4J0DA

Tannin acyl hydrolase from lactobacillus plantarum (cadmium)
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
470
structure length
470
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 167
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0dA00
4BDSA 1W4LA 2C4HA 4PNZA 5T4EA 5AI5A 2XQJA 4C4YA 1JJBA 1M33A 3H2HA 5AKLA 4DNFA 4AXBA 2BKLA 2WFLA 1GXSA 5HKBA 5HKAA 3ZPXA 5JZSA 3I2JA 3H19A 3TEJA 5CXXA 4RE5A 5CW2A 4A5SA 1W52X 1ZOIA 5ALZA 4BYMA 1H2XA 4F21A 4BZZA 1VZ2A 4OB8A 3WKAA 1QIDA 5A71A 3IA2A 4H35A 3HI4A 3STTA 2BJHA 5AO9A 5KWIA 5IVHA 3QPAA 1ZIYA 5FV4A 4GW3A 4P9NA 4K6GA 3VVMA 3V1MA 2WTNA 4XX1A 5T4BA 1EB9A 2CJPA 1VKHA 1Y7IA 1IUOA 1AX9A 3FYUA 3IDAA 1MX1A 2DFPA 1T4MA 1HPLA 3WKCA 5K3CA 2DQZA 4N8EA 5AOAA 4N5HX 3KDAA 4QLAA 1ZI6A 3ESAA 4X6XA 3WKBA 4U2EA 5DLPA 2QVBA 5A7HA 2XMSA 3FVTA 1TCAA 1CPYA 3I28A 1VE7A 1R4ZA 1F8UA 1OILA 2WHRA 1R9MA 4BB0A 4RGYA 3ESCA 3IURA 3FWHA 5DJ5A 3HJUA 2V96A 3E0XA 1L7AA 1A88A 3STVA 5HF6A 5CT8A 4AO7A 4IH1A 2O2GA 2E3JA 2XMZA 3WL8A 5EHZA 1XZFA 1XLWA 4FTWA 1MX9A 1XRQA 3G0BA 3BDIA 2HA3A 2OPHA 5IKXA 5LKRA 4L0CA 3M82A 4H7FA 5LZ9A 2I3DA 2J3QA 3IUJA 4DSZA 1UK6A 2C5GA 5AI8A 4B80A 1YAHA 4EY8A 3ZV7A 4Y2RA 5KBYA 2OXEA 4UBIA 2WIKA 5AKJA 2X5XA 1P0IA 4QLOA 3DKRA 1XZGA 3C6YA 4ZV7A 1UOPA 1H2WA 5I7UA 2ZVDA 3M3DA 3W9UA 3AILA 4UBJA 3DQZA 1ZGBA 3W05A 1ZGCA 3C6XA 4UHDA 3WWEA 4B0OA 3Q0TA 4FNGA 3R40A 4KEAA 3PFCA 2WIJA 1J07A 1G66A 3WKEA 1EI9A 5ALEA 2BAGA 1ETHA 3IB3A 3PF8A 1QIEA 2WLSA 1MAAA 1QIKA 1W75A 5DTJA 5CXUA 4DMFA 3BXPA 4AMZA 1CUBA 5CBKA 1XRNA 4KAAA 2XMGA 5HFNA 1JT2A 4OB7A 1B41A 1ODCA 3C70A 3RARA 4LXIA 4UUQA 4X85A 3KWFA 2C0PA 2X8BA 4Q05A 2YYSA 3HRHA 1VA4A 4F5ZA 3DS8A 2HRRA 5CTAA 3WK6A 3M83A 1YB6A 2AXEA 1XZIA 2CZQA 2HU7A 1Y7HA 5K5EA 2OCIA 4UFOA 1MNAA 1QOZA 2I3ZA 3R3YA 2J3DA 3A70A 4MQLA 2OGSA 1G42A 4X90A 3G0CA 1CLEA 4E46A 3FYUC 5AKIA 1J06A 5AICA 3R3UA 4QDTA 1K4YA 4RNCA 1XRMA 1AURA 3DCNA 3QMMA 2OQIA 1O6GA 2HM7A 5HZGA 1BE0A 4PF1A 1Q0ZA 2OLEA 3PF9A 2H9YA 3WA6A 1XZJA 1EVQA 3K9BA 2HA2A 4WFKA 2HA4A 3FNBA 4H77A 4BVKA 4O08A 1FJ2A 3WI7A 4YASA 4I19A 2WUDA 4Q3KA 1XRRA 2HHAA 3D2CA 3H17A 3IUMA 4BP8A 2R11A 3BJMA 2G5TA 1BROA 1CUHA 4KE7A 1JMKC 2JGEA 1WHSA 3C43A 4LKOA 4BAUA 5ALDA 2VSQA 1RP1A 4DTCA 3O9VA 1E8DA 2PM8A 4M0MA 4B81A 2FUKA 2OQVA 1Q0RA 3MGAA 2H1IA 2Z3WA 3DOIA 2YH2A 3IUQA 5ESRA 5K3EA 3UUEA 3C5WP 3G0GA 4DLNA 4DMCA 1EH5A 4A23A 3ANTA 1MT3A 1MJ5A 2PSEA 3FLAA 3PUIA 1FFCA 1JKMA 4G5XA 4H7KA 3D2AA 1TIBA 4KE6A 3WWDA 2Q0XA 1TCBA 2AJCA 1EINA 1SCIA 1DINA 1NX9A 3F96A 1QO7A 3WQHA 2D0DA 2XMRA 4XWGA 4GECA 3I6MA 4JYPA 5E4TA 3WWOA 1XLUA 2ZYSA 2HA5A 1EK1A 3ICVA 4EHBA 1NU6A 2PSFA 4RE6A 3W04A 1CQWA 1CEXA 3QPDA 3T4UA 5JD6A 4N8SA 1EDBA 3AJAA 3B12A 3EQ7A 3L1JA 1FFBA 4B9EA 3OOSA 4AO6A 4B9AA 2J4CA 2EEPA 1LPMA 3QBJA 4Q1VA 5IVDA 1KU6A 3V1NA 2QOEA 5ALSA 1K63A 4PV7A 1RWQA 1XROA 4F0JA 3QMWA 3H1AA 5AM3A 4GXNA 5AK4A 4PSUA 2H7YA 5C7YA 5E4YA 3WA7A 1LPAB 3FCYA 3NGMA 4AZ3A 3I2IA 4ZI5A 5LZ8A 4EUSA 4BP9A 4NS4A 1PFQA 3DNMA 1TQHA 1XZMA 1EK2A 3BL8A 3STXA 2Z5GA 5LZ5A 5JALA 3DD5A 5EIAA 5J3JA 1QIIA 2XUPA 3AINA 2VAVA 5DYYA 2HADA 3IUNA 3Q8WA 3STYA 2H7CA 5EGNA 5BOVA 3D4LA 2OAEA 2WU4A 5D3KA 1TAHA 2HA0A 4Y2VA 3BF7A 4B0PA 2JBWA 3EIOA 4S0XA 5AM1A 4C4ZA 4CIAA 2HDWA 3DJYA 5ALQA 1TKRA 1K6EA 2O2IA 2JGFA 3R3XA 1CV2A 1PV1A 3FOBA 4X7BA 2WJ4A 2XUJA 1XZHA 2FX5A 2IITA 4KAJA 2ZSIA 4NVRA 5CT4A 4BRZA 4YX9A 1ZI8A 5D3ZA 5LZ4A 1YS2X 3NWOA 1CVLA 1GZ7A 4J0IA 1MAHA 4CFSA 3I1IA 3G7NA 4ROTA 2HU5A 1YB7A 5H3HA 2AJDA 3NUZA 2Y6VA 4U2CA 3AIMA 3H2KA 4OB6A 3S2ZA 4AO8A 1XQYA 4LIPD 1J2EA 5AOCA 1BN6A 3FAKA 3WK9A 3SWWA 1RYYA 3GA7A 3R3WA 5JAHA 2YASA 4G8BA 1UK7A 1BU8A 4OUKX 5LLSA 1CUCA 4BVJA 1EB8A 1LBTA 4X6YA 5ALNA 3I1YA 2WHPB 1SFRA 5AKXA 3QYJA 4QEKA 5LKAA 3ANSA 1VJ5A 2WFMA 3ZI7A 5JASA 4FHZA 3BIWA 2BFNA 1DT5A 4G8DA 1JJIA 1ZD5A 1G4HA 2Y6UA 1ORVA 4GEGA 3RM3A 1XQXA 1E8MA 3DKKA 5T4FA 3BWXA 5JAOA 2XB6A 4CCYB 1VE6A 3IBTA 2OCKA 4EY5A 3C87A 5CH5A 2XT0A 3UUFA 4A16A 3EQ8A 4FBMA 1CUWA 4FLFA 4X97A 2ZJ7A 4AQDA 1XZDA 1L7QA 1UZAA 2PVSA 1LNSA 1KEZA 2XUIA 4BATA 4QZVA 3HACA 1TRHA 2QRUA 2ZYHA 2QS9A 1GQSA 5A2GA 1UKCA 2VA9A 1CRLA 3V9AA 3FVRA 1ZIXA 4DNPA 4AB1A 1E8NA 3W9BA 3VISA 3A6ZA 4IQ4A 3LS2A 1FSSA 5FDFA 4UHBA 2WJ6A 2Z8ZA 5ALVA 1W1IA 4INZA 5ALGA 5EHXA 5HF8A 5AK3A 2V98A 1FFEA 4KRYA 2WTMA 4WCVA 4W1SA 4QDUA 5I8PA 4D9JA 1N1MA 2ROQA 5ALOA 2ACEA 3LCRA 3CCBA 4IHAA 1UK8A 1DWOA 2JEYA 3OPMA 5CMLA 5DYWA 4HVTA 5CT9A 4OPMA 2XQFA 5FRDA 1CUXA 1XQWA 2QKYA 1WM1A 5FPQA 4KAFA 2WKWA 5K3FB 2WHPA 5ALUA 1WOMA 4W63A 4MWTA 3TGLA 3D3NA 3LLCA 4CG2A 1QTIA 2ZJFA 3IIIA 1UFOA 3FYTA 2V9ZA 3R41A 2ONCA 3ILSA 4FWBA 3WYNA 4UFNA 2ZJ6A 2VT7A 3C6BA 2ES4A 3AZPA 1MN6A 4E14A 4H7EA 4CCYA 2Y2UA 3H2JA 5CRIA 3EQ9A 4J0GA 4ARBA 4PW0A 5AK5A 5DWDA 3D59A 1O6FA 2I03A 5FUMA 3HYSA 1UOOA 4RPCA 3VVLA 4PO3X 1YA4A 4K5QA 5EHNA 2GBGA 5AP9A 1ZD3A 1YASA 1ACJA 1WHTA 2O2HA 4QWMA 1DQZA 4FFWA 1AC5A 4OYYA 4KYVA 5F4ZA 1E5TA 3I2HA 4NMWA 3QITA 2CUTA 2EDAA 4DGQA 4M0FA 4Q82A 5FOQA 5JD5A 3S8YA 2UZ0A 1Q83A 5EIEA 2XLCA 4ZRDA 1YSCA 3E1GA 1WB5A 2QR5A 2B4KA 2RI6A 4BBZA 1TCCA 3A2NA 2ZYRA 