1RSZA

Structure of human purine nucleoside phosphorylase in complex with dadme-immucillin-h and sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
282
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structural comparison of human and malarial purine nucleoside phosphorylases
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rszA00
4WKPA 4L5CA 4YMLA 4G89A 1YQUA 3ODGA 5CCDA 1ECPA 1U1DA 3FB1A 4GMHA 1TGVA 4NSNA 2HWUA 2B94A 5ETJA 5F7OA 1WTAA 4G41A 4MCHA 3E9RA 3K8QA 1TCUA 3OPVA 1OU4A 3OZBA 1CG6A 4WKCA 3UAXA 4UC0A 1K27A 1U1CA 1PBNA 1VMKA 3FNQA 1PR4A 1Z5PA 4OEHA 3O6VA 1V2HE 3NM4A 1ULAA 4OGKA 1A9OA 1Z34A 1QE5A 4QARA 1A69A 2OC4A 4D8XA 1T8RA 5CXQA 3OOHA 3SCZA 1JPVA 3ENZA 4EARA 3BSFA 5F76A 4BN0A 4K6OA 3UAWA 3EUFA 1LV8A 4MCIA 5EPUA 1NC1A 3FAZA 1JDVA 1OTXA 4LNAA 1RT9A 1JE1A 3NM6B 1Y6QA 1Q1GA 1V4NA 3O4VA 3TL6A 1RCTE 4R2XA 2QTGA 2PGAA 4LDNA 3KU4A 1YRYE 1FXUA 3UAYA 4KN5A 1OVGA 4JOSA 3KVVA 5C80A 2ISCA 2I8AA 4TXHA 1U1EA 1OTYA 3F8WA 2H8GA 3PNPA 3EUEA 2Q7OE 3NM5A 5CXSA 4D8YA 1Z33A 2AI1A 3DJFA 4ECEA 4R2WA 3E9ZA 2P4SA 1LVUA 4MARA 3INYA 4QATA 2AI2A 2IQ5A 4IP0A 2QSUA 3LGSA 4YJKA 3E0QA 2OXFA 4YNBA 1M73E 5B7PA 1NW4A 4BMZA 4M3NA 1SD2A 2QPLA 4FFSA 5FAKA 3PHBE 4QAQA 1TCVA 3FOWA 5IU6A 2OECA 4TXJA 3NBQA 3OOEA 3UAVA 1Z37A 1PWYE 2A8YA 1ZL2A 1PR6A 2HSWA 3DPSA 4TS3A 4L5AA 1RFGE 1I80A 2I4TA 1U1GA 3OZCA 1PKEA 1YQQA 3LA8A 4EB8A 1PR5A 4P54A 1ODKA 4RJ2A 1B8OA 5F7XA 1Y1RA 4DABA 2AC7A 3OCCA 3DDOA 1Y1SA 5B7QA 4YO8A 2HRDA 1A9PA 4PR3A 4DARA 1RSZA 5JPCA 4QASA 2A0WA 1PR0A 1V41E 3IOMA 1Z39A 4L0MA 3OZEA 1T8WA 3P0FA 4TXNA 5CYFA 3GGSA 1SD1A 4I2VA 4DA8A 4WKBA 5DK6A 1V48A 1G2OA 3OF3A 1A9SA 2HN9A 4F2PA 5F7JA 5I3CA 2A0XA 3C74A 3LBAA 4U2KA 5F77A 4GKAA 1PR1A 4X24A 1XE3A 3KHSA 1C3XA 4G8JA 2RJ3A 2ON6A 1CB0A 1U1FA 1Y1TA 5F78A 4R31A 4WKNA 4F2WA 1ULBA 4OGLA 1SQ6A 2XRFA 4JWTA 5EFOA 3K8OE 3QPBA 1ZOSA 1JDSA 4JP5A 1PR2A 1PF7E 3UAZA 3U40A 2OC9A 3T94A 4QFBA 1NC3A 4F3KA 1VHWA 4D98A 3FWPA 5EUBA 1T8SA 4TTIA 2GUWA 4L5YA 3MMSA 1JDTA 1Z35A 1Z36A 1Z5NA 1SJ9A 5CCEA 4LNHA 4NS1A 1PW7A 1LX7A 3FUCA 4M7WA 3D1VA 1K9SA 1TD1A 4WKOA 4NY1A 1N3IA 1Z38A 2QTTA 4F1WA 5IFKA 3EEIA 4DA0A 1YBFA 4TTAA 4OJTA 2QDKA 4H1TA 3PHCA 4TXLA 1RYZA 1Y1QA 2AI3A 1V45E 4OF4A 1K3FA 3DP9A 1Z5OA 1B8NA 4BMXA 3EMVA 3GB9A 4L6IA 1RXYA 3BL6A 1TGYA 1JYSA 1JDZA 1RXSA 3PNSA 4M1EA 3ONVA 1RXUA 3BJEA 3IEXA 4DAOA 4TS9A 4DAEA 4GLJA 4LZWA 4PNPA 4BMYA 4QEZA 3OZDA 2BSXA 4LKRA 1OV6A 1VFNA 3BGSA 1PK9A 5KB3A 5B7NA 4F3CA 3DF9A 3P0EA 1V3QE 4D9HA 1JE0A 4GLFA 4TYMA 1VHJA 5K1ZA 1ODLA 1A9RA 1T8YA 3KVYA 1OUMA 4TTJA 5CYGA 4D8VA 5F73A 1Y6RA 1JDUA 4OY3A 3KUKA 1RR6A 4DA7A 4TXMA 1ODJA 1YR3A 1RXCA 3KVRA 3MB8A 1T0UA 4DANA 1JP7A 1ODIA 1PK7A 4DA6A 4E1VA 3UT6A 1A9TA 2A0YA 5B7GA 5F7ZA 1A9QA
chains in the Genus database with same CATH superfamily
1IEXA 1Q14A 1VMEA 3CH7A 4L5CA 2MT9A 4JLUA 3VQTA 1IQ0A 2XQGA 2HTEA 1ZUHA 2JFYA 2GPBA 5CK4A 2GXQA 4CI0B 1VJRA 3RYFA 1GPYA 2NU7B 2UYOA 1IL0A 1RP1A 3ANYB 5TS2A 1QRUA 4RA9B 3HACA 3L1JA 1NY6A 3ZWMA 2C2YA 4V0ME 2QL6A 1T0PA 5AVWA 3CQ9A 1DHTA 5JMTA 3LW7A 3AUFA 4MR9B 4KRXA 5FF9A 9ATCA 1RXVA 5BQ3A 3KWJA 2XNDD 3VOTA 1GRNA 4QYWA 2QA5A 5E6RB 5IJZA 2FR0A 3UUGA 4WZAE 5KTPA 1Q12A 4ED9A 1CULC 4LVNA 1C7ZA 1E77A 1M2NA 4OHWA 1LK0A 2Q45A 1PFQA 2ZAGA 1CPYA 3JASA 4MLZA 5DLEA 5HFNA 3OZBA 4CMHA 4RTLA 5CCXA 3WO1A 3N87A 3KLBA 3VZSA 3WRVA 4LDQA 2E6UX 3ECCA 1PBNA 2GPYA 3LE8A 4FUQA 2O0LA 3H04A 4QHTA 3UANA 1PR4A 2Y6VA 2PK3A 4GRIA 3GLQA 2PT5A 4RWEA 3RU7A 1WXQA 2CEKA 2DRIA 4EJ6A 4E5UA 1NX9A 1EESA 3CX3A 5AVTA 3FDIA 3I09A 1NW3A 3PFWO 4OPMA 1FIUA 2QRJA 4BVEA 2VPXA 1Y7TA 1JL3A 2HWKA 2IEYA 2HRRA 4IJQA 1C7FA 4URVR 4PIPA 3BCUA 3WLNA 4QARA 1ZH2A 4KGZA 5TPZA 1T8RA 2PTGA 4PC7A 3LPLA 4JC4A 4RPHA 1E0SA 2HPAA 4RENA 4CQMB 4S2UA 3ZCVA 3RIYA 1BS1A 3I76A 1Y8QA 1DKRA 2YN4A 3F7OA 3GP3A 1KO8A 4HVAA 1WDKA 3AO0B 4F85A 2Z1MA 4O5OA 3GRRA 2ECQA 1M2GA 4UHDA 4YQZA 4LF9B 5ESRA 3BOSA 3KQWA 2KHZA 3EZGA 3P27A 5ALHA 1D6MA 3OJEA 4F3RA 2C59A 1LV8A 4E33A 1KJ8A 2BM9A 4JJIA 2O8FA 1IUNA 1CRQA 4I1YA 2CMGA 1OLOA 4UHJA 3E9MA 3SG0A 5KNDA 2RGRA 4IINA 3ISTA 3FWKA 3UT5B 3AG5A 1IC6A 2E4UA 4PS0A 1JJIA 5KPJA 5JNVA 2AQIA 5CM2Z 3H5IA 5EJ5A 1XDBA 5HBGA 3DOFA 4GOXA 5KSYA 4XI9A 1EXWA 2HRQA 2AFHA 2ZI6A 2FR1A 3IPAA 1AHNA 2I1LA 4BEBA 3RYIA 3PR2B 3I0ZA 2GKSA 4D1YA 1JGTA 3EWSA 4BNNA 2R97A 2I5PO 2BGLA 4O29A 4ILKA 6ABPA 1SBQA 1X3LA 2V7TA 4BECA 5BQOA 2WJ4A 1XJ5A 3L18A 4D4IA 3W6PA 4LX0A 4UDXX 2RFLA 4MUGA 4PRKA 4QQNA 3DLAA 2CDRA 1DHRA 1ZISA 4ZT4A 5K7SA 4V0QA 2B1JA 2JAWA 4K9QA 4I4TA 3KU4A 4EMBA 1KIMA 2BF4A 2OD7A 4R2MA 1ES9A 3HO6A 4EI2A 3EZFA 4RKWA 4N8DA 3OG9A 2B2XA 2QP9X 1ORIA 2ISCA 3C3AA 4GOND 1MJGM 4I1PA 1R8YA 1OLSB 2GUGA 1QV9A 2XODA 3GJ8A 4LF7B 1MX5A 5FOXA 4LMAA 1L1EA 3F8WA 4YMVA 5L4LA 1RACA 3OX4A 4KLRA 1MO5A 5CB0A 1UADA 2H2FA 3NGLA 4LRWA 1HKHA 2QTLA 3FPFA 4CEHA 2VPWA 2P4SA 3PX3A 3UV6A 4EB0A 1BWQA 4F06A 5KO2A 1WSDA 1DJLA 3P1JA 3RUHA 2V96A 5A03A 5JQGB 4GOJA 4R1PA 4ZPXA 3IELA 4EITA 5JV5A 1QTQA 1TEHA 3C1AA 1W75A 1L7OA 2I6SA 4DCOA 3WNBA 3A0UA 1AF7A 2OGTA 4ZT3A 1II0A 1E1QA 1MB9A 1QDUA 3KWLA 4MR8A 