5I4CA

Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein RcsB
publication title Crystal structure of nonphosphorylated receiver domain of the stress response regulator RcsB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gene regulation
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5i4cA00
2NZUG 4L4UA 5FWYB 2FLWA 1C4WA 3Q41A 2FVYA 5EWLB 4RXUA 2JVKA 1YTUA 1D1QA 3GT7A 4JP1A 3C3MA 4LZLA 1QNLA 3O2QB 4JB2A 4LDZA 4MAAA 4MS1B 1QKKA 5KQLA 1KRWA 1MAVA 4UHJA 1JWLA 1Z2EA 5JNWA 1EWKA 1XHFA 3O21A 1DBWA 1DJMA 4MR9A 3FFTA 3MIZA 5ED4A 3QX8A 2PE5A 1OXKB 3EQ2A 5KQGA 1JDPA 4KK4A 3OQMA 4YO7A 5HQJA 3H1FA 1IIBA 4F11A 5CNJA 1NXTA 4IGAA 5IEJA 1M5UA 1BAPA 1PEYA 3IDOA 1F51E 3GBPA 4ZPJA 2PLNA 1OXBB 1ABEA 4RY9A 2X7XA 3I45A 1FFSA 4XLTA 1DRJA 1VPWA 3JPWA 4G0MA 5EWMA 1JYEA 3N75A 3N6VA 5JNRA 1YS7A 1Z15A 1JH9A 2RJOA 5TPZD 1GUDA 4ML3A 4RZSA 4FE7A 4MYRA 3RVRA 1ZAYA 3F6PA 1LJUA 1NXPA 2CWDA 2HQBA 3F6CA 3G1WA 3KYJB 5HKOA 4F8JA 4EVRA 1RXIA 3VNAA 3RVSA 1BDJA 4RK4A 1QO0D 1QP4A 4RWEA 1JFTA 1AB6A 4Y9TA 8ABPA 5HM6A 4Z9AA 4MR7A 4O1IA 1A0OA 4LX8A 3EDCA 3LUFA 3LKBA 3T38A 1DCKA 2E4ZA 4RS3A 2R25B 1U0SY 2IOYA 3C97A 4PYRA 1Z17A 3KS9A 4F06A 1U8TA 3O2JA 5DGCA 3SG0A 1UDRA 3O74A 1LBHA 1Z16A 2FN9A 2GI4A 3JTEA 1QQBA 4G0OA 1Z13A 2CD7A 1FSPA 4RKRA 4N03A 4MS3A 1L5ZA 3OMWA 1URPA 3BILA 4KRFA 3CZCA 2WJWA 3EJWA 4UHKA 3I5AA 5IULC 3UUGA 2B1JA 2R47A 4OLAA 4WT7A 4KREA 3NBMA 1TJYA 1RPJA 4MR9B 3HJFA 1JYFA 1Z2DA 1YK0A 3LUGA 3QLUC 4ETMA 4GNRA 4D6XA 3OO1A 4KMRA 2IPLA 3QEKA 3EODA 3HSYA 4WZZA 3S99A 5IEBA 2FMIA 1GCGA 3OM1A 3F7NA 1ZHHA 1USKA 1Y1LA 1SXIA 1QP0A 2FQXA 4Z4HA 2ZWMA 4IMIB 1PUXA 3K4HA 3A0UA 3BREA 4E7PA 1VRVA 2FQYA 4JA2A 3C3WA 4P98A 1EFAA 2JB9A 3FGZA 1ISRA 4MQFB 4QICA 4YV7A 2L17A 3DZDA 5C5CA 1DCFA 3IPAA 5EWMB 2MYUA 4OTZA 2MSLA 3DGFC 4KZKA 4RY8A 4G0YA 3KLOA 2HJ9A 3Q7RA 3QEMB 5IUKC 4DADA 4ETIA 3O1IC 5KQPA 3T95A 1DBPA 5DLEA 5ABPA 3H6HA 5JNTA 3KYIB 