1RSZA

Structure of human purine nucleoside phosphorylase in complex with dadme-immucillin-h and sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
282
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of human and malarial purine nucleoside phosphorylases
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 86
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rszA00
1TCVA 5EPUA 1PF7E 3OZCA 1NC3A 1OTYA 1JPVA 1Y1SA 1V45E 1Z37A 1PR6A 1I80A 4D8VA 1Z5NA 4WKOA 3FOWA 2ON6A 1U1DA 1ULBA 4OY3A 5K1ZA 1V4NA 3EUEA 5EFOA 4DA6A 4I2VA 3UAZA 1PR1A 3ENZA 4KN5A 1V2HE 3LGSA 4TXJA 1Z5PA 3E9RA 3UT6A 3C74A 4TTJA 1JDUA 4JWTA 4L6IA 4L5CA 1ECPA 4TXNA 4JP5A 3K8OE 5F77A 1JE1A 5B7GA 1QE5A 3INYA 2Q7OE 3UAXA 3FUCA 3BJEA 1A9OA 4DA7A 4U2KA 2GUWA 3OF3A 4TXMA 5JPCA 1VFNA 5CCEA 4YJKA 5C80A 2AC7A 1Y1TA 1Y1QA 5IU6A 2I8AA 1WTAA 3ODGA 5F73A 1RXUA 4YNBA 3NBQA 4LDNA 5B7NA 2P4SA 1JDSA 1SQ6A 1NC1A 5F78A 1Z36A 1SJ9A 4E1VA 2AI2A 4DAEA 3FB1A 1RSZA 1FXUA 4R31A 3IEXA 1Q1GA 1PR0A 3P0FA 4D8YA 5CXQA 4PR3A 2A0YA 2A8YA 4F3CA 3OPVA 1Z5OA 4GLJA 4L5AA 4TXHA 4QARA 3U40A 1Z39A 1SD1A 1PBNA 4GKAA 4YMLA 1U1FA 1Y6RA 3K8QA 4L0MA 4LNHA 2QPLA 5F7ZA 1VHWA 4OGLA 5CYFA 1ZOSA 3OOEA 4R2WA 1PWYE 4LNAA 1K3FA 3O6VA 1TD1A 1PW7A 4GLFA 3UAVA 1PR4A 2AI1A 1V48A 1OUMA 1PK7A 4BMYA 4QASA 3OCCA 3MMSA 5DK6A 1YBFA 1JDVA 3T94A 2H8GA 4MARA 3KUKA 1NW4A 3KVRA 4OGKA 1ODLA 2HRDA 3EMVA 4DAOA 4WKBA 4ECEA 4QEZA 1T8WA 3KU4A 1RXYA 3UAWA 1Z35A 3LA8A 3QPBA 4LKRA 2HN9A 3OZEA 2HWUA 3E9ZA 1OU4A 1T8RA 3P0EA 3PHCA 3MB8A 4L5YA 4OEHA 4G89A 5I3CA 1N3IA 1RFGE 1JE0A 1ODIA 4MCIA 2BSXA 2QTTA 3NM5A 3EUFA 4QFBA 2IQ5A 1CB0A 3FWPA 3F8WA 4D9HA 4NS1A 4X24A 2OXFA 2PGAA 1ODJA 3TL6A 1VMKA 3PHBE 1G2OA 4JOSA 1YQUA 3DJFA 3D1VA 4M3NA 4TTIA 1RCTE 4WKPA 1A9SA 1Z38A 4DARA 3GB9A 3FAZA 4M7WA 1YRYE 4MCHA 1SD2A 1C3XA 3KHSA 3O4VA 2I4TA 1YQQA 1LVUA 3BL6A 1V3QE 3DDOA 3NM6B 4F2WA 3KVYA 5B7PA 1U1CA 4G8JA 1RR6A 2ISCA 5F7JA 1LX7A 4DA0A 1K27A 1RYZA 1PR5A 3BGSA 4EARA 1PKEA 5F7OA 1JDZA 4QATA 2QTGA 2QSUA 4TYMA 1Z33A 1LV8A 3PNSA 1K9SA 1U1GA 5KB3A 1CG6A 1XE3A 1TCUA 1U1EA 1T8SA 5CYGA 4NSNA 1YR3A 4M1EA 4OF4A 4K6OA 2XRFA 3BSFA 3EEIA 4IP0A 4F1WA 1VHJA 1B8NA 4BMXA 1M73E 3DF9A 2HSWA 4NY1A 4BMZA 4OJTA 1Y6QA 4TXLA 5EUBA 4P54A 1RXCA 2RJ3A 3GGSA 3UAYA 1A9TA 4BN0A 5FAKA 4R2XA 4F2PA 3SCZA 1Y1RA 1A9RA 4DABA 5IFKA 1TGVA 1A9PA 4TS9A 1OVGA 1Z34A 3E0QA 4D98A 2OC9A 4FFSA 5CXSA 2AI3A 5ETJA 4D8XA 3OOHA 1TGYA 3ONVA 3LBAA 4G41A 1RT9A 3IOMA 2A0XA 4LZWA 1RXSA 4WKCA 4H1TA 1OV6A 4UC0A 3KVVA 4EB8A 1ULAA 4F3KA 2B94A 3FNQA 1PR2A 4RJ2A 1T0UA 2QDKA 4TS3A 4WKNA 1A69A 4TTAA 1JYSA 3OZDA 3DPSA 3DP9A 5CCDA 1OTXA 1A9QA 1B8OA 5B7QA 2OC4A 4GMHA 4DANA 1ZL2A 5F76A 1PK9A 5F7XA 2OECA 1T8YA 3PNPA 1JDTA 1V41E 4DA8A 4QAQA 4PNPA 2A0WA 1JP7A 3OZBA 1ODKA 4YO8A 3NM4A
chains in the Genus database with same CATH superfamily
4X00A 4E3ZA 1YZHA 1V39A 2C8LA 2BD0A 4LMRA 1S2IA 3I04M 1ZD8A 4NP6A 4PQRA 4KAXA 5BSWA 3OUZA 4HADA 3BIFA 2BKUA 4HMQA 4URXR 2YXBA 5G02A 1MB0A 2HA7A 4MI1A 3I6MA 3OFJA 4PYKA 3LRXA 5HRCA 3OQ6A 4HNAB 1RS0A 5K99A 2QEQA 5TEVA 3ABRB 4AS2A 1J33A 2P4UA 5CFMA 3S5UA 2P9FA 2ZYAA 3PJEA 4KPGA 1W48A 3QJGA 5CX4A 4D4JA 4F5YA 1MJ5A 1N8SA 1F0KA 1BE1A 3S0JA 5HOEA 3DVSX 4B3GA 1E9RA 2VYQA 5B58C 1R0SA 4FN5A 1T3ZA 4EZEA 3EEBA 3LUDA 4G3XA 3RUIA 5AOVA 1AM4D 3SKYA 1HF3A 3I62A 1CR2A 1JBKA 1U3GA 2V1UA 3AG6A 4UFOA 5EJ7A 2C1XA 4ZZ1A 5AW3A 4UUNA 2BUAA 1IAVA 3BXPA 1Y3AA 2JIDA 2YIJA 3STXA 3NHPA 4X7MA 2YXDA 5BOSA 3EF0A 1ZJJA 1ZNWA 2VPXA 3L4KA 2JIOA 3IP6A 4P2GA 3CQ9A 4RH3A 4RIIA 1N4AA 3T5GA 1PL8A 4C6SA 4FQ8A 3KVNA 1SXQA 2DT8A 3PWKA 3RTAA 1PNQA 1XMQB 4IILA 4JN6B 1B42A 2TECE 3K8OE 5GVSA 3PFWO 4ZQHA 1G7TA 4YK7A 3VVMA 1TAQA 3I2YX 2XPCA 4ZC1A 2D1QA 4MVJI 3O4IA 2O06A 3SPXA 5JSYA 2FPGB 1NW5A 3HU1A 1E60A 2B4YA 3AUXA 1M72A 3I5MA 4O4JA 5A4DA 1W30A 3RFVA 4BC0A 4ZZ2A 2V7XA 4GDFA 1YCGA 2BRUC 2W58A 3AVTA 1OWMA 1OA0A 1BJKA 5TF0A 4ALLA 4NOKA 2QENA 2OCLA 4K9NA 5TARA 4EMBA 4YQYA 3OF3A 3HRHA 2GBPA 3ONEA 4KSCA 2MR5A 3UENA 5JPCA 1NBOA 1VFNA 2SCUB 4Q9LA 3ZW9A 4P0TA 2OUIA 2PVSA 5AXAA 4C7OA 4ILKA 3GLQA 4CG0A 2NVBA 4RAOA 3CG4A 3OETA 5ALZA 5TT1A 2JGAA 4C0WA 2ZBUA 3LRTA 2H1FA 3CR3C 2R66A 4P33A 1KZYC 1VI2A 3ESDA 2BI8A 3PEFA 1T9KA 3KPYA 4M9RA 4TSFD 2EQ5A 3DOOA 1E1RA 2A33A 3NHSA 1T0JB 4CKBA 4OFBA 1NQXA 4JBLA 3VVCA 4IVNA 4DDVA 1IJFA 1K3TA 3UMJA 4AZWA 1NXOA 2V7UA 3G0CA 3HY3A 2IYEA 4Q66C 1UFVA 2XNSA 1QORA 3KC2A 4YLEA 3SDZA 4AKHA 3FNEA 4UU7A 3MS4A 1Y1TA 5ESXA 4BTVA 5HRUA 3OZFA 4IHQA 4IMPA 1O97C 2VN8A 4JU9A 4M36A 5EP4A 3A1DA 5BWMA 3ZD6A 2D62A 2ZJ8A 4W7SA 4DM3A 4EAAA 2Q6KA 2AQ8A 3FBWA 4ZCSA 3RVSA 3S8EA 2AA3A 4G65A 2V6MA 4LDNA 4N39A 3VJKA 3MGBA 3RM3A 1Q7CA 2DWOA 2WT8A 3NHBA 1N2CB 4GBMA 5HQJA 1JDSA 4EHLA 5F23A 1BDIA 4MTLA 3PE3A 3BGWA 4QGFA 4YCLA 2DPGA 3LVBA 2Z95A 3IOCA 2VDVE 3DR3A 1A76A 1T2AA 1Y5NA 4GD3Q 2PJUA 4HUQA 4KWHA 4EGQA 5B4UA 2IC5A 1EVEA 3P71T 5DM70 1IN1A 4FCVA 3IEXA 3HMQA 4ARBA 2DLNA 4AJ1A 1QVAA 5GQSA 2GJKA 3RARA 3MCUA 3MOGA 4EB6A 4AO6A 4AJLA 2WYWA 3SHQA 4BPBA 2FQ1A 2G71A 3BH7A 3GVPA 1OAOC 1GUYA 2A8YA 2OSVA 1L7NA 3D02A 3ZWCA 5AI5A 1G5QA 