4J0DA

Tannin acyl hydrolase from lactobacillus plantarum (cadmium)
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
470
structure length
470
Chain Sequence
b'SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
molecule tags Hydrolase
source organism Lactobacillus plantarum
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
total genus 167
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0dA00
2FUKA 2W22A 3T52A 2YXPX 4K5QA 5ISMA 3K2IA 4J0IA 1YCDA 4UFNA 2VJCA 5D6OA 1H23A 5A6VA 1ZI8A 2ZJ7A 5JALA 5FRDA 4MEAA 3JWEA 2G5PA 3C6ZA 5LZ4A 4AN1A 1UOQA 3C5VA 2QJRA 3WWCA 5JARA 2H1IA 3G9UA 3FBWA 3H04A 5EGNA 2JEYA 3DL4A 3NUZA 3H1AA 1XRQA 4HTAA 1J2EA 3O4HA 4AO8A 4W1QA 5DLPA 4EY6A 3IA2A 2ZSHA 4PSDA 3FOBA 3IB3A 3MVEA 4UHBA 1MX5A 3RARA 1QIFA 2YASA 3WL5A 1EDEA 1C7JA 2C5FA 2Z3WA 1NU8A 4FMPA 3V9AA 4ZGBA 3SX4A 2NW6A 3C87A 3WIOA 2J4CA 3QPAA 4NZZA 1W76A 4M0MA 1WM1A 3G02A 2I3DA 4S0XA 5EIAA 3FCXA 3W2TA 4AX4A 1LLFA 4B0PA 2X5XA 5K3DA 3QMMA 1VLQA 3PFCA 3E1GA 3ESCA 1DTEA 1HBJA 1G5FA 3WA6A 4QDXA 3WKEA 1MTZA 2JBWA 3STWA 1LPAB 3SK0A 5EIHA 4YASA 1ODTC 4QDOA 3WKDA 4UFPA 1EK1A 2H7CA 4KE9A 4EA6A 4AMZA 4LIPD 4KJXA 2FJ0A 3BIXA 1U4NA 4KAFA 4X00A 5AKXA 5HQ3B 5IVKA 1UK9A 4L72A 1A7UA 1IZ8A 5JANA 2QR5A 3F67A 4Q05A 4EY8A 1BROA 4X71A 1K6EA 1XRPA 2BCEA 1ZD3A 3CN9A 3E0XA 1HQDA 3H1BA 4W1RA 5AK5A 4W9RA 4DMHA 1BEEA 5HF5A 1CFJA 3EQ9A 1CUVA 4BVKA 1AMNA 1T2NA 1X2BA 2BGNA 3C70A 4J0DA 4JNCA 1GKKA 3AILA 2OCKA 3JYHA 3HEAA 3WJ2A 4MYDA 3FAKA 2WG2A 1MNQA 1DWOA 3VKFA 5FXMA 3AIMA 1DX4A 2OCGA 1BN7A 1ODSA 5D7BA 2QTBA 2ZVDA 2PUJA 5HK9A 2CUTA 2HA7A 1ZIXA 4EY5A 2QJWA 3QPDA 3KWJA 5A2GA 2QXTA 3ZWQA 3DS8A 3AINA 3H18A 1WB6A 2JGKA 5E4TA 4CIBA 2ACEA 4C89A 3ZI7A 5AIBA 1QIKA 5HKAA 3STVA 4B81A 4E15A 2O2IA 3WZLA 1C7IA 2PX6A 3D2AA 1QIIA 5D3ZA 4FFVA 2OQIA 3WA7A 2BUCA 3AFIA 4EUSA 2CJPA 4H7IA 2OPHA 3RKSA 3QITA 4QZVA 4OYLA 2HRRA 4YK7A 2WHPB 4LHEA 4FNMA 1TRHA 3I2GA 3BDIA 1Z68A 5ALNA 2WIGA 1XRNA 1GXSA 2Y6UA 5KREA 1UKCA 2JGEA 4Y2JA 1R4ZA 3V1LA 4DMFA 3ANSA 1TCBA 2CZQA 2GBIA 4HXFB 2CMFA 3ESAA 4CCYB 1XZKA 1THGA 1XZIA 5ALZA 4H7HA 3GUUA 2UZ0A 3R3XA 5AM1A 3B12A 5DNVA 5KWJA 1UFOA 3I6ZA 2XUPA 4FKBA 3CN7A 2VT7A 2DFPA 3D59A 1QIDA 1QIGA 2WUEA 2ZYHA 4W1SA 5ALYA 3V1MA 2V9ZA 1O6GA 3L1JA 1AZWA 5CW2A 4OB6A 4PV7A 4IH1A 3AIOA 3A70A 5A7GA 3QMWA 1H2ZA 3N2ZB 3IUJA 4C01A 4BTLA 1GT6A 1QO7A 3O95A 1FSSA 1HKHA 1SC9A 1N5MA 1Y37A 3H2JA 4M0EA 5ESRA 1Q0ZA 4HRYA 1CQWA 3D2BA 3TJMA 1E8DA 4PW0A 4GWLA 3GFFA 5K3CA 1JMKC 4UBMA 3ANTA 3MGAA 3P2MA 1YASA 2C0QA 1UK6A 4U2DA 5AKJA 2HA4A 1YB6A 3B3QA 3HZOA 4G4GA 3WWOA 2LIPA 1GPLA 1SCKA 3FYTA 4PSCA 3AZQA 4G5XA 5JAUA 1CR6A 4BATA 5DWDA 5AH0A 1K5PA 1XZEA 5CT9A 1DQZA 3QH4A 3R3ZA 3TRDA 5HK8A 3D5EA 4CFSA 1LPSA 1QFSA 1T4MA 1MO2A 2FJPA 2Z5GA 5AKHA 1CUJA 3T4UA 4H7FA 5YASA 1NX9A 4ROTA 1AURA 2WTMA 5H3HA 1CUSA 4Y7DA 4DIUA 2Z8ZA 2XUJA 1VXOA 1LGYA 5CBKA 2XB6A 2HU7A 3EBLA 1QGED 5CXXA 4FNGA 2AXEA 1F8UA 1OXMA 4TVKA 4ZRDA 1GZ7A 5CH5A 2B4KA 4XWGA 1B41A 1PFQA 1UKAA 4J0KA 4AMYA 4IH9A 1THTA 1U2EA 4Y2RA 2V98A 3ZLUA 1WOMA 5CURA 1EINA 1UOPA 3OTQA 3D0KA 1LPMA 4DM7A 4CG2A 5ALGA 4NS4A 1XKTA 5JASA 3WK8A 3F97A 1R3DA 2O2GA 2ONCA 2ZJFA 5AI0A 3O0DA 5CXUA 3DQZA 2WIKA 2JGFA 5A71A 4AB1A 5LZ8A 1H2WA 4P9NA 4XVCA 3HYSA 1CEXA 4OCZA 1H22A 1W52X 1YA8A 1J07A 5T4EA 4AO7A 2Y2VA 3R0VA 2HA0A 3EQ7A 2QVBA 2AJBA 4BC1A 1XQWA 1ZD2P 4ZREA 3K6KA 4EBBA 1CUWA 4DNOA 4UHFA 4MWSA 4BAZA 5FKJA 4HS9A 3OC0A 3OOSA 1DINA 3UUFA 3NGMA 3BL8A 1SOMA 5A7FA 1DU4A 4QDTA 1U65A 4N8EA 5AM0A 1AX9A 4CI9A 5BWBA 4Y2UA 4QA9A 2JIDA 2WTNA 2QXUA 4JUIA 2Y6VA 4X6UA 4FBLA 1ZJ4A 4BB0A 4BC0A 3G0CA 1JU3A 1YAHA 2VA9A 2QRUA 2VAVA 4KE8A 2JGJA 2H7XA 2AJ8A 3WWDA 4A23A 4TPKA 3FWHA 3I6YA 2OAGA 1P0QA 3OG9A 3H17A 1XQYA 2R8BA 1VOTA 2G63A 2HA2A 1CIJA 1E5TA 2AJCA 3LIIA 2V96A 3C6BA 3SWWA 1R9NA 3C8DA 4YX9A 5EHQA 3QBJA 5HCUA 3PI6A 2QT9A 1ACLA 4PF1A 5EI5A 4DSZA 4B83A 3AZPA 1EHYA 1MT3A 1W75A 3MUNA 2WLSA 3U0VA 1ZD4A 5ALWA 2O2HA 1R88A 4G8DA 5K3FA 3Q8WA 4MYSA 2BFNA 1YAJA 3KDAA 5AIAA 4KYVA 3FVRA 5AI5A 3ESBA 2YYSA 2ZYIA 3PUHA 1CUDA 4UUQA 4UHCA 3S8YA 1DQYA 4H7DA 2VF2A 4UFOA 3FSGD 1K63A 1GQSA 1LPNA 3C5WP 5DTIA 4BE4A 3WI7A 4LYDA 3H0CA 4B7ZA 3AZOA 1ZD5A 5E4YA 3CCCA 3H2HA 1K4YA 3AJAA 3R3WA 4MXDA 1MX1A 5K3AA 1QTRA 4IH4A 3YASA 3WWEA 4RE6A 4CG1A 2VSQA 4G4IA 3I1IA 4Q3OA 1XLVA 4H7JA 5ALUA 1Q84A 1XQVA 2BUAA 1CUBA 4GI1A 2JGLA 2VJAA 1QFMA 5I9IA 4Y2QA 1SCIA 1XZHA 3O4IA 5AI8A 1CUYA 1EH5A 2BAGA 4ZV9A 3GELA 2C0PA 4KR0A 3FSGA 4GDMA 1WHTA 3NWOA 5C8XA 3R3UA 4WFIA 5ALHA 5CT6A 4RNCA 3STXA 2Y2UA 2OGZA 1DWPA 3ZLVA 4DTCA 1H2YA 4FLMA 5KWIA 1Y7IA 2BGRA 4MWTA 4B0OA 1EDBA 1RWQA 3G0DA 5AM4A 1WPXA 5FV4A 3DCNA 4OUKX 1VXRA 3PF9A 2ES4A 3DLTA 3CXUA 3ZLTA 4X90A 1JI3A 4EHBA 1MX9A 5C8VA 1CRLA 3LS2A 3STUA 3TGLA 4Q34A 1B6GA 3WKBA 3JW8A 4BP8A 2Q0XA 4DSAA 3M83A 2ORYA 2OCIA 3Q0TA 1HPLA 1WCYA 3G0GA 3QMVA 2K2QB 2XQJA 3D2CA 2DQYA 3WYNA 2AJDA 4CIAA 3E3AA 1JFRA 4J0JA 1UKBA 2WJ4A 2CB9A 1QLWA 2QMQA 2PSHA 2OQVA 2G5TA 5ALFA 2XUFA 2JEZA 3DOHA 2WFMA 1IVYA 1YB7A 2WG0A 5ALQA 4CCYA 1BEZA 4UBLA 4A16A 2VJDA 1DWQA 4H7EA 1A88A 1ZJ5A 2X8BA 1A8UA 2DSNA 2XQGA 3FVTA 