3OT1B

Crystal structure of vc2308 protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
195
Chain Sequence
MSKRILVPVAHGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADSTALLALIDAFSQQGKLVAAIATPALVFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVAAPMVLHPQQLTELSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VC2308 protein
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Structural genomics
molecule keywords 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthes
total genus 63
structure length 195
sequence length 196
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ot1B00
1QVZA 4AUMA 3NOVA 1KWKA 4XLLA 3EN0A 1A9XB 3VU3A 2YWBA 1CS0B 2VRNA 2YWDA 1CE8B 4N12A 3D54D 4P35A 4UOZA 1J42A 3B36A 4ENVA 1OX4B 3ZR4B 2RK6A 1I7QB 3N7TA 3TTYA 4MNTA 2AB0A 3SOZA 1OX5A 3SF8A 1PE0A 3CNEA 1CF9A 1S1MA 1GGHA 1P81A 2GK3A 3ER6A 4B7AA 5K4AA 2H2WA 1QWSA 1IZYA 1FY2A 1PDWA 2ZUUA 2W7TA 3EZGA 3OT1A 3P9RA 4ENTA 1IPHA 2YWJA 4S0ZA 1GGEA 2AD5A 2VXOA 3TTVA 3NONA 3WFZA 3CYFA 4BTEA 1T3TA 4OQ4A 1L9XA 1P7ZA 1WL8A 2NV0A 2VPIA 3ZJ4A 1SOAA 1Q2UA 4WINA 3UJNA 4UNIA 1KA9H 3RHTA 3UK7A 4Y1FA 3PQ6A 4B2YA 4ADSG 4ENPA 1GGKA 5E9AA 5DFAA 3B3AA 4P5PA 4LGYA 3KKLA 4D1YA 4BFLA 1R9GA 2OR3A 4R7GA 4AJ9A 1G2IA 1VHQA 3TTUA 1C3OB 3GRAA 1C30B 4B5KA 4ZDJA 3UGJA 1I7SB 4Y1RB 2R1UA 4Y1RA 4B40A 1BXRB 3CZ9A 4GE0A 4ENWA 2LXNA 3PQ2A 4L8YA 3PQ5A 2WJZB 4AULA 4AUNA 3BWEA 1T0BA 4GUDA 2D7JA 4E08A 3EWNA 2XF2A 4PXYA 3L4EA 3R75A 1T36B 3F5DA 4I4NA 2YWCA 3CY6A 1P7YA 4ENUA 1IZZA 1O1YA 2GHRA 3MIIA 4WXYB 5BV2P 3L18A 3EJ6A 3P9SA 4L78A 2ABWA 1SY7A 1KWGA 1UCFA 4UZSA 4B31A 4P36A 4N0MA 2ZUVA 3B38A 3UOWA 1FYEA 1ONSA 4LRUA 1M6VB 3EFEA 3SF8B 4BIMA 3PQ7A 1VCOA 4OIFA 2ISSD 4OGFA 4L8FA 2FEXA 2IUFA 1OX4A 4L95C 3NVAA 4ENQA 3PQ8A 1GPMA 5IP5A 4OGGA 4ZGGA 3UMMA 1PDVA 4JQSA 1I1QB 3F71A 1GGJA 2NV2B 4I46A 4Y1GA 5SY6A 3TQIA 1JVNA 3P9QA 4I2NA 1OY1A 1QDLB 4RKWA 2ZUTA 3OT1B 3R74A 4E5VA 3NORA 4MGHA 3R76A 3BHNA 5JZMA 3TTXA 4L7QA 1OI4A 1P5FA 1U9CA 1VCMA 2ZUWA 3L3BA 3TTTA 4K2HA 5SY9A 1QF7A 3FIJA 4Y1EA 1KXJA 4P2GA 1QVVA 5LIRA 2R1VA 3M3PA 4QYTA 3L7NA 1K9VF 4ENSA 1PV2A 1QVWA 2A9VA 2ZUSA 2R1TA 1Q7RA 3P9PA 2VKTA 3CZAA 3ZJ5A 1JDBC 3TTWA 3TTSA 4AUEA 3PQ4A 3PQ3A 4OFWA 1N57A 2R1TB 2V4UA 4UOQA 1P80A 4GE3A 5SYAA 2VDJA 5JZOA 4Y0NA 4P34A 2R1VB 4ZDKA 3FSEA 1GGFA 1VCNA 4RKYA 2RK4A 4HCJA 1GPWB 4UCFA 3NOQA 4MTCA 1OX6A 5SY4A 3MGKA 2RK3A 4ZDIA 4L8WB 4QYXA 3NOOA 1GG9A 4ENRA 4OJYA 1KEEB
chains in the Genus database with same CATH superfamily
2ZUCA 2HKIA 3EZXA 4R40A 3TSYA 5JH7A 1ZNZA 1PJ2A 5JROA 3MN1A 1YB1A 4JQCA 3K1TA 1XN1A 3NT5A 1QGDA 1AV6A 4AURA 1J0EA 2QGNA 4V02A 2XZOA 1F5SA 3KOXA 1D6SA 1QK5A 4CR6A 4ZI7B 1A4IA 3CUKA 4N7MA 1W96A 4AMYA 2GFHA 1KI4A 1FZTA 4FE4A 5J2TF 4G0MA 1JFFA 1EA5A 4HDQB 5LMUB 3EQ2A 4Y2SA 2DPLA 2GKSA 3TVYA 5TLSA 4QOIA 4M1ZA 3B78A 1KIMA 1U2SA 1VRWA 3I8XA 2FJPA 1PWEA 4IDEA 4JOQA 4MQ6A 1ZP6A 5COQA 3V8PA 1E6LA 2A9PA 3PNOA 1L7EA 2IHVA 4B2YA 3VBEA 2P5YA 5CX1B 2VT6A 4CEIB 1JR4A 1KO8A 5TDHA 3NANA 1ELOA 1DCMA 4TZ0A 3ESQA 3S27A 3RSHA 1YS1X 2Q8PA 3GUYA 2BR5A 2AJBA 4W1PA 3OEWA 5JXHA 2AI1A 3M9LA 2QR5A 1RAGA 4MUMA 1EIZA 5LWHA 1F7UA 3VTFA 5HBRA 2V7PA 3R9KA 3DMYA 1DWPA 5K09A 1PNTA 4Q9LA 1QV7A 1QYWA 2ISQA 3UC9A 4YRNA 3REGA 1DC4A 2CNNA 3BN3A 3LQYA 3ZZNA 4ASUD 4EUSA 3ESZA 5GINE 1XTBA 421PA 2O6HA 4M49A 3I05A 1FOEB 4JVLA 2Q3EA 5DHTA 5HJ7A 3UJ7A 5DX0A 5EXEA 4LBVA 3BCSA 4AY2A 2JFGA 4LNAA 3DTYA 2EKZA 4RPIA 2F67A 4YJ2B 3UWSA 4KFCA 1WBDA 2GVDC 2WA2A 1U0HC 3HACA 4MKFA 1JLSA 5KSOA 5EHZA 3X2EA 3E3NA 4MTLA 3HDTA 1VI2A 3SZMA 3B9RA 2VHWA 2JJ1D 1WS6A 4I5FA 2HSDA 5ITZA 1VGVA 2WYUA 1F9EA 1IAQA 2RCNA 3C97A 3HS3A 2XUPA 3AY3A 1LQTA 1SOWA 3I32A 3F5MA 4BN0A 5ILOA 2XUZA 3EIWA 2JEYA 3RRBA 4UD2A 4P1ZA 3AKDA 4YJGA 2JJQA 4UVHA 4OHRA 4L5BA 3WP1B 4NTZA 2JD0A 1FUKA 2H51A 3MW8A 1A7JA 1WDWB 1UBKS 1U3TA 1SB8A 3AFIA 4MQUA 4LWQA 4RORA 4XFKA 2FOLA 4LGVA 2HX1A 4NFYA 3RHZA 1U02A 2ATEA 2ZS7A 3DLTA 2V7WA 1M8PA 2QZJA 2R65A 2YFKA 3N05A 5JJIA 2YZGA 2FF7A 4ZT2A 1XRMA 3QPBA 3EMBA 1ISMA 1G5FA 1KO7A 1NMQA 2Z6QA 4KP7A 1JNYA 3D2LA 3B3JA 1F4VA 3TE6A 2XNKA 3IH5A 4C1NA 5A5FA 1K3FA 2PKYX 2GPAA 2X3YA 3NM5A 4PU0A 1ZD3A 4R16A 4MPJA 2PGJA 4WEOA 3OQIA 3UMFA 3QP9A 3P9ZA 1PS0A 1A7UA 4GKJB 4UNPA 3ZDEA 3R44A 4LWOA 4QLAA 4ZAWA 3LLMA 3NASA 2HPVA 3CB2A 3PNQA 3PGVA 1X86B 4GS5A 3ZWKA 1U5CA 4GI3A 5ITZB 4WDQA 2FN4A 4EG7A 1THMA 3HEAA 4DWWA 9MHTA 4JQZA 4M1TA 3TQFA 3MGCA 1A76A 3V1UA 1PT7A 3WWDA 1Y1PA 2DLDA 5L4NA 3OCYA 4TT3D 3TXYA 2MSCB 3QKTA 3P27A 5LPNA 1MB4A 3KPYA 8ATCA 1SBQA 4BL5A 4BNJA 1B0AA 2C2ZA 2WSBA 2AQKA 2C4WA 2P5SA 4CIVA 1QTIA 4I9UA 1YOVB 2OQRA 2VQFB 2NXNA 2YWJA 3BRQA 5FPSA 1G5RA 4RY2A 2B1JA 1X15A 1NG9A 3H0EA 4MZXA 2JIQA 4W1SA 4AW9A 2GR9A 1RS0A 3SYLA 1LLCA 3OP4A 4V2IA 3RHTA 5LSAA 4N8EA 3UY4A 4HZIA 1OWLA 4CU2A 3MWLA 3MWGA 2PE5A 4ZN6A 1ICEA 5KNLA 1TT5A 2MT9A 2RHHA 1D2RA 5AOVA 4BGVA 3HNPA 4C08A 1USVA 2IYEA 5LXTB 2J07A 5DIFA 4Y1RA 1L5HA 1HDGO 4KQEA 4K6HA 1FRNA 1FVXA 4M1KA 2WP8J 4C6HA 5A5GA 3UXYA 3GYBA 2OOKA 3LHSA 3NEJA 1QG0A 2P1RA 1W0CA 3TNJA 2CK3D 1ORWA 1SQ6A 1VFPA 1QS0A 2I8CA 4LKOA 2VJOA 3SQNA 4ALNA 1W49A 