1N1MA 4HC4A 4OHFA 5FXMA 4CF3A 4HNVA 1TB4A 4KQMA 3EIEA 1A5AB 1WU7A 3N0XA 1SCNE 3KZ1E 4GBGA 1HYQA 2BEWB 4RJTA 3E23A 4D2IA 3GR6A 4FFSA 1DC8A 3BIWA 3DEZA 1Z4QA 3L8MA 3FBWA 4JBIA 3ZE8A 2QP3A 1P5RA 3A2LA 4IZIA 4QGHA 3WSVA 2P3OA 2PUWA 4BNWA 3EH2A 1U8AA 3NBQA 7ADHA 1KK1A 2BBSA 2PR7A 1FUKA 3LUBA 4OLJA 4HATA 4YPFA 3RRMA 4E13A 1A82A 2R6HA 2YWRA 1AUQA 1FNDA 1UPAA 2QZPA 4G1BA 5EJEA 1KJNA 3FD8A 4MUEA 1XQ9A 5JS8A 2XE8A 3UAVA 1MB4A 4B6FA 1Y7PA 4JN6B 5H68A 4IOJA 4EK9A 3HU2A 2OCXA 4H0NA 3G02A 3KR0A 2H59A 2Q41A 1PV1A 1QE3A 1JSXA 2I71A 3K4PA 3AKDA 2ZIAA 1MU0A 3HTXA 2Z2XA 3W78A 3T3EA 5IN5A 2A3NA 4QIHA 3G2NA 1EBBA 3IH5A 2GF0A 1UMBB 2JK0A 3A1FA 3OFND 3PPXA 4KOAA 4EYGA 4X6YA 3KDSE 5K2OA 2Y6UA 5J58A 1UC4B 4W1SA 3O84A 1Y4AE 4R3UC 4D82A 3OWOA 3LA8A 3UJ9A 2JVKA 2X1VA 4EFNA 2DHDA 2WHYA 2R96A 4INZA 4PV7A 3RVDA 4IV0A 3FYSA 1RCUA 2JBHA 2J30A 1C1XB 1IJKA 3FCYA 1GL3A 4LJSA 4TX1A 4ZV4A 2ZDGA 2AZTA 4NENA 1N0VC 1MB2A 2CUTA 3QFRA 4YMIA 2OE2A 3O9MA 4BX9A 4ZO8A 4M8IA 3UPUA 1FVHA 1GCUA 1TI7A 2I4IA 2XKJE 3AFOA 4XVCA 1G20B 1W5BA 4KYTA 3GCZA 5KTSA 4E07A 3QFSA 3HN2A 4QFCA 1QGUA 4D25A 2P2SA 2HNBA 5D1HA 1ZOIA 5CR9A 4AAYA 1JZTA 2GKGA 3F6YA 4JFRA 2H1OA 1OI2A 1MVLA 1NGSA 1WZCA 3DHWC 4G8DA 1V41E 2JKVA 2BKEA 3PPWA 2UZ1A 2OD2A 3G17A 1NXQA 1PFVA 2IGTA 4XFJA 4ESEA 4PSUA 4RTRA 3WWEA 4E1BA 2I8CA 4CM1A 4L2IA 3DKKA 1W59A 1RQLA 1HNWB 4DA8A 1XYYA 3HABA 3COWA 2GNOA 3E7DA 3BMCA 1MT3A 2R00A 4RMNA 2C5AA 4TWAA 2PA0A 4UD6A 2ZKLA 5AJZA 3R7NA 2AJDA 3UJPA 3MIIA 3U81A 2ZBUA 1CUAA 1T5HX 2QPOA 3ACDA 1F2DA 1I0IA 1SVUA 2VQSA 2YRXA 2BFMA 3MMZA 4ENQA 1X0XA 3I9NA 4AX8A 5DGCA 3AB8A 1G21A 2XOKA 1MC5A 4RANA 1J1ZA 5HGJA 5DTEA 1H94A 3RC9A 3FUWA 2XW6A 1CJTC 1FCJA 3JQ9A 1ZK1A 2FSSA 2WWRA 4FK8A 4MXDA 1PHPA 5BSTA 1ZMXA 4AW9A 4BB6A 3OY2A 2C83A 1WP9A 2NUAB 1QVRA 3N8GA 2UVDA 2YTZA 1BHSA 3GLHE 4ZVTA 3O4IA 2PNFA 3CVYA 4QGSA 3MWFA 4YONB 3LHDA 4RK4A 4ZIRB 5JZMA 4HNGA 1CKEA 1J2JA 1THGA 4BX3A 1RYBA 3FI9A 1J06A 2DG2A 2KYRA 2NO1A 2QVYX 3Q88A 3USZA 5JSKA 3OP1A 4IDHA 3LOQA 4OSPA 2ZBRA 2ESRA 1GRRA 4NONA 3OQBA 3NB0A 3UJ3X 1LZKA 2VYCA 3K9HA 1R4MA 1S9HA 1JG1A 1Z74A 2CMHA 3QZUA 1OFUX 4XUCA 3N59A 5ALMA 3HYTA 3QPCA 1Z0JA 1M33A 2EYQA 4MQBA 4UM7A 3TJMA 1EVZA 3H5RA 2XRFA 1OT5A 1Z6XA 4D99A 5MGBA 2XTZA 5EFOA 4PNZA 4E31A 3TLGA 4JYMA 1LH0A 2J3QA 4DV3B 4I4TF 4MRAA 4DV6B 4G1FA 3BB4A 4OMFG 1XCLA 2P4HX 2XUFA 3VZQA 3AETB 5TQVA 2NUAA 1XDDA 5J47A 1K75A 2QUKA 3HBLA 4RABA 2FSUA 3AXSA 1U1IA 4MDFA 1BW9B 3ZW8A 2R44A 4BFCA 1YZ3A 3AOEC 5CM9C 1II9A 5F1PA 2ZE7A 3P2OA 4AJOA 5T7BA 2XB9A 2ZBGA 4FEAA 2PLFA 2WU3A 4JR1A 4IWXA 2OAQ1 2VSYA 1EXDA 3DA8A 1SQ0A 2AWNA 2N42A 3WNCA 5JS1A 3JR3A 4PLPA 4M7RA 5KWIA 2GUWA 5BQ5A 2J5XA 3CVUA 4L95C 1FS6A 3S8EA 1E98A 2GLTA 3IDQA 3EGEA 3KL4A 2AOTA 3OZ7A 2LXNA 3HMKA 1I10A 2COUA 3M5CA 4ZHSA 3GZJA 2YC4C 3ZQJA 2AVDA 3M4YA 3ST7A 2VWQA 3U61B 4JI8B 1Z5NA 5CLLA 2JGFA 5E4YA 2ERYA 4CRWB 1ZPDA 4REQB 5K45A 2D00A 5FOSA 4KX3A 3WAGA 4E09A 1NKTA 2HWYA 4PCLA 5H82A 5HR5A 2BH2A 2VT2A 4I9GA 2WZDA 5LB4A 1TUEA 5EVCA 1LPAB 2VPPA 1RLOA 3BD8A 3EVZA 1XAJA 1OBVA 1AXRA 5JMWA 4RPJA 1UWVA 1GTSA 3DONA 2JCXA 2IPMA 2AR7A 5KDLA 4DNQA 1X86B 4QFMA 2VWGA 1IZZA 3WSTA 4ETIA 3NAMA 4DZRA 3R20A 4B85A 1E2HA 2Y27A 3TZQA 2Q1XA 1SOMA 2P0YA 3UCEA 2GJSA 5H80A 2JRCA 3DAOA 4EO7A 4Z4IA 1KQFA 3EISA 1KY5A 2FEAA 1QVWA 4IIFA 3HJGA 3GW8A 5CLIA 5K8LA 1BH2A 4X1IA 1YQEA 5THQA 4M99A 4ZP1A 4C5CA 2OO5A 5HG0A 1CJSA 2QDKA 5DW0A 2ZI7A 2C4UA 3DVAA 1IB6A 1YBVA 3AEZA 1HE3A 4H1TA 4LOLA 4P93A 3SKVA 5BT8A 3FZEA 2PDAA 1SBZA 2HV9A 1J0CA 2FRDC 1JH9A 5CT6A 3ICQB 3O4HA 3HMQA 5EHQA 2BR4A 5CHEA 5FULA 5KQRA 3ODPA 1TF7A 3DCJA 4JGGA 3SY8A 3B51X 3EMVA 3SI7A 4G5RA 4EABA 4JODA 2GBFA 4K05A 2XY4A 5K4GA 3HVHA 4Y1FA 2C29D 1TGYA 3DKVA 5IM4A 4B6EA 4ZI7A 1XROA 4A36A 3CSDA 4ZCLA 2W98A 4ERXA 4B75A 2FSPA 1ESNA 1I7DA 3ZCXA 1ODSA 4UTVA 3R0IA 3V4RA 1YHNA 2PGJA 2QQ5A 4UDNA 1CQIA 4QBHA 3JD4A 4JBXA 2H2DA 3KKZA 3CCBA 1Y8RB 2XEXA 3MYYA 3PNBA 4UE3S 3V8MA 1RBQA 2DSTA 4FFDA 5A62A 4WOJA 2BFCB 4OJQA 3WWCA 1Z4IA 3ZK7A 1U4SA 2F2TA 2DFNA 2IYAA 4BUJA 2WFAA 2FW6A 5I51A 1NE2A 5ICFA 4CG1A 5I8WA 4Y1RB 1Z17A 2NTJA 3M6IA 1ZO8A 1WUHS 3C3MA 4S1WA 4BO8A 3OIUA 3GFSA 4OFWA 3NDPA 5JPIA 1IN1A 2XDWA 2GMWA 4G85A 2BTQB 1AQUA 4GM0A 3TWOA 4KI0A 3VAZA 3E22B 5JANA 5IT9A 3CBQA 4ZRNA 3GDHA 2J4FA 1FX1A 4BRWA 1R6UA 4UMFA 1PGPA 3KTAB 2JJ1A 3KR9A 4EA7A 3ZXSA 1NWHA 5FBVB 3ROMA 4YXWD 4Q3NA 3LC1O 1TYZA 2G88A 3QI2A 2VTVA 4REOA 3SNKA 3NHPA 4UNNA 4R1LA 3TD9A 5KNDD 1G2QA 1R16A 1J90A 3UK0A 3D6MA 1SKUA 1A7AA 2CDCA 1P2FA 4PHHA 3X1ZA 3IQGX 3SSMA 3FCUB 3GOHA 1ZQ9A 4F2GA 1Y6RA 1XXHB 1JDUA 1EAYA 2IEDA 2BFCA 5CVEA 1VKZA 3V42A 5A4DA 1C3OA 1U5BA 1RHQA 3TW4A 1E7RA 2QGFA 3D8BA 3HUUA 3I9V1 3CZQA 3JVVA 3ONEA 4G8BA 4KJXA 4WIAA 4G4IA 3NWEA 3W9SA 1Y89A 4NZNA 3IDSA 2H1WA 2XMCA 4CQMD 1ISSA 2HA6A 1NVGA 5F4BA 3RSLA 2KS6A 3QKUA 2AN4A 3WL8A 4WXEA 4NCBA 3J81k 3I45A 5CW2A 5J40A 1YH3A 1DG1G 4WL0A 2ACWA 4DC1A 1J07A 1U7XA 4V38A 1ZHHA 3KTAA 3PGA1 5F5LA 1QB7A 1X7HA 2GPAA 5IAKA 3MBKA 3ZJYA 2W42A 3NJRA 5JJIA 2B4QA 4NJOA 3W6UA 4HN4B 4DBLE 5TXGA 4EY4A 1W6UA 3A3YA 3PT5A 4OD0A 5DHRA 