2O2ZA 3JYHA 1CCWA 1WB6A 3D6JA 3QQ5A 4TSFA 3UF0A 1OH5A 3MPUA 4CKBB 2Y92A 1BA2A 4ZP1A 4DRZA 4FYKA 4MWGA 4PPNA 1VJGA 2VT3A 3GI1A 4MW4A 4R9VA 5ICMA 1POWA 5EERA 3JSAA 3CRW1 2UUBB 4C7JA 3SR0A 3RBXA 1BU8A 1CRWG 1TIKA 2C1ZA 1F9EA 3BE4A 1MTZA 2WWWA 2UYOA 3W8FA 4B6RA 2VP3A 5CDFA 5MN4A 4AS1A 1DBIA 1MEJA 1A4UA 2IY8A 1XNQB 1A8QA 2J0EA 1XZGA 2P0EA 4FEYA 3AYZB 1JTFA 1ZK1A 4ZI5A 1HM5A 4B09A 3DF7A 2QPLA 4N3GA 1DIRA 4R69A 4A16A 2RBEA 4AURA 2XCOA 4EPVA 2JI4A 4KBYA 5LBTA 3RUHA 3WMRA 2Z09A 2IU3A 3PFIA 2PVPA 4O3MA 2ZITA 3MQ2A 4U7PB 3F47A 2GHTA 1JEDA 3ZWVA 5DPMA 3HJHA 3ZWQA 4AP5A 5K5EA 3NOOA 3EVGA 4EO7A 5JWHA 3JAKA 4HZGA 1DAFA 4YREA 3VHRA 3MJRA 1RP7A 3JWHA 3UAVA 1JR2A 5SZHB 4YAIA 4HNTA 2JJ1A 2BIFA 1AQIA 3W1EA 2A6PA 3UUWA 4NYJQ 4WEQA 5IJZA 2DTXA 4WESA 1O3YA 4HRVA 4MHOA 2FG5A 1UKYA 1LZKA 1FP1D 2P90A 1EINA 1X3LA 5F2EA 1YBMA 4CNBA 4ER3A 4JGIA 4BMYA 1JQAA 4B6PA 1QIEA 4IIYA 2VQDA 1OXVA 4LUCA 1FYVA 1H05A 1OXSC 3GCDA 1IPHA 4WBSA 1P8AA 1HT2E 1ZH0A 3A36A 4PG7A 3Q11A 3VOAA 2GVZC 3BMXA 4RVNA 4MZDA 4D3ZA 1NR7A 1Q0QA 5JZMA 1IJBA 5DTRA 3Q3IA 1CNFA 2AN9A 1UAGA 3GIWA 2BFDB 3K3PA 2WJPA 1PJTA 2OLJA 2VLBA 1LF5A 1T1JA 2CLMB 4D80A 5AKIA 3AC0A 1KIAA 1LJ8A 1ZMXA 4ND5A 4A73A 3DONA 1IWOA 1F7VA 2P79A 1XVAA 2X2OA 5JZBA 1A2OA 4WKBA 4NJEA 4A82A 1PHPA 4KQEA 4WEOA 2D8MA 2A9OA 2GZRA 1R0RE 1P29A 2OWEA 4F8YA 4KIWA 3WGTA 1AF4A 3KU4A 4BASA 3MXOA 4RTOA 3EHDA 4C06A 1YTLA 4ZK2A 2IU0A 3TDNA 1QP0A 4XEHA 3ETGA 2OXIA 4UNRA 1XCLA 4JC4A 2WAMA 4OXIA 2NQ8A 3H87A 4P92A 3QI2A 3ZLTA 1AZTA 4K2AA 3PWTA 5DP1A 1M2OB 5I4BA 1P8JA 3HXKA 1KI9A 4GX5A 1UOOA 1B43A 3CKKA 4EUHA 4DQ0A 4FVTA 1Y98A 1EZ4A 3CF6R 5D8DA 4ZTBA 5FBLB 5I3CA 1NN1A 4D7AA 2JL1A 3CKLA 4ZYVA 2PFGA 4OQXA 4ENQA 1O89A 2J1LA 2OCAA 1P0MA 4GE0A 1GTVA 5CFQA 2DFDA 3GFSA 2A86A 3G5UA 1XWWA 4PSCA 1B26A 1I5EA 2W2MA 1HMYA 1XEWX 2DR2A 1XJWA 3GH3A 3PFFA 1UKVY 1V11B 2IHJA 2JH9A 2VXYA 3KX2A 5JJ5A 3KELA 2JH8A 3P9ZA 4D9HA 1ISIA 2AN4A 1KZ9A 2QVCA 4IJUA 5GV7A 3P2MA 1ODJA 1KVUA 1SEPA 3QMWA 2YVAA 1SB8A 3NBXX 1GM5A 1CBUA 4KWTA 6REQB 1KYWA 1OF1A 2PGJA 3QNMA 1VPVA 4G4SP 1KKUA 3ED1A 1N0UA 4J0EA 2XGMA 4WMLA 2IS4A 2CF5A 1XRLA 4Y2HA 1A7AA 2QG4A 3DWFA 3KOUA 2OTCA 2XXBA 5G4KB 1DXQA 4ZGBA 3SBDA 2C2ZA 3G2NA 5HKAA 1OBHA 3RYCA 1V37A 3CLUC 1AQJA 4LQCA 4X1IB 3HNPA 1GPDG 3FNFA 4RIFA 1XGKA 3OQ1A 2Y67A 4GPTA 4PX3A 4RORA 2YYAA 1QLWA 4UVDA 5CFNA 1DLJA 3RU3A 3CF0A 3GU3A 2HB6A 1NJ1A 4IX1A 1KDOA 3HYLA 4RHEA 5E38A 1XTZA 2JVJA 4AP6A 1YI8A 1YU6A 3I73A 1DB3A 4F4UA 3H1TA 2JS7A 3EZYA 1SG6A 4N40A 4QFDA 3U7QB 4QZVA 1F2VA 4GSLA 4R9RA 1A8HA 2GJSA 5EJIA 1YZYA 2GFIA 1YCDA 2QORA 5GONA 3ZV7A 4DLSA 1U9IC 1TKCA 2J5RA 1SCUA 4WXPA 3A6PC 2GVDC 4KQHA 1T5HX 1WZEA 2HK7A 3LC7O 2HM7A 1NY5A 1QHXA 2DM6A 2I2BA 2PH5A 4LYHA 3NNNA 1BGWA 2JCGA 3GFBA 4OGWA 4PE5B 3ZBTA 1JA1A 3D6UA 2C8JA 2CD9A 3QE4A 1MV5A 2E5WA 1TEVA 2JRCA 4FGSA 2I65A 2JAPA 1EK5A 4TMFA 4LF6B 3IEUA 5F7OA 5L3SA 4HDSA 3I2HA 1HI9A 2ONZA 3PI7A 4HOYA 4BVLA 3HO6A 1CWUA 4RFSB 1SHLA 4X94A 4PO9A 3MT8A 1DJOA 2VPPA 2BLNA 1K9SA 2VDWA 5ULLA 5JYBA 1AO0A 1U1GA 5HPYB 1RYMA 4CIXA 5E1BA 1ZGGA 2JHAA 4Z86A 1M33A 3WS7A 2Z57A 2F3PA 3CE6A 1ZA1A 2NIPA 1G8MA 1IYZA 1XA3A 3GWGA 4YYEA 2YHUA 3CZCA 2OCIA 1SM4A 2YWCA 3NAMA 3R0JA 2C92A 4LZZA 4CQLB 3HXOA 3HUTA 4WW0A 2YRFA 2Q3EA 3HI4A 5LA6B 1M6YA 5EXXA 1IBMB 2PSDA 2OUKA 3AVYA 1IXZA 3BB4A 3UMFA 3QU7A 1Z13A 3UOGA 2O9JA 3OEYA 4MB0A 3UCXA 3ECAA 4TQUS 1JR3A 2HHLA 4NMWA 2W11A 3WG9A 3WYEA 5J47A 1X1EA 3LS2A 2B98A 2R1TA 3KYBA 4FFOA 1Y5IA 4BLUA 1QH9A 3SBXA 3FOEC 5JU6A 1GPMA 2O8EA 1RQRA 1I2ZA 1OE0A 2UZ1A 5BN5A 4Q12A 1FNMA 4XDHA 5K6AA 1FMCA 2Q4RA 4LBVA 3IVRA 4OJTA 3VR2A 2QRJA 3D5EA 4LC9A 2G67A 4PPGA 3WTBA 4DJDC 4WINA 3ETEA 1IPFA 1MG0A 4ODIA 2Q8PA 2JLQA 2V0GA 1DKUA 1R9NA 1L5OA 3NVKI 2RGNC 5TMPA 1RQLA 2WV7A 4N65A 2EXXA 4RMJA 5K03A 5LMCA 3EB9A 3PYXA 4FDLA 3NALA 5LZ2A 2HSDA 3PT9A 3AWIA 3BE5A 5K0SA 3MMPA 3HHEA 2P41A 1A9RA 2JLCA 3CZ9A 3ZIDA 5K6TA 5CT5A 4MEBA 4P3NA 2GNAA 2GQ0A 4QGBA 4RHYA 3CWZA 1MQAA 4Z3KA 3H6KA 3ICCA 4PFKA 3VU8A 4EFNA 1EFLA 3G2LA 4UM7A 1Q3HA 3ZWXA 5KSYA 4PF1A 2PH7A 2IV3A 2OV3A 4OHRA 2Q46A 4PFJA 4FINA 4OB6A 4D74A 4PQEA 1IY0A 3LV8A 4IIXA 3R7AA 4XW2A 1PT6A 3RK0A 4H3SA 5LOVF 1QC5B 2P9JA 5IT9A 2CXNA 5DHSA 1ISRA 5J5VA 2BFEB 1T3LA 3FKJA 4FDUA 4PZEA 5CFRA 4TYWA 1RWNA 1X1CA 1JPJA 3HA5A 3RIHA 4R7GA 1BCSA 3SQOA 1Q6YA 1VBMA 5HF8A 3W0LB 3FCOA 1FP4A 1J1ZA 3ZPXA 4OUDB 1SCIA 3LW7A 2BJVA 4TQGA 2WPDA 4KJXA 1RAHA 1BCSB 3T06B 3AI2A 4JJ8A 5IZ4A 2Q9AA 1YJQA 4US0R 2YWHA 3KD3A 1U81A 1XDUA 5M3BA 2WFLB 5JS8A 2D5BA 2HPHA 5JXIA 1UAAA 1U94A 2FQWA 4CLRB 4JBIA 3HBAA 3CLUD 3HN6A 2XVZA 1GCOA 3IUNA 1H1DA 1AH2A 3OKAA 3GFTA 1YKSA 1FP2A 4QTYA 2F8LA 3GN2A 4YQFA 1XNRB 2RGBA 4UC0A 5JAHA 3IA7A 3TDMA 4TKLA 3T12A 2V3CC 1ULAA 2CNBA 3CTPA 4Z2AA 3QU9A 2ZUFA 2OM2A 1PN3A 3P2KA 3ADCA 1SIWA 1FS4A 3P5BA 1L4YA 1JVNA 1TK3A 3CLTC 4S12A 1KJQA 3PLNA 4EHDA 1QRDA 4MEAA 1O9BA 5MGNA 3AJAA 4RJTA 1NTRA 4BC1A 5LQDA 2E2WA 2ZDHA 1QQTA 2QJRA 3IAFA 3KP1A 2GYWA 5JFTA 3W04A 1KAOA 3VKUA 1PTJA 1URPA 1I2CA 3FLMA 3G0GA 4X3CA 1U99A 1TIBA 3DPSA 3H84A 1U9ZA 3HVJA 3RC7A 3HC7A 4MGIR 5HF9A 3IBFA 1A5ZA 