4J0DA

Tannin acyl hydrolase from lactobacillus plantarum (cadmium)
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
470
structure length
470
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 167
structure length 470
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0dA00
1IUPA 1GXSA 4Q3LA 5AI6A 2R11A 1ODSA 1JKMA 5HQ3A 3KWFA 4QEKA 2PL5A 2XUGA 3H17A 1XROA 5ALYA 2HU8A 4U2BA 1WPRA 3WWCA 2O2GA 3FBWA 5DLPA 4F60A 3H18A 5IVIA 1VOTA 3STTA 1S8OA 1MN6A 1JT2A 1VZ3A 1XZBA 5ALUA 4E11A 5AI4A 4LXGA 3A70A 4UFOA 5DNWA 1VE6A 5E2IA 5ALRA 2JGJA 4G4IA 2JF0A 2E3JA 1UKCA 2B20A 1UKBA 2V96A 3G9TA 3GZJA 3ILSA 2FX5A 1H2WA 2RIPA 5JASA 4MWSA 1MTZA 3I2HA 2PVSA 1LPPA 1LPAB 2XUAA 3DOIA 1J1IA 2J4FA 3OM8A 1VA5A 2XQGA 2G5TA 4EY8A 1QZ3A 1XRMA 1FFDA 4RPCA 3WL5A 5ALVA 3WZLA 2YXPX 1C7JA 5FXMA 4I3FA 2B61A 5LIPA 3QH4A 2VSQA 1ZI9A 4JYMA 2VF2A 5HCUA 2C5FA 3WK4A 3PDCA 3R3YA 4MYSA 3H0CA 2PU5A 4PW0A 4KYVA 4GHWA 3F96A 4ARAA 3WWOA 1BCSA 2XQJA 3AJAA 2ZYHA 1LZLA 3IDAA 5HF6A 5IVHA 5AKYA 4KE9A 1G5FA 1QLWA 1U8EA 2CJPA 1CUAA 1MO2A 1CUGA 4QDOA 4EB0A 4TGLA 1F8UA 4PO3X 3H04A 3VJMA 1W4LA 5HF5A 5I7UA 5E4TA 1CIJA 1XZEA 4MQMA 5AP9A 2OPHA 1VLQA 4AO8A 3G9XA 4N8EA 4Q34A 4A5SA 3WQHA 3LS2A 4H7DA 4CG3A 3CN7A 1BCRA 1A8UA 1HDEA 3N2ZB 1K63A 1J07A 4E46A 3WIBA 1UK7A 2OCIA 4UUQA 4GLBA 1UK6A 4C89A 1R9NA 2C0QA 1QIMA 3QMWA 2GBCA 3LLCA 4AMZA 4NZZA 4OB7A 1GQSA 5LZ8A 4CI9A 1K5PA 4Q3OA 2JGMA 2HA0A 1CUJA 3D7RA 5AI5A 2WFZA 1DWPA 2QRUA 2XE4A 5ALKA 4Y2SA 4X93A 4KE7A 2BGNA 1F6WA 3ICWA 3I2JA 4DGQA 1AX9A 3M83A 5ALLA 1WCYA 5CXXA 5DYTA 2Y1KA 4FBLA 4V2IA 3ZLTA 1HL7A 2HIHA 3O4HA 4W1PA 2WU3A 4QWMA 1ZIYA 5AM1A 3AIMA 4CCYB 5LKAA 1CUYA 5JALA 4U2EA 4H77A 2PU7A 4U2CA 4Q82A 4IHAA 3UUFA 5I8PA 3A6ZA 3SX4A 5LKRA 2XMZA 1AGYA 4K6GA 3S8YA 3W04A 4HXGA 3MGAA 2O7RA 4TPKA 2J4CA 5KBYA 2Z5GA 5FRDA 5A62A 4PQEA 3AZQA 4O08A 1EDEA 3C87A 3O9MA 4XWGA 1OCEA 3STWA 1K4YA 2VA9A 2Y2VA 1XLUA 4U2DA 3WL7A 3DYVA 3FCXA 3BL8A 3O4GA 4Y2JA 5LZ9A 1ZICA 1JMYA 1ZJ5A 3DKRA 2ONCA 3OC0A 4MQLA 4AN1A 5LZ4A 1VE7A 4X95A 4WFKA 3DEAA 4BATA 4KEAA 4L0CA 1CUIA 3WA7A 2HHAA 1ZD3A 1DX4A 4BZWA 5EIHA 2YASA 3WK6A 5T4EA 2XDWA 5AK5A 4N5HX 4M0EA 5KREA 5AI9A 4BDSA 3H1BA 2Z8ZA 1X2EA 4LIPD 5FOQA 4IH9A 3DCNA 3WWPA 3YASA 4W1RA 3BJRA 5KWIA 4N5IX 2I3ZA 4QLOA 1XRNA 5K3DA 3OOSA 4WCVA 4F5ZA 5AKXA 4Q05A 3VXKA 3L1HA 1SCQA 2V9ZA 5EIEA 3ZWQA 1ZI6A 3G0DA 3UMJA 1ODTC 4DMHA 1R9MA 5KWJA 1WHTA 1DTEA 3WJ1A 1CUEA 5LP1A 1QE3A 3QITA 3JW8A 2PSJA 4AO6A 4KACA 5T4BA 4IH4A 4C4XA 4ZV7A 1RYYA 1EK2A 1PFQA 4BP8A 1YA8A 4OU4A 3HI4A 4UHBA 1FSSA 5ALJA 4X00A 3DL7A 3KDAA 4RNCA 2WIDA 5AM0A 4MEAA 3MVEA 4BAGA 1CRLA 1SCIA 3KD2A 1I6WA 1PV1A 3TRDA 2WLSA 4Y7DA 3WK7A 3FCYA 4G8BA 2OG1A 1EX9A 1UZAA 1MX9A 5ALFA 1LPBB 2HM7A 1CUVA 4GDMA 2OGSA 4HS9A 4AQDA 1CUUA 5ALPA 1C4XA 3V9AA 2PPLA 2JGLA 3ZLVA 3PI6A 5JAOA 1AUOA 4PNZA 1G42A 2WFLA 1WHSA 1Z68A 3A2NA 3U1TA 1WOMA 3WJ2A 2WILA 4GI1A 3HYSA 1BN6A 5HK9A 1SC9A 3EQ7A 1CVLA 3FOBA 1BRTA 3C5WP 3ZLUA 4I4CA 1VKHA 4GECA 1XRQA 1YR2A 2PKYX 3C45A 5AIBA 3F98A 3ZPXA 3IA2A 2XMQA 1ACJA 3IUQA 5CURA 4FKBA 4UHFA 2PM8A 3WYDA 1WB4A 4FLEA 4Y9SA 4OD0A 2XLCA 3T4UA 1XQVA 3GA7A 4J03A 1YASA 2XQIA 3DKKA 4OB6A 2EEPA 4NVRA 3GUUA 2J3DA 1R50A 4DSAA 1ETHA 3HSSA 2PSEA 3U0VA 5ALXA 1T2NA 4Y2VA 3WL6A 4Y2YA 4CCWA 2VATA 3AIKA 5CW2A 4BAZA 1TCCA 2FUKA 1MX1A 1QFSA 1UOPA 3GELA 1K8QA 2H9YA 3LIIA 5JD5A 1F0PA 1GPLA 2WQZA 1VXOA 4P93A 4K5QA 3WL8A 4FLMA 1MU0A 3PFBA 3ESDA 4GWLA 2CBGA 3X3HA 1UFOA 5K3FB 2P8SA 2QXUA 2W6CX 1XRPA 5AKZA 2XUIA 5A6VA 4DSZA 3FWHA 5JATA 2VAXA 3WYNA 4BZZA 4OSEA 3W06A 2XB6A 1LGYA 4ROTA 1CUHA 5K3FA 2XUOA 1QIJA 5EI5A 3LCRA 2RGUA 3AUKA 3HZOA 1QFMA 2C7BA 5K5EA 2I78A 1E66A 2WJ6A 3O4IA 5AK3A 3EQ9A 2ACKA 3R40A 4BDTA 1N8SA 3NGMA 1UT6A 1TIBA 1JI3A 2WUDA 1XZMA 4ITVA 2HADA 1F0NA 1EH5A 2VTVA 1EB8A 4C01A 5H3HA 4DTCA 4FDMA 4F21A 3PF9A 2DCMA 3WK9A 3EBLA 4YX9A 4QWWA 1P0MA 3PE6A 2WUGA 4EY6A 3D59A 2IIVA 2DFPA 3DS8A 4LXIA 4C4YA 2C4HA 5IKXA 4BRZA 5DTJA 1GT6A 3D5EA 1EDBA 2ECFA 1JMKC 5LZ5A 1LPMA 4Y2UA 1N5MA 3OTQA 4M0FA 1VZ2A 1NU6A 3PICA 5JAHA 1GKLA 1JJBA 3F97A 4AB1A 4BB0A 1XZKA 4UBJA 2ZJ6A 3NOXA 1VA4A 4BCBA 5JARA 3W9BA 3Q8WA 5A7GA 5C8VA 4DMKA 1Y7IA 5LYYA 4F0JA 1QIFA 4X6XA 5CT6A 3K9BA 5AKHA 2Y2UA 5CT5A 1QTRA 2BUCA 3WWDA 2PSDA 2WTMA 3A2MA 1LPOA 2C0PA 4BCCA 2H7CA 2XUFA 1CUWA 1QO9A 3HLKA 4C87A 2OLEA 5AM2A 4B84A 5AK6A 2QR5A 4X90A 5JZ9A 4BC0A 1H2XA 1KU0A 1IZ8A 4UHEA 1NU8A 4B7ZA 1R3DA 1JFRA 5AKJA 3C6ZA 4B85A 2QTBA 5AI8A 1CUDA 3M82A 4BC1A 1EK1A 2HU7A 4JH0A 1A8QA 2DQZA 4FWBA 3IURA 1FFBA 2IITA 3I2KA 1Y37A 1P0QA 1G66A 5AKGA 1GKKA 4B6GA 2PBLA 5AO9A 2OQIA 5F4ZA 2WIFA 4AZ3A 4H7FA 4IH1A 4OYLA 2BCEA 4Y2PA 2PSFA 3KSRA 5EGNA 5BWBA 2QJWA 3G0CA 3BIXA 2O2HA 1CUSA 1XLVA 2H1IA 1IMJA 1XQYA 4FHZA 5ALOA 5D7BA 1K6EA 4X91A 2Y6VA 2CUTA 5AJHA 2UZ0A 3V48A 2EDCA 2HRQA 5JAPA 1CQWA 3G8YA 4X3CA 1OILA 5HK8A 2FJ0A 3G7NA 2RHWA 4ZI5A 4FBMA 5T4FA 4QDZA 3ESBA 3QM1A 4EA6A 3FLEA 1NX9A 4UPDA 3SK0A 1CQZA 1UXOA 4W1QA 3R3XA 1QIKA 2XMBA 3QPDA 2CEKA 2XUDA 1SCKA 2XI4A 5AM4A 4CIAA 2HU5A 4J7AA 4X7BA 1MT3A 3V1NA 2G63A 3EF3A 5AKKA 2WUFA 1YS2X 4AZ0A 5EHNA 