2QZSA 1XELA 1WDKA 3GDOA 4PAGA 2OK7A 1SK9A 1P1FA 1QHSA 2ZWIA 3JWEA 3KQWA 3A2NA 3LT2A 1JAYA 4ZOLB 1A7AA 4IWYA 2G71A 3ZE2B 4F6RA 3KZCA 3KD3A 5GIPE 5AHWA 2Q9CA 3RO7A 3V97A 1FCJA 4L0QA 1BHO1 1PR2A 4MI6A 1UXOA 1ZW1A 3WGQA 3ILYA 5KOIA 1S7CA 4XA8A 3VR0A 2PKQP 1TJYA 3DV0A 3ZTTA 2QM0A 2ZU6A 1VJGA 1YGPA 2YX1A 2RE8A 3IGFA 2PUVA 2XIJA 1DLJA 2NT3A 3BCHA 3GJRA 4R31A 2JATA 1TTPB 2X6QA 3ECSA 3REQA 1GNTA 2Q2NA 2QTAA 2CMKA 3MWKA 1RBQA 3RIGA 1EEXB 4Q3OA 3HO6A 4U7JA 3PTLA 3VZDA 2JLXA 5TS2A 1YVRA 4ZYVA 1REQA 3ZHQA 3HFGA 2JLQA 1AQUA 2IYOA 1O94A 1RXYA 3NC4A 3P8ZA 3AIKA 1KP3A 4DZTA 3QPWA 5JWOA 3EWSA 1W87A 3R0QA 4PQYA 3C4JA 5BNIA 5K6TA 2FK8A 5AK4A 4IJUA 4XE5A 4HN2A 1ZNWA 5EHNA 4E2YA 5AD1A 4Y9RA 1KI8A 1OVGA 1Z6PA 2Y8EA 5KHLB 2C31A 2EC5A 3IQZA 3K0HA 5FUXA 1JDBC 2ZBRA 2ZIEA 1GIAA 4MROA 2FFAA 4WFIA 1BN6A 5B12A 1Z18A 1A04A 2J4FA 4KQXA 4B3MB 3V8QA 1GZ6A 1JX6A 3DEAA 3QTBA 1HT2E 3MLBA 4G4JA 1VECA 2ROQA 4KWIA 1DQRA 3D6UA 3FFAA 4LZLA 3AESB 4O2AF 4WVLA 4BB6A 1N5JA 1ZLXA 2C7PA 3ORYA 1YQUA 4R3UC 2LGJA 2J5RA 4QD3A 4P82A 5LNK6 5FV4A 3U7QA 3OT1A 1ORHA 1USIA 1XTRA 4M46A 4UNQA 4L15A 4XR9A 1YR9A 4F8YA 4KQ1A 4Q1FA 4CLEA 4K26A 2NO6A 1TM2A 1RP1A 2MOKA 1PZXA 1ZN9A 3HCAA 4GBED 4KXUA 4LTMA 4UM8B 5AKEA 2CMHA 1LPMA 4H0FA 1D4AA 1G18A 2WKSA 5JD3A 1P3DA 3RK0A 4YRLA 1C2YA 1IVSA 5TMDA 3ZY3A 2AYYA 4O4LB 4C20A 1CCWA 3O7MA 3TAHA 2NXJA 3DD5A 1K68A 5GZ3A 4Q66C 2HIAA 3VYRB 5DT2A 5FTLA 3NONA 3LGXA 1I5EA 2CYCA 3G7SA 4WINA 2R6CA 3F6PA 1WXFA 4LZZA 4PHFA 3HYSA 1JG4A 3P5BA 4N8SA 4UTVA 3OZSA 3ZV3A 1DV1A 3GJQA 3AUFA 5FF9A 4DJFC 3FMGA 2JI4A 1V96A 1LDNA 4FNOA 2X8LA 3HXOA 4KQCA 1OREA 2J5QA 1N2XA 3DUFA 5TIIA 3N2KA 1E7SA 4XJVA 3K0AB 4FOOA 3D8HA 4PSCA 2DWUA 3BGIA 3BG5A 2AE2A 4CT4B 3PHBE 3BWDD 2I3AA 4BOYA 3UMBA 4QVKA 3TG8A 1NVTA 2Y2VA 1O57A 4X1OA 1TEHA 3IJPA 2BKEA 3UG6A 1ZSNA 2OGTA 2X0DA 1HE2A 4WK2B 5KIAA 3VKHA 2Q2OA 2SBTA 2V7GA 3GN2A 2FFQA 3K9GA 2CVPA 3VAZA 4BX2A 1E58A 1Y7HA 4DCMA 3ZKWB 4F8JA 5J2TA 1UK7A 4ND1A 4WUTA 5DMHA 4AMUA 3OO0A 4RXUA 5HK9A 3IRVA 4L9RA 5DHSA 4FGUA 4CETA 3GRYA 1ONNA 4YLYA 3W04A 3S81A 3C3PA 3KYJB 4E51A 4LCJA 3SF8B 4DA8A 3NOXA 3TLBA 2WVGA 3IDQA 3HEMA 3I23A 3LLVA 1I4DD 1EQ2A 4MUKA 4RU1A 4CTNA 4ZHQF 2HK6A 1P2GA 1YA4A 2YFHA 3HCCA 4M8KA 5KKCA 1EP2B 1Y9EA 5C8ZA 1GQQA 3LY5A 4GOOD 5F2OA 2XGJA 1I0ZA 3FNRA 1P7CA 2BTOA 1U2GA 1NVAA 3TOCA 3A2KA 1KFKB 1J0XO 3ER9A 3H9JA 1P7VA 3R74A 4F85A 3WIUA 3RC8A 4IMIB 1PYDA 3X44A 5ES4B 2O1SA 1ZO8A 3KCNA 4G2TA 2CNDA 3OQIB 4BLPA 1RRGA 4MWDA 3TI9A 1LDYA 1SVIA 4BQSA 1YB7A 1KNXA 1JA1A 3BIFA 4QOEA 3CZCA 1XOIA 2Q46A 3OC6A 3TR5A 4DJTA 4K1LA 4CKBB 2FW1A 3PXDA 3N39C 3A32A 4DA9A 3BREA 1TYAE 3S2EA 5CPBA 2OCYC 2I22A 4MI9A 4XASA 3RGGA 4KITB 2BJHA 4A0RA 5BMOA 5AW2A 4IDAA 2XITA 3I5UA 3GC6A 1KRHA 1MMFB 2D0DA 5JAZA 5G3ZA 1FYFA 2X0RA 5TNXA 1UJBA 4FNGA 3I53A 1A9OA 2GM5A 3JARB 4AAYA 4I6EA 1SVUA 4DJJA 1Z9BA 2FSSA 2J87A 1VCIA 3L7JA 3KE9A 1CZOA 5K0BA 4K6OA 3O38A 3GWZA 1ZJ5A 3DKIA 4ENRA 2PYIA 3OUUA 1KEEB 2AW5A 5CVTA 1DKQA 3LXMA 1NWHA 1U1IA 2PX0A 2EW8A 4FMCF 2C2OA 2IPNA 3IRUA 1CD5A 4NBLA 4HBZA 2ZR9A 4BKQA 4DQLA 1KDZA 3I5YA 5DRYA 1RLTA 2W6ZA 3HUEA 2A84A 3TTYA 4F3TA 4I0WB 5IVDA 1CV2A 3DFUA 4L2IB 4W5OA 4HEJA 3SKYA 1TMKA 3EUAA 2W43A 1NVVQ 2HXGA 5FRDA 4XDHA 3CZ4A 1SVOA 4U6SA 3HBJA 3IP5A 1GHTA 4RY8A 1QRSA 1M6EX 4YAGA 1FW8A 2C4HA 4I50A 2HEIA 3IKJA 1A98A 3JQBC 1CUYA 2AEFA 1PJ4A 1NFQA 3QOWA 3G2OA 4BGDA 1QWOA 2A9QA 3C98A 5EWLB 2QGFA 3IEXA 1T2VA 4OQNA 4QT0A 4B8WA 4YMVA 3KJIA 4P92A 3QU4A 2CFRA 4RTPA 1G2IA 4CYMA 4G5HA 2Z3ZA 4MRSA 3C6QA 1FDRA 1JAZA 4KGVA 1M2NA 3R5JA 5JSQA 2QLFA 1HSZA 2Q7OE 5CGQB 2G88A 2JAUA 2F3RA 1W35A 1KSJA 2OAP1 3FUTA 3NHBA 4FKBA 4H1VA 4BCDA 4LF9B 2W6QA 1G7RA 1OWNA 3GHYA 2ZRCA 3AFNA 2QAGA 4K46A 1PR1A 1TEVA 1GZSA 1NTOA 3DO5A 3T3EA 1DCFA 1L7QA 4A6PA 1RMYA 3ZU5A 4DRXA 1YE3A 1XLVA 2V7EA 2IDJA 2DEUA 2YZNA 5JCXA 3G8CA 3KT0A 3DXYA 1OMOA 1E66A 3PJGA 2BTQB 2POCA 2GGSA 1L3CA 2CFTA 1DAKA 1G8MA 2RKWA 2ZZKA 2W9XA 4TTIA 3B38A 3D2BA 4WK4B 3HB4X 1OU4A 2O57A 3PQ7A 4S24A 1CTQA 4AP9A 4LFBB 3FUWA 3JRNA 2SHKA 3DD1A 1T8WA 3LF2A 4LYYA 1P0PA 4DCJA 5JASA 1P75A 3GEBA 3O4VA 4ND6A 2BSXA 3N6VA 3O95A 4O33A 2VDQB 3SYRA 4GIBA 1AQNA 4XPZA 2Q3LA 3DKKA 3LBAA 5KU7A 5DMXA 1YL6A 1YT5A 1Z4OA 3LYUA 5EYPB 4ILEA 2X2PA 1KAMA 1D0SA 3FRIA 2YWXA 3FZQA 4URXR 3QVWA 3H2IA 1APBA 1LUAA 4E30A 2Y71A 3QG5A 2PU5A 4IYRA 5KQRA 1RM0A 3GLHB 3WMEA 4CR7A 1IEQA 5E4TA 1V7ZA 2VP5A 3F67A 1VLQA 5IHXA 3OEYA 2FPPA 1YS6A 4HYQA 4PYQA 3UJHA 4YT5A 2IVZA 5B55A 4OFWA 4ZZ2A 1Z7WA 3WLQA 5DHUA 5CX4A 1I7PA 4IIGA 3C45A 5CVVA 5F2EA 3IDOA 5LQUA 3JD1A 1U7TA 3PK0A 3QFRA 3AU9A 4O4JF 4QUBA 2WG0A 1T9BA 1O6FA 2IZ7A 5ARCA 3S2SA 3TR0A 3FAZA 4JLKA 2FQWA 4DIBA 3TFQA 4AYXA 1FFDA 4LF5B 1V3UA 3PX7A 4AKEA 3N76A 2R62A 1HYEA 1NDQA 3B1ZA 1TOAA 2P4UA 3QOFA 3R7WA 4W99A 9ABPA 4INOA 5K0GA 4B3XA 1ST2A 2CFIA 4M0CA 1HEIA 4XVQA 3F7NA 1QBGA 2D1RA 2ZIUB 2OQVA 1WUHS 1NI3A 2XA1A 1RACA 3BAFA 1FTWA 4TZ6A 3HYCA 1PWXA 2ZCUA 3PA6A 4FMDF 5AM1A 4AF6A 2PKXA 1UPUA 3QXGA 1DV2A 5HXAA 4TSKA 1D6JA 3RC1A 3ORFA 2VG8A 4BMNA 2ECQA 1UJMA 2I8AA 2X3UA 3HYNA 2B2CA 3L1VA 3MUEA 5A05A 4YRAA 5BUSA 5IK2D 4D44A 2W48A 1R5OA 1PDWA 