1RSZA

Structure of human purine nucleoside phosphorylase in complex with dadme-immucillin-h and sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
282
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Structural comparison of human and malarial purine nucleoside phosphorylases
rcsb
source organism Homo sapiens
total genus 86
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rszA00
1Q1GA 3BGSA 2AI2A 3PNPA 4L5AA 3GB9A 4PR3A 1OUMA 4GKAA 4IP0A 4L5YA 3INYA 1ZL2A 1A9OA 4OEHA 3BSFA 1PK7A 2Q7OE 1ODIA 1ECPA 3BJEA 2OC9A 4R2WA 1RT9A 4BN0A 4TYMA 4G8JA 1OU4A 3ODGA 1JDZA 2GUWA 2AI1A 4GMHA 2A0YA 3LBAA 3MB8A 1PR5A 5CCEA 4BMZA 4NSNA 1V41E 4DAEA 2OXFA 4QAQA 1NC1A 3KUKA 1Z5PA 5CXSA 4YNBA 4G89A 3MMSA 4OJTA 1T8RA 1NW4A 4RJ2A 1A9PA 1XE3A 2H8GA 2QPLA 3C74A 1Z39A 2QSUA 1T8YA 4U2KA 1VMKA 1K9SA 1A69A 1TGYA 1VFNA 2AI3A 5B7NA 4MARA 1Z5NA 5IU6A 1Z36A 5DK6A 5ETJA 2HN9A 2QTGA 4OGLA 4DA7A 3P0EA 3K8OE 1Z37A 3UAXA 1ODKA 1ULAA 4L0MA 3O4VA 2B94A 3PNSA 3UT6A 5EPUA 1Y6RA 4L5CA 1Z5OA 1LX7A 3E0QA 1SQ6A 1N3IA 5CYGA 4YO8A 1YQQA 4DANA 1PR2A 1Z38A 4TS9A 4LDNA 4F3KA 4LKRA 5B7PA 2XRFA 4NY1A 4BMXA 3OPVA 1U1EA 5I3CA 1K27A 3KVRA 4D8XA 1RFGE 3OZBA 4NS1A 4DA0A 4WKNA 3PHBE 5KB3A 3FNQA 4DA6A 2HWUA 1VHWA 1PBNA 3LA8A 3LGSA 4OF4A 5B7GA 5F7JA 4KN5A 1OTYA 2OC4A 1ZOSA 4TXJA 4ECEA 4F1WA 2QDKA 5JPCA 1LV8A 1Y1TA 3OOEA 1PK9A 1U1CA 1T8WA 1TCVA 3DF9A 1ULBA 3OZDA 3O6VA 1YBFA 1T8SA 1A9TA 4X24A 4UC0A 4TXHA 3QPBA 1PR4A 1Y6QA 1RXYA 4LNAA 4TS3A 2A0WA 4QASA 2ISCA 3F8WA 4PNPA 3EMVA 2ON6A 3E9ZA 4F2WA 4BMYA 4R31A 2RJ3A 1JE0A 1A9RA 1RSZA 5F7XA 2QTTA 1JDUA 4TTIA 1ODJA 5F7OA 4DABA 1NC3A 3OCCA 1Z35A 3UAWA 1V48A 1U1FA 3ENZA 3GGSA 1Z34A 3IOMA 3UAYA 1OV6A 3FUCA 1QE5A 1RXSA 1SJ9A 1A9SA 4M1EA 4LZWA 1T0UA 1Y1RA 4D8YA 1K3FA 1RCTE 4YJKA 1B8NA 4WKBA 4MCHA 1PR0A 3OZEA 2I8AA 2HRDA 4TXLA 3FOWA 4TTAA 4FFSA 4M3NA 4EARA 1OTXA 4E1VA 3KVVA 5B7QA 1JDTA 4D98A 3DDOA 5F73A 2P4SA 4QEZA 3FAZA 1PR1A 1U1GA 4M7WA 3IEXA 3OF3A 1JDSA 4TTJA 1PWYE 4JP5A 3PHCA 3EUEA 2IQ5A 1RXUA 3FB1A 1TCUA 4TXNA 3K8QA 1TD1A 4EB8A 3NM6B 3EEIA 4QARA 1TGVA 3DPSA 2AC7A 5K1ZA 5CCDA 5CXQA 5C80A 3UAVA 1PKEA 1FXUA 1SD2A 1ODLA 4I2VA 1RXCA 1JDVA 4H1TA 4P54A 4WKOA 4D8VA 5IFKA 3DP9A 3KHSA 4DAOA 1JP7A 4GLFA 5F7ZA 4R2XA 2A0XA 4D9HA 2A8YA 3U40A 1B8OA 4QFBA 4G41A 4JWTA 1CB0A 1JPVA 1G2OA 4JOSA 1A9QA 1YR3A 1Y1SA 4TXMA 4OGKA 1PF7E 5EUBA 4MCIA 3FWPA 1JYSA 1I80A 4F3CA 3KVYA 3UAZA 2HSWA 3SCZA 3NM4A 3KU4A 3D1VA 1CG6A 1OVGA 3ONVA 1PW7A 1C3XA 4DARA 4LNHA 1PR6A 5F77A 3DJFA 4YMLA 1JE1A 4K6OA 1SD1A 4L6IA 3NBQA 3NM5A 1V4NA 3T94A 1YQUA 4QATA 5F76A 1U1DA 1V45E 2PGAA 5EFOA 5FAKA 5CYFA 1Z33A 4DA8A 3E9RA 1RYZA 3TL6A 3BL6A 2BSXA 3OZCA 2OECA 1RR6A 1LVUA 1YRYE 1M73E 1V2HE 1Y1QA 3P0FA 4F2PA 4WKPA 4GLJA 4OY3A 4WKCA 1WTAA 5F78A 1VHJA 2I4TA 3OOHA 1V3QE 3EUFA
chains in the Genus database with same CATH superfamily
3W7BA 4H4DA 5JCJD 4JZYA 4KQIA 4ESOA 1X38A 4ZV9A 1Q7TA 3NATA 3KRTA 4PINA 1IHUA 3T38A 2W2PA 3PE6A 2ZB8A 2OCLA 4US2R 4YEDA 4CMBA 2YWHA 1W85B 5JH7A 1H1TA 1TC1A 2C9MA 4TN1A 2SNIE 1P1HA 1OUMA 1YL5A 4M1KA 5TB5A 3UT5A 1UBRS 1DG1G 1NBME 1OXKB 3SD7A 4O4JB 3KJXA 1RJFA 5IVHA 2WTXA 4IHJB 4UFOA 1XPUA 3EF3A 4RD6A 3LWBA 2HA4A 3RAJA 3QYPA 3FXAA 5E3JA 4EUKA 3ADPA 2QYTA 3FVTA 5EE0A 3LC0A 3IO5A 3ZGLA 2Q46A 1RQ2A 1HLPA 1DADA 3H5NA 4C06A 3EVNA 1XLTC 3OOSA 1PV4A 1NF8A 1H69A 4FEGA 1XTRA 1HORA 3W2GA 2XEXA 4EVIA 2R7AA 5L51A 3KKZA 3PDCA 3U61B 3FRJA 4U4AA 3AC0A 4GKBA 4K46A 3QPDA 3OIFA 1QJCA 1T3GA 3ICCA 3O8LA 3DZKA 1AZSC 1Y5RA 2QN6A 3MD9A 4NONA 5I7AA 3ZJ4A 4ZAFA 3MEQA 4BKUA 4HB2A 5AM4A 1DEOA 1E5VA 2XNKA 3NYQA 4GMDA 3SG0A 4PIVA 2B3TA 4JC4A 4BX9A 2EBFX 5HCUA 5CCXA 5JZSA 1QP0A 5IYZF 1NASA 1N5JA 3I6MA 4CN9A 4HNTA 2OP1A 3OPMA 4EGCB 4I1UA 4U5XA 3OT5A 3TL2A 2BAGA 3CVVA 5HKKA 3TXYA 5F9HA 4B7ZA 9ABPA 3LT1A 1CVRA 4NU8X 4DUPA 2GF9A 2VF4X 4D9EA 3IIJA 4H1WA 1DUIA 1ZA2A 2C1XA 5JR3A 3KR2A 4IF4A 3VU3A 2CL5A 2BFCB 3V32A 1Y5NA 2X2OA 4GPTA 3CT4A 1CUSA 4H1UA 3E2IA 1NMEA 4JIGA 3WADA 4DMLA 5HM6A 1N2ZA 1CY1A 3AOEA 2NPFA 4OA8A 1T8YA 1WMBA 1VMKA 5AICA 3ZX4A 1WM1A 4CTMA 1NXQA 3A26A 3Q7PA 2HXGA 4Y1GA 5DI3A 4BJ5A 1VHDA 1VFNA 4FFWA 4CDGA 1DRVA 4AF6A 2HO4A 2D5AA 3C6YA 1X39A 3KKKA 4IIGA 4YJGB 3RT9A 2PHZA 2CEAA 4O1IA 3G2QA 2BSQA 5KNBD 1XZJA 3HG7A 5B1SA 1L5VA 5M34A 2C9ZA 4D42A 3TAUA 4ZTZB 1TQ6A 4IIUA 4Y2GA 2VDQB 1KJYA 1KDRA 1WUTA 2J0UB 2C7OA 4F3TA 3MCAA 1XYYA 3TM5A 2YYZA 3PC8A 3K15A 3OJCA 3OT1B 1NLUA 3FNRA 1CRZA 1NX6A 4GRAA 1WSAA 1UJBA 4YQEA 3EFOB 4WBXC 3VVLA 1FUEA 3HU5A 721PA 3ANNA 2P6NA 4TWBA 4DLKA 3GFOA 3OIDA 4TQGA 1TNDA 3AILA 3EVZA 1RU3A 1EXVA 4D4MA 1U11A 3LHFA 1Q0LA 1L4BA 5CYGA 1PU2A 4I8DA 3IUQA 3WZLA 4X8HA 2XGOA 4M86A 3P0RA 4R2HA 4WNCA 2EKLA 3F6SA 3K2EA 4ZAVA 3TSWA 4DANA 1SBHA 2YY6A 2O50A 1G21A 3JR7A 5A9TA 2D1SA 4YYZA 4F3KA 2CD9A 2YCLA 3G0DA 2DP4E 5CLLA 4KK4A 2G09A 3L43A 4JJAA 3EDOA 4QULA 4D46A 3F67A 5DHPA 3N58A 1STOA 2BKLA 1QYVA 4TSFD 1PJRA 5BQOA 3TDKA 4AY6A 1SBYA 3T5AA 2PX4A 4J16C 2I0FA 2C77A 4WXHA 1ZITA 3EGCA 3GO4A 3SHWA 2QW8A 3BKWA 1DAGA 1RFGE 2W2XA 2ZRHA 3QVOA 2AXNA 1D4AA 4Y2SA 4WY5A 3G59A 1IM2A 4OV6B 3D1LA 