1FJ2A 4YK7A 1AQLA 1EA5A 4BTLA 1MNAA 4KAFA 1QIGA 3D3NA 1ZOIA 4CCYA 1XLWA 3K2IA 3DL4A 3HJUA 2GYVA 5ALSA 1HBJA 5HZGA 3OG9A 4K6KA 3HACA 3C6YA 4BE9A 3G0BA 3H2GA 1CUBA 1M33A 4WFJA 3QPAA 2XQKA 4OPMA 4J0DA 5JANA 5K3EA 2GZRA 3G9ZA 4YPVA 3E0XA 1XZCA 4U2GA 1HLGA 3RLIA 4QDUA 4OB8A 5HFAA 1HPLA 4ZV9A 1DQZA 1EVEA 1O6GA 3BXPA 4Q3KA 3C70A 2WIGA 2OCKA 3F67A 4G8DA 5DNVA 2EDAA 2JGFA 3FYUB 3K6KA 4OUKX 2HA7A 4G1FA 4ZXFA 4DNPA 4A23A 4DMCA 4EY7A 3PF8A 1FFCA 1XZFA 3EQ8A 4GEGA 4C6HA 2WJ4A 4H7JA 5JZSA 3G9UA 5IVKA 1TRHA 4J0GA 2QM0A 1TCAA 4WJLA 3E4DA 3VJKA 4DNQA 1YSCA 2YYSA 4QNNA 5LLSA 5EHZA 4G5XA 4DIUA 3BWXA 1EDDA 1HQDA 2DHDA 3SWWA 4E14A 4CFSA 3DD5A 3ESCA 3BF8A 3MUNA 4RE6A 3I28A 5AK4A 2PUJA 2WG1A 1P0PA 3STXA 2ZYIA 5CBKA 1J2EA 4FLFA 5CRIA 2B4KA 4RGYA 4BVKA 4B82A 4K2AA 1E5TA 2BKLA 1MAHA 4PSUA 4U2FA 1QIHA 1X2BA 2Z8XA 4OYYA 4LHEA 1VXRA 5K3AA 2HA4A 1CFJA 3HXKA 1UOQA 5D3ZA 1R1DA 2QT9A 3WZMA 5AIAA 4B9AA 1L7AA 1WB5A 4J0CA 1ZIXA 5CTAA 3VISA 4B81A 1IUNA 1W76A 3WKEA 3PUHA 3P2MA 1YAHA 4K6HA 1BU8A 1MAAA 1X70A 1EB9A 2DQYA 4GW3A 5ALIA 4XJVA 2WTNA 4KRYA 4MYDA 4BVJA 1QGED 3HABA 2QXTA 4HZGA 1CUFA 2JBWA 1U2EA 3V1LA 2ZVDA 2QJRA 2QKYA 1XKLA 3R3UA 2XMSA 3I6MA 1E3QA 2GYUA 1RP1A 2Y6UA 3B3QA 5CH5A 3R0VA 5BWCA 3GFFA 1BEZA 2HFKA 4H18A 5EHXA 1Y7HA 4UBKA 2HRRA 5DWDA 1ORVA 1QJ4A 2ACEA 2C58A 5AHXA 4NMWA 2DHCA 4B80A 2W22A 3OPMA 4C4ZA 3I2IA 1SOMA 5EIAA 2JEYA 3B5EA 4BBZA 2CZQA 1UK8A 5K3BA 5C8ZA 4L3WA 3RK4A 4AO7A 2ES4A 5E4JA 1CV2A 2BUBA 2C5GA 2JGKA 2HFJA 3V1MA 3GROA 3O4JA 5SYNA 2OQVA 5BOVA 4HAIA 4N8SA 2BAGA 1DU4A 1UWCA 1THGA 2X76A 3VKFA 3D0KA 1YAJA 3ESAA 1XZHA 2VEOA 3LIPA 1IUOA 1YCDA 1QO7A 4B83A 2QVBA 5JAUA 2XLBA 3I2GA 1E8NA 3FSGD 3KOOA 2D5LA 5ALDA 2XMCA 3WA6A 4UHDA 2AJ8A 1EINA 1C7IA 1VJ5A 1ORWA 5HF8A 4WY8A 3HRHA 5AKLA 1ZGCA 2QMQA 1LPSA 4EUSA 4YASA 2FJPA 2JGEA 4WDRA 4JEIA 3WIOA 5CT4A 1EHYA 3RKSA 3VJLA 3T52A 4NS4A 4QLAA 3STVA 2HA6A 1ODCA 2QZPA 4HXEB 4XX1A 3G02A 3HC7A 4G9EA 5T4HA 1L7RA 2WJ3A 4Y2TA 2WU4A 3WK5A 5FV4A 2OCLA 5IVDA 4HRXA 2B9VA 1BEEA 4FNMA 1EVQA 1XZAA 2OGZA 2WIJA 5LZ2A 2XMDA 5AOAA 4H7EA 2J3QA 4HTAA 3AIOA 4W1SA 5AM3A 1IZ7A 3C8DA 4MXDA 1UKAA 4OCZA 3BDIA 2XUJA 4P9NA 4EZIA 4OU5A 1ZD2P 3C8HA 2WM2A 1A7UA 2Z3ZA 3H2KA 1Q84A 4MWTA 4DYHA 4WDQA 3IVMA 1AZWA 1U65A 4DNOA 3FLBA 3O9VA 4J0JA 2HA5A 2WUEA 3WKDA 1BN7A 4LXHA 3ANSA 1E8MA 4M0MA 1W1IA 3CXUA 5JD6A 4X6UA 5AM5A 1BE0A 1Q0ZA 2OAEA 4QA9A 5A7FA 4X97A 3E3AA 1LNSA 3R3ZA 5FKJA 1U4NA 2D0DA 3DNMA 4PF1A 3R41A 4FOLA 4X6YA 2HA2A 3GBSA 4ZREA 3FNBA 1GQRA 2BUAA 3CCBA 3NUZA 4CG1A 4P08A 1A88A 3WWEA 2VJCA 3VVLA 5JYCA 4X85A 3H2IA 5ALWA 5JADA 2RONA 5EFZA 1WPXA 3ED1A 3DQZA 2H7YA 2H7XA 4PSDA 4G4GA 4KR0A 3G0GA 2VT6A 5HFNA 3CCCA 1JU3A 5AH0A 4E15A 3N0TA 3UUEA 2G4LA 5K3CA 1DT3A 1TK3A 1LZKA 5JIBA 2ZJFA 4BRSA 4AN0A 3VVMA 2X8BA 4FFVA 4H0CA 3IBTA 4ZGBA 4P92A 2LIPA 4D9JA 3I1YA 4UBNA 1TCBA 3AZOA 1QTIA 2XUKA 2HL6A 2CB9A 3QMMA 3FVRA 1DINA 2Z3WA 1H22A 2XQFA 3I1IA 3IUNA 5A71A 1XZDA 4DM7A 2IX9A 3WKAA 1YS1X 5C81A 3QVMA 2I3DA 2WHRA 3STYA 1PJAA 1L7QA 3HEAA 3BDVA 4KAAA 3QPCA 5CT9A 3Q0TA 1J06A 1ZI8A 2ZYRA 3DLTA 1WM1A 4EY4A 2HDWA 1AKNA 2ROQA 2AXEA 2WG2A 3D4LA 2ZJ7A 1WB6A 4G4JA 3TJMA 5AKIA 7YASA 1CUZA 4QZVA 4EBBA 1THTA 1BROA 4KRXA 1H2YA 2V97A 2AJCA 2I03A 2XUQA 1GGVA 2G5PA 2WSLA 1KU6A 1LLFA 3OURA 3H2JA 2R8BA 1QIIA 2QS9A 1A8SA 4QE3A 3C5VA 4EHBA 1CLEA 2GBFA 5FLKA 4KAJA 1LPNA 2GBIA 1DWOA 4LYDA 4QDTA 2CKMA 4UHCA 2RI6A 2WHQA 3BE8A 3W2TA 1MPXA 5J3JA 3CN9A 4Q1VA 2ZSHA 1XQXA 4HXFB 3I6ZA 3AILA 4XVCA 1XZLA 2XT0A 2BJHA 1XZGA 5HF9A 1HKHA 5FUMA 1FFAA 2WHPB 4FTWA 2XMRA 3FVTA 3PUIA 3NWOA 5CH8A 3VDXA 4W9RA 1W75A 1QOZA 3LP5A 3PFCA 4KJXA 3AINA 2O7VA 3M81A 3DJYA 1W52X 4ZRDA 3RARA 4ZWNA 1Q83A 4INZA 4J0HA 1ZJ4A 3RM3A 1JJFA 2WHPA 3L1JA 3FSGA 1R88A 1AURA 3IUJA 1W6RA 4X71A 2GZSA 4TVKA 1DQYA 4AMYA 4N8DA 4UFNA 1CUCA 1B41A 1P0IA 3EIOA 3WLAA 3JWEA 1CEXA 2WIKA 4WY5A 1G4HA 2AJBA 1UOOA 3FAKA 3H19A 3ICVA 4BYMA 2OXEA 5ESRA 3A2LA 4JNCA 1JU4A 2OGTA 4B0PA 3MUOA 3H1AA 1AMNA 4UBLA 2K2QB 5ALNA 1Q0RA 2OCGA 4W63A 3FYUA 2VJBA 4AX4A 2XMGA 1JJIA 2OAGA 1DT5A 3AZPA 1YB7A 4G8CA 4JUIA 5JD4A 2V98A 1ZD5A 1EI9A 1DX6A 3W05A 1AC5A 4BVLA 4JYPA 3WKCA 4FMPA 2ORYA 3BF7A 3C43A 3JYHA 2WKWA 4X92A 2XUHA 2PX6A 1E89A 3TGLA 1GPKA 5AOBA 1CUXA 3AFIA 5HKAA 3D2AA 4UBMA 3ZI7A 5ALZA 3FYUC 4L72A 3DYIA 4EY5A 5ISMA 2PUHA 4C88A 1XZJA 2YH2A 4PSCA 4BCDA 5JZBA 3DOHA 2ZSIA 4X94A 1MJ5A 2Q0XA 4BTVA 5C7YA 4XIIA 3B12A 3M3DA 2WG0A 1YA4A 3I2FA 4BAUA 1XZIA 3TEJA 3KWJA 1MX5A 3C6BA 1XKTA 5DJ5A 5BV7A 2AJDA 1TAHA 1QIEA 5DTIA 4H35A 1FFEA 3S2ZA 3QYJA 1ZGBA 5LZ7A 3BIWA 1N1MA 2RHTA 4FNGA 1CPYA 3WKBA 3STUA 3ZV7A 1QIDA 3O95A 1T4MA 3D2CA 1XQWA 3WK8A 5FDFA 3IIIA 4HVTA 5EHQA 1IVYA 1XFDA 1ACLA 1B6GA 4Y2QA 4CG2A 4J3JA 5ALMA 1GPNA 1UK9A 5ALGA 2PSHA 1R4ZA 3WMRA 3IB3A 3L1IA 4MJ3A 1N5RA 4RE5A 4J0KA 3FLAA 5CMLA 1TKRA 2DHEA 2VJDA 3QBJA 5FPQA 2WFLB 3R3VA 4MEBA 5A2GA 5AKEA 3QMVA 2GYWA 4DLNA 3E1GA 4L9AA 5DYYA 5ALEA 1ZD4A 4G9GA 1H2ZA 3ANTA 1QONA 4Z49A 5AOCA 1LBTA 3FYTA 4HRYA 5E4YA 3D2BA 4H7KA 5C8XA 5CXUA 1CR6A 1RWQA 4GXNA 2RAUA 5CT8A 1EXWA 4CIBA 4ETWA 4B0OA 1MNQA 1XRLA 5HKBA 2GBGA 3WI7A 4DNFA 2BGRA 2QUBA 3H2HA 4QDXA 5FPPA 2VQ6A 5IH7A 3I6YA 4GBGA 1DWQA 2VT7A 3BJMA 4IQ4A 2HA3A 4H7IA 3DDUA 5I9IA 5D3KA 4IO0A 4A16A 6YASA 4ARBA 4BP9A 4H7HA 5ALHA 3O0DA 1SFRA 3KXPA 4J0IA 4AXBA 5CH3A 4BE4A 2QOEA 1O6FA 5FP0A 2AJLI 4UFPA 1GZ7A 5A7HA 4WFIA 1LBSA 4PV7A 3G0IA 1OXMA 4UBIA 3SC2A 2VAVA 3C6XA 5D6OA 5AICA 2DR0A 2CMFA 2BFNA 2WFMA 2NW6A 2O2IA 2JIDA 2ZYSA 3IULA 5ALQA 4S0XA 3R3WA 1H23A 5DYWA 2X5XA 5YASA 5ALTA 4KE6A 1BS9A 2JEZA 4UBOA 3W9UA 4I19A 1E8DA 4UHHA 2XUPA 4LYEA 3F9CA 4Y2XA 1TQHA 1USWA 4KE8A 4FFWA 4DMFA 3V1KA 5SYMA 4B9EA 2JGIA 4LKOA 1KEZA 3QZUA 1D07A 5HQ3B 2QUAA 1YB6A 5AI0A 3IUMA 4Y2RA 3F8SA 2DSNA 1XRRA 2VJAA 1ISPA 5DNUA