3EIQA 1AO3A 3DR5A 2IYTA 1MC8A 2XEDA 4GOLD 1XNGA 1A72A 2JKYA 2NVOA 4RD4A 3KKNA 2QI9F 3NDIA 1E1DA 5IUNC 5IYZA 3QEKA 1P1KA 5A1TA 1IAQA 2ANBA 1ORWA 3KUCA 1VHLA 2GESA 1ADJA 1I0LA 3MEQA 4X20B 1SU6A 2R1TA 4L1KA 2CSXA 3GJ6A 5IXSA 5JOQA 2VF4X 1HRDA 1VLJA 5FEMA 3KQOA 4EFKA 3MINB 3I2KA 2OVFA 2XBMA 1QJ4A 4RV9A 1MIOA 2WWIA 1VHTA 2FQ1A 3K3PA 3OPYB 1E1QD 1Q20A 2WSYB 1YNOA 1UANA 3FTQA 3QY9A 5LIPA 3SS9X 1JG7A 3ZTTA 2C5HA 3BERA 1AK2A 3H5AA 1OU4A 4MIOA 4OREX 4CL8A 1MF7A 5HKAA 4DT1A 3X1DA 4RTMA 1PEYA 1XV5A 1WMDA 1YULA 5ER6A 1DAEA 5K6TA 5HDBB 4L0CA 4EPTA 2N3ZA 4EMUA 2XF8A 2CJXA 1WKBA 3IMEA 3JVIA 4Y0AA 4BFWA 7YASA 4HWRA 1JSCA 1Q1NA 4WDRA 4IFIA 5FPHA 4X71A 5KQSA 5DFAA 1V8DA 3IJRA 3PQCA 4RZIA 3PTLA 2PZBA 1RVDA 3AI3A 4CMEA 2WU4A 2J6IA 4U5XA 2MYUA 1QE5A 3AFIA 4FEYA 3SC2A 2GRAA 1IPHA 1OYVA 3QF4B 4HDKB 1J49A 2QT9A 3FMPB 5H81A 5JJKA 3HKBA 4B3MB 2AUNA 1FFWA 3GMIA 3MLAA 1S0UA 3TB6A 2JIMA 3W1VA 3E6AA 3M9LA 4NPAA 1NJ2A 1T15A 2XAUA 1B43A 1C2TA 3FAKA 4XD2A 1DP4A 3CSUA 5DWVA 4PN7A 1H8HA 2W2PA 3FPKA 3IUJA 3VHXB 1I2DA 3K05A 5DI3B 1PQWA 1H2ZA 1KR5A 2GVZC 2HXSA 5DBGA 4X1YB 1N4DA 3L7DA 3WRYA 5JNTA 4GZMA 4QUDA 5FLXA 2ZYHA 4I6GA 2H1LA 4D0GA 4XQGA 5JYEA 3TOZA 3W8FA 2DF8A 2H18A 4RDXA 4RKRA 1V1MB 2MSWA 1XZKA 1N9KA 4YDSA 3VDNB 2SHKA 1E2KA 5JW6A 3VGPA 3G2HA 4ZKDA 3QSGA 1E6KA 3AVUA 3T3PB 2WYUA 3L79A 1XRNA 4X93A 2QX8A 4HRVA 3PQ7A 4L4SA 4Z0NA 5HIIA 3LM8A 1RIIA 2XOEA 1V4NA 3I83A 1UKCA 2Q2VA 1ZJJA 3RJ9A 4MHTA 3ZGZA 2XYGA 4WFJA 3EG9B 5FWXA 1AKYA 2C07A 2CDBA 5K3AA 3ZXXA 5LC1A 5IDQA 4GWGA 1Z8NA 3WB9A 1S6YA 4ZI7F 5IM4F 1T9GS 1TW3A 2AG1A 2C5GA 4JI0B 3HDGA 2EF1A 5E4TA 2H7CA 1VL6A 2HFJA 1OBOA 4NMMA 4FCCA 5DI3A 3BCHA 1DZ3A 1DBPA 1DOZA 2BWJA 2YFKA 3TW0A 4EJ2A 1MUUA 2Y77A 4FT4A 1C3VA 1G7SA 2PS1A 1EGQA 2CB0A 5EG5A 1JQBA 4QRDA 3TTUA 3ROEA 1XDUA 1U11A 5U4XA 2BGUA 4MW7A 4OK5A 1NKSA 2FSFA 4WJKB 3S4YA 1I1HA 3UT0A 3E15A 1I32A 2ZLBA 5CLGA 4EOGA 1V8PA 3GEGA 4EHIA 3IBTA 1U8EA 4R9SA 1L4YA 3SMVA 4LXUA 3SBXA 2BI7A 4NBLA 1KQ3A 1H2AS 1L7XA 2XOKD 3CC8A 5GJVC 1WF3A 3HA5A 4OA5A 5F1OA 4V02A 4NDZA 4L9RA 4QATA 3H3XA 3VNRA 3IR6A 4LV6A 1XMJA 4QXOA 4AWAA 2FEOA 1ID1A 4F4DA 5KMGA 2A86A 1RWKA 4E2YA 3HY3A 2IBSA 1OC2A 2JAOA 4RHEA 5AQ1A 2FMUA 5E2AA 4JEUA 1FTSA 1R6AA 3ICWA 1YVRA 1NFRA 3FSGD 4YUYA 3EG5A 2V6FA 5JRDS 1AHPA 1JLLB 4HLQB 4HLCA 3L7LA 5CB4A 4FYXA 4CLEA 1ONSA 2HK8A 5EKTA 2ZVJA 2WZBA 1PQYA 2VBIA 1FW6A 1R74A 2PYDA 4DLUA 2B3TA 2FMXA 1CR2A 4HI0E 1YI1A 5EWJB 4ITRC 3RSFA 3VYWA 2GXUA 1ECLA 1XD2A 3DQZA 1OFGA 1OROA 4K6GA 4FCTA 4LY6A 5SZHB 3D81A 4XPIA 1U9ZA 4AC9A 1ZUWA 5BNZA 4N5MA 4G5OA 4N39A 5FR1A 1JJBA 3B85A 1XIVA 3JQAA 4ZEWA 1Y9EA 2VP6A 5LWHA 3D6HA 3A6FA 2C2BA 1BHO1 2HWXA 5UKDA 5L8VA 5LYJA 3D3QA 5IVDA 1PWEA 1TCBA 1GAQA 2AFIA 5KU1A 2JG3A 2XRZA 4LDZA 4KE9A 4WECA 3BQNB 4RHTA 4NESA 4CFYA 5KQMA 1SBYA 1RJEA 1V1RB 1K6JA 1IUPA 2BKUA 1N7GA 2ZI3A 4L08A 3CX8A 2ZPAA 1QANA 1G9TA 3DAYA 2PMEA 1CFZA 2OL4A 4BTVA 4S05A 1FZTA 2O4CA 1Q6YA 1VBFA 2I4NA 4I08A 2BGWA 4KDFA 3IAUA 2QMOA 1NRIA 4WBSA 4FB4A 4IDCA 2FN3A 1ECCA 3OE4A 2HA0A 2WV7A 3HB1A 4NPHA 4XFKA 3B12A 5F2EA 5IYZF 5TR9A 4DDMA 2RAUA 3KT3A 5I5GA 1NAIA 1GWNA 1XVLA 3SXUA 1QRSA 2FE4A 1U8YA 1V2GA 3HJCA 5HMLA 2BJWA 3AT1A 4F92B 1ZHFA 4BFXA 4IDGA 1EINA 3TW8A 4MUNA 5INTA 3NTOA 1MX3A 2Q62A 2PUHA 2GBPA 2J5BA 2AG0A 3NOOA 3R0VA 5H9WA 2WP8J 1ZKMA 2C9CA 2D5AA 4HADA 1P60A 4MQEB 1T5LA 3ZNNA 3QBEA 3V4VB 2PLWA 2W8ZA 1F17A 2CNWA 5JISA 3RASA 5MF6A 2FDRA 1FSFA 3VYUB 5BR4A 1QGDA 1YJBA 2WMYA 4C7XA 5A5GA 1RHUA 2XCIA 2PD6A 2IIBA 1Q7BA 2PL3A 2OWDA 2ZXEA 5CNKA 4DUGD 2GTPA 4I0WB 4IJKA 5CFRA 1DEHA 3HJAA 3VMFA 5FX2A 4JNCA 1RSZA 3ITDA 1RPZA 4QASA 1BGVA 1QQTA 4MV5A 4NEHB 1KMIY 4PZZA 3OUZA 3TXYA 4C30A 1HC7A 3L6UA 1P4RA 2EWVA 5T67A 1BU5A 3GZNB 4CKCB 4OG2A 3PXDA 5BMVB 3PWKA 1HETA 1PEKE 1U5CA 1WWKA 1D5WA 2PU5A 1DC7A 2X9QA 3V7NA 4LRSB 4QJ3A 3ZJUA 1KMQA 3R5XA 4HFRA 4I2VA 3WLHA 4ESVA 4U00A 1P9OA 4GR9A 3B3GA 4HUQB 1ZJWA 4BMCA 2PUEA 1G20E 1MX9A 4IJMA 1FTYA 2AL7A 2C95A 1L7VC 4MQUA 4PPFA 3OF3A 1YJCA 3PNLA 4RO0A 4QOIA 2O8BA 1HLPA 4ND1A 4F3TA 4DUYB 4O0MA 2YV3A 2EJTA 1HKUA 1YV9A 2AD5A 3FFXA 4GPAA 1YCFA 1D4FA 3GZ4A 3T34A 2HADA 1RPNA 2X4DA 1IOZA 2RHLA 3UOWA 1W1WA 2Q9BA 4L27A 5ER9A 1DFIA 2IOHA 3V4PB 2RH5A 2I4MA 4DJDC 2V5VA 1IHXA 2PGXA 3N8NA 1UPUA 3PR1A 3WK7A 4DXAA 3O31A 1E69A 1ZIDA 3GVHA 1GKUB 2FWMX 2G04A 3EMKA 4TQGA 1ZOOA 1A8SA 1VLHA 3TQQA 4YJGB 4KI7A 4F5DA 3L6CA 5TDHA 4FFOA 2Q4RA 4MWTA 4L3OA 4QNMA 2OXCA 3VZDA 3WBKA 4Q1FA 3GG9A 3MJ4A 4FOLA 3JQFC 4FS3A 3GCGA 4PQGA 4BV8A 3RFFA 4OH7A 2O05A 2AOXA 3ZHXA 1XTTA 4YWHA 1F6DA 4O4JB 1EH5A 2OORC 2F00A 5CT8A 5LP1A 4M1OA 4UEKA 3TJZA 4MW2A 2RD2A 7AT1A 1QIIA 4HFNA 4NNPA 3OZAA 1GPNA 2FPIA 2B5OA 2ZSBA 3KQSA 4NMXB 5EOVA 3W3AH 3ZHVA 4L9AA 3ZBPA 4OQNA 4FR5A 4FOTA 1WSBA 4TLCA 2O8DB 3BAZA 1N6KA 3A7DA 3A4YA 4DJJA 3TE7A 1Z5WA 3K0AB 3R9XA 1X7XA 1X38A 1XQ1A 1QOQB 4XEHA 4IH4A 1CUCA 4M0DA 2B6HA 4BKOA 1ZVVA 1W47A 1QH9A 3O8DA 2HLHA 3DJYA 1CR4A 2JJ1D 4COOA 1IZ7A 1CJVC 2OZPA 1BEEA 3B60A 5CA0A 3L6DA 2X42A 1EFCA 2XDAA 1BKYA 3JTMA 3I28A 3O3NB 2VH1A 4DG8A 2PKQO 2W2TA 4DLWA 3PEWA 2GAIA 3PDHA 4GKKB 1EEHA 