4U2EA 1CVLA 2QM0A 4GEGA 2IX9A 2OLEA 4X7BA 5ALLA 2DHCA 4X6YA 5C8ZA 2HFKA 2XUIA 4RE5A 4OU4A 4QNNA 1N8SA 1IUOA 4IO0A 1E66A 4QLAA 5AI4A 5F4ZA 2WHRA 4HXEB 1KEZA 4LYEA 1F0PA 3DD5A 5AI6A 2RONA 1JKMA 1EX9A 5JZBA 4KACA 1XZFA 4BRZA 1VZ3A 4C88A 5JD5A 1I6WA 2HL6A 1CUEA 2XMQA 5JAPA 2PSDA 3WQHA 2HU5A 2D0DA 2ZYRA 2HRQA 2PM8A 2EEPA 1TQHA 1IZ7A 2XMSA 5HF6A 3G8YA 1N5RA 1F0NA 4XX1A 4E11A 2XE4A 4Y2SA 4RPCA 1L7QA 5CH8A 2RI6A 3IIIA 1U8EA 4NVRA 2WKWA 4YPVA 5AM2A 3KWFA 3R41A 1CUIA 3NOXA 4WCVA 3I28A 4DNFA 1ACJA 3C6XA 3DJYA 4J0CA 4OB8A 4FWBA 1W1IA 4C87A 2XLBA 2VEOA 1R9MA 3WKCA 5JIBA 1X70A 4JYMA 4H7KA 5A62A 4B85A 5LKAA 1IUNA 5CH3A 4X91A 5KBYA 4BZZA 3WLAA 1FFDA 5ALSA 1IUPA 4G4JA 3A2NA 2GZRA 4ZWNA 2DHDA 1GGVA 5HF9A 3I2IA 2P8SA 1W4LA 1EK2A 4MJ3A 1QIMA 4Y2TA 4HZGA 2B20A 2I3ZA 4UBJA 4F5ZA 2HHAA 2G4LA 4E14A 4L3WA 1XZMA 3C43A 3O9VA 3WK6A 4M0FA 3PDCA 1DT3A 1Q0RA 1N1MA 2HDWA 2YH2A 5ALXA 3PE6A 5AM3A 5LZ2A 5ALEA 3D3NA 1LBTA 1EB8A 3VVMA 2J3QA 1QE3A 5CMLA 4H18A 2QS9A 5E4JA 1F6WA 1BS9A 5EIEA 4C4ZA 1XLUA 3WWPA 2VAXA 3PFBA 1R1DA 4X85A 3VVLA 4IHAA 2VATA 2WILA 5AICA 1FFBA 4I4CA 2Z3ZA 5AK4A 4WJLA 4OPMA 3VJLA 1G66A 3DKRA 5IVHA 5A7HA 1XZAA 1FJ2A 2WFZA 2CBGA 3IURA 4QDZA 5EHNA 5JZSA 3C45A 1WB4A 4A5SA 1CUXA 2PL5A 1BU8A 4UHEA 2PSFA 4Y2PA 2PU7A 1AQLA 2XMCA 4U2CA 1QIJA 1QOZA 4OSEA 5CT8A 3WK9A 4WDRA 4WDQA 4AQDA 5FPPA 1PJAA 4K6KA 3I2JA 4F0JA 1E8MA 5ALJA 5IVDA 3O4JA 3A2LA 2WFLB 4PO3X 4U2BA 5AK6A 2GBFA 5AO9A 4GBGA 4PQEA 4H77A 4DYHA 2ROQA 4BCDA 1TAHA 1QIEA 3W9UA 4DNPA 2XUKA 2R11A 1XRLA 1YS2X 2DHEA 3BJRA 3A6ZA 3VDXA 5AM5A 1EXWA 4KAAA 3WYDA 1BN6A 3IUNA 2JGIA 4BAUA 1TK3A 4X95A 1EI9A 5LZ9A 5AKZA 4X92A 4B6GA 2PU5A 1HL7A 2RHWA 3QPCA 4ETWA 2WHQA 3G9XA 3FCYA 3I1YA 3ILSA 3H19A 3IVMA 2CKMA 4ARBA 4QEKA 1ORWA 3C6YA 2H7YA 4MQLA 2RIPA 3AIKA 1BRTA 1JJBA 3F8SA 4HXGA 2GYVA 3B5EA 1CUAA 4EY7A 5ALMA 3LP5A 4L9AA 2XUAA 4ZV7A 4J3JA 2XDWA 4QE3A 1MU0A 3OPMA 4H0CA 4BAGA 4C4YA 2QKYA 3QYJA 4AZ3A 1OCEA 3KSRA 2PSJA 2IITA 2BKLA 3I6MA 1L7AA 3E4DA 1EDDA 3ED1A 1K8QA 2DQZA 4H35A 4U2FA 3STTA 5DJ5A 5EHZA 3HSSA 1KU6A 3K9BA 3W05A 3M3DA 3G9TA 5AKIA 4FLFA 5C81A 4KRXA 3FNBA 4B9EA 5LZ5A 2XMBA 2BJHA 2HFJA 4K6GA 5BWCA 1TCAA 2J4FA 4CG3A 5HZGA 1LPOA 3IUQA 4G9EA 4J03A 4F21A 2EDCA 2ZJ6A 4KEAA 4O08A 2EDAA 2WU3A 1VE6A 1S8OA 3BE8A 1ISPA 5D3KA 3DDUA 4MQMA 4FLEA 2CEKA 3BF8A 3V48A 5ALVA 1YA4A 1AC5A 2WUGA 2XUQA 1JJFA 1J1IA 4DMKA 1YR2A 3R3VA 4Y2VA 3IUMA 2I78A 1VZ2A 3HI4A 4ZXFA 3F9CA 4F60A 4J7AA 2HA3A 2GYUA 3LLCA 2PBLA 5EFZA 3RLIA 2VT6A 5LP1A 3M82A 1A8SA 4FDMA 5FUMA 4Y2XA 4UHHA 5EHXA 3HJUA 3WK4A 1EA5A 1CV2A 5HFNA 2RGUA 3IBTA 4PSUA 5ALDA 3WL6A 3BF7A 5ALPA 1SCQA 5C7YA 3ICWA 3GROA 1FFCA 4ZI5A 4KE7A 1OILA 3EF3A 4G9GA 5LLSA 4INZA 1LZLA 3IULA 4AXBA 5DYWA 1ETHA 2X76A 5JD6A 4LXHA 5LZ7A 4XJVA 3KD2A 1XRRA 1M33A 3HC7A 2XMDA 3S2ZA 1ZGCA 4UHDA 1VE7A 2XUGA 4Q3LA 4QDUA 2PUHA 5HFAA 4BDSA 4PNZA 5ALOA 4ARAA 5AKLA 3DYVA 4U2GA 4Q82A 3KOOA 3H2IA 5AP9A 4UBIA 1MN6A 1QJ4A 2JGMA 2XUOA 1ZI9A 3C8HA 3LCRA 2C5GA 4Y9SA 4EZIA 1XROA 5SYMA 1P0PA 4UPDA 4IQ4A 4DLNA 4N8SA 1CQZA 3V1NA 2GZSA 5JYCA 4BVJA 5DYTA 2HA5A 4KRYA 2VQ6A 1WB5A 5FDFA 4W1PA 5AK3A 1JJIA 2PVSA 3DKKA 5AKGA 4P93A 4DMCA 4MEBA 4D9JA 5BV7A 2O7RA 2WFLA 4UBKA 4BYMA 2D5LA 3ICVA 1YSCA 3UUEA 3H2GA 2HU8A 2H9YA 5K3BA 4HAIA 4E46A 4WY8A 5SYNA 1BCSA 1W6RA 2WUFA 1XKLA 3QVMA 1MPXA 4V2IA 4X97A 2OG1A 5ALRA 2B61A 5HQ3A 5T4HA 3WKAA 3V1KA 4N5IX 5DYYA 4AZ0A 4FTWA 4GLBA 1QZ3A 2XQKA 3BIWA 4C6HA 2ECFA 5CT4A 1DT5A 2ACKA 1CUGA 3WL8A 1EVQA 5AOAA 5FLKA 3I2HA 3F98A 3GBSA 2Y1KA 4RGYA 3BJMA 3H2KA 2QZPA 2PPLA 2C7BA 1JMYA 2OAEA 3BWXA 2OCLA 1XZLA 5BOVA 4BRSA 4X93A 5AOCA 3BXPA 2GYWA 3PUIA 1ZI6A 4JEIA 3EQ8A 3DNMA 5FOQA 2XMRA 1LNSA 1SFRA 2QUAA 4P92A 1XZGA 1MAHA 5DNUA 1IMJA 5ALIA 1LPPA 2I03A 3WK7A 4FFWA 2ZYSA 1BCRA 1LZKA 3VJMA 4Z49A 1JU4A 4I3FA 2B9VA 5LIPA 4G8CA 1UZAA 4G8BA 3AUKA 2XMZA 4L0CA 2WG1A 5ALTA 1RYYA 1Y7HA 2OGSA 5E2IA 1UK8A 3DOIA 5IH7A 1NU6A 5DNWA 5AJHA 1ZGBA 4X3CA 1VA5A 3FYUC 5DTJA 4B82A 4WY5A 3FLBA 4FHZA 4K6HA 3W06A 4ITVA 4QWWA 5LKRA 3WIBA 3FLAA 1CPYA 4QLOA 4GECA 3FYUB 2HADA 3HACA 3WJ1A 1DX6A 5CTAA 1E8NA 4BP9A 1XZJA 2OGTA 1ODCA 1G4HA 2WHPA 3VJKA 1L7RA 2WU4A 3U1TA 7YASA 2QOEA 3SC2A 2DR0A 3VXKA 3LIPA 1LPBB 3G0IA 3D4LA 1CLEA 4LXGA 1UWCA 2WJ3A 4BVLA 4OD0A 4WFJA 5HKBA 3IDAA 1CUZA 4B80A 3FYUA 1XZDA 5K3FB 5T4BA 2AJLI 5JAOA 2IIVA 2RAUA 1X2EA 1TIBA 4K2AA 4N8DA 1XZBA 1QO9A 3O4GA 5K3EA 1AUOA 3RM3A 2XLCA 3OURA 4JH0A 3RK4A 3ZV7A 2OXEA 2JF0A 1H2XA 1FFEA 1P0MA 1HLGA 1EVEA 1EB9A 2XT0A 4X94A 5LYYA 5J3JA 1R50A 4OB7A 4JYPA 2WQZA 3EIOA 4GHWA 4HRXA 1LBSA 3HRHA 3L1HA 1C4XA 1KU0A 4Y2YA 2WM2A 4OU5A 1GKLA 1QIHA 3HLKA 1TCCA 1AKNA 1GQRA 4FBMA 1XLWA 3WK5A 2PSEA 4I19A 3I2FA 4BDTA 4B84A 3M81A 1E89A 4LXIA 2XI4A 3I2KA 3X3HA 2WIJA 1ZIYA 3VISA 2J3DA 1MJ5A 2XUHA 5JAHA 5AI9A 1GPKA 2Z8XA 3WZMA 3R3YA 1UXOA 4OYYA 1AGYA 4X6XA 2WJ6A 1CUFA 1VA4A 3W9BA 5CT5A 2W6CX 4BE9A 4WFKA 1A8QA 4AN0A 1QONA 2QUBA 2BUBA 5CRIA 2XQIA 2XMGA 4BCBA 3WMRA 4C4XA 1WPRA 5IVIA 5JD4A 3G0BA 5ALKA 1TKRA 2WIFA 4UBNA 1E3QA 1P0IA 3DL7A 3GA7A 1UOOA 4GW3A 4FOLA 3OM8A 3FLEA 1PV1A 4J0HA 4AO6A 4QWMA 1CUCA 4GXNA 