3L1HA 3RK4A 5ALYA 3WWCA 2HU8A 5JAUA 3A2LA 2DSNA 1YCDA 1CFJA 3HLKA 4U2GA 3WIOA 2ZSHA 3WK8A 5ALRA 4B7ZA 3SC2A 4ZREA 4C87A 4FKBA 3VKFA 3JYHA 4J0HA 1A7UA 3QZUA 1UWCA 5A7GA 4P93A 3EBLA 4Y2UA 2C0QA 3T52A 2GBFA 2BUCA 3LIPA 1QGED 3K6KA 5K3FA 1H22A 1USWA 5C8XA 4QDZA 4H7DA 1ZD2P 2GYVA 3F8SA 3BDVA 3LP5A 3V48A 2VEOA 1ZI9A 4PSCA 3R3VA 5YASA 2P8SA 5HQ3B 3DYIA 2CBGA 1TK3A 4XVCA 2PU7A 5AKGA 5FP0A 1DWQA 3OC0A 3BF8A 3B5EA 1CIJA 3I2KA 3AFIA 4U2DA 2GYWA 3O9MA 4G4JA 5CT6A 2XI4A 1R1DA 4LXHA 3G02A 4QDOA 4XIIA 1CUEA 4C89A 2RGUA 4PQEA 4C88A 1MX5A 3ZLUA 3WLAA 3VDXA 1GQRA 1IZ7A 2QJRA 3G9ZA 4H7IA 4JEIA 4L9AA 2XUGA 4K6KA 5CURA 5FLKA 4MQMA 1HQDA 4AN0A 3D2BA 4J0JA 2C58A 1CUDA 4FLEA 4QNNA 2XQIA 4UHFA 4P08A 3ESDA 4B83A 4ZV9A 2QMQA 2BUAA 4X3CA 2ORYA 1MPXA 1N5RA 4PSDA 1XZAA 4UHCA 4WY5A 4X92A 1WB6A 4B84A 1QFSA 4AMYA 1BCRA 1BEZA 5AKYA 1SCQA 4CIBA 5EFZA 2XMDA 1FFDA 2PPLA 2HA7A 3W2TA 1F0NA 4XJVA 4FDMA 1SCKA 2WUFA 1ZJ4A 4EBBA 1GPKA 4BTVA 5AM0A 4JH0A 4AX4A 2PUJA 4YK7A 1U65A 4GI1A 1CR6A 1Y37A 2QXUA 3WYDA 2K2QB 2HFKA 1VXRA 4NZZA 1XLVA 2XMQA 1JI3A 1XRLA 2I78A 3SX4A 2C7BA 4KRXA 1P0MA 5AIBA 4UFPA 2VJBA 1W6RA 5D7BA 5ISMA 4J0CA 2H7XA 1DQYA 2WG2A 4C01A 4IO0A 1AKNA 2XUAA 4DNQA 2XE4A 1K5PA 3TRDA 4Y2QA 2LIPA 1QZ3A 5LIPA 5HQ3A 4HTAA 3C45A 1NU8A 2XQGA 2B20A 3I6YA 4UHEA 2XUHA 3G0IA 4G9GA 4IH4A 4KR0A 2ECFA 3OM8A 3ZLTA 4L72A 4OU5A 4AZ0A 3BE8A 2VJAA 5ALJA 1EX9A 2WIDA 3F98A 5BWCA 2JGIA 2HA6A 5JATA 3STUA 1BCSA 2BUBA 1G5FA 3RLIA 4ZGBA 5BWBA 5A7FA 3BJRA 4H0CA 1CUSA 4CG3A 4YPVA 3HABA 2OGZA 3F9CA 5K3DA 4FBLA 1EVEA 4HRXA 1LPBB 1LPPA 4CI9A 5CH3A 4Q3OA 4BC0A 2WU3A 1H2ZA 4N5IX 1ZD4A 4HXEB 5CT5A 3EF3A 5AI9A 3AIOA 3PUHA 2QXTA 1DX4A 3VJMA 5JZBA 1QONA 1QIMA 4TGLA 2XUKA 5FPPA 5DTIA 2WJ3A 1FFAA 4WFJA 5LZ7A 5AM2A 2G4LA 4HRYA 2DQYA 2AJLI 5JADA 1CQZA 4BCDA 4TPKA 4FLMA 2BGNA 1CUGA 3AIKA 2V97A 1CUJA 1IUPA 4UPDA 1GKLA 1K8QA 1XZEA 3GELA 2EDCA 4BRSA 5JAPA 1W76A 2CEKA 2X76A 3C8DA 4Y2JA 1L7RA 4G1FA 2WUGA 2HFJA 4OCZA 4QE3A 4BCCA 1ZICA 4WDQA 1LGYA 5SYMA 4WY8A 1XZBA 4LYDA 3E3AA 1ACLA 3STWA 3QH4A 2JGMA 1YS1X 1CUZA 5AH0A 3M81A 3DYVA 4HS9A 5HF5A 3GBSA 4P92A 1DWPA 4Y2PA 3WK4A 4Y7DA 3KOOA 1N5MA 2PSHA 2B61A 5SYNA 3HZOA 3OTQA 4G9EA 4W1RA 2XUDA 3WIBA 4JYMA 2HL6A 5CH8A 4C6HA 5JANA 5T4HA 5EI5A 5AKKA 4OU4A 4EY7A 4EA6A 2OCGA 4KE9A 5FKJA 4W1QA 2Y1KA 1JU3A 2PX6A 5DYTA 1IVYA 1UXOA 4LHEA 5LYYA 1A8QA 4MEBA 3D0KA 1U4NA 4U2FA 3ED1A 3PE6A 2GYUA 3O4HA 5AKEA 4FOLA 4BAGA 2VJDA 2ACKA 1IMJA 1UT6A 1DU4A 1VXOA 3MVEA 3V1LA 4ARAA 4WFIA 1JMYA 3CN7A 4Z49A 5ALXA 4Q3LA 1GPLA 3N0TA 4J0DA 5ALMA 1B6GA 4Y2TA 4OD0A 3U1TA 2GZSA 1R9NA 1C4XA 3SK0A 5HCUA 3FCXA 5JYCA 3C6ZA 3QVMA 5ALPA 3PI6A 3O4IA 3OURA 2VF2A 1E66A 5K3AA 1R88A 2QZPA 1BS9A 1THGA 2J4FA 4I4CA 4CG1A 2XMBA 1JU4A 5ALIA 1A8SA 3FSGA 3AUKA 1LZKA 2B9VA 3WL5A 2Z3ZA 3WZLA 1CUUA 1VOTA 2HRQA 2IIVA 2FJPA 2QUAA 4W9RA 4KACA 4L3WA 2Z8XA 1N8SA 5HK9A 5JZ9A 5AI4A 3G9TA 4G8CA 3V1KA 3MUOA 3AZOA 5A62A 3H0CA 3P2MA 2XLBA 1BEEA 5ALLA 1R50A 4DMHA 2C5FA 2VJCA 3RKSA 5KREA 2PSDA 1CUFA 3CCCA 2VT6A 3AZQA 3QMVA 1ORWA 2WILA 4FFVA 1H23A 2WFZA 3O4GA 3VJLA 3WK7A 3F97A 3ZWQA 5EIHA 1WPXA 3GFFA 5AJHA 3HSSA 1HLGA 1IZ8A 2WIGA 1XKTA 1SC9A 5C81A 1J1IA 2YXPX 2FJ0A 2JEZA 3QPCA 3DEAA 1MO2A 4E11A 1AGYA 5HK8A 3GROA 3D5EA 3KWJA 4X00A 3KSRA 2DHCA 2O7VA 5E2IA 2PU5A 3ZLVA 4C4XA 3GZJA 4BC1A 3E4DA 3H1BA 4BE9A 4W1PA 1CUVA 4B85A 5I9IA 2VTVA 2VATA 1HDEA 4HXFB 2XUFA 3N2ZB 1HBJA 4I3FA 3DDUA 1QTRA 4X91A 1UKAA 5ALHA 4J3JA 4MXDA 1ISPA 3IULA 3H2GA 1AMNA 1SOMA 2R8BA 1EHYA 4MJ3A 7YASA 3OG9A 4LXGA 1XQVA 2O7RA 4H7JA 1YAJA 5AKHA 4BAZA 1XZCA 4DIUA 1OCEA 4G4GA 4GWLA 1ZJ5A 5LZ2A 2DHDA 3WJ2A 1C7JA 3WKDA 2GBCA 5AOBA 1VZ3A 2JGKA 1HKHA 4EZIA 5A6VA 4QDXA 2RAUA 1PJAA 1OXMA 4B6GA 4DYHA 3ESBA 3YASA 3WL6A 3LIIA 4U2BA 2DHEA 2D5LA 2W22A 4K2AA 3O0DA 2QM0A 4DSAA 2JGLA 4X6UA 2XUQA 3H18A 3JWEA 3JW8A 5ALKA 5ALWA 1GPNA 1BRTA 1QO9A 4X95A 2IX9A 3HEAA 4Y2XA 1ODTC 1XZLA 2WSLA 3BIXA 1XKLA 2PSJA 1IUNA 4QWWA 2XMCA 4JUIA 5HF9A 2PKYX 1Q84A 5AI0A 1QIGA 5C8VA 4ITVA 3I2FA 3VJKA 1LZLA 1DT3A 5AIAA 1R3DA 2XQKA 1YA8A 4J0KA 1QIFA 4AN1A 2WG0A 3PDCA 2GZRA 4UBOA 2WIFA 3CN9A 5JARA 2BCEA 4GBGA 2WHQA 4EY4A 3GUUA 4Q34A 3DOHA 2WUEA 5IVKA 5JD4A 2DCMA 2VQ6A 4GLBA 2CMFA 3W06A 4UBMA 2Y2VA 4CCWA 3CXUA 3MUNA 1Z68A 4KJXA 4H18A 1VLQA 2VAXA 1YR2A 1KU0A 3B3QA 2DR0A 5LP1A 3H2IA 2XDWA 1LPOA 1EDDA 4B82A 3KXPA 3NOXA 3WMRA 5AM4A 5AKZA 4HZGA 1DX6A 4WDRA 1GGVA 4UBKA 3C8HA 4MEAA 1GT6A 5KWJA 1I6WA 3TJMA 2RHWA 4BTLA 3WK5A 3PICA 2AJBA 4JNCA 1CUAA 1UK9A 4QA9A 5BV7A 4H7HA 3ICWA 2QUBA 1EA5A 1U2EA 4HAIA 1MNQA 4DNOA 4IH9A 4LYEA 1LLFA 2JF0A 1WCYA 3K2IA 2HIHA 4UBLA 1XZKA 3UMJA 3G0DA 4E15A 1F0PA 4X71A 4MYDA 3HXKA 3G8YA 1E89A 4J03A 2PL5A 4X93A 1JFRA 2CB9A 4V2IA 2PUHA 1QIHA 3C5VA 4N8DA 3IVMA 4F60A 4BVLA 2QT9A 3DL7A 4G4IA 3WZMA 1X2BA 4BDTA 5K3BA 3U0VA 1BN7A 2OGTA 5JIBA 4ZWNA 2OAGA 4Y9SA 1WPRA 1X70A 1S8OA 2BGRA 1AUOA 1CUIA 1E3QA 5ALTA 3A2MA 4UBNA 3DL4A 5C8ZA 1QFMA 2PBLA 4MYSA 3D7RA 3VXKA 4X94A 3R3ZA 2WG1A 4BZWA 2RONA 3FLBA 2QJWA 4DM7A 1QJ4A 1QE3A 3HC7A 4MWSA 2WFLB 1WB4A 2RHTA 1THTA 2ZYIA 1XFDA 3O4JA 3I6ZA 5AHXA 1AQLA 3KD2A 3G9XA 4WJLA 3PFBA 2XUOA 4K6HA 3WJ1A 4ZXFA 2WM2A 2NW6A 2G5PA 1ODSA 5D6OA 2JGJA 3DLTA 1D07A 3O95A 4BCBA 1QIJA 2W6CX 1A8UA 4GHWA 3H04A 1QLWA 2GBIA 3FBWA 3FLEA 5IVIA 2G63A 3WWPA 3FYUB 1GKKA 5E4JA 4UHHA 4ETWA 3F67A 4EY6A 1XRPA 1MU0A 3QM1A 4TVKA 2JIDA 1LBSA 4Y2YA 1LPSA 2AJ8A 1CUYA 1UOQA 2OCLA 1P0PA 4M0EA 5ALFA 1EDEA 4Y2SA 1LPNA 4OSEA 5IH7A 4DMKA 5AI6A 4KE8A 4BE4A 5DNWA 2OG1A 2RIPA 5DNVA 5FXMA 5DNUA 1C7IA 5HFAA 2QTBA 4FNMA 3R0VA 5AK6A 4HXGA 1DTEA 1VA5A 4GDMA 1UKBA 1U8EA 3G9UA 1AZWA 1P0QA 3I2GA 2WQZA 1JJFA 6YASA 4OYLA 3WL7A 4EB0A 1H2YA 4FMPA 1F6WA 1EXWA 3X3HA 1HL7A 1MTZA 5EHQA 5AM5A 4J7AA 3FSGD 3L1IA 1X2EA 1T2NA 2CKMA