1X8LA 2YDXA 4XJXA 5CNJA 4LXGA 4RK1A 4FR2A 3R3ZA 4EMBA 1KZ7B 3MWGA 4P58A 1J2EA 4XUGB 5KWIA 3MWFA 3PFWO 4GC5A 3E03A 4UM8B 1O77A 2QLJA 3QSGA 4V2IA 3U26A 5BN3B 5C8VA 1NBIA 2C8JA 5CEFA 2DFVA 3TZLA 1A8UA 4U6SA 2Z04A 2OC4A 3M4JA 2EHJA 3K96A 3JVDA 1E0DA 4HYQA 2C9BA 5DU2A 1QDLB 5JNRA 4DGQA 2FX5A 1IG0A 4RWZA 3RIEA 3S1AA 2O8FB 1U7ZA 5CM2Z 4A8TA 4ZVQA 1WXXA 3L8YA 1U9ZA 2R47A 4G6ZA 4WXPA 3TR6A 4ZEMA 2HA5A 1F1BA 2NTEA 2OM2A 2ZTLA 3LU1A 4LMBA 3G1WA 3D4OA 1HFJA 3HCDA 5CXXA 1A2BA 1U1CA 2BKVA 2F3RA 2WF8A 4GMKA 4GKKB 1QS0A 2GM9A 2H07A 5BWNA 4ARUA 3GPCA 2C2ZA 2CW5A 1RI3A 2IYEA 2W22A 3KKEA 4J6FA 1A72A 2V59A 1QYDA 1T8SA 4RCYA 4JLSA 2W71A 1NP7A 4URXR 3WYAA 3OUUA 3UMVA 3VR5H 1XG5A 4UCFA 1YBAA 3D31A 4IFEA 4WSOA 3DHNA 3U81A 3UJCA 4MVWA 4YGXB 1MHTA 1YV9A 2RBKA 4M21A 3ZDQA 3M49A 1KQGA 5DYGA 4O3MA 2XY4A 2ONKA 5B58T 1CJCA 3Q3EA 4IV0A 2CHQA 2HMTA 4LNUA 4Q15A 3VBEA 5LZ5A 4CV1A 4ARCA 2DLCX 1QFSA 1A8PA 4ITUA 1XTVA 4J2TA 4CQLA 1Z6QA 2IHVA 2Q2QA 3EBLA 1OB5A 2XZPA 3K09C 4RWEA 1TZBA 2O05A 3O4FA 1E1YA 3W3AH 3O91A 1VIAA 1QYCA 3TRKA 1GZ3A 3LK7A 3VI3B 1E9EA 1Z7BA 1RI5A 3CGWA 2Q5JA 4WBNF 1UODA 3HR8A 3E1KA 1DAOA 1T1RA 1VL8A 2A84A 2WIFA 3IBGA 4OUKX 4ZAYA 1ZJWA 1CY7A 4X1YB 1G9XA 1Q2UA 2FW9A 1M1UA 1N2EA 1TYAE 1PGJA 3DCIA 3B9BA 3EVAA 2J9FB 4TMWA 4AJ1A 4UU7A 1EDOA 4R31A 5KQLA 5C35A 4G26A 4HMQA 2QZ4A 1WPRA 4IH9A 1M6WA 4PAOA 2HA2A 5C5DA 2HPVA 2PT5A 4NI5A 4U7FA 1BC5A 2FPGB 4DQUA 4RK4A 1L7QA 2UYQA 3AUSA 4RGQA 4GLOA 2EAUA 1HFWA 4NYIQ 5DJ5A 3UATA 5AD1A 3EPJA 3LTEA 1CSEE 1XMOB 4JKOA 2EQBA 4YT5A 4CEJA 2P30A 3AHFA 4CVNA 3R5SA 3KKNA 5KZMB 4XRGA 2IHKA 3SQWA 1X80B 4HDNB 1XKQA 4HUJA 2Q8PA 2WYIA 5LU8A 2CHUA 5JECA 3BF7A 4XDZA 3PNBA 2TRSB 1AF7A 4QYTA 1Z35A 2ZI5A 2BJHA 2CMHA 3UG6A 4LISA 1MOZA 4JUCA 4LOHA 1IBLB 4Z9YA 2EKDA 1AGXA 2B20A 3GLRA 4INZA 3GGSA 1R00A 1N2BA 1TYEB 5EZYB 3AUFA 1ILEA 2PWZA 5FOXA 5FWXA 1V5WA 1RRGA 2LIPA 3RUEA 2GBFA 1QVRA 3JSXA 1ATIA 1WWKA 4U1RA 1HTWA 1XMVA 1U7WA 4Z1OA 1L4MA 4OU5A 1OFGA 3X2SA 2IW1A 4B48A 2P3OA 4DMFA 4EGJA 4GOMD 4OP1A 1QP8A 4FFRA 4JLPA 5GTDA 5KOYA 3FDIA 1HG1A 3RARA 4GR4A 2DFLA 2C4KA 3QF4A 3MS4A 2EFCB 2DUNA 2OXCA 3L6BA 4P4UA 5IBCA 5ICSA 1MFZA 5K8CA 3KT8A 3PUJA 1X8JA 4ZRMA 4FBLA 5FQNA 4EI9A 5K09A 2FRDC 4P4SA 5JADA 4HGQA 3HP1A 3W6PA 1IWOA 4GI7A 5ICGA 1U8XX 2ZJ3A 3I45A 4K1XA 1Y5LA 2CFCA 3BMOA 1P2FA 2PMDA 4X63A 3EOAI 2R6ZA 4X00A 4QDXA 3ZVLA 1IQ0A 1KAMA 5KTSA 2AD5A 1GN9A 5U1PA 1VRCA 2BJWA 2I66A 2NYUA 4HLUA 4A15A 3SS7X 4Z0NA 2P41A 1RXVA 4GGMX 1JDTA 2M6KA 4WOCA 5LQJA 2CLCX 2ZXFA 2PZGA 3OCZA 1G6KA 2P4SA 3NHPA 2PPLA 5AHRA 3WY9A 1UEIA 1E4VA 4ZXFA 4QQFA 1VL0A 4W7SA 2VJYA 1JFTA 3E9MA 3DHYA 4UMDA 4HBZA 4OQXA 4EG1A 2PZJA 3TEJA 3JZFA 2R6JA 1RPAA 3PEUA 4BKQA 4M8LA 5BMOA 2Q45A 2QN7A 1HYGA 4W6ZA 2J46A 1UJ2A 3HFRA 3OSUA 3EXFB 1MC8A 1U99A 4JY7A 5K2OA 1TEHA 5EERA 3LBHA 4P3KA 4ZQCB 2H17A 3FFTA 4CQMA 3ICWA 3HFSA 3TJMA 2A35A 1SCBA 4JT9A 3REFA 1GKUB 1V5IA 3N2KA 3Q9NA 3MT7A 4ETIA 1DOHA 4DMGA 1M0EA 1DRJA 3HR7A 3K8QA 4XD7A 5JNVA 5CXSA 1AN9A 3NWJA 5T3UA 1L3CA 3AFHA 3RO7A 1QH9A 2WYVA 3RS5A 4U0KA 4LE2A 4BN5A 3BTSA 4Q02A 5H3LA 3VC7A 1M2WA 1WKBA 1R1DA 1V5FA 2C4MA 4U6QA 3EHDA 3B3AA 2FUKA 2X0FA 5MF6A 1ULUA 2VJQA 3VBCA 3L4BA 2WYHA 1SOAA 3JVIA 5DI3B 1T0IA 2ZUBA 4ARSA 3WIVA 3I6BA 4V3BA 1VE3A 3SZLA 4CM6A 2H51A 3GCZA 3AWIA 3ZE8A 1JDVA 1S7GA 3VR3D 2IP4A 2XTAA 1DO0A 1I5OA 5CH3A 4CEIA 1S2DA 4OYRA 4EFMA 2II6A 3GDHA 1TF2A 4XCQA 3ICQB 4EYKA 4X7MA 3EFBA 2JRCA 4Q3NA 3K0BA 3ABZA 3TLZA 5KOHB 4F6CA 1MEEA 4CNBA 3MGCA 2ZI7A 5CFQA 1OXMA 4R2XA 1KYQA 2VBIA 2YNMD 2IEDA 2HU5A 4C4OA 5AVZA 4HI0E 3TTVA 3QFCA 4LHYA 4LWQA 4U00A 4QJ3A 2YMMA 3IKMB 3OHSX 1KDVA 3FLMA 4F4DA 2ICAA 2EX0A 3LKVA 4BMOB 3R8FA 1RM4A 2HNBA 1VIYA 4NK4A 4ZZ2A 2BD0A 1EGMB 1LPNA 2RGWA 3ESAA 3QWFA 1YR3A 1HWYA 3CEPB 4DY6A 2GKSA 2BZ1A 1KEWA 4L7VA 5DF1A 3V9PA 4RDXA 1IE3A 2Q5IA 4YRRA 1GIAA 3AFNA 1E2FA 3UJ9A 1Z06A 3R7WA 1G21B 4FEYA 2EF0A 1JB9A 3DEHA 4JR1A 1SUEA 2XKKA 1I80A 1Y6JA 1QMGA 4PN3A 1ORTA 2OUKA 2Y67A 3R77A 3HBAA 4B6PA 4YXFA 1C1XB 3UGQA 2YFQA 1XQYA 4E31A 1AK9A 2X3UA 3HB0A 4GRDA 3IVMA 2A3RA 2CVHA 4P3OA 1WXGA 2RGGA 2IPXA 5FA5A 4ZU6X 5C7OO 1QGUA 3JY6A 5KAPA 5L3QA 3DC2A 4UUPA 2HPZA 3ZDXB 4AKGA 4ASUA 4YR7A 1Q20A 1DJPA 2XITA 1NBMA 1YJ5A 4FJ1A 5AOVA 1QKKA 4I4TB 3ZG6A 4B2PA 3IT2A 5DLQC 3VR6A 3VSEA 3IT1A 3U4QB 3D54D 3HYSA 2EKBA 1LBQA 1EINA 3CC8A 1N5IA 4P7KA 3WFIA 3GRFA 2P9YA 1DX4A 2W4QA 4YACA 4NZ9A 5EIHA 3D6TB 4W8GA 1U65A 1FVFA 1VI2A 2ZJOA 1KDPA 5E2IA 3S1SA 2FDRA 1PWXA 4NZZA 1FU8A 3AJ9A 3HGTA 5JG7A 5LCXA 1EWYA 2GDJA 2NX2A 5FIUA 3D8BA 1SBTA 3GUCA 4AL4A 1K5PA 4Q93A 4X3CA 2O0KA 3FWKA 5AXDA 4KYVA 1OWOA 2J85A 2K7ZA 4H6VA 4IBOA 1FYEA 4HDAA 3KNZA 3GROA 4KX5A 5EKDA 3S1AB 3H2JA 3K0CC 3LP8A 1ML4A 3HZZA 5EKXA 4EG8A 4X8LA 2OECA 1CB7A 2GCNA 3MJCA 2LDXA 1KIMA 3SLRA 2Q3LA 1LVUA 1LJLA 4WNIA 2AZ4A 4MS3A 1ZFNA 3F6YA 3ZLVA 3SQXA 1EEHA 3P0FA 4YHBA 2CLDX 1KK2A 1JN0A 4JN6B 4MGKR 1NYLA 3B6IA 3L7DA 4RV4A 2XQKA 4CF7A 3QBTA 4M1QA 3EGEA 3H5OA 3V1UA 3V1LA 1T9GS 2RBEA 1T36B 2OGZA 3CW9A 1KXJA 4QOHA 2A1IA 5EXPA 1JDBB 1JXMA 4DTCA 4UXHA 5AVJA 5K99A 1KAEA 3UMYA 2C88A 1SM4A 2ASEA 