2PKYX 1J06A 5AHXA 2WUDA 2GBCA 5FP0A 3CCBA 1XRMA 5JADA 2V97A 5I8PA 1XQXA 1MAAA 3WL7A 5HF8A 2O7VA 4KAJA 5AKKA 3HABA 3DEAA 2VTVA 5T4FA 3UMJA 1Q83A 4DGQA 3BDVA 3KXPA 5IKXA 2VJBA 2WSLA 4BZWA 3TEJA 3A2MA 1FFAA 3N0TA 4BCCA 1MNAA 1ZOIA 3GZJA 1JT2A 4UBOA 4N5HX 2WIDA 4W63A 1XZCA 5K5EA 2XUDA 4LKOA 2C58A 3QZUA 2E3JA 4EY4A 1G42A 4EB0A 1VKHA 4XIIA 2HIHA 3STYA 3QM1A 3R40A 3G9ZA 2DCMA 2GBGA 2HA6A 4CCWA 5JATA 3DYIA 5I7UA 1CUUA 1GPNA 4NMWA 5AOBA 5AKEA 4Q1VA 5AKYA 4TGLA 4BTVA 4G1FA 4BBZA 2C4HA 1RP1A 4P08A 2ZSIA 1CUHA 4J0GA 4B9AA 1QTIA 3G7NA 1HDEA 3ZPXA 1ZICA 3PICA 3MUOA 3O9MA 5JZ9A 2XQFA 3PF8A 1USWA 3ESDA 1UT6A 1ORVA 1O6FA 6YASA 2FX5A 3L1IA 4HVTA 1YS1X 2RHTA 1UK7A 3D7RA 1BE0A 3F96A 5FPQA 1D07A 4DNQA 3HXKA 4KE6A 2HM7A 1WHSA 1XFDA 3W04A 4Q3KA 1VJ5A
chains in the Genus database with same CATH superfamily
3AKZA 4PLTA 2UYYA 3T52A 2YXPX 4HSGA 2R751 3VNBA 1A9RA 1C29B 3V2UA 3INTA 1AXRA 4AP6A 2DBZA 3JD0A 1I6MA 4X3PA 1KO1A 4BVBA 1RRVA 1GGJA 2FW8A 3FTCA 2ZXEA 1RTTA 3P4UA 1ODLA 3OZDA 3EA4A 3EZYA 4LDRA 4HNAB 4PZYA 4AWAA 1Y1LA 4RJKA 2Y9PB 2GFHA 3SQMA 1N1DA 3IP8A 2JDIA 2OP1A 3MGBA 3DVQX 4BGVA 5LFAA 5B36A 3W8EA 2E6UX 2WINI 4JGBA 5JWRA 2O1XA 5AW2A 3L7LA 4R5MA 1O0BA 1TAGA 2YFYA 3PQ7A 3ITDA 5ESXA 2H5LA 2B99A 2L42A 1J7KA 3HVHA 3C6ZA 3L9XA 4B43A 3VBCA 3MJRA 3H5OA 3R5XA 3I09A 1OWMA 2H92A 4FFNA 1LTQA 1LF5A 1V6SA 3FSRA 4KX5A 4BNMA 4A8PA 2JG3A 3ZS9A 3JX9A 5JARA 5FOWA 5DMXA 2A86A 3BUSA 3NGXA 5ENZA 2QEQA 2Y1LA 4LC1A 3K9WA 3UAOA 3C3DA 1N2IA 1T2CA 3G9UA 3NM5A 2P1RA 4Q4LA 4AURA 5FBVB 5ITVA 5A0TA 2P9JA 2JDID 1LX6A 5BPHA 4B47A 1G2QA 1GTJ1 3ICPA 1G8HA 1XRQA 2FMKA 2AF4C 3RYTC 3Q6NA 2VYFA 1SVIA 3WJ7A 5L4LA 4Q4JB 3FMPB 5MDHA 5KJCA 1OY1A 1IHXA 2BBWA 4J4TA 1TIKA 1E63A 2VIIA 1F5SA 3BK7A 4TVBA 5E7IA 5FCDA 1H6DA 5FI1B 2Q7OE 3UUGA 4ZFNA 4JFRA 4PZAA 5A9RA 2IUEA 4NU0A 1JWLA 1USVA 2QTCA 3HEMA 2GF9A 4PSDA 1D9XA 4RVSA 3KSBC 2H5IA 3IB3A 4IUBS 2H29A 4P22A 4EW1A 5HVNA 4YJ2F 2EG5A 3UXMA 4I4TF 2W37A 2O2YA 4TSRA 1FFSA 1VI6A 2QYSA 3A4LA 3WSTA 1CJUC 4KR3A 1BVUA 4H6VA 1GU1A 2GCIA 2DQKA 3A4NA 4IR7A 2YASA 1D2GA 4IMJB 1COWD 4ZEMA 4PRZA 4LJAA 1PR1A 3PA8A 2Z3WA 2JH9A 5HKKD 1SC3A 1RZRA 4GYKA 1KSFX 1GIAA 2ZSAA 1U3CA 3GYGA 3LYLA 2R6HA 3PD1A 4KUEA 4KGDA 3SX4A 1E69A 2NT3A 3WIOA 2V6JA 3ZDEA 2VL7A 3QPAA 1KI6B 1SIBE 2GEDA 4LTMA 2LDXA 3OTGA 4MIKA 1KGDA 3DMYA 3LX5A 2CBZA 3UAYA 5ITSA 2I9KA 2HQ1A 3EJWA 5BV2P 3H1EA 2H1HA 4XGKA 4O59O 4OXIA 1E6WA 4DLTA 3HI6A 4M0MA 2B82A 2C8JA 3ZVMA 1WM1A 1FJGB 2KM1A 1C7FA 2I8LA 3K0CC 4J0EA 4PAOA 2I3DA 3LXMA 3EVGA 1UMKA 5TB5A 1J8DA 5C4IA 2AK3A 1YS6A 2AT1A 1ISSA 1GU0A 2IOHA 4PS1A 4S0XA 1HDCA 7REQB 1HEIA 5EIAA 5IXSA 3UBTA 3R23A 3RRXA 4BFZA 1EFUA 1PL0A 1BHSA 2VJMB 1IWOA 1WSBA 3LL4A 3HJGA 2X5XA 3L8HA 2HHCA 3B1XA 3H13A 3QMMA 1NDHA 1M1ZA 1T0PA 1VL6A 1VLQA 1H1LB 1NQTA 1JNXX 3RVLA 4QLBA 3F6SA 1H8HA 3IEXA 3QSGA 3GRAA 5CX4A 5EIOA 2FZ4A 1J4AA 2XPCA 1G5FA 4EEZA 4C14A 4AMBA 3DFUA 3BJIC 3AUXA 2I6GA 1OA0A 4E94A 2JBWA 5FA6A 3STWA 1LPAB 2FPGB 4Q3BA 5IZ4A 4DC1A 3AO0B 3DHEA 1VHDA 2R6GA 1V45E 1Y5MA 4PFQA 3F5DA 3NVAA 2K4MA 4TYYA 1R5OA 1HDOA 1GR1A 2QD4A 2VLBA 1T3TA 3CVOA 2WD7A 4TLEA 1ORHA 2AR9A 2O5EA 4UASA 4KJXA 1WKVA 4UATA 2PY6A 1C2TA 2NZJA 5EJAA 4QYSA 1PFGA 3ZEAA 2ZR7A 2XGMA 1U4NA 3EYAA 1SVNA 2CZGA 3OUUA 5FAXA 1KFCB 4OJMX 4BVEA 1KS9A 5BRAA 4L6CA 1B6RA 3BJZA 1M8PA 1SKYB 2PL3A 3KO8A 3SU8A 5HJ5A 1T5TA 4Z7JA 2UZ3A 3GWGA 4GBJA 3UFBA 1PR2A 5I51A 4YHBA 1QGZA 2VYVA 3NNDA 3PEUA 3RAEC 3WRXC 3FR7A 3VO1A 3F6YA 4EY8A 3O92A 2CDCA 3M33A 2PWAA 1QR2A 1N8KA 3G5TA 3ND5A 4PAQA 2A9FA 3T1HB 2CCKA 1KEVA 3I61A 1IUKA 2H18A 1UJNA 3EN0A 2VTEA 3FWYA 4MDFA 1NMYA 1UFVA 3VVCA 2FW9A 2BCEA 1WDKA 3G2JA 2O2CA 2F1OA 3IMGA 1DC3A 3DOOA 1HG0A 1V3VA 2WNSA 1ZH8A 1T9HA 3H1BA 3DVSX 1MZPA 2PSSA 3DKPA 5EERA 5JWHA 1BDBA 1Y7LA 2X15A 1CFJA 1JTFA 1AS3A 1XALA 3R9XB 3EQ9A 2D3TA 3WO0A 1LJLA 4RZXA 3L7IA 1AMNA 1Z37A 2UVDA 1E7SA 3BTVA 1GNPA 4J0DA 4JNCA 4TTRA 4MX8A 3AILA 5F64A 4YCBA 3UO8B 1ADYA 2V8OA 1PR0A 2P2DA 3GRCA 4P8RA 4AFNA 5ECDA 1T34A 1QP0A 3ZTYA 5EHGA 3DMPA 3RUFA 1Q0TA 1KY4A 2E48A 1MNQA 1ZUWA 2R8PA 4HGYA 3M34A 4NC9A 8ADHA 1OLXB 3PBKA 3T5BA 2JAHA 1X7DA 1E1YA 1ODSA 3A0RB 2DPHA 3OM9A 4FFPA 4R9SA 4RXMA 3WMFA 3ZE0B 4E4TA 1KIFA 3F3KA 2ZVDA 5TXGA 4O2AF 3E0QA 4CZ2A 4E3WA 5HK9A 3VJRA 3ZWBA 4KGXA 5B4UA 1PWZA 1NI4B 1VPDA 2B2NA 3RTAA 4EHLA 2XT6A 4QXPA 2A0YA 1NXPA 2CUTA 2X8WA 4EFKA 3EMBA 1OPXA 1Y1QA 1QG4A 5C1IA 1VJ1A 3P9XA 3W7BA 3SP1A 1H8ED 2G9ZA 3ET5A 1P4JA 1ZIXA 5A9SB 2LVBA 3SQOA 1N2CB 2AFHA 3QVTA 4NYIQ 2OOSA 1M9NA 1TA9A 1U1EA 5B30A 1JQBA 1NRXA 1PG2A 2AS0A 1ZJZA 2QR2A 4NBVA 1GLVA 1D6NA 2KI5A 2ZREA 3Q40A 3ZVLA 1Q1GA 4POOA 2OPBA 1PZMA 2JFFA 3A6KA 3V7FA 1FDTA 1CDZA 3VSDA 3OE4A 1L7XA 3I9V1 4IFTA 1LI5A 4L85A 3U4AA 1LH0A 1C41A 1MOSA 3CNNA 5THKA 4EMBA 1RYFA 3MS4A 3C1OA 3OMLA 3TTWA 4DB2A 1DJLA 2OCXA 2ZT7A 4TMVA 4KHZA 4P86A 4CETA 3UB3A 3MTBA 4B81A 3OJEA 4U7GA 3EY4A 3S68A 2PX6A 1II9A 4XUGB 1RS0A 2H3EA 3DAYA 4FFVA 5GWXA 5ADHA 4KR2A 1F6BA 3HCPA 4LZJA 4TSFD 2BUCA 3AFIA 1A0OA 2A57A 4WZZA 5LMZA 3QUQA 1ZS9A 3TFOA 3GLIB 1XMQB 1YO6A 4BMCA 4C7XA 4H7IA 3SXPA 4IAOA 2C59A 2VUUA 1UDRA 