chains in the Genus database with same CATH superfamily
4YHHB 3OIGA 3M3PA 4HMOA 4BDSA 5FOVA 4KL8S 4AJ9A 1UBRS 2W0MA 3W0LB 4G97A 5T4EA 1BKDR 2XQJA 3Q6IA 1IMOA 2LIVA 3L8FA 1X42A 4CNBA 4CEJA 1TVKB 2IOYA 2D00A 2IEIA 5AKLA 4AXBA 1K7EB 5HQJA 2J08A 4BQIA 4YIHA 1DKLA 2BKLA 2WFLA 3ZPXA 5JZSA 1DE0A 3L9XA 2FSPA 3OESA 1TTQB 2P4UA 5CA1F 5ELXA 3Q3EA 2D2VA 3MJFA 4RPHA 2FOLA 4QYXA 5ICEA 2IHJA 1TTTA 2RKWA 4PZYA 2XZTA 3BCUA 1GG5A 4BO1A 1UMCB 1QZXA 1PT9A 2AQHA 4BEVA 4BO0A 5ALZA 4R1MA 3TGPA 2RAFA 1PGNA 3Q4GA 3R75A 3ZXUB 2QSJA 2G9RA 1N0WA 3CLTD 2TMYA 3MTEA 2QUKA 5EP3A 3L4BA 3UCFA 1J2YA 1NBMA 1C3EA 2W4MA 2IUTA 2CEAA 3ANMA 1JHZA 3KDPA 4DBLC 3EBOA 1LQUA 3PQ6A 4MVJF 4BVAA 4Z7NB 1PUJA 1W88B 4P4GA 4OHBA 4CF6A 3HI4A 5C5IA 3STTA 1BOFA 3B3GA 3JARA 1GFWA 4FJ1A 5AO9A 4LMRA 2P11A 4NBSA 4ZD6A 1ZIYA 4CLHA 3EUAA 1EX6A 4GW3A 3VVMA 1ZM9A 4K6GA 4R16A 3V1MA 2VJMB 3ECSA 1CVRA 2ISCA 2OSVA 4FN5A 3LQRA 5LB4A 4A6XA 4F84A 3BL6A 3PHGA 5CCDA 3SKVA 3LKZA 2QN7A 1UZUA 1C41A 2CJPA 2VJOA 1H3FA 3M6LA 4QHTA 1RWVA 1HQYE 4FP9A 3A28A 4HMQA 1J99A 3FYUA 1MX1A 2IEDA 1T4MA 3JQAA 2IWRA 3VAAA 1X9HA 3DE1X 4DCPA 4ZZIA 4B2PA 4B75A 1P60A 5IG2A 3T9BA 2HYDA 4WLUA 3WKCA 1GGFA 3TCXB 2V1UA 1BVHA 5G1PA 1YQQA 3VYTB 5BSUA 1NYQA 2IH5A 3GJ8A 1YIDA 5AOAA 3NNNA 5T8KC 4WBNA 2GFQA 3CH7A 4AKHA 1TDJA 2H7VA 1NLMA 3ECAA 3ISTA 1R8QA 2OYRA 3ESAA 1O96B 1QE5A 2AG5A 3K6SB 1GPBA 1Q1NA 5GVRA 3KZXA 1CJCA 3PBKA 4C4TA 4AKGA 1R0WA 3ILXA 1TCAA 1OXUA 1VIMA 1CPYA 1MB9A 2ORWA 3W2EA 1U3VA 2AFIB 4MKIA 2NXJA 5EJ9A 3WYFA 2ARKA 5FWNA 1M6VB 4LJYA 1VJRA 2ID7A 4W7IA 3CMCO 1LNZA 2DFTA 2JAXA 4HEHA 4TROA 1JJ7A 2EJUA 4PAWA 3U80A 2WHRA 4BB0A 4RGYA 2B4YA 5HP4A 5A3SA 4HNHA 4IIJF 3UMSA 3EZNA 2IXDA 1YVRA 3DBVO 3NWEA 1QFYA 1ICEA 1NBIA 1T5TA 3WLQA 3GLGE 1Z47A 4DKJA 2LCFA 1OV4A 1UP4A 3GDHA 5ETJA 1DPFA 3C14C 2XGJA 3I6QA 1N25A 3SZMA 4B3MB 3S28A 3KB6A 5EUBA 5HDQA 4TUYF 3IOEA 4HJXA 4PPYA 5C8YB 1L7AA 2YC4C 2NV0A 4IPTA 5HF6A 1Q19A 1OFGA 3M4ZA 1GILA 4YONB 1H9CA 4AO7A 4LJAA 5JNUA 2BFOA 4TL8A 5AHOA 3VHXB 1HC7A 1L3CA 1P3DA 2CW5A 4IH1A 4AP6A 1NVBA 2YC2C 3G2HA 4DCOA 1DXHA 4M60A 1VJGA 1LBIA 1UOEA 1QHHB 1QYDA 4ZK2A 2C2KA 1C3JA 1I7LA 2CFCA 2J6BA 4NRDA 2H4JA 3IOMA 1UINA 1UKEA 1WNTA 3QV1A 3HB7A 5HR5A 3ETDA 5CCXA 1FSPA 3SQLA 2ACWA 1XZFA 5F9FA 2VDJA 1XTUA 2FGKA 3VR6H 1SXJB 4EL5A 1O0BA 3AUYA 3AXTA 3QGMA 3K71B 1EK0A 4J07A 1YIOA 3E35A 1U3WA 3HUFA 4CF3A 1H1LA 2HSZA 4QHYA 4PFJA 1LS6A 3HCNA 2X7HA 2L18A 1NAHA 4OBBA 2A0YA 2RJNA 3DB2A 4D0NA 4UAVA 5LKRA 5JH7B 4RZ3A 3E4CA 4L0CA 3M82A 5CB4B 2C78A 3VR5D 3CG0A 3JR7A 2I3DA 1PR6A 1J2RA 1TVKA 3NNDA 3PC6A 2ZUDA 4FZVA 4XASA 1OZFA 5G0UA 4KXQA 5K1ZA 1OHHA 3C8UA 4DCGA 1D1TA 5KJFA 1J5XA 1NVFA 1Q2UA 1XTQA 2FRVA 1C50A 3QKRB 4PHFA 5C5DA 3MCZA 5EXXA 3KSAC 1QX4A 2C5GA 4P4SB 6ADHA 4QM6A 2BHLA 2ZPAA 2DPXA 5EINA 4KWCA 3VKGA 4H17A 4Y2RA 3A14A 1UMCA 3EYAA 1S2NA 2WIKA 4EMTA 1IHPA 5AKJA 3I2YX 2LGJA 6PFKA 4J1TC 4KHPB 1P8JA 1BVRA 5DGXA 2ZVDA 4R2KA 3PD1A 4FZRA 1Y1TA 3R4VA 5TV2A 5L4NA 1IK6A 1FS5A 1WCV1 3KVVA 3A1NA 5M34A 1ZGBA 3W05A 2FPPB 1W88A 3I53A 3TZQA 1TVCA 3OBIA 3E9YA 3JYNA 1IZ0A 5EIOA 1SVIA 2H07A 3VPBA 2VZ8A 4FNGA 1HEUA 1NZFA 1DBVO 1QGOA 1ZM2A 2GASA 2AN4A 2N9UA 2Q0HA 2VJMA 4HHEA 1WUKS 3E7XA 4HQRA 4R31A 1AN9A 2Q3DA 2X2PA 4UNRA 3S1LA 4ZCSA 3S7ZA 4JU8A 3PUXA 4S2UA 3X1DA 4XQEA 3MCUA 1MB3A 1UMDB 1G66A 3LDUA 2AZMA 3NR2A 2JC3A 3GAZA 5L6MB 2PMEA 1ETHA 1V37A 1KFJB 3IB3A 1TK9A 3FMPB 4PYMA 4XOIA 1DOZA 3RGWS 1KVQA 1PFKA 1MAAA 2FR1A 3CLKA 4ONEA 3ZDEA 3JD3A 4WBXC 3J80A 4IDAA 5DTJA 4RY0A 2W11A 4E88A 1OPRA 4N6OA 3NOVA 4QUHA 4TTSA 4DC0A 3Q88A 4AY4A 4OSOA 2HQSA 2VPIA 5FNVF 2C2YA 1U7OA 2IQ5A 4KAAA 5CX4A 3V7FA 2D1TA 3RSZA 2W7TA 5BUCA 1N8NA 4UAUA 4DV4B 2W6MA 4LTNA 1O96A 3NX4A 3QOYA 4OB7A 3K6SA 2O0JA 1KVTA 2VDOB 3RARA 4A8JB 3NHLA 4W5NA 2C0PA 1V3QE 2X8BA 4CKZA 2RGGA 4Q0MA 1M6VA 4JOSA 5JSFA 4HCJA 1KI9A 3TQOA 3PXEA 1D5CA 5ERGB 1FDOA 1JKJB 2Q6TA 4TRJA 1KHTA 3HXTA 1W48A 2N1MA 3DS8A 1M8PA 3D2LA 2J6HA 1ORRA 3PA8A 2AR0A 3B1WA 3WV5A 3IAM6 1GTRA 1X19A 1E2GA 1U0HC 1H5NA 4TLEA 3FETA 1M1ZA 3CUSA 4GKBA 2AXEA 5FL7A 1XZIA 1W0JA 3OPYI 2G8NA 4XUGB 5C8YA 2G9VA 3ENNA 2GDZA 1N2JA 3RBXA 2LDBA 3A7DA 3B1XA 5I5EA 4N4AA 3VHXA 1XE3A 5EIWA 2DT8A 3O38A 2YL2A 3H9EO 3HCOA 4NQRA 4GU5A 1N33B 1FTNA 4HX5A 5DHTA 1QHHA 3P0FA 3SFZA 2XRFA 4JVSB 2WWRA 2I3ZA 3KR1A 4EY3A 4RVCA 4P33A 2J3DA 3D7MA 1E2DA 3BHIA 1KMHB 1JJAA 2BZ1A 4DXAA 1Y8AA 4OJMX 3W5SA 1SXJA 4KQMA 3TSZA 1CLEA 