chains in the Genus database with same CATH superfamily
3UAZA 2FPUA 2WB4A 3OOEA 1MRSA 3GNTA 3L18A 2VYQA 2L0XA 3VZQA 4Q3LA 3VUEA 1MFPA 4FMBB 2HCRA 2ZB8A 1UDCA 5LOVF 5HQ3A 3OCJA 4ZALA 4LMAA 2HBYA 3D1VA 1VM6A 3KWFA 3JVVA 3MMXA 5LQUA 3RFXA 1ZP6A 2XUGA 2A1TR 4LSWA 3CYFA 3MLBA 1HQCA 3SAJA 2IXFA 4Q1FA 1XB2A 2WR8A 1NJFA 5I3ZA 1NFRA 2IZ0A 2O2GA 3FBWA 2IZOA 3RV3A 4BKQA 1NQAO 3BWEA 3VM6A 1AV7A 3H18A 1Z4QA 4MIYA 1SBHA 5FFMA 3WGYA 1WMAA 3K8YA 1AUVA 3DZBA 2POCA 3JD4A 1WUKS 4JMPA 1MN6A 4LVUA 4EMUA 1JT2A 1OV6A 2OM6A 2X2OA 4XGRA 3L9WA 1T5LA 4MR8A 2I99A 2ZUBA 1SXQA 4MKFA 1KQ3A 3UJ8A 3LC0A 3P9ZA 4MQEA 4E11A 4UFOA 3A70A 5DNWA 3QHQA 2X22A 1ZVMA 4R8LA 4U4AA 1U7OA 3PNLA 1Z4NA 5E2IA 5ALRA 2DE0X 1U7XA 3KTOA 3Q9SA 1QYVA 2JF0A 3R7SA 4JB3A 3RAGA 2GRJA 3MK31 3NGXA 4RTNA 3E70C 2B20A 3TLGA 2OUKA 1NOIA 4HZUA 3C85A 2VVTA 1JB9A 3GZJA 4ZYWA 5C53B 5CLGA 3GGDA 5CVUA 4AJLA 1OFIA 4D8VA 1AHNA 5I7EA 1TAGA 1H2WA 4JJIA 1V8BA 3K8QA 1J24A 3TO5A 3UMCA 3LPDA 1X80A 3DFZA 1BVHA 2WYOA 5BN1A 4GPTA 4MWSA 2EW2A 1MTZA 1E64A 2WTBA 1MH1A 3FSJX 1YR3A 2PVSA 2YQ4A 3I2HA 4WNIA 5TQVA 4COKA 3ISTA 1LPPA 2J0UA 2W2LA 2WIBA 4F6LA 1AG9A 5T8KA 4N6GA 1YJBA 4CTKA 2F3TA 3JWJA 2EC5A 1ZXXA 4NDNE 2DOKA 4LMRA 2ACVA 1Y80A 2EHJA 1S2GA 4JJ7A 4OQLA 4B2IA 2XDYA 2NUAA 2CW5A 1ZITA 4A6PA 3RSCA 3M1IA 4PZYA 4C04A 4G5SA 1FP7A 4EJMA 1QG4A 5K0CA 2ILTA 2ZR0A 3M6VA 1NVMB 1KP3A 1XTKA 3GLVA 1SKUA 2IQ5A 2P5SA 2PBFA 3TE7A 2ZRFA 3HY3A 3VQTA 4W5NA 3AKYA 3FTPA 1O0SA 2VAPA 2YXPX 1C7JA 1X7HA 3K0FB 1DDIA 3JQGB 3SJAA 3WZLA 3HZHA 4L74A 4YCCA 4WKNA 3ANMA 1EJ2A 4CMEC 3FUVA 2C0CA 1OHHD 5EN4A 5JJCA 2VDQB 4PX5A 4F8YA 1G7SA 3QH4A 5LIPA 1DCMA 2F3SA 3CLHA 1ZI9A 1RACA 3O4VA 4XQGA 5KHOC 2O8NA 2VF2A 2CCGA 5HCUA 1SA0B 3WK4A 1U2PA 1J22A 4K8OA 3PDCA 4WESB 4AY4A 4LX0A 1C30A 4WH0A 1OGYA 4YCJA 5TJHA 5IZCC 2GI4A 3HJHA 1WX1A 4ARAA 4INOA 8AT1A 1M2NA 1D2MA 5A4KA 3U19A 2V7PA 2OORC 4DLRA 2UXBB 4J9UE 2GK6A 4N65A 1T5OA 2ZYHA 1XMJA 5K4AA 2D1YA 4ASUD 1KC1A 1Q16A 4TLAA 4GSYA 3JQEA 2XCSB 3PTAA 2H0RA 1YU6A 1OTHA 3TL6A 1RXIA 2BJWA 3T99A 4B48A 1J6UA 1RHUA 4KE9A 4JI5B 2FDRA 3WGZA 1OLUB 1L1QA 2VL7A 3EZYA 5SY9A 4EPRA 2MTBA 4WD3A 1MO2A 3ZIAA 4ITUA 2GVDC 5L3SB 3W6UA 5IU6A 3RSZA 2CD9A 3KALA 3DMTC 3IVXA 3LSTA 4R6XA 4M3NA 4K0RA 4D1YA 1J2TA 1KDPA 1HRKA 4DLKA 5I7FA 1JSZA 3A6DA 4QOEA 4H27A 3GP5A 4DAOA 4YROA 1E2UA 1G0OA 5JYBA 5J5VA 1GA1A 3RVQA 4AC9A 5UKDA 4L8LA 3ILVA 4JR0A 5SYAA 3S27A 3GRKA 1PNOA 2QJFA 3QUTA 1R27A 3PEYA 1NVGA 4FZVA 3MIZA 1BCRB 5FBQB 2Q3LA 5I7UA 1KZ4A 3K1TA 1ORDA 3FM9A 1GG5A 3AVPA 2RD2A 1A2OA 1LRKA 1VGRA 1P31A 4MQMA 4M7WA 1HGXA 1Q2XA 2GN0A 1EBUA 2P4QA 5FTNA 2NTYC 2E21A 3ZGNA 1KZ1A 4MUNA 3QXXA 4ZJUA 5BOSB 1BWQA 1PR2A 4L8FA 3CNQS 4XI9A 3OEEA 3M33A 2OPHA 4AO8A 1JEYB 1P29A 3PX7A 2GUGA 1U3GA 4NE2A 3G9XA 4L0MA 4EPYA 5K8UA 1WS6A 3IE1A 3RADC 1FTSA 3AW9A 2P1RA 3K4QA 3LS2A 4H7DA 1GO2A 2COUA 5ITWA 4ZTZB 2BM0A 4LJ4A 4ZEOA 3NORA 5K51A 1Z4LA 4N12A 4AYTA 5AVWA 3MOSA 5DCUA 2OAP1 2P6OA 4D5EA 3DBLB 1K63A 1KFBB 1UZUA 3AG5A 1UC9A 2X0JA 5SICE 2UYHA 1G20A 3RUHA 5B7NA 3PVSA 5EJEA 3H5TA 2WWVD 4JI0B 4YJ2B 1NA5A 1O0CA 4UUQA 3UOWA 1KJNA 2RKOA 2J6HA 4YGYA 1AK2A 1FQOA 3PRYA 4MRMB 3CWCA 1NJ1A 3RO7A 1H0KA 1QIMA 3RRMA 5CITA 3IAFA 1T1JA 5T64A 1JE1A 2XCLA 4YRDA 1W0JA 4UU0A 4NZZA 3DZFA 2P9HA 2B2XA 4UD2A 3ABRB 1DKUA 3KTAB 4GAEA 5LZ8A 3REFA 3AY0A 2ZI4A 3MILA 4CI9A 3E23A 1NP6A 1K7YA 4G85A 4Q3OA 4QELA 4ECAA 1CZNA 1MJGM 1UBOS 1KMHA 3G5AA 4MW6A 2HA0A 4UVGA 4B35A 4OK5A 4LOIA 4DSUA 1SKYB 1II9A 3TCNA 2SCUB 3D8RA 4EHKA 2J3IA 4CM8B 2WUVA 4ZCPA 2LCFA 1CSEE 2FMXA 2CJWA 2IGTA 2PAFA 2IEAA 2WFZA 5KIAA 1TNDA 4HZIA 4W7HA 5HMLA 3ZWMA 2IEYA 4X93A 1COWA 3LPLA 3AF2A 4GF5A 4GNRA 1US8A 1Z15A 3IMEA 2ISQA 1ZLXA 3LY8A 2QRGA 1V3QE 1QRAA 1DAEA 3T5BA 4RESA 5EFOA 3ZUPA 1Z2AA 2IVZA 2P6MA 3I2JA 4LF8B 1CRPA 4XX0A 1E9RA 2DJIA 2J9XB 5GOZA 4KI0A 1WCYA 4AZ0B 5CXXA 4KR3A 2GSDA 1U5AA 3O1LA 1XTRA 1EP9A 3A4YA 3PC8C 4HQKA 4BO5A 3GAAA 3H3JA 4V2IA 5H3CA 2P9YA 4M9CA 4WLNA 2PDAA 4M21A 2B9EA 1X1DA 3NKLA 4JY7A 5B1IA 1H0RA 3U4QB 1YA6A 3G5MA 4R3UC 3JVDA 2ZZMA 4ZOLA 4X41A 2XDQB 3MGCA 4MPJA 1XNGA 1QE5A 3H1TA 4B8WA 3ID6C 5LMUB 3M49A 3OQIA 4CCYB 1WV1A 3N74A 3NLLA 4M0KA 1OFHA 3GZ4A 1DLJA 5TGZA 4U2EA 1XR3A 2BLNA 1TKAA 4KFTA 3NHUA 2ZULA 5EE5B 4KYIB 3IX7A 5I8PA 4Z8YA 4TQ9A 1JG4A 1Y8QB 3TI9A 5LKRA 1FVHA 1PGOA 3ZS9A 1IG0A 4O2AA 2YFKA 3W04A 1CZRA 3SR4A 4TPKA 1ENYA 3PJDA 1IEWA 1P9OA 3ZOZA 1DRWA 4K6MA 