3WLOA 2D00A 2X77A 3AY7A 2WHPB 3GUHA 3IR6A 4QNRA 4ZOLA 3VDMA 2EXXA 1U2GC 1ZZEA 3KB2A 4GR4A 3BDIA 1Z68A 1CJCA 5ALNA 4ZK2A 1Q7EA 2ZYUX 2I87A 2NQ2C 3LDGA 3QLJA 1HV8A 4HQRA 4QBTA 1ZM2A 4PANA 2WUWE 1OIXA 1RHQA 1BMFA 9LDTA 1RYDA 1FP4B 2QPAA 1S8FA 4BNJA 1JKJB 4YRTA 1L4EA 2AN3A 1R4ZA 4QBFA 1FDSA 2GXUA 4B7UA 4QYWA 1PV4A 4DMFA 3ANSA 5I9LA 5IT5A 2ZIFA 1BQEA 1L3IA 1TCBA 3C4QA 1YBHA 2EX0A 2CMFA 1CJVC 3JTEA 4B2IA 3IBCA 1BNCA 4F38A 1Q77A 4BO5A 1I0ZA 3VC7A 2H8GA 2VDMB 3NHWA 2GM4A 2O0LA 4L95C 5IC6A 1YACA 3JPWA 2E55A 4QSMA 1UMBB 1Q19A 5ALZA 1FLAA 1OHHA 1SOVA 1I2CA 5EY5B 3JVDA 4TWAA 3QE9Y 2WUVA 4EPWA 1SELA 4MCAA 3ILHA 2UKDA 2XUPA 4KRFA 3N2KA 3CN7A 1RXEA 3E1SA 3H9UA 3PUYA 3QXHA 3VX4A 4F4DA 5IDXA 1RLUA 1F2UA 1XXHA 4XTRA 4BFCA 4FDVA 1NNSA 5G0WA 4FE4A 1KAEA 2P9YA 3HJRA 4PYNA 1EFLA 1OLUA 1GXSB 1XVTA 3CQ9A 1TO1E 3GJ8A 4HDCA 1KVUA 1ZHFA 2P9HA 3VI4B 2V9ZA 4CG0A 3WLTA 3HJFA 3FPKA 3E9EA 4Q9KA 1WR8A 3BGOS 1QG2A 1C3XA 3CH4B 4G01B 2BEVB 4GP9A 1FRFS 1JSCA 1RYBA 4IH1A 5AXAA 3QBEA 5ULLA 2B4YA 4PHTA 1YZKA 5D51S 3ORFA 4Y7CA 5BOSB 1JH8A 2BKXA 2L2QA 1XDWA 4EABA 1QAOA 2KHZA 4PCVA 2HWWA 2OCPA 3R0QA 5A7GA 5TR9A 3AW8A 3OHSX 2GERA 1H2ZA 3QMWA 4LPSA 3IUJA 4UXIA 2QHXA 3VO9A 3OOYA 3CURA 3W7VA 4U7FA 1Z0FA 4GPD1 3H4IA 5B58T 1FSSA 2IDJA 1E9VA 4TRNA 2ZYAA 1RPJA 2I6XA 4MO2A 4D7AA 1WBBA 4CEJB 3CYFA 1Q0ZA 5BORA 1E2GA 1I6KA 1JW9B 1UZMA 1V9SA 3ZY4A 1F7VA 2FDCA 3D2BA 2YWEA 4Q9JA 3JQBA 2QZJA 3DWFA 1NHGA 4MO9A 2CD9A 3DUFA 4PW0A 4CKYA 4E6PA 1SC1A 2ZW9A 4FK8A 2XGJA 2EJCA 3S1SA 1PJRA 3B5JA 2PQ0A 3ANTA 2OQRA 3KT8A 2IVZA 2QVCA 5CJ2A 5FOTA 2D5CA 4N49A 1WDTA 4TUYA 1EFRD 4QARA 5DP2A 4BVHA 4CMEA 1YB6A 4X1KB 1HDRA 3K9FC 3HZOA 4IOJA 3I9V6 4U7DA 1G55A 4Y6SA 1L4KA 5IDYA 1KI1A 2QTMA 1M2HA 1M2GA 2X6QA 3AHIA 4YTEA 1EM8A 1E3DA 2LIPA 3O1LA 2EERA 1V9LA 4EKEA 1E9SA 4CQMB 2QL6A 3BMOB 2F9LA 4TN5A 4MGIR 1E92A 1L7PA 4OXXA 4YIHA 2PK3A 4G5XA 3QEOA 1JFVA 1JYFA 1XZEA 3GLRA 3HY4A 4DJJA 3L2OB 1DQZA 2PX2A 1UINA 4UEQA 2BCGY 3HKDA 4B71A 3KHKA 2VQEB 2DLCX 3CE6A 3NRBA 4Q03A 4C76A 2B6HA 3ZDZB 1PD1A 2Q3EA 1VMDA 4IHJF 1QFSA 1T13A 4Y9DA 3ZXYA 1GUDA 4EPRA 5BQ3A 5HX7A 1WLSA 2VTKA 1T4MA 621PA 5F2EA 4JUFA 2H08A 3FSEA 4K6FA 3GLVA 5DBGA 2FV8A 5MHTA 5JQGA 2AGVA 2P4SA 2VWPA 3R0IA 3ZDYB 1XPRA 3IPRA 3EYWA 5TPZA 3C3JA 2Z5GA 5AKHA 1CUJA 3NBQA 1N1GA 4XQ0A 2DTXA 3AOEC 1T3HA 5CX1A 2HLHA 4J0QA 1NX9A 4AS1A 3FG9A 4DIMA 1AKMA 1U9JA 3JZDA 3QXGA 1K98A 3H0KA 4V2UA 2VNJA 2BONA 1PWYE 3E9DA 2R44A 1HURA 3W6ZA 1X42A 1M6YA 1NUQA 1U11A 2GFQA 2OSBA 2ZS8A 2Z8ZA 3DTTA 4FZRA 4YONB 1HL3A 4CL8A 1U0BB 3ZIUA 1C1YA 2DBVO 3IUPA 2XYVA 4FEYA 5T67A 1Y9JA 3L0CA 4BUZA 3OPXA 5E3HA 5LA6B 1L5HA 4PZDA 5DNYB 2XB6A 1TVMA 2HU7A 3LT2A 1DDIA 1X7YA 4XOUA 3T5PA 3BA6A 1G5HA 1QANA 4D8VA 1F5NA 1LBIA 1D2NA 2W6NA 4DCOA 5JC8A 2IYOA 2JEOA 5T6BA 3OZFA 1G8SA 2BM9A 5CH5A 2YFKA 2GUGA 4PG4A 3CZMA 4TTSA 3FUUA 2J67A 3TNLA 2MMCA 1AN0A 2JJ2A 5LQRA 4RWEA 4AMYA 1K88A 4IH9A 4Q3CA 2VSNA 4YQYA 2GVDC 2XDYA 1E5XA 1Z38A 4G0VA 4JYAB 4Y2RA 2WQ7A 3OHMA 4O4LA 4JQOA 4Y6QA 3ZLUA 4AMVA 1WOMA 4MROA 1UC5B 4R3UC 5A5GA 4HJXA 1UOPA 4H1HA 1OBCA 1TU0A 1CXZA 2CCJA 1LPMA 1NYQA 2WOOA 3UJPA 1ISIA 1J2TA 3R6LA 4DM7A 1Y6FA 4L4YA 3NB0A 1T9KA 2O54A 4LF8B 4JQSA 5GV8A 1NJGA 4FYHA 1U7UA 1LQ2A 2PPVA 4EX7A 1XWFA 2AH5A 2WSYB 3AR3A 2FPXA 4JCOA 4M1ZA 3MWYW 1Z2AA 2PRYA 4GPBA 3WK8A 2XODA 3HB0A 2ZJ1A 1RBMA 5FT9A 4B6FA 1PYOA 1M2VA 2ZJFA 5AI0A 4IQ0A 3IEKA 3O0DA 4GMGA 3ZV6A 3R4VA 3NBXX 4AJOA 3DQZA 2WIKA 3OFVA 4INPA 1CCWA 1PR6A 1UWKA 3DEHA 3PNOA 1WA5A 3GI1A 2YKGA 3I30X 4P9NA 4RVFA 1FQKA 1XEXA 3DLCA 1IN1A 2GAAA 1DLJA 1CEXA 1E7QA 2HBQA 3WBFA 4CTOA 3MLAA 1AK2A 1ZGHA 4OLAA 1TZKA 3CLSD 4XD7D 2XXJA 1UQRA 1DAPA 1IQRA 1GU7A 3PYLA 3SLRA 5TGZA 1XAHA 3U7GA 3H3XA 2FUG6 3PX2A 4DKJA 2FJUA 3H8WA 3MOIA 1J07A 1FNSA 3PRHA 4OMCA 1YR1A 2V59A 4C5BA 1D04A 4ED9A 4IQ8A 3JWHA 1KR2A 2OAQ1 4LG1A 5THQA 2XBMA 2HA0A 2A92A 3EQ7A 3LTNC 1T9GR 2YY6A 3H1GA 3VPBA 2OHIA 3ZE6A 3BBPA 2MYUA 4TMFA 2BJWA 1L8QA 2H6EA 2M6RA 3C7KA 3GAFA 3PGMA 4LHZA 3UG6A 4J7XA 2OZLA 2RC5A 2VN8A 3G3EA 1G6Q1 2RD2A 3H5VA 1L5FA 1MIOA 3AEUA 4YRLA 4QGAA 1WVMA 2IXDA 3V6LA 3VV2A 4BOYA 4D9MA 1XQWA 2OV1A 3MT8A 2F43B 1L7BA 3VNSA 3SVLA 4P3XA 5CA1A 3KKEA 1BFUA 1FYVA 4KFTA 3WDKA 1SBCA 3K6KA 4FYPA 4D8YA 4W8GA 1E61A 2QUIA 4YMIA 4YJ2A 1VL2A 4YH1A 3HBAA 3OMWA 1W29A 4MWSA 1W73A 5FKJA 3TNJA 5AVVA 3B2NA 1YQXA 2EZ4A 4NI5A 2YZGA 3RTGA 2OD7A 1DINA 3LCMA 1G64A 3C6MA 1MA0A 2UDPA 3LW7A 3OWOA 1SOMA 5A1JA 3M6WA 5F3DA 3WSWA 1KAQA 3HU5A 3VH2A 4TKUB 5TDHA 3Q3HA 1X13A 1Z6TA 2APJA 2ZPAA 2BR3A 4N8EA 1JEYB 4QULA 5AM0A 2GAFA 2WYUA 3LSYA 4I9FA 4IBOA 3R7AA 4WCFA 4QODA 4NYMR 3M9WA 3O8OA 1MJHA 2RJOA 2WZQA 3DMRA 4NESA 4QA9A 2D54A 4RAQA 2JIDA 1O1YA 3WHPA 2Q9BA 3S8EA 1KE1A 2WTNA 1VLVA 1D2MA 4MV6A 3ND8A 3AEYA 5REQA 4HX5A 1KZGB 3HKBB 2XCRB 4PLVA 1E6KA 4BQOA 4BIMA 4NIMA 1DLIA 3W5UA 3B82A 3L8FA 2QRNA 4EATA 5DWVA 3C6QA 2HNAA 1P7YA 3FDFA 1A4RA 1RRPA 2Q28A 2PGOA 3EJ6A 4LCJA 4PZ0A 4ETMA 3ZJVA 1VRCA 2CW5A 1QYCA 1JU3A 1TMGE 1NXSA 1VJ0A 4IG9A 3LHKA 5EIBD 3BDAA 5G1NA 3RVMA 2H7VA 2DWOA 3L43A 1VLHA 2FMTA 4CN8A 4R05A 3BVPA 2AJ8A 3RSLA 5E9AA 3QMPA 1IOVA 