2H4HA 2IKQA 4QU8A 4PCVA 2PSSA 5JQGB 5EAIA 4EPRA 3WR5A 2H2FA 4TMYA 1WOYA 1YKSA 1C7FA 4Y6QA 4EMBA 1T9GS 3ISTA 2NU9A 3K5PA 2XCRB 3TAXA 3RTEA 4PG6A 2VHUA 4KCGA 1AKYA 3PE4A 3U39A 1ZX1A 2J9FB 1AQYA 2G9NA 1SA0B 3VDRA 4M7WA 5KU1A 1I5OA 1R5BA 4BAUA 2X7HA 2XYGA 4ZDWA 4D56A 1WLYA 1PGNA 5FUBA 3CKLA 1SC4A 2QD1A 3RRMA 4BYGA 1KPHA 1MX9A 1SB9A 2DFLA 3K0CA 5CUQA 3E3LA 1WY5A 4EECA 1J2TA 1T0IA 3EMDA 4BJ3A 4A92A 4EMUA 5KOYA 2VRCA 3IP8A 1PR6A 2BEVB 2OORA 3OO1A 2XF2A 5AHKA 3VR4D 1V8OA 2A6PA 2WUVA 2JD1A 4FFLA 1UBNA 4M9ZA 5KYXB 3ETLA 1CJMA 1SIOA 2CSUA 2Q5EA 3ON5A 4YEDA 4X3CA 4CLXA 1OLXA 1T8PA 5JQGF 2G40A 1C8BA 2Y77A 3C6YA 3BEOA 3S55A 3W8FA 1LNQA 3PR2B 2YWEA 2CL7X 4JC4A 1II9A 1IXYA 3KFXA 2Y1CA 5GY7A 5BW4A 1CUZA 3WXBA 5CBPB 2ZYVX 4TXLA 1DO2A 3CKMA 1PFYA 3ZIAD 1H8EA 4PIPA 2YCLA 1QB8A 4MAFA 4X1IA 3QUTA 2Q3FA 2GBFA 3MG9A 1NRJB 2XNHA 1N9GB 2EDAA 2UYCA 3WYDA 1NXTA 4A7PA 2CLMB 2WILA 2X76A 2VTEA 3THSA 2GHTA 2I2CA 3U4QA 2PUBA 1E18A 2IEGA 3WNVA 1JQJC 5FUWA 2HAEA 4EZEA 1FS4A 3DAYA 2WM2A 3INGA 5KCZA 2NU6B 1E2FA 2ZJ4A 1L5ZA 3SM9A 5IS2A 1J5XA 3WV5A 1GZ7A 5CH5A 5IUJC 2VJKA 1GEEA 4IO1A 3QFCA 5EWMA 3RYIB 1A9PA 2F64A 2QRUA 3H4MA 3CR8A 4Q05A 4MUHA 2Q6TA 3M6LA 2YUIA 5DNAA 3AEZA 4CG1A 1ETHA 4LJAA 1W19A 2I76A 2JJ8A 2CHEA 2OV8A 2YHBA 2R2GA 2XE7A 3EEFA 3G8DA 4J1SA 4QXPA 4YP0A 3D0KA 3DMTA 4RKYA 4ZODA 1C9MA 4KLZA 2XR1A 4D74A 3N7UA 5KTRA 4RVGA 1NVVR 4WOBA 3UV3A 5A4DA 6PFKA 1TVKB 6REQA 3EYWA 3Q5EA 5BWOA 1IN5A 3IE2A 3PDCA 3BICA 3V55A 1E2EA 3GXBA 4WKCA 2DWCA 1SN7A 1ZIYA 3TH5A 3EN0A 4ZTUB 3W5UA 1XD2B 2QQ0A 3RRXA 1ID8A 4PY2A 4BX0A 2ZCJA 1XKQA 4UQOA 2HU2A 1BVRA 3V4OA 4B47A 4WOCA 1R3UA 4XIYA 4EB3A 3K1JA 4UKDA 2P9QA 4GPIB 5LQAA 2IF2A 4DUYB 4MS3B 3CBGA 3LSTA 3KX2A 4QE3A 3A0RB 4QTUB 4BO4A 5JFGA 1EMDA 4H3SA 4RFSB 4ID9A 3ADPA 1EP9A 3W6NA 4AT1A 4WACA 4MUGA 5HQ3A 3LUFA 1EE2A 2EL7A 5GONB 1S89A 2RB5A 2HF2A 4H18A 3N53A 1W36B 2IHYA 5BRNA 4RTLA 5K01A 4NEQA 4ZVMA 1EEHA 3E9NA 4R8VA 4I6GA 3WK7A 1JFVA 3E0XA 3SEFA 3EBOA 3LUPA 2E7ZA 3QYFA 4JU8A 4Q47A 2P79A 4G89A 1A72A 1DJNA 1HG1A 2IYPA 3FGZA 1W4ZA 4CIBA 1KH1A 3QY0A 4KK3A 2W98A 3H7IA 1H2EA 1E3QA 3MWEB 1K66A 1UK8A 1NN5A 5JMWA 4U2GA 1NYQA 3TS1A 4B3IA 5BVGB 3A4YA 4Q4HB 1QHIA 2AX4A 2ZJ7A 3P20A 2LDBA 3TZBA 3UK0A 2QPOA 2E87A 2J9FA 4IOKA 1J00A 4LFAB 2I62A 4GBMA 2QTRA 3DLHA 1DKNA 3DLIA 1V4NA 2OUIA 5DBGA 2H06A 3V7FA 4MV0A 1LVGA 4D9HA 4MDFA 5JNVA 3DEYX 4JB3A 3FA2A 4MUNA 3LT0A 4NHEA 2R8BA 3MCTA 4LJ5A 3K2EA 4XIIA 3VR5D 1NQWA 1PQ4A 4P80A 5G02A 4DLNA 1KC3A 5TGTA 3SU8A 4F4IA 4FYXA 3IQWA 4KO4S 3N8IA 6GPBA 4Y0AA 4QAJA 3QKRB 4FB5A 5I51A 2FW7A 2O8EA 2RBEA 3WL8A 1P1CA 4KK4A 1EE9A 3U48A 1SHTX 1RTKA 2O1EA 2ZSEA 3FR8A 4O2LA 5G4LA 4B4DA 4CIAA 4YXFA 2A33A 5GM2A 4ENQA 1EXNA 1QYIA 1CG6A 4JYMA 2W2XA 1DX4A 4W5NA 1KPGA 4BO8A 3VPDA 3NCHA 4TTVA 1SXJB 4BMPB 1QKIA 2C92A 4FYWA 3TI7A 3I45A 1N5MA 1U11A 1VB5A 1OAOA 2CLDX 1D2GA 2K4MA 2V9ZA 1Z25A 3NETA 1YH3A 2VXYA 2W4MA 1PW5A 1WSBA 3AEQB 2XMGA 3CLTD 4U39A 3VTKA 5K0EA 5K0ZA 4BCBA 4UOEA 5LR6A 4FHCA 5K6RA 4C4RA 2XYQA 4TS3A 4EB0A 1SHZA 1H22A 1C1HA 1OBFO 1YMVA 2O52A 3H2BA 4RE5A 3VISA 1QVVA 1F3LA 3AI3A 1UQRA 2C9DA 2GBLC 2NUAA 3P9YA 4IICA 1VPTA 1DHRA 2G9VA 3LIIA 4O3FA 4RK4A 3ZI0A 5BR8B 2VQ6A 3JYLA 4UDXX 2WD7A 5F1KA 2AMYA 4A8JA 1VMKA 4J7XA 4CMGA 4DV2B 3VNRA 2YOGA 3L8HA 4B6PA 2JLUA 4YO7A 2QROA 5IM5A 3M5DA 2O20A 1KMQA 1W0JD 2E3JA 4I55B 3SZRA 1XALA 2WKQA 1LK0A 1ZSYA 3SHTA 4ZEOA 2V96A 3GEGA 3IUBA 3TUJC 1GQYA 3EC7A 1WAMA 5JSYA 2PJUA 3USES 1V2HE 1Z7BA 2B8TA 1LDGA 3JVIA 2GCIA 3QV2A 3GLIB 1PFKA 1QHHA 3ZW9A 3THXB 2CBGA 2VT3A 3HRIA 2A59A 1NE2A 3BD8A 4AUMA 3GARA 1IUKA 1UADA 1WTAA 2DUNA 2YNMC 1V43A 2EAUA 1YC5A 5DCUA 5AIAA 3HCRA 4XJSA 3AVXA 4GP6A 4FDLA 3D1LA 1AT1A 1N2CA 2FN3A 2PSEA 3AB7A 2NZWA 3OIYA 3OZEA 1AKEA 3OZTA 1OIVA 4GI1A 4H27A 3QPUA 1EA7A 1JTEA 1N36B 3KDPA 5SYNA 2DR2A 2A5JA 2V6FA 4HV4A 4UE2A 4Z5XA 5ER6A 2AW3A 4WADA 1NULA 4GOKA 4YJHA 3UNXA 4RH3A 5H8WA 2GD6A 3UQYS 1ZD5A 4QKQA 1A1VA 1COWA 3JSAA 4MPRA 3TMAA 1T24A 4MULA 3QVGB 1Z88A 1SCBA 1MXFA 4V39A 4C0BA 2I2DA 4P81A 2IC5A 3IKMB 1RRVA 5J1TB 2H7CA 1L5NA 2JFFA 3BDAA 3PJDA 5H81A 2QTMA 1E3WA 2GKGA 2O7NA 3CF6R 4EG3A 1QLJA 1RAHA 2FW8A 4OKSA 3RC3A 3NRJA 2ZIFA 3VA7A 3ZN2A 1AGYA 4GKAA 3DDUA 4DLRA 5J23A 3CF4A 1WUTA 1QHXA 2PWAA 3LCVB 3QLUC 4M9QA 3FLMA 4L8YA 3O8QB 3PA8A 4V38A 5I3ZA 2AZXA 4YUYA 4WKOA 3IEUA 4FS3A 4G85A 2PQ2A 1IXRC 5JJ5A 3NDBB 4MDHA 4LYHA 1QGAA 4DMLA 4FLMA 3KELA 5JV5A 3IFSA 2P90A 4W5WA 3N70A 3S99A 1I6KA 3PYLA 3SK0A 2P9ZA 2YS6A 3TQOA 3JQFA 2QTVB 4QT4A 5A02A 5HQ3B 3R24A 3DFIA 3EK2A 4JLJA 3ZU3A 4L16A 4PZPA 1ZSVA 2O7SA 4MYHA 3E35A 1GD1O 3S0JA 4G84A 2VP0A 1PF7E 3LQQA 4Y9DA 4BP9A 1LV8A 5EERA 5AW6A 1Y63A 1QG6A 1MX3A 1D1PA 2CLHB 3QE0A 1K27A 1VPWA 3B20A 3JYQA 5IAGA 4BV3A 1OFGA 1GARA 2F62A 3JD3A 4UEOA 1C9YA 3ICWA 1E9RA 4MKGA 2FSGA 3FLEA 3K9CA 2F8LA 1BMTA 3PPXA 4P0QB 1BCSA 2XXAA 4OQEA 1TVKA 2HU8A 4KQIA 2AMFA 1YQXA 2BEUA 2CMGA 3PWZA 1P7WA 4L7QA 1M5RA 5EJ6A 1N2SA 4O2AB 1G8SA 1NSFA 1WDLA 2SKEA 3BRWA 4P7BA 3TLAA 4B2PA 3TUZC 4IX9A 4PICA 1DOZA 3BJEA 621PA 4JP2A 1IN1A 2FSPA 1U2EA 3BVPA 1VFNA 4HDSB 3CE6A 1J8QA 2VSQA 3ITDA 1UPXA 1N25A 2VI5A 