2FPWA 1JL3A 2HSJA 2QMUA 2H5JA 3NBAA 4FWTA 2GN8A 4Y67A 4POOA 3KSDO 5DXJA 3UWMA 1R8JA 2KE5A 1MC5A 1HNNA 1TW2A 2YZNA 2EGUA 1AXEA 5DTMA 3FHLA 2XB4A 4DEVA 2AHOA 4FFNA 3R7LA 3SQWA 1ZUHA 4TMZA 1NYTA 2QVCA 1XA3A 5CDFA 5EE9A 5JH7A 1DX9A 5K3SA 5CB4A 2IH2A 5BYBA 3QSYA 3GRAA 5HUHA 2PUAA 2QL7A 2XTJA 4BNDA 5GTDA 3RS2A 4B3XA 2G28A 5DTEA 3LQ2A 5FI5A 1PQUA 4FHEA 1Q0ZA 3QKRA 1E4YA 4MIKA 5FBLB 4NNPA 4P4SA 5BSMA 2QR2A 2PSSA 3WGUA 1ISFA 4L50A 1V1RB 2HDOA 3KD3A 3TTVA 1SVUA 1KXJA 1OGIA 1XZJA 2PRKA 3RS8A 1V25A 4M7PA 2FMXA 5A4AA 4MICA 5GADl 1DTWB 2A8YA 2HA2A 4EGCB 2F3RA 3OT4A 3BWMA 1PS0A 3LK7A 4I1SA 2K2WA 2EQ5A 1T3ZA 3H1GA 5AJXA 2A3NA 2D4AA 2HA4A 3LUBA 1VI2A 3G7UA 3FNBA 1IDOA 1P1FA 5IARA 3PNKA 5CM2Z 2CYAA 5FFFA 1KNQA 2FPPA 4PLWA 5JAQA 5TT1A 2GPAA 2H9IA 3WI7A 3DV0B 4LVUA 3UGTA 4EARA 4HGZA 1IN7A 1ZMTA 3PDIB 1UWKA 1Q22A 2HRCA 3AFNA 2VBFA 4RZXA 1VLJA 1X14A 4P5DA 1L4MA 5LD2B 2UUCB 1QYWA 3GH1A 3G5TA 2QTHA 1Q7BA 1XRRA 4L08A 2HHAA 2TMKA 3D2CA 2RB5A 3T7TA 3WRXA 1V5FA 1UMDA 3K4QA 3L0SA 4DZTA 1E2LA 4H31A 4IMPA 4BQOA 2HOQA 4QASA 3AEUB 2F8SA 4Z8XA 4KWIA 3HZHA 1U2SA 3QW4B 5IKMA 1SY7A 2A84A 3S8EA 2BEUB 3EHDA 2V8BA 4KE7A 3HLYA 2BTOA 2VP5A 2X58A 1M8FA 3H0EA 2ZJ5A 3SS7X 1TX4B 3U31A 3WLTA 5F7OA 4HDAA 1HTBA 3N75A 4Q15A 4GO1A 1H6AA 2QRKA 1OR8A 1GRNA 4PLPA 3TIVA 4OHXA 4HEJA 3K9QO 1R5BA 2RHRA 2COUA 1JXOA 4GZMA 4A8JA 4WOPA 4YQFA 5BPHA 3QFHA 2UU9B 2CDCA 2PK3A 2XDYA 3CZMA 1CJKC 2ODTX 5TE9A 4ON9A 1NT2A 2AEJA 2LP4Y 1Q0RA 3MGAA 3HCDA 2J46A 3DQQA 4JGBA 5IAOA 1JKJA 1RLOA 2O50A 4MR9B 5ABPA 4YAJA 5A5DA 3ZHRA 2H2IA 4ZI7A 2O8EB 5TGTA 3P2YA 5K3EA 1L4YA 3RI3A 4B47A 2CGEA 4XSHA 5G4KB 3CZAA 1CG6A 1M6EX 1YZHA 3C5WP 3PFIA 4MGEA 1KH2A 1NUTA 4DJFC 2VJQA 3ADBA 2QLBA 4F8YA 3IUPA 5EXPA 5KVVA 2GBLC 1T2DA 1AUPA 1PTKA 4P7GA 3TUIC 1C0PA 1M5TA 1MT3A 5ER9A 1MJ5A 3UJDA 3TL3A 4AWAA 4L76A 5L4LA 1UBJS 1ZMRA 3U5ZB 1XNRB 1T8SA 3T8YA 2HMAA 1KETA 1ZCJA 1ZHHA 1FFCA 1VBFA 2FG6C 4FHDA 3ZHTA 1U31A 3A32A 3BRSA 4M1OA 5C0OE 5FEUA 1TA4A 1Q0TA 3Q9NA 2A1TS 5L4SA 3FKQA 1IAVA 1U11A 1ELOA 1S2LA 3M5CA 2NXNA 4IFTA 4JI6B 1YL7A 1KMHA 2VPWA 2Q0XA 1NKSA 4O6VA 4PTLA 2AJCA 2Y8EA 1WOYA 2A58A 1EXMA 3IEPA 4CQMB 3PR3A 4D9NA 4Z51A 1DINA 1WS6A 1EESA 4ZMRA 2HQ1A 2Z58A 3W6NA 1GZ4A 1PZNA 3S2SA 4BZQA 1QO7A 1GM5A 4OJQA 3SHVA 5FH9A 1UEXC 3D02A 1MV8A 5AVKA 1Y63A 2XBMA 5KNDD 4XWGA 1UWVA 3IIMA 3ILYA 4OIMA 4EVQA 2IXAA 4RLSA 4GECA 5TQ0B 5K03A 2VJPA 4P3NA 3S2EA 4UDXX 4IV5A 4TQAA 1UPTA 5E4TA 1XCBA 1T1IA 1XTPA 4IWYA 3ORQA 2YN0A 4TLMB 3BHNA 1MA3A 1W5AA 1X8XA 1R37A 2EF0A 2Z43A 3PLNA 3UK6A 1EK1A 5ICMA 5ITWA 1PYOA 5A1JA 4TRRA 2SICE 4ENPA 2O2JA 4K1XA 2DFVA 2ZXFA 3ASUA 2PSFA 1CULC 1ID1A 3NYIA 2SHKA 3EA0A 4FZ5A 1CQWA 5HMMA 4ZJPA 2PZFA 1V1RA 3NXSA 4WLEA 2IXTA 1JE1A 3L7YA 4TQUS 4F1KA 1RWPA 2BGMA 2XKBA 1RYEA 5EJ4A 4N8SA 1H0SA 1H0RA 2A57A 4G1VA 2IWHA 4G01B 4RVSA 1UDBA 2AMLA 3KTAB 1EDBA 1DTWA 3B12A 2YWGA 5D5PA 3L1JA 4EDFA 1I24A 2AGVA 3MJRA 4N3GA 1B42A 3MOSA 4PLZA 1FFBA 5H7XA 5FTMA 4NXMB 2WPDD 5LVAA 1PGPA 3CQ9A 4WXHA 4B9AA 1I14A 2IYNA 2HQOA 3QBJA 1HFWA 4Q1VA 2K6GA 2WJZB 2ZTLA 4OQXA 1T6ZA 4WZBE 1B8VA 1QR2A 3QENA 3IR6A 3DV0A 3G2NA 5J43A 3W3AA 1KU6A 2ICAA 5ED0A 5ALSA 4M86A 3PDIA 3CSUA 1TZKA 1U1DA 3HVIA 3JAKB 2HO4A 3MAAC 4UUNA 5E6UA 1XROA 1TKBA 4B09A 1I2MA 2R1UA 2I91A 3Q5EA 1VMDA 3CW9A 3QMWA 2YVUA 4M1TA 3M3HA 3PLAE 2ZRKA 1MFZA 3A3NA 2ZPUA 2XYVA 1E20A 3EZ7A 2PLAA 5AK4A 2QQ0A 2E55A 2H7YA 4EHAA 2QTMA 2EFGA 5E4YA 2LE0A 4PPGA 4CGYA 1KAOA 2DLCX 2BEUA 2JGNA 3QVSA 4Z1OA 1XU9A 5LZ8A 5REQB 1RLUA 4H3HB 3KAKA 4Z53A 5HE8A 1N2IA 4HUTA 1JDZA 2P0EA 2CL5A 3KZNA 4N48A 3VI4B 2CV1A 4J16A 3U3XA 2ZUUA 3LP6A 4YXFA 3E82A 4UARA 4P3YA 2P77A 1BQ3A 4MUFA 2WTAA 4QELA 5DCYA 2Z5GA 2AS0A 5LZ5A 3RCBA 3QX9A 2LD4A 4PPQA 2WPNA 2FP4B 3FSJX 3RVJA 2AHRA 1U9IA 5U4QA 3OFND 3PGJA 4JLBA 3O8RA 3E22A 3IUNA 3EVCA 5ED4A 3CZCA 1ZCAA 4F6RB 4MR9A 2DM6A 1D4ZA 2HF7A 3RSOA 2OV8A 1UBTS 2O8EA 4RCYA 1KMIY 4BVHA 1OTHA 1DIGA 4RDXA 4P4TA 3RC7A 5G4KA 4M6WB 4H60A 4IBOA 3EC2A 3F8TA 2QI9F 3HU2A 3LQ1A 3UWDA 1YUBA 3ASVA 1JLLB 4OQNA 2OK7A 5AJYA 4CF5A 5H1YA 4ENUA 4B0PA 5SZJA 3OLXA 4I8DA 1ONPA 2VOEA 3RYTC 5KPJA 4UUAA 2MSKA 3ND7A 3QYFA 5FPYA 1GUAA 2CK3A 2XCOA 2WV9A 4BRUA 2HDWA 1YKGA 5ALQA 2PS0A 4CIAA 2WINI 3TDKA 1TKRA 2ENUA 4EG5A 3BZWA 2I65A 1Q14A 4JT9A 3R7DA 2JGFA 5HVNA 2G0TA 4QUBA 5FYDA 3RTBA 2R6DA 1DZIA 1GT91 1PV1A 2DUNA 2ZTUA 4KQJA 3FOBA 3WWZA 5IULC 1B74A 3CH4B 3SZUA 4C3OB 4CU2A 1XZHA 1F7UA 3QIAA 2F90A 2IITA 4KAJA 1M34B 3GZTB 4II7A 1K2WA 1C7QA 2BISA 3HM9A 4D25A 5CM8B 2M6SA 2RB4A 5EZYF 1YL5A 3N8DA 3W8FA 5I9SA 5BV2P 4YX9A 1BWSA 3JPYA 4CQMA 5IWCA 2FEPA 4L9RA 3EGIA 1NBMD 4LRYA 2YV1A 4C7OA 5AJUA 1KFEB 1SKYB 1GZ7A 4NCHA 2UXBB 1YVDA 1N6LA 3PD7A 1SVMA 3NVDA 4OMFG 4U0JA 3FUVA 1VL2A 4JLOA 4R0MA 5FUWA 2OORC 2HIAA 1Y3FE 2KQUA 5JDCC 5TQ0A 4AKSA 1W5EA 1NM5A 3TW8B 1EFPB 3EX7C 1LS1A 2DULA 4Y6SA 4JI5B 4DE5A 5DGHA 1VJTA 4KNVA 1SD2A 2P35A 2CJYA 4FBGA 3T4PA 4F3TA 1Z4JA 3OPYB 5HYVA 3DO6A 2CLLB 4JBIA 1T2EA 3MB8A 1OBOA 1ZP6A 2VT3A 3BFKA 4UCQA 3SBOA 3UAGA 3UTCA 4C14A 4M2LA 2I7DA 1YC5A 1C80A 3EARA 4BZPA 2VAPA 5IASA 1M1YE 1ABBA 5DCWA 4RELA 