3OT1B

Crystal structure of vc2308 protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
195
Chain Sequence
b'MSKRILVPVAHGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADSTALLALIDAFSQQGKLVAAIATPALVFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVAAPMVLHPQQLTELSGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthes
publication title Crystal structure of VC2308 protein
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Structural genomics
total genus 63
structure length 195
sequence length 196
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ot1B00
3ZR4B 2IUFA 4BFLA 1OI4A 4S0ZA 4MNTA 4XLLA 4UOZA 1JVNA 5SY6A 1IPHA 2R1TA 2RK4A 4L7QA 2YWBA 3NOQA 4ENRA 4ZDIA 3TTUA 1Q2UA 1GPWB 1VCOA 2VPIA 4LRUA 5E9AA 4AUMA 4OGFA 4ZGGA 3UMMA 4P35A 4GE0A 3NOVA 2ZUSA 4Y1EA 3GRAA 1OX5A 4B5KA 3BWEA 4ENVA 1I1QB 3EJ6A 1UCFA 4OGGA 1P81A 3PQ5A 4P2GA 4Y1RB 1C3OB 4UOQA 4Y1RA 3KKLA 1SY7A 1QF7A 3SF8A 3SF8B 3CZAA 2YWDA 1GGHA 2NV2B 1FYEA 4HCJA 3D54D 1GGJA 4L8WB 1CS0B 1CF9A 2WJZB 2YWCA 4RKYA 3NORA 4L8FA 4B40A 1G2IA 1KA9H 1O1YA 1P7ZA 1P7YA 4OIFA 3NOOA 1PDVA 4Y0NA 1CE8B 4ENQA 4OQ4A 1VCMA 2YWJA 4P36A 4N0MA 3TTVA 3NVAA 2LXNA 4WXYB 3R75A 2R1TB 4GE3A 2OR3A 4UZSA 1PV2A 1WL8A 3FSEA 4QYXA 4MGHA 1QWSA 3N7TA 3EZGA 2VDJA 3R76A 3SOZA 1K9VF 2ZUVA 1QVWA 1P80A 1T36B 3FIJA 3NONA 3L18A 2ZUWA 4WINA 4K2HA 3B38A 3PQ3A 3UGJA 1IZYA 5SYAA 4ADSG 1I7QB 3TTYA 4PXYA 1S1MA 4Y1GA 2VXOA 1OX4A 1OX4B 1JDBC 5DFAA 1Q7RA 1T3TA 2R1UA 1ONSA 2R1VA 1OX6A 2R1VB 3B36A 3F5DA 3P9SA 4RKWA 5SY9A 3TTWA 4B2YA 4AJ9A 3P9RA 4ENWA 3PQ8A 1VCNA 3PQ7A 3TTSA 3L3BA 1P5FA 4B7AA 4R7GA 2GK3A 3CZ9A 2RK6A 4I46A 2W7TA 4BIMA 3B3AA 3WFZA 5K4AA 3F71A 4OJYA 4ENTA 5BV2P 4P5PA 1N57A 1KWGA 3TTXA 4L8YA 1QVVA 4ENSA 3R74A 1C30B 1M6VB 1GGKA 2A9VA 3PQ4A 1VHQA 3PQ6A 3UOWA 2H2WA 2ZUUA 3EN0A 4AUEA 4AUNA 5SY4A 4AULA 1FY2A 1A9XB 2NV0A 3ZJ4A 4B31A 4ZDKA 2GHRA 1GGFA 1U9CA 2AB0A 1QDLB 1QVZA 1KEEB 2V4UA 3EWNA 3L4EA 4JQSA 2VRNA 4L95C 1IZZA 3PQ2A 1KXJA 4I4NA 4BTEA 1T0BA 4ZDJA 2VKTA 3M3PA 4UCFA 2ZUTA 4OFWA 4QYTA 3UK7A 5IP5A 1J42A 3MIIA 1GG9A 1OY1A 3CNEA 1PDWA 3OT1A 3OT1B 1PE0A 4P34A 4ENUA 1KWKA 1L9XA 3RHTA 4GUDA 3MGKA 4UNIA 2AD5A 4I2NA 1SOAA 2RK3A 3EFEA 3TTTA 1I7SB 4ENPA 1GGEA 4N12A 4E5VA 3CYFA 1GPMA 2ISSD 3BHNA 4L78A 5JZMA 2XF2A 3UJNA 2ABWA 3P9PA 4Y1FA 1R9GA 4LGYA 3TQIA 1BXRB 3VU3A 4E08A 5JZOA 3P9QA 2FEXA 3ER6A 4D1YA 3ZJ5A 3L7NA 5LIRA 2D7JA 4MTCA 3CY6A
chains in the Genus database with same CATH superfamily
3QKIA 4H60A 3ZHXA 1U9YA 3TLCA 4S0ZA 1U7PA 2E37A 1M1UA 2J6IA 2WMNB 3DDNA 3L4BC 5DYTA 4B6EA 4BNWA 1Q84A 5K03A 4LC9A 3WNQA 5EKSA 5JU6A 5HMMA 4BO5A 4OK5A 4KH0A 1P45A 1RWMA 3UWDA 1J8MF 2WTNA 3HBNA 5K4GA 4ECEA 4G8BA 1UQRA 1MZVA 1I5RA 5JHGB 3A32A 3WBJA 3NIFB 4OXRA 4BX0A 3MWLA 4ZYTA 5CXSA 3SP1A 1T34A 2YHBA 3H2IA 4IMRA 1KC3A 5DI3A 4CG2A 5BOSB 1VSVA 2A86A 2WILA 4JQOA 1KSGA 5FAKA 2WNHA 3DE2X 3H97A 4E03A 1L7PA 4GI2A 5KQRA 4ZGBA 1L5SA 4U2GA 5E4TA 3OEHA 1WS6A 3EGXB 2M6RA 3QLVC 1QDEA 5DMHA 1BX0A 1IZ0A 1NF3A 2RJOA 1WOYA 4OI4A 1T3SA 2ORYA 1QNLA 3ZWAA 3USES 4CU2A 1QKJA 4CVNA 2W8ZA 5E6RB 3ICEA 3DR3A 1JHUA 1YFKA 1D1TA 1S3SA 4PAWA 4DR1B 3WRYC 3EA0A 3QLJA 2I6SA 5AI9A 1FX0A 4O4IB 4MS4A 4MCIA 3FW1A 4BNIA 2IUEA 3UANA 2JEOA 3RNLA 3ZWWA 2NQ2C 3P32A 3OZTA 4RIIA 3URKA 4ETMA 3ZXXA 4UREA 2NXNA 5ER6A 4CQMA 4I14A 4OSEA 1KBZA 1NE7A 5SYAA 2R9VA 3CX4A 3LI2A 3IOYA 4FLFA 1ZCFA 3HDJA 3WQRA 2GXAA 1E4EA 1EX9A 4O2AF 4MUJA 1P0PA 5BSHA 1ZAKA 4CM8B 2OKCA 4OP1A 4RZUA 4PIMA 4TTAA 4X1OA 2HYDA 4A7PA 1QHXA 2GTHA 1K0UA 1W8IA 5H59A 3EVFA 3UHJA 4F4UA 1S2GA 2E1RA 2CUNA 1P4GA 4BFTA 3MD9A 3S40A 3MRSA 4FW9A 1SK8A 5IKPA 1OXXK 4CEHA 2IS2A 1Z0JA 3O3CA 5EIXA 2EFDB 1MRNA 3LZCA 4TL7A 2FFJA 5LZ9A 4M86A 4R2XA 1JG6A 121PA 1AOXA 2GPNA 4JNKA 2AFHB 1XOIA 1U9CA 5C5CA 1XB2A 2DYKA 1KJ9A 2NZ2A 3AHCA 4Y67A 5JO9A 3T52A 1MJ5A 2B5OA 1B41A 3ZN2A 2F6RA 3T94A 2WF9A 4X1IA 4TKMA 1PNTA 3TD6A 1QM5A 1P1HA 1TYZA 2IYPA 3QVTA 1OZGA 4LZLA 3E7WA 2WTMA 4J7UA 4HPJB 1S2OA 4KR7A 4BFCA 1Y6ZA 5HR5A 4R3UC 1I2DA 1J20A 3S7ZA 3G2HA 1C7FA 1CRZA 1N7HA 1O5OA 3E1SA 4LQLA 3UVEA 5JEEA 1K0FA 3OOWA 5B2EA 4L8LA 1Z0FA 3H87A 2D2EA 4ME6A 4YXWA 4JEMA 2QD4A 4U2DA 5CAEB 4RDCA 1XQVA 4CTJA 4DLUA 3RW9A 3AKZA 1T2VA 3BHNA 2BE9A 3OE7A 5JZMA 3ZVRA 1Y1KE 1JSLA 3O75A 2JGMA 2XMCA 3O73A 4M89A 4QBHA 3TBKA 3T9AA 3EZ2A 4AP9A 1UXIA 3GEMA 5ALUA 1XZBA 4N3AA 1KAQA 2J3KA 3B5JA 4ALIA 4IZHA 1CE8A 1IN5A 1XMVA 2EL9A 3KR0A 5LXTB 2J9RA 1C4WA 1G5RA 3TKAA 4LI0A 1DBIA 4AKGA 3ZXYA 1Z12A 3LWZA 1VI2A 2RI1A 4OQXA 1CJKC 3LBAA 4H4CA 2F3TA 1Y34E 4MGIR 1D0SA 2GFIA 3FLAA 3ZZ1A 1ZA2A 4O4HB 3M34A 5AJHA 4H3KB 3AEKA 1QFSA 5C0OE 4BZZA 3C7KA 5GQSA 3ZNOA 3CEPB 1ND5A 3TQQA 1EUYA 3BILA 1ZGGA 2NVWA 5KINB 1HXHA 2XCRB 2WZBA 4NHOA 4R0NA 4BV2A 5KSZA 3KUUA 3JQAA 5ENVA 5L95A 4BFVA 1BN7A 1T35A 2X9VA 4XAQA 4XVHA 1CS0B 2G4CA 4KJZA 4CR6A 3OZBA 3B8EA 1VKNA 5BSUA 4HAVA 1CUHA 1UBTS 4R6XA 1UKVY 3ZTTA 5AW8A 4JP1A 3ZQ6A 5JWOA 3JYNA 1Q95A 1Z9BA 1RI3A 4C7KA 1ZINA 4QOSA 2OCBA 3DFKA 5DNWA 1CYDA 1QNFA 4LYEA 4X92A 3U4GA 5IZCC 3DE6X 3NOXA 1VOTA 2BFOA 2DBRA 4J91A 2GBIA 4OUDB 4GGMX 2ZI7A 3E82A 3E3NA 4QASA 5JTUA 