1OX4A 4TRJA 2UXDB 1AK1A 2Z5GA 5FRDA 1WAMA 4EK9A 2P9BA 3DBIA 3L6RA 2CDAA 3PEVA 4PQEA 2Q62A 2OHIA 3VTFA 3BJEA 4NFHA 2PKRA 4NATA 5GGYA 4XYEA 1F3LA 3EZ9A 4TLMB 5K3OA 3HDVA 4AJIA 4FB4A 1FFWA 4RVCA 3SR0A 3AZQA 2ORVA 1RWXA 3ZBPA 4C0QC 1JDBB 3C7AA 1ITZA 1NYLA 4TV8F 4Y0NA 5J2TA 3DE1X 1ZGZA 3S2EA 1B3RA 4FR2A 4AULA 1EDEA 4QFCA 3KQPA 3RNOA 3T6KA 1W5FA 2CNNA 4V0QA 2OZLA 3Q0IA 3RBZA 3STWA 1KO5A 3TKAA 1ATZA 4O4HA 2B3DA 1S7CA 3LA6A 1N3BA 3HVHA 2PZJA 3NM6B 3PYLA 2GVNA 3PWTA 4Z4GA 1GLNA 4WK2B 2IHYA 3BH0A 5TIIA 2Z2JA 5DLDA 1IOVA 2ENWA 3C1TA 1TT5B 4QARA 2JHPA 3EEQA 3LCVB 3T3MB 4AROA 3O4GA 4MJXA 5KQRA 1FSGA 2YJTD 4MUYA 3T7IA 3WRVA 1ECFA 1UBKS 1C1XB 2EZTA 2L17A 3OC0A 4C0JA 1EVJA 1C2TA 3TD6A 1JQDA 4AN1A 3K70C 2P1DA 3P96A 3TDMA 4XLTA 5K2MA 2VJNA 3AU8A 4BNFA 3WYBA 4L85A 5JS2A 5BP7A 3D4OA 1XMPA 3H1EA 1P6QA 3V3KA 3NUGA 1UBHS 4N5MA 5D5HA 5I7VA 1RM4A 2PK3A 4NK4A 4X60A 4BATA 2EKLA 3O8RA 2C1ZA 5DI3B 4BYGA 3WGIA 2W2VA 4U6NA 4A8JA 1DX9A 1IB0A 3FUWA 2BZ1A 3G8DA 4JVNA 4ESHA 5FUVA 4YRIA 2AG8A 1NW8A 2D2XA 3QE0A 4KXQA 3AT1A 4CKXA 1LXCA 1BYUA 1NXOA 5MGNA 1CUIA 3WA7A 2C2HA 1U2ZA 3NFRA 3O7MA 3KYDB 1Z5VA 1ZD3A 3HFGA 1H1DA 4XPZA 5E9WA 3S28A 3SHTA 1T26A 1QH8A 3LNTA 5EWMB 1DX4A 2IY8A 3GLRA 3C14C 4BMSA 1X9HA 1IIBA 4DR1B 4H2DA 1EIZA 5LD2C 2PUFA 5EIHA 1G2PA 5IZ4A 1PWHA 3ZKAA 2IQIA 2J5KA 2H5LA 5EE0A 1YDGA 3CO0S 3EZ7A 5EJFA 1G3QA 1P44A 5J23A 4UVHA 4FWTA 1THZA 3KSDO 3NTRA 1M8KA 2WA1A 3FFAA 4GZ5A 4ZO9A 2RJOA 4BNLA 5AI9A 2BGLA 1KGSA 4BUZA 4EFLA 2YY5A 4QSMA 1Z17A 3KKNA 2Z8ZA 4TMVA 3KHSA 1GILA 2PGLA 3MT7A 3BVPA 4LIPD 4LJ9A 3ZTYA 1EIWA 4ZICA 1G41A 5GGXA 1HEUA 4C2TA 3DAGA 4WE3A 2H1SA 1CRZA 1GSOA 1SEPA 1WXWA 3IOMA 3DHNA 2EARA 2O5VA 3DEFA 3FUUA 3F5DA 1U3FA 3DDOA 1P5RA 2RH9B 3NUQA 1PD0A 3R8XA 2IELA 5CB4A 3JZAA 1LDMA 1EQUA 4LZZA 2JA2A 3KU1A 1XTVA 4M2LA 1EDOA 1GIAA 5F1YA 3B7WA 3WWPA 3KOZA 5IEBA 4BP3A 2VCHA 4H31A 4CUZA 4OI0A 4CF7A 2A59A 4N5IX 2IGBA 1WZUA 4MVJP 2JFOA 2Q4OA 3RAFC 1KSFX 4HADA 4MI3A 2PMBA 4QPJC 5JZMA 1U99A 1K4KA 3TX2A 2BMAA 3CJQA 4MKZA 2JAPA 3FPAA 1F20A 3B1VA 5GINE 3ROFA 1LUAA 5KNDA 1XZ8A 4QM6A 2AZMA 2C3MA 3G1UA 3Q9UA 3VXKA 4MI1A 3X1ZA 3H4TA 1USKA 2J3KA 1SCQA 2SBTA 5EIEA 1GTRA 4MP6A 3AUSA 2F2TA 3CUVA 4N54A 4Q7LA 3KKPA 2A9OA 3OQJA 4RHXA 3ZDZB 4JITA 3PE3A 3UMJA 3KKEA 3W9SA 1P2BA 2AOUB 2Q7DA 3S2YA 2BFDA 3LI2A 5C1OA 5LWQA 1FVOA 1I4WA 2VJYA 3VRHA 5F3WB 1N5IA 2PXXA 1HDYA 1AF7A 1DTEA 1J5XA 4WOPA 5LR6A 3AEKA 3FAZA 1VCMA 5BUZA 4AI6A 1E9FA 4X66B 2P6UA 1UJCA 1W88A 4RVNA 2RG1A 2XCQA 3FVQA 3BHNA 2XE8A 2VSXA 3MWDA 3H86A 2ZSFA 3HY6A 2YV3A 5F5XA 4BGUA 3ENZA 2PHZA 5LQDA 3NBUA 3G2JA 2KSQA 2XZOA 2YCBA 3QXHA 1RYYA 1WSAA 3GGCA 1EK2A 2AYXA 2H1VA 4D26A 2AEEA 1FLVA 3NHAA 1L9KA 1EFPA 1M76A 3PCXA 4KQ2A 4DLSA 4BFXA 2FNAA 1PJQA 2QTRA 4XVRA 1FDUA 1E63A 1BW9B 1MHPA 3E3NA 4JHLA 2BKUA 1FSSA 2PR7A 4ND8B 4PZ9A 3TB6A 4OYYA 4XVHA 4RNCA 3BB4A 1PGNA 1IWPB 5MFZA 1N1GA 1NMQA 1SQ5A 5BN5B 4ZEVA 2ZIFA 1UIMA 3AB8A 3EULA 1RBYA 3I64A 3HUFA 3HXTA 2FPLA 4ZIRA 1Z45A 2CWWA 3W1EA 4CQMA 3R7DA 2WLSA 4MYUA 4N01A 5DVZA 1PDVA 4RXUA 8OHMA 1PUIA 3MBKA 3DEZA 3TTTA 2OY0A 3FCYA 1PFYA 1IU9A 3RVSA 2C2MA 2Q4RA 2TRSB 4LZNA 1VP9A 1JAIA 1X1TA 1UXGA 4LRWA 4ENWA 3N1UA 4YJ3F 3B82A 3G8AA 3E3MA 3QPWA 2C7OA 1CY2A 1DIOB 1TO1E 2AHRA 2A30A 2P4UA 3I9JA 3KBBA 3NTVA 4PHCA 5IM5A 4D4KA 1SXJC 1K7EB 1WDLA 3D8SA 3IT1A 2HXSA 4IAOA 2JARA 3N2YA 4PZPA 5CXQA 1BG6A 2I8CA 3ICOA 4HS9A 5AVKA 2OK8A 1QQAA 3PHBE 4Y1RA 1NNEA 3JQ7A 1CVRA 1G8GA 2ATIA 4AQDA 3HGMA 4IIUA 3TL2A 5KZMB 4BV8A 3O3CA 2WDPA 5DW0A 2JGLA 3CRQA 3IDZA 3OPYB 4XWWA 1G6KA 5AYVA 3TRHA 4KGXA 3KNZA 2PD3A 2LBPA 5DX8A 3VR5D 3GLGB 1XCPA 2JFWA 1Z68A 3HB0A 4LWPA 4LQLA 4WACA 2QRLA 5A3SA 1TECE 2ONYA 3IAXA 3EUFA 5TPWB 1GYRA 3IVAA 2FEAA 1IAVA 2C3OA 3THRA 3ENVA 1IN6A 4MWOA 3OLYA 1D2EA 2A7XA 3LZDA 4B2YA 1F1BA 1SD5A 1Y4ZA 3RS2A 4BO2A 3HYSA 3WB0A 3WQRA 4FFRA 4BHTA 2BEVB 3IP5A 3HHEA 3S70A 1MIOA 4Q48A 4KFCA 3C5WP 3A0RB 3U7JA 4BASA 1FDTA 1E6UA 1PDWA 1S02A 3BK7A 3EZXA 3LGSA 2N9UA 3VBCA 3BTUA 3AOEA 1QC5B 1XRQA 10MHA 2IYSA 4TTQA 1PFWA 1VL6A 2FUNB 2ZI3A 4JI6B 3ZPXA 5JHGB 3ZJTA 3AOGA 1X9IA 1DMSA 2F3RA 3GJXC 1E2HA 1A04A 1C5KA 3ABOB 4OA5A 3TEFA 4EPVA 2BPOA 4DR6B 3TFOA 4QQFA 1G1AA 5IBRA 2XMQA 3DTVB 1ACJA 3OPQA 2DQSA 4Q16A 4YV1A 4AY6A 2EWVA 2YVKA 3TIIA 1CR2A 3ON5A 4JL8A 5HILA 2NZXA 4A92A 3QUBA 4C06A 3TXXA 2JIBA 3IODA 1PUXA 2BSAA 2AMJA 5F9FA 2AFRA 4JZKA 4UHFA 4K8RB 1T1EA 4ARIA 5IUKC 2YYZA 4HDSA 2HUNA 2W2QA 3KOUA 1AHPA 3CEMA 1DJLA 1EMDA 3O90A 3ET5A 3SC6A 4U5XA 5T3UA 3FFBA 2DWCA 3TAHA 1NMEA 4OD0A 4QL3A 4KSCA 3GA7A 1BMQA 3FDXA 3OJEA 3AJRA 4MW9A 4BBJA 5DN6D 1EXDA 1WUIS 1R8JA 4ZRNA 3DPIA 5D1NA 4U9UA 4RQTA 3TTYA 4CM5A 3MBIA 3A6FA 4GRIA 1YZGA 1ETHA 4KQ1A 4P98A 2PEYA 4DSAA 3TD2A 4FZ5A 2A92A 4HLQB 5TARA 2ZB7A 2EFGA 5A03A 3MHTA 4L6IA 4M9ZA 2ZSUA 1F2TB 4ZKDA 1LB1B 3I9OA 2W2NA 4Y2VA 5JECA 4LGYA 1ZVQA 4J6FA 3WL6A 2JK1A 4MVCA 4ECEA 1H3EA 4CCWA 2WU8A 4GYYA 4M53A 2VATA 4PPYA 3CX3A 3IP9A 5GIPE 3NHSA 4OI1A 1G8HA 1Y5RA 4Q1DA 5KNCD 3QU5A 1WW2A 1QQTA 4I9HA 3COSA 3D3WA 1GTG1 1H3NA 1LVHA 1XXLA 1YS6A 1YZQA 5ERYA 1K8QA 2H9YA 3K2QA 3OU7A 2XEXA 