4ND5A 4EGSA 3OPMA 3ZE9A 3ZJVA 1GPLA 1MGOA 3I09A 5F1PA 3NHPA 4G0XA 2FWRA 4CM1A 3VU8A 2D7CA 1SC1A 1BA3A 1WF6A 2OXCA 2P2ZA 1Z5VA 4NU0A 1M0WA 1XVAA 2VDJA 2GZAA 4HXFB 4WHMA 1X80B 3DKPA 4U2FA 5BY2A 3CIFA 4M9UA 2J85A 3V3TA 2CVQA 1RW4A 5CJJA 4R71A 4DLVA 5IVIA 2NO4A 3W5CA 2AR0A 3OZBA 2PUAA 1IC6A 5DNUA 1B8UA 3BRSA 1ZCFA 5ALLA 3RAFC 3O8LA 5GGXA 1O6ZA 1QIDA 2J32A 3I34X 2D1SA 4M0KA 1WZNA 4QJ4A 1OC4A 1V41E 3VR3A 2XECA 2QGZA 1JYFA 1M8JA 3LRTA 5WRFA 1RFLA 2AQHA 5IN4A 4N0EA 5JO0A 1XKTA 1EVQA 1YFKA 3IAHA 4B4VA 4HNUA 3PRJA 4A6EA 2O9JA 1HQYE 1E3TA 4MS1B 2BKAA 2UXDB 4ETWA 1HEYA 3K16A 4WZBE 3RJ9A 5K8VA 1AA6A 1T3LA 5F3RA 5HTKA 2AJLI 1BC5A 1S3FA 2VYND 2HA2A 3FOZA 1C80A 3PRHA 2GYWA 2JK1A 3CLTC 2IE0A 3EC1A 3ELDA 1RPNA 2EKDA 1U8FO 4GDMA 3SJBA 5BR1A 4FCCA 1LPAB 5AWFC 1Z3IX 2R7NA 2ZB8A 3CZQA 3FSGA 4GPBA 4BATA 2PWYA 1GZUA 4HAWA 4NFHA 5CB4F 2JAQA 2A1UB 3IPLA 1T5IA 4LG1A 1NGSA 1ZY2A 2QLNA 2NXWA 2CNLA 1L8LA 1DU4A 5TE9A 3COZA 2JJMA 5BN5B 1Q16A 1SBHA 1M1UA 3EPLA 3MFYA 3W5SA 5DCYA 1N33B 4HATA 7MDHA 5AYVA 3JYNA 3W9BA 3KEQA 4JVOA 3R9IA 1U3VA 2VAPA 4RTQA 1YJQA 2XEDA 5AOBA 3RAPR 5EKSA 4V2UA 2PFKA 4NQZA 3E22B 2YN4A 1XKLA 3UK2A 3QBDA 3CZ9A 1U3CA 5AJVB 1X14A 1ZAKA 3FI9A 3BWBA 4JIMA 1ZPDA 4UTOA 5GAJA 4ER3A 2VIIA 1M2KA 3MPUA 3KXDA 4I4LA 3M6XA 4I6JA 3ICCA 1A97A 2ILTA 2QDXA 4JR1A 5KNDD 4IZIA 1SXJE 2YHIA 4KOAA 4C0HA 4NU5A 1RQXA 2CUKA 2I3ZA 2JRCA 1R0SA 2OAQ1 3KVRA 2JCVA 3OPNA 4GMDA 4AMBA 4AZ0B 1BE8A 4O4LA 2OD7A 4RF2A 2P30A 3UF0A 5LKAA 2CN1A 5CMLA 5KTNA 3WYAA 3DBHB 5REQB 1LQ2A 1Q7CA 2XB6A 3HR7A 5AHRA 5HOEA 2NYRA 1XZHA 3L0IB 3NU1A 5ABPA 2ZIGA 1MZPA 2NZXA 3TKLA 4R1SA 1HNWB 2RHTA 4V0NA 1YJ5A 2Y6UA 1T43A 4D43A 3GQBB 2WF7A 2J09A 4BV8A 1FTGA 1DC8A 4BP8A 4JBLA 4CLOB 3X1WA 3QFHA 4MV6A 3R41A 3UFBA 3T3MB 1SBCA 2GJ9A 4HNGA 2I4NA 3J7AC 3OH8A 4UDOA 1ZUHA 2XWJI 3CVJA 3ZXXA 4EFMA 2HMYB 4JZKA 4C29A 1LW6E 3LNCA 1M7GA 4MO9A 2ILVA 4MI1A 1IHPA 1JDZA 5JXGA 2WQ7A 5H83A 1C7JA 1R64A 3W9UA 3T3HA 4BJ1A 3GDFA 1BX3A 3A3OA 3L7AA 4WA8A 1UQUA 1LSJA 2FW6A 4PANA 5JSHA 1OCEA 1G291 1KJ9A 3GJ6A 1U2RA 4R05A 1AMUA 4FGKA 1UDCA 2CGEA 1YACA 1E2LA 2H5IA 2QD2A 4M22A 3GEMA 2H8KA 4P34A 1ICIA 2C8LA 1K98A 1WRBA 2CD7A 3FDXA 4KFSA 1XNRB 1OX6A 3IAEA 1SD1A 4Y9SA 4Z0TA 3GCZA 3HN6A 4EI2A 2YVLA 1W6UA 1EG2A 1NONA 3K1YA 1GG9A 3LL4A 4EYOA 2AC2A 2HJ9A 2ZSUA 3FTQA 2A5LA 4X64B 3A6ZA 1XLTA 1A2BA 3DNFA 3VV2A 3KZVA 1DBSA 4II7A 2AR9A 3MSXA 4QQFA 5A6VA 4IOLA 2XMBA 5DKFA 3EXIA 1KU6A 4DTIA 3FN4A 1JHAA 2MINB 2BHNA 1TM7E 2ZYDA 5CA0F 2B4QA 2VO1A 4UARA 1WW8A 4PC6A 4Q1AA 5CVDA 4K6GA 4K5QA 3DOJA 2A14A 5CDSA 1Z5NA 1VJCA 1V16B 1YR8A 1Z26A 2FZ4A 3VU9A 3GEHA 4HOYA 4J9VA 2NVUA 1N9ZA 4GZ5A 5U4QA 1P9LA 3IVMA 1ZN2A 2ID4A 2C03A 1XZQA 3M6WA 1C3XA 4QULA 5AJXA 1NJGA 5KVCA 4NVRA 3EXHC 3GCWA 3LUGA 5DEIA 1AK9A 1F8XA 1K5PA 3W1WA 1A69A 4YCSA 4FD2A 1CERA 2QUBA 5IJXA 4E5MA 2BAGA 3DAHA 4Y1RB 2XJ4A 4E88A 4I9GA 2ZBFA 1SIWA 4JC5A 4OLFA 1UJCA 5FADA 4EX6A 2GM3A 3C15C 3D3JA 1CUSA 3GMTA 4XYMA 1D07A 5AJWA 5EOVA 2P2YA 4XZ3A 2MU1A 1YQ9A 3NATA 4OQXA 1JG6A 4DPMA 1NBOA 3NLLA 1FXWF 1ECPA 3H8WA 5IG2A 3QE9Y 1E4OA 4KWHA 3I72A 4I50B 5AVRA 1CVIA 5HPYB 2IH5A 2HJRA 2F4NA 1N0WA 4JROA 5B6PA 2FPWA 3OZVA 4Z0HO 5ECYA 1TTQB 2P67A 1IL0A 1VM6A 4JXKA 4KQJA 5KJ1A 1Z34A 1ZUNB 1OE0A 3R0XA 3A9SA 2XOKA 3FCOA 1GDDA 3AJ8A 3G1UA 4J0DA 3TYXA 4ZI7F 5DYWA 1KO5A 5K7SA 1PWYE 1ZDMA 3B3FA 3CWQA 3MGAA 1FMJA 5ALYA 2J4DA 2ZR0A 3MMNA 4KREA 1NVGA 2FUG6 3H2HA 4WPGA 1N34B 2QIPA 4M1MA 3VKGA 3AUUA 4WX2B 2I80A 1MRZA 2WF8A 2ZTHA 1SQGA 1F2TA 2HL6A 3FB4A 3V1KA 3WADA 3BHJA 2J6CA 3PYMA 5DTJA 2V8BA 1ISGA 5JAUA 1KEEA 1JU9A 2Y2UA 1Y4UA 3AEUB 4CZ2A 3EC2A 3D1JA 4DQDA 2X7JA 5KWVA 2BP7B 1TCBA 5D3MA 1KDYA 3I3SR 2QU8A 1HM5A 1R16A 3HRHA 2DPHA 3K9NA 3DWIA 5HWSA 1X7YB 3KUXA 4OXIA 2GLXA 3EBPA 2OY0A 1UH5A 1XLTC 3HUTA 4IJVA 4R2KA 4UZEA 5DP1A 2IBSA 1P3Y1 2PSDA 4LV6A 4EFDA 4I1OA 4Q21A 2VKTA 1JHZA 1RJEA 4EEZA 4O1MA 1ZA2A 1DBWA 2QN2A 5AI9A 4F6LA 2H1HA 4C03A 2ZI7A 4KQ6A 2JI8A 3M6IA 3MMPA 4KEAA 4DIKA 4FDUA 1VZ3A 1NX9A 3C8ZA 4GLOA 5T4EA 3TG2A 2ORED 7REQB 4CM8A 3I73A 3TCKA 1BXKA 2LE0A 4PRYA 4MGZR 5C5IA 3HR4A 4HCJA 1PYOA 5ILQA 1C5KA 3ZE1B 3NWBA 1KZ6A 2IYYA 3OLVA 2B20A 1MC4A 3OWOA 2YW2A 1UMDB 1GLGA 1OI7A 3KFVA 1Y8QA 1RCTE 4HQNA 4BKPA 5G41A 4CKWB 4RPJA 3QWIA 3ASUA 4WN9B 3VO9A 4DEXA 3DE3X 4FFOA 1V0JA 1ABFA 5DP2A 2EVWX 1YQGA 2CXUA 5DN6D 2D2EA 2BE9A 3OE4A 2C7OA 1HDEA 3R20A 4BC0A 2K7FA 2QJWA 2VN8A 4P38A 2DSNA 2GJKA 4DV1B 1XCJA 3ZHRA 1HT1E 3C74A 4HVTA 4UBLA 1IG0A 1DWQA 1W75A 3VDNB 3HWSA 4X85A 5CA0B 5B2EA 1ZVQA 4PSKA 3HDHA 4CM3A 1MHTA 5EZYB 4IIXA 2ES4A 3SYTA 3FOEC 4R3NA 1UEXC 1PGOA 4RLSA 3WL7A 2P0YA 2RMKA 3LFHA 3TLXA 3DPSA 3IP6A 4DWVA 2FE4A 1NAHA 2QM8A 2V7UA 4LQLA 4JBWA 4NWIA 3I61A 2RGEA 2ZSHA 1XJCA 3T0GA 3W34A 3WGYA 1G9TA 2XA2A 4IGAA 4IPTA 3AHJA 3DUFB 1MNQA 3VOTA 1O8CA 3W9SA 2Y1KA 3DBIA 4Y2HA 2Y76A 3KQNA 4GXNA 4W5JA 5IF9A 1AD2A 3O5AA 1QH1B 2O5EA 1J99A 1RE0A 2EWMA 4O59O 3A6FA 2QY6A 2IE8A 4MLCA 1POWA 4J1TC 2GBPA 2A4MA 1NA5A 4J43A 3NHWA 4I2VA 5LYJA 1U8EA 3NBQA 1U80A 1CUJA 2BFEA 2PMCA 3FNBA 5JCJA 1VOTA 3U1VA 4RTOA 4G25A 3RSOA 4M87A 1VYTA 1WE2A 2DHRA 2WB4A 1K3TA 3TIGA 1ZHOA 