4QICA 1PX2A 4KB5A 1CY8A 4OBWA 3N70A 4JI0B 1ZEJA 3OQPA 4WOPA 5C3MA 1PGPA 3AEZA 3Q98A 2N0SA 5IAAA 5AVWA 2AI2A 2CDAA 2UU9B 1Z2PX 1VCMA 5B58C 3RBZA 4KDFA 4LNUB 3P94A 4F06A 1RTTA 3HSKA 3MMPA 3VHLB 2WVAA 2GN9A 2GXSA 3OTIA 4DXHA 5K0EA 4RA9B 3PEFA 5B3JC 1FNSA 2ST1A 1UDRA 3F5SA 4HAXA 2VH1A 2XZTA 3W1VA 4AG5A 1P4AA 2ZJ5A 3B3JA 2HSGA 2JCYA 1ZD1A 4JI1B 3VSAA 3DE3X 1XZBA 1PFKA 2G82A 3F2VA 4PYKA 4UHEA 1FFYA 4P93A 4MI3A 1BHSA 1HI9A 3W34A 4LJ5A 4HXYA 2ZS8A 4WEQA 4E30A 4YRIA 3KOOA 3MJEA 1KPHA 3OPNA 4JYPA 1EM6A 5A5GA 4W8OA 4G8JA 2FE1A 3D2CA 5FWDA 2JLYA 5A0VA 1F6DA 5T5QA 2YWDA 1A88A 2DQ4A 1VIVA 3ZHYA 1JMVA 4MUYA 1RLIA 3OX2A 4OXQA 5HE8A 2PVPA 1LPBB 4TYQA 4DVJA 3GVCA 2P7HA 1RLMA 2WW8A 2IXTA 4IGAA 4XSGA 3ZCTA 2GRJA 4F9FA 5L4LA 3L6OO 1VG0B 3LUBA 3LRXA 1HLFA 4H4EA 1A5BB 1REQA 3W04A 2ZITA 1JHOA 3ELDA 2AYZA 2HRZA 3B6JA 4Q4DA 1NUTA 2CXRA 4JJ8A 3WAKA 4CMGA 4DADA 3JARA 3AF6A 2C94A 1VIDA 3DV0A 3MC1A 5JCOA 4X1OA 3K1TA 4JP8A 2DERA 3ZHZA 2I55A 3C4QA 3L6DA 1NJ5A 4PAWA 5FTMA 3T9AA 1RAEA 3QXXA 2GJ4A 2BGNA 1Z8FA 4KWTA 1NQ5A 4LGMA 3R23A 2H18A 3BTUA 4AJIA 1E18A 4E12A 5F64A 3D81A 3JQPA 4RA6A 3TLMA 4BJ1A 3H1GA 1LFAA 3NTRA 5E6SA 1PJ3A 1XE3A 6NULA 3OF5A 2X0KA 4J9UE 1QUFA 4AJJA 2V9PA 3MYRA 1IB6A 3LUPA 4IIVA 4JBXA 4ARZB 2W8BB 5BOVA 3KTAB 3RVBA 4EJSA 1KJZA 1U8ZA 4FCWA 3UK2A 3T1QA 1J24A 3H8WA 2OXRA 1AGYA 4EW3A 1QPBA 2ZSAA 5ADWA 3QF4B 1SB8A 3OLCX 1VE9A 3W8EA 2YY7A 1MA0A 3HB4X 2QUHA 3OQ6A 1ZUHA 1BYIA 4MHSA 1VKZA 2CN1A 4P4SB 1JSCA 2WYWA 3EMBA 3AXSA 3NIGB 5IZCA 1M1XB 1C1HA 4G0NA 5ENDA 2ZJAA 3V80A 4BE4A 3CTMA 4L5CA 2VHTA 4I1OA 1R88A 2VHJA 4DRXB 3GVXA 3FLBA 4C0BA 3ZQ6A 4ARAA 2Z2XA 3ETEA 3PKIA 4FNMA 4X3PA 5DEOA 5TJHA 3EBPA 3TQRA 2QK4A 2XCQA 1TVEA 3NYRA 3M6UA 2VPQA 4AJ4A 1YQDA 2Q5EA 2R1UA 3ETCA 3LO5A 2WU3A 4MLDA 3UYKA 1C30A 4QA9A 5ALRA 3ROPA 2A9RA 4TMKA 3TTWA 7MDHA 1DAMA 4G36A 5JQGA 4GXTA 4HQNA 2R751 2EL7A 2VCYA 3NW9A 4KR3A 4BNJA 1T4BA 2FRXA 4QDUA 2C2MA 1NVDA 1DX6A 5LB4A 5B7PA 1GEGA 3TJRA 2WABA 5JHGB 2WT8A 4XWGA 1C2YA 1IUKA 3BE5A 4LBYA 1W6UA 4GW3A 1V4BA 2A0KA 5DGXA 1DI0A 4Z53A 4WVFA 1X1SA 3LVRE 1WVMA 3WLOA 1YZ3A 2DMRA 3DA8A 1DELA 1H9CA 2VJBA 1XEFA 3N2KB 2IDJA 3V34A 1A8IA 3OZBA 1D0SA 1J1IA 1Z62A 2H31A 3BSYA 4QQ8A 1ZM3A 2YX1A 1WSDA 1CF2O 4R0VA 5FQOA 5GGXA 3VYUB 4EGFA 2FPPA 2E18A 2MSNA 4PIPA 1NTRA 2WUVA 1L4YA 1CZKA 2CK3D 1UKEA 2QRHA 4P31A 3MWJA 1V16A 3R7NA 3T6KA 3ASZA 3EGOA 3ML1A 1QHIA 2HRBA 2R8PA 4GOOD 4OG2A 2WYUA 3LO8A 4LHSA 5AW7A 3DO8A 4CM9D 1YA6A 2D3WA 4KHPB 4PBTA 4HS9A 5K0FA 2AQIA 2YYYA 1SOWA 4ENVA 3ER9A 2E4AA 2IXBA 3ACCA 5F7JA 4BV8A 2XQVA 4KTTE 5K0BA 2B4KA 3KXDA 5JAPA 3OFSA 2ZUUA 1GLVA 5LC1A 5FP0A 2QDKA 3VJMA 1DKRA 1PLJA 3DUFA 3PK0A 4RAQA 4EKEA 3ZHQA 3PWSA 5JPCA 3BHJA 4KR9A 4ZEVA 4DHWA 4N49A 3BEOA 1PUXA 5M7EA 1TM1E 1A9ZA 1UQTA 2ZZKA 4DSUA 1S89A 4HG2A 1PNOA 3ZBQA 1VTKA 5U4QA 1VE1A 2R87A 1X70A 1A7KA 4MEJA 2VYVD 1ODSA 4E7PA 3LXXA 4NHEA 1Z2DA 1ULBA 3G5TA 4S1PA 4C22A 2PEYA 2WVJA 3T1OA 5KJCA 2YIVX 3LWNA 2H5IA 4PNZA 2H08A 3LF1A 1BIFA 3TW6A 4FDVA 1OWMA 3VR0A 3DE4X 5JO9A 5GIPE 3B1XA 4OJQA 1XCPA 1JPNA 1QK4A 2Y4OA 2WOJA 3MBKA 1PR4A 3JR3A 3SBOA 3CZAA 2EZUA 2WWXA 1QKIA 4G5XA 4QGAA 2NU8A 2C03A 4CTJA 1COWA 4PG7A 5FUWA 3AJ8A 3TZQA 5DHQA 4BTEA 3PT5A 2C5LA 1YA8A 1WL8A 4GZMA 4PLZA 4QWWA 5K4AA 5M3BA 4XIJA 3MLAA 3H9GA 3ZJTA 2YWXA 2IH4A 4XQ9A 3RASA 1KZ6A 2QOEA 4B76A 5L3QB 1YZHA 2QZ9A 4A27A 4CG3A 2HK7A 5HIKA 3QOWA 4IZHA 1QUEA 5AFSA 5A4DA 2X6TA 3PGJA 4XDHA 4KMOA 2X8JA 3OWHA 1Q74A 2VRWA 1F8FA 4X7BA 4MVCA 2GA9A 4LC0A 5LQMA 4DM7A 3LXMA 4EB0A 2JI6A 5TDHA 3VKUA 1IJBA 1JG3A 2NYAA 2HNAA 4UW9A 4NP6A 4OGWA 1HK7A 4GUAA 4AS3A 2ZE8A 1G5PA 2IUSA 1D1TA 3M5CA 5DNYB 4X65B 3VOAA 3BTOA 1L8XA 1RRCA 3S7ZA 2I2XB 3LCMA 5SV2A 4O5AA 2JB9A 1DKOA 3K05A 2WZQA 4DNQA 4N41A 4OU4A 1E2BA 1JAXA 4HX5A 1HTBA 1OT3A 1H8HA 2UZAA 4BQQA 1ZGCA 3CRQA 1GTSA 2OWEA 1S2OA 5E9QA 1UP4A 1GTMA 2NM0A 4GP7A 4QXMA 4XXHA 1TRHA 5E4TA 5EFZA 3ISVA 4Q1FA 2CE2X 4FW8A 5D7BA 2JKYA 4UHJA 1VP3A 4MS3B 3K6RA 2WJJA 5DHRA 1V48A 4L4ZA 1O8CA 2B37A 4H35A 3X1WA 2KBFA 4L27A 5KWEA 1OGIA 3BCUA 3ITNA 4J4HA 1DEXA 2ZUTA 5EJ9A 2BGIA 1UMBA 3K9NA 3RRXA 1QKJA 1D04A 3EVFA 5F1PA 2UYHA 3FCEA 3FNBA 4BPBA 3EFEA 3I5AA 1FFDA 1Q5PA 3D8TA 5TNXA 1U7DA 4BO8A 1N7HA 2ONZA 2KW5A 1F60A 1AQUA 5IH3A 5GZ3A 3KP1A 2O2ZA 3AUUA 4Q7LA 5I7EA 2R00A 2ZBFA 1OWNA 4NEGA 4RHYA 2BGJA 4YJ3A 5IAKA 3RSLA 1P7ZA 2DLNA 3IIKA 5KOJA 1N2CA 2QKYA 1Y1RA 2P4UA 1AV6A 4QPDA 4YP1A 5T4EA 2QUIA 3OZ7A 4ND4A 4IIJA 3RYCA 4RPJA 4B6EA 1G4AE 5DTEA 1P0QA 2OPHA 5BN5A 2VDWA 3TZHA 2CNLA 3U4CA 4D56A 4URVR 3AETB 4QBTA 4C2UA 3F1LA 4WERA 4GDMA 3RDPA 4AUKA 3OF2A 5P21A 3NGXA 3D64A 3SX0A 2RAPA 2RKOA 4M3NA 3GH1A 4LVNA 3ZYCA 5I4KA 3D4BA 2NSHA 5BQPA 3WOHA 1Y4ZA 2QGNA 3JTEA 3SSOA 3OKPA 2XWSA 3WBBA 1GRRA 3EVTA 1D2EA 4YXWD 1CS0A 2IYVA 7GPBA 5FLKA 4YRBA 3THOA 3X1DA 1IVSA 1MX5A 4CIVA 2RH8A 5CB8A 4AMGA 4PYNA 2XVZA 2MYUA 3FGPA 3QELA 2C2HA 4DIEA 1BZYA 1P2DA 4M7WA 4DCNA 1UJ6A 3VZCA 4NCIA 5FTKA 4E51A 1T8UA 1LI7A 3AVWA 1EP3B 1F0YA 1OLSA 5AVSA 2I76A 1MX3A 2R44A 2WHYA 9LDBA 1WB4A 4KBFA 2IIBA 3T4PA 3DV0B 3L1KA 2H7XA 3G2HA 2ZUDA 1R0ZA 3AIIA 4MVJM 1FMFA 