5E7MA 1J97A 4IIJB 1FC0A 2JIBA 2PFSA 1B76A 3PGJA 4RKRA 3INYA 1TCUA 4YUYA 3FCEA 3T3DA 2MR6A 3HUTA 3OJFA 2HIGA 2Z2YA 4FHEA 2WHPA 4I1UA 4U7GA 4UMFA 4YUVA 4RTQA 4WL0A 3T5GA 3WV4A 1A0OA 1UJ4A 4DIUA 5LC1A 4UFPA 4RY0A 4DMHA 4QUGA 5AKEA 1DJLA 1R7RA 2O05A 2Q5CA 2VHUA 4YR7A 2AYYA 1VGQA 3DV2A 2ECPA 3THSA 5T5QA 5U4QA 1D4FA 4UDYX 3EFBA 1KWGA 2BP7A 4NJOA 2WSLA 1GYQA 3L4KA 4AUNA 5B1EA 4HG2A 1P3JA 1DFIA 1W0CA 3RUEA 2IF0A 2Y6UA 4KWIA 2RCYA 3R7BA 3ZE1B 1L1EA 1LDMA 3SVLA 1Y82A 1YIAA 3DFZA 1NMSA 1NP6A 3CR7A 2G7ZA 4MH0R 1TVKA 1XZHA 2QG9A 4CW7A 1J8FA 1UBEA 5I9LA 1J25A 1GDHA 3P9YA 4JWTA 4RZHA 6ABPA 4QYTA 3WYFA 3DOFA 4M0UA 4NZPA 4BGIA 2HK6A 1WMFA 1KO7A 4IWNA 4G5FA 5E6UA 4ZQIA 4J3NA 4G0MA 2V7QD 3ZD8A 1UKAA 3DM5A 4OU4A 4R51A 4DV6B 2YS6A 4GR5A 2OGWA 3V34A 2NO9A 4IZ6A 1OREA 1PX2A 5DNEA 3GZTB 4GNRA 4ER6A 1I7NA 3HDGA 3R6TA 1M1ZA 4PQEA 5FD8A 5FI5A 4JLMA 3FH0A 4KQ6A 3H5OA 1JJIA 5FOXA 2I7DA 4XCVA 4MB6A 2M1XA 1XCOA 3MJDA 5L9AA 3FJYA 5DGTA 5BUSA 5F33A 4UUQA 1H2EA 5H9WA 1DRUA 2JRCA 4WERA 2SKDA 3DKIA 5IZ4A 2O8BB 5GONF 1M8FA 3FGPA 1P2DA 2JAXA 3NH6A 3LCCA 3LQ2A 1L8XA 2A4MA 3KTAB 1DEXA 2VO1A 5EIWA 1LB1B 3TLBA 3ZU3A 3H9UA 1MB2A 1A8IA 5GADl 2Y0BA 1C9KA 2DWUA 3N74A 1NNLA 2FPSA 1N34B 2A7XA 2PJZA 3U4CA 1Z6YA 3KAQA 5AW5A 5KWVA 4GVLA 5CX1B 2Q99A 3TQSA 4N82A 1G8KA 1E9VA 3C3YA 1OZAA 1ZD3A 3ENNA 2XTZA 3I2JA 4DYVA 4F86A 1IQ0A 5E9JA 5IAAA 5ALNA 4MARA 3KSZO 4Y2RA 5D87A 1GCGA 1HUQA 4B0PA 4JBGA 2Z5GA 4I3HA 4HGYA 3LO8A 3IKVA 3CLUC 1FYEA 3JQGB 4II2A 1JW9B 4YMLA 4F6CA 1OZHA 2Q4TA 1WEKA 1IU9A 3K53A 5IW8A 2X23A 1B6SA 3M4NA 5LQAA 2FRVA 4MUKA 2DUJA 1GIAA 3DBRB 4WXYB 2X40A 4HC4A 3SHVA 3HADA 3UUEA 1WU8A 5JFGA 3H19A 4K86A 3WHLA 1RWOA 2PU5A 4GPZA 3CG4A 1NWHA 4EB3A 1PSZA 2KW5A 3LYAA 2I2WA 3QJGA 5TE9A 2KE5A 3V48A 4NMXB 1MB9A 2NU6A 1C9MA 5EFZA 5F1OA 1QV6A 3B9PA 3LA8A 5IDVA 2DT8A 1QP7A 3EXIB 5THXA 1MA0A 4TYQA 1A4UA 1I7QB 1NXPA 1YMVA 4Z7NB 1OA1A 1RT9A 4PZEA 3M6AA 5L8VA 2OV3A 2IW1A 4K9RA 3E8MA 3ACDA 3EYWA 3R24A 3KT3A 5I7EA 1J8QA 1SJ9A 2NUPA 3F97A 4QLOA 2A57A 3L8FA 3NGLA 5TDHA 5EERA 1VCNA 1VP3A 1WMDA 1BROA 3N58A 1PZXA 4HEJA 1H8ED 1U2DA 2H5IA 4MUBA 4PEVA 3TLGA 4FOLA 3ETGA 2QY9A 2EL7A 1KI2A 2ZRCA 3M9LA 4F71A 1P9LA 4DUPA 3VAAA 3R7AA 1DC6A 3I9JA 4CV1A 4XRGA 2DBYA 4JOQA 5K2MA 2WLTA 3PP8A 3LCVB 4EJ6A 2BZGA 1ZVVA 2GJ4A 3TN7A 3QFFA 4NQRA 1QHYA 1PF7E 1YC5A 1R16A 3IQWA 3KUXA 4J7AA 1USKA 3TQFA 1PJ8A 4YJ3F 1R6XA 4L95C 4HVAA 1IONA 221PA 2PWYA 3I28A 2AJ8A 2EATA 1SKQA 1FYDA 2VAWA 3HRHA 4RPHA 4DRXB 1F2UA 4IKOA 3E9YA 3LJKA 7ABPA 1XGKA 3A6DA 4TSFA 1FLNA 1J56A 2VA9A 2XT0A 4BQRA 4ABYA 1ACJA 4M55A 4DNFA 3F8SA 2SNIE 4E0BA 3FCCA 3MIIA 1IN8A 1TX4B 1OY1A 1XVLA 4KKVA 5IYZB 4BMZA 3IA2A 2J9FB 3JD3A 3L92A 4WT7A 2GPSA 2GM5A 2OBYA 2XOKD 5KDOA 5K0GA 4L1KA 4JP2A 3PI7A 5J4KA 2DFDA 4N5NA 1XCLA 1ZZEA 2VHYA 4MQ5A 3HG7A 3WWEA 4UNRA 2OD2A 4D79A 1ZISA 2VBFA 5KVCA 2Z6UA 1OHHD 1S8FA 1CB7A 2WKWA 4O4LA 5GAJA 4G2NA 2FZKA 5LBIA 1N9ZA 3GZNB 3IYLW 4PG5A 1QYCA 1RQNA 1VLHA 3RWBA 1N2SA 2P65A 3ZGYA 2GLTA 1D6SA 2JLSA 3G0OA 3I23A 2E3JA 4WY8A 2V4MA 4EX6A 1DQNA 3UMYA 2AA3A 1PD1A 1W4BA 2FPOA 3C4VA 4LAFA 4OIMA 1QIIA 1SZCA 4C2BA 4ITUA 3A58B 2HJGA 3IO5A 3ZKWA 5JSQA 1BHO1 3SYRA 4DARA 5JCOC 4RY8A 5EP4A 1ZNYA 4JQCA 3UJ7A 5IC5A 2W2NA 1GPKA 1DZ3A 4A2WA 4M7WA 2VN8A 1XMOB 1E69A 2WG0A 1I1QB 3FLEA 2ATIA 4OGGA 1P81A 2QX9A 3QOYA 4YP0A 1G2QA 3EF1A 3MUFA 2PUDA 1UBCA 4PXSA 1XZPA 1IXSB 3LUCA 4HXFB 4NBKA 3QBTA 4LRWA 3RC9A 3T1QA 721PA 4HR7A 3RVNA 2ICAA 2FUEA 2HCTA 1J0CA 1AK9A 5JBQA 1UWVA 4KWEA 1VJ0A 4JS0A 3QVUA 4L4SA 2G9NA 3K9CA 4WQMA 1PJ4A 3K5IA 4IVPA 4N8SA 1U3CA 4W6QA 3U3KA 1PX0A 1DTEA 5DN6D 5KYVA 4W4TA 4TYMA 7REQA 3G7UA 4A9AA 1M1YE 4WLEA 4M98A 3W9BA 3I8XA 4KQGA 4CM1A 2QUBA 1BFUA 3EWAA 5FPPA 3W2GA 1EM6A 4I1IA 4LY6A 1UMCB 3U1BA 2YDYA 5I7SA 3EEBA 4Z4HA 4L75A 4M9ZA 4TMYA 3M1LA 1XNGA 3PLNA 1AO3A 2BJVA 2VEDA 3FPKA 4PTZA 1NLFA 4A3SA 1U2GA 3PRHA 5JE8A 5I9BA 3D6JA 5B1IA 4DIOA 5JT1A 2K7FA 3GLGA 2R8PA 4LWQA 3RYHB 3ZHSA 3MS4A 4BO6A 3H2BA 1TW2A 4RPKA 3C8ZA 3LXXA 2A5FA 4MDYA 4MUXA 4ON9A 1X1AA 4ZODA 1AV6A 2EU8A 4ZVLA 3WMGA 4CL8A 5BV1A 1X8KA 5AW4A 1OH7A 2DWCA 3KQHA 1B16A 4KEAA 1MQAA 3EIHA 1FS6A 1THZA 3HCOA 2WTAA 4KGZA 1SG6A 3RUDA 4I5GA 3Q6MA 3RYFB 4AROA 1KVUA 2P6MA 4MV0A 1GA6A 3P94A 4KWCA 3ZGOA 4EB6B 1OLOA 2A9OA 4F9TA 2ZCJA 4WV3A 1GFIA 1YVUA 2ZJ6A 4KNWA 4JNCA 3G23A 4FR5A 1KHHA 2GPTA 3EW9A 4IDCA 4UAVA 5C51B 4BMXA 1N32B 4FONA 3LH5A 1X80A 1ODJA 1PQPA 1ZICA 2VZEA 1VJGA 3H1BA 3KWFA 2OO7A 2VSNA 3OH8A 4LRSB 1KH3A 4PX9A 4JCOA 3PX2A 1TEVA 3GCXA 4RK4A 3SEZA 4J2OA 4ZEWA 3ZWDA 4D4GA 3PHGA 3A05A 2G70A 2Z04A 3K96A 4Q82A 3RVBA 1S2NA 2ZBRA 3C39A 4JI1B 4C29A 4YECA 4YPOA 3H84A 5CNKA 5DASA 1R12A 1Z34A 2Q2WA 3EIOA 2B25A 3L4BA 4KNVA 2XA2A 4F5ZA 1XPUA 1QUEA 1MJHA 1CJVC 3BXGA 2BRUC 3GRZA 5H3HA 3WRVA 4LHSA 1SGWA 4O4JF 2OV6A 5EMJA 5EOVA 4L5BA 3H2KA 3K32A 5HQ3A 3T9FA 5JD3A 5EJ4A 4MEAA 1QG6A 3W8FA 2PFGA 2QLTA 3EFEA 3I2FA 3K09C 1VSTA 3LM8A 4GS5A 4YACA 3ZK8A 3BFXA 1GGEA 5FL7A 2DM6A 5GV7A 5IU6A 1Z7YA 2HWXA 4L78A 2PUEA 2V74B 5F12A 1XHFA 4D8YA 2QAIA 2G09A 3GLTA 5EKXA 3SFTA 3BK1A 1FIUA 2MSEB 1NUHA 4X6YA 2C9YA 1SR8A 2SKEA 3KSUA 3QLVA 