2N46A 4OUDB 4A23A 1VPLA 3FWHA 1RTKA 4DL9A 1PL7A 2OAGA 1R12A 3B1JA 3DEIA 2LTAA 4HZUA 4EB6A 3HB9A 1KMHB 4IIXA 2CLSA 4E5NA 3GLKA 3OSZA 1I1NA 3HCOA 5JSUA 1AH2A 1D0SA 4WFQA 4B3JA 5C7LO 1AUXA 3DZIA 2UXBB 5L3SB 3TOSA 3NBMA 1REQA 2JJ1D 3X43A 3TINA 4FIDA 4WXPA 2WBLC 1J7JA 2WKRA 5EIBC 5GADl 2DR2A 1NVEA 3GJYA 4QOSA 1QHHA 1QORA 3U7FB 1MENA 2C5LA 4BNGA 4FX2A 1EJ6A 2C2OA 1L5YA 1F6DA 2A9PA 2PIAA 2WDZA 1SO8A 1PR5A 1BHJA 5DHSA 1B8VA 1Z17A 3QBJA 4JD5A 3C15C 1ZHHA 1GYQA 1NVAA 1KKLA 2H5JA 5BSHA 4OFBA 2GPAA 4MPTA 3RTDA 3F5SA 3AZPA 4GM1A 3SQLA 4B83A 1U2SA 1M2KA 1EHYA 2PV7A 3VTFA 4MUMA 4YCCA 5D7NA 2CXPA 1MT3A 4DSNA 5G53C 1JBEA 2BHRA 2FY8A 2XHZA 5DI9A 3LC2O 2WLSA 3L8CA 4HNHA 4OMUA 5B64A 4BNWA 4NJMA 3A9UA 3JALB 1TOAA 1TD9A 2OO3A 1QYXA 1O94A 1T0IA 2H2WA 3ZTWA 4BJ6A 4HAVA 5K3FA 2LCIA 2CVHA 3SOZA 2JA2A 2GJKA 3QTLA 4LYAA 3KDAA 4OLBA 1RRKA 1U28A 2JAXA 2ZVJA 3IKMB 4NSNA 2DFKB 4WLEA 4C08A 1RP7A 5E1BA 4ZO7A 2CGEA 3S2SA 4CMCA 3FVRA 4KYTA 5GIPE 1KZ7B 1YIAA 3JARB 3ESBA 2QTRA 2GZMA 3HHPA 2YYSA 4HGPA 4OP2A 4WD3A 2QIPA 3ZIDA 1RCUA 3OZCA 3LI2A 5AT1A 3ERCA 4RK1A 3MGCA 4HLQB 4XARA 3A10A 2EGGA 1T1JA 1P4RA 4HK4A 4RVDA 3EC1A 4UUQA 1I2MA 3RYHB 1LTHR 1HETA 1NKSA 4YJGA 3NV7A 4KREA 3MG9A 3DG9A 2XHEA 2FU5C 5FWYA 1IOLA 4OX9B 1PJZA 3EZ9A 1SMKA 1X1QA 5ED0A 5JH7B 4KPFC 1AQNA 3VNAA 4GKAA 4MDEA 2FNAA 2WI8A 2R3SA 4RFSB 5CA0F 2AFIE 2ODWA 2WJZB 3L0PA 4MLPA 4PHHA 3EPPA 4F2GA 2FN9A 2N1MA 3LCVB 2EF0A 1G8MA 1C1DA 4UFOA 1K63A 1Z8HA 3HY3A 3L84A 4O4IF 4DT1A 3TN7A 4LXUA 4MVJI 3CKLA 4ZOBA 3C5WP 3Q15C 4HNSA 2WC1A 5J59A 4NAVA 4BE4A 5C53B 3OQIA 3RIGA 1TI7A 3ER6A 4G23A 1MQAA 3CE9A 3G79A 3H0CA 4XVRA 3CEPB 3GRPA 3IKJA 4GKBA 4O4HA 3F46A 1ZD5A 4TWIA 3CCCA 5E4YA 3D9QX 2W2LD 3KG2A 1X0VA 3HTXA 3ORYA 3W2IA 4JUBA 5EUCA 4PAMA 5IKEA 4ALMA 4H17A 4H0NA 1N8TA 2H5EA 2PVCA 4R6XA 3T38A 4S1WA 1UPAA 1E2JA 1MX1A 3LVBA 2CLFB 4NBNA 1P75A 2J41A 5J9FA 3YASA 3OESA 2VHUA 4DOMA 3QVUA 4IXTA 4YUYA 3FCCA 1OGJA 4MUYA 4JELA 4RE6A 4CG1A 5EN4A 1NXTA 2H16A 1YIOA 3OO0A 3T5GA 4MW5A 2VSQA 4Q3OA 3GLHA 2VBFA 3K0FB 2BUAA 1Q84A 1XQVA 5C32A 1CUBA 2ZP1A 2W2LA 2D1TA 3PIDA 4AG6A 2NU7A 1DBQA 3NJ8A 2G0AA 3ZLBA 1N33B 2DE0X 3SEAA 1R64A 1IY1A 2GNAA 3E3MA 1HYHA 5TPWB 4DSOA 1AKYA 1LC3A 4LFAB 3B60A 4YHHB 5HGJA 1ORTA 4YV2A 3I9LA 4PO9A 3BG5A 5G0VA 2E1RA 5KU1A 1CYEA 4W82A 3DE3X 2AKYA 2YY5A 4P34A 4D44A 3NI2A 5AI8A 3L18A 4J0FA 3EZ6A 5BO5A 1U0EA 2Z8YA 5K0ZA 1VSQA 4KR0A 4BX3A 3FNFA 4GDMA 4CF4A 1WHTA 3UXYA 4EHAA 3PNKA 4K05A 4HGQA 4WFIA 5FTKA 2R1TB 1YGPA 2IGBA 1U0OC 4JA0A 1FLDA 5LBUA 2Q3JA 2DYKA 5BSRA 3MMXA 2UZIR 4BB6A 4I0WB 5ALHA 1K7EB 1U1FA 2GNPA 5CT6A 5EPOA 4DJDC 2YZKA 4Q37A 2PJRA 3JQ9A 3UICA 4WA8A 1E0AA 3QU9A 1SD1A 1F1BA 3QELB 5TNXA 4KODA 3UUWA 4NJEB 1DWPA 2NXEA 2WV7A 3IBSA 3I62A 1H2YA 4U2KA 1Y7IA 2XD4A 2XYPA 1UM8A 4KMOA 3NBFA 4MWTA 4COKA 4F4FA 4B0OA 5J1SB 2WWGA 3E27A 3RHFA 3U9TA 3DCNA 3CUYA 5AVTA 1YU9A 2HCJB 2ZTSA 2VBIA 1VI2A 2AYXA 3CXUA 1KI3A 3FVQA 4M88A 4EHBA 1JQ3A 1J1ZA 4HWGA 3JVIA 4HDSA 2IU6A 3QFTA 3STUA 1FX1A 1YD7A 4PCAA 5B12A 2P6MA 4M83A 1QX3A 4NHOA 3PQ2A 2HGZA 4BWVA 3K70B 2NQ8A 3QU5A 3Q7EA 3QLUC 5LYJA 5TT1A 2ZPTX 4KTTE 5C9ZA 1KYQA 2BF7A 3JW8A 4MUAA 3IVGA 2F00A 1GUZA 3ZX5A 1DHRA 1K75A 1WRBA 2Q0XA 1YS9A 3RFTA 3OP4A 1IXSB 3A3NA 2VK8A 1B0UA 3KUKA 2R60A 1W4CA 2FW6A 2FMHA 2P6RA 3WL4A 3DDNA 1CR0A 1WCWA 2BTEA 5H0IA 1RZVA 5KHLB 2ZJ4A 3EDQA 3T7AA 5TSDA 1VDMA 4BXOA 2GQ0A 5B37A 3MJVA 1K8XB 4G1BA 1FXWA 2IYUA 3OH8A 2BKEA 4NK4A 4XAQA 2AJDA 2P2SA 4D4JA 3A6GA 3C2QA 1GPUA 3KU1A 3KYIB 3E3AA 4FGLA 3KDPA 5KAPA 3VPCA 4EITA 1PR9A 4QAQA 4LI0A 4WINA 1JMVA 1IN6A 1G2PA 1KK3A 3AL2A 4MSUA 3TD6A 5DX8A 5FO0A 1G7TA 1U7XA 2YNMD 1M83A 3V34A 4XGRA 3KSAC 4M1QA 2XUFA 5ALFA 2HQRA 2JEZA 3FGNA 4XLLA 2WFMA 5IZCA 3C3KA 3ZU5A 1RC0A 4CKZA 3HCAA 5ALQA 2D4HA 3LF2A 3AL0C 4UOQA 1DJMA 3DMTA 3HUEA 4CCYA 3K0KA 1B0AA 3AERB 1NXVA 4NNPA 5KPJA 4UBLA 2AA3A 3DP9A 4N5DA 1DWQA 1UR5A 5EJ6A 5KU7A 1C3JA 4O2LA 2ZIZA 4BNYA 4DG5A 3MPOA 10MHA 3LVRE 2YS6A 4P5PA 4YAGA 3MMNA 2MU1A 3WLRA 1A8UA 1ZXBA 3K1TA 5DEIA 4MP8A 4KV7A 5LDHA 3WMXA 3FVTA 5C8DA 3IFSA 4UTPA 2F7SA 2QM0A 4GEGA 1BVYF 3EB9A 3DT9A 4HTFB 4MV0A 4GNKA 4XH9B 2V45A 3FJYA 2WDPA 5IUKC 1ZHOA 2QQFA 1QJCA 5ALLA 1NNI1 1CJKC 1J56A 1FRQA 1H9BA 2G9UA 3PNVA 4I66A 4Q3DA 1RCTE 1I9GA 4YRCA 2H00A 4YS6A 1D0VA 3WG9A 3BPSA 5LMUB 1T2VA 1Y6ZA 4ENQA 1V95A 4OU4A 2CMGA 2EW2A 4QNNA 2ZUTA 4DMLA 2WU0A 2J8ZA 4IO0A 1EKXA 2ZJ0A 4X5OA 4KG7A 4G56A 4AICA 2P91A 4QLAA 1ZK4A 4XIJA 3PGXA 1R66A 1RQRA 2B1IA 5CFMA 1Q2XA 1SVUA 5F4ZA 4BO7A 2A6PA 1VSTA 4BQEA 2I2BA 5KKCA 1FSPA 1Z28A 1YI1A 2WHRA 3F2IA 3AVPA 2PXXA 1JHRA 1O77A 3LM8A 4JENA 2M6LA 4F45A 1NE7A 1OASA 1WXGA 3CH6A 4IJKA 3PS9A 4IZHA 1TLFA 3E2MA 3SIXA 5AI6A 2BHNA 3TSZA 1UEIA 3A1DA 1PUJA 1YQEA 3AKEA 2A1UA 5KNDH 1E1KA 4WBNB 4I4LA 1YB5A 2YY7A 3OLCX 4M36A 5CA0A 5DXJA 1LI4A 2E5WA 5JAMA 1Q0SA 1SKQA 3DTYA 1XZFA 3JAKA 2XDAA 1C3OB 3AR4A 3NT2A 4RF5A 2QLFA 2XA1A 1XMVA 1VZ3A 1Q1QA 1K6JA 4H1UA 2HL6A 3NC0C 2CCGA 4ZCTA 2O8CA 5DH9A 2PT9A 1IJFA 3Q6IA 5E8RA 3UK7A 4B3TB 3AM1A 1KDTA 2Y1DA 2QB5A 3CW2A 3IHKA 1SOUA 2E49A 3I5AA 4V0SA 4FI3F 2DY0A 3IDQA 4FYMA 4LOJA 4O4HF 