1VMIA 2CLKB 4IKPA 3L0IB 3U7FB 1CF2O 3OI7A 2GDJA 1G4HA 1K4MA 4HR7A 5DNAA 5KOHA 3GJQA 1AN9A 1YAJA 4QHTA 1O94D 3ZIUA 4WK4B 4QOJA 1D04A 2QD2A 5F12A 1U0LA 2I2CA 4CTNA 1LI4A 1PFWA 2QXUA 2ZWPA 4B7CA 2E4XA 5AHKA 3J81A 5CRIA 3QXHA 1BC5A 1G17A 1YI1A 3CISA 3HKBB 5JR3A 5FOVA 1EPUA 4O2RA 4LAFA 3OZBA 4OHVA 1RHMA 4EEZA 4N49A 2BC9A 3A6KA 3OICA 4H59A 4DG5A 2OGTA 2ONYA 4FOOA 1CEQA 1EFUA 4Q7MB 4AROA 5DX0A 2QUHA 3UMMA 1QQBA 4GQIA 4XJVA 2O2SA 4H9GA 1ONOA 1NC3A 4RENA 4KCGA 2A4MA 4I6EA 1JPVA 1KH3A 1EJBA 3I6QA 4N0EA 3REFA 2QV7A 1D2AA 4UTZA 1ENYA 4S2EA 5AI8A 3SKXA 4AYXA 3LX4A 2AN5A 2FGJA 4BB5A 1QRTA 1WP9A 3Q9UA 3EQ6A 4WXMA 2Q62A 4Z9FA 5EWLA 4DV3B 1KZ1A 5EJFA 3UMSA 2QUJA 1NUPA 7AT1A 3B78A 5JNRA 3ILSA 1DC5A 2ETXA 4EI8A 3U61B 3OLCX 1W1WA 1J22A 3EOZA 3WGQA 1O57A 1NQAO 2O4UX 3FMGA 5ALOA 4CG3A 2GPYA 3GLGB 3DUFA 4Y18A 2ZBEA 4HAOA 4UPVA 1WY7A 4J0KA 4BV8A 4U7DA 3FDZA 4PBRA 1DO0A 4FOLA 4LISA 1XZIA 5JRDS 2BSQA 1OFUX 2XZTA 4XX0B 5CLJA 3HHPA 4OLFA 3L8FA 3ORYA 4IV5A 3ZI7A 5KHLB 3ENZA 2CDAA 2C2GA 2YY6A 1ZD1A 4R2HA 4XIYA 2MOKA 3N0RA 4NHOA 5CA1F 4JOQA 2O3TA 3B70A 4A0FA 3CVXA 3IYLW 4F45A 3KKEA 1U2PA 4TXJA 3AIIA 5G3YA 3WICA 1F6WA 1X70A 5M2QA 3TAXA 2BTEA 5EMKA 2QJFA 1AURA 1VXOA 2Z6QA 2C5EA 1Z9BA 1E2DA 4KO8A 3FSRA 3H4TA 4ZOQI 4MV0A 1ANKA 2DR3A 2ZE6A 4YP9A 3NIBA 4RE6A 2V8OA 2B7BA 5JC1A 2QM7A 1QGYA 3IT2A 2BF7A 3L6BA 4PPYA 4EK9A 1OXTA 4XWTA 3HRIA 2IYLD 1KH1A 3JQ8B 4AMYA 2EGHA 2Y77A 3V4OA 4Y2GA 1QTIA 2R3SA 1NJ6A 2I54A 3DAHA 3DP7A 1PX0A 1TIPA 4K8RB 3HXQA 3ZTYA 1Q2UA 3VTFA 3UK6A 3WKAA 1Q0RA 4M6WB 3A4NA 5HVNA 3SCZA 1FPQA 3KKPA 3RG2A 1G291 1W0CA 3NGXA 3UQYS 1QE5A 2C7RA 4HLQB 3G2OA 4DCMA 5BP7A 3L6EA 1KRHA 4IZIA 1RPTA 1FP7A 4YGXB 3IGFA 3LUBA 5FV7A 5HR5A 4FJ2A 4CMEA 4EPXA 2G08A 2YZMA 5AM1A 2GK4A 4DA7A 2Q07A 4Q19A 4EL0A 3A58B 4HNUA 4II2A 1ID1A 1XEAA 2X1VA 4L16A 3DTVD 3GRKA 2CWWA 3EA0A 5JYCA 3MA0A 4F9EA 5T7BA 4INJA 2O3QA 4PC6A 5AVSA 1V3VA 5K0JA 1A1VA 3TFOA 2JA2A 4R1MA 1VHLA 5DWQA 2Z9BA 2RDMA 2QSZA 5BMOA 4EP1A 2ZR8A 3FNBA 5AVVA 4LF8B 4Z4FA 8GPBA 3AVPA 3CS3A 2F43A 3M3HA 4INPA 2PX3A 2Y6UA 4O4IB 1CRPA 3DLTA 4OFZA 5IJ9A 4TSRA 4ZTUB 5BT9A 1E6CA 1HRDA 5K3CA 3BF8A 3PD0A 4M55A 5TQ2B 4AKIA 4BNXA 1QRAA 4W1QA 3RWMB 3B2QA 3HB9A 2IYOA 5F2NA 1SUSA 5H4HA 1QZUA 3TD9A 5CG1A 4EGFA 2EDCA 3WAKA 4M0MA 4XPZA 1Y8RB 5JTTA 4X85A 3HS3A 3I34X 4QJBA 3NBMA 2GRUA 4O2AF 1K08A 3QVXA 4IVRA 3II6X 2JFWA 4Q9NA 1J20A 3CVWA 2Z3VA 3GRRA 1QLJA 4F8EA 1SU4A 1PZEA 1U3TA 2WHQA 4UHFA 2OPHA 1N9GA 1OXUA 1PG2A 2I3BA 3NCHA 4DC9A 2D2IA 1BKYA 2DZDA 2GJ8A 3GR6A 4PTZA 3I0MA 5BN4A 4PN7A 3LWNA 1G8JA 5CPFA 1P2VA 4YT2A 3BMNA 5HZGA 2OZPA 3QHQA 3PEVA 4D9IA 5AW0A 2FEOA 3GEBA 2JLZA 2EW8A 1NMZA 4PINA 4Y6PA 2IF2A 3NS7A 3WQRA 1Q83A 5BMVA 3PS9A 3O2QB 1D4AA 2FE4A 3WDSA 3GFVA 1H2XA 2W2LA 2A92A 3B8HA 4MS1B 4RK4A 5JZVA 1ZCBA 3LPNA 1BYIA 1P1IA 5IT4A 2NYRA 4CM7A 3MHPA 1L5WA 4NBKA 3LJKA 5BQ3A 3U40A 1RQNA 2BGWA 4F2GA 3E8SA 3LLUA 1QVRA 2OXCA 4IKOA 5D3QA 3K9HA 3QKSB 2N1MA 1O96B 2AF4C 3KJFA 1I6KA 1GL6A 1W9HA 1QH8A 2IP2A 2CSUA 2LCFA 3LG2A 3R7WA 6CHYA 1O4WA 3DTVB 4L5IA 3RU2A 5C5IA 3NYIA 1XBTA 1BA3A 1N7IA 4WLNA 1HEYA 2F9FA 2JKZA 4Q5IA 4LRTB 1VJTA 2CHQA 1JFLA 1N32B 2N75A 1QOPB 1TD1A 2KSQA 4M0DA 4WL0A 2PO5A 2Y93A 4RLFA 3MWFA 3HU2A 4RZSA 1W19A 1Z7GA 2HSJA 3BAZA 3I1YA 1OYYA 4KDFA 2O8DB 2VT6A 1N33B 3H05A 1NNUA 3HYNA 4KPUA 4UBKA 4BLRA 1KYYA 1ST3A 2JIMA 2OYRA 5C35A 1KBOA 1JU4A 2GLTA 1XC7A 3UH1A 3ZX4A 1FTGA 2HJHA 4A6PA 4B46A 4E94A 3QPCA 3TOSA 2IZ7A 2NXEA 3DHWC 3GFRA 3M1IA 1F8UA 2IUYA 4NV0A 4HS4A 3FVWA 1W5FA 4MUXA 5KHAA 1M8FA 2VRBA 2QN9A 2V6FA 2I0FA 2P3SA 4G0PA 3K0FB 2Q2VA 3LQQA 4CUKA 3IVAA 4DWWA 4EJFA 1UZUA 3OT5A 4Y2JA 3T94A 4G5OA 1H9BA 4LGCA 3CWQA 1V6SA 1YB2A 4JXKA 3TQTA 1WW3A 2RI0A 4X0EA 2FOLA 4NYJR 4ECEA 1QQ6A 3HYCA 5IAEA 1N8NA 5GJVC 3IEKA 3GBPA 3TRKA 1SVLA 1ZCAA 5LNK6 1XAGA 1U0TA 5G4LA 5IZCA 2F1IA 3M6LA 3LQ4A 3K30A 3BAFA 5L45A 1H6BA 3LHSA 2JNWA 2WTBA 3RSSA 4AJPA 2COEA 1UDBA 1JU3A 1NURA 3DMYA 4QG3A 4W4TA 5LB2A 2VP4A 4H15A 4WCFB 4JMPA 2NUAB 5TQ2A 5CVTA 1LVGA 3F9CA 3L7CA 4YDRA 3D0RA 4B2YA 1C1XB 16PKA 5ILOA 2XUJA 3HABA 4B79A 2CSXA 3H9BA 3I53A 2PGNA 3U7RA 3PHCA 3FPFA 4LE2A 4MQLA 3PGLA 4POOA 1DKMA 2JKVA 2IYXA 4FU0A 4OFWA 1KC1A 2QTMA 3WKBA 3C6ZA 4E5DA 2VP5A 5JD6A 3D2LA 5LU9A 2ZE7A 3HGQA 1C0PA 1O5OA 2XVYA 3PPWA 4PQGA 5CB8A 3QKWA 1I6MA 1NI5A 1JLRA 5TPWB 5FWXB 4GX0A 3R5XA 4FLFA 2CFIA 1ZKMA 2XH8A 4IJMA 4O2AA 3SLRA 1YA6A 1RZRD 1WBDA 1L6IA 4LE1A 1PV1A 4M46A 2AOVA 4N3AA 2GA8A 5FLXA 4CGYA 3F6BX 2GBIA 1YOVA 3O93A 2H4JA 2QJWA 2QL6A 1NM5A 1MRSA 1USIA 2VHQA 2W90A 3E7WA 4RW0A 3UCFA 4B4VA 3B38A 3PC8A 1I2MA 4LDRA 3H99A 4YHBA 1TC1A 2ZJOA 4GZ6A 4QQ8A 3VAAA 2HCJB 3S2ZA 3KBOA 2IWHA 2WJ3A 4XSGA 3L0CA 1PDOA 4N0PA 3T3OA 1ST2A 1W85A 4G84A 1L0BA 3SVLA 3WLJA 3T7TA 1C9MA 1XMSA 2W22A 3G9UA 3WAGA 4FK8A 1ZMTA 4EH1A 2V7GA 4A36A 4YJ2A 5K3FB 1J99A 1XQ9A 4H17A 4RPLA 5D5QA 4F5ZA 3UPUA 5KSZA 1Y42X 1QZZA 4HEJA 1FRFS 3BJIC 5J4HA 2ZUBA 2H1IA 1NFFA 2H2WA 1HFWA 2QTFA 2WKPA 5BWNA 1RCUA 2PUFA 5LP6B 4JC8A 1NTOA 3DDOA 4YPOA 3N2EA 1GV0A 1KF0A 3CNQS 3FTFA 3AVWA 5J2TA 3A6DA 2J0SA 4BCDA 4ZYWA 1AXGA 1XCJA 