4RZIA 4UM5A 4BXOB 3Q4GA 1F1JA 1FRQA 3EIUA 3EXEB 4YWJA 3M6FA 1DC6A 1GEEA 3RTCA 2FGJA 4HWOA 3SMVA 1E60A 2I4RA 3HNRA 1R9GA 2JGRA 2WQZA 4PZEA 3AKDA 3VO8A 1E2PA 1M1UA 1RAHA 4P93A 4ZD6A 4K5QA 2GF2A 4MYHA 4AYWA 3KWLA 2X6RA 4GRAA 4D3FA 2E5LB 2E87A 4IJ5A 1WKBA 3OA2A 4NJEA 5IF3A 1CDOA 1VHTA 2Y92A 3T34A 2OCYC 5ECGC 3DOOA 2CBGA 2HPZA 3BWYA 3IPAA 1A9ZA 5AVJA 4D6YA 1O95C 2XGOA 4GR9A 2P8SA 4Y6GB 1XD2A 1A2KC 221PA 3QY9A 2OHHA 2V7GA 5JNRA 3GLFE 3TNYA 1WW3A 4UNNA 1GUDA 1FVXA 1EUDB 1KK0A 1PS8A 2XUIA 1MJHA 1W5AA 4M1QA 1G18A 5DNEA 1R0YA 2PFKA 1JQKA 5AK0A 1E4EA 2QXYA 5LQNA 3M4XA 1UM8A 4HXYA 1FP4A 5JATA 1DRVA 1HL3A 4NPCA 3VZPA 1M2HA 3AM5A 2IYZA 3THSA 1VIYA 4DLBA 4DPMA 2HJRA 4BZZA 5L3RA 3RC3A 1TMGE 1LGYA 2XB6A 3M1YA 1Q2UA 1PTJA 3G79A 2AKAB 2GFIA 4P6VF 4ROTA 3U44A 2CC2A 2ZYVX 3PXAA 3BBPA 3ZBUA 4EDHA 1K7FB 1QIJA 3BGVA 5EI5A 1E2GA 3FCSB 3L0SA 4K3UA 1EG2A 2MSEB 5CD9A 1MOQA 3MFYA 1PK7A 5E3IA 4KBYA 4EYGA 4JBYA 1PT6A 4D9EA 2QLTA 5LP6F 2RGUA 3AFOA 3NBAA 1J25A 5EXXA 1YS7A 5K0BA 4GVPA 3NRBA 2QMYA 1Z8HA 2B5OA 5BURA 5LPNA 3CVUA 3MMNA 4AK9A 4G4SO 1TQ6A 2BTQA 2NU7B 3VC7A 4CV2A 5LYJF 3IYLW 4N7RA 4Q4HB 1E66A 1E2DA 1PN3A 2BHTA 3HJRA 4LHVA 4QAQA 4ALJA 4HNSA 2ZXEA 2BV3A 3EQ9A 1B15A 2VP5A 2Z2KA 3MERA 4FGLA 4MKRA 3AGPA 1PL7A 4GI2A 4W5OA 2UDPA 4G01B 2IYUA 3LUFA 3TB4A 2WUDA 2EP7A 3ZHQA 1JQAA 1N5KA 2LKCA 1U7DA 2OCXA 1EJ6A 4N3NA 1C14A 3AVQA 2NVUB 3INTA 1JDZA 2QENA 4DBZA 5FQOA 1NNSA 3O8DA 4E07A 1EFRA 4DC1A 1EQ2A 2Y1DA 4DTCA 1TEHA 1NJ8A 3L4SO 1A27A 4F21A 5CCXA 2B1JA 3GLQA 4O4IB 1G8MA 4O2BF 1L5NA 1K68A 3A7DA 4NZNA 3QEAZ 1G60A 4AURA 4EF6A 1KRWA 5EYPA 4V03A 2FWMX 4XOUA 4YX9A 4OJTA 3U3XA 2DETA 4HH4A 1LI5A 4QWWA 3IXMA 2PRZA 4R5HA 2MR6A 2FWIA 3DOJA 4K28A 2QX4A 3B7GA 3KDPA 1V8FA 2FZCA 2IIVA 1HXHA 4JI3B 2NVBA 4CTMA 1UDBA 4XRRA 3ZU6A 1OKKA 4AY5A 5KOHB 1HG1A 4KQXA 4C4YA 2PUGA 4BRZA 2AFHA 1V25A 5DTJA 2QNBA 1TZBA 1E62A 1L7MA 2WKRA 3FGPA 2I9PA 1E61A 2NXWA 3EVNA 3BA1A 3D6TB 1M34B 3IAS1 4HGZA 4R8KA 4URZR 2I6QA 3UMRA 2O48X 3PTLA 3F1KA 1E32A 1WUYA 4NONA 5LZ5A 4E13A 1OH8A 1G5IA 3Q6IA 4DMRA 4JEUA 2I6TA 3ELDA 5I5GA 3T5CA 2D7CA 2LKDA 4IJQA 1N5MA 4IUDS 2PKWA 3OTQA 1MV5A 3TDNA 4M8KA 2RHOA 3FTNA 2VF8A 2XD9A 4KX3A 5CG2A 2C2BA 3I62A 1NU6A 3C6MA 3CX8A 2VP4A 1BNCA 3F97A 3PD1A 1XZKA 1KY4A 2I1QA 2ZJ6A 3O1JC 3WG9A 3ZY3A 5EERA 3QYPA 2PVCA 3L0CA 2HB6A 3E15A 1TW2A 3FPBA 2Z09A 3PUXA 4YUXA 1ST2A 2LGJA 1JFTA 3NEJA 3AL0C 1DKLA 5CNKA 3ZTTA 1VLJA 3JU3A 5LYYA 2FETA 2ISSD 3U4IA 4FYHA 3K9BA 1FK8A 1XUOA 3CURA 3JAWB 2Y2UA 3EH2A 1QHHA 1VRCA 1RWBA 1ULAA 4WLOA 3G7SA 4HVAA 1JRLA 5B1EA 1VLLA 3K5PA 4O8ZA 3ROZA 2FWNA 5I5EA 1XA4A 3KL2A 4Y6QA 2RC5A 2GEDA 5EKTA 2FLVA 1JSRA 1PEYA 2ZUDA 2XZDA 3A2MA 4Y0AA 5J47A 4QPZA 1F5NA 2C0PA 3EG9B 5IBCA 2H7CA 3K0FA 4KNWA 4E3ZA 1H0HA 2P7HA 3JQGA 3A4LA 2O05A 3MF4A 3UMMA 2NSJA 1N36B 3OPVA 1CUWA 4D74A 4F9TA 2CBXA 4LRQA 4MGYR 4C87A 2PD6A 4IDEA 5FI5A 3VV3A 5I4BA 2OLEA 3FG9A 1UEIA 1G19A 2WTUA 5KTMA 1ILEA 2QGZA 2REOA 2W43A 3NWJA 4X90A 4A8HA 5JZ9A 4WESA 1EFVB 1WEHA 3AQ4A 5EXPA 5JOQA 3HCDA 2F1IA 2XF8A 1Z63A 3RUPA 2R79A 2AC4A 1TM5E 4EQ6A 4KMMA 3OZGA 4BEJA 1NU8A 4F8EA 4JT9A 1YRLA 1Z37A 1MABB 3C6ZA 2Q9CA 4P86A 4B85A 2QTBA 4REQB 3ZVMA 1JKXA 5JMWA 3OOJA 5DNYB 3GLUA 3ZHXA 3Q8LA 2YOFA 2GFQA 2H1CA 4Q3BA 5A3RA 4KK4A 4LWQA 2B8TA 2DUNA 2PT7A 4QFBA 5DBFA 3M82A 3WGHA 1Q0SA 2AZTA 1YK1A 1EK1A 2AS0A 2GTIA 4LZJA 4ZO7A 4YP6A 1M2VB 1X7ZB 2JJMA 2XYGA 2Z6QA 2WOJA 1OBOA 4JH0A 5L3SA 2R4UA 2QN7A 2QL6A 1WWKA 4TMXA 5D87A 1U3WA 3COYA 1X0XA 3DAYA 3M34A 3VR6H 3BXEA 2IITA 1E1CB 3I2KA 1DIAA 4FJ1A 4IPTA 2R4TA 4K88A 5BT8A 1G66A 3HPRA 2A9VA 3PUZA 4GEKA 4OMCA 4C5AA 4MPDA 3WYEA 4B6GA 3VI4B 1NLFA 1LCIA 2ZXFA 1GR1A 1ZA1A 1FFSA 1NW4A 1PL8A 2O2ZA 3IR7A 3O2NA 5F4ZA 4IYJA 4Q47A 4OXYA 4MJLA 2ALJA 1O9GA 3FNGA 3N8NA 1B14A 1WDWB 5BOSA 2V7EA 2PSFA 5EGNA 3I32A 3GGSA 4D81A 3CZQA 1JEYA 4PGAA 1TJ4A 3PNSA 4UAJA 2FI1A 3BIXA 4Y6PA 1N2GA 4PCAA 2FV8A 2ZIVB 2OB1A 1K97A 4JJ4A 2ZAIA 3L0OA 3VOAA 1N3YA 3QUSA 4GZMA 2J5BA 2FXIA 3FFTA 3M9WA 4K87A 4Q9AA 4YMSA 1T3TA 1BH6A 2FMHA 1F51E 2J0VA 2JIPA 5D7BA 3DBLA 1ZN8A 3AVVA 3H84A 3BT7A 2ZANA 3COJA 1FDRA 1N9KA 1G8KA 1RAEA 1W85A 4OXNA 1N0IA 4ZVMA 4XCQA 3UV3A 4OP1A 5AJHA 2I2WA 3I05A 3H5RA 4BMCA 3V48A 4PRZA 2HRQA 2DH5A 2BFCB 2P3SA 3O7WA 4RPHA 5G53C 1GAXA 2PWBA 2OWEA 3I9MA 3G23A 2AQIA 2FJ0A 5IJ0B 4TWRA 5JSUA 5TQ0A 5GZ1A 3KR1A 4NABA 4OHMA 2IP1A 1EM6A 4R31A 3IBFA 1KDYA 3CRRA 3FTDA 3SZRA 4QFMA 3KQNA 4M1SA 4XH9B 1ECGA 4FBMA 3KTAA 2P2SA 2H5EA 4QDZA 4ID9A 3S68A 4K6OA 3ESBA 3P9NA 5L4LA 3FLEA 4M76B 3ZW9A 1EFDN 3AHCA 2J9YB 2Q6VA 4LJSA 5KDDA 4UDNA 1JXAA 1JSCA 4URFA 1CJVC 2XH8A 2DPHA 2SCUA 4W1QA 4Y6LA 4D4IA 5KYXB 2HPVA 3DAFA 1QIKA 3DVSX 3KEQA 4HN2A 3NBQA 4IKEA 3VZBA 4CM8A 2CEKA 2XUDA 3KOYA 2QY6A 1SCKA 4B4OA 5I3CA 2R4QA 3TMKA 1G9SA 2C8LA 3H1GA 1LQ2A 4J7AA 1SCJA 2RI0A 1FMTA 3PGJA 4X7BA 5E1OA 2PZ8A 4G0ZA 4DV7B 3V1NA 2HDNB 4O5AA 1A9YA 3A1FA 4LJ8A 5FOSA 2H18A 2CVQA 2JBHA 2QN6A 1N32B 5E6SB 4AZ0A 4OFXA 4EB8A 1NVWQ 2GNPA 2NXNA 4HH1A 4X3OA 3Q0EA 1ZL2A 2QTVA 1P74A 3BIJA 4FGUA 1I4OA 3UICA 1V16A 3I9FA 4KAFA 3B9PA 2DKFA 3GX1A 4J6EA 4LNUA 