1U9IA 2D0OB 4ZGGA 4D98A 1OX4B 5AHRA 2N47A 1AE1A 2JHGA 2CCKA 3K53A 3MFYA 4RK6A 2NSDA 4NJMA 4KN9S 2Q21A 1I2ZA 1SCDA 5AI4A 3SAJA 4FYVA 4PTLA 1YFJA 2VH2A 1DEAA 1X14A 4L8LA 4DHEA 1R7RA 2AOVA 4QQFA 1FVFA 2V97A 2IZ0A 1ZD1A 4KO4S 5F1KA 4AMGA 5AVQA 1OH8A 3K70B 4H3KB 4NKRA 1LRJA 1ZI6A 4CLXA 5AXCA 5MHTA 2A9VA 1CUFA 2A9PA 3UENA 2HSJA 3W4IA 2Z5VA 3VU1A 3CKMA 4UTZA 3K71B 1MORA 1XN4A 5FWNA 3V2IA 2GSDA 2VNAA 3IB6A 4LAFA 1IXSB 2FP4B 5CB4F 1R8JA 1ZXXA 3E8MA 4LYGA 2H0QA 4GX5A 3VYVA 3OF2A 1E3DA 4NZ9A 2JIZA 3C7AA 1VKNA 2PEYA 3K9LA 1I2BA 2VHEA 3E5MA 5J63A 1PE0A 5JVDA 4KQIA 2V1UA 3PJEA 1NYRA 2IC5A 2O2YA 3F9CA 4S1PA 4Z2YA 1Q0LA 4G67A 4HNAB 4C7BA 4CM8B 1F0PA 4FZ5A 4X91A 4XQ0A 2IDJA 4GP9A 3QJGA 3RYHA 3WIOA 5L53A 5KYNA 1KERA 1WVMA 8ATCA 1BMDA 1XVTA 2RGAA 2VPYA 4NDNE 3JZFA 1FFEA 3DZKA 4TKUB 5D6OA 3SHOA 4YRAA 5L6LB 2V6MA 3AXTA 3OMWA 3I9FA 3FHLA 3T4XA 4ARSA 1ULZA 1SPBS 2KQUA 4IMPA 4F71A 4RAOA 3FCOA 3FNHA 4GD3Q 3CPHA 3DZCA 5CYOA 4DLPA 5KJCA 4FJ0A 4M0EA 1GPAA 3IJEB 2QL9A 2HK6A 4JJZA 4NV0A 4XARA 4MKZA 3LF1A 3SSNA 2M1ZA 4WRRA 4CM7A 1ELOA 3H1FA 4IDFA 2ZSHA 2I0FA 2QRVB 5BV8A 1RM5A 1VXOA 5CH3A 4H0FA 3V46A 3KAJA 3EOAI 3K9GA 2EX1A 3N0VA 3LFHA 3DUWA 1YB4A 1ZGCA 2OHIA 2V65A 4MMZB 4Q9HA 2X0DA 4BIIA 5IVPA 1ZWLA 1D1PA 3LQ1A 4L0QA 3ESQA 3L0CA 4AN4A 1A5BB 4EF5A 2CV1A 4E6PA 1S8NA 2C5EA 3N70A 4NTZA 5FB3A 1JJ7A 2GILA 4OP1A 4E4TA 5B6IA 1RHKA 4IS3A 5JAOA 3HVKA 1PNQA 2ZWOA 4J07A 1J70A 2G07A 1NI5A 2NVWA 1E9RA 2DQSA 2FZGA 3OE7A 4NYIQ 3ZDQA 1R4AA 2WT9A 4DAEA 1JWBB 2E4YA 2QTHA 3SJCA 4TT8A 3MERA 1USUA 1Z6GA 1FNNA 1NUSA 5K8IA 3KEFA 4PLTA 1BQEA 1OAKA 1DZIA 3IJPA 4LPKA 4DLRA 1A9ZA 3CJQA 4JMPA 1OYYA 1P2GA 2XPCA 3A1NA 3FUVA 1ECFA 1B2LA 1CIJA 1VPVA 4PS1A 3U7QA 1C81A 4B82A 4BNKA 3T9EA 1UPFA 2VUTA 4KQ9A 5FDFA 4KV7A 4MRPA 1JFFA 2DWCA 3HH8A 5CD1A 2PANA 3HA2A 4JP8A 4KR6A 1X70A 3KUDA 4PWYA 4MWGA 2DFDA 1GGHA 4I55A 4POAA 3EASA 4RZ3A 3RNLA 5SV2A 1HQYE 1P72A 1QIKA 1NYTA 3UJDA 2GHQA 2FUNB 5J4YA 1L7MA 3HYLA 1KKUA 3ZWXA 2P79A 4Q9AA 2NAPA 2DFKB 5F5XA 3TQOA 1L6IA 2QU7A 1P2TA 3L6BA 3OY7A 5FH9A 1X1TA 2POCA 3EPRA 4L4YA 2I6QA 3W6NA 3PNOA 2BHSA 3UBTA 3OEYA 1O6BA 1RTKA 5K51A 4MIKA 1RWNA 2YQ4A 1IEWA 3JQDA 1A9YA 4GHWA 5TQ2B 2G82A 4JBWA 1N2ZA 3U9SA 4DLVA 1GTL1 4IGKA 4KMOA 4YAOA 3WQRA 1D07A 3C6QA 3L82B 4YREA 5LP6B 3T5TA 4ZDWA 4MVJM 1T0UA 4RH1A 1UQRA 4RDHA 4B2IA 1PLKA 3I42A 3OMXA 2UVPB 2BFFA 4TTVA 3RFCA 2GF2A 2SKDA 3FMOB 4D26A 2KX7A 5FTMA 4MWSA 4LC9A 3PA6A 4LFBB 1DV1A 3O82A 2Z58A 3WNZA 3T9DA 1O97D 4HVTA 3O9ZA 1PT7A 2ZT7A 4IV8A 5ALIA 4ZI3A 4KXMA 3TEMA 2Q5IA 5GVRA 3U4HA 5DHSA 4YT4A 2XT6A 3B8EA 3GJQA 1U81A 3S40A 1B42A 1G55A 2GT1A 2QLBA 3H4TA 3AY0A 1I1QB 1MB3A 1XZCA 2OCBA 3GP5A 4MJ7A 1KEEA 1XU9A 5DYGA 4YMLA 1BXRB 2DR2A 1H2EA 1TM5E 3L7BA 5EWLB 4DLXA 3ODGA 1CZHA 4K26A 4DMLA 1PL0A 4CKEA 3CF0A 2PKYX 3OWXA 3UFXB 3H42B 1UJBA 4UAVA 4BV2A 2P78A 3R5FA 5LM3A 1A4XA 4OKNA 1EAMA 3QNMA 3NC1C 3JTEA 2CYAA 2OCIA 4XXHA 1GOTA 3AR8A 3ZIDA 5ETJA 1KZ6A 3T3GA 4ZZ1A 1E1LA 2H1HA 4UUBA 4BYMA 3JPYA 5CM8B 4EGSA 3F67A 4CV3A 1N5JA 3U3OA 1C0KA 2A94A 4JB3A 3SEFA 5CJPA 2ECKA 1K3UB 1JQ3A 1ILWA 1PCXA 3IQWA 2C2WA 4IOLA 1NSFA 5B53A 3TSWA 2C54A 4QO7A 4TKVA 4LBWA 3RIEA 3H3FA 2DQ4A 2IXBA 3RU3A 2HRCA 3L4BC 4NU5A 4X8OA 5EIAA 4UC0A 3U1BA 1X7WB 2R8BA 1VG9B 3FNQA 4JUCA 4QGBA 4Q66C 3ETDA 5J2UB 4A0QA 4RJKA 2OLJA 1VBKA 1ZR4A 1ZH0A 4ND7A 2VHZA 2QTVB 4V1CB 1DCTA 3JQAD 2P7HA 1NM5A 2E6KA 2VL7A 5L7TA 1E1NA 1EWTA 1NR5A 3AEQA 3PJDA 1Z34A 3DD5A 1QM5A 5CH8A 4F4CA 3UFXA 5CT9A 2QY9A 3SZ3A 4HP8A 1NUAA 3FNIA 4RIGA 1U3GA 1YZTA 3WDMA 1CDOA 4TMYA 3D3KA 3QKSB 1VM6A 5JAPA 5JVDF 1JPVA 3JD1A 5IXJA 2W37A 4AG5A 2IYLD 2YVLA 1UT6A 4CUZA 3OM1A 1N32B 3QVKA 4TRRA 1BVHA 3KD2A 2P9ZA 5HUJA 3NWOA 4BN0A 3EZLA 1XLTC 1Z82A 4QQKA 4NF2A 3PRYA 2DFTA 1ZS9A 3NT5A 1IIBA 1HFWA 1EDOA 1WHSA 1X7WA 1XA3A 2QROA 3PVZA 4J9VA 1GL9B 4L5BA 2HB6A 3PB3A 1OTXA 2R4TA 1JA9A 1CBUA 1LFDB 1AMUA 1ONPA 1QVAA 2HQRA 1ZN9A 1QMPA 2Z4RA 2BGTA 1RT9A 4UM8B 5JDCC 2JIRA 4O25A 1QLJA 3IC5A 3ZCUA 3JVEA 4I4IA 3FTDA 4PYNA 4RAQA 3DXFA 1OIXA 7REQB 3EQ6A 3QLVA 2OHFA 4KXVA 5AXDA 3ZWNA 2BEUA 5AKJA 1EIZA 2XVMA 2CNWD 4UFNA 2VHJA 1EM6A 2JFUA 2QAGC 3DVRX 4FXPA 2FA9A 2F64A 2JGEA 2ZJYA 3O8QA 4R41A 4MI1A 3LP6A 5AHOA 3TD6A 1XKLA 5IDWA 4PX9A 5FUVA 2JNWA 1QO0A 1GPWB 1U7UA 3I01A 3UUWA 1G0NA 1RQNA 2PT9A 3LWZA 1Y9JA 1IEVA 1F8UA 2H63A 3I6ZA 1SO8A 3CNOA 3TOCA 5K0EA 4CVNA 1DJQA 2B9EA 5JRJA 3HLYA 4C6RA 2FFQA 4RADA 1ZIYA 3KHTA 3R9KA 3VR2A 1U1EA 4PPQA 4QHSA 3THOA 4YJ2A 2DH6A 3A9TA 3IBGA 3KB1A 1Q5PA 5JJBA 3KR1A 1OTYA 3MMNA 2WVAA 4TL6A 5AOVA 5K0CA 4NU6A 2FOXA 3GEPA 4LMRA 1R0LA 5EXDA 1YFZA 1WEKA 2ZANA 1UP6A 2GQ0A 1XRPA 2RARA 4YPOA 2ZI4A 5CIWA 2IP4A 1QG2A 2OYRA 4I55F 5FUBA 1Y0BA 4AIRA 2Q0SA 1I4TD 5T6MA 1KNQA 3D59A 1Z0FA 4A10A 1BX1A 1GAWA 1N3BA 5E3IA 5EKSA 4ZXFA 3CO0S 3LXUX 3RUIA 2WQ7A 2F9MA 3EF3A 3EVCA 4HG2A 5TX7A 1OE0A 1S3GA 2VDPB 3GBSA 4HRYA 4HQ6A 4Z5XA 3D9QX 3VR6A 3ZLVA 1GZ4A 1UK9A 2HIHA 3A4IA 1MJGA 3V1TC 5E9JA 3I6QA 1RE0A 3DZIA 3RS4A 4DSOA 4LGVA 1OAOA 4G0PA 3M6FA 1ZRNA 3E61A 3GQVA 5TC4A 4ERNA 3RVSA 2OBBA 4YT8A 3PHBE 3V34A 2PIAA 2FP3A 3NBZC 