1I5EA 3MMNA 5ALWA 1CR6A 1SUDA 1C4XA 1Z5VA 5BN1A 3IIIA 1T4GA 2H8GA 2HXGA 1VJTA 3DC7A 4Q12A 1JVBA 2AI2A 2PNJA 5JAUA 4NCAA 1VBMA 1M6EX 3E5NA 1A8PA 1XWIA 3N86A 3PKIA 3C6ZA 2YKGA 2OG1A 4V1CI 5KNBA 4WOCA 2HSZA 3QVOA 3HJRA 4DG8A 1ZWKA 3B1VA 5TVKA 5BWCA 1EFUA 4O59O 3WRYA 1PZHA 2R5WA 4L3VA 1C7EA 3WQBA 3U09A 1ZM4A 1XK7A 2QXYA 5BOSA 1ADGA 3PJFA 4KUHA 5K0FA 5ESDA 2ZSIA 1RYZA 1W75A 3E7FA 4KXVA 5F7ZA 1CP2A 3VDRA 4TLAA 4UQLA 4EYGA 3FUXA 3AFMA 3AR5A 2NZUG 3G7NA 1V25A 2C8JA 3PJEA 4WVFA 3EGXA 2OXRA 1LEHA 1WHTB 2D8MA 3DDOA 1P60A 3KALA 4EG7A 1RKVA 5DTMA 1B2LA 3FJ1A 2GEKA 3SQWA 3RT9A 1GKYA 5E6RA 1VBNA 5CBPB 3MGCA 1YNSA 3GWZA 1U7WA 2GN6A 5KJFA 2DULA 3DP7A 4EK9A 1JAZA 2XUKA 4Y6SA 2H0QA 4JK3A 4O4IA 5CXQA 1C9YA 3DV9A 3E58A 2I2BA 3H18A 4JT9A 1DWOA 1Y3DE 4Z99A 1E77A 4PHGA 2H18A 5DTIA 2NZVG 4O2BB 1R5NA 2Y77A 5JCXA 2CCKA 2OHIA 5LZ2A 3JAWA 5DRTA 5B3KA 4CM8A 2C7PA 1JJFA 1PDOA 1G5HA 3Q5DA 3B53X 1HNNA 4KX3A 4NG5A 1JWBB 3C6KA 2OM2A 4NV3A 4Q16A 4C4XA 3AVPA 1LPNA 4IW3B 5JEDA 1USIA 5L53A 3KLOA 2OP1A 3PNYA 3WJ1A 3EASA 3JRNA 5EY5B 3C24A 1IEQA 2NPFA 2WU8A 3BJEA 2P5SA 3M6LA 1G8HA 4GPD1 3B3AA 3KZVA 4OM7A 4F4HA 3WLOA 2IGTA 4ZI2A 5BUZA 1FDOA 3SPXA 3OIUA 3I2GA 4G23A 2GVDC 4NZNA 2GUGA 3FUUA 5EQTA 3H5AA 3JWHA 3T7AA 4D3ZA 4AQDA 3W7VA 1MIHA 3CX8A 4ZDKA 2JAUA 2QRNA 2EEPA 2G9UA 3PCXA 1THGA 2PUTA 4S12A 4PTYA 5L4LA 2AFHE 1L5FA 2NU9B 2UVPB 3LDAA 4JJGA 4NEQA 3TSWA 4XPZA 1KIAA 5M2QA 2JIMA 3GUVA 2EW2A 2HA2A 3B6ZA 1WW2A 3LQKA 3W3AA 1TJPB 2CJWB 3GRVA 2AR9A 1Z45A 3KCQA 4NPCA 5B2FA 2EWWA 4V38A 5HILA 2ZSJA 3H1TA 3OZUA 3T4XA 2WB2A 1WB9A 4RE6A 1HE2A 1CDZA 1J8DA 1HYQA 2XLBA 3AP2A 2HFJA 3FYDA 4RF5A 2HQ1A 1ABBA 4EZIA 3WMEA 16PKA 1AB5A 2IZZA 5FPSA 2SBTA 3EAQA 2OHVA 1B43A 1K88A 1NWCA 2VP3A 5K5EA 4X61A 3W5IA 3F90A 3WTBA 1YMUA 1K27A 3KUCA 4MWOA 3W7AA 3ZI4A 3C3KA 2AFRA 5J4YA 4UNPA 3TDMA 2COKA 5JI3E 1U2TA 2C29D 3GOQA 2RHGB 1UFVA 3A1VA 4Z1OA 2CVPA 3NWEA 4LA4A 1X3SA 1FBTA 2B6HA 2POQX 1FFHA 3E9DA 4XARA 2H1HA 5JZVA 1G18A 3FF1A 3TPFA 2NTEA 2PX4A 2UYCA 5LXTA 1KFBB 1QGAA 3TOXA 3WQSB 4PINA 3ZEIA 2O8EB 2RIRA 4OQPA 1T1RA 4GSKA 3NYRA 1P29A 2LCFA 2QQ5A 4K9PA 5CW1A 3USZA 3ZDCA 3CKYA 2YNMD 1KI7A 5IZCA 3B60A 2CDAA 5LDDC 3D7RA 1V5GA 1FSFA 3GRAA 4O4HA 1Q1ZA 5JD4A 1KK1A 3AHGA 3EXFB 1XELA 3VJRA 3H9GA 1EFKA 1L3IA 2HA4A 2IYFA 2VK4A 2W4MA 2Q07A 4YREA 2WQZA 3VYRB 5CB4B 1D6NA 1SY7A 1KY4A 1WXXA 3SD7A 3ZW9A 3F0TA 1AX9A 4BX2A 2YOGA 3UIEA 1ZXLA 4DCNA 4L5IA 1IJEA 2CWDA 4UMDA 3O91A 4UTOA 1EVYA 2B83A 1G3RA 4MVXA 2UU9B 1TD9A 1J2RA 2FMUA 2XD4A 2EFCB 4E30A 2VNJA 4WJLA 4ND4A 4P7KA 2FFQA 1VCMA 4OQ4A 3KOXA 3NTQA 2O06A 3GAZA 1R88A 1E6LA 1HDYA 1V3QE 3F8WA 2XUGA 4JWKA 3UHFA 2DKOA 4OUDA 1BD4A 3NHLA 1FW8A 4WCVA 4A8PA 1HETA 2BR5A 3DKRA 3EODA 3PXEA 3H4MA 4J3JA 1C3EA 5AHXA 4MYHA 3TQTA 3L6CA 2CNNA 2PZBA 2WKQA 1LUAA 2XIJA 3NONA 1OE0A 4X95A 3TJZA 2PL3A 3AC0A 3KL4A 2HM7A 2JJ8A 3RSGA 3A4IA 2MJLA 4AECA 2XB6A 5BVHB 3RBVA 1PJQA 2IXAA 3EEFA 3FR8A 4RY2A 2HMSA 2QVYX 3KXPA 4XLTA 8ATCA 3U3XA 1PEDA 4FW8A 2GZAA 4G0OA 3H75A 4ONEA 3WO0A 3M0EA 1K6XA 3CX7A 2NUAB 5BR7A 4HDKB 2C3UA 1ZNXA 3VR4D 1CU1A 2ZRJA 2ZTMA 3B1WA 3DV0A 3L49A 2I22A 3M2PA 4N7MA 4YRLA 3QTTA 2AS0A 1CVRA 4UJ5A 1HBJA 1SHKA 1FE8A 2WZQA 1JNYA 3GEPA 1NN5A 3N8GA 4P5PA 3Q7QA 1HYHA 1H2AS 2B37A 2FLVA 3ZBUA 5A9TA 4P80A 1IXYA 3NTUA 2XEXA 3NB0A 5KEIA 3IP8A 3G8DA 4LMPA 5C7LO 1IM8A 5AVJA 5FULA 3RIYA 4B09A 5K9ZA 3L0OA 5DN9A 1L5GB 2R3SA 1E2IA 1KEEB 3E03A 5K3BA 2ZYIA 4LFCB 1JR3D 2IY7A 5ICMA 4K9MA 4HL6A 1SRQA 1VECA 5D6NA 2YW2A 2B78A 3RG2A 1G20A 2QX6A 5KTOA 5I4CA 5TRTA 1W36C 4M1OA 5CT5A 3QNMA 3L0CA 3VMMA 3NTLA 3S99A 4MICA 4KVAA 2HADA 3JRWA 1GPLA 1JXAA 2JH9A 4QREA 4N01A 3ZHTA 3KQLA 4IX9A 4TLMB 1P31A 4CL0A 3HYRA 3BM5A 1JFLA 3FI0A 5CFPA 4KACA 2XVXA 2PLNA 3HKBA 4KIUA 4F97A 1HYGA 4HAWA 4P7GA 1H1LA 2PTHA 2X0KA 3N3AC 1K68A 3OEWA 4WKGA 1FYWA 1FP7A 2QJFA 4ICIA 4YCDA 421PA 5IXYA 3DL4A 2VI5A 4J0IA 3VR4H 4EUNA 5LWHA 2ONZA 3AHDA 3LTEA 3U5ZB 3GGCA 2UZ0A 2F8SA 3G59A 4H6PA 2YRXA 3PIIA 4X8LA 5DX0A 5JSHA 2WSSD 2A0FA 3M5WA 4RKEA 2FWIA 2X3UA 3C7CB 5E3HA 4DLLA 2OMEA 4NAVA 4YAFA 3X0DA 3QVSA 3AM1A 1RYBA 2E89A 4AI6A 4D98A 2FKAA 2HT6A 3KTAA 1C7JA 4K1XA 3ZCVA 3UMMA 2WW8A 4BVEA 1DC4A 3PXDA 4UEQA 4ZP1A 1X7YB 4E4RA 1L4LA 3OG9A 3P7MA 5CX1A 4MHTA 5HK8A 1ACLA 2QMUA 3EGWA 2R5FA 1RRPA 4ZQCB 1V5IA 2E5WA 3BH6A 3REFA 5LSAA 1TTTA 3G2JA 4JUAA 1BWPA 4C0JA 5HKOA 1GTSA 3BHIA 3O31A 4CKXA 1E9RA 3JQGA 4IHQA 2NU7B 1J39A 3MYYA 2QN7A 2D7CA 3N3BC 2YRWA 4NFHA 2I80A 4QULA 4EEKA 2QJRA 5KX5B 3TGPA 5J2UF 4Q66C 2ZAIA 5I5GA 2BMAA 4V0SA 2RE8A 2JBHA 1CUZA 2C5FA 3JQEA 5LYYA 4AF8A 3AW8A 3JW8A 3FHJA 1EGHA 3H65A 5A5EA 1Q14A 3CN9A 5IJ0B 1VPDA 2HIMA 1E61A 2HLHA 1DXOA 2ODEA 1QCZA 2AX4A 2RGYA 3NAQA 4EZEA 3S55A 3P27A 2DBZA 3ZV6A 2RHHA 3N7AA 2QPAA 2B35A 2HR1A 2OXIA 4QVGA 3PNVA 5HX7A 5ICEA 4HP8A 2WF6A 3ANSA 3UBTA 1M6NA 1AURA 3Q4GA 1ISJA 2EF1A 2JHAA 2HAEA 4GBJA 2VP4A 4PC2A 2HPZA 4OI2A 4C6SA 2R5NA 4BUJA 5B7NA 5KJEA 4D9EA 3AJEA 5BSKA 4QJ4A 5IHXA 1LPMA 2DTEA 3FTEA 4JOSA 3MFYA 2VJCA 3NS7A 1TMGE 2II6A 1DGQA 1Y1QA 1BEEA 1GZVA 1EWRA 1Y8RB 5CFRA 4AJ9A 2EKPA 4JQYA 4UU8A 2Q29A 5KS2A 3S0JA 4PGAA 4C9BA 