 3H9CA 1AMUA 4KZPA 4ZN6A 4DXDA 2X8LA 4ESOA 1P6XA 3OTQA 3HN6A 3HZOA 3VTKA 3LUCA 4C78A 4JLMA 4X9XA 3G8DA 3V4FA 3UT0A 3A0RB 4RJ2A 3KEQA 3AEQB 1JRLA 7ADHA 2HR1A 2QV0A 3D6UA 1KMHB 2P2CA 3AETA 1JEYB 2EW8A 2M32A 2W0MA 3AL2A 3U44B 1GSHA 3RT9A 5KWJA 1Z4JA 1W30A 1RLOA 4OJTA 3R6GA 1W34A 1MAVA 4OGKA 2H08A 4LYDA 1X7WA 2VHJA 4GLJA 1EI9A 4WKCA 1UIMA 3IERA 3DCJA 1WHTA 2JI4A 3PQEA 1AQNA 3N2EA 5AO9A 1JN0A 4KQ9A 4HQFA 3OMWA 2H85A 1PL0A 1UIRA 2HQBA 2H31A 2HV8A 2GESA 1O4WA 3GLSA 1F17A 2XMSA 4IV8A 2VJCA 1H6AA 3IAS1 4IF4A 5E9AA 4CIBA 1G5PA 5ITZB 4O1HA 3AXTA 1TMGE 1UBLS 2G0AA 4L9SA 3C3CA 1JG4A 2D2FA 1CQPA 2LP4Y 4E46A 5FI5A 3NPMA 2BKLA 2GZ2A 1BIFA 3P9CA 1X87A 4OGGA 4QYSA 5G0TA 5J63A 3VZPA 4DC9A 3ZIUA 5GIOE 1CUZA 1N0HA 1Q11A 2DAPA 4OAPA 1P7ZA 4I2VA 1NXSA 4YRJA 1T1GA 2CFRA 3UK1A 2GK3A 1Z0KA 1FRZA 1A04A 1T0BA 1DFGA 1UXGA 4L95C 4EY8A 3FTQA 1YB2A 5FUWA 4EZIA 1KC3A 1B8PA 4UHJA 4PTYA 2H5EA 1V1MB 1RLJA 4FMDB 1G5RA 2OO5A 1HURA 1YVPA 4O4HA 3C5EA 3FX2A 4FTWA 5BWBA 5ALQA 4I8IA 1RZVA 5F3DA 3Q9NA 4DR6B 1XU7A 3Q3EA 2IRWA 5AOCA 3U56A 2PWAA 4F2WA 1QG0A 4L8VA 1GNQA 5HQ3B 3BKXA 3PITA 3RO7A 3ZDFA 3UM9A 1OWMA 3WOHA 4RV9A 1OWLA 3QLVA 3QEJA 1VG8A 3BVPA 3DSRA 4WA8A 3KSZO 3B3JA 4JB8A 4RETA 3H13A 4BE4A 4DE5A 2Q1SA 5BW4A 5HK8A 1NRXA 3F4LA 4KFUA 1IAQA 2W6OA 4Q37A 3NTOA 2QX7A 4FT4A 3RG8A 3B78A 3ZDDA 2XR1A 4DTCA 3LPMA 3DT8A 3NASA 2YIJA 2CUNA 2YJ3A 2I1WA 1DV2A 3SOPA 3UB4A 4X24A 2PVSA 3WVNA 3WLTA 2XZTA 4ZAWA 1V2GA 2G1JA 5JTUA 1KAEA 1WD7A 2OC4A 2XUDA 1G16A 1TM7E 2H1HA 4IIHA 4D0GA 1EGAA 5B1HA 1IEQA 3RC3A 3S5JA 4F97A 2XOKD 2Z6VA 2HRCA 3GCXA 1YDWA 1KS9A 2W71A 5ICEA 1W35A 3OTOB 3U4MA 2HA7A 1NSFA 3FFAA 4DCNA 5BQFA 3KJQA 4HVAA 2UVQA 3AJRA 1XDGA 2IXDA 4GE0A 4K87A 2VPYA 1GTVA 3GVHA 1L7RA 3PL1A 4YV2A 4TYYA 2QA5A 1N8TA 2HWKA 1Q91A 1AA6A 1ECLA 4LGMA 2VRWA 3VO2A 4X54A 3A1EA 3DMYA 2PZLA 4RMGA 1U11A 5DYTA 1NY6A 1LBIA 3F6BX 1DARA 1J97A 2ZJ8A 5HA5A 4Q4AA 4ZAXA 4CLRA 2V7UA 3THYB 3KT6A 1FFHA 2JAUA 1DKUA 1U6JA 1V5GA 5TQ0A 2IWHA 3RVSA 5JBQA 5LYYA 3AV3A 4LTNA 2OCPA 1ATIA 4J3NA 2R8ZA 1MQSA 4JI6B 3GLRA 2XCSB 2DQKA 1W88B 2LD4A 3KXKA 3OZSA 1OBOA 2MR6A 2QMZA 3FKJA 4H35A 3P2KA 4FE3A 5JFGA 3I5XA 1EQUA 3K96A 4OEHA 5A3SA 3V6LA 1KBQA 3IQZA 3BL8A 4XSHA 1TCAA 4NC9A 3RW9A 3SEZA 3U3DA 4B3HA 3UF0A 3SWWA 1T1EA 4XYLA 2WU0A 4EH1A 2B1GA 2G9ZA 1DO2A 2WJPA 1TYEB 5FA6A 1RT9A 1UK6A 1T36B 1QO7A 1V96A 1HK7A 3FR8A 3LAWA 3WIVA 4BHTA 2DHQA 3G88A 3ER9A 3QI2A 2WAMA 3MRXA 4QD3A 5I9NA 4O6VA 2P6UA 3LU1A 5L4SA 2JCVA 2J08A 3FHTA 4XDZA 2KBEA 3TCNA 1LRLA 2CKMA 4MUXA 2CLMB 1Z62A 4KAAA 3HYLA 1RHJA 2SECE 3ZI0A 1SC1A 2HQSA 2HRQA 1D7OA 1KVRA 1GQ2A 1SHTX 1U02A 2YY5A 2GN9A 2N0SA 3F8WA 4PNPA 3ZHRA 4E15A 4DQUA 1JFTA 5DLYA 3V34A 4UQPA 2DU8A 4U7GA 4P7KA 4Q3NA 3UK7A 5BRJA 2RD2A 3MCUA 2GCPA 1SCQA 2AUNA 3EVZA 1OILA 3IIIA 4IQ8A 4D8UA 2JI9A 3WDLA 1SWVA 4IICA 2GVDC 4ITVA 1U9ZA