1RXUA 2W0MA 2W90A 4KQFA 4QM6A 1JAIA 4QBFA 4BBAA 2C3UA 5JSYA 1ZD9A 3LMKA 3AIKA 1U31A 5FA8A 4RTKA 1AMUA 2FLVA 3PA6A 2PAFA 4ZPJA 5JMPA 1B8PA 4WE3A 4R3NA 1Z6PA 2Y0EA 3GEPA 5E6SB 3WLSA 1RLOA 3SF0A 3TMKA 2Z9DA 1VLHA 1YIOA 3AX6A 4BASA 2FEPA 3VR4D 1IXYA 1LLQA 3JQ9A 3KOWA 4M55A 4UOQA 1YS2X 2FZWA 2B4TO 3DSRA 5H59A 2C82A 4FI3F 1ODLA 2NUPA 3CJQA 5FH9A 1DQRA 1WZ2A 1OBOA 2ET6A 1ZRSA 1HRKA 2JRLA 1PL0A 4JQCA 2KS6A 2XE4A 2REQA 2RHHA 1GGKA 1J23A 1R0WA 2VP6A 3COZA 4S0XA 3QX7A 3GPIA 2E0IA 3D0QA 4JQZA 4A91A 5AVTA 3IEVA 5E2AA 3N0WA 1IY2A 3L1UA 4GVLA 2FEAA 4BP8A 3MSXA 1E7SA 5T8KA 1W52X 4CMEA 1A8SA 2O2SA 4NBNA 1TM2A 2PA3A 2YS7A 2ECOA 3KR9A 1WULS 2HJVA 3GOHA 3KFXA 5GZ6A 5G1OA 4E5KA 1B8OA 3L1VA 1YZQA 3RVMA 1YK0A 4INPA 3NC4A 4MUBA 4O4LA 1ZA1A 1FTYA 4DJ5X 2HHCA 1QU2A 4NYIR 1IPEA 5B1EA 2KBEA 5I7UA 2OAP1 2G5CA 3AGPA 3CNLA 1FMTA 2ECKA 3EZLA 2XADA 4NBKA 4EPXA 2XVMA 3EIXA 3I1JA 3NEYA 2R86A 4TRJA 5COBA 1YT5A 1SVMA 4I3GA 1KMHA 2IFTA 4HLDA 1QK5A 3VOSA 4PAMA 3BX1A 4JH0A 3T7DA 2E2WA 1MZVA 3EWAA 4PZPA 2VS1A 4YLGA 5KNCD 1ZVVA 1I5EA 2WTMA 3R5TA 3KYCB 2ZQZA 4JL6A 4BNIA 3FCAA 2Q27A 3HN7A 5IDVA 4RO0A 4Y98A 1U8UA 1K63A 3EPPA 3H1TA 4LTDA 1F8YA 4O3FA 2I9KA 2F1HA 5CHYA 3U1VA 2P2DA 3LG2A 3PB3A 2WJHA 2CLMB 4NCAA 4CGYA 1IY9A 3N2ZB 3I9OA 2VT6A 1RQPA 1OIWA 2XA1A 4QYMA 4YPOA 1QE0A 4KUHA 1XQ1A 4MUMA 5F77A 1UKAA 5C1IA 3ZWNA 1SZDA 2Q6TA 1JR3A 2ORED 3LZDA 1GPMA 3N9IA 1W1WA 3W3AA 1NFQA 1QAOA 1U2RA 4EPTA 4AWBA 1CQJB 1E6CA 3WK4A 4HFNA 4XYBA 3HEAA 1DWQA 4K3VA 3HBLA 3ZXIA 1ZSYA 1L5NA 4B3XA 4REQA 1YQTA 2YR0A 3QWIA 2PUJA 3CHYA 4MV5A 3N8KA 1GTVA 2X1VA 4MQUA 4MUJA 1B76A 1M0WA 3IE2A 2R6GA 1I1NA 2I6XA 2CV0A 3CUYA 3EXHA 4PSVA 1EAYA 1LNSA 3LPMA 1SBZA 4M0CA 2VJOA 2G9ZA 1SHUX 2AB0A 3DUFB 2WD8A 3DZFA 3P4UA 2H2AA 2ERXA 2VK2A 5HJEA 2VNIA 2HHLA 1G63A 4FFMA 5BNIA 5IT4A 1UZLA 1YRYE 4TT3A 5TQ0B 1LWOA 3FPSA 2BM8A 4LA4A 1RBZA 4LYJA 2QN8A 1G3UA 3AI2A 3QPAA 4GMGA 3LP6A 3RUCA 4BPRA 4HEA1 4XR9A 3HWSA 2OYSA 1LRLA 3MTBA 1UXGA 4OY3A 3SBXA 1WTAA 1QP7A 1T0HB 4HADA 3O2SB 4ER0A 1I7SB 2JNWA 5ERYA 3ORFA 2QP4A 3SC6A 5HQ3A 1NT4A 4DLTA 3WSVA 2I4TA 4YJ2A 1TQ4A 1BFKA 2AEEA 3R44A 2D5CA 4ZOLA 3WLTA 5HIAA 3U62A 5JQWA 5JTTA 3M6XA 3OEHD 1U0RA 5FBQB 4OI1A 4H18A 5LL6P 1R0CA 3P0IA 2NU8B 1XRJA 5K4GA 1KZ4A 2JJ1D 2X5JO 3I01A 3X0DA 2QU7A 2OZEA 1ISSA 3JSAA 5EP1A 2HBYA 1YS9A 4ZVTA 4YMTA 3WLRA 1JFRA 4CBVA 1LDYA 1XGKA 1MX1A 4MV4A 4IVRA 5KC8A 1Y4SA 5JCXA 3PSAA 1E2DA 4HB4A 2B1QA 3DLIA 1KIFA 4JJ4A 3V8NA 1E7WA 1UBEA 2QX9A 3UGKA 3L0SA 4OMDA 2L2QA 2RHWA 3FMVA 2H5EA 2B78A 3M6FA 1QH8A 4OEHA 5K0NA 2IPMA 2GKOA 1O97D 4L8LA 4CG2A 2JH3A 3C41J 3R3SA 4RTPA 1G8AA 2X8JB 4G1VA 3IP3A 1U7UA 2HU7A 3K94A 4F97A 3WLHA 4MVJD 2XNDA 2IC5A 1NR5A 2JFGA 2F62A 3SXUA 2CNBA 4NYMQ 3VZRA 2HPAA 1A76A 1TUIA 4D44A 4HY3A 4CTNA 2V98A 4PXAA 3I12A 1UFKA 5DP2A 5F21A 1EZ4A 1NNLA 3UMRA 3WLEA 3EIFA 2OCYC 1PLKA 4QYSA 2X41A 4BVLA 1CP2A 4RJIA 1KO4A 1QF9A 4CTOA 3H4IA 3GMDA 1H2ZA 3LOQA 2O3QA 2PX0A 4TWRA 3FYCA 4QSHA 4E46A 4ZI2A 2V0NA 1CQPA 1PR5A 4V02A 1JG4A 5J43A 5D6NA 5ENZA 3RRYA 3V8VA 2DJIA 2IYTA 4A03A 2PT6A 2CUKA 3C3XA 1FX1A 1JU3A 2ZB4A 1TCAA 2HC9A 1XSEA 2DX7A 1WCIB 4KQ1A 3W4IA 2XWPA 1QZUA 1XJ5A 3EJ6A 4PZ9A 1J56A 4C2BA 3RSHA 4JLNA 4NYJR 3ROGA 2WMDA 3CO5A 5G1NA 3EF1A 1DFGA 2QTAA 2KI5A 3F3KA 4M7OA 5ED0A 5F9FA 4TZKA 4P7GA 1T0BA 1YS7A 4Q3LA 3FDZA 1OI2A 4EDHA 3O8CA 1G3QA 2Z95A 1W25A 1ZK1A 1KEZA 2ZB3A 4J94A 2B5OA 1P73A 3MUNA 4EK9A 3EYWA 2Z5GA 1K4YA 4HVTA 4FCVA 4UEWA 4Z1MA 3TZEA 1GFSA 4PYMA 3KOYA 3Q0TA 2B2XA 3V7FA 1DMSA 3U2QA 1Y82A 4MVJE 2FH5B 4ER3A 1EP9A 1P45A 2W2TA 3JQ7A 3JD0A 1PL8A 3LQ1A 4IGIA 5FA6A 4J16A 4YB8A 3UC9A 3AI7A 5DT9A 4ADSG 2XUFA 3HEMA 3C4VA 3LHDA 3CE6A 3KELA 4OOFA 2QMZA 3SNKA 3LL4A 3LY7A 1N2CB 4PLCA 2XPCA 1M1ZA 5CBKA 1O94A 4OA5A 5CT5A 5TQ0A 3VV2A 4RTJA 4DCCA 4IIJB 1KQPA 4I1YA 2QEQA 4JBHA 1LDBA 1N32B 3H5IA 4XGRA 2NO7A 2ZJZA 1MQ9A 2ADOA 4RAOA 3INRA 5KO2A 1UMCA 2J32A 2YJ5A 1Z4KA 5EPUA 1VOTA 2DHQA 1S2IA 2MMGA 9MHTA 2ZU0C 3L06A 1T1JA 2GWHA 2H00A 1ZMRA 1E0KA 2BKUA 1BKDR 2BW0A 2PEZA 2IOYA 3LDGA 4L4SA 1K5DA 2WVGA 1LLDA 1B00A 3IP8A 1TLLA 1R0RE 2YDYA 5TPWA 1HSOA 1N3IA 3GCXA 1KRXA 1N92A 5IVDA 2G9UA 3ORHA 3JVUA 1JQKA 1UM9B 2FU5C 3JWIA 3KSDO 4NZYA 1GNPA 3ADOA 3RF6A 5IHXA 5T7BA 1TQ8A 1GR0A 2Q5FA 3PDHA 1CS0B 3Q3GE 3UWMA 3CTPA 1U90A 3OCXA 4MVJF 2F3PA 4RABA 4KXFB 3EEFA 4F71A 1CLUA 3K9WA 3HYNA 3ISTA 2GKGA 2MMCA 4JUDX 4OVKA 3SP1A 1THZA 3PF8A 3S2SA 4D9JA 4E5PA 4WNAA 1C3EA 3F6BX 3IP9A 3JX9A 2H3EA 2IDKA 3NTQA 4RMIA 2QN9A 5AUQA 1M1YA 4XDYA 3T5BA 2PLFA 1ZJ6A 3R9KA 4MI9A 1OLSB 3DTVA 1ZLXA 1Y0BA 5C46F 4S1VA 4B7UA 2JD0A 4RULA 1KDTA 2EIXA 3PUXA 2FK7A 1U2GA 2ZAIA 3R0ZA 4IG9A 4KIFA 4PHTA 4QDOA 1CNFA 3HWRA 3L1JA 2O52A 5FV4A 6GPBA 1ZL0A 3T4UA 2I9PA 2QNIA 3Q6MA 2R85A 4G1UC 2V7TA 4F5DA 3ZIDA 2DTXA 4FJ0A 4M9XA 4Q24A 2ZRKA 3CQ9A 4U2GA 5JMWA 1ZHHA 1AUPA 1CVLA 4M1ZA 5HWSA 2GBPA 1BEEA 1KGSA 1CUZA 3T9CA 2EL9A 4KWIA 5E0OA 3I04A 2RK6A 2AUMA 4YROA 4C7XA 4KV9A 3PFCA 3Q0EA 4NJMB 4QOSA 2DT8A 2H3HA 1Q0PA 2NUAB 3MJVA 3R7AA 4RKEA 5CCBA 5KDOA 1TMKA 2WIDA 4JHXA 1XDGA 2JC3A 2NUPB 4UCWA 1U4OA 3H0KA 2AW3A 2UZ0A 4PGHA 