5IUKC 4W1SA 3EDCA 1E8MA 2IU6A 2VUTA 3IQXA 1PNQA 1WABA 5B7QA 2QZJA 4FMDF 1P72A 2XX3A 3IP5A 1QO0A 3R74A 1M6VB 1H42A 1ZSVA 4Q0MA 4QEDA 2QUHA 4EFLA 4Y7CA 2R7NA 4LJ9A 3WLJA 5JHHB 2GN4A 2JHCA 4IJKA 3F6YA 5EIBD 5EJEA 3TECE 1NKSA 1VPTA 1II9A 1OBFO 2BKEA 1B1AA 4LQ4A 2ZQYA 3MINA 3PVSA 4HH3C 4JJ8A 4MV8A 1QANA 1Z4KA 1H6CA 1DBRA 1KAEA 3TMAA 3WKBA 3LAWA 4HZIA 3SKXA 4DRXA 1Y1TA 4Z8XA 2X6TA 3U4AA 3V8VA 1PR9A 3O5AA 1FUIA 4IX1A 3K9QO 1MTOA 1T8TA 1GA1A 3KK0A 4KN9S 5DTQA 2WU0A 2YIDA 2GETA 1DC8A 1DP4A 2NNLD 2P3LA 3DULA 3IB6A 2J9FA 3ISTA 4G36A 4JDUA 5JCOA 3D3EA 3RJ9A 2XT6A 4FWTA 1ZL0A 3KB2A 2TS1A 5C4IA 1ONPA 4W63A 5KYGA 1VRWA 3SS8A 4UM8B 3TRIA 1RNLA 2PZ8A 3CEJA 3N2ZB 3UJ6A 3ROXA 2XB9A 3VX3A 1B73A 2OOKA 2O7VA 1V7PC 1U2SA 2IYWA 3GZNA 2RHOA 4IJ5A 3WR5A 2A30A 3C3JA 3FDZB 3GUUA 4WHMA 4D1YA 1SUSA 1QR6A 5EI5A 1L7QA 3OJLA 1GT91 3HJBA 1JEEA 4MAAA 3O9MA 1S7CA 1WY7A 4UZFA 4BO2A 1YRWA 1JHAA 1BKSB 4WAUA 3VSBA 2ZFUA 1AGPA 2ORWA 4TRJA 3QNUA 1CEEA 5DHSA 2RJ3A 4C01A 4FYIA 2IK8A 4NI5A 3TLEA 4BVFA 1GP2A 5EHGA 3ZCXA 1HDXA 1KK2A 5C8VA 4DY4A 1RJ9B 4RL4A 4I5DA 4OV6B 4RWZA 2BEKA 3WSWA 4W5QA 3CLHA 4N03A 1DQPA 4YBRA 2GYWA 5JAPA 2QMYA 4RTPA 1RZ3A 5C3MA 2OY0A 2YV4A 1NA5A 2O20A 3KLPX 5LBTA 1G9SA 4TTSA 2JGJA 3B8HA 5CB6A 1XJCA 4ASUA 3SJBA 2UUAB 1NTOA 1PDVA 3KXLA 3NR2A 3WL6A 5AI8A 1GTZA 1CY1A 3Q12A 2C2OA 1HYEA 3VKGA 4GWGA 1SBYA 2OZKA 2P91A 4BX3A 5KDDA 2AYXA 3D43A 3EBLA 4Z4IA 5T6BA 3HU2A 3WB9A 4E5MA 1E3QA 2O50A 1XVIA 3W1VA 4X5OA 3C7AA 1UMCA 2ZUVA 4C0QC 2EV9A 2DUUA 2H1LA 2ZUWA 1UKZA 2Y99A 4G0YA 3JWGA 5IJAA 5BQFA 1ZFNA 1H2HA 2G25A 1LVHA 4UCQA 4EHNA 4ADSG 1I3CA 1QAOA 3TL2A 1RC8A 3FX2A 4NBWA 4RS3A 2ZJAA 1FFAA 1AKMA 4G8CA 3KPUA 1R8JA 2Q0HA 3OE4A 2ZAMA 5DNDA 3SXUB 4YMVA 1Z82A 4YJGB 4YPVA 5DO9A 1L4GA 1C0KA 4EYKA 2PA3A 2O8DB 2IWHA 1AH2A 1CR0A 1W1UA 2I78A 5NULA 4BYGA 4DV5B 1J1IA 1SC6A 3ESBA 4MV7A 3FWNA 3RYFA 5I7UA 2XCQA 3AV3A 2AXQA 1Z6XA 2BRUA 4KIFA 4B82A 4EB6A 2G67A 1BA2A 1SU7A 4YFYA 1SXJD 3CX3A 2QN8A 3OO1A 5EL0A 2JFXA 4JFRA 1HMPA 1LPAB 5K99A 3GEEA 4RA6A 3K09A 3R7LA 1FY2A 4DMGA 2OKGA 3KB1A 1K8ZB 1K63A 2O0MA 2PSHA 2F8LA 2XTJA 3ZLJA 2X7HA 3C6BA 3KU4A 1F2VA 2X0DA 4NKRA 5GJCA 3K92A 1NVEA 2HJSA 3FDFA 1WKVA 3ME5A 2NPOA 5T64A 1OBOA 2ZT6A 4D99A 3C41J 4EI9A 1L5HA 3ZH2A 3IXQA 4ZDJA 3ZE7A 4HN2A 4E15A 1G60A 2H2HA 5KIAA 3P0RA 5ED4A 1MP0A 3DYBA 3PXUA 5K0NA 3LXUX 5I8PA 1IB0A 1JDTA 1PTKA 4PZDA 3ANMA 5TQ0B 2O19A 5HG0A 1X13A 1W5SA 1MHPA 2VJPA 3RUPA 2G5PA 2XVMA 3CSDA 3GLKA 3EQ7A 3KT6A 4XCQA 4QUDA 5CIQA 4ALJA 4PLGA 1RLUA 2Y4OA 3A0RB 5EIAA 5B36A 2OZLB 1Q0LA 4Y0AA 4JL5A 1OYWA 4R2LA 4QGAA 1X7GA 3KWJA 1H5QA 4I8IA 5LP6C 2R8BA 4WN9B 1LF0A 4TZKA 4Z1MD 1OKKD 3KKNA 3N2KA 2HA3A 3AT1A 3OUZA 4NQZA 4TXNA 1N33B 2ZVDA 3OP4A 4XIGS 1R9GA 1OXSC 3P45A 1T25A 3EAGA 4A27A 4I19A 4HMPA 1G5PA 2VTVA 3ENVA 4NE9A 2JARA 4TXMA 1U2PA 4F96A 1BVUA 4QYWA 3R9XB 2ZRAA 4TMFA 3NCTA 3CO5A 5IDWA 1A5BB 1MJGA 1M54A 5P8WA 4B6OA 1M83A 3L9XA 5DKFA 4CLHA 3UWPA 1UZNA 2CLMB 2QQ0A 2Y0DA 5KAPA 2Q9CA 2OCYC 3P5BA 4RD2A 3RGWS 3ER8A 2I7TA 3HFSA 3K6SB 1R4NA 5DXJA 4F45A 3KUKA 3IOCA 1HG0A 3DFIA 3UJ8A 1F20A 4FQ7A 4KIWA 4R41A 3ILXA 4N7BA 5CLHA 4NIMA 5B4UA 4R9RA 4HD8A 2QSZA 3T7DA 1KVRA 4C0XA 5THKA 3ZE8A 1K2WA 4TVOA 4RKYA 4CV2A 1WHTA 2HL6A 3NT2A 2JI9A 3OZEA 3EE6A 4N0EA 2PGJA 5EYPB 3ZU4A 5BT8A 2DQ4A 5KSOA 4Y0NA 2ZRBA 3E3OA 1UR5A 4NP6A 5DYIA 3HBAA 3GJ8A 2CVHA 3BE5A 4V2IA 5CBPA 4OEHA 1WL8A 2QSJA 3CEMA 3LZDA 5DWDA 5CG1A 4WNAB 4QXOA 3I8OA 3BF8A 4KREA 3CVOA 3PGKA 1HQCA 3WFIA 1OCEA 4MO2A 5DP1A 3ZLTA 2IP2A 5BO5A 4TVSA 1AV7A 1DAIA 2XDAA 4GKVA 2ZBQA 3LT2A 3P4YA 4RVFA 1Z6QA 4IDPA 4O2BA 3EUFA 1BS1A 5HZGA 1IHYA 1CDDA 1QIHA 2I1VB 3IVMA 3M6XA 3NBFA 5AK6A 4DJDC 1H2RS 3ZV5A 2Q9BA 1MR3F 1U0HC 3E61A 4EX7A 4MR7B 3W5SA 1CNMA 4XVCA 1THMA 3IQEA 2XB4A 2FETA 4HWGA 2OB1A 5E38A 5JWHA 4QQFA 4V02A 1NJ6A 3PV0A 2H16A 1C0EA 2YMMA 2PXCA 3U4MA 2OVFA 1ZY2A 1JB9A 3EVNA 3W5UA 4LRXA 3AY7A 3BD9A 1E9CA 1RHRA 2X9LA 4G0WA 1KBOA 3DVSX 3ELYA 4NNPA 3AILA 4TUYA 3ZNQA 2MSWA 1Y9ZA 4H31A 2H2WA 4HNVA 3F7NA 3KL2A 2V7UA 5SY4A 1D8AA 3MPOA 2LV8A 1BS9A 3PSAA 4NK5A 3DEAA 2CK3D 4JLPA 5CFLA 4RIEA 5AUQA 2NU9A 2UVPA 5JYDA 3I0ZA 1T2EA 4YA6A 3H04A 3X1JA 5CVTA 5HM8A 1Q7BA 2GS9A 3UXMA 3MWKA 3TINA 3NRJA 1PT6A 5LLTA 1ZIOA 3LNTA 3KTFA 2JL1A 2WWGA 4HYTA 5FOSA 3ESZA 3K1YA 3UJ3X 4R9VA 2P68A 3Q7EA 2QP3A 1PS8A 1LGYA 1RZUA 1Y6QA 3RK0A 3UMVA 3W6UA 5JNSA 3Q8LA 2HUPA 1DX4A 2VYQA 3H05A 1K8QA 2P9ZA 3H5TA 4EI2A 4YJ2F 3ONDA 4RQAA 4ENPA 2WLSA 2HBRA 4DEXA 1YE5A 3D3WB 4QOGA 4WE3A 1ZUD1 4PXAA 4D6PA 2XCLA 1QG2A 2R4TA 3QU5A 3FA2A 4QECA 4RV5A 1WXGA 4X44A 3Q5GA 1TU4A 2C2HA 4K81B 2IOQA 3JVUA 4U00A 2JIPA 5AVXA 3WL7A 1DWPA 4HZUB 1EP2B 1ZU5A 3G7SA 3O1HB 4R16A 4Y8VA 2KBFA 2O8EA 1GVHA 4K9LA 2DWOA 4ZDIA 1GLNA 1KEVA 2A9JA 1UH5A 2PCJA 1DJOA 1ZM3A 1GUZA 1T6YA 4MP3A 3VC3A 3RG8A 2PO7A 4BWFB 4HAXA 4Q47A 1EWKA 1JWAB 3H16A 1GKIA 3EXFA 2HU2A 1Z0IA 2WJGA 3E9ZA 5CB4A 4Z9YA 2QN6A 3HRIA 4RVNA 4BWGA 4D8VA 2B82A 3W9YA 4CL2A 3PZRA 3FVTA 3RRFA 4XSGA 4XD7D 4XFJA 5J5VA 5ITVA 1ECBA 3G2QA 3GCDA 3TEJA 2XDYA 4KBYA 4WTOA 4QQKA 3VPGA 3LF2A 2JZCA 4TZ0A 4NOJA 2R4UA 1GGVA 4HYQA 4MW4A 4E14A 3E5MA 4XPIB 