1WXFA 2YOGA 2XWJI 4RTLA 5LUAA 2OZLB 3WBKA 3L4KA 1V8ZA 2YWHA 3JQAD 3OPQA 4C05A 4BO3A 1HTWA 3L82B 2RGEA 1UANA 3KTAA 1N2HA 3I9V6 2D8MA 3NIDB 2CV0A 4KFTA 2QHXA 4DCSA 1BN6A 2KLBA 2FWAA 3FVWA 3WK9A 4ALMA 3K0SA 1RXCA 4GOMD 3PRKE 3GA7A 4HAOA 3D64A 1P2DA 2JA2A 3OIVA 1H6DA 3GFQA 2NVOA 4PLFA 5LU9A 2ZUEA 3EUEA 3UMMA 3ZV4A 1NXVA 3SOPA 5E9QA 1KFKB 1RAFA 4NK5A 3TRJA 1QPBA 4YPOA 3U7HB 1E0KA 3T99A 3JAKA 4MA5A 2A0WA 4GGPA 4DUPA 2C9CA 5ALNA 5HIIA 5ADWA 3ANNA 2FQWA 3HVKA 3I1YA 4QOSA 5IEBA 1FMLA 1K0UA 1SFRA 3I04A 1CX9B 3HPRA 5G3YA 5IT9A 1Z07A 5I8ZA 2P9BA 4G0QA 5AKXA 1NR5A 4F85A 4JLNA 3TCKA 4QEKA 1FL9A 1XRJA 2IHUA 3DZKA 3KKMA 9LDTA 2XYQA 1UBEA 1Z28A 3ROQA 2OCXA 1OBHA 4ZO8A 5BNFA 4BB6A 5KKNB 2J48A 3IT2A 3CXRA 1VJ5A 2ID9A 2IF2A 2WFMA 3ZI7A 4ZYXA 1HR0B 3D1JA 2A35A 4MEJA 5ARDA 1ADBA 5JASA 3OZEA 4LA4A 1WBJB 5REQA 4GMFA 4GX1A 4LVCA 3OE4A 3QNUA 1BHJA 2WRZA 5A0VA 3DONA 4ND5A 2QSZA 2GSWA 3ZWBA 5IFKA 1ZQ1A 1ORVA 5DTQA 3COZA 4DY4A 4TTRA 4OQMA 4J6EA 4MRAA 4UATA 1NUHA 3BWEA 4D56A 1E6WA 2IS4A 1GAQA 2IPOA 3U1VA 5BSFA 1D2CA 3C8ZA 4IHQA 2FP4A 2PL9A 1Y7LA 4QAJA 3K30A 3L7KA 4F06A 5C1PA 1B0UA 1UXIA 1NNUA 1FLVA 2CE2X 1OWLA 2G9QA 4PS1A 2OCKA 1W93A 3HO8A 3C87A 4F6RA 3ZE6A 4PCAA 1UBCA 2JARA 5D5QA 2DHQA 2OMEA 4NZOA 3H3FA 1LFAA 4CV2A 1SJ9A 4FLFA 3RBAA 4CKEB 2CLHB 2ZJ7A 1N5OX 4M6WA 2WYVA 5C9ZA 4Y3UA 3H5IA 1IQPA 1X9GA 4E03A 2K87A 1XZDA 2UYQA 1Z08A 4F4CA 4JMPA 1JLLA 1HXHA 4JR2A 1E3TA 2VXOA 1UZAA 1FNDA 4OOFA 2PVSA 3ZNQA 2XUIA 3BH7A 1RQ2A 2EWVA 3MG9A 3U2QA 4QZVA 2AI2A 4J1SA 2Y0DA 3LUKA 4QO8A 5KAMA 3LL4A 3HACA 4RD2A 4D4MA 1TRHA 2QRUA 2ZYHA 3V4RA 1SRQA 1OHHD 2WD8A 3BHJA 4PINA 3UH1A 3TTXA 4EW2A 1M8JA 2CHVA 1UKCA 1KO5A 4OKSA 2VNKA 4DAEA 2PKEA 2R48A 2N42A 4LRWA 4ZYLA 4JC0A 3GPLA 4I1YA 2AK3A 4I9GA 1M34A 1J21A 4DM4A 2OY0A 1PJTA 3OJCA 2ZCUA 1K9VF 1DV2A 4MYCA 3TJZA 1TE2A 2O3RA 4AB1A 4HFNA 3DBHB 1JG6A 2D54A 3CJRA 3LYUA 1X7GA 4IP0A 1NQTA 3OJWA 4JT4A 3QKIA 2GAFA 3LS2A 3LBNA 4P2GA 5AOVA 3W1EA 2QTZA 3PHIA 3K5IA 4WVLA 1U2QA 1T9DA 3NORA 2VUTA 2WJ6A 2Z2JA 1HT3A 4ZYTA 1KFBB 3LVFO 3TW8A 1EFPA 4TTAA 5ARCA 5ICFA 3PDJA 4RDIA 2P4HX 1XQ9A 4FS8A 4ZYYA 4XM0A 4C3ZA 3K9NA 4V0RA 2FSVA 1D8TA 2O6HA 5EHXA 2BM1A 1NTRA 1UJ4A 2DUMA 2XB9A 5HF8A 2XUZA 1ORTA 3KOUA 5CLFA 3DZCA 5AK3A 2HDHA 1XIVA 4HPJB 1D04A 4ILKA 3S27A 3AJ8A 2NUPA 3ORYA 2H1LA 1N57A 2NG1A 3DTTA 3R6GA 2GEFA 4NENB 1FYFA 1U0LA 2D1YA 3PC7A 5FTLA 2OZLA 3HVJA 4QDUA 4D9JA 4H9GA 5I8PA 5CLJA 2X5JO 4RYLA 1EBBA 1JEDA 2AFVA 2AFIE 4RO0A 1C8VB 4NTZA 2MHCA 2OXRA 3UKOA 2WQ7A 4ZQFA 1MZPA 5FOWA 1GV1A 1ZZEA 3LCRA 4ZTBA 5EMMA 5JQGF 2QX4A 5AW9A 5J2UB 3O5AA 2DHRA 3B6MA 4WI1A 4Y6QA 5EHGA 3W9SA 3NBFA 3CJTA 2IK8A 2YV4A 1GNLA 4B2LA 2GBPA 3IR5A 2G88A 1P9NA 1WMBA 2OSBA 5FRDA 2QKYA 2BM9A 2BP7B 4TVBA 4Q37A 5DRTA 3TQHA 2HPZA 2C4VA 1TF2A 4DQXA 4DV1B 4Q9HA 4Y6RA 2OD7A 2F1JA 4FPXA 4P80A 1RJEA 1RCUA 3OLYA 1MO4A 1UDXA 4BMDA 3S1SA 4MYTA 1HEYA 5T5QA 4RMIA 4PY2A 3QYPA 3GV0A 3BWBA 1DAGA 4BO6A 2JEOA 1KGSA 1OFIA 3UMCA 4QGSA 3DLBA 1C4KA 4UM7A 5FL7D 3ZE9A 4GLOA 4C0JA 3JQBC 1W0JD 2A1UB 4DC9A 4FZ3A 1OLOA 4JT2A 5EE1A 5DN6A 1FY2A 3FPAA 4TN5A 2P5YA 2FEKA 4FWBA 3DBIA 3LHSA 3WYNA 3ZE7A 5C53B 1IJFA 2Z09A 3TOXA 2AKEA 5IAGA 4OG2A 3T7KA 2VT7A 4IS3A 3SZ3A 4XX0B 3SZRA 2CVPA 4HWKA 4U5QA 1Q57A 1Z0UA 1D9ZA 3AZPA 1MN6A 3GRPA 4HG2A 2Q3FA 3VUEA 2ZS9A 5TSDA 4ZOCA 2ZRMA 3D8SA 4H7EA 1BXRB 4CUJA 2NZYA 1JR3A 2Y2UA 3D7NA 1SXJD 1T0JB 2YTZA 3EQ9A 4I1OA 4I5EA 1IBLB 4PW0A 1N77A 2NTNA 3BSYA 2ZI5A 5AK5A 2D06A 1KI4A 5F7XA 2J07A 3CYFA 5LC1A 1AB5A 2I03A 1R8SA 3EG5A 3L0CA 4W5OA 3CRRA 4C06A 2MOKA 3P97A 3T3HA 3MJVA 1GPAA 2FMHA 4CKEA 1FLDA 1GSAA 5FUMA 1UOOA 3ZS9A 4MVJM 1F9AA 3H5OA 3VVLA 4PO3X 2A9FA 3UFXB 3QUCA 1YA4A 3OFJA 5EHNA 3EXG2 2R8YA 4WBNF 1ZK2A 1P1HA 4KFSA 5AP9A 1E1LA 3NC0C 3X1JA 4CMJA 4EGFA 5B6JA 2R6ZA 3TQFA 4FEGA 4GYJA 2IRWA 4QWMA 4YVFA 4LHWA 2I1VB 4DCMA 3OT1B 1GNPA 4YEDA 1IXKA 1I7DA 2J3KA 2BBSA 3FUXA 4KYVA 2KJQA 3SXJA 1IH8A 5HWSA 2J8ZA 4KHZA 2FRXA 3LM8A 1FS6A 3G49A 1ORHA 4JELA 5ECWA 3SIPA 1A96A 3IJRA 4YB8A 4EAQA 2BKAA 3QITA 4NMWA 3KT8A 5KC9A 4AM8A 3LY8A 3DT9A 4AJHA 2EDAA 1Q7RA 1S9DA 4KWHA 4TTPA 1Z63A 3L8GA 3DBHA 1Z0AA 2GZ1A 1ZC3A 1YBHA 1YCFA 2YJ5A 4W9NC 4IO1A 1KK3A 1CETA 3AC0A 3QBDA 4OHPA 3IQEA 3ZEAA 1JEOA 2DFNA 2XLCA 4KX5A 2RHOA 4QDJA 3GHYA 5EIEA 2IEYA 3EDQA 2KBEA 4LE2A 3TVDA 2VHEA 3W5VA 3AF3A 5B3LA 3RTGA 2JJ1A 1DIRA 5D5HA 3RTDA 3W9YA 2DUUA 3IUYA 1TUIA 4L7VA 2I2CA 4F45A 1XCOA 1WNFA 5LBTA 3TYXA 1A7AA 3K1YA 4MIOA 2RI6A 1ADFA 3DO8A 3V3TA 3ZEIA 5EJEA 4B3TB 1EIWA 2ZRQA 3ZNPA 2XECA 3F7MA 4W9MC 4EG1A 4KOEC 2JIMA 2QYOA 2BELA 4H3SA 1PT5A 2FPUA 4I5DA 4Q4HB 1P2FA 1IRXA 1P1RA 1Y9ZA 3E3LA 4RDHA 5TARA 1EMDA 4NENA 4UQOA 3ZX4A 3KL2A 5J40A 3WWCA 4LI0A 3RAPR 4G0XA 4DUZB 3MRSA 4EHLA 1DC5A 4AWBA 1BAPA 2Q4EA 3HLKA 6AT1A 4CUKA 5ALRA 1AS0A 3FRJA 2WAAA 4A9AA 3K94A 4C87A 1YJ8A 1CJUC 2PNFA 1U2ZA 2H63A 2YMPA 4PHTA 1V71A 2RAVA 4J0HA 4XLTA 1A8PA 1PQ4A 2QMEA 5FTKA 1A7UA 3HFSA 4EA9A 1KDVA 5J2UA 4X44A 5K0BA 1LDBA 3RWOA 3MJDA 1SBHA 2UDPA 4P93A 2HZBA 1FUYB 4IFIA 4AKEA 2A2ZA 2EGGA 2NV2B 3LHDA 3IGFA 1SQSA 2VPTA 1LX7A 3QVGB 4E5PA 2BP7A 