3E18A 1L3IA 3PG5A 3OPYA 1SUDA 4ZANA 4Q3NA 5KO2A 4RQAA 4LHXA 1Z0JA 3T3IA 3ISVA 3ON5A 2PMFA 3QEBZ 1K27A 1KC3A 3DAOA 3EZ6A 4MVJF 4P98A 2WYIA 4B3BA 3HXLA 2X5XA 1PKEA 1AZLA 2AEEA 1SVMA 5C1OA 4AY2A 3SJBA 3HCWA 5LLDA 5KINB 2A59A 4J0JA 4ZT2A 3B3JA 4EITA 4QM6A 4R16A 1IIBA 3N2YA 3FWNA 4OHZA 3L8ZA 4EG3A 1Q7BA 1P61B 2HMAA 4H31A 4LJSA 3MBKA 3ZZUA 4MUFA 1EX1A 4RGBA 5SYMA 4CEHA 4UOQA 3IRVA 3R8FA 4HH3C 1GSIA 3D9QX 4C5BA 1QQ5A 2J7PA 3HB4X 5ICSA 4MRAA 1GAQA 4EW3A 4JB3A 1I8TA 1NJ8A 1YNOA 2IT1A 1A3CA 2FP4A 3NFRA 5E1DA 5A0TA 4CCAA 1E2BA 5KQMA 3O47A 4YP1A 2PG3A 4EYEA 2OXTA 1O95A 3PX7A 1O5IA 4A8PA 2J3LA 3CGGA 4C7MA 3LY7A 5K6AC 3MCTA 2BFAA 4X90A 3EVCA 4WK6A 1A77A 4LECA 4KWEA 5AKHA 4J4HA 1M34A 2J9FA 4IP0A 3E22B 1YDMA 4CVNA 1G8HA 3F90A 4MWZA 5A3QA 2HQOA 3Q1KA 1VDMA 2B8EA 3R3ZA 5CLFA 2C7BA 5BV1A 2W2QA 4OL9A 2D0OB 4GXQA 4MA5A 4B3IA 4EJSB 1TA0A 4TMTA 5EYPB 1U7DA 2ZSHA 3D8UA 1D6SA 4IDBA 1S01A 4KKVA 1XEFA 4ZVPA 3IIMA 5H0IA 1RXCA 4W8GA 2B1GA 4TYPA 2QDXA 1C4WA 2BF4A 3A26A 5JMTA 3IUPA 5AKEA 2AE1A 3OEHD 4CDNA 1Y1PA 4PYNA 3BEOA 5KQSA 1L7BA 1H4QA 1KMCA 1DQZA 1A7JA 2CLLB 3OQMA 2R00C 3BMOA 1JDJA 2ASEA 2HA2A 4IIGA 3D4BA 1A7UA 4WOPA 1G3MA 4EYOA 2VS1A 1YD7A 3BFVA 3GPBA 4FGUA 3UMGA 2FUEA 5TGTA 2BI7A 4OQ4A 4S04A 1Y9ZA 1NZFA 1GTSA 1X42A 2O8FB 4L2IA 4UUPA 1CQJA 2JK0A 2OV1A 3AFIA 5FEUA 4YRLA 1QANA 1N7JA 1N1GA 3B7PA 1UEXC 3FCEA 1XXHE 3EODA 2OYCA 3BMQA 1NV9A 3PEUA 1IUPA 5H59A 5E2IA 4DYHA 3AL0C 2QT9A 4FOTA 4B44A 3PPIA 1SNYA 4EY3A 1U0JA 2WZCA 4L9AA 2ONJA 3ZUGA 1D1QA 1N8KA 2BBOA 3RREA 1JR6A 5IX8A 4F5DA 2GN4A 4L50A 1FDRA 1YTUA 1SZDA 2XE7A 3IUJA 4XYEA 2ZYIA 2BFCA 2N47A 1PGJA 4A0HA 2WVAA 1ZH8A 1IE3A 3DEJA 2OHVA 4UM8B 1MO5A 3JZMA 4UD6A 2JLVA 1GGJA 1B0PA 1FS5A 1UT5A 4MRSA 3BORA 3I3SR 4MV7A 3JQQA 1GLGA 1NDUA 2G82A 5JNTA 4Q3OA 4OSOA 2V6BA 4KVGA 1IU9A 3HVHA 5BN3A 4CLRA 5LIPA 3HEAA 5JO9A 2ZQZA 2X1MA 2Z8YM 3SZRA 3BXOA 3E9QA 2L18A 2LV8A 4F6RB 3R75A 1IG3A 3IV6A 4IJWA 3E5NA 4QYIB 1BFDA 3NCTA 2NMVA 1EIWA 1A9ZA 3WWOA 1TVMA 2PT6A 2H5IA 4MKFA 1PIWA 1LPSA 1DBQA 2W2XA 3IDOA 4AY4A 2D4AA 2VAMA 3OQJA 1VGRA 1CJUC 1ECFA 1FNDA 2GCEA 2MWMA 2O07A 4G86A 4MX8A 4X66B 1EM8A 4R40A 3TZ6A 4XFKA 3SE7A 1L4EA 3C7KA 1KY2A 4ZYUA 3P9QA 4RVGA 3SZUA 1R8YA 1TAUA 5IYZA 1MHTA 4NPAA 5KTMA 3K9NA 2IIVA 1CUGA 2FPPA 3FUVA 3QBTA 4GT1A 3GEMA 2X6RA 3TF5A 1W73A 3K20A 5HFNA 4GMHA 1BQ4A 1G18A 1WLYA 1DZIA 2ZIFA 3SF0A 1MABB 2UV8A 4QXMA 5CU7A 1T9ZA 2QRGA 3H9UA 1V41E 4Q1BA 2DFTA 1I4WA 2Q49A 4KMRA 3FYDA 3ZOKA 5KKCA 1Q0TA 2X3FA 2OBLA 3WK8A 3AI7A 4LGMA 3GLFB 2R1TB 5JH7A 2WT4A 3B36A 2ZXEA 1G60A 1PWHA 3LMKA 4PNPA 1Q3TA 2EJVA 4TX1A 3TFQA 3AHHA 1GA4A 2X8JB 1JG4A 2RB5A 4HAWA 4XVHA 3EMBA 3TTTA 3VVLA 2F8SA 2WBLC 3JYLA 3O8QB 5DNWA 4ZO7A 4BDTA 2ZRQA 1UL1X 3CV3A 1UXHA 2H4XA 4CCWA 1V1MA 3AY6A 5DCLA 5DJ5A 4AJKA 5EZYA 3N87A 3RAFC 2XB2A 3EQ2A 1GNQA 5ERXA 4DLZA 3N2KB 1TO1E 1OBOA 3R0QA 2VCYA 3RW9A 3CNEA 2XZPA 5AM2A 5T6MA 1CDZA 2MYTA 3HFSA 4JLUA 3GJ7A 4MO2A 2ECKA 3DE3X 1F7UA 2RGWA 3O8BA 4QPZA 3K2BA 4KNYA 4C4RA 2HCBA 4A9AA 1DRVA 2EERA 5DLEA 3UJ8A 3H7AA 1UBLS 1QVWA 2Y1KA 3QTLA 1GGFA 1MX1A 3G9QA 3UK7A 1PNTA 4IMJB 3GPCA 1UFKA 2R1VB 3NC0C 4AMBA 2IGTA 3PTZA 2GN0A 1GZ7A 2Y8EA 2WSSA 5AFSA 3CLKA 2OVBA 2VF7A 2A9KA 3LYLA 3BREA 1M1NA 2GZSA 5IKEA 4I4CA 3M4YA 2R8EA 4EJ2A 1JL3A 2ZTLA 4EG6A 3HWSA 2BE7A 3K0BA 4JGBA 4U00A 2DFNA 1SUIA 4XDZA 1UINA 5G1NA 4A0GA 4C0HA 2FR0A 3D6NB 3HFRA 5DTJA 3AO0B 1VL6A 3F3SA 3GLRA 4TTJA 3T8YA 3ZVNA 4JWTA 1E9AA 4L6IA 1SQ0A 3PL1A 4M7PA 4NZPA 3HTXA 3FFBA 1L5ZA 4URVR 2Z4RA 2EOAA 4U7WA 4K46A 5JDIA 2IDMA 3SFZA 3PT5A 3QBVA 4DWJA 2IPLA 3A32A 4I3GA 4BO0A 2V65A 2GPNA 1XYYA 3H4VA 3HJCA 2D1YA 2I2AA 3P4XA 4HPWA 4JBXA 1NRIA 1SZCA 2WICA 3L01A 3PZRA 4K0RA 3O4RA 4L8YA 4RY9A 4YP7A 3VSAA 2VF4X 4R0MA 1LX6A 5JZ9A 1T0IA 1P2BA 1JH8A 1KDTA 5C46F 2W6ID 2W6OA 1UFOA 3GJ6A 5JYEA 1CSEE 3AKEA 4JVOA 3KEFA 3QNUA 1KQFA 4WHMA 2FQXA 1XQ1A 4HC4A 2NZWA 2C4NA 2WT9A 3PCTA 3RHTA 2P78A 3SN6A 3GUUA 5TQ0A 4HKTA 3ZGOA 2HBZA 4BE9A 3VJMA 1L6RA 4KN6A 3SC2B 1PR9A 4GX1A 4FX2A 2QBYA 4GOXA 3INGA 1OZAA 5C8DA 3EASA 3GLVA 4ALIA 3EQ8A 4BVBA 5AJWA 5AKYA 3E6AA 4YRNA 2IZ0A 4O4LA 3KL4A 1ND5A 4OQQA 1MT0A 3RTDA 1P0QA 3NWJA 4B83A 2P2SA 1MPXA 1IZZA 5A0FA 4KTTE 4X7RA 4CKXA 3GLUA 5BT8A 2CNKA 2XGJA 1Q0ZA 4PYOA 1CUAA 1JKJA 2I6TA 3Q15C 4DG9A 5KSOA 2AUMA 1RRPA 2DG2A 1W6RA 5IKMA 1NU6A 3GDOA 3R7FA 5I7OA 5HP4A 2H6EA 2I6XA 3ESAA 5KOJB 2PRZA 5K20A 1N6KA 3W9SA 1DCKA 4L3WA 2Q2NA 4MPDA 4RPGA 4K7JA 3HCCA 3CVOA 3NPMA 4IFEA 1DUVG 4LZPA 3VNAA 2VSFA 1Q92A 4M1OA 2CFTA 1ZJYA 3K70D 2W6JD 1BVHA 1VHDA 1YO6A 3JWEA 1T4GA 2JA1A 3K0HA 5HXAA 2D06A 3F1KA 4YVFA 4QOFA 4UTRA 3IR7A 4MCAA 2R87A 4CM1A 1N0WA 2IEYA 3OUUA 3DOJA 2RGXA 5JVDF 4XWGA 5HSGA 4FE3A 4BVFA 1QO0A 5A3JA 1Q1GA 2PUHA 2X6QA 2R751 2K2WA 3IJEB 3QE2A 1DMSA 3SC2A 3GLIB 1JQLB 3SK0A 4X65B 1F4PA 5HZMA 4QVGA 5JDCA 4PR3A 3LSTA 1C81A 2NYUA 1XWFA 5E8RA 1YZVA 4F3CA 2BCJQ 1ZCZA 1PZHA 4V0QA 1S89A 1XCGB 2Q4OA 1DTWA 3D8SA 1DEAA 3Q3VA 3B8EA 4JR1A 4RDHA 1M8KA 1CUXA 3LPCA 2B6NA 1NNSA 4OHWA 2AMFA 1CLEA 5IBRA 1THTA 3LY5A 3PGMA 4B4WA 4BLOA 4F2HA 1U8FO 1USWA 5F35A 3S2SA 2JFXA 3LDAA 