2ZYDA 1K9VF 4XCXA 3VO9A 1T29A 4LYHA 3SZUA 1P0IA 3ANXA 4QO8A 3KNZA 4F92B 2HU5A 1NSFA 3KPVA 2K87A 5KC9A 5BVHA 3HL0A 5AVUA 2YUTA 1U81A 2QT9A 2PRIA 1BD3A 4DQDA 2O5RA 2PKYX 5H4GA 3CTMA 3F73A 2QTZA 4ISCA 4N5HX 4E2WA 5FB3A 1YS9A 2JBWA 2R00C 1FVHA 2YCBA 3BSWA 2B8WA 4D3DA 2AG1A 3I3SR 4HDKA 2R1VB 1DHTA 1H2BA 4UW9A 2CE7A 4B2YA 1GPUA 1GZ3A 4DIDA 1PGJA 1UBOS 2GWHA 3HDHA 4HDRB 4B7AA 4F2GA 5HJ2A 4LBWA 2CL6X 1BHSA 1P2UA 1Z3IX 3AZQA 5BY2A 3GLIA 3KIPA 2GARA 3PYMA 2RIPA 4YRJA 5ARBA 1AMOA 4Z5XA 3EVTA 4X20B 1CZRA 3STHA 3SDSA 4EG8A 1G2OA 1AQIA 1H6AA 1BOOA 5IN4A 4KH1A 1CD5A 4KQXA 1E2KA 2A92A 3CZCA 2C98A 4XR4A 3ZDBA 1KEEA 2W6ID 3AF4A 3IAS6 4QDZA 4MGEA 4DAOA 4EW1A 1OA0A 1UZUA 2PMFA 4ND7A 1PL6A 2JLXA 2OO5C 3TZKA 2OHXA 4ZCQA 1ZW1A 1M34E 1Q21A 1JQ5A 3D2LA 4JI5B 4PBSA 3E2PA 4K88A 1N2XA 2Q4RA 3THYB 2A4KA 4QDJA 1U99A 1WU7A 1XZNA 4W5NA 2FQWA 2FQXA 2VRCA 3EPKA 5LB2A 4D56A 3D2BA 4MW1A 4COKA 5HE8A 2V03A 5BMVF 3ZH9B 3FLMA 5CVVA 1N9GB 5JMWA 3OZAA 5F2NA 3LK7A 4LV5B 4DLKA 1U2RA 3OZFA 1DIHA 3RC2A 2RMKA 1VL1A 3LHKA 1MO2A 1Q12A 3WDLA 1C80A 4BLSA 4GRAA 4HN4B 1N2IA 1OI2A 1TA4A 4RMGA 4XB1A 4DTIA 1WUYA 1V6AA 1FMTA 2BEWB 4CQNA 4CF4A 1L1FA 5BW4A 1KAHA 1QIGA 1BGWA 1HT1E 2J4DA 2YOFA 2VWGA 1CY8A 1IXKA 1NLZA 2QSUA 4Q1FA 2JIRA 3JQ9C 4QXQA 4CEIB 1GFSA 4OAPA 1SULA 3AYXB 2ZPUA 4J7CA 4RGYA 3S2SA 1FMCA 1PEYA 1DSSG 2EIXA 3KKEA 1P6XA 2GAJA 4A5OA 2Z8YM 3WGJA 3UFXB 3EGDB 2BMWA 1O6FA 4ZOEA 3ZHCA 2B7BA 4LY9A 2QAGC 3VDMA 3ANTA 4BMPB 1ZUIA 4K6MA 1R6BX 2DQYA 3ELUA 4C4ZA 3CW9A 4KMOA 1IHOA 1KYVA 4OQFA 2GZ2A 3UATA 4XX0B 2OT3B 2O2JA 5DNVA 5HIJA 1K5GA 3E1GA 5C4MA 5KX5A 1RM0A 5JRJA 1A5ZA 2AF4C 2IL1A 2ZJ8A 5HS6A 3S4YA 4KN6A 4PYLA 1N1DA 2C0PA 3B82A 3FZGA 3GRUA 4HWSA 4ZO8A 1R37A 3JYHA 5DYWA 2C94A 4DGSA 2ZRIA 3D8RA 2HNBA 3QI2A 1QZZA 4B35A 1QHHA 5K6RA 2WJIA 5IJ0A 3UJHA 1O6GA 1IZ8A 4DR6B 1SQSA 5TIIA 5BXYA 1E9BA 1MVOA 4RVGA 5BNFA 1OPXA 1ZYUA 5TJHA 4GUAA 1J0EA 2EGGA 4YHHB 3UOAB 5EXPA 3RAPR 5TY0A 2ZREA 3DM9B 3LU1A 4L74A 4ZYUA 1PJZA 1SC9A 2C9OA 3I3OA 4KLRA 3UCXA 4EB0A 3KQWA 1HYBA 1NPYA 4QM7A 4AMZA 1NJSA 1Z15A 3PQ3A 4D4KA 5AI0A 3UGJA 5FTNA 2GYYA 3ZY4A 3H0CA 2P3SA 4X7MA 2CSXA 3ZDEA 4B44A 2Q6IA 5JAOA 1JIIA 5MDHA 1AZSC 4QNRA 1U4OA 2BI4A 4MYCA 2HCBA 4GW3A 4FYPA 2GILA 3NV7A 4UBOA 3S5JA 1Y8RA 2QEQA 3ZU5A 5DE3A 3GG9A 1SKBA 1F9EA 1H2ZA 2J6HA 1CB0A 1Q20A 4BFZA 1CUWA 3RBAA 1UPFA 2ZRPA 3IESA 1YDFA 3OC6A 2HK9A 1L7AA 2R751 4MUAA 5H70A 4EY5A 4M37A 4AWAA 1MJNA 1GL6A 5TSDA 4F4FA 1ST2A 2C5AA 3NGXA 1VCIA 1RXSA 2VK8A 2GNOA 1L8OA 3CN7A 3H9CA 4O6VA 4XVQA 1JE0A 3ACBA 2YDXA 3JR7A 3OIWA 1NW7A 2OYRA 3OFSA 3LK6A 3P2OA 3R0VA 5JJBA 1BYIA 1KARA 1YI1A 3PK0A 4GM1A 4DYHA 2LCQA 2DHRA 3WNBA 4HNGA 3RIEA 1OTXA 3IDFA 3SKVA 4OCZA 1GKUB 2IU3A 3SU8A 3BCSA 3L7LA 4OQLA 1U98A 2WNSA 1EM8B 1FYFA 5KO2A 1KQGA 2ZBFA 1IVNA 1DC3A 1MB0A 1PHPA 1Y1SA 3EUAA 4G0PA 2CL7X 3T0GA 1PDWA 2GN0A 4DJFC 2AZ4A 2GCEA 4NCHA 2A8YA 1GUDA 2GEJA 3U3OA 2NAFA 2ZSHA 1ESCA 2EXXA 1EHYA 2Q0QA 3U7QA 4OK3A 3NBMA 3OLCX 4QPDA 4O5OA 3ODPA 4RSRA 1QIEA 4DT1A 3VVMA 2ZU0C 3KX2A 2XYHA 2BUCA 3X1MA 2OPBA 3P9KA 4XIFA 1ZGCA 4WDQA 3A04A 1W30A 1XE3A 3PD1A 4XJSA 3FDZA 1EA5A 1QFZA 4BLTA 4MS3B 5IM4A 3R3YA 1IAVA 1COZA 1PP4A 4U6SA 3TE6A 3LQFA 3T0IA 2QZPA 1UPAA 1FFDA 2J4FA 2FEAA 1R15A 3LVRE 5COAA 2WIFA 4F4JA 2GZDA 1ULUA 5CNJA 5HRAA 5HF6A 2BC9A 1PSDA 3A26A 3UPUA 1X7WA 3H6KA 1A98A 1YQUA 2IPLA 3AWIA 3PFNA 2ZRFA 5C52B 1CETA 2RGEA 3L8YA 4B5KA 2C2ZA 2HBZA 4LJAA 2J3MA 4G0QA 1X92A 1C3OB 1QG4A 1RJ9A 3EBPA 4FLMA 3E53A 4POAA 3DE4X 3LC1O 3NQ41 4Y18A 4YP5A 5EE5B 1FLVA 2ZBEA 4JIMA 3IQDB 2O5EA 1OTHA 4IPTA 4G5RA 2W6CX 2I7XA 3JQDA 4R3NA 4RKQA 4XR9A 3RABA 3GLFE 1VE1A 5B6IA 4LF8B 3VYUB 3NHSA 3H17A 1EKXA 1SWVA 1D7AA 2YIMA 3OCCA 1LRJA 4Z3OA 1RYFA 5BW6B 3U3RA 1KO5A 2EBUA 2WU1A 4MA4A 2IGBA 1TIPA 2IUSA 1L5QA 2H1CA 5EGNA 2ZR7A 1OWLA 4I36A 5KU1A 2V5VA 3MMPA 5TXGA 1P4HA 2W6PA 4JVLA 3MB8A 4X8OA 1QBKC 1Q16A 4K46A 3CWZA 4FYMA 5F9HA 4DSZA 3FDJA 4OMCA 1O94D 4NABA 1PFQA 4DZTA 1NF9A 2QE7A 5I3ZA 3CKMA 1TUIA 4D9BA 2WUEA 1N5RA 4M49A 1F6BA 1NUSA 1T2UA 2PH5A 2VDWB 1A9PA 2W2MA 1JL3A 1RLTA 3GGSA 3UUFA 1ORTA 2ZSAA 3P2JA 1LFDB 2JLAA 4XFKA 2BIFA 1PR2A 2J46A 4HLCA 3SXUA 5BWLA 3LRXA 5EE9A 5DXFA 2O8DA 5M04A 4ZWNA 2PWZA 2CVZA 1W1WA 4L07A 4CI0B 2F3UA 1AGRA 2R60A 2GVNA 4GICA 4XYMA 5DX1A 3SQDA 1EXVA 1LPOA 2QMHA 4GMDA 3OMWA 4J49A 1KZYC 1EG7A 1YB6A 2G0TA 3HPQA 4IVNA 1M2FA 3TXAA 1JBQA 3BERA 2W43A 3OM8A 2X2OA 5LP6A 1SMKA 1O54A 2GHRA 1U6KA 1V9CA 4OYLA 3RC3A 4WZ6A 2OCPA 4C7OB 4FQ5A 1GAWA 4HQNA 1LX6A 2A1IA 3QHAA 4LJRA 1JN0A 1FRZA 3PQ2A 1UXKA 3WLLA 3KEOA 2XGOA 3EZ9A 3P4UA 5D7BA 2BF7A 4FFDA 4LHXA 2YIVX 3PPYA 3CT4A 5TQ0A 3SQOA 1QMPA 1NLMA 2ADMA 3D8SA 4DR3B 1DG1G 1HG1A 3CLTC 3DZDA 1C2TA 3H11B 5GZ1A 4FZJA 5KVVA 2AN3A 2PUHA 1GSAA 2OZLA 1EWYA 2FN9A 1EGVB 1I6WA 1KJQA 5DZSA 2CDNA 1HM5A 2AI3A 3BHJA 3W2EA 4WN9A 3WYDA 1IUNA 3ZS8A 1WUTA 3SWWA 3KSBC 2O5CA 3MTAA 4HKTA 4FEEA 1U80A 4L72A 4Y2UA 3L8ZA 2RC6A 1Z7EA 3VYWA 4FFWA 4YRPA 1KZGB 2AJCA 1ADYA 3NV9A 3CVWA 2IZ0A 3MCZA 1E9AA 3V7NA 2Y71A 5E2AA 4EJ2A 4H59A 1YJXA 3D7KA 1Z8HA 3R9XA 1N3BA 1I1OA 3WAGA 1JB1A 2OC4A 2GTPA 2M6LA 4B7XA 5HTKA 5SZKB 