2P65A 4GP9A 4C6SA 1KJWA 1E1MA 3O21A 1G41A 3F5FA 4TLMB 4Y6GB 5F4ZA 4ZEMA 3D4BA 4EF6A 3FRJA 5EEHA 2J46A 1C0KA 1HMYA 3F1LA 5F35A 3FTPA 4ZK2A 3V2UA 3T8YA 5LD2B 4NBUA 4AKTA 3O74A 4B17A 2PMWB 1K7SN 3WLKX 1RRFA 1CS0A 1HNNA 4NENA 5LU9A 1U0GA 1W36D 2NU8B 3TVTA 4JUBA 3EASA 4BKUA 521PA 3ADKA 5BYJA 4FJ2A 3W5DA 1OYYA 2JA2A 4EBBA 1ZM9A 2OXRA 1W9MA 1YQDA 2IHUA 1R5NA 2E18A 4TRNA 3WJAA 4C7OA 3RT9A 5JJCA 2X19A 4IUDS 2DH5A 3TW4A 1KC1A 2HT6A 1KMHB 1XEWX 3MUNA 4JL5A 3GAMA 4PLPA 2XT6A 2AUTA 4EH1A 2I4MA 3EW7A 3TPFA 1HFEL 1O9HA 4X92A 1EHCA 1EGQA 1QVWA 2CWDA 4WZAE 5IKPA 5CCBA 3NV7A 1BXGA 2BMJA 4GX5A 4LNHA 3SXUA 3PQ4A 4UAGA 1BXGB 1R74A 4XGRA 1OA0A 3BXGA 4J29A 3EFOB 5JDCC 4ACAA 2C94A 2ADOA 4ISCA 1PJSA 3NHMA 4CM4B 5CLHA 1P5HA 4ZGWA 2R11A 3VDXA 2PXXA 3HXTA 5BQ5A 2CDRA 5SY4A 1YIDA 3RIYA 1MG0A 4G01B 4EJ6A 4C06A 4TV9A 4ZYTA 3CM0A 1THGA 2BFOA 1XROA 3IBTA 4KQWA 1H66A 3LXXA 3EZNA 2ZPAA 4FYHA 2NU8A 2Z9CA 3LPCA 5HKKA 2XQIA 3EEIA 1FTYA 4WI1A 4CMCA 4F1WA 3RVJA 3OCVA 3REQB 3ROQA 1G21A 3WZMA 4WTOA 1ORTA 2I7TA 3VR3D 5BWBA 4NH0A 1QHGA 2QMHA 3DKRA 3HVJA 1FP2A 3EZ2A 3K2IA 3H9EO 4H7JA 2VK2A 1CY0A 3RQSA 3TQSA 3NEYA 4B7AA 2W22A 3GZNB 1SUCA 3FTFA 5K3SA 3FR7A 3CH6A 3RUEA 4JKOA 1X0XA 3MS4A 5LP6B 2IOQA 4KI7A 3R5SA 1ATIA 1T3TA 4B8YA 3E1SA 1W44A 4RQBA 3CR7A 2QP9X 2OCAA 2QA5A 3GNLA 1MT3A 3BCRA 1QS0B 1FTQA 1ISJA 3GRCA 3Q3IA 1E0JA 3MXOA 2ZTSA 4K9LA 2PKWA 5DIZA 2GZ1A 5T4BA 4J49A 4CCYA 4F9FA 2O5CA 1KOFA 3L7BA 3R3HA 4RVSA 5CJPA 3GGOA 4BFXA 4BFLA 2GYVA 4ZC8A 1JQAA 2P8JA 1XZ8A 2GT1A 3PP8A 2XNDA 4Z0NA 5JJLA 5JNLA 3WK4A 3J7TA 2G6BA 1LPBB 2X0IA 4X7RA 4EVRA 4JLMA 4XW2A 4B7XA 4OK6A 2DOKA 3WLEA 4D4HA 1ORRA 2J33A 3ANTA 4IIBA 5ICGA 2WTUA 2XB2A 4HL6A 4BFZA 4CF5A 4KACA 3CEMA 1I1HA 1G63A 2MWMA 3WWEA 3TQQA 4ZMRA 1CQJA 1XEWY 2CJPA 4C0QC 2A1UA 1ARZA 2H29A 2Z30A 2JBWA 3AJAA 5DXJA 2JBAA 2DSTA 1QP0A 1M1YA 4KE9A 2J3DA 2ZJOA 1W2HA 4PZAA 2CUTA 4FFVA 2EZTA 5LN1A 2IW3A 2DR0A 3GVXA 2M32A 3B70A 1Z75A 3UOWA 3P26A 3AX6A 3AY7A 1YR3A 1UUFA 1RYFA 1COZA 3W4JA 4NBTA 5FBZA 2EQBA 1CFJA 1YR7A 5J2UA 4YFYA 2I7XA 1N0UA 1U94A 3MNFA 4IKOA 5BRJA 1N6LA 4E5NA 3BS4A 3U3KA 1PD0A 1VKOA 3AFMA 1CT9A 4KPUB 1K6IA 1RWXA 5ENVA 3WKAA 3Q0TA 3X1YA 1VCMA 2CFCA 3BL8A 4FJ0A 5M2QA 4K9RA 1AGRA 1PKEA 4GQBA 1U3GA 1H65A 1YTUA 1G8JA 4PG8A 3CGGA 4Z9AA 1SKUA 3QIAA 3AUJB 1S8AA 3GA5A 4FMPA 5CG2A 4JSRA 2A0WA 2VJQA 1OZGA 1H4VB 1N6NA 4XAQA 5G4KB 2NTYC 3CUYA 5LQNA 3HKDA 3KU1A 3LVRE 1A9YA 1HFJA 2B37A 4LRSB 3RC2A 1EGHA 1Y98A 3EPRA 5HF9A 1TM5E 2E4VA 5D86A 5AVZA 5AKIA 2AFIE 1L0BA 4D2IA 2GHIA 1NBIA 5JCPA 4KXVA 4WGFA 2EW2A 4MW0A 1GXSA 2E48A 3NKLA 2JGDA 2R8PA 2YJNA 3F6YA 2DCMA 5KTOA 4QM6A 4ZCQA 3UXEA 4JH0A 1TADA 3T5TA 3FYUC 3W1EA 3DP7A 4TMKA 4LZJA 3UPUA 1O5TA 4C05A 2X13A 5EE0A 4BQNA 4PNPA 2QKYA 3CQ9A 3PGJA 4Q7KA 3MTEA 2FPUA 2FYTA 2PXHA 3AFHA 3LXRA 1UAYA 3GBPA 3GZ4A 4MUAA 4DCUA 1ADFA 3PRYA 2XGMA 4DUZB 1I7QB 1N6PA 2J48A 4G4SP 3E8XA 3W2FA 1U0LA 2GAOA 4KQKA 4LZAA 4YJ2A 4QG7A 4GLLA 5LC1A 1YCFA 4LE1A 1LFDB 3QI2A 2D8AA 3M3HA 4P3NA 5CDTA 3W4KA 3WQSB 9GPBA 1DKUA 3EMKA 2QVXX 1U0SY 3MJSA 5TARA 4EJMA 2WQ6A 5B3JA 1F6DA 4EJSA 2IIPA 3GJ3A 3GLUA 5F77A 2C2HA 2ZRBA 2N1MA 3GI1A 2VC2B 3RR2A 3QEMB 1GGKA 3PFKA 3GAAA 2OCGA 3G5MA 1HUQA 3SHFA 3LNTA 3MT9A 1G5QA 2VQSA 3PC4A 2H4XA 3IPYA 4JGIA 3ZDFA 4HFNA 3V6MA 3J81A 2B8NA 2IK8A 1DP4A 3FNGA 1YZNA 3O90A 2XE8A 3UQZA 3AKYA 1VIMA 2FR8C 5HIKA 4CEIA 4FQ7A 1TZMA 2B3DA 4BDTA 3B82A 5FNVB 4MW2A 5K0NA 1JG2A 4GGMX 4K9MA 4I55F 1QOQB 2H31A 3OM9A 4JLSA 3MMZA 5AOCA 1KJIA 2O2XA 3ZZ1A 2ZVPX 4NYJR 2WSMA 4BNNA 1JN0A 3GH1A 4QRIA 1Y1SA 4JOBA 1UMKA 2Y92A 3D3QA 3NTXA 4H17A 3GJSA 5KI6A 5IKXA 1V5IA 4YJHB 3ONDA 4D4JA 4CG0A 1SHJA 1KVSA 4H1UA 2HMSA 3A6LA 2A67A 2YBDA 3QJGA 4YHBA 1WY7A 2EERA 3CLRD 4DV4B 3RSFA 4RVDA 2EGGA 4UDYX 1AQLA 4CIWA 2CXNA 2VJNA 4G81A 4NJEA 2ZRMA 1WSWA 3K0FB 3DL0A 3GD5A 2XZDA 3KJZA 2XT9A 4IINA 3FDJA 4HH1A 4ZO9A 3UJBA 5JALA 3M83A 4YJ3F 4MVJH 1KK3A 1O97D 1UL1X 4YCCA 3THXA 2YYSA 3MIZA 2EW1A 1YRQA 2X8BA 2EBWA 3VO2A 2Z5LA 4O02B 3I37X 4J0HA 1V4BA 1ORIA 2GD1O 5A4AA 1DIRA 1LTQA 1OAAA 1Q3TA 1HNXB 2BFCB 3DL2A 4OJMX 2Q5CA 2ZUSA 1BH6A 1WMSA 2EFGA 2N42A 4X60A 4AJ4A 4LVCA 4NV0A 5AKHA 2F3SA 2NUTB 2QYOA 5LP6C 2OFPA 2VJLA 3L1HA 1T2DA 4B6EA 3GGDA 4R01A 4D97A 4ZYZA 2WHQA 3OM8A 1DT3A 1N5RA 3JATB 2VUHB 3BMQB 3OLXA 4KXFB 1KZGB 2IFTA 3PEUA 1MIHA 3QMMA 3BZUA 1U2QA 2WWIA 2PR7A 1TFRA 2C9ZA 2NYAA 3QYPA 4II3A 3MJDA 3B7GA 4J07A 2O0HA 3HV2A 1TT7A 5DYGA 2IOFA 2PT6A 4KDFA 5ESXA 1FL9A 2VWQA 4H7DA 1H8HA 2QUIA 3IDAA 3U40A 3BGWA 2GZSA 5FORA 2FW0A 1Z62A 3BWXA 1LDMA 1Z5ZA 4G36A 1P19A 4UVIA 3IXMA 4RMHA 4RKFA 4Q03A 1EP1B 2DKOA 5DO9A 2MYNA 2HO5A 2WDZA 4MARA 1NM5C 5JS1A 3BGVA 2JAOA 4E5UA 3K0CC 1KAQA 1RLMA 4K7JA 4Z7QB 4DM7A 1YL7A 2REQB 2PGNA 2B92A 3IQDB 2CV2A 1K4MA 2FR0A 2ORWA 5KVSA 1WBBA 2XWPA 4FC7A 4ZPXA 4EP1A 1OFUA 2LRHA 5DW3A 1CUEA 3HB9A 1RI2A 4DR1B 4M9XA 4OG2A 1RAIA 1VXOA 5FQOA 3THRA 3RBZA 3BAZA 5BORA 1QK4A 1E2IA 1CDZA 1M74A 2R5NA 3H5VA 5F5NA 4HDCA 2ZSKA 4KB5A 2A0KA 3OIDA 1ZD4A 4MYUA 4Q48A 4CGZA 2J6IA 1X1CA 4JDPA 3CR3C 4Q4HA 1U81A 1W76A 3EIFA 4LNUB 5ALFA 4CL8A 5LM3A 4B2IA 4Z53A 2G07A 1HTBA 1NP6A 3DE4X 1G4UR 