4DT1B 3CTPA 2ZG6A 1KGDA 2QY9A 5GM1A 3IPXA 3W2FA 5KQMA 3RC1A 6ABPA 5IM5A 1M2WA 4AQ7A 3O03A 1D2NA 1H22A 2NSHA 1WRBA 1N7JA 1E9VA 3A1EA 1VMAA 4MV3A 4YRBA 1ZWKA 4UEQA 4YRJA 2Z95A 4A4DA 3S7TA 1SRRA 4IVPA 2GYVA 4KO1S 4OAQA 4QRDA 3LP5A 4DV3B 3IVAA 5EUCA 4A6EA 5KB3A 1ZI9A 2QLNA 4PFSA 5K6AC 1V5IA 4AJ2A 1GUDA 2EKZA 2XZOA 1Z6XA 1PV4A 1N4DA 2NXWA 1JU9A 2JH8A 1GZHB 3AHIA 1TZJA 2A1UA 2HPHA 3GPBA 5GJVC 1LKZA 1G17A 3SLGA 3U5TA 3PC3A 2ZSUA 5BQOA 3AR8A 4RVOA 3GN2A 4EABA 2B6NA 2FG5A 3ESRA 3VR6D 4WVFA 1MT0A 2JLQA 3CF0A 4IEEA 2R25B 1E1KA 3GVHA 2ANBA 3NNSA 4XX0A 2E4XA 1CTQA 2IXFA 4U2DA 2ASVA 3O9MA 4G4JA 3RVLA 2DBYA 4CT5A 2NNLD 4HZIA 2B2NA 3CIOA 1FC0A 4LXHA 3SM9A 2XJ9A 4IKPA 4DQLA 1FQJA 2EFJA 3EA4A 4QDOA 2R5NA 4WESB 5IK2D 1JFSA 1XP8A 1C14A 4I36A 4GC9A 4PQEA 5BW8A 4V0SA 4QLBA 2J3IA 3BB4A 3P26A 4KUEA 5DNAA 3OWOA 3FE2A 3QOFA 4IRMA 1IZ7A 2QJRA 2QRMA 16PKA 3TLCA 4TLCA 5JCXA 2QYTA 3M9LA 4JEIA 4J0FA 4L9AA 4LHYA 4XXHA 4K6KA 3UFXA 1XXHB 1AA6A 1NP3A 2IZOA 4A92A 1JAIA 4CXMA 1T8WA 1J8MF 1II0A 2OZEA 1NOJA 1CWUA 4CN8A 5DISB 4IDQA 3CNQS 1ZNYA 1V16B 1Q5PA 4UHKA 4MINA 2ETVA 5KEIA 4OLAA 1ZAKA 4HYYA 3OT1A 4J0JA 5BO5A 3SJBA 2BT4A 3ZKAA 1S01A 4KSYA 4ZAGA 4B4UA 3K70B 1B8UA 2H18A 2Q1YA 4QNNA 2ERCA 1FDSA 2OXIA 3R0IA 1J56A 1OLSB 5IBRA 1GVNB 2QMQA 1DIOB 3KUCA 4OUDB 4R7ZA 1D1SA 1HE5A 1G8KA 2A92A 2WJHA 3KB8A 2QTNA 1HLPA 1N5RA 1RE1A 1XZAA 3OF3A 1GRRA 3QVLA 4PR0A 2WWVD 5IC6A 1N78A 2PBFA 3OZUA 1U0NA 2AA3A 1WB6A 1BXGB 1E6KA 1NLFA 2FFJA 1QFSA 1L7XA 2DCUA 4R8SA 3VC1A 2C8JA 2PGJA 3PXDA 3H6HA 4FYKA 3W3AD 3I61A 3AGPA 2IZ1A 3EPPA 3ROGA 1O9HA 4FDTA 4EB6B 3E3NA 3NEPX 3W2TA 1IY2A 2EFDB 1V95A 2QX7A 4XJVA 3AL2A 4U39A 1AXRA 3KV1A 5DM4A 2I4RA 1Z62A 4Q4HA 4OHRA 3EIHA 3ELWA 4PLGA 1YBAA 4LTDA 3IQDB 4OHFA 5AM0A 3EAFA 3L49A 3ZE0B 3MUEA 4NCAA 1RJGA 3DEIA 1GN9A 2A9VA 1M1UA 4FCWA 1V8BA 4YN3A 1YB5A 1SUBA 3H4IA 2TMDA 1FDTA 1T9GS 1CR6A 3GFOA 3KXDA 2Z98A 4R2MA 4PZLA 1KPGA 1I6KA 4ZMSA 3R0XA 2XHZA 3HB4X 1CF9A 1SWWA 2WI8A 2WUVA 3JS5A 4G0YA 5CITA 1JFFB 3OVMA 2Q5IA 3CR8A 2NUAB 1KSJA 5JH7F 3QF7A 2WR8A 2WWHA 2RJ3A 3RRNA 2XMQA 2C0CA 1JI3A 4PLHA 5CB4F 3FCEA 3AMVA 1DG9A 1HRKA 4MO2A 1FRFS 1YZKA 2UXDB 3QVGA 2P6PA 2X8WA 2M6LA 4DT1A 3Q15C 2EIXA 4RD3A 3UMRA 2HPAA 5D7BA 4CFYA 4HO1X 4D74A 1P0CA 4Q01A 4EMSA 4CKCB 1YFJA 1Q7EA 1UJNA 3RHTA 4J0CA 3RIMA 3U7QB 1B00A 1X3SA 4YFVA 3P0RA 3CISA 3RF6A 3ZTWA 2WG2A 1SQ0A 2HF9A 2P9QA 3FKSA 5B64A 4FIDA 5E3IA 1NE2A 1SEVA 4IO0A 4CT0A 4YLYA 5KWEA 3B9BA 1OXXK 4MIYA 1WEHA 3PPIA 1JQBA 3C3YA 4LXXA 5BUSA 8AT1A 2LIPA 3RK0A 1DKMA 3J7TA 1HFKA 4LDQA 1B1CA 4FE3A 5E3JA 2PA0A 4XKJA 1BC5A 5CNKA 4B3GA 4KLCA 1Q1BA 3EXHC 3VA7A 3OJ0A 3ORRA 5JDIC 2C7VA 2ZLBA 3SFVA 4L22A 2WMNB 4IH4A 2RGXA 3D31A 4QT4A 3IEUA 1O58A 1E0JA 1F4VA 3MCWA 3OM8A 3D54D 2GI4A 2QNIA 1E64A 2W6NA 3GEMA 2YXDA 3ZWMA 1Q3KA 1U7PA 4U6NA 1VHTA 3WLEA 4F71A 1OIVA 2BJWA 3R5SA 1KJIA 4RK5A 1TM4E 4HAVA 1CE8A 4BN0A 5TF0A 3DDSA 2VJAA 4WESA 1MJNA 1AGPA 1ZA2A 2YUIA 2WIDA 4OY3A 1SHZA 1I51A 4CQMD 3PNMA 4MA0A 2NGRA 3TTUA 4HF7A 4NHEA 4DRXB 5BWCA 3WGTA 2AVDA 3F4BA 1HRDA 1L3BA 3MOGA 5EPEA 3PJEA 1U5BB 4M89A 4YH1A 1M66A 3KQMA 1PW7A 3F9RA 2BUBA 5JPIA 3V1UA 3ETHA 3I37X 3ADOA 3HR8A 4DAOA 5A7FA 3CINA 3FCSB 4MAAA 4JSTA 4H0CA 2IY8A 1XXHA 4DLPA 4HEA6 2WICA 5TB5A 2C9OA 4R5HA 3TB4A 4XQ9A 1LF0A 1NW7A 4CG3A 1ADGA 1O9BA 4DJDC 1VG1A 2VP4A 3HABA 4KVFA 3WBBA 3E3OA 1V16A 3E8XA 1OAOC 1WMFA 2FXVA 3E5NA 4K03A 3ISVA 1I0LA 1OIXA 1U2GA 4XWTA 3IODA 3UF0A 1SN7A 4LBZA 1NX6A 1JAXA 3EIXA 4N39A 4FBLA 2X41A 1EVEA 5AJWA 3OCYA 1NUPA 4A8PA 4IDEA 2HF8A 2Y3IA 4V24A 1ZD1A 4WW0A 1OLSA 3VSDA 3B6KA 4X60A 3GP3A 3TUZC 1RI1A 1Z2CA 3GJ5A 3LCUA 4IOKA 4OUDA 4R2XA 3TE6A 1ZCBA 2DRIA 3QTBA 1O95A 2KW5A 2FWBA 3JVEA 2WU3A 4E22A 2Y1DA 3KHUA 2C4MA 1XVVA 5DHUA 4DY6A 1PZEA 3RC9A 3IPCA 3UTDA 1Q1GA 5CT5A 4BGVA 1BXGA 2DLDA 4C21A 2P7IA 3LQQA 2AUNA 3FTDA 2F59A 4CPDA 2J0QA 2R7LA 4UOEA 4QARA 3Q9SA 1WL8A 3ZU6A 3ZHCA 1O97C 2C2ZA 1X86B 1ZLXA 1QONA 4KBFA 3WWYA 4OXQA 5BNIA 2I2BA 4TGLA 5DM2A 1WUJS 4Q3NA 3MCAA 5FPPA 4EB6A 3CRQA 3M4NA 5T6BA 2BFDB 2EOAA 2CFRA 2SBTA 4YS6A 2LDXA 5LZ7A 5AM2A 2ZBRA 3ZZ0A 3BZBA 2AH5A 3K0FB 2OBFA 4KODA 5JS6A 3WR5A 4DIFA 3T5AA 2V59A 1OC2A 1KBQA 3IP5A 1Z75A 4CI0B 2X13A 4UNQA 4M88A 2AJLI 1OA1A 4H27A 2O6LA 2FW6A 4WT7A 1YFZA 3VQTA 4BCDA 1CP3A 1JIUA 3GGSA 4HDMB 4JJFA 1PR0A 2IYUA 3VR2A 1KWGA 1VCOA 4FLMA 5DGDA 2FKAA 3BA1A 1OGYA 1JFFA 1VMKA 1JEEA 2HTFA 4WD3A 1GDDA 2NUAA 5JMOA 1BE6A 1TA0A 3DWEX 1KDZA 1IBSA 4AU1A 1Z4IA 1Y33E 3AF0A 1QHNA 3A1FA 2Q6OA 4MKGA 4OK3A 1GKLA 3HCEA 2R68A 4RQBA 1OH6A 4LTMA 1KDYA 3DC7A 1E3DA 3UCEA 1PDVA 4X1YA 1E1QA 3KKNA 1G2PA 1WU7A 4HC4A 4AUMA 3EEYA 2QSUA 4CKCA 1AZLA 2XRYA 3H9UA 4QE3A 3U7QA 1RKUA 1USVA 4BCCA 1HNWB 2O48X 1Y7TA 1GU1A 1HEIA 2BHTA 2W58A 4WV3A 1WAMA 3KQSA 4EJSB 5LOVB 3HYCA 5AXAA 2PLRA 3L4EA 2YBEA 4MNTA 2FN9A 1EVKA 2JG3A 2V74B 3H75A 3ZJ4A 1FU7A 1RE0A 1T3GA 1XTRA 2Y71A 4IZIA 2B0CA 2C1ZA 1HZZA 1YIAA 1ZVKA 2XCUA 1P7PA 3AKEA 1M34E 2E82A 1UAGA 2VUUA 4ZKEA 4JXJA 2ZBFA 3IHKA 5BRAA 3LSTA 4L5AA 1CUZA 4J7UA 4UDYX 5CP8A 3K1ZA 2O7SA 3DYVA 4B48A 1SCJA 2QJTA 4F86A 4HS9A 1UC4B 