4RS4A 4B6PA 5IDWA 2J7PD 4FCVA 3Q72A 4K6MA 3QY0A 4RJTA 1D0IA 2M98A 4OHUA 2QP4A 2EEPA 2JLRA 3A6JA 4PX5A 4M8NE 2ACVA 5IFLA 4ZCPA 2PZAA 2X5JO 5EWLA 1IRXA 5FUBA 4FMDB 4HAWA 4O29A 2Z83A 1NVVQ 3PEEA 2OYCA 3IUSA 4AKTA 4DJAA 2ATCA 3OY7A 4M3NA 1XDZA 2CHVA 2XUZA 1TA0A 4TSKA 2PQ6A 4YFVA 5EP3A 3E22A 4TWJA 4DADA 3UJDA 3NW9A 4E11A 2QRKA 4IWXA 1CYDA 1TAQA 2VA8A 3FTNA 1O4WA 4M9RA 4X0EA 4RELA 3KCQA 1WUHS 5JJKA 2H31A 5AHKA 3ZWKA 4KL8S 2Z95A 4GRDA 4HAOA 1AVTA 1MF7A 1IPEA 1Y6QA 2ATIA 4WQMA 4BMDA 2CK3D 1W0JA 3PPYA 2GB4A 2EWMA 1TEZA 4V39A 1FIUA 3PU6A 4P3OA 3RAGA 4BLTA 3R24A 5EE9A 4BQQA 4EFNA 2EHDA 2BFBB 5HWSA 5J2UB 1PW5A 5BYBA 1ECFA 1U9ZA 3LRPA 3P97A 3RVNA 3I76A 5KI6A 5JO0A 2LDBA 3UXEA 3UT5B 2BHSA 3W6PA 2GH1A 1DPGA 2O2JA 1CU1A 3ZV5A 2W6ID 1ACJA 3KQQA 2G9RA 4NOJA 3WGMA 5CJPA 1GDHA 4J0CA 1KMCA 2BE9A 1DAIA 1YZTA 3RWMB 4PZEA 3HKCB 3U1BA 3IKLA 3OEYA 3H5NA 2P6PA 3QRWA 3D6HA 5KVVA 3DA8A 5CXQA 4BQPA 2ZUEA 2IIBA 2JLZA 4B4VA 3VKGA 2ZWOA 1LY1A 4YRIA 3WKCA 3K09A 1N7JA 1FPQA 4M9CA 4R2KA 4GEKA 4JYMA 1SCDA 1UQTA 3KOZA 2IUUA 2P3LA 1W85B 2O7SA 1IK4A 4CMEC 4CJXA 2G40A 2VRCD 4OVKA 5LC1A 3IALA 5EIWA 2FPRA 1DRVA 4BNVA 5CH3A 2W6MA 3E7WA 1QGAA 1Z4QA 2FHSA 1GTVA 3KOUA 3TMYA 4EF4A 2Q2VA 3S27A 1MR3F 3HBMA 3S44A 1WETA 3BA1A 1KY3A 2I1WA 4F4IA 2V03A 121PA 1BSVA 5ALSA 1GDDA 3I0ZA 1KOGA 3A3YA 2PQ2A 3BMCA 2M32A 2GA9A 1H66A 3EWIA 4G4JA 3A2NA 4ZAVA 4MPRA 4CKCB 1X74A 4BKMA 3MCWA 2VDKB 3PPXA 3ZBUA 1IH8A 2B7LA 3I2IA 5H82A 2DOKA 2UUAB 1K5GA 3NPAA 5AJXA 1Z82A 4DWWA 4CV2A 1Z2PX 1EK2A 1SHJA 3L7NA 1QIMA 1W34A 3I64A 3R8CA 1B8UA 1H5QA 1SH7A 1Z47A 2B20A 2QQ0A 3JRNA 4HZGA 4KFRA 2FPSA 1R6AA 1K2VN 4ZQFA 1JPVA 5CDFA 2HHAA 1EXNA 4YROA 4ZQHA 5JOQA 1UBRS 3O9VA 4IHQA 1ZL2A 1T4CB 4M0FA 1TF2A 3WK6A 1DT3A 3GT7A 1SHTX 2B1QA 2CNOA 8LDHA 1JQJC 2YH2A 4UM9D 1DBRA 5ALXA 1FTSA 2ID4A 3WLNA 3ZXSA 2HPZA 4ENVA 4EHNA 4RKQA 1EVZA 1MC4A 5B5SA 2QN6A 1DV2A 4B31A 1N32B 1GADO 1JECA 1BJTA 1V4NA 3RTCA 1AUPA 2PH5A 1WLYA 3KLBA 2FPPB 3EXIB 2VQFB 4HY3A 3ZVRA 1PP4A 1D4FA 3MAJA 1QE3A 1KP2A 2E82A 5CMLA 1XEWY 3EPRA 3R74A 1GQFA 1IVNA 2HCTA 3FZYA 4KWIA 5DGCA 2GBPA 4X6LA 4ETIA 1JDJA 2QS9A 4FOTA 1NNUA 4PPFA 4JASB 1COZA 1BS9A 3KE9A 3OOHA 4A4DA 1XU7A 3DPSA 4HYYA 5EIEA 4X44A 2QUZA 2AYZA 4LNUB 2CYBA 4TL9A 4AYXA 3THSA 1Y5LA 5KSOA 5IJ0A 3SR3A 2COEA 2FWRA 4HLUA 2OAP1 4UDNA 1MC5A 3TUIC 1SK8A 2ATVA 2WILA 3AVOA 5DNAA 2IJGX 4R1MA 3KZ1E 1YCHA 2QPLA 1RI4A 3GT4A 4LZAA 3LY8A 5D8DA 1U6KA 4D45A 3A27A 3OJOA 2O8BA 3N39C 4ECEA 1J5XA 1EFPA 2VO1A 3HSYA 1EK5A 2F3UA 3T34A 1X77A 5KQMA 1H2FA 1UBTS 2X14A 5BWLA 1PX2A 1M1XB 1FJ2A 5K4GA 4TVOA 3QIAA 1CW2B 3E2IA 1A9XB 1DKQA 5JT1A 2Y71A 4PHCA 2CBGA 3CUSA 4XVHA 3S70A 3QLVC 3FETA 4HX9A 2ZRJA 4LVOA 2OFXA 2VC2B 3A6HA 3C45A 4M1SA 2EF1A 4G8JA 5JNLA 4MS1A 1TGVA 3HNPA 3AB7A 1OSNA 4JLWA 4QT0A 4Q9HA 2VJMA 2C2BA 3ZN2A 4EYEA 4A5SA 4P2BA 1N5IA 1TMYA 4XCQA 2O07A 3LUCA 3RIEA 1FTNA 4ZP1A 2V7QD 2W6JA 3VX3A 3THWB 3K70C 4D98A 1CUXA 1QB8A 1BU8A 3AUTA 2NV0A 4ACAA 1OWOA 4RJ2A 1WXWA 3W5DA 1FW8A 1SBYA 1I24A 3NYWA 2HT6A 4UD2A 1AKVA 2BMFA 3IVAA 4RD0A 3SC3A 1EXDA 3IOCA 4KXNA 4ER0A 2BM1A 3U16A 1WX1A 1X8JA 2TMGA 4TL8A 1QOZA 4OSEA 1JLRA 1Y3HA 4ZVPA 2JIQA 2HTEA 1P5FA 1WW8A 1WPGA 4UEWA 1JLHA 1J6UA 1QV6A 2E4WA 2V7EA 4K9OA 2GD2A 5FI3A 2DB3A 4J94A 3WK9A 1KOFA 4IDDA 4AQDA 3OY2A 2IYWA 4GI7A 2G3YA 1PJAA 2I33A 4K6KA 4NU8X 4BJHB 5FX2A 1PD0A 4X24A 5KTSA 4ESOA 3QSYA 1E9AA 2QLJA 3TW0A 4UTXA 3X1MA 1E8MA 3V8NA 2BGIA 4ARZB 5IVDA 1NULA 1NOKA 2CFCA 2CVQA 1NVTA 1G0NA 1YJCA 3A2LA 3ROFA 3OIYA 2J9FB 3EIFA 3BH6A 2FVYA 3H2BA 3ZIAD 4HEA6 2XZLA 4QYTA 1JFLA 2JFZA 2R7LA 1ADFA 2ST1A 3KJEA 2YWGA 2Q6TA 3TAXA 4C0HA 4EF6A 5L7TA 5IFKA 3GO4A 5ELXA 1K7XB 4M0LA 4XCVA 1F2VA 4LOLA 4GO1A 3UY4A 3ZC3A 4PQEA 4EQZA 1I8TA 2W2KB 4KGZA 4H7PA 2NPOA 3FYSA 2RFLA 3PR3A 2OKCA 2AK2A 3ZYZA 1FMCA 3W9UA 2FK8A 2WJJA 5IARA 4NBTA 2R11A 3IQFA 4KO1S 1W1WA 4MVJE 4TTIA 2AMJA 3HV2A 3LBHA 3DCJA 3RABA 2AN1A 1RPAA 1U8AA 2Y0PA 2A5FA 1YE8A 4DA7A 3MWJA 4GI5A 3U13A 5MN6A 1QCYA 4GWGA 4DDUA 1T1RA 2JGIA 4PLPA 3U0BA 4BAUA 4BBPA 1YFLA 1T8SA 1KHTA 1XVIA 5IWAB 4XIFA 5LXTA 5DYIA 3H9CA 3OP1A 3DGFC 3EH2A 1UWVA 4PTLA 3E23A 3K1YA 4IZ6A 1Z13A 4FYIA 1U0GA 3T9FA 4EHJA 4Z99A 2FP4A 1E6LA 1RMTA 1OLXA 3DOJA 4Q3NA 1ML3A 4B3GA 5DGHA 2Z5LA 3L7OA 2QDXA 3V4ZA 4RDHA 1R8JA 5H8WA 3L7CA 1BGVA 3TO5A 1M1NB 3LBFA 3LU1A 3GVIA 3O8DA 2R1UA 3SFVA 4ETWA 3JVVA 4OGLA 2AF3C 4L8YA 4MKIA 3UCFA 1R0SA 3EARA 4RZIA 4JBNA 1ANKA 1KBZA 2YCBA 3D4PA 1MJGM 2OFPA 2ZWAA 3I1YA 2KMLA 5A0VA 5F51A 5KO2A 3JAWA 4MVJM 1R6VA 1W87A 2WHEA 4JJGA 2CKMA 3A1FA 1SBTA 3INYA 4LBYA 3FOZA 2O2SA 3HWSA 4MRPA 2A9JA 3GYBA 3NM4A 4JSTA 2Y1WA 2FSFA 1XTQA 2W2XA 5BQ5A 1E0SA 4N65A 1BRTA 2AUNA 3ORRA 4K9PA 3LE8A 1QRTA 1Z2OX 1CBUA 2IEAA 3B5EA 3QOFA 1NV8A 3BIFA 3H1FA 1I94B 1XNHA 3HBJA 3JQQA 4V0ME 3PDJA 1JJAA 2W98A 4Q66C 4B75A 1H8HD 2UYGA 4JYBA 3PNMA 4ZV7A 4J3JA 5CFLA 5JSFA 4OI0A 4IUCS 2HF8A 4IP0A 4PBTA 4TRJA 1IY2A 1VHLA 1KARA 1BAPA 1M76A 2FCAA 3PHCA 4QE3A 5AW8A 3QEJA 3G49A 3C7TA 5F4BA 1VP3A 4U6NA 5T8KC 2F1JA 2P62A 4F3TA 3E81A 4H0CA 4R2LA 1NBHA 5BSFA 3EDOA 2D5AA 3L07A 1E77A 4R7ZA 3L7YA 8OHMA 4RK6A 