2R1UA 1A5BB 5ALKA 5IK2A 2DB3A 4TTQA 1SBIA 2D5LA 2RSLA 4EY4A 721PA 4PO1A 1C9KA 4AZ3B 5A3JA 5JEEA 1WZ2A 1KOLA 3TW0A 3JS5A 3BHMA 3DC2A 1RM3A 2W6ID 1ZMBA 3F5DA 1AXGA 2DWOA 3KE8A 1J09A 1SCIA 2R6HA 2C7BA 3WMGA 5KOHA 3PXCX 2HPHA 4KWTA 1TQHA 3O8NA 4KTTE 1PJQA 4JJKA 1RWWA 3NFRA 4ND4A 1JSXA 4D9JA 1F20A 5C7OO 2BZ1A 4B31A 3D8RA 3KWLA 4LFCB 3UATA 2CXOA 4EKNB 1WXXA 1YRBA 4LJ4A 1JFTA 4CL0A 1W4BA 2F17A 5DM2A 3RYFB 1G8AA 4A8JC 1L5SA 3JQ9C 3NP7A 3Q7SA 1ZD8A 4QQKA 3NR2A 3B7PA 1PR9A 4JS0A 2O8BA 3ZOKA 1IBCA 1UJ5A 1TM4E 5I7OA 4C7VA 1KJNA 1WKCA 4W5QA 1T3ZA 1FDOA 4FK8A 4CM9D 3PDUA 3IDFA 4IUCS 1YI0A 4PS0A 1SXHA 3IP1A 2AGVA 5FOWA 2HIGA 3TFWA 4GHWA 5LOVF 2ONKA 3MTBA 3P2OA 2VJMA 2WABA 5FUQA 2VYNA 3A4IA 4TSFA 4OUDA 2YIMA 1F8FA 3MINB 1NR7A 3OA0A 4MRMA 1N8KA 3GLIE 1LBSA 5CGZA 2OP0A 3N58A 4BFUA 1HQCA 3EULA 3IOEA 2XA9A 3C1UA 3K30A 1QZ3A 2HRZA 3BMOB 4IS2A 1KYZA 1U98A 1QHFA 4K9KA 4XM1A 2OK8A 2D1TA 3V3KA 1R0YA 1JIQA 3CSUA 5FI0B 1UK9A 1BDIA 4JT2A 3CT6A 3CTPA 3KTAB 3K53A 3PWSA 3BFPA 1XZAA 4NATA 5EWMB 3RYIA 1JI3A 5DNCA 4IXDA 3PR1A 3GEPA 1QCYA 5TY0A 1FU8A 4RSRA 5JVDF 1HOTA 3OEHD 1B76A 1N2ZA 2VPXA 3GOQA 3ND8A 3FYSA 4YCLA 1HDOA 1HT3A 1TUGA 2OC9A 2NU6A 4J0CA 4M60A 4EYEA 1DOHA 2I2XB 1YONA 4RCZA 4MDEA 1CR4A 3L4BA 5EJFA 3D3KA 5JATA 1ESMA 1UBHS 3QEAZ 1K63A 4LK2A 1N2CE 1P0QA 1ZNXA 2Q28A 2Z95A 3EXEA 4FOSA 1EWVA 5ER9A 3WFJA 3PPYA 3R5FA 5L45A 3VQTA 4B6OA 2WPDD 3CX8A 4L0CA 1VBFA 5CA1B 3B1FA 3S1SA 2I7CA 2HT1A 2BCJQ 3CX3A 4P22A 4UOZA 2A0XA 5KYGA 4E12A 3LC0A 1IN8A 3BEDA 3JALA 1NW8A 3LBIA 1WMFA 2AZTA 2QVGA 2WM3A 3N8KA 2E0IA 4QDUA 3E9YA 5DXFA 5IVKA 2H4YA 4WLUA 1NI5A 1I94B 4JKIA 1IJEA 1WCIA 2AIRA 3RYHA 1AQJA 3NHKA 3KLBA 5FO1A 1E61A 2Y1LA 4HPXB 4LSZA 5HF8A 4Y6SA 3G1WA 4N47A 1NW5A 3F3SA 1ZM4A 4AF8A 2NWQA 4YUZA 2XT0A 5I4IA 1DAHA 2QRVA 4YK7A 4B71A 4W7IA 5KYXA 5KOHB 3EIQA 4D3SA 3JASA 1OIWA 4JLNA 3QH4A 3R5XA 4US1R 1OXMA 3C6ZA 5JISA 1WX1A 1BW9A 3KO8A 4XQEA 2A88A 1VJ0A 2XSZA 3CEHA 3QXSA 3RNOA 4RZUA 3O4JA 2EZ8A 1JA9A 3IT0A 2X4LA 5C7IO 1U90A 3VYUB 3DE5X 2PZBA 3MT0A 1Q14A 3ORQA 1B43A 2VSOA 1C3OA 2PBZA 4RVOA 1QGZA 4K3UA 4ALJA 1KDOA 1CYEA 3I5MA 1EX1A 2GCEA 3BIJA 3QE3A 4E2XA 3KV3O 3ZYZA 2IA5A 3T1NA 2OFXA 1NBMA 4DFDA 121PA 3U7JA 4G5OA 3EWNA 2YIDA 4OIMA 2H52A 2QV0A 1JG3A 4I4NA 3O0TA 3UGQA 3NX4A 3LHIA 2JJ2D 2R7MA 1JPUA 1ZUWA 2GKOA 3TMYA 3VM6A 4F93B 3QVGA 5KNCA 2VF7A 2WBLC 3AIMA 5A3VA 2JAHA 4K9OA 4WK0B 1UCFA 4WIAA 2QD5A 5K99A 4OHBA 2FWBA 1KMIY 3SJCA 3UWKA 3QELB 3OHMA 4N4AA 4NMLA 5KVQA 5JZVA 4JLPA 5TSDA 2GXUA 4PVDA 3OZDA 3D7KA 2XMRA 3G1TA 4QBGB 4FINA 5AVUA 3ZU6A 1Z0DA 1EFLA 1M54A 3BGDA 3HY3A 1IZ9A 3O8OB 2PKCA 3DNMA 2H5LA 4FZ5A 4URUR 1Y48E 1JKJB 5FUMA 4QXQA 2FU5C 1SCJA 3MAGA 3OZAA 3QY9A 4M4SA 3RANA 1QJ4A 4EG8A 1LBEA 1O2DA 3SEQA 2NU7A 3RBVA 4ED9A 4UTRA 1QF9A 4OOFA 3RARA 1CR0A 4BWFB 1KSHA 5ADUS 4DCTA 5DTQA 5KMGB 4FYYA 1XG5A 1NU8A 3MVEA 3NAMA 2ODPA 1FS6A 5E1OA 3A6GA 3LUKA 2QX7A 4H0NA 4D4IA 3NJ8A 4JBXA 2C5GA 4REMA 1ZJ4A 5AXCA 3RUCA 2WD7B 1B73A 1MF7A 2W58A 3GLGE 2DUWA 3AV3A 1FMTA 3DAOA 3E70C 3G0DA 4PXAA 4DR5B 5BO5A 1A2KC 1TYDE 1ZHHA 1QRUA 5AQEA 3UB3A 2ZBEA 3WIVA 4D8YA 2D59A 2ONZA 2PL9A 3MELA 4H15A 3PC6A 3UMVA 3GGCA 4F5WA 3H9BA 4P4NA 3AEXA 4V3BA 2VSXA 3V7YA 1UBGA 4PC3A 2JLZA 1L4UA 4HNHA 4XWOA 4IKPA 1VJ1A 1JALA 1AQ6A 1X92A 1DIOB 2OHGA 2FMUA 1I3KA 1ZG3A 3RVPA 5GJCA 5JLAA 1VPDA 1LWOA 2EXXA 3K0FA 3O2NA 3C5EA 4H0CA 2J5BA 2P77A 1E0KA 3KQVA 1T9CA 3LO8A 3AB8A 4IDBA 2COEA 4Q01A 1AZLA 4FGZA 4C4ZA 4EQ6B 1Y3IA 2PZFA 4KVFA 5E0OA 2WJ6A 3GU3A 1GDTA 5A1JA 1H9AA 2BMVA 3DB2A 2IU3A 2ZYSA 1TFUA 1IWOA 2Q4OA 1Y4ZA 3I9JA 1DRKA 1G1MA 2X9GA 4EG1A 4UHBA 2CNWD 1XRQA 2O14A 1KZHA 1NUQA 1U7OA 3IPRA 1XE3A 2FK7A 1YHZA 3TSWA 3VR6D 3ZWDA 4COKA 3F98A 1FJXA 2CHGA 3O3MB 3TMKA 3VPAA 4RJKA 5A5EA 1E60A 1OBVA 1BS2A 4Y18A 1C9DB 3L8ZA 4BKMA 2M6RA 2JIZD 3VKFA 1OI2A 1Q0LA 4WNAA 1R4NB 5EE5B 5ALVA 1S7GA 3PGLA 1NMYA 4ZV4A 3OY2A 1WD7A 2JC3A 1HC7A 5E7QA 4G0ZA 4B5KA 2GVZC 2R751 1AX9A 1P31A 3AQ4A 4FX2A 4M1SA 4V0ME 1P0FA 2NYUA 2ZM5A 1CXZA 2X3FA 3DB1A 4ZU1X 3FZEA 3KR2A 3L8GA 5JI2E 5A71A 2P41A 5CEFA 4EMTA 1A8PA 1BW9B 2IZ6A 3CRRA 4GBJA 4FDAA 2DFNA 2FWJA 3ZVRA 3O8CA 3QPAA 1GFIA 3DWGA 1HSOA 3OX1A 3OJOA 5HF6A 2MR6A 5H4HA 1RJ9A 2OB1A 1Z4NA 2VH1A 4KLCA 5A6SB 3S28A 3RVOA 1NJFA 4EZBA 5I7UA 1YJ8A 4LYDA 3LK7A 4XD7A 5E6SB 5G0VA 4QOHA 3T6KA 4XTRA 4CLRB 4DANA 2P62A 2Q1XA 4NQRA 1SEPA 3WYEA 3WYNA 4ZZIA 4CLHA 1PX2A 2CXQA 1Y82A 2X4IA 4PZDA 4BEJA 2XF8A 1Y8RA 3L6DA 5L6MB 2I6FA 4Q12A 1JT9A 3ETEA 3M5PA 2X0EA 5JTUA 1Q3KA 1KOJA 4Y7CA 2R48A 1Z5UA 2YASA 4TKLA 1RD4A 5A4JA 3A1UA 2ZRHA 4P08A 1WV0A 1CQWA 4WXEA 4HLUC 4MIOA 1VL0A 4NMHA 4P84A 5CPFA 5H3LA 3UTDA 1KJJA 3ACDA 1A2QA 3LI2A 1H93A 3OECA 4FXOA 3KKNA 3ZNNA 3IUMA 5JZMA 2BI8A 5ALDA 4Q3AA 3ZDAA 2Q0HA 3Q2IA 4QATA 4EKEA 1ZC3A 1PJ8A 4MQLA 3JZFA 2R4TA 2R00A 4S1WA 4JI4B 1CIPA 1Q21A 2DERA 5FA5A 3B6ZA 4H77A 1SCAA 2HUNA 3QKIA 2DTEA 2OGWA 1JZQA 2L82A 2VNHA 5J4HA 1I7DA 1CY8A 1AKQA 3DJYA 3GNQA 5A2GA 3OE7D 3NGLA 3Q4GA 4O4HB 4B34A 1IHYA 2I5PO 3HJCA 5I7RA 5HJEA 2AUMA 5AK6A 3LPLA 5DSXA 3AVYA 1VE7A 4OU5A 4LJ9A 5BOSA 1I4EB 1ECLA 2QY9A 3H3JA 4HC4A 3S7TA 4O6VA 2LWIA 5G2OA 