2NU8A 3DBOB 3AF1A 3OA2A 4NYMQ 4X1KA 3V1UA 4G1CA 3JY6A 1MIOA 1XPOA 1JZSA 2CE2X 1JF8A 2W5UA 1E8NA 4BO9A 2C29D 1GDTA 1V1MB 3PD1A 1Z18A 1CRZA 4UZEA 5GM1A 3M81A 3D2BA 4GMXA 4JD5A 1L5KA 2NXCA 3I2IA 2GM5A 4NHEA 4ZGGA 5TNXA 1R6TA 1TC2A 3L6OO 3W2FA 2TMKA 3DFFA 1RC0A 2X2PA 3K70B 5I7AA 1IQRA 2B5VA 4LNAA 1AVTA 4UMFA 3TXXA 4E15A 5ICFA 1ESNA 1YQTA 3DZBA 1NFRA 4NXMB 2IPOA 2F9LA 3NTLA 4FYJA 1KL7A 4D6PA 2XLBA 3TO5A 3MINA 4YH1A 2PQMA 3T7SA 4E6PA 5LQAA 5IC5A 3VHQA 3U4IA 4QKQA 1V48A 1WRBA 3MCZA 4PEVA 3H3XA 4DMCA 3TUZC 1UJ2A 2BZSA 5ANRB 4A2QA 5EJ5A 1CC1S 4Q3AA 2GO7A 2CVPA 3GGDA 3BTSA 4WE3A 3CX6A 3B6EA 4TTQA 3A1EA 3X0DA 4CQNA 1Q7GA 3JQ7A 4LW8A 2DECA 3BTVA 2H1SA 1MB3A 1Z45A 4IX9A 1DT3A 5FWXA 5TPWA 4B81A 1JQ3A 1X80B 2NZYA 4XYMA 4JJKA 3CIOA 5EN4A 3Q87B 4EY5A 3RS3A 1KI1A 4FDAA 4MARA 1PV4A 3QE3A 2BP7A 4TM8A 3C15C 4RABA 2D00A 2CLIB 5HTOA 2FSVA 3OSZA 2L19A 5AM3A 1NXXA 1ZIOA 4DAOA 1P9LA 2XMBA 1KU0A 4L0DA 2FX3A 1OY1A 1A9XB 2JFYA 3O26A 1F3OA 4YRIA 1BEEA 2IVZA 1HURA 1U8UA 4MA0A 2UXCB 2AFHE 1YJBA 4DC0A 3ZCRA 2Z56A 2N0SA 3V1LA 4AJHA 5FR1A 2X9NA 3TGLA 4GLOA 4H1UA 2BGJA 1EVQA 4G4IA 4UPDA 4RZIA 4WACA 4TV8B 5I7RA 1XPUA 1M7HA 1M6VA 2Y05A 2PD3A 4TL6A 4WNYA 2V0NA 1VLZA 5K0CA 2FB9A 3HA3A 4IQ0A 3TZLA 1KMQA 2CXTA 3N9IA 3H8SA 1I51A 5PNTA 2BPOA 1Z4QA 3L04A 4MV3A 1QO7A 1RWQA 4RZHA 4XLLA 4Y6SA 1G6HA 4ER6A 2ISQA 4IFIA 2YBDA 1VE3A 4N7BA 3I6BA 2C4KA 1GZSA 4IGKA 4KQKA 4RTRA 1ODIA 3I9V1 2VPWA 2P1RA 2QLJA 3X1MA 3IQDB 3A1FA 4H08A 1WBBA 5GOZA 3GLGE 1FTWA 2AKEA 1EJ2A 3GP3A 4IGEA 1T4BA 3QF4A 2BEUB 1IC6A 4S1WA 3WRXA 4YR7A 2Q3JA 3K6KA 2E82A 5A9SA 3AUAA 5DH9A 4EB6B 2XF2A 1MGOA 1D4OA 1BXKA 4C29A 1Z4OA 1I30A 3UT5A 1MTOA 1YDHA 3LP5A 5T4BA 4ENUA 3GUVA 2OO5A 3WIBA 4YALA 4PCVA 4E22A 1L1EA 2QTBA 1ZIDA 3FDXA 1S2MA 2PGAA 4OJNA 3TB6A 3JW8A 4E5KA 3SU8A 2Q5HA 2QOEA 4HN4B 4OU5A 5AVZA 1W8DA 1EDEA 3AUUA 2VJYA 1UOEA 3DLPX 1JB9A 4INZA 5E7MA 4AB1A 2PUDA 3H1PA 1HYEA 4TZ0A 1SXGA 3ZLUA 5CT8A 4L85A 5KI6A 3NH9A 4UE6A 2RHBA 3HL0A 4D4LA 4Y2TA 4B3TB 2FJUA 2CJWB 3WKDA 3IILA 3LDGA 4YLYA 1C3XA 2XT9A 1CS0B 2DUMA 3OPMA 3VQTA 4UOZA 4D0SA 5IANA 1KY3A 3DTVA 4E11A 4DUZB 2H16A 1CUZA 2ZYHA 3KLNA 3OBIA 4O63O 2DLDA 1O96A 3JARB 4PGMA 5B1EA 1G7CA 1LLUA 1LVUA 3DW1X 2OA0A 2ZBVA 1T5TA 5CYPA 3H6HA 2IBMA 3EYWA 1JPUA 1H2ZA 4L28A 3DFKA 2Q5FA 2HF7A 2YZNA 4EW1A 3LF1A 3FMPB 3N2KA 1NP6A 5KYUB 2E37A 3AR8A 3S27A 4FBLA 2MSNA 4G5SA 2R1UA 4QVKA 5AVUA 5JAOA 3DT8A 1E63A 4MKXA 4M88A 1AN0A 1PR5A 1OW3B 2HHCA 1DBRA 1ZW1A 1RP1A 1KNXA 2F48A 1REQA 3OY7A 4MRRA 3A25A 5IBCA 2P68A 3JR7A 3ZY3A 3HKCA 3WYFA 3OQIA 3QVJA 1W88B 2EX4A 3RKUA 4NCKA 1E2JA 4LHYA 4CZ2A 1WQ4A 1ZK3A 2ZIXB 1BSVA 2JEZA 3HNOA 3JQ7B 2XOKD 3RSHA 2ZWIA 3GYGA 4BYGA 3U4QA 2HA4A 3RKSA 2E5LB 1AS0A 3IT0A 3R74A 1R0CA 3OTQA 4R1PA 1U7WA 2AS0A 2CJWA 3C5VA 5FBVB 1Z4JA 2IV2X 5JO0A 3CINA 3GZ4A 4HGNA 4BGDA 1UZAA 5J3JA 5AWFC 1Y7HA 2EKZA 5A5GA 5B53A 2M32A 3UJ3X 3UVEA 2YJ6A 1EX9A 3GRPA 4ZRNA 1TTPB 3ZN2A 1VCHA 3G82C 4DHWA 2I2FA 5B57C 2HX1A 1CK4A 4EVRA 2ZSAA 3WBFA 3ZU3A 1VHJA 5CDGA 1EDOA 3R7SA 3CRRA 3IQHX 5CT4A 1T3GA 1SUBA 1BYUA 1I4DD 2GR9A 3H2BA 3B1JA 3LNTA 4YRFA 5FYDA 4MVJM 4YIKA 4ZN6A 4BWYA 1SKAA 1JTVA 2ECPA 2IZOA 4MW6A 4EVSA 1P1FA 1P4JA 5CT9A 5CH3A 2FSUA 2NYAA 3HGMA 5MFPA 1NJ5A 1NUUA 2QNIA 4F84A 4ZMRA 1MN6A 3EBPA 3K9WA 3L5OA 5T3YA 4C87A 1QONA 4HNAA 1W4ZA 3U7IA 3ADOA 2YYYA 3L43A 2ZIEA 2M6KA 4R1OA 1V6CA 5IDWA 1ODTC 1HOTA 3FVRA 3F7TA 3SNKA 3TJZA 2WILA 2XUAA 3GLKA 1OH6A 1M6HA 3N8GA 4ARVA 3HN7A 3LTNC 5ARBA 3RS5A 3I5XA 2PHZA 4D9KA 4DABA 4RGQA 3RSGA 2WWRA 5L40A 4Q9DA 5J4YA 4LWZA 4P4NA 1VDZA 4WLVA 4RNDB 3WX0A 1DO2A 3ILHA 1B41A 1RJ9A 3KEQA 1BIFA 3SEZA 3F5MA 3QK7A 4A03A 1VKNA 3R5HA 5T8KA 1O0BA 4FUQA 3LLCA 4J1TC 5CEJA 4H1VA 5CPBA 2ZJ3A 3OM1A 3R9XA 4V0MA 3AR3A 1ZCJA 2IUTA 3MGCA 4OH1A 5E2BA 3WGJA 1E1DA 1I3MA 2YC2C 2VTBB 3EXG1 3FMVA 2PXAA 4NENB 4OSPA 4D4MA 3I83A 5C1IA 4N1AA 5IVHA 3AEKA 3EK2A 3KOMA 1L3BA 2R2AA 2CUTA 3I42A 4RVSA 1SBIA 5FB3A 4B47A 3PNLA 1P9RA 4XD7D 5LD2C 5HS6A 4UAUA 1Y6JA 1H2WA 2IHVA 4OHMA 2DCUA 4QYWA 5LQRA 3LVQE 4PYIA 3TQCA 4ERXA 5C4GB 3WSVA 1B6TA 1PYOA 4PO1A 2FSVC 1AUPA 3K9CA 2DETA 1GTZA 1C41A 3K1JA 2BHNA 1CF9A 2VRWA 4IH4A 4J7UA 3CUVA 4LYJA 4TKUA 3TLJA 2EFHB 6Q21A 4O4JB 2QZJA 4GL4A 1TKRA 3V8MA 4F3NA 1QYVA 2P69A 1RXSA 1M0EA 1OV6A 3QA9A 3BKXA 4JP1A 3VSDA 1Q0UA 1GV1A 4M8KA 4QBTA 4ITUA 5CDSA 4XE5A 3I4CA 1VBFA 3IKLA 1VKHA 2EU8A 1FFAA 3O94A 4ETWA 4CPDA 2YASA 4V0SA 1F8YA 4BOYA 4IIFA 4G37A 1PR2A 2PWBA 1QCZA 3NXKA 1RPNA 4OLAA 2HD4A 4FXPA 1BW9A 1Y9DA 4H16A 1ZITA 5HX7A 1WX1A 3EVAA 4ROTA 1ABBA 3RUEA 5CB0A 2G25A 2X8LA 5DNVA 1AU9A 4LY0A 2C99A 3SYLA 4RD4A 1X7DA 4UEKA 5CVJA 2ZAYA 4WNAB 4AJEA 1C7IA 2VATA 2X8AA 2W71A 3KYJB 4RKQA 1IQ0A 3D0QA 2PZAA 4NOLA 1ZH2A 3DMPA 2I3AA 2B0JA 2IXBA 5JY1A 1ZW6A 1DAMA 2OC4A 4DADA 1E1QA 1AUQA 1LW7A 4TMZA 3SMQA 4Q7QA 2B92A 1JHYA 1PZXA 3D7RA 3QH4A 5CNJA 1FFYA 4OD0A 1CEXA 3EZFA 1OFUA 4JQZA 1ISFA 2Y27A 3LIIA 3EG9A 4Q1EA 1FMJA 1ECJA 2IYYA 3FR8A 5FWDA 4H6WA 1NF9A 1L4GA 1EJ6A 2PT9A 1W4AA 4F85A 1X3SA 4DJJA 1NXTA 1S2GA 2ENUA 1X8JA 1FQJA 2CZQA 2ZT8A 1CW2B 1ODKA 1JA9A 3A37A 3ITDA 4J29A 