1NW8A 2YINC 1EZ1A 1LS1A 3GX1A 4ZGGA 5L3QA 3HJFA 3ZDXB 4HEA6 4CODB 2ES4A 3K6SA 4KUGA 1R66A 2MSCB 2VATA 2ZIAA 4K0KB 3UBMA 4HQLA 3DDUA 2Z5LA 5AM4A 5CEJA 1J2EA 5F3RA 1E20A 2GBGA 3BL8A 4U2BA 1QF7A 1P74A 2EKQA 3VQTA 3RHSA 4DNOA 5FRDA 3I42A 4YRGA 4HCJA 2I9KA 2OBLA 3M6WA 3NP7A 4PZZA 2BUBA 4KHPB 4EHHA 4YHBA 2ZETA 4NCJA 5EYPA 3DCJA 3PNBA 4HOYA 1UXJA 2VP0A 3OTGA 4JXKA 1KPGA 5FWYA 1QU3A 4TMZA 2OECA 2F3QA 4RETA 1E9DA 2C82A 4JBIA 3MW8A 3F3SA 4NH0A 3T3HA 4UKDA 5KPDA 1X0VA 4WY2A 1WTCA 1DEAA 1JIXA 1QZUA 4WNAA 3LUFA 2BFFB 1HA3A 1F8XA 1ULAA 4BLWA 1GAXA 4A1FA 4DCGA 3JQFC 1YL7A 1XYYA 2BFAA 5IYZA 2WTBA 4GVXA 3AR2A 2VUUA 4H3HB 4D41A 3R7NA 4TTQA 1A76A 1Q1NA 2W6QA 2PQ2A 4QJIA 3S2FA 1DXHA 2HV8A 2EJVA 1PG5A 4S1NA 4BJ1A 3HP7A 3N6RA 4ZOLB 2FZCA 4QTYA 3WK4A 4UAUA 4MR7A 3U7FB 4FB4A 1ZXXA 2IIVA 1EFTA 1GU1A 3GHHA 4JH0A 3VKVA 4C0AC 5EHZA 1DO0A 1F0PA 4XQGA 4ARZB 4DQXA 2FN7A 2RGCA 1M6WA 4REMA 4FM9A 2K4MA 3OAAA 2LR0A 2QLLA 3R5SA 1TVMA 2IY9A 3D02A 3IQFA 4HFMA 4MVJF 1OYYA 4HJXA 3NAMA 5H3CA 3T3IA 3VFDA 5K0ZA 2IKSA 1LS6A 4P5EA 5LYJF 3X1XA 2IJGX 3V4RA 2VQSA 2P1ZA 3HDYA 4D6XA 4DQKA 4HQ0A 5DOVA 4YIKA 1FZQA 4D42A 3DLAA 1QF6A 2G4LA 1JAHA 3LSTA 4UCXA 2GM4A 3HXLA 3LT5A 3V8MA 1QDLB 2AQHA 1C1YA 2C7QA 4BASA 2MYTA 4GQBA 4QTZA 1IZZA 2CLEB 3HNOA 3JSAA 4IEFB 1QYDA 3THXA 2PQMA 3NHBA 3KZ1E 5WRFA 3IEMA 3DW1X 3O6VA 3Q15C 1PFUA 3QELB 4ZCSA 4OA5A 2ZE5A 2BSQA 2DFPA 3D6VA 5KQMA 3C15C 3SDZA 3LYUA 3SHTA 1ZD8A 3EIXA 5FHQA 3UWKA 1WXIA 2WAMA 3G5MA 1N4AA 3GJ3A 4NNJA 2EFJA 4ETWA 3MTBA 4TVKA 1EK1A 3VPCA 1R9JA 3D3WA 4DUGA 3RODA 3NKFA 1SCAA 4OK6A 3UA4A 5I47A 5TGTA 2EARA 3HJHA 3O2QB 1E1QD 2PYIA 3K2EA 3GDFA 2OUKA 3L0BA 5FTKA 4NWIA 1S2DA 3KT8A 3K1JA 4JBXA 4IIJF 3FDXA 3I6ZA 3KVNA 3LC2O 4KSCA 4HZUA 1XTJA 4WKCA 4DAEA 3CVVA 3KUDA 3UMJA 4L0CA 1JIJA 1FRVA 4CTMA 2CKDA 4E5UA 3HK2A 2RI6A 4KCGA 3K9WA 1ZJ4A 4DXHA 2JCSA 3THOA 4HLDA 3WYEA 4JC8A 5JSZB 1CUGA 4OQQA 5ESRA 5AIAA 5AR1A 1ZVQA 4A0SA 3EOBI 3QPUA 1WW8A 5A5VA 3LE8A 3N70A 2JVKA 5H81A 2HSJA 1H0RA 4EG4A 3CNBA 1SCQA 4G1VA 3D54D 4D02A 3RSOA 1VXRA 1XKLA 3B85A 3SIXA 4DLYA 2R00A 1XQXA 1U0RA 3PVZA 5EJ8A 4E1BA 5IULC 2P9TA 4ZCPA 4DR7B 1MU0A 2VA8A 1LTKA 3AETA 3H9BA 3OO0A 4S1VA 2JJYA 1OLSB 3RTEA 3IFSA 3ZI7A 1NW6A 1XEXB 3A06A 2R1TB 2XNDA 3IUEA 3T1YB 2P2ZA 1Q19A 4W5HA 1V1RB 2LTAA 3EAFA 2WYVA 3CLRC 4TLEA 1MPTA 5DWQA 1T4DA 2PX6A 2X6RA 2Q4EA 5FFFA 4CIBA 1IOWA 4X60A 2WV9A 5JSUA 3ADCA 3N8HA 3F5FA 2Q4DA 3G1TA 2CN1A 1O97D 4FI3F 4URHA 4Y6GB 3G82C 1Y8QB 3EGCA 3T1NA 1MPXA 4AL4A 1G21A 2ONJA 4MROA 2IYNA 4KRXA 1A3CA 1K7CA 2QRLA 3SLRA 3ZV3A 3A6EA 3BN3A 3UB2A 2XCSB 3VNRA 3ZHQA 3OU6A 2R1VA 3ABSB 1Z2EA 2OO5A 4GMGA 1DDOA 1SVKA 4HZGA 3OICA 3EXHB 4Y6PA 3WV5A 1MC5A 3JWJA 3VR3D 4HDRA 3AGPA 1J2TA 3LLCA 2WUVA 1XZJA 4LTMA 3VNAA 1L5KA 5L7WA 4NRDA 2W2LA 1KJJA 2HTEA 3PIRA 2DPLA 2DQSA 4YT4A 4X20A 2Q62A 5BWNA 4OLHA 2B2NA 3D7LA 2J3IA 4KFTA 4RTLA 1WULS 5C8YF 3I5AA 4AULA 4YFVA 3JZIA 3TOVA 3DMGA 1N5MA 2CT8A 2OC9A 2B92A 4YMUA 1TJNA 2NXCA 2WABA 3I32A 3WGTA 5CCXA 3GV0A 4JU9A 4KQIA 1XUOA 5JBNA 4AM8A 3UMBA 5DBEX 3U7JA 1YJ8A 2BOVA 2B34A 2HJWA 2FOIA 4UEWA 4F7DA 3NKVA 5FBKA 3VTAA 1DBPA 2Z56A 1FF9A 2BGTA 3DZ8A 1W2WB 2NPIA 3EXHC 2RGXA 2PGLA 4HDOB 1EWVA 2P35A 1RW4A 1Y7IA 3WLHA 4XJVA 3THYA 4OHRA 1MH9A 3JQ9A 2FMXA 2RGAA 3SEFA 2GD6A 2CLLB 3INTA 1T5TA 3JQ8B 4DN6A 1FVFA 5FBQB 3E5RA 4P86A 1F0KA 4U7TB 2Y05A 3C98A 3PUVA 4PGHA 4X63A 3WZ2A 5F98A 2HFKA 2Z83A 1N9GA 1UDAA 2P8JA 3Q9UA 2D0IA 1H0KA 3RYCA 3NBQA 2ONYA 2YVUA 3GCWA 2QAGA 3O3MB 1BGXT 4E2YA 4ZEOA 2QTNA 5AHRA 1RI1A 4LS3A 3SN6A 4CMJA 6GPBA 2C4UA 4Z0HO 5D3MB 3DQPA 3FRIA 3VOTA 4PIVA 4Q37A 2B94A 4XQ0A 4DCCA 1E64A 2ZB2A 1GRNA 2BEWA 5IVHA 1YQ9A 2FG5A 4Z53A 4IXMA 2ASEA 3Q8XB 3GIWA 1F12A 3EULA 5K2OA 1LV7A 1E18A 1KYYA 3TQCA 1PK9A 3QFRA 4BO3A 3ESAA 5BNWA 3IUSA 4NR0A 3FMIA 1J2YA 4U0JA 1GNLA 3OPNA 2UYHA 2FN4A 2QU8A 1LC3A 1IK4A 2JEZA 4LV8B 5CURA 1INLA 2IBTA 3L40A 3IP1A 2ZYWX 2GLUA 5I8WA 1NN3A 1ZN8A 3L9WA 3UFXA 1PEKE 2ORIA 4PLPA 5DHTA 3EGDA 2AHRA 2I54A 4HX2A 1LNZA 4QSHA 1YE3A 3W04A 5E9QA 5LLDA 2SICE 2BZ1A 4BNLA 5JWRA 3AOGA 2RJNA 3HU1A 4C0SA 3RRZA 4XX0A 3ZPXA 1LI4A 2PY6A 4DNPA 5JCZA 1Z39A 1HNZB 1NG1A 2KYRA 5DLPA 4DYDA 1E1RA 2OHJA 1X15A 1PIWA 1BN6A 4H16A 4MTLA 3U3MA 3KQQA 3UXEA 5KVSA 1SURA 1W5FA 4AG6A 4BE4A 4N7JA 4J0HA 2IDJA 4Z6KA 4A0QA 1Z75A 3THWB 5GV8A 3AR7A 2R8YA 5A7GA 1S3FA 1C3LA 4BLVA 2NSJA 2ZWVA 3IT1A 3OETA 3Q9NA 1MB4A 4KO1S 3H8SA 3OURA 5JDCC 3SHFA 4AY4A 1U3TA 3RVOA 2GF0A 3OA0A 2W6JA 3LXMA 3WICA 1QQTA 3STTA 4E1AA 3ECCA 2ZUDA 2FZLA 4YI3A 4YWHA 1Z0DA 3OQVA 5FXMA 3L8MA 3NNNA 2KX7A 3DOEA 1SXJB 3BK7A 3ENKA 1MOZA 2HUNA 4AJ2A 3C5HA 3QQPA 4KVZA 4GIBA 3OOSA 1L4NA 3RFCA 3Q2KA 4LHVA 1S1MA 4EEXA 4IS2A 4OJTA 5TPZD 4DCUA 4FTWA 1TM2A 2NSHA 3DZFA 3U19A 3WGYA 5JNVA 3ZDZB 1E0JA 1LTQA 3FOEC 2JDIA 1CQZA 1H8HD 4MUEA 4OB8A 4ZI5A 1DXYA 1H4QA 2R65A 2RK6A 4MKZA 3C87A 1B2RA 3WLPA 2EGHA 2FUG1 3K0CC 4K9OA 3EIQA 1CZLA 4KYUA 2G06A 4C1NA 1M75A 4BVAA 3EDMA 1T9GR 2JFOA 1N57A 2UYQA 1BDJA 4UEOA 2WY2D 3Q3CA 4Z2AA 3D9QX 3KOUA 1BCRB 3NC4A 1WUHS 1URPA 1YJQA 3EEIA 3L7BA 2AC7A 1V16B 4QJ5A 3FYCA 3V1MA 3V4ZA 1C3XA 5FCDA 2X1LA 1GM5A 2GRJA 