1JWLA 1PJ4A 1JJVA 2CCGA 4WEOA 3K0FA 5D5PA 1IVYA 2VATA 1U2DC 4OP3A 1SXQA 1ZD2P 3F73A 1Y8ZA 1LC3A 2J41A 2VDLB 3B3GA 4CCYA 1TEVA 1H2YA 2REQB 3LQYA 1G2IA 3T06B 3GEHA 3STYA 5DM2A 1KA9H 3H6GA 4WCFC 1AKMA 1YQWA 3DEJA 2XLCA 4BNKA 3WNQA 1HV8A 3L01A 3LYHA 1W46A 4V1CA 3OZTA 4JYZA 4JNKA 2Z09A 5I8ZA 1HKHA 1N9ZA 1HEUA 1YI0A 2O48X 2VLIA 3DF9A 2GBLC 5HG0A 1L7RA 1E3LA 4BIIA 2AUNA 2FDCA 2Q1TA 1BQEA 2B21A 4O4LB 3QEOA 3SGLA 3EQ9A 2KYRA 4H3VA 4MI6A 4WXMA 2OBYA 5IEBA 1J90A 1HNNA 2D5BA 1THMA 1YE3A 3P71T 5GVSA 1UBGA 4B3MB 4R05A 1SH7A 2V74B 5BV2P 1MBZA 2ZYUX 4ISCA 4PQFA 4BQPA 1KMHB 2QRZA 2AJTA 3K6KA 2BDTA 2HIMA 2IA5A 1YR7A 3GEIA 1E1KA 5D00A 5JXGA 3N2NA 1DC3A 4NKRA 5FV7A 1EG2A 1Q7BA 2XJ9A 3GI1A 2EX1A 1FZTA 1CEEA 2ISCA 2R1VA 2HLDA 1NXOA 4GWLA 1YR2A 2VDMB 3GJYA 2FRVA 1L1RA 1FU4A 1SPBS 2ATCA 2EERA 3OM1A 1DEAA 3Q5GA 2Q5CA 5CIWA 3TTSA 3FUWA 2ZSJA 1LNQA 3ND6A 1GKKA 1K6JA 4R1SA 1RPTA 3DAHA 3DMPA 1NDHA 2LDBA 1M7BA 1MQ8B 3HNOA 3QRWA 2O3JA 2WU0A 4BZPA 1OIXA 3AFOA 1M7HA 2FEXA 3DVLA 1QAQA 3OU7A 3ZWCA 1KVRA 4HF7A 4HQOA 3E6AA 4IFBA 4IIFA 4ZKEA 2WF9A 2H0RA 3D7NA 1LX6A 2D2XA 2XGGA 3H2SA 1OV4A 4XWYA 1T1GA 2HIGA 2IOFK 3KDPA 2PH1A 1CLEA 4REQB 5EZSA 2XOXA 4C30A 2PUCA 1Y3IA 4G25A 2XMQA 1PNRA 1NVTA 4KQXA 4Y6OA 4PSDA 1VBMA 1P75A 2NAPA 4IIYA 3B5JA 3P32A 5DIZA 5D7NA 4IHKA 4FT2A 2VF2A 4G0OA 4Q48A 5HMMA 4MGHA 3DWFA 3EXHB 1QHYA 1Z0DA 1H4SA 1Q21A 2GXQA 3ZGOA 4O0LA 4AMYA 4DLUA 1LBSA 4IPTA 2G36A 1ULTA 4LXHA 4ZAZA 1ZS9A 1F5NA 1S96A 2YW9A 2DBRA 4YJFA 3WHIA 4WLEA 4MPDA 4ZGGA 1R6VA 1RJDA 2WZBA 1V6SA 2PQ6A 1WKVA 1UEXC 3A4NA 3FSRA 2FFRA 3L7JA 2JI9A 5C32A 1AH2A 5EHIA 1EWVA 5DXFA 3NT2A 4ALMA 5LDDC 1E5XA 2UZ4A 4EUNA 3LK6A 3M1AA 4N7MA 3D8UA 3U3ZA 2WYOA 5JC1A 2I34A 5JXJA 4BQSA 1LCIA 2B8EA 3D5TA 4U7HA 1PG2A 2BEWA 2YZMA 3HN2A 3NT5A 1BN6A 1QE5A 4AU1A 5HQ3B 1RXSA 1XHFA 2OGUA 4R7TA 4NVRA 4UQLA 1U9CA 1QWSA 3EJWA 3ZIUA 1OGJA 1T1EA 1H93A 3QE0A 4INAA 4CIWA 3DUWA 2QW1A 5TR9A 4R9SA 3FWNA 4KFRA 4II3A 1K6IA 2B0JA 3V6MA 3DW1X 1U0NA 5FNVA 4Y3UA 3RSFA 4LJRA 1L8QA 4I55A 1T0UA 2HZBA 1OKKD 1K3FA 3R75A 2P9CA 1OAKA 2OK7A 4A5SA 2ZBRA 4E32A 1SULA 3K35A 2VQ6A 4WY8A 1ACJA 3MBOA 4EF4A 1GCAA 2VTDA 4L4RA 1BOFA 1F06A 1QH8B 5K6AA 4M7RA 4XUCA 3ESXA 4RDIA 3UF0A 3BIWA 1SGWA 3GW8A 4UOEA 4ZYWA 1F2TB 2GWRA 1NOJA 2R62A 1AQ6A 1KBOA 1LDGA 4IUCS 5BT8A 1ZVKA 2AK2A 4IEFB 4B73A 1J0CA 3NWEA 4H6WA 4EMSA 1PZFA 4IVNA 4A6XA 4EB6B 3SXUB 2ZIXB 1I3NA 5TEVA 3BM5A 3PZRA 3IYLW 1P4JA 4HZIA 4URZR 2BONA 3DLBA 1U5BB 3B78A 3HVIA 4HAIA 4ZCRA 3G13A 3D7MA 3PGKA 4KE7A 4Q7JB 2I2WA 4H17A 1ELOA 4GZ6A 4C2AA 1MAHA 2VPYA 3RS9A 2PZKA 4DQVA 2FMTA 1NVWQ 3IOBA 4KACA 5BN1A 1UPTA 2FPOA 4IDEA 2HBRA 3GZJA 1AV7A 1QVZA 1X1TA 1G2QA 5TMDA 2VPPA 4Q21A 3P9PA 1JF8A 4XYMA 2GZRA 4MK4A 5EJFA 4D9BA 1JUDA 3IP5A 3OF3A 4Z86A 1G2PA 2R4UA 3IAXA 3P4XA 2VZ9A 4K9KA 4ND8A 5GM2A 1EGQA 1ZJ4A 2CHGA 4QE3A 4LOKA 3BJMA 3H2IA 4CR8A 2XDQA 4D79A 9GPBA 1IHXA 1WDLA 4K9DA 1EX7A 4L8VA 1QVVA 1F38A 4II2A 2PX8A 1ESCA 4KOAA 4F2DA 4NQZA 1ZK3A 3FKSA 3STWA 1RNLA 1TD1A 1I0LA 2VJPA 1UKYA 1YB6A 5H3HA 4KE9A 4C14A 2JGRA 3FDZB 3GP3A 4OOEA 1SURA 5DOZA 3FDXA 4RVUA 3GRKA 4UDOA 5C5IA 1TEZA 5DM70 1IY1A 4UUAA 5DGTA 3I37X 5KINB 2QN2A 2IS2A 4RZUA 5B3AA 4RMJA 5C80A 5DGDA 1A9XB 4MV0A 3TOZA 3FDJA 1QF7A 4TTPA 3K70B 3MTGA 4ID9A 1SWWA 1DT3A 3M81A 2WIAA 1G66A 1ZOPA 3JQ7B 2PR2A 3QU5A 3HB5X 4MYSA 3DOEA 2FPRA 1E79D 4FFNA 4PNHA 3QKSA 4N76A 2YJ4A 1Y3AA 2JLSA 5EWLA 2BGTA 1YE5A 1TO2E 2EYUA 2QPTA 2QN3A 4Q3DA 2BLLA 1FRQA 2D74A 1RHJA 2UYOA 2P77A 1PFUA 3CLTD 3LCRA 3PXAA 4FYKA 1YVDA 4ICIA 3DVAB 5AMXA 3HN6A 4C3OB 5KVAA 2PGIA 1QOZA 3TEFA 2J9ZB 4BNWA 1CUBA 1TAGA 3F4KA 3I8SA 4S2EA 5A3VA 2XA2A 1UMCB 2WJIA 1Q6ZA 3G5LA 3AR4A 3COSA 2XE6A 4Z7JA 2GZ1A 2OBFA 3OTHA 4WHMA 3TUJC 4ZZIA 2J9RA 2HREA 4OXYA 1FJ2A 2P27A 5TPWB 2E82A 1AQNA 3WJ7A 1P2SA 2AG6A 1FLNA 4BLSA 5IX8A 3FF4A 2ZOSA 1J5PA 6YASA 1QF6A 1XMPA 2ZRCA 5IEJA 1GZUA 1LSSA 1SBCA 2HUNA 2OCAA 3NHSA 4WZBE 1GDTA 5JFOA 1UPAA 2GCPA 3EISA 5CYPA 1Z2EA 3GPDG 4BNXA 3IBFA 3KVYA 3VKGA 3FROA 1K7CA 2E55A 1NYRA 4CM1A 5HUQA 4KI7A 2PE5A 2Q6VA 4CL2A 5LPNA 3G23A 2XT9A 1TXGA 621PA 5BRAA 1UQUA 1MIOA 4QDZA 1YU6A 3JZIA 3D6VA 4CMJA 1DHRA 5KX5F 3TG8A 1OXXK 4W6QA 1JHQA 3TG2A 3RE1A 4FBMA 1S1MA 2HMAA 1BFUA 1G1MA 4KUEA 4ZI7F 5BMVF 4C4YA 1UC8A 4ZRDA 1U0TA 3ZU6A 1KH1A 1E1QA 4YT4A 3QVXA 2DTDA 3CUKA 1U1DA 2JHGA 1CIPA 5KIAA 2PGAA 1R8JA 3MCZA 3EYAA 3NBXX 3QE3A 4MW2A 2A94A 4YRAA 2FSHA 3LT4A 2H4XA 1Z33A 4CETA 2RGYA 1GRVA 3LBNA 5DGCA 4BNYA 5EHZA 2P5SA 3DGFC 2DSTA 4U8GA 4ZODA 4I08A 1XKXA 2A1TS 2ZANA 5DW0A 3UB3A 4CCYB 4B35A 2PWAA 4L3OA 4D0RA 2GPAA 2IS1A 2QL6A 1NMSA 4F46A 4RZSA 5JAIA 5A2QA 1ZGBA 3BOSA 3RR2A 1VLMA 3EODA 3ETNA 4WQMA 4BGDA 2R8RA 3SZ3A 4MQLA 2V6IA 2FXIA 4GECA 1NVAA 4YMUA 2EQAA 2P65A 3T5GA 2EX4A 3QTBA 3D8SA 3AVQA 3B1JA 4FW9A 1C7RA 3K4QA 3DMTA 4Y0NA 2PYIA 3KCNA 1XJWA 2V4ZA 4PFSA 4W9NC 1C41A 3CSSA 4IQFA 2XYVA 5E7MA 3W8RA 3VNBA 4EIWA 1XA3A 4J1TA 5JWRA 4C7OA 3QUSA 4POAA 2FAXA 3CS3A 5JDIA 2NLOA 2WV9A 3TKAA 2AJDA 3WOVA 1AQLA 1YJXA 2DWUA 4P98A 3MQFA 1G8SA 1R0XA 2AKAB 4D4KA 1IBRA 3AYZB 3L79A 2ETXA 2JD2A 3IRVA 2WU1A 3DZJA 