4I50F 3IJ5A 1PGQA 3O5AA 1CF9A 4JROA 3WQQA 2PG3A 3OLQA 4F5WA 1LBEA 4CCYA 2P2NA 3QVKA 1ZK3A 4CXMA 1Q1AA 3FNEA 5LDDC 4KDFA 2GYVA 4KPFC 2UYGA 2P79A 1L7PA 2R7KA 1P60A 1FLDA 1M8JA 3GP8A 3UJ6A 4TYPA 1K6XA 4J07A 4KX5A 2LCQA 1Y8QA 1IZYA 4OHFA 3HACA 3C6YA 3CKLA 2DU8A 1M33A 3QW2A 2FZWA 3WGJA 3KJEA 2X1VA 1J2JA 2V0NA 1CJMA 1T6ZA 1SCUB 5DTRA 3TRFA 3ONFA 5JANA 1JYSA 3E1KA 2C5AA 4HYTA 1SKBA 2GZRA 3L8GA 5K3EA 3QENA 3PGMA 4LQ4A 1ISHA 1FOEB 2QM7A 3ZU4A 3M5WA 1MJNA 4DUGD 4R01A 3ETGA 5KYGA 3OO0A 3AH8A 4WINA 5ITVA 1DG3A 1RPNA 3W5BA 1PJ4A 3Q5EA 3PGVA 4NMLA 3E9EA 4QDUA 1OLXB 1VBFA 1AMUA 2Y1XA 3PEWA 1T0UA 2ZAMA 3M6UA 2F9FA 3QLUA 3S6JA 3WP0A 4M87A 3JQ9C 1DXHA 4QM7A 4PU0A 4NU5A 2VS1A 1UMDB 1GDTA 2BLLA 2XVXA 4JJEA 3D43A 4NULA 1EFAA 2LUOA 4O4LA 2P9ZA 1YIOA 4FIDA 4UVDA 1Y1SA 5JNUA 1CQIB 1P2GA 2NQTA 2WT4A 2EDAA 5G0SA 1F14A 1EG7A 1XCJA 4BMYA 1ID8A 2H2GA 4UU7A 1T3LA 4QX6A 2ZSBA 7ABPA 4ZXFA 4DNPA 1NE7A 5F4BA 4A23A 1W4BA 3GFQA 4QG7A 4DMCA 4EY7A 3CRMA 3G0OA 4WOJA 1NTRA 2PY6A 2ZUFA 1KO1A 4X64B 4X6LA 3EQ8A 2HQBA 1JFVA 1RQ2A 1P9LA 3KT3A 3QKWA 4G0YA 4C6HA 1JT9A 2Q3EA 2QX8A 4I81A 4LAFA 3VZSA 3TUZC 4NYIR 1GGJA 4RXTA 3P9KA 4C0KA 4J0GA 2R3SA 5GVSA 4FC7A 3VR3A 3AJDA 3SJZA 1DAFA 1EU1A 4C6RA 1EVZA 2GEVA 3INNA 4GQBA 4BIMA 4MGKR 5DI3A 4Y1FA 4LNHA 2I3GA 3T0IA 4F7DA 3AETB 3W4IA 3N9IA 3I6IA 5B6IA 5EHZA 2GEUA 4ZAVA 4ZTBA 2REXB 1JKJA 3FIUA 3DMRA 4HY3A 5FFNA 5AVUA 4ZQBA 4BZXA 2FY8A 5JCOC 5BYBA 3PUKA 4Y6SA 3KYDA 5CK5A 4WNAA 1P2SA 5EWMA 1G7CA 2X9VA 2Q3DA 5EQTA 1Z7BA 4E14A 2G7ZA 3BF8A 4ZT5A 1AH2A 1SKQA 1SXPA 1BIFA 4FE4A 4ER7A 1UXHA 4YYEA 2R8YA 4K1LA 1GAJA 3B6IA 4V39A 2WPDD 1S8FA 3BM5A 5CVJA 2IRWA 5F7XA 2C4UA 2DAPA 2JLBA 3ZHYA 2ZYIA 4TMWA 2FUEA 5KNBH 1SNYA 2Y1GA 3IQZA 4FLFA 3EZLA 2Z5LA 2C83A 3AKCA 1I51A 4M37A 4MWBA 4YREA 3AFNA 4CMKA 1ISGA 4RGYA 1P91A 3GEBA 2JLCA 1CD5A 2IYOA 2VKQA 4K2AA 3W4KA 4B43A 2BKAA 2VZ8A 2LWIA 3GEEA 4O4JF 2E37A 4I2VA 4YUAA 1XTUA 1QOQB 3QUQA 1AJEA 4RK1A 2O19A 1SVSA 3SD7A 2ODPA 3CGGA 1C9EA 3L2OB 4PVDA 3QNMA 1UOQA 3GRVA 2P4HX 2IYLD 2ZM6B 2QT9A 2PCLA 1NMYA 4QECA 3LZ6A 1G9TA 3AF3A 2HJVA 1RZ3A 1Z82A 1OTXA 3T95A 1GFSA 1A9SA 2R1TB 2FOLA 5AVVA 2Z4TA 1IUNA 1W2WB 2G76A 4HDKB 1NFQA 3V4PB 3I2YX 3WKEA 5ETJA 2FF5A 3ZJYA 2CMKA 1NKSA 4O1IA 1C0PA 1YAHA 5KVAA 2J5XA 2FPGB 2VYCA 4KGVA 2VRCA 3BREA 2CSUA 3EXG2 4TTSA 2DQYA 2AOUA 1GCOA 2XA9A 3L4BC 3BFVA 3OCCA 3UXMA 5LM3A 2BFEB 4CQNA 4NH0A 4EHFA 3OCUA 2CLMB 4XJVA 4BOYA 5LNK6 2XTAA 1M2KA 3WC4A 4DA4A 4FGJA 1U5CA 4MYDA 1L5LA 4DV1B 2PZMA 3DBVO 4BVJA 5INTA 2QXTA 1Q1NA 2VXYA 1IUKA 1XJCA 2VWQA 4HZGA 4LRXA 1SOWA 5KB3A 1V1MB 1VE3A 4I46A 5KSZA 1I5EA 2OO5C 4YMHA 5E6RA 4TV9B 1PHRA 4S2EA 1T9CA 1U2EA 1Z28A 2QGNA 1SHUX 4BQFA 4O33A 1IXKA 1M10A 1PJTA 2QJRA 4LVNA 2P62A 3R7BA 1J2UA 2G0NA 3NHWA 2D06A 3T12A 3TZ6A 3UXYA 4PYLA 2BGKA 3L7OA 4UE6A 1RXCA 1WBBA 2P65A 3TUJC 1YFLA 3NNSA 3HWRA 1OW3B 2A6PA 2FWBA 3OF3A 4E2FA 4J0QA 2NO7A 4ND8A 1OGIA 1QMGA 1YZVA 3EZFA 4EI8A 1VIDA 5IANA 1KYTA 5BN5A 3RSFA 1ADCA 3D8HA 4IXTA 1PD1A 1RP1A 4R2IA 1YFKA 3U60B 3R0VA 3V8BA 1F8GA 3GFFA 2YDYA 3AVYA 2HFKA 1WR8A 5F98A 2GCOB 4KQEA 5E95A 2FSUA 4NJOA 2X23A 5HMMA 2VUIB 2AEFA 5JFTA 4AKIA 1RMYA 2CUNA 1G8FA 3WB1A 5KTRA 1FC0A 5HTKA 3WV5A 1RFGE 2DM6A 2C2YA 2HRRA 3LPNA 3SICE 4L3OA 5NLLA 1R66A 2H1WA 4IIDA 1RLOA 2PZKA 4QYSA 3OECA 4LOHA 3LLSA 3TMAA 1DDGA 1W2HA 1U2QA 1WXHA 2H4FA 2KBEA 1JHAA 2VRBA 3OP1A 3SOZA 3TTWA 1UINA 1QYRA 4JOBA 3QKRB 1SOMA 2Y66A 3B5EA 4BBZA 4D8WA 3ZCXA 4MZDA 1UK8A 4TSFA 1IHXA 3UBMA 3QA9A 5IBPA 4I1IA 3ZXYA 5C1PA 4BY9E 1VQ1A 4I99A 3RK4A 3UMGA 3AESA 4WADA 3LC1O 5T41A 2ES4A 2YIVX 5DK4A 5E4JA 5F9MA 4PO1A 1YJXA 5K3SA 3RU3A 5BWLA 2PYDA 4KZKA 5D7NA 5BQFA 3HCAA 2EZ4A 2EIXA 4JLBA 2JATA 4UOQA 3QXCA 1Z8NA 4CW7A 4RKWA 2ZI5A 2VXOA 1DC8A 4GKKB 3A9RA 2VIIA 4N8SA 1RHQA 1HDIA 5CDSA 1UJ6A 4AF6A 4CLDA 1SZCA 1THGA 2BEVA 2CL6X 1Q7BA 2X76A 3G6KA 4J0EA 1EVIA 3LAWA 3NWPA 3GLKA 3TQRA 3GIDA 5ECWA 4BNUA 1NVVR 4ND1A 1NQ5A 1RJEA 2JH3A 4AW9A 1NF8A 3IPYA 1IUOA 1QC5A 1E3LA 2EQ5A 3NV7A 1P17A 1U3CA 5EJ9A 4BFCA 2AFIB 4A9AA 2ZRDA 3A06A 4P83A 5IN5A 1G8AA 5K0TA 3L4KA 1Z2EA 3QBVA 3ROQA 2BFAA 3TZQA 4M0UA 5TVKA 3VR0A 1ZAYA 2QVBA 1C8BA 4UZFA 5D1HA 5BVGA 4Q66C 3FPSA 4NIMA 4ATNA 2HCFA 3I2GA 2IP4A 3DTVA 3DDWA 4P5PA 1E8NA 1PJZA 3FSGD 2YV1A 3OFKA 1YB1A 3WMGA 5KYKA 1AMOA 3RGGA 4UM9B 2AGVA 3MCUA 3WHKA 4RFLA 4C0XA 1YRQA 2R2GA 4PXYA 2D5LA 3AL2A 3RVDA 1H1TA 3FPKA 3TLZA 2AJ8A 1C7IA 3ZIUA 2CXQA 2EWMA 4MRAA 3SXUB 4I4LA 1KVQA 2FFHA 3GB9A 3KQYA 2DERA 4PCUA 1QRTA 1ANKA 4WY8A 3KSAC 1Z0AA 1QAOA 4FMDF 4TXMA 1PSZA 3AF0A 1GQOA 1ZGCA 2QMQA 3P0HA 4PFJA 4L5BA 2CWDA 2V0CA 4R2MA 4HUQB 2FJPA 2NZ8A 5G4KA 4HUTA 2FZVA 2IEBA 2X7HA 2AD1A 5IP5A 1SCBA 2WSSA 4JEIA 3TW8A 4FFNA 3LX8A 1GNQA 1SEVA 3PXUA 2QE7A 3V2HA 5A4IS 3S1AB 3JQPA 4U6QA 3H1PA 2C3PA 2Y1EA 3RKSA 5IKPA 4MVJD 5G1PA 5IM4F 1KI8A 1QE0A 1Z47A 4NBLA 4MB2A 1F2TA 4KIGA 3FHTA 1D2AA 1F2VA 2PV0A 4JLJA 2R6R1 4N0PA 2ZRKA 1MEJA 4HXEB 1RWNA 3R8CA 5FNVF 4LJAA 4I08A 1E1RA 5H9VA 4XX1A 2A4MA 3Q3HA 1QPBA 3G2LA 4OBBA 1DAGA 3HC7A 4J76A 4EL5A 3SIXA 4HDMB 5L6MB 3ZJVA 1NW7A 4G9EA 1UAAA 1LQUA 1L6RA 