5K01A 5C7YA 1PZGA 2ERCA 3CW8X 4BTEA 2H92A 5GOZA 4YEDA 1LBEA 3AG5A 5ABPA 1N2HA 3QVWA 4JL8A 1Q17A 1PWHA 3R7SA 1N25A 3OZCA 2PLFA 4FT2A 1J33A 3LW7A 4IHJB 1I24A 2JH8A 2V5UA 4KXWA 5I8ZA 4EOGA 4QT4A 1OYVA 4LJSA 3RS2A 1Q91A 4OU5A 4WLNA 4AW9A 4DJEC 4DV4B 1YHZA 5JLAA 1GUYA 5EJIA 4EY3A 3R40A 3ER9A 2J31A 4GUDA 3B9RA 1U5CA 3ZCUA 4DLTA 2H06A 1PBTA 3G79A 1P1IA 4PYNA 4YLEA 4ZZ1A 2H00A 3F4KA 4CLXA 2C4MA 1QHIA 2OXEA 1V96A 3G88A 3NUZA 4EMUA 2CLOB 1JHYA 3VUEA 3IC5A 2V6IA 4LE0A 3NWPA 4FDVA 1UP6A 3SJ7A 4HGNA 1NDUA 3WGIA 1XAGA 4MS3A 1E63A 1QIFA 4DBZA 2Z2ZA 1YR2A 3BZUA 1C8KA 3EDRA 3D64A 3K5WA 4E46A 1DQZA 2JFZA 3EZXA 3PUZA 5J23A 3FNEA 3WLMA 4KE7A 3MM4A 3MAAC 3JALB 2JCGA 4W1RA 4MQMA 2CJFA 1HURA 4EVQA 1N2EA 2GJ8A 1P5JA 3RFFA 1F0NA 3VI3B 3OQOA 2IH4A 1OX5A 1TQ4A 5EXTA 2H3EA 3AY3A 3HU3A 3QKRA 4I50F 4QOFA 5GGYA 3RWMB 1C3OA 1I3NA 1D2MA 3E9QA 4AX4A 2JAPA 4N4AA 1YA8A 3B12A 1P4RA 1TU0A 3O4JA 2I66A 4NBTA 1YR6A 2EAUA 3OCJA 1BRTA 3MG9A 1PFGA 5K0SA 3GEIA 5C1IA 1NXSA 2CNLA 4X90A 4G89A 1PNOA 2OESA 1EQ2A 4CT0A 1G2IA 1V45E 2CV0A 4O2LA 2JIQA 4LUCA 4N9WA 2YXLA 1L0BA 4KN5A 5TARA 3VZCA 1MOPA 3IVGA 4JA2A 1UK7A 1WPRA 5JXGA 5KTSA 4GE3A 3COVA 3FSEA 4HGQA 3S81A 2C9BA 4PCVA 5JD6A 3C8MA 2NP7A 3BQ9A 3GEDA 4JEHA 1W4ZA 1MXFA 1CUSA 2Q4BA 3BCRA 2FSFA 3WLSA 3D59A 2H1IA 5TF4A 2GPWA 3C5WP 4EVRA 3EPHA 3B3JA 4HNUA 5LQJA 2V3VA 5KNCD 5CDTA 2QNBA 4J03A 5FV4A 1E5LA 1A7AA 5T4BA 3N6VA 5ED0A 4C2TA 2Z8ZA 4R98A 4A6PA 2Y2VA 5CYFA 3WB2A 3ZZNA 3DZGA 4Z4FA 4H77A 3AF2A 2VPWA 3FCAA 2YHSA 5HIIA 3Q2IA 2OM6A 4HADA 3ZTYA 2G36A 3HXTA 1WSWA 2WJVA 5LQNA 4EPRA 1RPZA 4FCTA 4LCEA 3WOHA 3CZ9A 3AONB 3GJYA 2HWYA 1CTQA 1CUFA 2IYRA 3DKKA 3FMGA 2SKCA 2XUPA 4J0GA 5AI6A 1WDWB 2FXIA 4O2AB 3UTCA 5C8XA 1HRDA 3DBLB 4PIPA 2C0CA 4LY3A 4ZARA 1O89A 3WSVA 2V7TA 3CC8A 1UQUA 1J2UA 2GZ1A 3BA6A 3JQPA 2A9VA 2HDHA 3BF7A 1VXOA 4RZXA 2I3BA 2VJQA 1EK2A 4TKZA 4DKXA 1X77A 2WE8A 4DLPA 2L42A 2C96A 2OAGA 3GFVA 4J0FA 2WR8A 3TK1A 3AUFA 4P4LA 2HJRA 3LFTA 1QTQA 4NCBA 4AZ3B 1AO0A 1V0JA 3MAGA 3P8ZA 3WGNA 3WAJA 1QHGA 4IDNA 2AFVA 4TV8A 1GL3A 2G28A 3EGOA 3DLHA 3G9TA 1IUPA 5IVKA 3GRCA 3RVRA 2BT4A 5CA1F 4BKRA 2LDXA 4PRYA 2VDNB 3H11A 4UVIA 3Q9LA 4R7TA 2H4HA 2WPDD 4CKWB 2UYYA 5EMHA 4ESOA 5ALSA 1TUBB 1VHWA 2GKOA 3MT7A 1L5OA 3ESXA 3GNLA 3QGMA 4HNAB 2HGZA 5AKZA 1KI1A 2HQRA 3CCCA 4A8TA 1SKYE 1E79A 3FCYA 5CXXA 2G77B 1FA9A 3LG2A 1B4DA 4TN1A 4GRDA 4Q9HA 4KRYA 5H82A 1ODLA 3IUJA 3SS9X 4EKNB 4AMYA 2A9FA 4CUZA 5JJKA 3HLKA 2Y1FA 3QEMB 1KJIA 1ZMOA 3REOA 3VR1A 1WDMA 1FFYA 1J23A 5BSMA 2I67A 3CF2A 2BN4A 3DNMA 3N0WA 1PJLA 2LW7A 3IB3A 3ZZUA 4ZK6A 1KO1A 1QUFA 2D0PB 3Q10A 2D06A 3R3ZA 4DOMA 3PR1A 4IG9A 3GNQA 5KOYA 2QPOA 4WK6A 1TTHA 3MCVA 4EECA 2CF5A 3BWEA 3QUBA 5BP7A 2O2XA 1AKQA 2AD1A 4Q01A 3IHKA 3JQFA 3MQ4A 1QGED 3C3WA 5EWJB 3LOPA 5CB0A 4TLBA 3DVRX 4Q7EA 1BJTA 4UATA 4Z9AA 1ONBA 2YFQA 2NZWA 3LWNA 4QVKA 4EZBA 1P62B 3PICA 3CPEA 3PUYA 2HSDA 3L79A 4IIVA 3JQ7B 2JKYA 5KNLA 1K89A 1YZHA 1XDDA 3Q7TA 5SV2A 3HXMA 1V43A 1IBRA 4TS9A 5K3SA 2E4VA 3V8NA 4INJA 3FUVA 4FHZA 4C4OA 1PZNA 4CM7A 5A9RA 4R8RA 4MYTA 3AV0B 3EZGA 3R2JA 2CJXA 1W76A 4LOLA 1XPOA 3E15A 1VHDA 1V2GA 3FVRA 2LPMA 2WM8A 4J76A 4R8LA 1GXSB 3GDWA 3TYXA 3OZXA 2PUGA 1QO9A 1FL9A 3CVUA 3K9HA 3MRVA 1VIMA 3TZBA 1Y9DA 3QVKA 3QY0A 4FDLA 2PK3A 1JEYA 3V1UA 1FLDA 1W2GA 3E22B 3EPJA 4N5LA 5AOVA 4LDPA 3GEBA 4Y2JA 3A9RA 4GX1A 5CLFA 4Z4GA 1NBMD 2VHCA 1WVIA 4JZYA 4EELA 4S2EA 3VUFA 1U8XX 2QGFA 3OPMA 4M1KA 3W5HA 4HTFB 4YQEA 3ZK9A 1HE1C 4PS0A 4YRCA 1JR3E 4ANFA 5J58A 1XN4A 4B32A 2HK7A 1JTEA 4O3FA 4RZSA 4U5QA 1VP9A 1VKRA 2WA1A 1Z56C 4RDIA 4V3CA 5EJGA 4XFDA 2R7MA 4FZRA 3F9IA 4OF4A 5DISB 3ZX5A 3TX6A 2YXNA 2WHXA 1TAGA 3KHUA 5G4KB 5TPWB 4CF6A 4YUXA 3PUKA 5ITZA 3BD8A 1B0PA 4E6PA 4JR0A 4GXRA 4C07A 2ADOA 4BEWA 2ZJZA 3QIVA 2JCVA 2FK7A 4W82A 3GJ5A 4MDHA 4AYTA 1ZH2A 3ASUA 3W4IA 3WIBA 1SC3A 1XTQA 3BXXA 2QD1A 2XWJI 4LKRA 1TQDA 2HEIA 3MWJA 5IC4A 4QXAA 1OH8A 1JU4A 3OC0A 3RVSA 1W46A 1J0DA 1U3UA 4RTMA 2YWFA 1Z73A 3MQ2A 4ZV4A 2WWYA 3NHZA 3OT1B 1E3WA 2JFQA 4FILA 3S44A 4ZQHA 4UXIA 3KQOA 1KU0A 3MUOA 3FMFA 2CLIB 4EM6A 3LA6A 3SFVA 3L7MA 1UT8A 3M1AA 1YQDA 1JJAA 5CT6A 4G26A 4E09A 3EEQA 3OWHA 4INAA 3F2VA 1U02A 1LI7A 3G8YA 1CRPA 3GGDA 1BDIA 3WGOA 2KJQA 4G5HA 1QR2A 3IBGA 4ND5A 3VH2A 5J3JA 3TS1A 1MEOA 2FSPA 3QJYA 4ZEMA 1HOTA 2D1SA 3F49S 2TMGA 4FUQA 3A2NA 4G3XA 4BNYA 1WLYA 1X7ZA 2RB5A 2OGSA 1B0AA 2J9XB 4JUIA 4BTLA 1VI6A 4WOKA 4OLBA 3NC1C 1S4MA 1P6UA 3EY4A 4CTOA 4EARA 1XPRA 3LQRA 2KSQA 3K20A 5H68A 3K31A 2WWHA 4N18A 4F85A 5KNDA 1DXQA 5GONB 4EWLA 2ZJ7A 5JSZA 3KC2A 5ERXA 3SQLA 4IV5A 3WA6A 2AJBA 4IQ8A 4K6HA 5KVAA 5KTKA 4TV9F 4LJ8A 1NR7A 4QPZA 4H18A 4ZZ2A 1JHMA 4MB2A 2ZTLA 4F91B 1SD5A 1YSCA 2YV5A 5JZ9A 1Z3CA 4U7FA 1JEAA 2NSDA 3AF1A 1VBFA 2LZ0A 2ZR9A 5ADWA 2WAYA 4PZ0A 1N6OA 1BWRA 2A5LA 3FRHA 2H54A 1WP9A 1OLSA 4NSNA 1KU6A 1W5EA 1H85A 3GU3A 4OYHA 1XEXA 1MF7A 2W2TA 1UBNA 2YV2A 3ZCRA 4B6JA 1ZMXA 2X4GA 2FI1A 2EJTA 3SC4A 4DC9A 4Q6BA 1V1RA 1H5UA 2ZWMA 4XEUA 1JPVA 3WG9A 2WU3A 1W0JD 3RT7A 5EIHA 2PAAA 2IYOA 2ZRKA 3GWGA 4F3YA 3W5AA 3ICQB 5J1TB 5ISMA 1JHPA 2BONA 2VDRB 1VTKA 4DQVA 4JUCA 4V0LA 2QI9F 2AOUB 3HY6A 