2HK9A 4HDKB 4QICA 3VSBA 3FLBA 3EGCA 3ISJA 2WIFA 3DCJA 4P6VF 2H2GA 1B00A 3U4QB 4B7ZA 4RCVA 3N86A 1LF5A 1VBNA 3MERA 4NR0A 4TLDA 4FFPA 4C78A 1N9GA 2PQ6A 4R9NA 1TZKA 1A9XB 2QDKA 3GFRA 4M53A 4CKCB 2R5WA 2VJCA 2XCTB 2B36A 2YWDA 5AT1A 4B6FA 1SBYA 2IXEA 4DV7B 4C30A 1UT5A 3N0WA 3SOZA 2PZJA 5JS6A 3WDLA 2XEXA 3E7FA 5KCMA 2CDBA 1QF6A 1CRWG 4MA5A 4UUQA 3SQWA 2Y3IA 3UMRA 1DXOA 3ER6A 4BUJA 3M4XA 3OCCA 4DR4B 3W7BA 4K9DA 5TF4A 1PUXA 3DW1X 5JAOA 4N49A 2VRWA 1K5GA 3AUSA 3GIDA 3I92A 3UV7A 4F2DA 1NMEA 2O8NA 5L4LA 5DGCA 5H7XA 5JCZA 3U5ZB 1QQAA 4LPSA 3A05A 3EF1A 4G5YA 2WJGA 2JFWA 4KSYA 5EE3A 4UULA 1KI6B 3SS7X 5T67A 1I30A 1R88A 2OQ2A 3JD2A 3FMFA 1Y0BA 3UN1A 4Q1DA 4BXOB 2YVQA 1A4XA 1ULBA 4LDNA 3LP5A 5E7JA 1O94C 4HB3A 3HZRA 4YP9A 5C3UA 4U3JB 4NZZA 4L9AA 1ST3A 1PFWA 1QR2A 1OXTA 2EFHB 1JQ3A 4J2TA 5CNJA 3QNMA 4AUNA 3VR1A 1SUEA 2Q2QA 1JSLA 3N2EA 4KN8A 3OTOB 2JZCA 3RT7A 5IYZB 3H8SA 3OCZA 1J8MF 1TQ6A 2VRCD 3BPSA 1QYXA 3KSDO 1U1DA 2G82A 3U37A 4KMMA 2FEWB 1NVBA 3A3KA 3VV3A 3A6JA 4INJA 2J9RA 2HA6A 1MN6A 2Q2VA 4KBGA 5AVXA 3KK0A 2VZ0A 5DTRA 3EFEA 2BLNA 3KXPA 1N2HA 3TD2A 3KFLA 3MJHA 2EFYA 4TMFA 1VHLA 1O6CA 4QFBA 4MQEA 2GJSA 3HO8A 4OKIA 3S4YA 5ILGA 3JYHA 1UM9A 1J0AA 3RKUA 2P6MA 1YJCA 3PF9A 3GEEA 4D8WA 1QIKA 3QMWA 4NY1A 4NE2A 1GRRA 1XTJA 2BKLA 4ZVVA 2B94A 1CETA 1S3GA 1EPUA 3DR3A 2HGSA 3EDOA 4G1MB 4Q00A 4QOJA 2DBZA 5M29A 2H1OA 4ON9A 1Z2DA 1JHUA 4HNSA 3BA6A 3QVSA 3RAJA 3TJZA 4DB4A 1MRSA 1KK1A 4RFLA 1D2AA 1RC1A 2O3UA 4FIZA 4U7TB 1LS6A 1T1JA 1JQLB 1ZOSA 3H7AA 4ECEA 3K6SA 4QYTA 1YBVA 1MAUA 3C3BA 4CQNA 3I04M 3C7AA 5K2OA 2IXAA 3F7MA 1WOMA 1AKRA 1VCHA 4XSHA 1OF1A 3KOOA 4EYSA 3IYLW 3SI7A 1BHQ1 1H4TA 2WWGA 2H8GA 4OF4A 4QASA 4W7SA 1GLVA 1MFZA 2AZMA 3UTCA 5E1BA 4BV9A 2HXSA 3PI6A 4EY7A 4KZKA 3VPGA 2IEAA 5I8PA 3M6AA 4Y0NA 4D9EA 1NR1A 2R6R1 3SDZA 1JWAB 2OV2A 5B1YA 1I4WA 3CJTA 3C8MA 3K71B 1YRLA 2FPGA 2I99A 2IDKA 1L8AA 2QAIA 4KAXA 5JAPA 1OPXA 1XFAA 3NVDA 4ZDIA 1G6OA 2DQ4A 3K35A 3OPVA 4MRNA 1YMUA 4AO6A 1EVIA 2PO5A 2NO1A 4BPRA 4BVEA 4J3JA 4D5GA 2UYYA 1LSOA 2VHXA 1DJQA 2G8LA 2XWSA 3FSRA 3FWZA 2ZSBA 1P2TA 3KKEA 4O4HF 4OCZA 4EENA 3V7WA 3G8AA 4NENB 8AT1A 1T0PA 3QW4B 4OFBA 1GCOA 1Q22A 2BFMA 2XJ9A 1MC5A 1QX3A 1VE9A 2WM8A 2H4FA 3PWKA 5G0TA 2EL9A 4RNCA 1HI9A 3AGPA 3NGXA 4ROTA 1PK7A 2J7KA 2AJCA 3EAQA 4ZOCA 1DKMA 4AJ1A 4DCNA 4EUHA 2IOFK 3WWZA 9LDBA 4O8ZA 5AKJA 2E55A 3A1EA 4HEHA 4Z2AA 4UM9D 1COWD 3K1AA 4A0HA 4D82A 1CUFA 4PEVA 3SIPA 4EO4A 3UAZA 5IM4F 3JAWB 3MJTA 1D8AA 3A7DA 4PLCA 4D42A 4FJ1A 4DLWA 1NASA 3T7TA 3KL4A 5IDQA 1X87A 3BJIC 2QRLA 5JRJA 4LE2A 3NB0A 2B98A 4Z1OA 3NWJA 2QLLA 3W5VA 5CB8A 3CVWA 2J30A 5AKXA 2ZW9A 4R98A 5FPTA 5KJFA 1ZA1A 4OI2A 2QT9A 3IS3A 1W47A 4FWBA 4PNZA 4RSHA 1N0IA 3C43A 3OKFA 1C30A 1MTOA 2FPMA 1TT5B 5DBOA 1IQ0A 4DVGA 2O2JA 2YJ3A 4EAAA 5KTYA 2FZWA 1SGWA 2NSDA 4JMLA 3ZEIA 3AVUA 3GJ7A 3LVQE 3UW1A 5CYOA 4MMZB 2ARKA 3KETA 2W2VA 4PXYA 3X0DA 2HCRA 5K51A 1ONPA 1LKZA 5ES3A 4YRBA 1H1LB 3M6UA 4Q9KA 4N0PA 4QYWA 3N2GB 4S2UA 2WU4A 4C3OB 4LZOA 4IJMA 2OO7A 4C2AA 2NAPA 3NNSA 1OXVA 1N2GA 4OSPA 2B78A 2Z9BA 2A9OA 4RA9A 4K6MA 2LCFA 3IV9A 3SYKA 1P4JA 3NIFB 3PGA1 1EFHA 1YZYA 2IYLD 4OV6B 3WLAA 4AWAA 5H0IA 2GBIA 3WAKA 3ENQA 5KTKA 5LDHA 2IZ0A 2I6TA 1DAMA 1XAHA 1KMNA 4BV2A 3LKDA 4MUIA 4XARA 4W9RA 4OLJA 1TUEA 2HWUA 4J0QA 2PGDA 1L5GB 3FPBA 1ZEJA 3MQ2A 5FWAA 2PFSA 1ZVVA 3S8YA 1G9SA 4LJRA 4GOXA 1LLUA 1HL7A 1KERA 1RCUA 2Y1XA 4HUQB 4QXRA 2AQ8A 5EJ2A 2XTNA 3GCXA 2PCLA 5SV2A 4LYGA 1EP3B 4NOJA 4O1IA 5B7QA 5LZ9A 1CJBA 4YYEA 1BDHA 4OLBA 2YDYA 3T34A 3IBGA 4HGOA 1TKCA 2PA3A 3C3MA 1DL5A 4CMAA 1QRTA 4X61A 3A6DA 3KB8A 2QMUA 2H7XA 2JL1A 3EXFB 3FH0A 5C1PA 1LTHR 2A3NA 4JUDX 5T4FA 3D6TB 1P9RA 4K40A 3FX2A 1W36C 2QOEA 5D5PA 4EY3A 1S4MA 1PNVA 1XNGA 2X9VA 2FFJA 2WF6A 3K73O 1Z2EA 3KYDB 2AKEA 2YHAA 3S1AB 3DEIA 1F4LA 4HMOA 1EBFA 2O2GA 3WNBA 3AU8A 5LP6F 3Q87B 1VCNA 2FA9A 4HWRA 5DTIA 3CVUA 3KEGA 2ZRPA 3FPKA 4I9NA 5L3QB 1BMQA 1H6CA 3EHEA 3OWXA 4EF4A 4CL2A 1EUDA 1YZHA 4GMFA 3DCNA 3NOVA 4MQ5A 4UAUA 5G1OA 5CTJA 3VXKA 4C4TA 3MJ4A 1KORA 3U19A 3PICA 3TRJA 3I39X 4DC0A 4GUAA 3GRRA 1JPNA 1K6JA 4R51A 4J7CA 2WLTA 2Q0SA 2VTVA 3C5WP 4M98A 5EUMA 5B2ZA 4NC9A 3ZLJA 3GWGA 4KN6A 1RQ7A 1F17A 4URZR 5K4GA 1KOGA 3DWEX 1ZMRA 1YK0A 2XCLA 4N7RA 2P6RA 4E22A 1I2CA 4JLUA 1SXGA 5JDCA 3DULA 4J1TA 3DH0A 2W7TA 3L8EA 1EXMA 3T4PA 1E3EA 4UXJA 1UBEA 4U0KA 3F8WA 4CHGA 1C8KA 4U2EA 1WXQA 1G2OA 1XU7A 1Z3CA 2SCUB 1RQLA 3UAXA 5HCIA 4L4ZA 1MVNA 3GRVA 3ZW8A 1YNSA 3WNCA 1M2JA 1Z0IA 3T9AA 2PLRA 1T3SA 2RHWA 3KAQA 2IWRA 1U28A 1AGXA 1C4OA 3OZFA 2PUHA 2ZS8A 2GK4A 3SSAA 2ZULA 4RXMA 4LI3X 5ALUA 3T1OA 1G98A 4LJLA 3RABA 5AQ1A 4HVLA 1IULA 2HIHA 2QWXA 1X94A 3UG7A 1HKHA 1QO0A 3TIVA 4O29A 1JHQA 3TF5A 2CNWA 1T0BA 3RUIA 2AWNA 2KW5A 5FL7D 2D2XA 2R8ZA 2YWCA 2ZIXA 3LDHA 1OWPA 1DC5A 2YY5A 4QAQA 4URWR 1HYBA 1J23A 1ML4A 3OLWA 1GUZA 2I71A 1S6YA 2P9FA 4TN1A 3RT1A 4X97A 3KOYA 5AK5A 2HA7A 1GJRA 2YJGA 4CQLA 1BE0A 2Y0BA 2WM9B 3FPHA 3RVNA 2AJTA 2H17A 3LF1A 1FBNA 4R68A 2D2FA 5IJAA 2GO7A 4XGKA 3SBEA 4DEVA 4FYMA 3BL6A 4LS3A 1DQYA 1L1QA 1IK4A 1FRFS 3G0HA 2BFDB 1TAUA 1SH7A 2CD9A 2KB0A 3TNFA 4BLWA 2YV4A 4Y6LA 3U3DA 3W3ZB 