5AHKA 3TYXA 1ZUWA 5DX1A 3FKQA 5E2BA 4DL9A 3DLHA 3HVJA 2WJ3A 3BUSA 4B2LA 1PAUA 3PK0A 1M6VB 4MYCA 3OF2A 3DT8A 4I5DA 1S2NA 4LI0A 4BKUA 3VR6A 3SQXA 2OCLA 5IVDA 2WJHA 1ZL0A 3AM3A 1JI0A 2B5VA 4PLVA 8MHTA 1GY8A 1X8XA 2OGZA 2P4EA 3G2OA 4QBGB 1XE3A 4YY3B 2ZU6A 1H2BA 1YR9A 5EP3A 4KO1S 3NKFA 1JJVA 3MJVA 3F47A 3A3PA 2XZTA 4FU0A 4IEFB 3DGFC 4KBFA 2H51A 1QXSA 5JWRA 3HNPA 3RS9A 2R68A 3DAHA 3ZDEA 5F21A 1KXZA 1ZMBA 4W1SA 4ZN6A 4JV5B 1T9GS 1ZJYA 1IZ7A 1R0KA 2IPXA 3CLRC 3HEMA 4IGFA 4PO9A 1Q0QA 5CK4A 2A5YB 1XV5A 4K9NA 4C78A 1MZPA 3U61B 4EHIA 1UKAA 5H68A 2B78A 3I1JA 2XWPA 2HDHA 3NBYC 2WJPA 4P9NA 2D0PB 2HNBA 1ZD2P 3HDTA 4OU5A 5HUQA 1YCFA 2YTZA 2RGAA 4G65A 3DW3X 2Z3ZA 5GTDA 3ETJA 1RM5A 4IVPA 1WSBA 3KQMA 2RCNA 3JZFA 4MWTA 1P1KA 2G82A 4Q12A 4WDQA 3TBHA 3ER9A 1X8KA 3LCMA 3ZNPA 4PC6A 2PS3A 3GF4A 4DQKA 2XNDA 4A2CA 3FLBA 5DLQC 4JLVA 4DNOA 5EPEA 1FMJA 4GM0A 2GAFA 1JKFA 1Y4SA 4X8LA 1FFXA 2W42A 1SMKA 4PINA 1MT0A 2HA5A 2WUEA 2A5LA 2MINA 4NZYA 4UATA 4YH1A 2ZBUA 2HCBA 1D2RA 1E1QA 2C99A 3GRAA 3HHPA 1MORA 1WZ2A 2NU7A 5JD6A 3RAJA 4X6UA 1FX1A 2OHJA 2JCSA 2Z56A 3VU8A 1DGQA 5AM5A 4Q4HA 1OH5A 2W70A 2J5QA 4YHHB 4R0MA 1N78A 4GICA 4ALLA 1N33B 3C7CB 2HWWA 2JIZD 1KYIA 2ZRQA 5C34B 4QA9A 4YMIA 2FRDA 3CPSA 2XADA 1KZ6A 5A7FA 2D2IA 1AQUA 1YUNA 2LXNA 4X97A 3E3AA 3PB3A 3HO6A 1P7VA 4AAYA 1SUCA 5IJAA 4NPHA 2NVUA 3R3ZA 2JBAB 1I2AA 2EQAA 1UBUS 2OFFA 2DSTA 4UNIA 2F8LA 5JSKA 2QRJA 1VCHA 3H5WA 1I3NA 4NFYA 3U80A 2P6RA 1WMEA 1PO7A 1K6JA 4O4IA 4P3KA 3Q15C 4H08A 4CPDA 4WOBA 2QL7A 4ZVLA 2B35A 1NLZA 4QNMA 1GZ4A 2I6GA 2HJ9A 2X9LA 3B5JA 3KFXA 1QWOA 4QUIA 3UGQA 4D79A 3P19A 1T0JB 4FOLA 3CLVA 2F43B 1T8UA 3CLKA 4X6YA 3R24A 1CF4A 2JD2A 4OX9B 2ZJZA 4YJ3B 2JFZA 4DXHA 2QJTA 1LX6A 1GQRA 4QRDA 1G1MA 2QYOA 3F6SA 1FXWF 1TADA 4DPLA 3ROXA 4LCEA 3OE7A 1P7ZA 5KOHA 4P08A 3WAKA 4FHDA 3M6WA 3DB2A 4GVLA 5U4XA 3RASA 2I66A 3MJHA 4X54A 1P3DA 4EW3A 4G5OA 2WJWA 2FOXA 1M34A 3EUEA 4WT7A 5CPBA 2YOGA 4FS8A 2PBZA 2H2WA 3OZIA 4RF2A 1NLYA 4PPFA 1GCUA 3W34A 3GGOA 1DEHA 1XI2A 2GX6A 4HFNA 1D4ZA 3EISA 4X85A 3SMQA 1WY5A 3IT2A 5FX2A 4QO8A 4J94A 4FJ2A 4YI5A 4LQDA 4MR9B 4P3NA 1BGVA 1QGYA 4FN4A 5ILOA 2FSSA 2B4AA 5DYIA 4TQUS 4A36A 2C97A 3PCTA 3WLIA 2H7XA 2X2FA 3ROGA 4PSDA 2EFHB 3IOEA 4UC0A 4G4GA 3LKDA 3AWIA 1BCSB 1LNZA 2E5WA 5BN3B 2PH7A 3X1WA 4XM1A 3A1DA 2O0MA 5A2QA 3DLBA 4P5EA 4PO8A 4E15A 7REQA 5EQJB 2BN4A 1T5TA 3JAWA 2VCEA 4G89A 5BUSA 2G4LA 4QPNA 2C5EA 3N2EA 1IY8A 1FSFA 1RQGA 2GRAA 1Z4KA 2ZWIA 1N0WA 2ZG6A 3TG8A 1AO3A 1TK3A 1LZKA 2VZ9A 4QEDA 5DH9A 5FUYA 1WQ4A 2O9JA 3VYUB 3KYCB 1YZFA 3QY0A 3VTAA 4ARZB 4BMOB 4AN0A 3V33A 2EGGA 1VYVA 2CZCA 5KJCA 2WU0A 1EWQA 2FE1A 3IKLA 1RPJA 3JWIA 3BAZA 3RFUA 5M2QA 4ZGBA 3P2JA 1JPJA 4P92A 3K05A 4NCXA 1PR5A 3TX6A 2JFBA 2YHSA 1J97A 2ODNA 2IYFA 3IMFA 4MMXB 4OHRA 5CFQA 3PZBA 2IS4A 5J4VA 5JNVA 3HKEA 4NMXB 2IHUA 1IOZA 4IINA 4TLBA 1VKRA 4AKEA 4UBNA 5KYYB 1FIUA 1PW7A 1QTIA 3FW1A 3HJCA 4GOKA 4B09A 1N2JA 4WCFB 2YNMD 1Z0IA 3QMMA 1H2AS 1PLKA 3W5UA 3KR2A 3QU7A 2AMVA 2DPLA 1MB0A 1MABA 1YOBA 5JEDA 2C42A 3HADA 3LP6A 4REQA 1GCAA 1EWKA 4UTXA 1JIIA 4OKNA 4ZQCB 3F90A 4LDRA 3UKJA 4DYDA 4BZQA 1T2UA 3JQFC 5DB4A 1P33A 2NMVA 3U4QA 2Z3WA 4Q1EA 3KJHA 3JQ6A 3DE6X 4H60A 3RTGA 4R2XA 1P7WA 1KDZA 3SC3A 2GPTA 5JO9A 1YKGA 2GBLC 4DWWA 1N2BA 2RHDA 3UT6A 2OCDA 4RY2A 3ADDA 2CLHB 1M2VA 1I0IA 1X7ZA 4DM7A 5LQJA 2OE2A 2HSDA 1E1YA 1NDUA 4XD7D 2J6IA 4KPUB 2HF2A 2BY4A 5C81A 1XCBA 2COEA 4IGIA 1Z06A 2A0UA 2I3DA 2WHRA 4MR7A 3STYA 5EZQA 3HEAA 3N59A 2ZYUX 1T3ZA 2VFAA 4PR3A 1E79A 1QHEA 2NN3C 3WNVA 4KAAA 3N2KB 3OESA 4P2BA 3RRZA 5KNBA 4IUCS 3SDBA 5KWEA 1QO0D 4NNPA 1QB8A 3ZLJA 1XZNA 1SU4A 2W90A 3H3FA 3L3BA 3Q0TA 1J06A 3U9SA 4CKBA 1JLSA 1MRNA 4MKIA 4RVOA 1AKNA 3RB8A 3MLEA 3T3OA 4FYMA 4BX8A 4HYQA 3D4LA 3ITKA 2ZJ7A 1WB6A 3U13A 2P8JA 3ZYCA 1JR3A 3TJMA 3VR2D 5KDLA 1OVMA 5HIKA 3I3OA 1HT0A 4ENTA 1U6KA 1U80A 1AKQA 1PS9A 3WVNA 5I4KA 4HPXB 4BJ1A 1XU4A 2FZ5A 2SNIE 1GQQA 5DGDA 2IUEA 2H6EA 3EVAA 4FINA 3KETA 1RDFA 2IDMA 1F4LA 4HWPA 1VKNA 1E7SA 2XVZA 4KB5A 1IBKB 2JLWA 1A5BB 4JBLA 1THTA 3GFPA 3SF8B 3ZBTA 4CCAA 1D2NA 1ZCAA 4GI7A 1UXJA 2QI9C 4MMYB 4ZAGA 4B3JA 4N3AA 3ORRA 5JG7A 1CEYA 2DC1A 2OWDA 4D3DA 1XVLA 2BFCA 5CX1B 5B6PA 1PJ8A 1T6BY 3EXHC 1KU6A 4L08A 3TOVA 3VPFA 5IHPA 3H4IA 3OURA 1YVRA 3VNSA 3HU5A 3RIYA 1Q22A 3EAFA 2R8BA 1QIIA 2EJVA 3U9TA 2GR9A 5AVSA 1A8SA 2WWTA 4QE3A 2AXQA 3ZZ1A 5LP6B 5LJIA 3DMDA 3RODA 2IZ5A 4E33A 5K6AA 1PF7E 2IIBA 1OZHA 3DMGA 3JD0A 1WVMA 1B6SA 1UBFA 2XD4A 5IJ9B 5KYXA 2JLYA 2QTFA 1CQPA 1UMCA 2B2CA 1OZ0A 1OXBB 1U7WA 2JH8A 4G6ZA 1U2DC 4I6JA 4URYR 5FI1B 5LYJB 4W5QA 4GSLA 2KYRA 3N2IA 4QBTA 3KZMA 3TAXA 1GN9A 1XVIA 2Q0SA 2FSGA 3NRCA 1SUAA 3NHFA 3MD0A 4PQYA 1S9DA 1NAIA 2RI6A 2WHQA 1JUDA 1ZCZA 4O2RA 1Z74A 5A05A 3CN9A 4UUNA 1IJFA 4DR5B 4EUEA 1QPZA 1TTHA 2AOVA 1LQTA 1W581 1A9XB 1M5UA 4FR5A 4HXFB 3TZEA 1PT7A 2BJHA 3K0BA 1G0NA 2WZBA 1XZGA 3LL7A 1QVAA 4KWHA 3V4FA 1HKHA 3HJAA 3QSGA 4LYAA 4AECA 4K9RA 1G5QA 2NAFA 4FUTA 3B85A 3FVTA 4XQCA 2OR3A 1V8ZA 1YRYE 4O2BB 5LU9A 2ZB2A 1W75A 1JEQA 1V47A 5I9LA 2BF4A 1VSQA 3BDAA 5CVVA 3B2NA 5BRAA 1NI4A 3Q41A 2Z6AA 3DH0A 