5FLYA 1M54A 2ESRA 1L5MA 2DPMA 3GEDA 3HTXA 2M6KA 4RHXA 5J23A 3WLRA 3O94A 3WQBA 3IAEA 3MXTA 2JGDB 4XQGA 3COYA 1BJRE 1T5DX 1DWPA 4UE2A 3MINB 1DO2A 2ADOA 3HSKA 5TT0A 2A9OA 4PXAA 2KWIA 5FWDA 1QZUA 2C5BA 2OVBA 3KXIA 3K2QA 2E49A 4DRXA 2B4QA 4AS3A 4NESA 4F9TA 3ONNA 4ZO7A 4BFYA 3C3EA 3AHFA 4JSRA 4PR3A 2VQDA 1QUFA 4ZKDA 1HLFA 2ODAA 1E94E 4V0QA 5CDSA 5JS8A 1F6DA 3CF4A 4TYPA 5BV1A 4D96A 2X3UA 3VDMA 2FETA 3U3MA 2VRWA 4TWIA 4MKFA 2XUDA 1UR5A 3WIBA 1YV9A 4MW7A 4FONA 2ASEA 3PT5A 4P36A 1XR3A 4DA6A 2X4LA 2HL6A 3U7GA 1YCGA 5CH8A 1KKLA 1K4KA 2GXQA 2IOFK 3GOHA 3NASA 4LJ4A 4WSOA 3AR9A 1QMGA 3E9QA 4C6HA 5BQ3A 5EI5A 5AKKA 1PNOA 1RAIA 2H4YA 4EY7A 3F5FA 4Q16A 3LA6A 1HY3A 2AN9A 4AN4A 1DAOA 1G5HA 5HJ2A 1JU3A 4BP1A 1XMOB 2PX6A 4DCUA 1IVYA 1T8RA 5BRJA 3FDJA 3QXCA 4TMKA 4E3WA 1LW7A 2PX5A 4LHEA 3UK7A 5TX7A 5E0OA 2FE4A 3MPOA 5A05A 1XZQA 2H5IA 1M73E 3DF9A 3E48A 1GY8A 4RS3A 4B71A 2CY0A 3AJDA 3ED1A 4CIXA 1I3OA 3LPMA 4D82A 3ACBA 3PE6A 3CJQA 1DAKA 1T0IA 2I2WA 4HX2A 5LQDA 3TLBA 1HFJA 3DLHA 4M54A 2MIIA 4ESEA 2YV3A 2BM8A 2FFBA 5EVJA 2DUWA 1F5NA 4LOKA 2VJDA 5GY7A 1YZTA 1OU0A 5K0FA 5TF4A 3K0FA 1GAEO 1RBMA 1I7QB 3BMQB 2PX0A 3NCHA 4M1ZA 3HJRA 3N2YA 3QHPA 3SR4A 1VJ0A 3HG7A 2A9QA 4F4JA 4S04A 1DU4A 2AC2A 1VRWA 3DQPA 3QEKA 3QBTA 4LE0A 4W5WA 5BYJA 4Q6BA 3V1LA 5F78A 4L6CA 5DM0A 4C76A 3CN7A 3QA3E 4QBIA 4HDMA 4BNLA 2OCBA 2Z83A 3AU9A 3PUWA 4TXMA 3O1HB 1GPLA 3GFPA 4A2WA 1IN8A 4U7PB 3CNOA 4KN5A 1EJBA 2VHWA 1WJGA 5KQPA 1A3CA 3RSCA 4LDNA 5JHGB 5ALMA 1B6GA 4XM1A 4D41A 3UATA 2OO7A 2IHYA 4Y2TA 4C20A 1FPQA 2GPTA 2BWJA 3NGLA 3O7WA 4P81A 1EVIA 3IOBA 4GOND 3C7KA 1OYOA 3GARA 1I4TD 3PGKA 4DLWA 3QEBZ 1JKIA 4FR0A 1C4XA 4RHFA 5EJ2A 3V33A 1CQXA 2AQIA 5HCNA 3NYQA 2A1IA 2FHSA 4GPD1 4PZEA 4X24A 5LOVA 1U8TA 5HCUA 3VOTA 1GEGA 1W0KD 2HJ9A 2XF2A 3CRMA 2OGUA 1GO2A 1Z2EA 3QVMA 1MTOA 3U7EB 2W6JA 2XXAB 1JQ3A 4FXOA 1IM5A 2AXPA 1K9SA 4G3XA 4ENSA 3E58A 4X66B 2Q8QA 2VF2A 1E66A 1CR4A 5JT1A 2QN6A 4YRGA 1Z7EA 2QZPA 1OTYA 1THGA 3BGDA 4OO3A 2I6FA 2VL7A 4RK6A 3KALA 3I5YA 3V7YA 2ORED 1JU4A 3FWNA 3IEKA 2HWXA 4GVPA 2J0VA 3VC2A 5EJAA 1R4NB 2WP0A 1Q6ZA 3AUKA 3PL1A 2F9LA 2FW1A 2V54A 3SYMA 5H3LA 4I55A 3CPSA 2JGDA 1ODFA 4G5GA 3MINA 2FJPA 2HMWA 1A98A 4D02A 4GSYA 4L3WA 4RNDB 5DASA 5ADHA 1AH2A 2RIRA 1N8SA 3RRZA 2N0SA 3KQOA 4Z9XA 3G9TA 4N1AA 1BDIA 1NQXA 3A3PA 2NWQA 3RC8A 3D4OA 1CZNA 2H9AA 3LC7O 3AZOA 2JJ1D 3D6TB 4NI5A 2IXBA 1DIHA 2JAQA 1JTEA 4L57A 1DJQA 3GQVA 4JBHA 2R44A 1TZCA 2QTRA 3B82A 4NH0A 3PEEA 3ZWXA 5LR6A 1L7EA 1IN6A 4PXYA 3IBFA 1M9NA 4DMHA 1K3UB 2PEYA 2R1ZA 5CFQA 1XQ1A 4KCGA 1JZQA 1RXSA 1ANKA 1DQPA 1ONOA 3AZQA 3L0OA 1VE5A 5A4JA 4JXZA 4OH1A 3K16A 3GNLA 4FFVA 4RY8A 5A5FA 4H6VA 4OLJA 4CTJA 2QPAA 1MCZA 4QBFA 1H23A 4KZKA 3ANYB 1Y1QA 4RF4A 4AMGA 3N0WA 3O4GA 2VDUE 3AUJB 4K9RA 4MV8A 3W7VA 1ZG3A 1Z8HA 5E2BA 2Q2WA 3FTNA 3L92A 1MW8X 4QODA 4PNPA 3DPSA 2JAWA 1HLGA 2IYRA 4W8OA 1Z8NA 2NZXA 4YC7A 2RBKA 3SBXA 1JYFA 5DB4A 5CDHA 1PLJA 3ET4A 4MH0R 5C81A 3L7BA 3Q8XB 2FEAA 2H31A 3T1NA 2JEZA 3LUFA 5JO0A 4B7CA 3ND9A 4FOOA 4OAPA 2PWZA 4OQEA 4G8JA 3F7TA 5HUJA 4P86A 3TLZA 2ZTHA 4NBKA 4ZOLF 1OYVA 4HDSB 4E11A 3PPYA 2X4GA 4U5XA 1JPUA 3ZDDA 1ZGGA 2PJUA 1SG9A 4ZCLA 3BD6A 3GOQA 2M9MA 3LWDA 2X6TA 1X8JA 3G2OA 3QTLA 4DBVO 2VRCA 3KEGA 2B7CA 1PTJA 1X8LA 1P1IA 1JHAA 4K46A 1T3TA 3K9CA 3NTRA 4M0DA 4N6NA 5C2JB 5JYDA 2ZVQX 1BFKA 2Q1UA 2XKJE 4QXOA 3BTUA 3H1BA 3INYA 1X1RA 2ZIEA 3KOXA 1NONA 4FFDA 5IANA 1W25A 1TEZA 4FILA 5I9IA 2P2SA 3BC1A 1HDEA 4NCXA 4BLUA 3UGQA 4D9MA 3AYZB 4IDDA 1WDKA 4UUBA 4WLVA 1Y4DE 4ZQGA 2Z04A 4KH0A 2PXCA 2VXYA 4WH0A 4DGSA 1SU6A 4B4VA 1YR6A 3N2ZB 1X0XA 1G6KA 3NTLA 4PLTA 1MC8A 4ETIA 2B8NA 5M5BA 2OB2A 4I3FA 3U7JA 4UTVA 4X91A 5KSOA 3E1KA 2BZ0A 3E1SA 3B38A 1K06A 1IHOA 2Q4RA 3IRUA 1P6XA 2GYYA 1VPLA 1K7YA 4J49A 3J81A 2CXOA 4TV8A 4P7BA 1MFPA 4YUZA 2PFSA 2C31A 2MR5A 2PX4A 2RGAA 2ZIFA 3BGOS 4OHOA 3H11B 1AMNA 4GDFA 3S55A 2HHHB 1UKZA 4LOHA 2DBQA 4KGXA 1SC4A 2VP0A 2F1KA 3B6EA 1U2DA 4M99A 4MI9A 2XXAA 4EHDA 4QD3A 3G8AA 5DWVA 1XCLA 3FBTA 3OX1A 4MJ3A 4XIYA 4D92A 2E6UX 7YASA 1O4WA 1QQBA 3TE7A 4F4UA 3OG9A 3IKJA 2REXB 2V5UA 4HQ6A 4LXGA 1I10A 5IABA 3CVUA 2JFOA 3PEFA 4WECA 4H3KB 2IP4A 4F4DA 4BAZA 3DXFA 4H1UA 4RXMA 4DIUA 5IKEA 2YIJA 4G4GA 1OFHA 3VAZA 4F2GA 4L8LA 1XSEA 3LCJA 1VCMA 2A0XA 3GUYA 1THMA 3R3SA 4YRTA 4N0QA 1C7JA 1R4NA 1KVRA 2BOVA 3SY8A 2ABWA 1EDOA 3BE6A 3MTAA 4WLFA 3KS9A 5AOBA 2JGKA 4ZHQF 4EZIA 3QG1A 1CD5A 2QZJA 5ICCA 1VSTA 2HHJA 2RAUA 1B3RA 1PJAA 2YWCA 3VNBA 2D3TA 4JIMA 4JEHA 2O5EA 1DXOA 1LXCA 3ESBA 1V7QA 2J30A 1OFVA 1NDHA 2NSYA 3A06A 4QQRA 4U2BA 2GCEA 1N6KA 3I5MA 1CJVC 2CXPA 3MT0A 5M2QA 3B9RA 4MPTA 3LYHA 5B7PA 3CVWA 4ND2A 4O2AB 2Y1GA 3OLCX 3N76A 2VXBA 4KZPA 2JGLA 5IP5A 3PYLA 1GUZA 3L40A 4X6UA 5BVGB 2QROA 2YVQA 2EX0A 1HNZB 1JQAA 3CLSD 3EQ6A 3GJ3A 3MELA 3THWB 4E1BA 3H18A 4G23A 2HK6A 1KI3A 4O4HB 2VSXA 2W2LA 3QTTA 1HYBA 3OEHA 4KXLA 3VNAA 3A3YA 3O4FA 4X95A 2R5WA 2ORIA 5EJIA 5AXCA 1JH8A 3DMDA 5KTOA 1A5TA 2G36A 3CRZA 3HEAA 3UAVA 4KUGA 2PRIA 4PHHA 4Q1DA 1ODTC 1M8GA 4Y2XA 5DYIA 1RJFA 2B94A 3BIXA 2FSFA 3HHEA 4AY2A 1KHHA 1NN5A 4G2TA 5FBKA 4GLLA 4YGXB 