2PWBA 4XOUA 4TM8A 2GNPA 1YDMA 2JH9A 1GZSA 1UOOA 3UXMA 4ZIRA 1XEXA 4AY2A 2HDHA 4OLBA 4IKPA 4R1UA 3DB2A 2ZI3A 1H6DA 4EHFA 2I80A 4G1BA 3O8OB 4RPKA 3ZLBA 4GKAA 4LPSA 2Q9BA 2GT1A 3NHAA 4LS3A 4Q4CA 4CGZA 3FMGA 4YAWA 1Q19A 1L4GA 1A9OA 3I2FA 5D5QA 4J0KA 3KXPA 3FPLA 4CF5A 4MKIA 3G1UA 1BX3A 3MJ4A 4DZRA 3AKDA 5EAIA 4RUKA 3ZWWA 4F2HA 1YJCA 3QYFA 4RM2A 3OD1A 3RW9A 2OV8A 2Z56A 4AWAA 1DQNA 2XUJA 1LS6A 3UPDA 2BEVA 3Q7EA 4J43A 3SBEA 3QLTA 3AEKA 1O4WA 3HQ4O 3MXTA 3BRCA 4X45A 3PFGA 4B6JA 2YN2A 1OJLA 2RCYA 4B1FA 1FMJA 1SCQA 1L7BA 3DWGA 3O3MB 4DR5B 2P4QA 3PC4A 3UV6A 1YFLA 4BXOB 1UEJA 4F7WA 3GMSA 1P4RA 3MCUA 2ZROA 3WB0A 1TQDA 1PS8A 3UMSA 5FULA 3P27A 1W4BA 1E9SA 1LJUA 3LPCA 4KXMA 2CSXA 2WWIA 5DRYA 3ZCXA 3FVVA 4HC4A 4MW7A 4LFAB 1JLMA 1W73A 2ZPAA 3AY3A 4RF4A 3ZE2B 2M6RA 4NZMA 2H9YA 3PWZA 3NBAA 2I71A 4YJFB 2QIPA 3KKOA 4HO1X 4O4IF 4ZDIA 2YKGA 1IC6A 3P2OA 1AKYA 4GWGA 16PKA 3K0KA 2CNWA 4H59A 1UMKA 2VRNA 4HWTA 2HWYA 4H7FA 3UO8B 4U9IS 4GXRA 2FB9A 2VDNB 4S0ZA 3GZNA 4IQGA 4XB6B 4B8WA 2XAAA 2QLNA 3NRBA 5C34B 2E4XA 2VCEA 2J5KA 3G6KA 4MUKA 4BX8A 3NHYA 1G19A 1GAWA 2FMUA 3R9XA 1Z83A 2DYKA 3PNQA 3F96A 1CD5A 2OOKA 2WD9A 3G6WA 5TVKA 5J58A 2XNHA 1P1FA 1YULA 3L9WA 4MARA 1OILA 3HCAA 3M5WA 1KPGA 1RJEA 4G01B 4MPRA 4TYPA 5FNVB 4CLHA 2DHDA 3MF4A 4ZMBA 2G71A 1QQ7A 1PG0A 4I55B 4QUJA 4RIHA 2ZRLA 4H7JA 1BS1A 1KO8A 2IYAA 2R5NA 3GJTA 4FWBA 4K0RA 3KKMA 4FGLA 3JAWA 4RDHA 1FFXA 4I8XA 3SHTA 1QX4A 1JW9B 3SYRA 2D54A 2CUZA 2B34A 4IM7A 3W5SA 4F4JA 4G0VA 3WDLA 1MTOA 3QKWA 4L0MA 4Q9HA 2YYAA 2EW1A 3ONNA 4GM4A 1G18A 4KOEC 2CHEA 3WLQA 4DDHA 4ES6A 2FN3A 1MPXA 4W1PA 3BZWA 3X1YA 1NQUA 1RIIA 5AOCA 5AW8A 4PICA 1P7PA 1SC9A 2CC2A 3W9SA 6CHYA 1WNFA 5HTKA 2XVAA 2NU7B 2BV3A 3QUBA 4B33A 1NW6A 1P0IA 4MVJG 1BDBA 4R4JA 1X9IA 5EVJA 1MP0A 3WXMA 4FI3C 4TV8F 4IJ5A 3WYEA 4C07A 3ESYA 4RHCA 2WBLC 4BLRA 4YDHB 1CY0A 2FSVC 3V4OA 4FHFA 1ILWA 1BHO1 1CUGA 3JRNA 4XB2A 4K86A 4ENPA 1MJFA 5CDTA 5A62A 1TM5E 5I3CA 2VWPA 1SQ0A 1UDAA 3T34A 2XDQB 1VE5A 2BMDA 1A50B 1PT8A 2HFJA 3U9LA 2W4IA 2WFLA 4X1KA 4KPFC 3M3HA 3I2KA 4BQNA 3DL0A 1C3LA 3OP4A 3TKYA 1G20E 2ZJ2A 1RC8A 3KOZA 3O8NA 4G8DA 1S5PA 5F4BA 1U04A 4ENRA 3CXRA 2JEYA 3UCEA 1OWPA 2GCOB 3GAMA 2F67A 1P1KA 4KVFA 4FEAA 2ZI9A 3GDWA 3G2KA 3OLZA 2R48A 3ROEA 3TSYA 4BWFB 4YQYA 4FCCA 3H7IA 3E1SA 1IHOA 2YWJA 4BB6A 3B70A 1QR6A 1CUWA 1SQGA 4FHGA 3OLXA 2OFXA 5FX2A 5I4IA 5IJXA 2F4NA 2JCBA 3FHCB 4URUR 1XQWA 3L1HA 5ESRA 3QKSB 2AA3A 2OHGA 4FR0A 1HEYA 4LWPA 4FIZA 4RHUA 1W4CA 1WKCA 4ZQGA 3TLAA 3EIEA 4NMWA 1KMCA 1PJCA 1Y89A 3E7DA 1T5BA 4JGBA 3USZA 1TRKA 2AEMA 3IEMA 1J20A 4D5EA 3TRFA 4D0NA 1Q14A 3M9LA 3OMLA 4G07A 1ORIA 3V4FA 3GAZA 1NBAA 4TLBA 3O1LA 4B6FA 9ATCA 1N2SA 3BK7A 3U16A 1FXWF 1VB5A 1ZGGA 1NIJA 1WB9A 3TD6A 1Z5VA 1WUJS 2X9VA 3NKFA 4DIFA 1NVVR 5BR8B 1W0KD 3MIIA 2I3GA 3Q0IA 3HKEA 2F1JA 2OSVA 3CNBA 2P4EA 4KJZA 2JIQA 5AKLA 4DDUA 1E6MA 4Y9RA 3NAZA 4CCWA 4FU0A 5E4JA 1GQFA 1Q11A 5HFAA 4AVYA 2ZUFA 2ESRA 3F0TA 4EF6A 1WXWA 4N5LA 4P3XA 1M7GA 2RJNA 1EVZA 1OAOC 2NT4A 3HDTA 4M60A 5J3JA 3CF2A 1R6XA 4YUZA 2XRZA 1XRSB 3TW8A 3N8HA 2P6MA 1C9NA 4HDSB 3VTAA 1ADCA 4LNAA 4X8MA 1Z75A 4WIAA 4YWJA 1AUOA 2B99A 1U28A 3HBMA 1UT5A 1OZFA 2ZSIA 3SOPA 1XR3A 1CV2A 2GN1A 3GMIA 3SLGA 3ZQKA 3IPCA 2E89A 1LI4A 2J09A 3A6EA 3OQIB 1KE2A 4GS5A 1M6YA 3F2IA 1TU0A 3IFSA 3R3YA 3OZRA 1MIOB 2C2BA 3F6PA 2HKIA 1SPXA 4DIOA 4RTLA 2ZDQA 5CFOA 2VHXA 3QNMA 4JS0A 3SM9A 3TOVA 4DC0A 1TE2A 2J0VA 1LPMA 3MRSA 3GD5A 4EG3A 4ZCLA 2Z5LA 2JCXA 2AHOA 1DPGA 4B09A 3QOFA 3OP1A 1N2XA 3PGLA 5K3FA 4PQGA 3K3PA 4DCOA 2EZ9A 3DL2A 1RTKA 1C7FA 3L40A 3JXEA 4NMXB 4DPMA 1GL9B 1NXVA 1JQ3A 2WAMA 4NIMA 2WSBA 1AHIA 3P2YA 1LLUA 3BXZA 4G5GA 3DO6A 1N7GA 4R5HA 4W1QA 1JQDA 1N57A 1PNTA 1PTKA 1KP3A 1WCYA 4FHDA 4URWR 1RSZA 2J6IA 1DXHA 4Z7OB 2IS4A 1UBUS 4MO9A 4YAGA 5FBVB 4J7CA 4HZUA 3WKAA 4EYEA 2QTRA 1J0EA 2NUBA 2YHAA 4L8FA 4TTIA 1TMGE 3EK2A 2VP2A 2ZZNA 1BVHA 3LXUX 4MYTA 5CLJA 2QTNA 2YVKA 2XYRA 3C5HA 4LMAA 3SR4A 4Y6SA 1XD8A 3M5DA 3ZV5A 2Q07A 1KARA 3ZDFA 3TAXA 1FMLA 2I4LA 3PE4A 3VJKA 4AQ7A 4AS1A 2OV3A 2YXLA 4KPUA 2DBZA 4WESA 4CT4B 2C5BA 3F8TA 1OH7A 2NT3A 1P1BA 3SJAA 2HSJA 2HBQA 3ZDDA 1K5HA 2VR1A 1QGAA 4PC3A 2HNKA 2FP4A 4MO2A 1YJAA 1NOIA 1YHYA 1YWGO 1F2DA 4I66A 1SK9A 4XR4A 2X77A 4HMOA 1B6RA 3BHMA 4LYYA 1XL0A 1OCEA 4EUFA 5J4VA 2ZBEA 3TFOA 4MLCA 4F6RA 3LUCA 1HL3A 4C7OB 3UCFA 1SCUA 4V39A 1U3DA 4OLAA 3C1UA 1ZMTA 2ZUEA 5HEKA 5TC4A 1HNXB 3SSAA 3BXOA 3GGDA 1M2OA 3S5UA 1PHRA 3LDHA 1DJLA 4U7TB 1WPQA 1K2WA 4LZWA 3WLMA 5HZKA 1MJGM 3RC3A 2YJZA 4Y30A 4ZIRB 1XEXB 4OXNA 2OLKA 4YAEA 1GA1A 3MUOA 3I5UA 4RW0A 4ZVPA 3OO0A 1L4NA 2FZGA 1I3MA 1ZH2A 3MOIA 5MHTA 1XN4A 3RT7A 3ESQA 5A7HA 4OFXA 4CUZA 1U2ZA 2Q7XA 1L5HA 1D6SA 3HZHA 2Q9UA 4J29A 1XJ0A 1TKCA 4OHZA 1L9KA 4NV0A 4MQMA 1DKUA 1P91A 1OIVA 1XHEA 4WPGA 2AMLA 1YFKA 3HZOA 5AHXA 4PSAA 2BEVB 2HLNA 3CF0A 2FEOA 3P9YA 3IQWA 4RKRA 5AVXA 1F3LA 2UVDA 4PX2A 4E5UA 3UW3A 5B5SA 1MX9A 1EX9A 2B7BA 3ANMA 4KXYA 2HO5A 3PUVA 4JI4B 5HP4A 1EVJA 4LVOA 3TIGA 2BCJQ 1PJBA 4PCVA 3UK1A 4CMHA 4C6HA 2HF9A 2Q4EA 4CODB 4FN5A 4L6AA 1UK8A 3HXMA 4NRDA 5I4CA 3C5EA 2P5YA 4UUBA 3EAGA 