2CT8A 1Y1LA 1ADGA 1GZDA 1SKYE 1Q7TA 2AFIE 2EQBA 2LDBA 2Q3JA 1K4KA 5FUWA 2VK4A 4EKYA 3T9AA 5AW2A 1ANKA 4BV3A 3LUAA 4XKJA 3FXAA 5IJ0B 3OJFA 4KWIA 4JEHA 1B73A 1KBOA 1DJNA 2F6RA 4XJSA 2FJ0A 3A25A 1CY2A 4R68A 1UPBA 1R5BA 3MTIA 4R71A 3C6KA 3CSSA 3B89A 5DSTA 1T5BA 3ETLA 1GZ6A 4YJFB 2PUBA 3OLVA 1Q2UA 1KQNA 2H3HA 1COWA 3DNMA 3HPQA 3N2GA 2PM8A 3FTFA 2NN3C 4EVQA 1I80A 1IM5A 3E81A 3DVSX 1EWKA 2P8JA 3OT5A 3WLTA 1BCSA 4J8PA 3EDQA 3MT0A 4B2PA 4DUPA 3KPVA 1E6WA 4AY3A 4JCOA 5KQLA 3ZWVA 5EZYA 2IYQA 1VI2A 3K8ZA 3WOHA 1KJJA 4IOKA 4TLEA 4ZVOA 4MIYA 4GMGA 3TTWA 3T7EA 4YLYA 2ZBFA 2PRKA 5CCBA 1E2GA 3M82A 1JEQA 1YE5A 4URWR 3UV3A 2IXDA 2YFHA 5JAIA 1H8EA 1SPXA 3PRJA 5KYWA 5LP6F 4PZDA 3IE1A 4QZVA 3KWMA 4YWJA 4B5KA 1MJNA 3O0DA 3EMBA 4RJ2A 5JZSA 1O94A 3KKMA 2ZE5A 5F7XA 1I9GA 3T52A 3JQGA 4GYWA 4MV0A 2CLIB 2OXTA 2ILVA 5AM0A 1WDWB 2R8RA 3KZXA 1XVIA 3KCQA 2JIZD 1QCYA 2QTFA 1RZVA 1EJ0A 3HHPA 4PLHA 4W9RA 2ZOSA 4U63A 1VG8A 1ZLYA 1LI4A 2MR5A 3E9CA 5A3JA 1KXJA 3PC2A 4PR3A 4RM3A 2H6EA 4ENTA 3OQHA 1F8GA 1UM9B 4MLDA 1XVVA 3IQXA 1XT6A 2A0WA 3CE9A 2IEBA 1D04A 4QUAA 1BFKA 4CU5A 5JI2E 4FGJA 5C5CA 1GVHA 4G6ZA 3HGQA 4ODIA 3RBXA 5IJ9B 2AZMA 4ZQGA 1WE2A 2YL2A 3RS0A 4X3CA 2X76A 4IKPA 4Q1EA 5DYWA 3IBCA 4LSMA 4F4HA 1P5HA 1AKRA 1PYGA 1RRKA 4CV2A 3V1LA 4BMDA 2RH9B 2IOFA 3PXXA 4DSUA 1G2OA 4MPRA 2H00A 4GSKA 4AKEA 3ASYA 4C6HA 5EXEA 5HCNA 2NO9A 3D4OA 1MR3F 3HG7A 4CIAA 3K6SA 1I36A 4X45A 2VHYA 2GCOB 2WNSA 1TT5A 4IIJB 4LYJA 4Q3KA 3FYUA 3R7WA 1QLWA 5KTOA 2HN9A 4YCSA 4H6VA 3UXHA 3W5JA 3DVQX 2I33A 4M1QA 1KH1A 4HOYA 2GF9A 2JL1A 3AUXA 3OEHA 1KE2A 1FMJA 1H1LB 1P17A 3NZEA 1RRGA 1NBMD 3E8SA 4NOLA 3GPLA 3EY4A 1KI2A 3MJSA 3A6JA 4AVYA 1EUYA 2X77A 4BFYA 4TMTA 3ICCA 1RYHA 2OV2A 2I22A 5FBKA 1V16A 4U2KA 1KMHA 3U6KA 2OB1A 2FI1A 1J39A 1J8YF 4I5DA 4IG9A 3WJAA 3ZTYA 3KJQA 1HL3A 3OE7D 2NO5A 1TCCA 4Y9UA 5HE8A 4RLHA 2B9VA 3O8RA 2VXBA 5JZVA 4ATNA 1XXLA 2LGJA 2MSEB 3V7FA 5L3SB 2I9PA 4QUBA 1U1FA 1Y3BE 2FW7A 4GXRA 5AQEA 1GGMA 2D1RA 2OLEA 1L7EA 1M74A 3EHDA 5DJ5A 5EQJB 1TK3A 4CV1A 5FTNA 3Q1KA 3X2FA 1E1CB 4TL9A 1KYIA 4BX8A 3IB3A 3EQ2A 1OWLA 4PR0A 4X7RA 1TTPB 1X80A 2OO7A 1ZXLA 3QEBZ 1JDSA 3GIWA 3TYXA 1A4UA 2H65A 2HK9A 1M0TA 2ZJZA 3GJTA 3DUFB 4JT8A 5T4EA 2AVNA 4B34A 2W2KB 3H6GA 5I7UA 5JY6A 5GJWC 1JH8A 5DIZA 4PO9A 5AVYA 3ELUA 1D2EA 2WKRA 2CZCA 4ZZ3A 2BRUC 3EXHA 2HJ9A 4EPRA 1GL6A 3DG9A 3P9NA 3HUEA 4YJ2F 2C4NA 4EJ0A 5KVAA 3JR7A 3U60B 3GN1A 4H7JA 5JT1A 1PV4A 3DZGA 5KWSA 2VJNA 2C8LA 5CPBA 3FWPA 3F78A 2PZJA 1G8MA 3ZVNA 5K99A 4HTAA 3GLIB 3QW2A 1DQNA 4R40A 1R6DA 1E9FA 3W4KA 5JEEA 1EVIA 2FLKA 2IPOA 4L8YA 3MMSA 1Z35A 2B25A 1XN1A 3GDOA 3N2KA 3BXOA 4XWYA 3W8DA 1KNXA 3QOXA 4Z2AA 2FPOA 1IY0A 3FUUA 5KQGA 2QT1A 4XSGA 2H57A 1U2PA 1QP8A 2HLDA 1ZC4A 3O8LA 4K3VA 3EXFB 4QLAA 3ZXIA 4EBBA 3R5HA 1KP2A 1Z2OX 2IPXA 1II8A 2MJLA 4QDJA 2YWEA 1G9SA 5B1HA 3NC0C 2UYCA 4DGQA 1Q0PA 4UNSA 1K9SA 2ONJA 3TIIA 1NR7A 3AJ8A 1TD1A 4FYIA 4W8GA 5CVDA 2BKLA 2ZR0A 3ZHUA 1Z4JA 1H9AA 3BF8A 3JD0A 3FTNA 2JGJA 4QUKA 4YMSA 1QAQA 5E38A 2C1XA 4UCFA 3RC3A 5K03A 2RHMA 3DL7A 3JZDA 1ZD5A 5FFNA 2H29A 4Q1AA 3LY8A 5LZ5A 3SHWA 5JJCA 3K70C 4F1KA 1A98A 4AN1A 1JHOA 1ZEJA 2YNMC 3GJZA 3BXZA 3BA6A 2IYXA 1S3IA 1JTFA 3U09A 5EKDA 1ZGAA 3KVOA 4KTVE 2JHFA 4PHGA 4DQXA 4XJVA 5DCYA 5AO9A 2ZU0C 5ADHA 2NXJA 2ZSJA 1ZJ5A 1E0KA 1VMDA 1XP8A 3CRMA 3HS3A 4FVTA 4OVKA 2AKYA 1NBME 1P45A 3C48A 5DYNA 3VKWA 5A3RA 1L8OA 2HF9A 1RC1A 2JH9A 3BEDA 5DYTA 4EA9A 3G5AA 4MAMA 4YR7A 1UEXC 5BWOA 4NG4A 2W6IA 3KNZA 4B17A 4RQUA 4UU0A 1X6VA 3JZAA 1UBHS 3LLCA 4F5WA 1SXJA 1ARZA 1FL9A 5EZYF 3O21A 1RKBA 2F3SA 4M1EA 4NCKA 3QFCA 1D9XA 3EXIB 3D7NA 4OP2A 4HAYA 3WO0A 1V7ZA 1KIAA 3HYRA 2FDCA 1MG5A 5DGIA 4LE0A 1A5SB 1T0IA 2XTMA 3DP7A 4RESA 2PX0A 1HFEL 1MV8A 4TS9A 2DUUA 3UK2A 3ZHZA 1F3OA 4CKWB 2F3PA 4F96A 2HMUA 1HRKA 2VP4A 3L0OA 1V5GA 3MTAA 4ZGWA 1M2OA 5J9FA 2C4WA 2WNHA 2Q1TA 3JQPA 4W82A 4C4TA 2QLMA 4GLJA 1XDGA 4WUTA 3O7MA 2RHOA 2CDNA 4HGNA 3ZH9B 2E5LB 2PKCA 4GYJA 2D1SA 4F5EA 4QT4A 2VLBA 3W8NA 1SGWA 16PKA 1CUXA 1U0JA 3DDNA 3EWIA 3G0BA 3OLQA 1E99A 4OXQA 2RCYA 3E35A 1U28C 2C3MA 1TLTA 1E3TA 3SX2A 5FOQA 2XTNA 5EAIA 2Y68A 1J33A 2JLCA 3TTSA 3NAZA 5DNVA 1FU7A 4O4IA 4CM3A 1V3QE 4IIYA 4I4CA 4WASA 3AEKA 4N0QA 1JE0A 3EVAA 5GONB 4KQWA 3DWGA 5TGTA 2WWVD 5C8ZA 1ORRA 5HM8A 2AMVA 1Y6ZA 5D3MB 9GPBA 1SOAA 3L1HA 1A9RA 2CLDX 4XM1A 4ND6A 3ZZMA 1SH7A 3KSDO 3AVYA 1T3TA 5AI8A 3AVTA 5BP7A 2EJCA 1FJGB 3ZHCA 5DLDA 1XC7A 3ECAA 2I03A 4U2CA 1TTTA 5LQNA 3M1YA 5J59A 3PGVA 2HCTA 1XEXA 4PBRA 2GDZA 2OTCA 2FG6C 3O4JA 4ND8B 4JQOA 4NULA 1Z0IA 1SG0A 3KELA 5EMHA 3E5HA 1KWGA 2QM3A 1QR2A 1S2IA 1ZGGA 3I64A 3GX1A 3OICA 3RG2A 4KEAA 2NZ2A 3OZFA 1W96A 5EZ5A 2AGVA 1JFTA 3UTDA 3P9YA 2XECA 4C04A 4H7DA 4OX9Y 3CKLA 3ILXA 3ER9A 2G09A 4TUYB 3PFKA 3LQQA 3QKRA 2ATIA 4V0RA 1R9NA 4IQ4A 3S1AA 1DOHA 1QO0D 3DYVA 1QCZA 3F5MA 2IYNA 3FUXA 3M3DA 1CY4A 4P86A 1B8UA 5BNIA 2P2CA 4OYLA 4HMQA 3T7KA 3CXUA 2ZATA 3IAAA 3QLJA 2PYZA 3ERCA 4II7A 1YKFA 1BS2A 2E3JA 3VR2D 2VI5A 1U7OA 4C5BA 3I1IA 3FRIA 4IQGA 1J99A 1FYDA 4PZAA 2BBOA 2HBRA 3BHIA 1XRLA 4WKPA 4BVHA 1O5TA 1X15A 4IYRA 1W5FA 3F2IA 