4JC8A 2BFCB 4RUKA 1QWOA 2C7GA 4DHEA 1Y7TA 5K03A 3PT9A 5KOJB 1G21A 4QQKA 2OZKA 4MTCA 1DUIA 3LLSA 2BKLA 1O96B 3F6BX 4C03A 3PR2B 2B25A 3J81A 4JJEA 4OHFA 3AU9A 4WLUA 3V42A 3E8XA 1MQ8B 2IUTA 1E2LA 3OPVA 1I9CA 3UOGA 5FA8A 3UN1A 4YQFA 4ZOLB 1ZDMA 2QK4A 1B1AA 4G1VA 3STTA 4DCTA 1H0KA 3VYVA 2ZS9A 4GM4A 5DJ5A 3FPFA 2YIMA 3K94A 1A2OA 1NMSA 3KZKA 1P80A 2NSYA 3ZJUA 4UMEA 4I1YA 5TE9A 4DLPA 4XYEA 3E3NA 4UM9B 2AN4A 1T3LA 3L0DA 3W05A 4PPGA 4M1MA 5I7AA 1GPJA 1PT6A 1C0IA 5AKIA 5CM2Z 5C81A 3R7SA 5JVDB 2FSVA 1USKA 5ADWA 2DRIA 3DWEX 3KVRA 5DCLA 2PFSA 4IDBA 3JQFC 3MUEA 1MH9A 4OOFA 5HMMA 2HFJA 2XNDA 2QMHA 3HADA 5FFMA 4EKYA 4Z8XA 1J2JA 2RIRA 1DC6A 1ZGAA 1BE8A 2OK8A 3H11B 2SKCA 4Z7QB 4RMGA 1TPZA 2J4FA 1QZUA 4FJ2A 3FFWA 3QWAA 5AW6A 1MVOA 2YMQA 2AG5A 4H31A 3OOJA 5HZGA 4G9EA 1JQ5A 1RHUA 2FZGA 2I54A 5EZYB 3QHPA 5DYGA 2BFWA 2RGWA 4S1OA 1UPXA 3JQAA 4UW9A 3DC2A 1CR1A 4Q19A 1C7RA 5I01A 1PYDA 2EDAA 3DEYX 2GBLA 4CDNA 1GAQA 2AR7A 1V5GA 2GSDA 1VE6A 1S8OA 2I65A 2OM2A 2V7PA 4AQ7A 4FLEA 4Q4CA 2CEKA 3BF8A 3V48A 3DZGA 1UDBA 3WLEA 2O9JA 2CJFA 1F7UA 3KPUA 1R0CA 3WIEA 4PSVA 4WK4B 4LF7B 3RFCA 2VUIB 4FP9A 1J1IA 1W2HA 4LJ7A 3R3VA 2JJMA 2JIPA 1QHXA 3IUMA 4AIRA 4EIWA 4QGSA 5J4HA 4ZXFA 3HI4A 3DFMA 1NBIA 2PGJA 1G4AE 1W59A 3EW9A 3NU1A 1X7WB 3ESQA 3AUYA 4LUCA 4D0SA 1RPZA 4OXYA 5FI0B 1IC6A 1HQYE 1NJFA 1NSTA 2VPZA 2Y92A 1OX4B 2VJKA 4XPZA 4ENPA 3DLIA 1NBOA 1MG0A 3RIMA 3B9PA 3RVDA 2X7HA 3DZJA 5KVCA 5LP1A 3PR1A 2WAOA 2NNWB 2ZRAA 3EUWA 1CF4A 1P3JA 2IEIA 3Q98A 3WP0A 4CU5A 4J16C 1E6EA 1KSHA 2Y99A 3MCUA 1A8SA 4LE2A 4DNXA 3DR5A 4FDMA 2XF2A 3PJGA 4IIFA 1OJLA 1T24A 1MRZA 3WISA 5FUMA 2YV2A 1CZLA 4Y2XA 1MRSA 5EHXA 2O5VA 2RH4A 4NECA 1P4AA 4F8JA 5IJAA 5DX1A 2OXIA 4LF4B 1DP4A 1NM5C 1S2NA 2PLAA 3CX7A 3OIVA 1RM0A 1CV2A 5K0TA 2C97A 2Z5VA 2RGUA 4M55A 2YWHA 3O75A 5ALDA 3ZR4B 2P2ZA 3BF7A 3M5PA 5HR5A 4P0PB 2G0TA 3CIFA 3B85A 2ETVA 5JC1A 1YZYA 2BFEB 1S9HA 1ZIPA 1ZH6A 3HL4A 1X86B 1YQDA 1PEDA 3DDCA 3K5PA 4TYPA 1ZSNA 4A0SA 3NWJA 1OIVA 4KLRA 3RR2A 3EG9B 1XNGA 1DMSA 2NADA 2WP8J 3AY6A 5LLSA 5G1PA 4U3JA 1NN5A 2I0FA 1ULTA 1PVOA 4J2TA 5IDVA 3ZTTA 4TXMA 3TR0A 4I2NA 3DKIA 4KHPB 1DI0A 4X1KA 3LPCA 3A06A 1Z6YA 4KX3A 2P79A 4PC2A 1ETHA 1E2BA 4QOEA 5HZKA 1I4WA 3S40A 4U5XA 4D9GA 1OYOA 3AP1A 1L5MA 3TB6A 1SBQA 4AMGA 5SY6A 1YZNA 1L0BA 4IOLA 2XE7A 4MJ7A 3KD2A 4ZDIA 4JT4A 3S2EA 3TF5A 1JLSA 3LBAA 3LY5A 4OREX 1K7YA 1OYWA 1EE1A 1XRRA 2OD9A 2R84A 1JG1A 5EE3A 3ZDAA 2IIQA 3OEHD 5EWJB 4GP6A 3GFPA 1H4SA 4UHDA 3GF4A 2WTAA 3ZU4A 4HGNA 4Q3LA 4QDUA 1U5BA 3NVDA 1ZKDA 4FEEA 2FVXA 3U3OA 2AFIA 2G0NA 2OB1A 4BDSA 2VP0A 2A0UA 3UJ6A 4XUEA 2VF4X 4HLCA 1VKJA 3RFUA 4Q9DA 1U7WA 3RGGA 4AJ1A 1H93A 4MRSA 3NDPA 1K8RA 3KX2A 1JJ7A 4XYMA 3DO6A 4ARAA 3DYVA 4DAEA 4U2GA 4QXOA 4MHSA 2JA1A 4ND8B 2D6FA 4UBIA 5DRYA 2H17A 3OM1A 5AP9A 5L6MB 3HVRA 1LLCA 1U8TA 2WOJA 4OKSA 1T8WA 5CFQA 2HLDA 2Y1CA 3B3AA 1N2HA 3ZE2B 4JLPA 1FYXA 1KYXA 3LGXA 2MDTA 3T7CA 4F46A 1K3UB 1TJ3A 4J91A 1C7QA 2ZR8A 2ZXFA 4FR0A 4JIGA 1E5VA 1G8JA 1EAMA 1K0FA 4G4SP 1E2HA 4JSRA 1G60A 4KUHA 4L5CA 1QOPB 3V4SA 4CMKA 3M9LA 1XDSA 3O8CA 1T3SA 1EVYA 2P6UA 3DAHA 4OQYA 4OHMA 4PU0A 1HSOA 4Y9SA 5M3BA 2ONJA 4BLRA 3KYDB 4BZQA 1WQ4A 1DTWB 4EJ6A 2INGX 2TSYB 4RKRA 2C4VA 4JOCA 4UPDA 3L6CA 3DNFA 5C2JB 2I2WA 1NW3A 1Z7BA 4ILKA 4A8HA 4B7XA 4N8SA 1CQZA 3ZHXA 3BK2A 5C1BA 1TUBB 2B4TO 4UJ3A 3V1NA 1KS2A 2UZAA 3A26A 4HH3C 4NV0A 2GZSA 1OXSC 1E2QA 4L5JA 1MV5A 2BV3A 2AW5A 3KEQA 3KD3A 4QXMA 3W8NA 2CLLB 3T7SA 1ZD1A 2NYUA 4MYCA 2ZB8A 5KEIA 4Z53A 5T57A 2PUFA 3A0UA 3UWDA 4YXWA 5JWOA 1EDOA 5JZ9A 3ANNA 1JJIA 3JQ8A 2HMUA 5G40A 2JI4A 3CUVA 3S5UA 1XXLA 1AIPA 3C16C 3GLQA 2X1LA 1R6UA 1PS8A 5DWQA 4JZKA 5HRAA 4D3DA 5GAJA 1G3UA 4G24A 2ZATA 4R7GA 4D9JA 3MYRA 5DHAA 2PD6A 4QPNA 1YL7A 5M34A 3BCHA 3FOAA 1DSSG 1DBVO 2Q3CA 4PYIA 5JZMA 2FDRA 1E9CA 1D9ZA 3FF4A 3CM0A 3IAAA 1FW6A 1VMEA 4RLHA 3KVOA 3QLEA 2H8KA 5TMEA 4Z4CA 4HWPA 4M8IA 4R0NA 1U3WA 1UOEA 5CFZA 1GL9B 1HZZA 1YSCA 2R79A 3D0QA 4UCWA 1VHTA 3VTAA 3H2GA 1U63A 1M54A 4GZ5A 1Y0BA 4N12A 4KH0A 4JKIA 1QRUA 4QVKA 1IEQA 4H1WA 2PXHA 2GGSA 5F3WB 3X2EA 3T9BA 4BFSA 1KAGA 3G9QA 4TV8B 4JOBA 3CBQA 1W6RA 1A5AB 1Q50A 2H85A 1GARA 1RRMA 3T0GA 1MPXA 3R5TA 4Y6OA 4BLVA 1W8IA 5IEJA 3MMZA 3RF7A 2OG1A 3FMVA 5ALRA 3SBDA 4BP1A 4CW7A 4QGFA 3U61B 1JLLB 5A6SB 3C8UA 1VRVA 3N7AA 4TMWA 5GPBA 3OM0A 4P80A 4AJ2A 1IMOA 3AJEA 4JLSA 5NULA 1NIJA 4N5IX 3WGYA 1S4QA 2EP8A 1RQXA 4KOEC 1T36A 3F5MA 4YP0A 1FNMA 2QV7A 4NBLA 1XI2A 3MWDA 1E4VA 5EJIA 4WGGA 3TZ6A 5HNKA 3S6JA 4MUKA 2A5DA 1P31A 3F6CA 1AA6A 3BMXA 1M1YA 3WL8A 4KKVA 5FNVB 1WB9A 1A5TA 2HF2A 1QTNA 2J0UB 3A3KA 3GUCA 3EG5A 5DLQC 2P78A 3O7WA 3VHXB 3I2HA 4Q02A 3BERA 1GSHA 1DHTA 1RXSA 3JASA 4DR5B 2CDRA 3PDIB 3WSVA 2Y1KA 3V80A 1QC5A 4TL6A 4OM7A 3UW1A 1W0JD 5C3UA 1S1MA 1L5SA 4KIWA 1T2EA 2VNAA 3F5QA 3VR4A 4F5EA 1EX7A 1JXOA 4KNVA 4MKHA 1VJGA 4BRSA 4RD4A 1HYEA 5AOCA 3GP5A 1DL5A 2JH8A 3RKRA 4CBVA 3BM5A 3LWBA 4RHYA 4US1R 1GRQA 3E03A 1B3BA 1M7HA 5CYGA 2DQ4A 3EVBA 1LVGA 3U3XA 1AY0A 2BKUA 4XCXA 3BGWA 1Y82A 2YZMA 3RF6A 2JZOA 4OGFA 2OORC 2P6NA 2QTWB 1QHGA 4GAEA 4CV3A 4MZXA 1KTVA 2Q9UA 4RPKA 2GVZC 3M1IA 5ALIA 