5KYUA 4FKMA 1TT5A 3OA2A 4B46A 1XBTA 4REOA 2H1IA 5ESXA 2BFOA 3HYTA 1U1IA 5FKJA 3KKQA 1H2RS 1IXKA 4PO3X 2FWMX 1XEAA 2HJSA 1AKTA 5GQSA 1DWOA 2ALJA 2GTIA 1Y98A 2C1EA 3FCXA 2O3TA 1JZSA 3HJCA 3OY7A 4M37A 4U3JB 4J8PA 3EUEA 3PXCX 3IS3A 2IBMA 4CYMA 4CLOA 3OQJA 3PCRB 4TM7A 5KPJA 1E94E 3AY7A 3STHA 3TGLA 1P2UA 1S01A 1SKUA 1LFDB 2FUEA 2P78A 1I7NA 2W00A 4PWZA 1N5DA 2Q3FA 4LJ8A 1OXTA 1DFIA 1PJLA 1MOQA 5LP1A 3GZNB 2JBAA 3RVQA 4R2KA 1EBBA 1O97C 2ARKA 4LJYA 3RYFA 5CXQA 2I4RA 2YJ6A 3R9XB 1IXZA 2FZEA 2A5LA 4XSHA 4JP1A 5CNMA 5DYNA 3WAGA 1L7OA 2J31A 3C8UA 4D3YA 4X20B 1GV1A 2ZETA 5A06A 3WMEA 3CONA 1FXUA 4NE7A 1HA3A 2LWIA 5TGDA 2YMQA 1TVCA 1O6CA 1RQGA 4DYHA 1W9HA 2P2YA 3FSGD 4CKCB 1H65A 1ZXXA 4KO2S 4P54A 1CJUC 5KNDD 3CX7A 2JI4A 5I9BA 3KS9A 2PA0A 2IBSA 3FZQA 3KHSA 2G5GX 3JAWB 1FFXB 1OW3B 1ZI6A 4IEIA 4MWOA 1JL3A 4XDGA 4A5OA 4DAOA 4B3HA 1DS6A 2ZBUA 1Q7CA 5F4ZA 5F7ZA 1FDVA 3WYDA 3CEAA 1VC2A 2IEAA 3EWIA 4RPHA 4WCVA 1BDHA 2HH9A 5FUBA 1FP7A 1LPOA 2ENWA 5C53B 2HEGA 3NR2A 5KHAA 5FD8A 3NPAA 3C8ZA 3UYLA 1YDFA 2IU4A 3AVTA 2BMJA 1DBRA 1LTKA 3B9RA 5BSKA 5KDLA 1D03A 3MHTA 1E2IA 3M1YA 5C31A 1MAVA 3WMWA 3PS9A 1E3QA 1UDWA 1Y1SA 3D4IA 4PQRA 4JJIA 2WD7B 2D0OB 3VZDA 1UBCA 2JLBA 2GN0A 3CLHA 1QLHA 2YS6A 4YONB 1YHNA 2JVIA 3TIVA 4PVDA 3ZWYA 2DPXA 1H1LB 3TMYA 4IH4A 5ITVA 3H5VA 1GL3A 2AEJA 3QNUA 4MCIA 1BCRB 4MA0A 4Y2TA 4QNNA 3Q2OA 2Z8ZA 2PV7A 4FYYA 1VPDA 1PIWA 1D6MA 1JEQA 2GZMA 2HRQA 1EAMA 1VL1A 2MOKA 2QE7A 3IUEA 3RF7A 4DCPA 4X3OA 1YMVA 2WK1A 5BPFA 5CDSA 1CG6A 4OHOA 4ZICA 1E3WA 3A1EA 1M5UA 4ZANA 3OIUA 3BD9A 4RCZA 5KAMA 2WFLB 4X1KB 5E6RA 3WRXA 3VAZA 4TMXA 4BQOA 4BUZA 3IQGX 3RYTC 1UK6A 4TOIA 1JE1A 1EK1A 1M8FA 1GCOA 1SD1A 3RSCA 4L6IA 5HRAA 4NHOA 3U7QA 3L7NA 3RPEA 3C6XA 3Q11A 2BMEA 3TLGA 3S81A 3A9VA 1MB0A 3LCJA 1PT9A 4R9RA 1YQUA 3T94A 3VSCA 5C4MA 4E07A 3RFVA 3DE6X 2B3DA 5JC8A 3COJA 3GCGA 4L08A 5EFOA 5TQ2A 2ZSBA 3H1EA 3AI1A 4ALLA 2VXCA 1IEXA 4LC9A 2JAOA 5F5NA 1E1RA 4IV8A 1XK6A 4EW6A 5FJIA 1FSZA 5GOZA 4BOYA 4DLVA 2RSLA 4M0EA 1U8CB 1R5NA 4J9VA 4PR0A 3SJ7A 5H1YA 1K7XB 3M4XA 1ZK2A 1JI3A 3O7MA 4G67A 3B6MA 5LYJA 1PZNA 3EAFA 3IP7A 4M0MA 5BVGA 1V2HE 1SRQA 1WB5A 1Z7GA 1YBVA 3CPHA 5EGSA 3N39C 1MAAA 1TFUA 3N8DA 5KSOA 4CL0A 2BGLA 1ZD3A 3WGJA 1E66A 3HKEB 1YB5A 1EVYA 4IHAA 1WEHA 2JBWA 3KR0A 3QFSA 5JALA 3I73A 1XPJA 1DKLA 4JVNA 5G0SA 1U3TA 3DLHA 3MFYA 4O4HF 1ZM9A 1T13A 2AJCA 3G79A 4AX8A 1FLAA 3DDSA 5KNCH 3U3DA 4D8YA 5GONF 1UPFA 3W77A 2CUTA 3GAAA 1Q1GA 1RHQA 3PJRA 4N9QA 3UWOA 3F46A 5IS2A 1E3IA 1F2VA 2FFBA 3T52A 421PA 1IPHA 5JJIA 2VF5X 3MMXA 3LVQE 2XTZA 2A5GA 4KYUA 1ZVJA 1ZH0A 3OEED 3ZDRA 1YDHA 3DLAA 4FQ8A 4IXDA 3DBHA 3K6SA 2BJVA 1W2WB 1LU9A 5AXAA 5JD4A 4L76A 2DR3A 1Z6GA 2GK6A 4FS3A 3SXPA 3D2BA 1NDQA 4JK3A 1VJ0A 2QIOA 4BFTA 3V1MA 1JA9A 5HS4A 1U7TA 4IUBS 1J22A 3IKLA 1PZGA 4OMFG 5EUCA 2NU6A 3NHUA 3GNTA 3VR2A 2XMDA 1WHSA 2W37A 2PKRA 2YL2A 1BO6A 1NVGA 2AOWA 1E3SA 1IU9A 2ZTVA 3LKZA 4FMBB 5CVVA 5K3FB 3SEQA 1LNZA 3JQGB 3U4AA 1FF9A 3WGHA 4GMHA 5IMBA 2FZCA 2XCSB 4YRJA 1XMQB 1SIOA 3OJ0A 3NT4A 1XVAA 2AS0A 2Q4RA 4PZDA 3RKSA 1N3BA 3GPBA 4BP1A 3NHLA 1QBKC 5DBIA 5JIBA 2PZFA 3OIGA 4OM8A 4W82A 2O1SA 4BMCA 5LD2B 4FLEA 2ANBA 3ZVNA 1IULA 2MHCA 4HZUB 3AH8A 2HWXA 4H9GA 2N9UA 4J0EA 3C2QA 4IXNA 3U9TA 2QRMA 4Y0AA 4EPVA 4I46A 1XIVA 1IWPB 3X1XA 2JFVA 3K0HA 4L8YA 1BMFD 1RQNA 2Y2VA 5L3SA 2C20A 4KPUB 4WESB 2NP7A 521PA 2HQ1A 3OIYA 3EQ8A 3QLUC 4DXDA 1J0BA 1V8BA 1ZMBA 2I33A 3RWMB 5BSTA 1T9AA 1G8YA 2ZTHA 4LK3A 2NZVG 4CF4A 1AB5A 4N6NA 3QW2A 2FP4B 1BKYA 2YXNA 4TSKA 1MDFA 4YAOA 2FZ4A 1R8YA 1G20A 1XCBA 2D7JA 1IHYA 2V54A 4CQJA 3ECSA 4Q00A 1T6NA 1JDNA 1W2HA 3LUFA 2DHCA 4OJNA 4ND5A 3F71A 3GLIA 2EP7A 2Y8EA 4YMGA 2XA9A 1SCUB 3TO5A 2PO7A 4KBYA 2V7WA 1WDTA 2DKOA 1JSXA 1L5SA 1XKLA 4ZK6A 1AGRA 1YJBA 4I81A 4LX8A 2N42A 5A5DA 6REQB 1KAHA 4D81A 1XCMA 1M2OB 4H31A 1BW9B 5BT9A 1X6VA 3LDAA 4M8NE 2C0QA 3R5HA 5CD1A 2J3HA 1E8MA 2X9QA 4TUYF 4S1TA 4CR6A 2OAGA 1RAIA 3C70A 2YICA 4DUZB 4DA7A 3IT3A 5BYKA 1FP4A 3I52A 1ZU4A 4RTMA 4NZOA 2B92A 1X74A 5ELLA 5DYIA 1ODKA 3O1JC 3EQ2A 1L5HB 5ALWA 4ZC8A 3RVLA 2CDCA 4MVJH 4L3VA 3FR8A 3UQYS 2J08A 2XUAA 4ILKA 4ARVA 5HUJA 2FZKA 4UAUA 2F1IA 3S2IA 1CZOA 1WBJB 1WCWA 3K8YA 2UYYA 2PX5A 3GJ8A 2CXUA 3G17A 4ZI7B 4ZT3A 1NI4B 3PIDA 4PZ0A 1N77A 3VA7A 2HK9A 4CM4A 4ZA2A 1IYZA 5EIOA 3SDSA 4C5BA 4OQYA 1N5KA 1TTPB 4TS9A 5LOVF 2NVUA 5U9CA 2WDPA 5CU7A 1NF3A 4BO1A 4XUDA 5FFMA 4DLAA 3OM8A 3H9CA 4AI6A 3HPRA 1E2JA 5ABPA 4WCFA 2Y1OA 2UVQA 2Q2WA 4QFDA 3M4ZA 4WZBB 5CLFA 2V5VA 1HDCA 3FGOA 4K8OA 4WADA 5AW4A 5FO0A 4HYYA 5L9AA 4RE5A 2BTQA 1ZOOA 4F4IA 2WSSD 3HVHA 1NJSA 2RIPA 3JWEA 2QM3A 3K4PA 4ZXPA 5WRFA 3GRAA 5FI5A 4FK8A 4DR4B 2CNNA 1UAAA 3SX2A 3VSDA 2GM4A 5AJXA 1M6NA 2P8JA 4GF5A 2J3DA 4CLOB 2Y6UA 2FZ5A 1T1IA 3BS4A 2ZSEA 5KKAA 3S8YA 1QV6A 4XFJA 1T9ZA 1NAIA 3K7EA 4ZYUA 1JAZA 3UN1A 3WC4A 5J2UA 1K6MA 1JIVA 3G0OA 2JBAB 4EFKA 1CF4A 3LQ2A 1H2AS 2IY8A 1I10A 5BWLA 3FNQA 3KO8A 1D1PA 1E1CB 2LKDA 2SKEA 2WF5A 3PFNA 1OOEA 1XL1A 2AV6A 2LD4A 5EQTA 5KJ1A 5KHLB 3AUKA 1FFSA 1W1IA 4Q3BA 4UMEA 5SZIA 2BGWA 4LZLA 5ENVA 2N1MA 1N78A 3TSCA 3M8KA 4NATA 1VCHA 1V4VA 3HGQA 