2EBHX 3B38A 1Y8QA 2IV7A 2ZT5A 2XNCA 3F3KA 4PYOA 5T4EA 2QVCA 3WDSA 4AO6A 2CLSA 2VRWA 1G9TA 4A26A 1CZHA 1YBHA 1ICIA 4ZTBA 4DCJA 4E07A 1U65A 5HA5A 2O1XA 3AKDA 4D43A 4W9MC 1ORWA 3O1JC 4BLRA 2WWVD 2QTLA 4W7HA 2RGGA 4AJ4A 1S89A 1SUEA 1RKBA 3EXHA 3ICCA 4IDAA 4E4YA 4IDQA 1IHPA 2QTVB 3K6RA 4U6NA 4P22A 5TX7A 2FUNB 2UAGA 4KR0A 3A4MA 4DF3A 2W7TA 3A11A 3AW9A 3OIDA 4FFMA 4LXYA 1RWQA 4QLAA 5A3QA 4Y9DA 3RVDA 4H7HA 5KYNA 5KYYA 3HBJA 2IUUA 5JR3A 2YXPX 1T9ZA 2HNKA 4NBUA 4JI6B 4QQ8A 4X41A 1FSSA 1JP7A 3A14A 4LY0A 3ZJ4A 1RM4A 3BWBA 4OXNA 2WD8A 4FUTA 4X00A 1PAUA 1TIBA 3AUXA 1VKOA 4FC6A 4K8RB 3W9SA 1RPJA 5EN4A 4CMGA 3L07A 1U8CB 3K8YA 4AY5A 3ZC3A 2CUZA 1T5HX 3GH1A 2Q5LA 1TDJA 2WSYB 5LOVF 3DEYX 4ISBA 1YZUA 5P21A 3T3NA 3JQ8A 1Z4NA 1O5TA 1I13A 3IEIA 3OCVA 4G63A 1NBEA 1O6CA 3QMWA 4QO7A 4YJ3B 3PGMA 1XHEA 1MNQA 2GJ9A 4H7DA 2YWGA 3OLYA 4O5AA 5AKHA 3RVJA 3JRXA 5HIAA 2ZYGA 2R6R1 3KZKA 5KWEA 4OI1A 1X9HA 1U2ZA 3GF4A 4TKVB 1GPMA 2QTCA 3HB4X 5D3MA 4JAVC 2UZAA 3SMQA 1UMDB 4K3VA 2BMEA 2P3OA 3HZOA 4CG0A 4IJMA 1BXRB 3T1TA 3MTEA 3ER6A 3FYHA 4NMWA 5FOVA 4EL0A 1D2HA 2AUMA 4RD1A 5BWOA 3RK4A 3VU8A 3VR5D 1JLKA 1Q3HA 2P7HA 3M33A 3K5HA 1OSNA 2FN8A 4FGZA 4PHTA 3EPLA 3TFOA 1ID8A 4X54A 4AS1A 1T91A 1C7ZA 1NZDA 5JDCA 1EE1A 1Z37A 2ZJ3A 3H0EA 1CNEA 5T57A 1Y0BA 3QMMA 4FFNA 4YJFB 2GNPA 3R09A 2QPTA 3BQMB 3W4KA 3QV1A 3TKYA 2DPHA 2VNSA 3V8QA 1F4VA 1T5BA 3M5DA 4FKZA 4F93B 1T9GS 3LW8A 4KXXA 1VE7A 5AKIA 5DRYA 2NX2A 3E7PA 4J6FA 1XCPA 4OHOA 3VXKA 1HEYA 1OFVA 2BEUB 2QTRA 3PITA 2IEZA 3Q8KA 2A1UB 5IT9A 1VQ1A 1I1NA 3A3NA 3G9ZA 1UBLS 1XL0A 4ZVPA 1KA9H 5LDHA 1XXHB 4RPLA 3IR7A 2AGVA 2NO7A 1FP2A 4L9AA 1XVUA 5A71A 4N6NA 4WNYA 1PHRA 5CGZA 2I71A 4K9NA 2BELA 4AIRA 5M29A 3BMCB 4J16C 5IC6A 3K0CA 2O07A 2HJVA 2ZIGA 4FN5A 1D4AA 5CCDA 3IKLA 3UGKA 3WL5A 3GJ7A 5LDGA 1TF5A 3LT0A 1T43A 4Q02A 4MZDA 2C83A 2ZS8A 2QZ4A 4ZO7A 5LR6A 2Y1EA 1UOQA 2PMDA 3AJ8A 4O8CA 4RVDA 1T5DX 4JMPA 1U1CA 1YIOA 2CMGA 3U44B 1Q0QA 2H1WA 1OWMA 1EUCB 1SXJE 3A9SA 4P5DA 4IGFA 1T8YA 4M7RA 1HX7A 1ETHA 2FW8A 4AICA 4IF6A 4GZLA 1GYPA 1KZ6A 2O1SA 4F1WA 3V4OA 2BBOA 2NTVA 3A27A 4FS3A 3ANNA 2A9QA 1AQYA 4XVRA 2BGLA 1KRWA 4U2CA 5EPEA 4FMCF 4LYJA 1IPFA 3UT0A 4MAMA 1Y6RA 4BKPA 3L2OB 4O1IA 4ZVKA 4DPMA 1BCRA 2FQQA 1V16A 3KKPA 5EG5A 1TJ4A 4G0ZA 2XQIA 4CIWA 2O0JA 2J33A 3LX5A 4KE6A 4OX9B 1KJNA 1DAGA 2PRSA 2VT6A 3KZXA 1HLPA 1N6NA 1YCGA 4YC7A 1PKXA 4F1KA 2GM3A 2G1KA 4HY3A 1K9SA 4OATA 4Q9DA 4LWPA 1FS4A 1CJUC 3FSGD 3LQQA 3RARA 4BNJA 1SXQA 1TECE 4IHJA 4KR2A 2YC2C 3I1YA 3MJ4A 2Y3IA 3UPTA 2V98A 5K6AA 4OH7A 1S1CA 2PMCA 4Z4EA 2NVUB 2VHEA 3BRWD 1KDPA 1NMYA 4G37A 3V2IA 4DLZA 2OCGA 3K05A 4V2UA 3TTTA 3NG1A 3PX7A 3QA9A 1RYHA 1XRMA 1C4OA 4OHVA 4N12A 5F64A 4EKYA 2CLHB 4GKBA 2ZATA 3STXA 3ZDYB 2GPAA 3OU7A 3OFJA 1SO8A 3Q5EA 4LV6A 3EDQA 2A84A 4G4SP 4O4JB 1ST3A 1WIWA 2HREA 1P0MA 3JYQA 3OFVA 1U04A 4CQLB 5AP9A 3F6BX 4LJ6A 2O2DA 2C2GA 3RSQA 4P84A 3UQYS 4URXR 3JALA 3MJHA 1XTIA 3ADPA 3D8HA 4NENA 4CF7A 3HI6A 3ZG6A 5FBZA 3R6DA 4LC0A 4P81A 4L0MA 4ARSA 2EFGA 2HA0A 3DTYA 4Q9NA 4WN3A 4COOA 2G83A 2YN0A 2ZG6A 4Q9AA 4WD3A 2XODA 2EKDA 3RIXA 1VYTA 1PR5A 2VS1A 2A5YB 3CUKA 4N76A 4RZ2A 1BO6A 2VK1A 3AU8A 4FXOA 4WA8A 2ZI5A 4N7RA 3TL6A 3IP7A 1YIDA 3R7FA 3HCEA 3E7DA 1R4AA 2X8BA 3LKBA 3VSAA 3FPJA 4K0RA 3GMDA 3HHPA 3UPDA 3UXHA 5K0EA 4ARVA 2D8AA 1R6VA 1UPXA 2LIVA 1M33A 1PV2A 2I3DA 1GAEO 8ADHA 1V37A 4RFVA 4CHGA 4H27A 3RASA 1MAHA 4ER7A 1N5JA 4EFNA 1JQEA 2H85A 2Q46A 4ZCRA 4WXMA 1SVUA 2MSKA 1DNPA 3EDOA 3N2LA 1VA4A 1ZIDA 3KAJA 4FNOA 4PCUA 2CMDA 1KZ9A 2FWMX 4HSEA 1HT0A 1WUIS 3C14C 3FUCA 4E13A 4K05A 4FBMA 3OLVA 3I9OA 1XZGA 2JIOA 3N9IA 3WLKX 2NWQA 1E1YA 2HMYB 2MYUA 1QJCA 3HV0A 1CQIB 1OX6A 3FBGA 4KTVE 1J6UA 2QG6A 1L7DA 3OBIA 1Y81A 2XE6A 4HEHA 4MUHA 4QT0A 4C3ZA 5BN5B 1MH1A 4JBWA 3UJPA 1CEXA 1AMNA 3RLFA 1GPJA 1KPHA 2R47A 3RTCA 4RTNA 4O2AA 1YB4A 3I5MA 3AI1A 1V9LA 3DBLA 2RB4A 2IHZA 3S8EA 2FCRA 1BJKA 4RO0A 2HLDD 5DDIP 1L5VA 3AL3A 2VJBA 1ESZA 1P3Y1 5JNWA 4XH9B 2XADA 1KF0A 2OZEA 2DCMA 2NYUA 3W05A 2QR3A 4AZ3A 1ISRA 4M7PA 5B1SA 3IT2A 4X6LA 1JA9A 3RB8A 5K8TA 5L3VA 3AB7A 1N5OX 3O90A 1QCCA 2V3CC 2CBGA 1EE9A 4XUGB 3TZEA 2B61A 4JOCA 2JFBA 3FVQA 4BJ5A 5FR2A 1CW2B 2D74A 4ZZ0A 2W4IA 5F4BA 1TGYA 4ZCIA 3L1KA 4RK7A 1EFDN 4KNYA 4G0XA 2FQ1A 1TUBA 1EJ6A 1VLVA 3UAWA 4HNAA 4YLYA 2GZ3A 2G5CA 3H8JA 5CFQA 5DHAA 1F3LA 3MRTA 5HJEA 1EBUA 3HLYA 4QYSA 5CH5A 1Z13A 2V9ZA 5FEMA 3ZLUA 4CBVA 4G4SO 4WKNA 3FYUB 4ARUA 4PO1A 3SJCA 1Q7EA 3DTVB 3FWHA 3L04A 4MDEA 3W78A 3EGEA 4RQUA 3QEMA 4S2UA 4OHWA 5LIRA 4FMPA 3SBXA 3F67A 5AVQA 2PGIA 2AI1A 1VL6A 4J4HA 4WNCA 4X7BA 3Q11A 2WDPA 2PANA 2Y4NA 4GLOA 5J5CA 1EDEA 5KU7A 4GZ5A 3RLIA 3HFRA 3BG5A 1EFRA 4P35A 5F35A 2CZQA 4TWJA 3WLRA 4BCCA 3FOFC 3TLZA 1NVTA 5K0TA 4RZIA 1U1FA 1S8AA 2VYVA 1HLGA 5KTRA 3ENZA 4GPBA 4HNRA 5EWJA 2WAOA 2HRZA 3Q88A 4B33A 3K6KA 1C9EA 3FYUC 3KJQA 4FNMA 5IH7A 1A8HA 4FCVA 1E2NA 3ETJA 3CCBA 3B6JA 2ZTSA 4FFRA 3KETA 3OY7A 1K7FB 1RQ2A 2ZYTX 4CKEB 5LMZA 1GTVA 3GFFA 1Y80A 1M2KA 4K3UA 4YRTA 2J3LA 4GM4A 3DEFA 5KI6A 2OBNA 4ENQA 2XPCA 2PXHA 2QJOA 1X7DA 1Z7BA 1Y4UA 4NU5A 4HNQA 4I6JA 4NLLA 3ZIAD 2JC3A 4B3CA 4B3XA 3L77A 5LN1A 4QVIA