3PDIB 3G89A 2PYZA 3DJYA 4I7EA 4NC9A 3VH2A 4EKEA 2Q4EA 1IQ0A 1P4SA 1EFRD 2VLBA 3M6LA 4OQMA 3PD0A 3KUUA 4FW8A 1RZRA 4M98A 4C0AC 2LDBA 1RQ7A 2J6BA 4KWEA 4N1AA 3MJ4A 3RARA 4BVAA 4YP5A 4ZVRA 1AE1A 1Q83A 4J0HA 3JRWA 2P0AA 4JVLA 4NR0A 2FA9A 1NSYA 4OUDB 5F23A 1B0UA 4XUDA 3W1VA 3GFBA 3P0FA 4KN8A 4R41A 4DSTA 3RROA 3I52A 1AURA 4KXUA 2ZDGA 1W6RA 1QRUA 1W5SA 4DMLA 1TTTA 1Z4MA 1Z8DA 4AMYA 2ZUEA 2V6FA 1E6CA 3OE1A 2E0IA 3TQIA 4QKQA 1GPH1 4P4GA 2ZZKA 4RNDB 1V3VA 2VLIA 1I0ZA 2P0EA 2YRXA 3QOFA 1OLXA 2JI7A 2WBLC 4WY5A 2AJBA 3BYZA 4GL2A 1MVOA 1JHDA 4RJIA 2GZMA 4Y3UA 3QVGB 1NXPA 1FNNA 2QAGA 3GLFA 3I1FA 4K05A 3V2IA 3OE5A 2HQSA 1W36D 4JNCA 1L4BA 2OGTA 1JZQA 3MM4A 4Z5XA 2K2QB 1PNQA 4AKSA 1ZNZA 2H2HA 3WNBA 5KPJA 3DEYX 4P5DA 1GGFA 4JLDA 3TMYA 4IG9A 2IU0A 1Y7PA 2BGJA 1X1QA 3R2JA 4RMJA 4D99A 1J23A 1OBFO 4XW2A 3VBEA 3DFFA 3OD1A 4GC9A 1R6BX 1RWVA 2XV1A 3FJYA 3U81A 1S3IA 4CM7A 1DT5A 4Q24A 1B8VA 4EDFA 4ND4A 4DS3A 1JWLA 4M36A 1OI7A 1X94A 2G80A 4OBEA 1ENPA 5GV7A 1UAGA 1ZC4A 2MSNA 1RW4A 1S9HA 3LWBA 1QORA 4E4YA 1FDSA 4FCVA 2V98A 1P1IA 1J7KA 1ZD5A 2EL9A 4XWOA 3R6GA 3AETA 1DX6A 1L7OA 1LX7A 2EX1A 2Q5CA 3EVFA 4RELA 2E1PA 2IOFA 1QTQA 2XB2A 3A26A 4JYPA 4EHLA 4ZYTA 3HLTA 1XXHE 1WCV1 1ZQ1A 2XEDA 2Z9DA 1JGTA 3WMFA 1Q3KA 3WKCA 4RU1A 2I6XA 3DWEX 4FMPA 3C43A 1GTVA 3W7BA 5CYFA 4H15A 4X92A 2GCEA 2RK4A 4II2A 1DIGA 4D97A 2XBMA 1SB8A 3RRJA 2FZEA 1SR8A 3ZKWA 2OYRA 1E5XA 1T6YA 2W00A 4MH0R 1PCXA 2G06A 3FWZA 2X13A 2JCYA 2O1WA 2HWYA 2IYWA 3EXIA 4Q9HA 4EI9A 3PGA1 2WQ6A 2X4DA 4RY8A 3ZQJA 5ALZA 3OICA 3SLRA 4JQSA 4L72A 1ELOA 1MOPA 4YLEA 3W6PA 2EU8A 4ZO8A 2HN9A 3FZYA 3ZD7A 4EY5A 4ZGGA 4MNTA 5ISMA 1EA7A 1KBOA 2PUHA 3HJFA 1ZUIA 1N2HA 3ZE6A 1TTQB 4L3VA 1Z0FA 4QXMA 4NOLA 4BJ3A 3PXCX 4KWCA 1CDZA 5JDIC 4E32A 4GPD1 4U63A 2V7WA 1W2GA 1VB5A 5IABA 2R48A 1MJ5A 1WHTB 1F4PA 3ZHZA 1E6EA 4C05A 5E6UA 3TS1A 3LFUA 3WGQA 4HN9A 1U81A 5FIUA 3EPJA 4I9UA 1D09A 4GRDA 1IM8A 4RJJA 3MJTA 4I55A 2EJUA 4K9MA 3M3DA 5C5CA 2C3YA 1T8RA 3TRJA 2F4NA 3BSFA 1G5TA 3NS7A 4BAUA 4JI7B 5FORA 1XZIA 1ZWLA 4HLDA 4LSMA 3V55A 4D8UA 2XYHA 1ZC3A 3KWJA 3RHTA 4PYJA 4ZOQI 1O5IA 5C7IO 1V48A 3OZWA 4IX9A 1NBEA 4WZBE 3DKPA 3ENNA 1XYYA 4H35A 1IQPA 1VSTA 2YDXA 5AJXA 3TTVA 2R1TA 1ISSA 2HKIA 3VTKA 3SIPA 5EUCA 3N3AC 3OZVA 2YWDA 4GIBA 2UYYA 1ZGBA 2PKQP 4WJZA 1O97D 3BIWA 5BV0A 4YACA 3I5XA 2FPGA 1A8HA 2OBLA 2F1JA 4QGAA 4A0HA 1AGRA 2BFEA 1T9KA 3CZRA 4F46A 2R8XA 3NO4A 3ZV7A 1DWUA 3U6KA 2PXCA 1ZNXA 2Z5FA 2BHNA 1XLTA 4LYJA 2IZZA 4Q3AA 4YRTA 1JG7A 3QLVA 3WHLA 2UUAB 4F1JA 2CV0A 3CZAA 4KXMA 1DEOA 3K0CA 2FEOA 3NIDB 5L3QB 3D3QA 5J2UF 4CTOA 4L5YA 1FNSA 1XQWA 1V1MA 2VOJA 2IHZA 3EJWA 1T1SA 3MINB 1GU1A 4IIJF 3ZCRA 1Z3IX 1FCJA 1ECLA 2OV2A 3IHLA 1NRXA 3MPOA 4TV9A 5EHQA 5EKXA 1XFDA 3LU1A 5FBLB 4AL4A 2WAOA 2ZTLA 3C2QA 5CFNA 3FRJA 1UH5A 3B20A 3KXDA 3HXPA 4C4OA 2GWRA 3LUAA 1D2GA 1SBZA 2GT1A 2JDID 3KIPA 1MG5A 5ALGA 1RMQA 2PSHA 1M8PA 3R0ZA 1R4ZA 1A71A 3KZKA 4YT8A 3EMKA 3M5CA 2X8AA 3LBNA 3SVTA 3L1IA 2BR3A 4JA2A 3ETLA 4PRYA 3L6BA 4H6XA 2E4XA 2JLAA 4G84A 3FLAA 3G88A 4QPDA 2BONA 1TKRA 3EFHA 1C9DB 2WZCA 3T4XA 3QBJA 5JDCA 1JPVA 1TM4E 2WFLB 1EQAA 3R3VA 4HLCA 4R7ZA 1KFJB 3QVJA 2EJTA 1SHZA 2GYWA 2GCOA 2K2WA 3QV1A 3E9CA 3IEIA 1QYWA 2C95A 1I7PA 1Z0JA 4LHZA 5DYYA 2Q2OA 2ZVQX 2X1HA 4G9GA 2WA2A 5I7RA 1KKLA 2O0KA 3H83A 1NVFA 4FX2A 5IWCA 2Z1NA 3ANTA 2ZJ3A 3F6PA 3HBAA 4Z49A 1AQJA 3NW9A 3EQ6A 2Z58A 1LU9A 1Y5MA 1NY5A 4I50B 3NB0A 3MJSA 1ICIA 1HYHA 4WLFA 3SBDA 1ISIA 1JG3A 2FP3A 1Z7GA 2VDWB 3A8TA 1GPYA 3D2BA 3DOFA 3NOQA 4HRYA 2WOOA 3QKRA 4RSHA 5TEWA 3AFHA 3GUHA 3R5KA 5CXUA 1OWLA 3EFEA 3PRHA 2P78A 4ZARA 5DBHX 4RPLA 1M6WA 1MPTA 1N2XA 5CT8A 1R8QA 2NUPB 1N3LA 2H06A 3FGZA 1R15A 5HHTA 1E2BA 1NTOA 3WGKA 1PK9A 1MNQA 1P1CA 1YVEI 2G07A 4CKYA 3ECAA 3KRTA 3TOXA 5IKOA 3ESXA 2WHEA 1SUIA 5IAKA 1V1JA 2VR1A 4DNFA 3K71B 3ETNA 3NIFB 4GQIA 2BGRA 3ZDDA 1KPIA 5TS2A 4IKPA 4ESOA 2PPVA 521PA 3HKDB 3H2HA 2CNLA 5CYOA 2Z30A 2IYVA 2CBZA 5LL6P 2RE8A 4N18A 3Q7SA 2ZUVA 3FJOA 4HN4B 4QDXA 5FPPA 3WIVA 4PG8A 1UJNA 1XIVA 2X0IA 3OZUA 2I1LA 1M2JA 2OTCA 1Y5IA 4Q0MA 2AOXA 1ZNQO 1HO3A 1CFZA 1U8FO 2BRUA 5COBA 1QZTA 2ZE5A 3PPXA 2ZS7A 4WZAE 2X8WA 4WX2B 4BJ5A 3B6KA 4RAQA 1EFKA 4KLAA 1MUUA 3H4MA 1YWGO 1MHTA 1A8PA 4WN3A 5FOVA 3CQ9A 5TMDA 4GZLA 2RGNA 4H7IA 3DDUA 3ABQB 4KUHA 4UW9A 4R51A 1D0VA 4UEJA 5IF9A 4AS3A 4INAA 2R7MA 3NDBB 1H8HA 4V0ME 4PYKA 3THWB 4F4IA 5EIXA 3O0DA 5MN6A 4FN5A 4CCSA 4BUCA 4R7TA 2QOEA 5EEGA 1O6FA 1DV2A 1Z5GA 3ENQA 4DCSA 5HW0A 2VTDA 3A10A 3F6RA 3WHIA 2ZIWB 1ES9A 4PG6A 4ODIA 3SXUA 1RQNA 1RRKA 3SE7A 2W4IA 1LBSA 3G0IA 4XIFA 5FBHA 5F52A 2Q7XA 3GFVA 3GJSA 2UUBB 3QYAA 2W6OA 4HLNA 2VAVA 2GD6A 1Y6GA 4YMWA 1JHVA 1MP0A 2I7TA 3C6XA 4HUQA 5CEEA 1VFPA 1TMKA 3A1UA 4PRLA 2BTOA 2DR0A 3FNIA 4QUHA 2QY9A 4Z7OB 5JQGA 3PENA 1OREA 2PRSA 3X2EA 2DFVA 4PR0A 4S0XA 5ALQA 4BQOA 3CX4A 3IKVA 1ORHA 1JSXA 1ULZA 2C4WA 2IYEA 3DUFB 3JWGA 4PCLA 4U7HA 4TVOA 3OT1A 3QBTA 2QN3A 5COAA 3TM4A 3EA0A 1ONNA 3IHTA 3UXHA 4X1OA 4KE6A 1BS9A 1MB3A 3BGOS 1IATA 4C4RA 4JFRA 3K8ZA 3I42A 4I19A 4UHHA 2ZSAA 2XAAA 2R9VA 3BULA 1QANA 4MS1B 4IOKA 4IRUB 5J4HA 3S7ZA 3F9CA