4TWIA 3ILYA 5CDYA 4MWBA 2LXNA 3A36A 1EK5A 3HSSA 2ZUVA 4WZAE 5JZOA 1TK3A 4GE0A 3JVVA 4Q1EA 2P0AA 2LTAA 3IMKA 2V7UA 5FLEX 2DFNA 3DMRA 1U2PA 1ENPA 1BS2A 4GM1A 2HCJB 4GRIA 1DXOA 1CFZA 1CZNA 1JHMA 1ZI8A 3VDRA 5BURA 3N07A 5KQGA 3IUBA 3NCTA 5LXTA 5CA0F 3E3LA 1BRMA 1LK0A 4E4RA 5BNWA 3DTNA 3EH1A 3NORA 3ZLTA 1YC5A 2ZSFA 4DSTA 2O1EA 2XNJA 5EZQA 2PXXA 2W2MA 3PPIA 4JU8A 1TAUA 2G70A 1UXJA 4QUKA 1MCZA 3O6VA 4MUGA 2IV2X 1WETA 3JD2A 3QBVA 3H5AA 4FJ2A 4B79A 1XCLA 2NV2B 2G08A 4OKSA 1U5AA 4UC0A 1OX5A 4P80A 3GJSA 3ABSB 4KRYA 3TN7A 4OB8A 2ZJ6A 1IZYA 3TVYA 3GJ5A 1YCFA 3LGAA 3I3OA 3IAS1 5ALMA 1SBNE 3EUWA 1Z82A 2XMBA 1WO8A 2PYZA 3D3WA 3GXBA 2V4MA 1OZHA 2EKQA 1EXNA 1J2TA 2O2IA 3OIWA 1XEWX 1HDEA 1W75A 2C04A 4FX5A 4KRXA 3C7TA 5CT6A 2P68A 3I23A 2ECQA 1JEQB 3VNQA 3E18A 1WHTA 3RYHB 4S04A 3HR4A 3VPGA 3OWOA 4KZKA 3UUGA 2JLXA 3ICEA 4D6XA 1E3WB 1P0FA 4HQFA 3UKDA 3U5TA 2B8TA 3O83A 5E6RB 3FSJX 1ZSNA 5BXQC 3CLTC 5LVAA 1W88B 4MHOA 4EHJA 1Y1LA 3I1FA 4NCBA 1WOYA 2FX3A 1ULZA 2OQ2A 3QE2A 3TLGB 4BCCA 1SB9A 3OIVA 3H0EA 1FB5A 2RJ3A 4NFYA 4TTTS 4KQEA 3SXJA 4BKRA 1EK0A 3JQAD 2A9OA 4JOCA 4KVAA 4QPCA 5TQ2B 4ER5A 1NQAO 3KZ1E 3O5AA 2XOKA 4G1MB 3ZZ1A 2VHWA 3R4VA 5D1HA 3RHFA 2W6IA 1AB6A 1B1CA 2IUTA 1XTQA 2QTTA 4GZLA 3RK0A 4IDDA 1PV1A 1SHJA 3KZXA 4CKBA 4DDTA 5F7OA 3EZGA 4KH1A 4MJ7A 4GAEA 2VP3A 1YL6A 1CJVC 4ZT7A 5LWHA 4MDFA 1CUDA 2LNDA 1M6VB 1M34A 4MQEA 1JNXX 1JHPA 1NR1A 2P90A 2PJDA 3NEPX 2KSQA 3NJ8A 3PD0A 5CTJA 3KJGA 3SAJA 3U7JA 5BVGB 2I6SA 4JVOA 1FTWA 3CLUC 4O25A 4UM9D 3R7SA 3ZBUA 4EPWA 1XZAA 1E7YA 3OCUA 3PHGA 1KQOA 3ENZA 3TOCA 4K81B 1C3OB 3GZTB 3IJRA 3T7RA 1K97A 4O1MA 4U7JA 3U1TA 3ZK7A 3SBDA 2D2EA 3BDAA 4AZWA 1VKHA 2PCLA 1B3RA 3A70A 3Q41A 2NZUG 2P67A 3AM3A 2AQ8A 4HDCA 4ITRC 1C0LA 3PC6A 1EE1A 3EG5A 4MQ5A 4UHDA 2AE2A 3NHFA 5ALDA 4FE7A 1UZNA 5DPMA 4BVFA 3OE4A 4F4FA 5HSGA 4ESVA 3HXPA 3M0EA 1I6WA 3RG8A 4G81A 3QH4A 1ADYA 1YONA 4R3UC 1JEOA 1JHYA 3DT9A 3FIJA 3BXEA 2V7BA 5IXYA 1O8BA 3ENVA 4CDNA 1TKRA 5JZ9A 5LZ4A 1VE6A 1EGHA 4BJ6A 3M6WA 3BXXA 4HEJA 3R5XA 4MW0A 3G2OA 1MORA 1D2NA 3OJWA 4YMWA 2IUFA 1T6BY 1EWKA 3DBHB 4XPIA 2WKWA 3PXUA 3GMTA 3G8DA 3L4EA 5CJPA 1VJDA 4N1AA 5ERXA 4OPMA 3TZBA 4AO8A 1R0YA 4JA0A 3LX4A 1X3SA 3G2NA 3M33A 3NS7A 4PXSA 4WFQA 2O2HA 2BMAA 3D6NB 2YRXA 2R79A 1II8A 4Q7KA 1JHUA 4G5YA 2ZDHA 4YRNA 4TXLA 1QC5A 5AJUA 4FVTA 4LYHA 3UJAA 5IJ9A 1XVLA 1E0JA 4G0WA 2BEKA 1WCXA 3ENKA 4O2BF 4AP9A 1BEUB 1P81A 2VUTA 1GQQA 1ZOLA 2A9JA 2Z4TA 4AULA 3OZGA 2AQKA 1IBSA 4R0NA 3GDFA 1O57A 1T4CA 1R15A 1L7MA 2PZEA 3LAWA 2RHRA 3K20A 3UQZA 4OK6A 1W30A 4GIBA 3N2LA 2OCBA 2OZVA 2AJ8A 2XTMA 3FFWA 1CUUA 1GU1A 3CMCO 1Y81A 3NOQA 3T5DA 2E9SA 4I1VA 2O2JA 3KTFA 4KCGA 4V2UA 3WKEA 2JA1A 2NPIA 2Q3BA 3NC1C 5HW0A 2EATA 1IY8A 4UUMA 3GHHA 4G3XA 3J7TA 1G7TA 1YZNA 2Y0CA 2BUCA 2R11A 2H1OA 3AW9A 4L95C 1EFVA 3TTUA 5FT9A 5JNSA 1GNLA 3MELA 3ZH9B 2HWWA 3L4KA 2OV2A 1ISIA 4Z4GA 1RMYA 3MB5A 2G72A 5JRZA 2XIQA 3DKPA 4N82A 1N3YA 4RNCA 3KQHA 1L3IA 1U7OA 3BMNB 2BP7B 1HDOA 2YV3A 3GBPA 2ROQA 1G20B 2JASA 3MM4A 4IXWA 4LRWA 4N47A 1JKFA 5REQA 1EZZA 1JJBA 1Q1ZA 4X6LA 3F98A 5EWMA 5DI9A 1BWRA 2H2GA 1XFDA 3AVOA 2R84A 3GLIB 4OI0A 1ZQ9A 4RFSA 1GPKA 2DT5A 2JARA 3EGWA 4MS1B 4X9XA 3PWTA 3ZU5A 1XPOA 5ALKA 1QGED 4DKXA 2Q0HA 1C4WA 3FNFA 4NMLA 2X0IA 2O5RA 1YGYA 2YIJA 4OJYA 5CDGA 1T34A 2PUHA 3DBIA 4QGBA 3FJ1A 4CU2A 3Q7SA 3SLKA 4ESHA 3AT1A 2DF8A 5H83A 4CTKA 3UPUA 3KWLA 3LX8A 5C8YF 4LCJA 2CXXA 3PWKA 1FP4B 1Z0FA 3BB4A 1ZO8A 3GLHA 2H2IA 4QELA 4HMPA 4FOLA 5ULLA 2PMBA 5DNUA 3LYUA 1KSJA 2F43A 2PGLA 3DFUA 1T15A 3CUVA 4LQDA 3KZVA 2WWTA 4ZT2A 1J39A 4V0MA 4DYDA 2PX2A 3LPLA 4XTRA 5BYBA 1A1VA 3CLRD 4MS4A 3FPKA 4JSYA 1RWMA 3TWOA 3KE8A 2BFFA 1UH5A 4UE3S 3PI7A 1NBWB 3WSTA 1ZIPA 4Q3OA 1CB0A 1KO7A 1O0SA 1G2OA 2NO9A 2R25B 2W58A 4OFZA 3MK31 1E9RA 3CPEA 3EC7A 3LT2A 2VK1A 2NN3C 3MUFA 2NVUB 2O59A 4PM4A 2OP0A 3TQTA 4GGPA 4C08A 4XA8A 3L8EA 1T6ZA 3JAKB 1TIPA 2QVCA 5I01A 3P19A 2QSZA 4D26A 5FBKA 2UYGA 1LWNA 5HJ7A 1R0KA 1ZICA 3SCZA 3C8DA 1UIMA 2BTQB 3K9CA 3LNCA 2CWWA 2VH5R 4M1MA 3TECE 5DLYA 1TL7C 3PLNA 4ATNA 1BHJA 2FFHA 1FLDA 3B53X 1C3XA 3N7TA 5K03A 4DARA 4W9NA 3ZIAD 2J59A 3CFYA 1RZRD 5KYWB 4LZAA 1JLRA 4HH4A 5KS2A 4BX3A 2WT4A 3VPSA 4PC7A 4G4SO 2RCNA 3OTGA 3PBKA 4HOYA 1H6BA 2VUHB 3E58A 1FE8A 1NZJA 2JLQA 5J2UB 4B45A 3VHQA 2BEJA 3T3OA 2WMYA 2DFKB 1EVIA 2BEUB 4PPFA 5DN6D 5JATA 3SR3A 2D2VA 2W9XA 4RLHA 2OCKA 4HVLA 2VRCD 5DWQA 1WDKA 2IX3A 1V45E 1ZMXA 2O57A 4R01A 4Y2XA 1SOUA 3DM5A 4IINA 2Q1WA 1TT7A 2V55B 2W2LD 4JLJA 4M8IA 2V58A 2AK3A 3IV9A 1D1SA 4N0DA 3GZ4A 2IS6A 4HDMB 3RQIA 4W9MC 3WYBA 1Z18A 5P8WA 1AUQA 1OPRA 5HGXA 3LKBA 1II9A 2FN9A 2BSXA 2LV8A 1RYEA 1ZR2A 4GX1A 2IYLD 4LDRA 2BL4A 3FKJA 3O1IC 1RLTA 3BWVA 3I58A 1FNCA 2PL3A 4LDQA 4R1PA 4C6TA 2PY6A 3PNMA 1E2KA 1G42A 2YBDA 4IZOA 1PAUA 5EIWA 8LDHA 3LH5A 1D07A 1AO3A 1KI1A 2GS9A 1YR9A 5K2MA 4XM0A 4K6HA 4A2PA 3SJBA 3SVTA 2ZS7A 5SYNA 1Q50A 1QDUA 3QZUA 4KO4S 4L9WA 4RMHA 3SICE 3WVNA 1OX6A 3I62A 5DBEX 5EVCA 3V6LA 1KIAA 5HFNA 2C9CA 2QT9A 3FM9A 5DM1A 2PRSA 2VQSA 4E1BA 1CUYA 2RGXA 2C8VA 3LUHA 4P4TA 5TVGA 4Z49A 3G88A 2RK3A 5AQEA 1R2QA 5JUWA