3IAM1 4RY8A 4Y6QA 4BZPA 1EP2B 3A2NA 4DQ0A 3NKLA 4EYSA 1PLLA 3FX2A 4FHFA 5B12A 3DLBA 1OX6A 2FJPA 3F6SA 1FFBA 1JPUA 2IEGA 3O93A 5BWLA 2X9LA 4NE9A 2FF5A 1BJTA 3OA0A 5IBRA 3EGDA 4ZZIA 3HKCB 3CRVA 3SICE 4X66B 3B2EA 1IN5A 2N1BA 3H1AA 3M2TA 1VBNA 2XHZA 4Y2TA 3ZOZA 3WGQA 4L76A 5HPYB 3OEWA 1A7JA 3IEKA 1ZN2A 2QR3A 2X23A 3GF4A 3HP7A 4WXHA 5H9VA 3MTDA 3VR6D 1KI6B 1TU0A 4ENVA 4FD3A 2A67A 2CXTA 2EF0A 3O7WA 2XMQA 3OMLA 3P0IA 4M1WA 5E8JA 3BFKA 1P80A 5JBNA 1L5SA 5KYYA 1K4YA 1YWGO 1QP0A 1H69A 1E4YA 1TVEA 2I6TA 1XTRA 1Z83A 2DY0A 4MGIR 2R0QC 1YDEA 1JILA 1YA4A 5EYPA 2AQHA 3T3NA 5IT4A 2ECFA 4D9JA 3OZXA 3EBLA 2JFZA 5G1OA 2C20A 1TAUA 2XYPA 4W5QA 3NM4A 1MD9A 2C3OA 2YV1A 1QIJA 3GH1A 5IAGA 2IVZA 1N5DA 3DAPA 4ALMA 5C1DA 3H05A 4XDGA 1JTEA 4N5NA 4TKMA 4QVIA 2EQAA 3ANMA 3D5TA 1PRYA 4AULA 4L51A 4NCHA 3MT7A 3W9YA 4KREA 3GRFA 1B76A 2WSLA 1ISPA 4URFA 1POXA 1TVKB 3R5TA 4AJEA 2WSSD 4BLRA 1TX4B 1UFOA 4B4WA 2DERA 2YJZA 1SK9A 3E3LA 4FFBA 5M3BA 2D8MA 3VBCA 1N2OA 2H4WA 3KB6A 2QGNA 1CS0B 4MV4A 4TL7A 2HHCA 1CS4C 1D5CA 2B69A 3K8YA 4G1EB 4K2AA 3DT6A 4MV7A 1G5TA 4D9FA 4U7DA 8ADHA 1HE8B 1GL7A 4EEXA 1NE7A 4ZCSA 1YUBA 1Z6ZA 2HU8A 1UOQA 4RFLA 1VDMA 3SDSA 1Z7GA 2IZ7A 2GTIA 3DMPA 4BE9A 3BN3A 5L40A 3DO5A 1EI9A 3FJYA 3DCIA 3WGHA 3PJRA 3D7MA 4KW7A 4DMUB 3RT9A 1PJ3A 3QHAA 1O94D 4WNIA 2W8BA 1Q1GA 3ER8A 2FPRA 3JS5A 1WLSA 4JOQA 5K4HA 2QTZA 1FBTA 2V8BA 3NI2A 5IAJA 4P5PA 4QT0A 3EZYA 3IHKA 1BMFA 3U7IA 4GG1A 1U94A 2JIBA 3CPJB 4WLNA 2PHZA 3WLSA 3MWGA 2HREA 3SN6A 4IH1A 1H4VB 4ALIA 2ZPTX 2J3KA 3DMFA 1J2UA 2A5DA 2O3TA 4KAJA 4YPVA 5AI5A 3OJ0A 4IVQA 4DCUA 4E1AA 2V4UA 5EP2A 2AUMA 1D6SA 5AVKA 5GQSA 3T4UA 1CDZA 1DIOB 3MUEA 3CUSA 1BU8A 3TQIA 1DKMA 4G5YA 2BP7B 4HLDA 5C2JB 4EKDA 3U31A 4QSHA 4LDAA 3KG2A 2XB8A 4LYDA 4D42A 4KE7A 4DV2B 2C04A 1L7DA 3ZLBA 4B7ZA 4DMGA 4PSDA 1FOEB 2MSNA 3OTWA 4LN1A 4TRNA 3T7RA 5DNCA 2ZCJA 1T10A 2PGOA 3I39X 3KBOA 5DASA 3S7ZA 4DIOA 5HZHA 4KIWA 5HP4A 3CLTC 2QJRA 1MB0A 3DAFA 5CXSA 2P6UA 3MTEA 4HLUA 4MYRA 4QPPA 3H8WA 4K9RA 1AUPA 1P7VA 4CTOA 1TW2A 2FN8A 1R1DA 4O4IF 5HE9A 2Z09A 2W70A 1KDZA 2HBQA 4S0ZA 1U6JA 2C9DA 3TG2A 4KRYA 4QDZA 5D5QA 3VO9A 3BC1A 4FCWA 4UXHA 4CPDA 1BDJA 3A32A 1WVIA 1PJSA 4YNBA 5E7IA 1RVV1 3M6UA 1E2MA 1VL5A 2YFYA 3K0SA 1YVPA 2IX3A 1NWCA 3S55A 5L45A 1XZQA 1E7MA 3CW9A 3DEKA 2P90A 2J3LA 3E9YA 1BCRB 2ZYVX 3SYRA 1GZ3A 3JD3A 4TM7A 1W87A 5DGDA 1DIAA 3TSYA 4IRMA 1QK5A 4KR2A 3ZGOA 3P9SA 1VP3A 5C4MA 4I9HA 5BY2A 4QAQA 4F91B 3R3UA 1JMVA 1YZNA 3IUMA 4NOJA 5C3UA 1KAEA 2R5WA 3OTIA 3LDAA 5E1BA 3GIDA 4GI2A 1NSTA 4TWZA 3RABA 2VQEB 1XMOB 4MVWA 1KF0A 3GMDA 5D86A 1XQXA 3TF5A 2XIQA 3HV0A 4YK7A 1KDYA 5CPFA 3STYA 1XLUA 3UV7A 3C7DB 1OFUA 4IXWA 1ZHOA 1U02A 3C5VA 4JUDX 4EYKA 1AC5A 1UKAA 1L4HA 1SU8A 4UPDA 3IAXA 1Z37A 1PWYE 1K97A 1Z4NA 2JH8A 1KDTA 3ORYA 4JLKA 4R3WA 5EZ6B 3SBEA 1OXKB 4EEZA 5HS4A 4ZZ0A 1GQSA 2ORIA 2RJNA 5L3ZA 1B23P 3JAWB 1MO6A 2ILTA 1U4OA 4AZWA 1ZL2A 2EKZA 4N40A 4Z0HO 4CTNA 5AFSA 4WY5A 4OI0A 1FS5A 4JP1A 5CA1A 2O5VA 3EPPA 1K5HA 5LZ8A 4A16A 4I14A 2RHHA 3HZZA 2TMGA 4ND4A 1QP4A 2J32A 4KDRA 2XI4A 4QAJA 4GWLA 4ZCPA 3RG8A 5E7MA 1SURA 1UWLA 1LQUA 2HZ7A 3R5SA 1H22A 3PWTA 3OZCA 3ZV5A 2NT3A 4XOIA 3V1KA 3WXMA 1PWZA 3VI4B 4HQFA 1UXIA 2WNIA 4MV3A 2ZS9A 5HHTA 3UGTA 1CZUA 5CEFA 5A4AA 1YRQA 4Q7LA 5A3VA 1OFHA 1ENOA 3AM3A 4EB3A 1B4DA 1DTWA 4JU9A 4XDYA 3V32A 4Z1OA 5LJLA 1PVDA 4OQ4A 2X2EA 3UHJA 5FUYA 1ZESA 1JIVA 3RFUA 1KXZA 4WBNB 1B8OA 3NYIA 2Z6UA 3URKA 3L8CA 4DSNA 4UTNA 4YRKA 2FJUA 1GCIA 1QH8A 3VZRA 3O38A 1OI3A 4E2FA 3UJ8A 1LW6E 1X7YB 2IXTA 5JZ9A 5FADA 5A5VA 1M0WA 3TTYA 2EEZA 1QZ3A 2MYPA 4P98A 2DHQA 3WIBA 3I72A 4ZTUB 4QREA 4EYQA 1U6KA 1IJBA 2HRDA 1JIKA 2FX5A 3NHSA 3TSZA 1VIMA 2BKXA 4Y0NA 4B3CA 1D1SA 4NYJQ 3AERB 3LUDA 1EVQA 1P19A 2JZOA 2MSLA 2B5WA 3LQKA 1OV4A 3JYLA 5BYKA 1KYVA 1XJ0A 3OPMA 3LIIA 3IOMA 4BY9E 1C8LA 3UH1A 4S2EA 4M8NE 1TRKA 2CFCA 2EJVA 2ZT8A 1TJPB 2G28A 3GGSA 3LHFA 2W4IA 3AGPA 4ZQIA 3PZRA 3CIFA 4B7CA 5ENZA 3F2VA 2CCJA 1GZVA 2ZIGA 4OJKA 4RH0A 5G41A 4CGZA 3TRKA 2QW8A 1R27A 3DEYX 2REOA 4PW0A 2X1HA 2DUNA 4F45A 5DM70 3LH5A 5JBQA 2QKYA 4AS2A 1RZUA 1EK1A 1OX5A 1N5RA 1UJMA 1UPCA 1IBRA 3BGWA 1QVVA 1WQ3A 3W4JA 4A2PA 3NT2A 3SEAA 1T43A 1Z8FA 4Z4QA 3GPDG 1DWUA 1SXJD 1R9MA 2GD6A 2AA3A 1LBIA 1NMZA 1DELA 2P9JA 1VIVA 4INOA 4OBWA 4RJIA 4A9AA 4DKXA 2VBCA 3IL2A 1H0SA 1NW7A 1BRTA 4S1TA 2Q3DA 2YZGA 3C14C 2EBHX 2PGLA 2QW0X 2NLOA 4ECAA 3MCZA 4C2TA 1EA5A 2C3UA 3GT7A 3NBXX 4H08A 4G97A 4YCJA 4MW4A 2FX3A 4BTEA 3HB4X 1GKKA 2FXVA 2I7DA 1PZNA 3PUXA 1MC4A 4X63A 4A8PA 2O5EA 2QSYA 4RVNA 4BEWA 2WTMA 3IKVA 1LI5A 221PA 1XMXA 3UMMA 3P0JA 2UUCB 1IBMB 1AGYA 1E1KA 3QPDA 1IVNA 3AZQA 4ENWA 4A15A 5HNKA 2QUIA 2G5TA 1X87A 1ETUA 1NHGA 2NV6A 4CKBA 1JTVA 4LXHA 3QPBA 5AUQA 5SZJA 1KQOA 1ZOSA 4B3HA 2Z98A 2XOXA 4PGHA 3ZE6A 4XIGS 1G1AA 2J9FB 1VCOA 2J7PA 4BKUA 2W83A 1M3SA 4FDUA 1TIPA 4ZTBA 1L7QA 4K1LA 1YMQA 3H87A 1QNFA 1ORTA 1W2WB 4MKFA 3R9IA 3JYNA 4XYMA 1SULA 3V6MA 1JHXA 1QWSA 2IYOA 3GOQA 3GXOA 1WQ1R 2BCJQ 3FRHA 3TAUA 1R9JA 4NHEA 2DUWA 3PITA 4P3XA 3T94A 3HDQA 4RD6A 4X1KA 5JDIA 2H2GA 1P3Y1 4II3A 4MLPA 4YUXA 3VPDA 1JR3D 