1U90A 1ZINA 1ES9A 1S96A 2Z5FA 1BJKA 1WEKA 3UT0A 5CB6A 3QX3A 1IIRA 3W4JA 1PJLA 2PSJA 4AIIA 2PE5A 2C84A 2JAOA 2UUOA 3IO5A 2XMCA 3N9IA 4E5UA 2BHSA 3UMFA 1FFGA 4TXJA 1OZGA 1UBOS 4JQOA 4ITVA 4DW8A 2QUJA 4G89A 3BFVA 3CMMA 5TMPA 3FX2A 1JHVA 3EZFA 4Q48A 3BAFA 3M6FA 4OHUA 1NW9B 3WOVA 3G2PA 5KWSA 3TINA 2WYIA 2XQKA 2EBUA 2QVZX 3HU5A 4GMHA 4PG4A 2ID8A 2JASA 3UT6A 1H0KA 2QAIA 1M8KA 1R2QA 2YOHA 4BWVA 1T6BY 1G7SA 3FKSD 3OOYA 1JSXA 3PC8C 1RVDA 4JLDA 2J0SA 2BMJA 3NIWA 4GF5A 4JODA 1RQLA 1UXGA 2PZ8A 3RW9A 2M32A 1JR4A 1US8B 3GNSA 2IH4A 3R76A 2F43A 4PRYA 2DG2A 3TBKA 3URKA 2CNBA 1TTHA 2FQ1A 2ONYA 4EH1A 1NPTO 1NXSA 2VK1A 3I5UA 3LRPA 1QK5A 1M5RA 4NFYA 4O3MA 3RUHA 1WZNA 3V42A 2DEUA 2CXUA 1IG3A 2ZP1A 4YP0A 4BQEA 1JWBB 3QWBA 1JALA 4Z0HO 5AHWA 4Q34A 5SY9A 3UXHA 5L45A 1VPTA 4EEKA 4QPJC 2DZDA 2WUEA 4GRDA 2O3QA 2DCMA 3LTNC 2GD2A 1HOXA 1ZMBA 4AZVA 2BSAA 2CMFA 2P5UA 2C03A 3HN7A 4S1TA 3TXAA 2O8CB 2PKQO 2CHGA 1L4HA 3H11A 3REFA 1QYCA 4YDQA 3I4FA 1NC1A 2ZYTX 2VYQA 1LLDA 2WT9A 2W5UA 3NTVA 1Z68A 4YRCA 1NVMB 2FZGA 4V3BA 2GX6A 1VLQA 3SBDA 1ZN9A 1O8BA 2C4NA 1CR2A 2W37A 3B3QA 4M0PA 3AVPA 2DR0A 3PI7A 3LLUA 1Z6PA 2UAGA 1UJCA 3HUUA 2FU5C 3N74A 4U7JA 3V8BA 2Z2ZA 2WOOA 3ZLJA 4B82A 4K86A 1SHJA 3EZGA 4MW6A 1BW9B 2ISSD 3PXBA 3HL4A 1G8HA 1DX6A 4GQAA 4I9HA 1EGMB 3A27A 1Y5RA 1KDTA 2QTWB 2YN4A 3FDZB 4O0LA 3P96A 4Y6LA 2ZE5A 1GT6A 3GFRA 5KWJA 1Y48E 1J33A 1W2WB 5KTPA 4DADA 2FQYA 5BT8A 3TTYA 4BTLA 4DG5A 1KAMA 3K70D 1EFRA 5GGYA 3KETA 3LP8A 3B2NA 2IE8A 3AJ9A 3WK5A 1IHYA 1FB5A 1SZPA 5DGIA 3N8GA 1X1TA 2AJBA 5E0KB 5B3JA 3F90A 1N2EA 1CUAA 3FCAA 3L84A 1VP3A 1O95D 1QF7A 1YVPA 2JKZA 3B3AA 1U2EA 1IJBA 3R7WB 4YJ2B 4YRIA 1IJEA 1YR8A 4XTRA 1WUTA 4HAIA 5BUZA 4Q1AA 5EXTA 3UB4A 1MNQA 3WLNA 1LSJA 2RGYA 3WGNA 3W1VA 4EPRA 2H2FA 2PT5A 3PGMA 4O2AA 4OQFA 1P1BA 1J00A 2Q07A 5TJ9A 4KGVA 5I7WA 3SQMA 1ZKMA 5BVGA 4DA4A 1U7HA 1YBVA 2PQ2A 2Z2YA 4B3JA 4RDCA 3GCDA 1E3JA 3THWA 1I32A 1LLFA 2JF0A 3K2IA 2ZI9A 2AE2A 1VLLA 4O4HA 3K0BA 1J7JA 4XOUA 4OX9B 1UJ6A 3N7TA 1F2UB 1E1MA 3EZ2A 3I4LA 1S3GA 1B73A 3R3JA 1SKUA 1JECA 2EKBA 2QG6A 3G0DA 1INLA 2F2TA 2V7VA 4UCFA 3TLKA 4KR2A 4IIJB 1F0PA 1AKYA 4KLZA 2LR0A 3LBIA 4MYDA 1ZNXA 1Z5WA 1WP4A 1AHIA 1IU9A 2V6FA 1H9BA 2D5BA 3EJWA 3G8YA 4FR5A 1WKVA 1E89A 4LCBA 3VR2D 1BDHA 2PL5A 3SEQA 5KYUB 5AUPB 1V35A 3QIVA 4YT4A 2PR7A 3RHZA 4C2UA 3R3HA 1X1CA 1BH6A 2ZAMA 4LAFA 3H86A 2P0AA 3BVPA 1K8ZB 1QANA 1PI3A 1QIHA 3PRYA 4RH1A 1AS2A 1G63A 4RETA 2C4TA 2Q2NA 3HWSA 4PZUA 2AWNA 4BVLA 1PL6A 2A67A 4O1IA 2DH6A 2Y4OA 1E1QD 3CGGA 4KFRA 4WOJA 3SF8B 3F8WA 2H92A 1HE2A 1T10A 3CH5A 5BWMA 3ETEA 2YDXA 2AFHE 3JRNA 5K0ZA 2JATA 2F1HA 1RIIA 1S02A 1JDBC 3T41A 4BDTA 5I7AA 2ZI7A 3LMKA 4ER6A 3KLMX 1OX4B 1N92A 1JFLA 3V9PA 1NBWB 2J5BA 3CLHA 4UEWA 4JBLA 4EIWA 1US8A 3K8OE 4OLHA 1CIPA 4Y9SA 1PFUA 1UC8A 1X70A 1ZEJA 2PS9A 3LQKA 3VNUA 5KQGA 1U4SA 1AUOA 1RRGA 4JVNA 3ABZA 3LHIA 2FWIA 1QV6A 2HBYA 1D2AA 2MMCA 1XHEA 1FTGA 3W5BA 1QFMA 2FMIA 2FVYA 3JX9A 2JFNA 3OKFA 4NFLA 4RFVA 5DT9A 4HWTA 3SS9X 1E3LA 1HG0A 3G17A 3P9KA 3GRYA 3N2NA 3KM0A 2CLEB 3QHAA 4I99A 3ZC3A 4G0OA 4UOZA 1K2VN 4OP1A 4KITB 1RWNA 3P0HA 5K2MA 3R5JA 1YNOA 4FYYA 1H9AA 5T8KA 4JUAA 1QJ4A 2FZ4A 3TXXA 2BDUA 3BMCB 1XKQA 5DH9A 5IN4A 1XXLA 1IEWA 2O8CA 4DCCA 4L75A 3ELDA 1M75A 2PZBA 4X8OA 4AYTA 4Z9FA 3N8NA 4MWSA 3RABA 1GXSB 3RFTA 4NBWA 1JP7A 3FD8A 4QICA 5AW0A 1N1DA 3QKWA 5C8DA 3ZCUA 1XFDA 1ZNQO 2K7FA 3I6ZA 5AHXA 3VU0A 2YKGA 3BGSA 5TC4A 1YJBA 1JG3A 2EVWX 2O2YA 2QZ4A 3QU2A 1T43A 2OFWA 1DEHA 4WINA 1SBYA 1O6BA 1Q92A 5B58T 3G9XA 2JI8A 1E4EA 1L7OA 2WF5A 2CHEA 1BW9A 2YJZA 1ISHA 3CKMA 3EEFA 2GWHA 4P6VF 2F8TA 1QVWA 2BKVA 3FDZA 3NC1C 3ND8A 4R4JA 3N5KA 4YLGA 1GUYA 2EKQA 1BSVA 4ZXFA 1IVSA 5JNWA 1TKCA 2WSBA 3DGEC 1VCNA 4N9WA 2C92A 2ISQA 1MP0A 5DM70 3GAAA 3GYGA 4G5QA 3VSBA 4NV3A 1TZMA 2B3TA 2JGJA 1KJNA 2Y1LA 1UBFA 3EGXB 2ZYGA 3I05A 4GXRA 2FN3A 3BJEA 5CR9A 1Q50A 3RVPA 3A36A 3GEPA 3UK1A 1RPAA 4MI1A 4ZCRA 2W6CX 3EPHA 2I2XB 2HT6A 1NKVA 2NZUG 3LQYA 3H04A 2CLCX 4R2WA 5EKDA 1QLWA 2GBIA 2AV6A 3R7WA 4YJ2A 4JKYA 2QSYA 1EP1B 2C3OA 2E4ZA 2Z2IA 1H93A 1G3QA 2AEFA 1GKKA 4YRQA 2EU8A 4YT5A 4WXRA 3P0JA 3TQIA 5EJ6A 1RHJA 4ETWA 2W6OA 3U9LA 2QXYA 4XTCS 5FX2A 3F67A 4RM3A 4D3SA 3A9VA 2Q99A 1Y9EA 3L8DA 5DP1A 1ZU5A 2AW5A 3Q11A 4HDCA 3SX2A 5C1DA 2I34A 1F2UA 4YRZA 1XA4A 4TVKA 3HY6A 4U7HA 3RE1A 1UDRA 2JIDA 3IEXA 1E2NA 1W29A 1IRIA 1KAGA 3ETGA 4QJ3A 4HNQA 2ZR7A 3T15A 2PMWB 3BWCA 3EIWA 1OZHA 4BNTA 4D26A 1UOQA 3E23A 3DMTC 3HFJA 5SZHB 2VYNA 5JRJA 3UPUA 2WM8A 5HTKA 1EZZA 5KYUA 2KM1A 1GZ5A 3KL4A 4R1SA 3MW8A 5IAEA 5CIQA 7ADHA 2R7MA 1NVVQ 1YXMA 1LPNA 1QWOA 5JCOC 2QB5A 2AN5A 3T5MA 4TYYA 2WA1A 1LSSA 4F11A 3D6JA 2GN1A 3RVRA 4CLXA 4DIBA 1QYVA 5GZ6A 3DCYA 5DM1A 3GLRA 4DA7A 4IV0A 4CM9A 2EZTA 1PEDA 4IJWA 2DLNA 4KE8A 4JC8A 3MFYA 4MB2A 1DMSA 2RIPA 2BI7A 3G1TA 1HYHA 3MCTA 5DNVA 4XR4A 5DNUA 4FWIB 1IOWA 2HK8A 2OAQ1 2R751 3GW8A 3FB1A 4CF4A 4LF4B 4GRIA 3L6OO 4O8ZA 4QTTB 1C8LA 1DADA 3EJ6A 4L8WB 1UKBA 2ZWOA 1PK7A 4LXUA 3SEFA 1OX4A 4TWBA 1U8EA 3OSUA 4R8LA 3VDRA 3WO0A 1II8B 1AZWA 1K98A 1XWIA 2W6JD 1A27A 2OFPA 4HRAA 3K1TA 4JKOA 3T1TA