1NVFA 3AUAA 3UH1A 3RRJA 4CG3A 5CHEA 1RAFA 1Y9DA 4GWLA 4YA6A 4AN0A 4FFDA 1MOZA 3D6HA 1C50A 1XYVA 2Q41A 4NZOA 3IKLA 2AX3A 1V47A 2P6NA 3O92A 3PI7A 3L0BA 3TOSA 3U9SA 4QYIA 1MEOA 1Z4QA 2PGOA 5E1DA 1XYGA 2Q3JA 1QM5A 3FKSD 1NNLA 2XVMA 5FUYA 4AKSA 1MU0A 2IV2X 2UZ1B 1F0YA 4ERNA 3QMPA 3A11A 4ALMA 4AP5A 4BO6A 4Y2JA 3KQLA 4BMSA 5CA1F 2C42A 3RS4A 2ZDGA 3I8SA 2X6RA 2XUIA 3GG9A 3KZNA 3CW2A 3L7MA 5IBPA 2ZJ0A 4QGHA 4UXHA 5GJWC 1DARA 1L6RA 2UDPA 4BO1A 3G0BA 3O03A 5I6DA 3WG9A 2YRXA 3AERA 4LE0A 3JQGB 1SURA 3JQ7B 3M3DA 3WHLA 5SZIA 2IZ1A 4D0RA 3UK1A 2H1SA 2Z2ZA 5BWCA 3CH7A 2HRDA 3QU2A 1EFCA 3TLYA 2MMCA 1F2DA 1RWBA 1KQGA 3L0YA 2O8FB 3V00A 3ZS8A 1FF9A 1J2JA 1GR0A 1NP7A 1YR6A 2IHZA 2Z2IA 2HBYA 2CVZA 1T5HX 1G19A 3PC2A 2O48X 2HCBA 5HEKA 1GPNA 3G6WA 3DYVA 3KJFA 2QT1A 4QFMA 2ETXA 4FFBB 4ZYYA 4OQQA 1RMQA 2JGIA 4IDDA 4EAQA 1RC8A 3UYLA 4NOLA 1X7DA 2X58A 2GHQA 1OTXA 3I5XA 3HJTA 3GMSA 5EC8A 2ONCA 2R68A 3IUSA 5EZ5A 1GTZA 1IZYA 3EA4A 2YH2A 5FTKA 5K4AA 3EZGA 3P0HA 4Y2RA 3G79A 2F8SA 3N0XA 3AM1A 3WICA 3NEAA 4OJNA 2HA5A 2IVFA 1FFSA 4UBMA 5P21A 3RROA 3WRXA 2F9LA 3B5JA 4OMFG 4DAEA 1Y6JA 3N87A 2IU0A 4EW6A 2FZVA 1FK8A 4EB6A 5L9AA 5CG1A 4AI6A 1MDBA 5KUTA 1OKKA 4G0YA 3OE5A 1RJWA 1M2HA 4ZOAA 4YQEA 2C04A 4ZCMA 4PFSA 1E5QA 2W6NA 2J9GA 3ICPA 4KVZA 2J6BA 4OGKA 2WF9A 5EL0A 3RH0A 1H9CA 1G8YA 1GNLA 1GEGA 1L7NA 4PLVA 3G6KA 3OOEA 3C1AA 3T5DA 4JEIA 4MA4A 3RTBA 3WL4A 4B83A 2X0NA 1KHHA 3ZZMA 3D5TA 1XA0A 1DT5A 1E5DA 5HDBB 4HJXA 4NCIA 1P60A 4WXYB 2W2OA 2XUJA 4YC7A 5B58T 1SU6A 4JJ8A 1YHYA 2NOAA 5HSGA 1MDFA 5FIUA 5L51A 2PUCA 3O7WA 3M6FA 4U5QA 1XMPA 4LYJA 1AHHA 1W4CA 3ENZA 3O9MA 3Q6NA 4HAZA 4QUGA 1JTVA 1Y4AE 1IFXA 4HYYA 4I1UA 4NV3A 5F9MA 4BMZA 4ZQGA 5B7NA 3HN7A 2DKFA 3E9MA 3OCXA 1JMVA 4DDUA 2ACVA 3OTQA 4TWJA 1XP8A 3H1GA 2ZSAA 4KO1S 1B8NA 1QIEA 2IYVA 1A9ZA 1G5HA 2BJVA 4QQ8A 3GMIA 3CX7A 1M2FA 3GYGA 4U7WA 4ZGGA 5IKMA 3OPYI 1A71A 2HSEA 1ENYA 1T1RA 3RVLA 3HBLA 5KYYB 1JVNA 3DLAA 4YXWA 4CF4A 4KUEA 3VR6H 5L3QA 3F6RA 1BQ3A 2G72A 2VSNA 2ST1A 1M0TA 2HNAA 4JFAA 1ZK0A 1ZRSA 2IITA 3FE2A 1MB2A 4NCNA 1EHIA 3EEQA 1O5OA 3RJTA 2GERA 4WE3A 3Q1KA 1ML3A 1HT0A 5G1NA 2G08A 1EGAA 5E9JA 3WJ1A 3KSBC 1ENOA 2BR4A 5E9QA 2IP4A 3VRHA 4FKMA 2C7RA 4GF5A 1AN9A 1PZHA 1QUEA 3BE8A 3MB8A 3B2QA 3IA2A 3OJCA 4JHLA 4W4TA 3V1MA 2R1TB 3DMFA 3O91A 3A1VA 2Q8QA 3ANYB 3ELUA 3Q11A 3OLYA 2X22A 3B1WA 3IMKA 4J16C 4TPKA 4WCDA 4UBJA 1U31A 3SE7A 2A94A 1O97C 3G2LA 4D4MA 1SG9A 4C7JA 4KPYA 1ACLA 3ZHYA 4F06A 1YI1A 5DDIP 4CV1A 3DWFA 2UYHA 5K3CA 821PA 1RQNA 3DXXA 3Q15C 2H2HA 3FCEA 1US8B 3VPSA 2FP3A 4ZCTA 1R37A 4YAOA 3W6PA 4P9NA 4MS4B 3EIXA 3KR0A 4HUQA 3D7NA 4IRMA 2P5TB 3K9LA 1LJLA 3QVXA 1IRIA 2QW8A 4DXHA 2L2QA 4QOSA 4FMBB 1GRNA 1LI4A 1X19A 3AR6A 4GRDA 3FAKA 2FHSA 3CLKA 3DC7A 3HCDA 3LQFA 2FX2A 4MR9B 1FEZA 4UUBA 1DZIA 2Z2YA 1Z4JA 3IHWA 1CQIB 4Q7EA 1XEXA 4E5PA 3GEDA 3SHVA 4QBIA 1LY1A 1P81A 2QQGA 1P5RA 4YJ3B 2VHYA 1U5BB 5TB5A 4YPOA 4AK9A 2PJDA 4U6QA 3N0RA 3USZA 1ZNYA 3DPUA 3K32A 4BE9A 3TSZA 1MVLA 4O5OA 4B3BA 1HLDA 4BNIA 4BU1A 4HAOA 5KWEA 1VZ2A 1ZYUA 3MS7A 1Q2UA 3U09A 4BMCA 4NFLA 4QUHA 3NGMA 1Y9ZA 4TLCA 3OZXA 1AZWA 4BBJA 2FLWA 3G5TA 2G1JA 1OYOA 4UPEA 3LLCA 3O26A 3VOBA 1U7HA 1RQGA 1Z0FA 2DQZA 1SULA 1V11B 2VS1A 4BNTA 1RWVA 5EIHA 1OGYA 5KREA 4KMOA 1TW3A 2WFZA 3ET5A 3QYJA 1PN3A 3BXOA 3I12A 1INLA 3LTNC 2Q0QA 2DAPA 2RG7A 4ZYWA 1NN1A 4WNYA 3BWEA 1NDHA 1ZH0A 4YMGA 4M8IA 1UZLA 4BHTA 1V7QA 3R3UA 5HG0A 3CF0A 5T7BA 2QTWB 4MPPA 2HJHA 4A27A 2Q6KA 2FFHA 3ZCRA 4FYJA 4LHXA 3TGWA 4YAKA 1O1YA 2VDPB 2PZEA 4IVRA 4MH0R 4AS3A 2G1UA 3BDVA 1W5SA 3FUUA 2WPNA 5BSTA 4J7UA 1DEAA 1EJ2A 2HZBA 3DBLA 4JI6B 1VTKA 5BV0A 3O8RA 1U8AA 4XYGA 5KB3A 3KS9A 4IMJB 4WRRA 5G0SA 1O5IA 4R8LA 4XVUA 3KU4A 4G5RA 5IBQA 2OFOA 4JWTA 2IBTA 2H63A 3JVDA 3PQEA 3SZ3A 3TPZA 3TECE 2C8KA 3BJRA 4TMWA 5DASA 3W8DA 4G5QA 2DJ5A 4IQFA 4ZQEA 1NATA 2BDTA 4CIYA 1FP7A 3O4FA 4I08A 1V35A 2YC4C 4NDZA 3OX3A 4PGHA 2P8SA 4BLSA 4EPYA 2C4KA 3JCZA 1WVMA 3HA5A 3NORA 1IHOA 4MGHA 1GN9A 2IU6A 1S2NA 1MJNA 3BWVA 1M2WA 5KNBH 4AJEA 1L4EA 3P4XA 4RYDA 4D0NA 4IMPA 1OHHD 4LJ6A 3UAWA 2RBKA 1KARA 1EU1A 1YCDA 2BONA 1X9HA 1DI0A 2G0AA 3EB9A 3MRSA 4MVJF 3ZJ5A 5TMPA 5JXJA 1XXLA 3KKZA 2KJQA 2ZROA 3DAGA 3JTMA 4LCEA 4Q3NA 5FEMA 3NAGA 1R12A 4AKHA 3AR2A 3PXAA 3W78A 5CB4B 4YMWA 2OZEA 2ZP1A 4EK9A 5LOVA 3EEBA 4QXOA 4GL2A 1GUBA 4YT4A 4OLHA 3CNOA 2OLEA 1MP0A 2QRJA 2OXTA 4E33A 4LOJA 5IHPA 3SR3A 2CXRA 2EU8A 4OIFA 3NYIA 5K3BA 4BUCA 4JI2B 1E2GA 1AG9A 2JHPA 2FI1A 2L18A 2UUBB 3VNSA 4H7KA 4ZI5A 5GMOA 2CHUA 3GFGA 4Z2YA 4KKVA 1VC2A 2VYQA 4GSYA 3AF5A 3EBLA 2QE7D 3KWMA 4HGZA 4KGDA 1TM1E 4ZRMA 2J0UA 5CW1A 1R5JA 2VK1A 1P9WA 5AKLA 2W70A 3WTCA 4F4UA 3NCTA 4WQMA 1C0EA 1T6BY 1X7XB 2BKUA 3OX2A 3QKUA 4O2BF 4NU6A 5DI3A 4RHXA 2C2MA 3OT4A 2AR7A 2D3WA 2Q50A 4OO3A 4KPFC 5CK5A 4DMCA 5BSFA 3EE6A 3TQCA 3EIEA 3SSNA 1ZZGA 3KC2A 3R6DA 1AH2A 5FLKA 4XJTA 2X14A 4AZ0A 4XUGB 2JGMA 4RJJA 1L5RA 4LJKA 4FS8A 1S5PA 2ZM6B 2JAWA 3NTRA 4TXNA 4NXMB 1WA5A 3WB2A 2WJPA 3HNOA 5EKDA 3ADBA 5BWNA 1MC1A 1L9XA 2BZGA 4F21A 1E2DA 1N2BA 2D2IA 4TGLA 1XCBA 2PT9A 1B15A 1DADA 3ZKAA 4PLGA 1KTVA 3FDFA 2ZJZA 1ESDA 4US0R 1MO6A 2PNFA 3WRVA