4AIIA 4UTNA 1VPWA 1KRXA 1K8ZB 3OP4A 5DM1A 3AUYA 2QAGC 4EEKA 3ZV4A 3OJFA 4DFDA 3E2MA 2X3UA 2OBXA 3KUCA 3OY2A 4JJEA 4BATA 5LA6F 1SY7A 3BX1A 4OREX 1MMFB 4WN3A 4C6HA 1Y5MA 1ELOA 2ZUWA 1FY2A 4QOHA 1D2RA 1H0SA 1ZC4A 2FOXA 4E51A 3H5WA 4JLBA 4AW9A 1G64A 2QUZA 3C98A 5CLQA 3QE9Y 1UKZA 3DC7A 2ZRMA 4BB9A 4LJYA 2Y4NA 2WJVA 2NUBA 1JPNA 3RBAA 1EVIA 4G1BA 5FL7A 3WC4A 3SD7A 3ANMA 2BEJA 5EFOA 3PWZA 4LZLA 1RTKA 2HHAA 4QE3A 5IKPA 3UKJA 4A8JC 1JVBA 1OZ0A 4FDMA 1MV8A 2GCOB 3AV3A 5EE0A 4CL3A 3EGDA 4US2R 2QTCA 2FPLA 1VJRA 2V74B 4J7AA 4RPCA 4PNHA 2O6LA 1E5QA 1HBJA 3ROEA 3M0EA 1BS2A 4PC3A 4BRUA 1NL3A 4XRRA 4EDHA 1FTQA 1GPUA 4EO9A 2ZRIA 4EF6A 1Z5PA 3ZJ4A 3SFTA 2EKLA 2C77A 2CMFA 4JUFA 1LS1A 1Z73A 3QXSA 3WSWA 1RAEA 4J0DA 4CTOA 2D3WA 2VAPA 3MQ4A 4D2IA 4PZ9A 4Z7QB 3QFFA 3CB2A 5IDQA 2HCTA 4FWBA 5H3HA 1ECPA 4UVHA 3KB2A 4DDUA 1ZJZA 4MYUA 1L5HA 1N7HA 3CE9A 3KK0A 1T8TA 1WABA 2EL9A 2PS3A 2O54A 5ALRA 3E5RA 3NHJA 3EDYA 2JD2A 3DKPA 2A5LA 4ZGWA 2J9RA 4KR9A 3W6ZA 3QVGA 5CM8B 2NSYA 2QMQA 3HADA 1Y0BA 9LDBA 2FEAA 3AETB 3NBFA 1GNLA 2FW9A 1RZUA 1QDUA 3LTEA 2C04A 2YJ3A 3B60A 2REQB 2VA9A 1GTMA 4O08A 3A9RA 5J2TF 2GM3A 4QTTB 4EATA 3ZJVA 1GPNA 3NTOA 3MTAA 3QEOA 2LGJA 3KKOA 3L7OA 2H2AA 4UVGA 4YRGA 4PO3X 3ZCUA 1NN0A 2O7SA 1JU9A 4G0OA 4BE4A 1K6JA 5KQRA 1RC8A 2Q2WA 1XZKA 2QAGA 1P6UA 2HO5A 2SKDA 5JI2E 4B6OA 3LT5A 4V1CB 2PMCA 2CB0A 1FUYB 1G1AA 2Z2JA 4RQUA 1J49A 5J2UA 4DR7B 1U28A 4EGJA 3FFWA 4CKEA 4PGFA 3BZWA 2QY9A 1RADA 3DLIA 3VBEA 3IOYA 3RBZA 5E7JA 3V8QA 3V8NA 4ZHQF 1OGIA 1QHHA 4QDTA 1J8FA 1PEKE 4H77A 4ZEWA 1C30B 2QS9A 3DUFB 2QW1A 4L07A 1V1RB 2W8ZA 1L9KA 4OP1A 3IOBA 5JCPA 1OTHA 1VG8A 5TGZA 3FI9A 1YL6A 2EP8A 1XAJA 1HDZA 2NAFA 3N2LA 4HDOB 1WSDA 5DCWA 5EZQA 5IULC 1Z0KA 2X0RA 1GG9A 3HCEA 3TQHA 1H2FA 4HNGA 4YNBA 1U5BB 4OPMA 4UXJA 3VGJA 3WOVA 3DBHB 3E58A 2EATA 4JWKA 4D43A 1B6RA 2NO7A 3BXFA 3FWYA 3NOQA 4JLSA 1N0IA 5IABA 1W1UA 4HPJB 2C0PA 4I55F 3M49A 3MT9A 2XEDA 1EM8B 4JODA 4PGAA 3DCJA 4M76B 2DHEA 1WVMA 2L82A 4ZT6A 3X1XA 4NESA 5TC4A 1JQBA 2EHDA 3LT1A 1KO5A 2CMDA 5BWLA 1IVSA 4V0OA 3NHUA 4DHEA 3P0FA 5F3RA 3RS4A 3IBYA 3Q85A 1YL7A 1PE0A 2FN4A 4NU5A 2I03A 5BY2A 2P2NA 2F9MA 1TZ2A 2Z4SA 1KOLA 1YJCA 4Q93A 4ZWNA 5FV4A 3WWEA 3AJEA 4O02B 4W5RA 2I80A 4GOKA 4L0QA 4TN1A 3UJ9A 5KEIA 2CZCA 2F3SA 3VGPA 4DF3A 1B93A 3T7KA 3ERCA 1VSTA 2PXXA 3WE7A 1TRKA 3FYCA 4KQJA 2DUUA 1J0XO 1SU6A 1P81A 4G63A 1DRKA 3QIAA 1DSSG 1SC1A 3QEJA 2O1EA 3DBLB 4RAQA 5G0WA 3TBKA 5AVTA 5JLJA 3ZJTA 1T43A 5FOQA 1DX4A 1E9BA 5JHGB 2QYSA 3RAJA 3TLMA 4MHTA 1LPNA 4JVMA 2YCLA 4RH0A 3K8QA 3PGA1 5EESA 3T7CA 1IZ7A 5B30A 1NAHA 4HK4A 5CYFA 2YV5A 2PCJA 3NV7A 4ZVKA 1YVDA 4NBUA 5JPIA 3OOEA 3S1AB 2ZJ4A 1WUYA 2R47A 3I9LA 721PA 5FA6A 1XZBA 1XZJA 2J4CA 3FSGD 4P93A 1L4FA 1TM7E 1OB5A 3DB2A 1K7XB 2WIDA 2BL4A 5D5HA 4XUEA 3DLAA 3C24A 4NZMA 4WA8A 1KYXA 3P7MA 3SYRA 2LNDA 3U7HB 2ABWA 4R2MA 5FTKA 3R5KA 3RAPR 3CT4A 4JL8A 1F20A 6REQA 1V4BA 3ICOA 4HUTA 4LCBA 4YMUA 5MFZA 2DULA 1AZSC 2Z9DA 2WF5A 2EWVA 4WCFC 4DGSA 3DB1A 3OPYI 2ZP1A 2ATEA 2E4YA 3N6RA 3PV0A 2AEMA 4MUYA 3OIDA 2RJNA 1KXJA 1H8ED 3NEPX 1ZD9A 4ZIRA 4UUAA 1GG8A 4OHKA 3D8TA 3HJRA 3IPCA 4KSYA 1YBFA 2KJQA 4ZZ3A 3K6SA 3ZBQA 2Z6VA 1EBUA 3R4CA 1UKBA 2WWIA 2Y99A 5J5AA 3T7DA 1QFYA 1U2TA 3DHEA 3FPJA 1LRJA 5IM4F 2HRDA 1R8QA 4IF4A 1WMBA 1K7FB 2FR8A 3VJLA 4Y9TA 2BTQA 4G23A 2XV1A 3TVDA 1SZPA 3W5AA 3QNWA 3AGPA 1R4MA 4D0RA 4X61A 4DB4A 4W7IA 1XK7A 2LIPA 1LBIA 2OZVA 1K8YB 3GFPA 4CCYB 4HVLA 3WGIA 3U5ZB 3IMCA 1NT2A 3AT1A 4H7PA 5DYIA 4RKEA 4OIMA 3KQUA 1V95A 1K8RA 4OG2A 5JDCC 1Q77A 4LXGA 3ZD9A 3QUQA 2PSEA 5DASA 4S2UA 4QYXA 3W2HA 2CNDA 1EXMA 2HWUA 1EP9A 5C18A 1NYRA 3LHIA 3V4VB 1Q1QA 3H75A 4QXRA 2QRQA 4CR8A 2NTNA 3HUDA 4NCHA 4RXTA 4WXHA 1R5JA 1PLKA 3TTYA 4G89A 1KNQA 3I37X 6NULA 1YVEI 2BFEA 1NLUA 4C21A 1ML4A 2ZJZA 3L7JA 3HDTA 3B1VA 3RK4A 3W1VA 1GUAA 1L7QA 1SBZA 4G07A 2J3QA 2WIFA 1KR5A 2XYPA 2IQ5A 1WMFA 4L4XA 4PHHA 8ABPA 3HVKA 4WCDA 1MVNA 1B16A 1RRKA 5TVGA 2JASA 3EIWA 1WXHA 5KOYA 4QU0A 1MFZA 1JQJC 1NE2A 4G8CA 1X7GA 1SN7A 3DPUA 4DIKA 3EXG2 5T4FA 3TL6A 2JCYA 2IUSA 2B1IA 2CL5A 4IV0A 2DHRA 4IFTA 3TMAA 4IM7A 2BFFB 1XCMA 5LWHA 1YT5A 4GR4A 4OUKX 1SR8A 2P4HX 3MD9A 1DAOA 1DCTA 3P4UA 5FFFA 5K3BA 3I45A 3TR5A 1T5SA 1PVVA 4NPHA 2CJPA 1ABFA 4GZ5A 4XX0A 2M6LA 2R65A 4CM4B 4ZK6A 2W42A 4G1EB 3W2EA 3UJAA 3X3HA 5IMSA 5CIQA 3ZJUA 2HU5A 4PZAA 3SNHA 4KIFA 2C7QA 1JDNA 1W4LA 2JGDA 5E0OA 1J8MF 3U3ZA 5COBA 4DNXA 3L4JA 3L7LA 2I3DA 3FBTA 3ADKA 2PX0A 3I9FA 1J9EA 2J7PD 4F4CA 1K5GA 1UQUA 2DT5A 1P5FA 2EVWX 2GXUA 3BD6A 3EXHA 4WOCA 4YP6A 4ESOA 2XQGA 1JG7A 4YCAA 2XWQA 3JRXA 4W5JA 2RHTA 3HMKA 2PXHA 1J9ZA 3ILYA 1SCAA 1MGPA 5HF6A 3AV0B 3GPLA 2GYVA 3COVA 3OQPA 3S2GA 2B5OA 1N34B 2NXJA 1AK1A 1N2XA 4QRDA 1D2EA 2B7CA 1ICIA 1QHEA 4I5FA 4LXUA 3SC4A 2XCSB 1VG0B 3NAQA 2XNKA 2B20A 1RYZA 3OZUA 2YXNA 5PGMA 3N7TA 2HFKA 3UWDA 4MJXA 4WJLA 1P1CA 4HT3B 1JALA 2ZJ7A 3K0FA 4QATA 4BO4A 2PSSA 4PICA 1I4TD 4AMZA 4RL4A 4QULA 3GF4A 3MOSA 3PNSA 3RRYA 2HQRA 5KYWB 2G72A 3T9EA 4B2PA 1MXFA 2JI6A 5CW1A 5ELMA 5LC1A 1PFYA 2BZ1A 3IDFA 2G06A 3HLKA 4IDQA 1W8IA 3EN0A 3VSBA 3IJRA 9ABPA 4D6YA 1YC5A 