4XR9A 1VHWA 4BBAA 1Y33E 2P9QA 4LY3A 1ZUD1 3SJ7A 3T0IA 3GCDA 1CYEA 4DV5B 4NJEB 2CCGA 2PMWB 4JC8A 3KT8A 3Q9NA 4WEQA 1FUEA 1L3IA 2FMFA 1J0EA 2EEPA 4JYBA 5FTWA 5LYYA 5A2QA 2ZW9A 2ODQA 2WUFA 1SUWA 2FW9A 1GG5A 1NONA 1W4RA 4M1MA 2IJGX 3SIRA 2HUNA 1FPQA 2GR9A 3LVFO 1Y4DE 3G3EA 3MNFA 4GYYA 4UQOA 1NA5A 3BUSA 3MS2A 4CIYA 1XZGA 2ZS8A 4I5EA 4FMCF 3WMFA 1GN8A 1Q11A 4N5HX 3TIXB 2W2LA 2BFPA 2OOKA 3GLTA 4QODA 4I5IA 4L7VA 5LD2C 1YQTA 5DMXA 4EQ6A 2JGNA 3FSRA 3LD9A 4WAUA 2AW3A 3P9ZA 4FFLA 1MA3A 2HJRA 1GZHB 2V9PA 2VF5X 4M4SA 4ZI5A 5IANA 3LY5A 1Z38A 5ALNA 2QTTA 2A35A 5IFKA 3C39A 2Y3IA 3GGGA 3HV2A 1X2BA 4IFTA 3EEIA 2E18A 1BD3A 2FUG6 3RVKA 2V8OA 1MHTA 4Q4AB 4LYHA 4C7VA 2CXSA 1JEEA 4P3NA 3KDAA 4HTFA 4RELA 1KS9A 5G1NA 2OBYA 4IUDS 1CV2A 1OYWA 1OZ0A 3PHCA 4YFYA 3S3TA 3ZWDA 1A04A 4ALKA 4EFDA 3WMXA 3JWJA 1SXJE 4LX8A 5EMLA 4COKA 4ZMRA 3H5TA 5JATA 1E2NA 3RS9A 5CA1F 5KNBA 2PR2A 1GPMA 2WIDA 1L3CA 3LUHA 1K3FA 4QA9A 3WWDA 4ZJYA 3LTEA 1QQ6A 3GT4A 4KFTA 4MJ3A 1DOAA 1Z5OA 5BVHB 3BE8A 4RMHA 1UMCB 4O6VA 1KYTA 3QVOA 1FY2A 3LX4A 2GWRA 3A3PA 3I8OA 3N86A 4HPXB 2A9OA 5CUQA 5G4LA 2W2OA 3H11B 3MYRA 4FHDA 5DHPA 5C5DA 3BL6A 2BGIA 1BHJA 1JYSA 3KLMX 2CKDA 2A1UA 3HXLA 3TQCA 4C7OB 2XBUA 4H7PA 1IYZA 4WX2B 1Q92A 4YQEA 4B46A 2QQ0A 3VU0A 3G5MA 3W8EA 4BJ1A 2Z8XA 2LPMA 4ZYWA 1CQJB 3DE2X 1LLCA 3F9RA 2ID7A 1F0NA 2XZPA 4YP5A 2VNKA 3SQOA 2RGCA 3ZYCA 1V7CA 3WFZA 4AYWA 4GSYA 4UOZA 5MN6A 3LX5A 3MAAC 3W5SA 1Q0TA 2RHCA 1CQZA 3C97A 1N77A 4MEAA 1C3LA 3UY4A 1B6GA 7MHTA 1TM3E 1MQ8B 3TBFA 3NBYC 5DX1A 3EOBI 4AFNA 1KY4A 4WCFA 3STVA 2L2QA 1X13A 3QUAA 2FOIA 3GNSA 4KXUA 4Q1CA 4PWZA 2PRZA 3TFQA 1JR3E 4CF6A 4ZOCA 1GRCA 2XMBA 1GZUA 2J48A 1G59A 6REQA 4J76A 2QTMA 2CMDA 5BSRA 4JHXA 1ODLA 2DLDA 2AE2A 2X8JA 3G2QA 4MPTA 4G81A 1J5EB 2GFHA 1ONBA 1Y37A 4WNCA 5ILQA 2NU8B 1ML4A 3U37A 1PS0A 4TYPA 4MRNA 4Q4JA 2NG1A 4WLOA 4QTZA 3IRUA 2LKDA 2UUBB 1GAEO 2C9MA 2EL7A 4D9NA 4C6TB 4WBNF 4IZ6A 1DX4A 4J0CA 5FOTA 1A97A 1TZBA 4BAUA 1SG6A 4NP6A 2ZJ6A 2JS7A 2WB4A 4IFEA 2IE0A 2PUVA 5L95A 3H1TA 1ZK2A 5FAXA 4CG2A 2YCBA 4JOBA 3NRJA 4IQ0A 3T3MB 3V2HA 3WYAA 4ZU6X 4D57A 5LYJF 3K2EA 4KR7A 4WK0B 1U99A 3SE0A 1XF1A 3DOOA 1JV2B 1CW2B 5KX5B 3Q6NA 1U0TA 3NHAA 4Q6BA 4U0KA 3QJ5A 2KWIA 1GUFA 4OX9B 2C2XA 2QTNA 3GUUA 4KLNA 4QWWA 3K5IA 3PQ6A 3RVPA 4E30A 1W0JA 1S2DA 4INAA 4KQKA 1FXSA 4DYHA 2NZWA 4H35A 2PAFA 4KWEA 1VCNA 4Y30A 2FPPA 4D74A 1BWPA 2R2GA 1F4VA 5HZMA 4Y2JA 1G7CA 1RI1A 3NWJA 4G36A 1J2RA 3VPCA 5COQA 3WLEA 2DZDA 2DXIA 1HV8A 3K0CA 1YQUA 4TWJA 5KEIA 3SXPA 4YCBA 4Z99A 2GK6A 3QE0A 2WWFA 4WWHA 1IBCA 4WGFA 1A9XB 3QIAA 2VDQB 4RTQA 4I6JA 1E60A 4BE4A 2QTRA 2C4VA 4LJKA 5AW9A 1ZCBA 3H4IA 4FSXA 5BQPA 5JSQA 3HB5X 3RTDA 3F5SA 2JJMA 2FOLA 2VS1A 5KX5A 7ABPA 5C7YA 2I62A 5GOZA 4HEA6 2Q2NA 2LCIA 5FJIA 4DL9A 3V4SA 3KAKA 1JKFA 3SDBA 4HH0A 3C8DA 4CMIA 5EE3A 1OYOA 4NCNA 2HAEA 2WIKA 4WHMA 1KO7A 2P2GA 4GX2A 3THSA 2PKQP 2QTAA 3PZBA 3QWFA 1UZMA 3UMJA 4A8JB 3V9PA 4F1JA 3S81A 3PEVA 1DSSG 1GTMA 2JZCA 3I2IA 1GNTA 3FVTA 4WXPA 3TZHA 3NVKI 5HZKA 2XADA 4PRYA 1USVA 3WK6A 1E5TA 1PI3A 3TR6A 4EZIA 1CUJA 1M5RA 2NNLD 3KFLA 4C7JA 1YS4A 2FFRA 2Y1CA 3N1UA 3A3NA 2VYQA 3LLVA 3QFTA 2P6NA 4XB2A 1O6ZA 5YASA 4WTOA 4I6EA 1IBKB 5FA6A 4OGKA 3WWOA 3NOXA 3Q87B 1GR1A 1SC4A 1CETA 3DGFC 3OCXA 5AKIA 3OU6A 3ACCA 4J0GA 1VA5A 1A69A 3PQ8A 2CL6X 2OC4A 4W63A 1EK5A 1SRRA 2EIHA 2CFSA 3F49S 5AOCA 4CI9A 4HNUA 5BSKA 3SIWA 4JBYA 5GZ3A 2DH5A 4C1NA 3B6JA 3IQZA 1KORA 5K05A 1C30A 4IDAA 1E3JA 3WTBA 4MIEA 2OM2A 4O2BB 2DTXA 2VDWA 4YRDA 5EKUA 5LBUA 1N2JA 1RRFA 3FHJA 4PZLA 5F76A 4Q9KA 1I4WA 1JVNA 2CD7A 4E03A 1KRWA 3PE6A 1I13A 4P8RA 1NASA 3O3OB 4I99A 3JQ9C 2ACEA 1H5UA 4LSWA 4I9FA 2IGBA 4NI5A 4EGAA 3X3HA 2DSNA 2XB2A 3ISJA 1ONNA 1BXGA 1FP4B 1RS0A 1UIRA 3BTVA 4A7PA 1US8A 2XUQA 4HAUA 4NZZA 4JV5B 3F7TA 1X1RA 3KB8A 4BWGA 4DLSA 2X1MA 2D7CA 2ZDQA 2X13A 2O8DA 4D4LA 1EFAA 1Y9DA 4M6WB 2JGKA 4LXIA 4GVPA 4KJZA 5CVCA 4C0SA 1M6EX 4RFSB 4HV4A 1IHDA 3GRPA 1CUEA 2PH3A 1WR8A 2QJTA 2CE7A 3AFNA 3N6XA 1EE1A 3MJEA 1WIWA 4KKXB 4KPFC 1NUPA 4KB5A 2QI9C 2JCBA 2DQYA 3B6MA 2YJ4A 5AKZA 1CZOA 3PS9A 5KTTA 2PRYA 4TMXA 1M1NA 3EGWA 1TAGA 3LA6A 4AM8A 4ZN6A 2C2GA 1CJCA 1PJ4A 1WBJB 1Z6YA 3AEUB 3LOPA 1U7TA 1YR1A 1NYLA 2J67A 3NJ4A 5FNZA 1QG0A 8AT1A 3KVVA 3JALB 4PLYA 4TXHA 3DBLB 2O8VA 5DNYB 4U7JA 4G0VA 2EHDA 1D8TA 1LLUA 2V7VA 4QXMA 5FRDA 2J07A 4MS1A 3Q7TA 1PWXA 3PNPA 3EUEA 4Q01A 5A4JA 4GPIB 5CTAA 4NQZA 1MH1A 1W36B 1JEJA 1CD5A 3T3IA 2FR8A 4MA0A 2Q5HA 4Y2GA 3SJZA 2ZQZA 3D0RA 1G42A 1O95A 5IEJA 1CF9A 3ZKWA 5KWEA 1QYDA 4K9MA 3WHIA 3D02A 3HFGA 2V4MA 2E7ZA 1TKBA 2BT4A 1Y7LA 5IKEA 2XITA 3OQJA 4M9UA 3CGWA 4ZVMA 4DLAA 1U90A 2IOQA 5AKLA 2XJ9A 4BCBA 4R6WA 4XSHA 2Q6OA 4BAZA 3EDOA 2WYIA 3WBBA 5BT9A 1KFEB 3Q0TA 4ZODA 4F3NA 2FEMA 3RC2A 5T3UA 4LWQA 1D6JA 5HA5A 3RRYA 3U3XA 1QBKC 4RNCA 1JYFA 4WKGA 3WLLA 1Z15A 3AKZA 1RYYA 4XIJA 2OECA 3D2AA 3LRTA 4TXJA 3CNQS 1QF6A 1TO1E 3EBPA 2C4KA 4JU8A 4JXXA 2QZ9A 4C43A 3OKAA 1EVYA 2OY0A 1E6CA 5FBHA 3DHEA 3TPZA 1UJNA 3O9VA 4D41A 2OGWA 2X2OA 4EUKA 5HUHA 3ND9A 1T1GA 3NONA 1CDDA 4O08A 2J7PD 4WOKA 1QZXA 1M8KA 4M9ZA 4TQ9A 5JR3A 5F5NA 2IT1A 