1XMJA 3PJFA 3P2IA 4LTDA 4L74A 2D7CA 4FFWA 2UVPB 3ZGLA 5CB6A 3KKQA 2XJ9A 1EVLA 1SUAA 5TF4A 3OD1A 1ZVMA 4Z49A 1AO0A 4FFRA 5FUWA 1B2RA 1W4ZA 1T0UA 2PAAA 4KLNA 3TUJC 1VMKA 3E9NA 2X1VA 4ZT2A 4QRDA 3F2VA 3KYBA 3HHEA 2D0PB 4YMUA 2GZAA 1L4GA 3FHLA 4G8BA 4V3CA 3SF8A 4YUZA 3PXAA 1UT8A 5I7WA 5JY1A 4PRKA 4RU1A 2XMZA 3T5CA 3T4EA 4N01A 4RVGA 1AGRA 4DW8A 1Z5NA 4IJMA 4UJ5A 4NF2A 5ALTA 1JR6A 1Z4PX 2W8BB 1NURA 3UHOA 3BWBA 3F4LA 3DOIA 3D81A 3O4RA 4NK5A 1QHFA 2AG1A 4L02A 1YC5A 1PKXA 3AEQB 1NU6A 2B30A 3N3BC 4NZ9A 4IMRA 1IG0A 2NXCA 4IZIA 2BP7B 2G8LA 2IZOA 3QVWA 3QXXA 3JTMA 4JP1A 5CYFA 3X2SA 4NCIA 4LDNA 5JCJA 1Y3CE 2Z6AA 4UAUA 1YT5A 3AB8A 3CT4A 5BNTA 4CCAA 1PYGA 1MABA 3PJDA 3R75A 1TFRA 1BEUB 3W06A 4K6HA 3GGSA 1J8QA 1JN0A 1IHYA 1SD5A 4EUEA 1E0KA 4ITVA 3GLFB 1I4LD 4GPIB 1V2GA 3FLAA 5LLTA 4JOSA 1CPYA 3NIGB 4QLOA 2JGDB 3ZLTA 2HADA 4Q6BA 3RVJA 5LQMA 3ZCTA 3PGA1 4DANA 2H06A 4DJ5X 3A6PC 1DQNA 1ULUA 1G3IA 3THYB 2Q4BA 2Y68A 1ZWLA 2FPIB 2EEZA 1QHHB 4LDQA 3U62A 5B6PA 1G4HA 5F76A 1V6AA 2P5TB 2NZUG 2RG7A 3C3AA 2WU4A 2QXYA 4S24A 3S55A 3S0JA 1W88B 3RRZA 3NBKA 5CIYA 2QOEA 1A3CA 2GYYA 1I51A 2FK7A 2JIRA 5EWMB 3SC2A 2IXTA 2HBYA 2QLMA 3A1UA 3TOVA 2CFIA 1NASA 2UV8A 2B4AA 4MA5A 4JQCA 3QBVA 5J4KA 3GLTA 2Q07A 3Q7TA 3CV3A 1R4MB 1UWCA 1ZM9A 4BV8A 4WJKB 1KNXA 3FF1A 2JCXA 2V7TA 2ZUWA 2HWXA 3BRQA 3EIXA 3IP6A 1E3IA 1QE0A 2JI8A 4G5RA 2WT9A 2Z9DA 2NU9B 4FHGA 1KIAA 5ICGA 4DM3A 1J21A 1OKKD 1S7GA 2QE7D 2VYND 1RCFA 1HI9A 3ODPA 2EKPA 3PNBA 1P44A 4GOOD 3DTNA 4Y2GA 2EW1A 4RZHA 2IIVA 2RAUA 1NP7A 2Z2ZA 1Y8RB 1KZHA 1XCOA 2D2XA 5ESWA 4WKOA 2VRWA 1DIHA 2OB2A 3JARA 4N8DA 1XZBA 5J58A 3TL3A 3REQA 4GX5A 4J3NA 2PUCA 3HWWA 3SPXA 1L5OA 3ONVA 5ILQA 2NUTA 4QOGA 3N2GA 3PK0A 2ZTHA 3FTPA 4RIEA 4TMTA 5CB0A 3HDHA 4FC7A 3SSNA 2P0AA 4TYNA 2JF0A 5JNWA 1E9DA 5FTMA 4E2ZA 3ENWA 3ZHCA 4CMHA 1BJRE 4UCXA 1KQ3A 2J6HA 3V4RA 1IBCA 5GINE 2CEAA 2BGUA 5CM9C 4BKRA 3SBOA 3RS3A 2OL4A 1XMSA 1T0BA 3AJDA 1DO2A 1HFWA 1MDBA 1UFKA 2XT0A 3IP7A 4MVWA 1KEEA 4ACBA 3N2IA 1OAOC 1R50A 2JFYA 5KYUB 5JAZA 3LZDA 2WT8A 1C1DB 1MLDA 1GTSA 3AM4A 2X0FA 5IJ9A 2PMCA 1JDBC 1RXWA 3FYDA 3RBZA 3UFXA 1VB3A 1UBFA 5IH3A 2IPXA 1BHO1 2MR6A 1QH8A 1B8PA 2QRZA 3QKRA 3OQIB 4ER3A 3SYKA 3KTOA 3KQVA 3AVVA 1E3WA 2XZTA 3AJRA 1P5HA 2QBYA 5IJZA 2ZJ5A 3PNYA 4FCCA 3ZW7A 4BWFB 1YWGO 2C9ZA 1KU0A 2IV2X 3E9CA 2JVJA 2A8YA 1G5TA 2XE6A 1GKLA 4ZT4A 1QCDA 2JIMA 4A5OA 1B2LA 3OFNA 1WXIA 4KC0A 4ON9A 3JAMA 4IIJA 6CHYA 1RE0A 3D3KA 4FBMA 1EBFA 3FDXA 3UJBA 1K9SA 1IZ9A 2YRFA 2Z3VA 3LCJA 4MV1A 5EQTA 3HPRA 3LFUA 3RUCA 1E9RA 3M81A 3JQ7A 5DSXA 1VCIA 4DLRA 1CDDA 4JL5A 1NVBA 1KRHA 3IOBA 1E20A 3GH1A 2I6TA 1OPRA 2ONZA 1P29A 1VFNA 3WNBA 5F1YA 4DLBA 1DKMA 3K0FA 5F5LA 2J3DA 4RJJA 2CLOB 4DLAA 1GNLA 2NU8B 5IC4A 1GRRA 1MJ5A 2XUHA 1IM8A 2PNFA 1HYBA 1BX0A 3EZFA 3K15A 4IKOA 2J48A 1GPKA 2O7QA 1XDDA 2Z8XA 3EGXB 2PZ8A 3T4XA 4N0PA 1QCZA 1R2QA 1E5LA 3B1YA 3MJ4A 4JIMA 4KI0A 2EKBA 3F7TA 3L4KA 3EF1A 5AM3A 1WVGA 4GP7A 2J6BA 1CUFA 1VA4A 2LKDA 4CL3A 5K0EA 2VF8A 2YJ6A 3KKLA 5EZSA 1ISHA 2EZUA 1JHPA 2DFVA 2C2KA 2KLBA 3B36A 4CKEA 4NG4A 4ND6A 5SZKB 2QRVA 3OX2A 4RZSA 2AKEA 2JHGA 1XKXA 3IJ5A 1UEXC 1MEOA 3A4MA 2XQIA 3N58A 3M7IA 4OI2A 4YJKA 2VXYA 4D25A 1ZH4A 1A7JA 1U0LA 1R4NA 3PFGA 1DWUA 2DX7A 2CHUA 5IVIA 5JD4A 2FQ1A 4QM7A 3G0BA 3TLMA 3FSJX 2YXLA 4A8TA 4B6RA 5DI3A 4MA4A 1BXGB 2VH2A 3QOYA 1QLHA 5IASA 3W3ZB 3GA0A 5F7JA 1G6OA 2ACWA 4GKJB 1LDGA 3GA7A 2ZSBA 4QGGA 1UDWA 3BWYA 4KQWA 4Q93A 3NHSA 3UCXA 4FOLA 1A69A 1ZRNA 2DETA 4BLSA 1Y1TA 4PZZA 2GCNA 1E2PA 3DXXA 2PBRA 2WF7A 4MW1A 2ZRFA 5EEGA 2ZBPA 5CFOA 2A9OA 3JD4A 1XP5A 2PKYX 2W6OA 1J06A 5IXJA 2Q7DA 5CD1A 2Y77A 3U7IA 1XEWX 1E98A 2J9XB 3JZMA 3N7TA 4LXTA 3KPYA 3TH5A 3HMQA 1MHTA 5FP0A 1NTOA 2BGMA 4AZ3B 4BPRA 2PUTA 1TM3E 4MIOA 4FPXA 3FOWA 3CCBA 1BDIA 3ZI0A 4X3OA 4X20B 1B26A 2MMGA 3IR5A 1BD3A 3QQ5A 4FVTA 4BO6A 1U28C 3OCVA 2O7VA 1XOIA 4HVAA 4KAJA 4CEIB 5EE5B 4MQ6A 1GGEA 5A1TA 3DEAA 4JBGA 2PR2A 4WK6A 2MJLA 4EHFA 1WY5A 2PUBA 4BXOB 2HSWA 1KQGA 3ZKWA 1M34A 3IO3A 3T3NA 2WVHA 3ZHRA 1Q17A 1E4EB 2EKZA 3DXZA 3EXHB 4KO8A 2ADFA 4BJ3A 4G3XA 3WRWA 4IX9A 4TTJA 3TEJA 3WGQA 1TJPB 1N2CE 5FYQA 3V4PB 1YTLA 2G1PA 1EIWA 4OXNA 3HM9A 3U3ZA 3V1UA 4NPCA 1WS6A 1FFAA 2GZDA 2R8ZA 4W7IA 5LCXA 4KR6A 1DC7A 1VL0A 2VP5A 3SKVA 5BQOA 2IPLA 1YIDA 4F7WA 1JT2A 2GK7A 4I1OA 5TGTA 3WDLA 4J7CA 4UBOA 2G1KA 4EI9A 1Z7EA 4UNSA 4RTQA 3DVAB 2DPYA 4UVGA 3OIDA 1LB1B 1QDEA 1XCMA 3I9OA 3QK7A 4W63A 4F9FA 1J25A 3L77A 4E1BA 4Q1AA 3QXSA 2XUDA 4MQUA 3HKEA 2R2AA 3HZHA 3DE1X 3I1JA 1KJ9A 2ZVQX 2C58A 2QLBA 1NI5A 1VKOA 3KK0A 4H6WA 3N87A 4HCJA 2QRQA 2J0QA 4EB0A 1PHRA 3KZXA 4CR6A 1ETUA 2V6GA 4UUOA 5MF6A 1CETA 2JKVA 2ZB2A 2P6OA 3IIMA 4D9FA 3R40A 5J23A 5FBRB 3SKXA 2O8EA 3HB1A 5JATA 2GFIA 4FB5A 4KAXA 2DG2A 1GPNA 2R96A 4NMWA 1WCIA 1QFYA 5AKYA 4MUEA 3QYPA 1SCNE 1JB9A 3AG6A 1P9RA 2TMYA 1QF7A 4ICIA 1OV6A 4B2PA 1N2BA 1IEWA 3E61A 3R7WA 2GXAA 4D9IA 1JWAB 3Q7QA 1S2OA 1G2OA 2NZ2A 1P2VA 1H2AS 2QQGA 2ZSIA 1CUHA 3U49A 1NLYA 4J0GA 4B9AA 5JXHA 2AZTA 2X9QA 3BTOA 2Y9MB 2YS7A 1WUYA 2JATA 3WMEA 5EAIA 1TE2A 1EWVA 1BCRB 3U3MA 3ZZ0A 2HREA 4C6RA 3KYCA 1M1YE 3RAFC 2EARA 2YOHA