4K9KA 4B32A 2OBFA 2XR1A 1SIUA 2R5NA 1XRQA 5BR8B 4JI8B 1AA9A 2AJCA 3N8HA 4WFJA 1YR3A 1GIAA 2FLVA 4DQLA 3O73A 4YN3A 2I7CA 3IBGA 1GLVA 3R9IA 2DBVO 2FHSA 2WU8A 2DLCX 2VT7A 3I5YA 3D3NA 2VNHA 3GRZA 1I33A 3ABQB 3DF9A 2B6HA 4M0EA 4QBHA 4JB8A 3TOCA 3ZE1B 1CYEA 7GPBA 1A71A 4PLVA 4JI4B 2R5FA 1XTRA 3STTA 4FILA 4FGWA 1MOPA 1TMGE 1E1MA 1M66A 1VM6A 3EF3A 1HTTA 1VE7A 4KIUA 5TQJA 2C4HA 3W79A 1Q95A 4K9DA 4QUBA 3GJ8A 3MLAA 4RPKA 4I1PA 5EWJA 4KH1A 2GF9A 3NBKA 3ETHA 3PNQA 2FZWA 4KHPB 1P75A 2ZAOA 2PIAA 5TIIA 5HZHA 3TK1A 4Q7EA 3O1IC 5HK8A 3LY8A 4U1RA 3WGOA 4ARZB 1F60A 5DTIA 3E1GA 5J4KA 3KPUA 3QQPA 3DQQA 5ER9A 3BF7A 3CHYA 3SIWA 4CV2A 1JWLA 1VA4A 1EFVB 3GGJA 4KIJA 4Q24A 1O6ZA 4LJRA 2YMQA 1J5PA 2QJTA 2QI9C 3IPRA 4U9HS 5CURA 4ARCA 3MMXA 4I1UA 5F3DA 4ZJPA 3TSYA 5JAQA 4DV7B 4Y6QA 5GZ1A 4YASA 1J1IA 2ZS9A 4KO1S 2ZYWX 4DNPA 1L7DA 4Y9RA 3TQSA 3PR1A 1FRQA 2PVCA 2C82A 1WB4A 4G09A 1CJVC 1UK6A 1SIOA 3OM8A 2IXDA 2JGRA 2JGFA 4LWQA 4Q1CA 5CXSA 5DX8A 3ZHXA 4DUGD 5C81A 1OD6A 5KJFA 2I4OA 3BGVA 1O58A 1J00A 4P5PA 2BGTA 3K5IA 2IUUA 1U5BA 2WPNA 1S8OA 3KB6A 1RRFA 2CUZA 3FNRA 5L53A 3PQ2A 1X38A 4X7PA 3KQNA 4F3RA 1ZJ6A 2PA3A 3C85A 4D26A 5AXCA 2C8VA 2FHPA 2OL4A 3MINB 1ONNA 4K26A 1T15A 4GXTA 4FE7A 3TNJA 4DDHA 2FPGA 3MTDA 3WDKA 3CO5A 4DRXA 4HAYA 3AHGA 3B6JA 1HKUA 3O91A 4EYQA 4H1TA 2X7XA 3CFYA 2JIZA 3LXRA 2RG7A 4KQ1A 1RIFA 3CUKA 5DMHA 1YZQA 5K4AA 2ZYTX 1WZUA 5KKAA 1FXWF 3EA4A 5HK9A 2FW1A 5DHTA 2Y71A 3C1TA 5DU2A 2CJFA 1HRKA 3YASA 1DFGA 4F12A 1X1SA 1AUVA 2G76A 2QUKA 3PFBA 1KK2A 3AVXA 1W0JD 1PNOA 3PYLA 1T0UA 4HWOA 4ARIA 1WDMA 2QR2A 4KVAA 1UC9A 1DKNA 2O2EA 4KXNA 3K71B 2H3HA 1YZUA 2NU8B 3TCXB 1IZ0A 4MA4A 1NQUA 3N59A 5E2AA 2WP0A 3PQ7A 3VMMA 4CEIB 4WASA 2ATXA 4TTAA 1EGHA 4BZQA 1JYSA 2FUKA 4KMSA 3N5KA 5BVHA 5CA1A 2IXEA 1RYDA 2Z3ZA 4U7HA 5LOVA 1X7WA 1L7PA 5FPYA 3VVBA 2P9ZA 2OAEA 4C5CA 2KYRA 5HCIA 3VC2A 1NASA 1QG4A 3FJ1A 2JI7A 1HC7A 2WPDD 1X14A 3OJCA 4X8OA 3U3KA 2PN1A 4JYAB 3VI4B 1UIRA 4GI7A 3GO4A 2FSHA 1A88A 4XM2A 2XQFA 4NCNA 4DT1B 2Q21A 2D5CA 3EIUA 1AB6A 1I9GA 2O0HA 3BUSA 4DQUA 1ZAYA 1NP7A 3UTDA 4LDAA 3RHFA 3TI7A 2QMEA 4BNDB 3ORSA 3NQ41 4WKGA 1Y5LA 3J80A 1D07A 2AFIE 1R88A 3KJQA 2IL1A 2YDXA 3FOAA 3K0KA 2APJA 1DARA 3H1BA 1ADJA 2XUZA 2OXRA 3ASVA 3GWZA 5FQOA 3EVBA 4KQ2A 1GPWB 2R86A 9ATCA 1R8JA 1YB5A 4FC6A 1SKYE 2HZ7A 4BTEA 5D1NA 1C9JA 1XRMA 4ZCPA 4AZVA 1YZ3A 3WRWA 3UC5A 3CT6A 4KO2S 4Q48A 3JR3A 5J4VA 3DDCA 2GYUA 3JWPA 3MUFA 1YFJA 2YN2A 3R4VA 5DFAA 3WRYA 3GZNA 5KTNA 3KT8A 4JB2A 4KI7A 1XDGA 4NYMR 4TV8F 3UYKA 4NMMA 2B83A 1F17A 4L8WB 1AS2A 1NMQA 3LXUX 4OQNA 4BNVA 4CF6A 1LCIA 2WHRA 3C6XA 4KPYA 3N6XA 4WKOA 2AHRA 2ZTVA 1EFPB 3FCUB 4OU4A 4BS9A 5IJ9B 1NPDA 1TXGA 5LCXA 1WPGA 3HKEB 4JMLA 2VT2A 4OY3A 3LPAA 2WA2A 3BFXA 5FPTA 3U4GA 4XYLA 5LWQA 2RG1A 5K0FA 2VJAA 5C34B 1EBFA 4IGIA 2PM8A 3TKAA 2ODQA 1P0FA 1O54A 2I66A 4HDKB 4P3YA 1KDYA 3JQAD 3AF5A 3GEPA 3VOBA 3SJAA 1OI3A 2H7YA 3QX3A 4I3FA 1NBMD 1TKBA 5AVXA 2O0JA 1OR8A 2QX4A 3JARA 3X1WA 4BB0A 3KOZA 1JKIA 2M6SA 5FOSA 1EDBA 3IL2A 1JH9A 2CFOA 2WD8A 4ZVQA 2QYTA 3PQEA 1EHCA 3TLCA 1EMDA 3PUXA 3VR5D 1T34A 4GZMA 2BMAA 4ZEVA 2YNMC 2ZIUB 5F1KA 1XD2B 4JS0A 2G77B 2RAPA 4L5CA 3U44B 2PGLA 1R5BA 3N8DA 4GOND 5SZIA 2XWBF 1AV7A 2C2XA 2HDOA 4FNMA 2ZETA 3FDJA 4EW6A 4ZVUA 4RTQA 1FSPA 2FPKA 3AEXA 2PZEA 1FVFA 1Z26A 4BNJA 3ZUPA 4BO7A 3G6WA 1RJFA 2ZI3A 1N1DA 3LOUA 5FADA 1YKFA 1JAHA 1TADA 1Z8DA 1WKVA 1WXDA 2PY6A 3SJ7A 4GBED 4EA8A 2RCNA 2RMKA 1TJ5A 2ZDGA 2ES4A 5FWYB 1JI3A 1Q15A 1FC0A 3INYA 4XARA 4XGNA 2W2NA 2FEWB 1E1CA 3PA8A 4GOLD 1ADGA 2E4UA 2IYTA 3KWJA 3HEMA 4N6NA 5LDHA 2G1KA 4AF7A 1RPAA 4L6CA 4C7OB 4RK1A 3IMFA 4HAUA 3P96A 1F6BA 2BUCA 3HCBA 3TG2A 1DQRA 1JI0A 1W88A 2YFKA 2JF0A 1BW9B 3UT0A 2YS7A 4J0CA 1T26A 3F8SA 5BWOA 2POCA 3CUSA 4HF7A 4OA8A 3RVDA 4LRUA 2JC3A 2WB2A 1SWVA 3IEMA 2JLWA 3HJAA 5DSTA 3UC9A 1S2OA 3AZPA 3EC2A 5K7SA 2VDNB 1Z2CA 4H18A 3UBMA 1IUNA 4JQOA 5B5SA 1VLQA 4INOA 5C0OE 2ENWA 1VZ3A 3DEIA 4MRMB 5DGDA 2BJWA 1Z8HA 5IAKA 5LOVB 2CMHA 2ZJ1A 4IOJA 5KUTA 2HPVA 1H4VB 1QTNA 3EXHB 5DMXA 2OEPA 3AHCA 3E3AA 2GTHA 2PAFA 3JD3A 1II0A 1BX3A 3WDMA 3KSAC 3ODGA 3L49A 3HB0A 3ESQA 1G21E 3CUYA 3DOUA 3O0DA 4BEJA 3MZ0A 3HSYA 4YMTA 5LFAA 1AV6A 2GNPA 1V5WA 3EFEA 3NBQA 1XP8A 4MUEA 4RCZA 5AQ1A 5AOCA 3OD5A 4KQMA 3W77A 2B36A 2MDTA 1KXZA 2FF5A 3F4LA 4HQFA 2ZGVA 4Q4CA 5H16A 4BO3A 3MW8A 1ZZGA 4MUNA 2Q3LA 4JI3B 4PZCA 1DLIA 3VO1A 5IH7A 5CD9A 1X9IA 1RXVA 1RKXA 3N07A 3J7AC 5I48A 2WG2A 5LL6P 2ZSEA 3G1WA 2WM9B 1II8A 1R3UA 4LFCB 4LK2A 3ROZA 1HH4A 3T99A 4S0ZA 1W5BA 2DPXA 2J48A 2FDRA 2IZZA 3LGAA 5ERYA 1NVTA 3WSTA 1RXWA 2JW5A 3JQCA 2KLBA 4HH1A 4BNWA 2P0YA 4COKA 1W2HA 1KAGA 2JDID 1VI5A 5ARDA 3FSEA 4M87A 5FI0B 4XQ9A 2HLPA 4AL4A 2XVXA 3TOXA 4XUGB 5EE1A 5LKRA 2H2HA 4HZUB 3VXKA 4U3JB 1M74A 4PN3A 1VB5A 4OQLA 5BW5A 4HDMB 1JA0A 2XW6A 3MRSA 1R9MA 2D2FA 3DQZA 4PZLA 2LVBA 1PBNA 1YV9A 3AP1A 4UXHA 2DWQA 4U0KA 1R00A 3KLPX 2X8BA 4HI0E 4KW7A 1DPFA 2A4KA 2VJOA 1OZGA 1N2CE 4NQRA 4AYWA 1DQYA 3T38A 4BIIA 8ADHA 4E2ZA 4OGLA 3TQFA 1JHMA 1UZNA 1U5CA 4NU0A 4XA8A 3H9CA 2IH5A 2AXPA 2C2HA 4CEJB 3ZHCA 2O1SA 4MV6A 1EP1B 3UMBA 3D7SA 