2YBDA 3PU6A 3AKEA 4H27A 4WVLA 4IWYA 4B8ZA 5JYDA 2V6IA 3D5QA 5I6DA 5IASA 2OO5C 3ECSA 5BRNA 5T5QA 4LW8A 1JR2A 4N18A 3IQIX 5DHFA 4JR2A 2UXCB 4HDAA 3QG1A 2C5LA 2HDNB 1BNCA 4L5AA 3M1IA 3QMWA 1SIOA 2DM6A 2I4TA 3PXGA 3M4JA 3W1WA 4RIHA 4LV8B 3KQYA 3VTFA 4HFMA 2I2BA 3GJXC 4S1VA 1RU3A 1WO8A 3RIMA 2EJWA 4UBLA 3F1KA 3ONFA 1DX9A 3A6PC 1NTRA 1J9GA 1FTQA 3GRAA 3N2EA 3BCRA 3WTCA 4ZAXA 3CONA 3QNUA 4UBKA 4XWKA 3QELA 1JA0A 4W6QA 2GPTA 1PR5A 1SOVA 4RULA 3GLGB 3PIDA 2CVZA 3BZBA 3H4MA 1JLRA 5KX5F 2G1PA 1UL1X 1JHDA 3ORSA 4HCJA 4EY3A 2ZTHA 3ONNA 1X39A 3CZ5A 4ZDKA 4I3HA 3PXUA 4IPTA 1OH7A 2ZZMA 3JX9A 4E6EA 3MWDA 1IY2A 1QGZA 1EM8A 1FMCA 3H9BA 4I1IA 1JVSA 2HPZA 1ABEA 1KS2A 3LBHA 1WV1A 1IVYA 1YJXA 3IHTA 4HLNA 4OL9A 1GTRA 2QXTA 1AGXA 4TZ0A 2PBLA 1M72A 5FWYB 1TO6A 4R9NA 3AF4A 4C06A 2W22A 4WESA 5FBWB 5C31A 4BGUA 2NW6A 2HUPA 4FEGA 3TLZA 2JAPA 1YSCA 2D0IA 3SNHA 4PLCA 2IIPA 1YZLA 1DCFA 3CJRA 2RIRA 4NEGA 1K8QA 3R40A 2P67A 1IQPA 2PZLA 4PFQA 4RSHA 4WA8A 3WBFA 2O06A 1NLFA 4C29A 1G5FA 1K86A 3BGIA 3F0TA 4P2BA 1NQXA 5CYFA 3V7UA 1LDGA 3OLWA 2HHLA 2R8OA 1MNAA 4EL5A 3GLFB 5ICGA 4FMDB 1KYXA 2ZVDA 3A6DA 1SC3A 3AX6A 1H6DA 5GZ6A 4LJRA 2KW5A 2JLWA 4YLEA 3IEMA 1KH2A 3T9FA 5KNBD 5K6RA 2WI8A 1W9MA 4YJHB 3V8QA 4YTEA 1H05A 5TRTA 5JFOA 1O87A 3FCCA 2GBCA 5JAQA 3BFXA 1ZRHA 5C1IA 4AICA 4BDSA 2J08A 1QRTA 3K0FB 2CNOA 4L7QA 3G0GA 4F72A 2WF8A 4KO3S 2O52A 2R62A 2ZQYA 4IF6A 4IUBS 4WDQA 1UFVA 4XQEA 1UFKA 3PNYA 3UB3A 5ALSA 1VRVA 4AJPA 4WJLA 2FYTA 1C7QA 5CITA 4MW6A 4B6PA 3VTAA 4QTYA 2XQVA 5FO0A 3GJ7A 3PXAA 2Q4TA 5EJIA 1WD5A 2C5BA 3GEDA 3WRWA 3IHLA 1RC8A 1ENYA 1CB0A 3BFPA 4QVKA 4P0PB 1A27A 4M7OA 4EHDA 1OGIA 4CYMA 1TKRA 3JW8A 4NAHA 1CUWA 4U9IS 4YEDA 1O54A 5I45A 3K09C 4XM0A 1RYFA 4RIFA 1KPGA 5EPOA 5J1TB 4IJ5A 1H0RA 4IXTA 4WA7A 4EUEA 2AOUA 1PN3A 3HNOA 3C15C 4EH1A 4PYKA 3EA4A 5F3RA 4JITA 2DR0A 2VOEA 1NN5A 2ZB4A 3FGOA 2GFIA 3K8OE 4J7XA 3ZR4B 2PS0A 4DIBA 4Q39A 2C8JA 1V96A 4K9KA 1PF7E 4LHWA 1J2YA 2B35A 2X0FA 4JYAB 3WSWA 1Z07A 2HYDA 3GJ5A 3SJBA 2GEVA 1EUCA 4A2WA 1F8FA 2DTDA 4B3DA 2VQDA 1EB8A 3I34X 2SBTA 4MRSA 1WMFA 1K2VN 2HSGA 2QLLA 3DDSA 4ACAA 1CE8A 1N6OA 2NZXA 4M21A 4EPWA 5ICMA 3T3OA 2HI0A 2JW5A 4LHEA 3H1EA 1T0HB 1D0VA 3L49A 5AVJA 4LCEA 3MRTA 4KFSA 2OQIA 5CIYA 4V0SA 5EUBA 1EUDA 3U7RA 3A1EA 4RA6A 5BMOA 3DTVA 3FZGA 2QD1A 3GRYA 2L82A 3KPUA 4WK2B 1QQAA 4PTZA 3EGIA 1IAVA 4Q16A 2J85A 4MW9A 4NYIR 4RF2A 2HC9A 3KZMA 4QUHA 4EMTA 1VE9A 4M0PA 4WLVA 4MB2A 3O73A 2OVBA 3IAEA 5CCEA 4ARCA 1LBHA 2HCFA 3O8OB 3LZDA 4LOKA 2HYIC 5E6SB 5EHGA 1PK8A 2OV1A 5I7WA 3S8YA 4NS1A 3U3RA 3J81A 1ZR2A 2H1VA 4HB2A 4CMEC 1YVEI 1HMYA 1VXRA 4X7MA 3M1LA 1SCKA 2QVLA 3FOEC 3DLIA 4L3WA 3ZHBA 1FW8A 1ZK4A 4WK4B 4X00A 2X7XA 2OUIA 1QK3A 1MBZA 1G2IA 2VA8A 4M0UA 2BUBA 2ET6A 4PCAA 4KPYA 3HJUA 4KXFB 2PU7A 1KOGA 3RJMA 1A3CA 4RKEA 4NY1A 4XASA 4NZYA 3SQMA 3WDSA 2JD1A 3PCRB 3TNFA 4UARA 1GPKA 1JT9A 2P5YA 1W9HA 2TMYA 1KOFA 3H2ZA 4O3MA 5AJVB 3TB4A 3WRYC 3HRIA 3NOVA 3PGXA 1YBFA 2YIJA 4AZ3A 1XF9A 4MGZR 5AVZA 4GIBA 5KJEA 1AO0A 4Q9IA 4V0KA 3GRZA 3S5JA 3AYZB 3MWEB 3FI0A 1QIFA 4FS8A 5C37A 4YAKA 1C9YA 3E9DA 3U0VA 5DHQA 4F6RA 1F38A 2UZ4A 3E0XA 4A5SA 3HFJA 1E79A 1DAMA 1GCAA 1KOLA 3KPWA 2G9RA 3EDMA 4KVGA 4AP5A 2Y1DA 4RCZA 3WGZA 5LKRA 3OZIA 3O94A 2PS3A 4Q03A 1UKBA 4YAIA 3ENKA 3UJNA 5DT9A 3H9JA 4JOCA 5EESA 3ZKAA 4TYYA 3IERA 1JDZA 3G5TA 1ADYA 1YQGA 4EX7A 2CMKA 4Q02A 1P0MA 2WT4A 3P7MA 5EC8A 5FHQA 1HTTA 3OJCA 4MUMA 3WZ2A 4O33A 3G2LA 4YAUA 3NATA 1J56A 4MVJG 2WUEA 5EUMA 4CV0A 1M6VA 1CWUA 2X5JO 3AF1A 3M83A 2REXB 4D6PA 1YR9A 2W6NA 2WJZB 3P9XA 1EDZA 4W99A 1O97C 1VBMA 3A1UA 3C4QA 4JNKA 1CK4A 5JSZA 1AK9A 4M53A 4Q93A 4NFLA 1J2TA 3VJLA 2YIVX 1D2RA 1CY6A 1IHUA 3JRXA 3MGBA 3LS2A 3NHMA 3R6GA 3RQSA 1HLFA 4BJ6A 1KHTA 3CH5A 2J3JA 3RUEA 2CLLB 3DOHA 3EA5A 4TWRA 2JIOA 2I7XA 4LZAA 2I1QA 1AX9A 4RHFA 1M1XB 2DKNA 5DVZA 4D9HA 1Z3CA 3HA3A 4LCBA 4MWZA 3UTCA 4TYMA 3PD7A 4F97A 2O1EA 4D9MA 4EHLA 2Z57A 2IYWA 1DC6A 3H19A 2CBXA 2OGUA 3ETJA 3L8YA 2GJ9A 1YZVA 3FMGA 4QHYA 1H2YA 1ZJ4A 4HWGA 5BW6B 2A1IA 2QXUA 1K0FA 1I94B 3A6HA 4HH4A 5JZOA 4AI6A 3NHUA 4GLBA 5CBPB 2FMKA 5B1SA 3OT1B 2YMPA 3F5DA 3IE0A 4Q12A 2IZ6A 1DUSA 1FE8A 2J8ZA 2LBPA 3UKJA 4EHBA 4CIWA 3CLKA 3TEJA 3DFKA 3JQ7B 4MVYA 4OY3A 3PV0A 1QH0A 4CBVA 2PX3A 4M0FA 5CBKA 2ZUFA 3LRXA 2V5AA 3TGWA 2WKWA 3DM9B 3MJRA 5H02A 1PFWA 1SNYA 4CQLA 1KO4A 1RAIA 4MUFA 3C1TA 4XQ9A 5HM6A 5SICE 1YR3A 3E58A 3GAAA 3G7SA 4O4HB 3NOQA 4JVSB 3PDIB 4M87A 5KREA 5E95A 3OLYA 1Q0ZA 3LBYA 4MTCA 4MRRA 1V3UA 2IBTA 2GBIA 1R0CA 3ORQA 3C5HA 4K0RA 4KWCA 2BFBB 1EZZA 4HJXA 4OH1A 2CJYA 2ZUCA 3UWMA 4DWOA 2WABA 4LGCA 3WLQA 1MABA 2O5RA 4OL0A 3D8RA 1Z7WA 4RC9A 1L5KA 4PG6A 3KOOA 4C22A 4LEIA 3RU2A 1SZDA 4MI6A 1T9GR 2A0YA 3TQTA 2V7XA 4QDOA 4U9HS 4FGKA 4TQUS 4IO1A 4JJAA 1V5EA 2LIVA 2NYAA 1JN0A 3LCMA 4HZIA 4JAVC 4C0LA 3IMCA 1M5TA 3PCXA 1ZL0A 4W5RA 3VH4A 4DLKA 4MPJA 3GC6A 3PC8A 5KYVA 3UPDA 2EFDB 1YS1X 1GXSA 3BHMA 5CCDA 1O95D 3EVGA 3CXRA 4NMLA 4MUJA 4BJ5A 4CR8A 1BN6A 1QRAA 4IVNA 1AG9A 3VUFA 4FXOA 3NRCA 4WN9A 2OKCA 4JKIA 1N36B 5AHXA 4FW9A 3MHTA 1QS0B 1Z2CA 1YJAA 4K2HA 4YRTA 2MOKA 3B6ZA