1ORIA 1Y3DE 1JN0A 3OZVA 2GD2A 4ZOAA 1Z4PX 2W6NA 3H17A 3F1LA 2OB1A 1YACA 4MYHA 3EMKA 3UUEA 3I9OA 3COWA 5KJEA 1JXMA 4OAQA 2F1RA 2YL2A 1W87A 1CNEA 3UXYA 4R6XA 5AHWA 3TZBA 1EGQA 4FMCB 2W2OA 4Y1FA 4EA6A 3P2IA 3C3PA 5CBKA 4BQPA 1BD3A 1I7NA 4YJGA 4NYIR 3F2IA 1G66A 1RMQA 2GCGA 2V1XA 1QF9A 5BMVB 3TI9A 4EFLA 2VDWB 3IQIX 4OATA 3AIKA 4BQRA 3WJ2A 2EWWA 3M9XA 3ET4A 2SBTA 5ALYA 3VZRA 5LPNA 4KITB 3KLBA 1M1YB 1XF1A 4OHBA 4UDOA 5J1SB 2Z1DA 2OY0A 4O25A 4ZYTA 4LBYA 2P9TA 2VXCA 2ZIXA 1DG3A 1A5AB 2CEAA 2IYRA 1QYWA 2R6HA 2UXDB 4CKEB 2QRKA 1PX2A 1Q17A 1EK1A 3BWMA 3LBIA 4PR0A 1ZR2A 1X86B 1YMQA 1NWCA 3MXTA 4P7KA 2GHRA 2R60A 7REQB 5K3DA 1NN3A 2BFWA 4ZYLA 1POXA 4IVQA 2DQSA 4ZOLA 2HUPA 2C3YA 3I9MA 5EQJB 3WNVA 1T2CA 2G5TA 3BXZA 3OX3A 4E2XA 1KDRA 3FYUC 3FZQA 1DHRA 1E2MA 3D3WA 3FKQA 5CB4B 5IJ0A 1LLCA 3WQQA 1THGA 4MS3B 4I6JA 3CEJA 2P9HA 2K6GA 5CK5A 1C3OB 3KXLA 4KQIA 3TOVA 3ZBPA 4E70A 5GGYA 1C0KA 4R6WA 7MDHA 3H7IA 3OBBA 3OCWA 1BXZA 4MYCA 2RKBA 4BX9A 1QC5A 2HMYB 2ICAA 2ZBDA 4R54A 3UJCA 1NV8A 4CLOB 1SXPA 3UJDA 3ZHSA 1P2DA 2QD1A 3KWLA 5BUZA 2WHPA 4LRXA 3RIMA 1PSZA 3UHPA 1DVRA 4A10A 2AJ8A 4DMUB 3PDCA 4MDYA 3TW8A 4EF4A 3AYXB 2HMVA 5BYKA 1FFDA 3WIDA 1YQXA 1AC5A 3HCAA 3HJBA 4M9SA 4L78A 2XECA 4RFVA 4D0GA 1TM1E 2PRSA 4MMYB 1KARA 2HIHA 3DMFA 1N2SA 4R9SA 2X4LA 1GQ2A 4W7HA 2UYHA 1WZIA 3L6UA 4GKKB 2YXEA 2CHGA 3SEFA 3R41A 2ODNA 3F3YA 4P82A 3T5CA 4YP5A 4ZJZA 3UGQA 4RZQA 1O5TA 1A9YA 2BM0A 3BN3A 2D2EA 4JBWA 1S3IA 4QA9A 1J2YA 3AEZA 3FTCA 3WQSB 3IAS6 5G0TA 3PC3A 1JFFB 2Q7DA 3STHA 3T5DA 4HCJA 4KXLA 4QDZA 3C3DA 5EHXA 1RCTE 1P5JA 5DXAA 5FUQA 1PT5A 4GFDA 2PMDA 10MHA 1RW4A 1SPXA 4BZWA 4WFIA 3UMRA 1OYOA 5B1DA 1TZJA 4XAQA 1X7ZA 3WB0A 4IYJA 2VSNA 1HDYA 1ZN9A 4DQXA 3DBHA 4V1CI 1AQYA 1LJLA 1RKBA 1Y5RA 2H07A 2JD1A 3KXPA 3QX9A 4TKMA 4TLAA 1L4UA 1E0JA 5TY0A 4AN4A 2DUNA 5IUNC 4YAOA 2YOGA 3KHSA 5BYAA 5H80A 3TLAA 5FBWB 4M0CA 3THYB 4F46A 4L3OA 4W63A 4MVCA 5B55A 1USGA 3W8RA 1P31A 1TCCA 4ROSA 2XSZD 2AG0A 3RIYA 4I1IA 1FUUA 1UWVA 4JUBA 3PFKA 3FKSD 1GTL1 2VEDA 4UAJA 2WNHA 3KVYA 3ZY5A 1GD1O 1Z2AA 1JMKC 2I6GA 4OQDA 3HK2A 1BQEA 4S35A 1WVGA 3VPGA 3ZWAA 4B85A 4II7A 3CX3A 2EFGA 5F7JA 4EI2A 1RRCA 2BMFA 1LX7A 1NM5C 1Y4UA 3H16A 4O2BA 1TUGA 1GKKA 2YJ4A 4MIKA 3SJCA 1OIVA 3W7BA 1X1BA 3CH6A 3OHMA 1ZXLA 2QZSA 2VIIA 4LCJA 5HIMA 5JANA 2O3JA 3K6SB 2FCRA 3BZBA 1AK9A 3EFOA 1UMDB 1WO8A 5FO0A 3T1QA 3TW6A 4YYZA 1UR5A 2EAUA 3NHAA 2G4VA 4Q3CA 3U3OA 2IXGA 3LX8A 3WNCA 3C5CA 4B3CA 4M49A 1PT8A 1ZQ9A 1IY8A 1QOZA 2VAWA 3ESRA 3PDUA 5K8IA 1D5CA 4NBSA 4RESA 1U9IA 4LYDA 2DQKA 4G9BA 1P7VA 1G41A 2B2CA 1U1EA 1SBHA 2CK3A 2JLRA 2FWJA 4P58A 2OV8A 1GUBA 2IYAA 1SHJA 1T2EA 1FFWA 1R74A 4LHSA 3JQGA 2P1ZA 3JTEA 4FR0A 4F7DA 4V39A 4FBMA 1BQ3A 1C2TA 3PJGA 2VDQB 2X76A 2C95A 1P72A 2C88A 3SSOA 2VA8A 5ENVA 2BT4A 2VRNA 2VNSA 1YE3A 1MABA 1QIKA 1P0CA 2GN1A 3B5IA 3PENA 3C8HA 1Q1AA 1V8BA 2G28A 4FEGA 4JQSA 4NAHA 3VYTB 4BMXA 1NX9A 1SHUX 1D6NA 4ZV9A 5DGTA 3FVQA 3ML1A 4NRDA 4PZUA 5DLQC 2ZZNA 2ZLBA 1J42A 2P9BA 4FEEA 4NFSA 3UB3A 4LZJA 5D6NA 2D1TA 3O4FA 4Z5XA 4E07A 3BH6A 3W4KA 3O8QA 3COJA 4O1HA 3LDUA 4R98A 2YTZA 2JBWA 1T2VA 4TV9B 5I5EA 2WAXA 5KAMA 3KO8A 1VSVA 3MTIA 4UTOA 2UVDA 3SHWA 4Z4QA 1M7GA 1P4GA 3CUUA 2NZVG 2OR3A 3P20A 4K2HA 3M5PA 4QJIA 4EHJA 1XEXB 2RHWA 4KC0A 3NJ4A 5ECGC 4PG6A 3USCS 4AZTA 5FT9A 5HUQA 2PQ2A 3EEFA 1FDUA 1L7EA 1MOQA 5BW6B 3STYA 3DM9B 1UPXA 3EDQA 4ZOLB 3KSDO 4YDSA 1B23P 1XDZA 1KBZA 4ID9A 1Z4KA 1IK6A 4YLGA 2XMCA 3MUOA 3C3AA 1D0IA 4C1BA 4RS4A 2DPLA 5D3KA 2E4AA 4ND6A 4R3WA 3HDJA 1ZQ1A 1VPDA 3MWEA 2XNCA 1F0NA 2O1XA 1ZESA 4BFYA 3K05A 2YKGA 2FMIA 2O3UA 1TECE 3EEYA 4GGPA 3G9TA 4WRRA 4FFSA 1RD4A 3VRHA 1N5KA 1YFZA 2IU4A 3V6LA 3WNBA 5JNWA 2FWIA 3B13B 3M2TA 3MF4A 3HDQA 1FDVA 4KP7A 3AFOA 3DE2X 2SNIE 2H4ZA 3JQEA 1KJIA 1XL0A 1V9LA 4MAMA 1DNPA 3ZU5A 4FBGA 1ZUNA 4OAOA 5JCOC 4DLPA 4C78A 2GPAA 4NE7A 1TQ2A 1ES9A 4GSKA 4HUJA 4XWAA 1JEYB 1QGAA 7MHTA 3L4BA 3ABOB 4KDCA 1XMOB 1G98A 5FBKA 1FTYA 4TZTA 4Q3BA 3W7VA 3ZHOA 5J63A 2VBGA 3PNMA 3T3EA 1DT5A 2V7EA 2ZRJA 1SCUB 4WKCA 2BCEA 4BEBA 5BNFA 1UPCA 4I46A 5LDGA 4RZ2A 3SXPA 2ATCA 1P4HA 3NKLA 4LBZA 3QITA 4D3XA 4DIBA 5EJEA 4AZ0B 4F3KA 1G19A 1SFRA 5L3RA 2ZIWB 1TF2A 2BEKA 3M4JA 5HNKA 3D3KA 1UWLA 3FNQA 1IBLB 1ZVJA 1C8LA 1I1QB 3THWA 3GCZA 1W25A 3EQ9A 2PU7A 4RBNA 4N3NA 1X1DA 3LC0A 3UY4A 5IH3A 5MDHA 1J56A 1MHPA 1GKUB 3EPLA 1BDMA 2VK2A 2HLDA 4ZXFA 3HACA 2FSFA 2OZLA 5EOVA 1JSRA 2W8BB 2DQYA 3VNSA 4KQCA 2FXIA 4X9XA 1NMSA 2GAFA 3H4MA 3CX8A 4MDFA 2YJ5A 1CPYA 5JISA 4E31A 1B8OA 3CH5A 4X97A 1AIPA 4DIEA 2GN2A 4RA6A 3R7BA 2R8OA 1COZA 4LOHA 5B7QA 1WLSA 2CLDX 1ZVQA 2ZU0C 1Z4NA 3FCXA 1ZL2A 3FRJA 3SJZA 4YMGA 2H2FA 3L0DA 5DHUA 4EVQA 2ETVA 2O59A 2MSEB 1Z6ZA 1R0LA 1N3YA 1QQ7A 4HATA 3LSYA 4NBRA 5EKXA 2X5OA 1BOOA 3HDGA 4XGIA 1BWQA 2IS1A 2VJCA 1KK3A 2WSYB 1P3DA 3NHYA 4I9UA 4JELA 4OJYA 2RH5A 4S0XA 3WZMA 1ZDMA 4MQFB 2VXOA 1EIZA 1MF7A 1RKQA 3ZK8A 1J5XA 2P2LA 4BVHA 2EZ4A 2UAGA 2I6QA 3KOXA 2IPNA 4FWTA 3JSXA 3OZCA 1H65A 4C4YA 1T2FA 2QRVB 2RHGB 1I1NA 4IH9A 1ZLXA 2XA2A 5JNUA 1V45E 2ZS8A 2VDRB 3AR6A 1O8BA 2HWYA 3EPJA 2F4NA 4YAEA 3W5CA 1GFWA 5FJIA