4W5TA 2HQRA 3SM9A 5CNMA 1ISSA 3HDGA 5TQ2B 3QLVC 1F4VA 1ZN2A 4LE1A 1H9CA 1YIOA 4Z4EA 3OMXA 3CG4A 1RXEA 1B00A 1NXWA 3NHZA 3GV0A 5FBHA 3TD9A 4JB0A 2JK1A 2VK2A 4WUTA 5IUJC 3OLZA 2FXIA 1YVUA 2A9RA 2JBAB 1J56A 2AYXA 4JAVC 2LIVA 2MYPA 3VNBA 1MB3A 3OQOA 4IMJB 4LDAA 5GOTA 2M98A 2NT4A 4E7OA 3IPCA 4PICA 1XWWA 4MS4A 3T8YA 4RK0A 3OLXA 4W5OA 4IRXA 3BBLA 1RZRD 1ZH4A 4XASA 3SY8A 4MS3B 5KQMA 4B09A 3KJXA 3QLUA 2IPNA 2R4QA 2GX6A 1W25A 2BGGA 2L19A 1YMVA 1GCAA 3IP5A 2FKAA 1U04A 3IP9A 2PKXA 2J48A 2A9QA 3QELA 4MLCA 1VLZA 3GL9A 4FE4A 4N0PA 2RDMA 2IKSA 4F3TA 3HDVA 1P6QA 2FTKE 4LRQA 3LUHA 3T6KA 3LUKA 2H0AA 4ZMRA 3RVJA 6ABPA 4RK1A 4NQRA 1P2FA 4MLDA 3MF4A 3LUCA 2Q5CA 2DRIA 2OENG 4ZMSA 2E4YA 1DRKA 2R48A 2PMCA 1DG9A 1P8AA 4RY0A 1PNTA 1VKRA 3L49A 5JNVA 5DKFA 1CEYA 1TVMA 5TPWA 1S8NA 3HUTA 4TMYA 5KWSA 5T7BA 4PE5B 4CBVA 1RZRA 1LJLA 1NY5A 3OO0A 1CHNA 4KV7A 3QLVA 5FWXA 2KYRA 3LUAA 3M9XA 4ZJPA 1PHRA 1ZGGA 3C3KA 3DBIA 3JVIA 4NV3A 3H5VA 1KGSA 1A2OA 3EGCA 2IPAB 4IILA 5TQ0A 4EVQA 4JASB 3EQZA 5EWJB 3E61A 2E4VA 3HK2A 2QR3A 1YS6A 3FFXA 3K9CA 3NNSA 3BRSA 4YP9A 3RVLA 3HEBA 4G0QA 4ETNA 3JPYA 3QX9A 1E6LA 1ZITA 4OLBA 1A04A 2FMKA 4Z4GA 1YMUA 3UKJA 5D2CA 4H60A 4RXMA 4YWHA 1QPZA 3IP6A 1BDHA 3GYBA 5TPZA 4RK7A 1APBA 4MS4B 3HS3A 1JDNA 3CRNA 4KPYA 3HZHA 3MA0A 3OQNA 4RK6A 4Q7EA 1P6UA 4LE0A 2M1ZA 1T34A 1BA2A 3H5WA 4RKQA 1EWVA 3H1EA 1TM2A 3N53A 4F12A 5CHYA 1JF8A 3M9WA 3ROFA 2HPHA 4G0XA 1QO0A 1Z18A 3CG0A 4IF4A 1NXSA 3KLNA 4EYQA 9ABPA 5FWYA 4GPAA 5EWLA 4RK5A 5BRAA 1D2AA 1Z25A 4MS1A 1NXVA 3JVDA 3KCNA 1TLFA 3OLWA 1DP4A 3HCWA 1SD5A 3NNNA 4ZYLA 1QQAA 1HEYA 4KNYA 2JVJA 1NXOA 4N76A 1ZVVA 3H5TA 3GRCA 3DLHA 3F73A 2YHBA 2PL9A 3LUDA 1Z26A 4FB4A 1JLKA 1U2QA 3TO5A 2GWRA 4DN6A 1GLGA 2ID9A 2FEWB 3GA5A 1K68A 4Z99A 3NHMA 4N47A 2QVGA 1MB0A 3TX6A 5BQ3A 2P9HA 4EGSA 5IBQA 2PUEA 2PUGA 4G86A 1M5TA 2WJAA 1U2PA 1ZY2A 2PJUA 1DCMA 3A10A 4MQEA 2FMFA 4MR8A 5JS1A 4YS6A 5DCLA 3Q7TA 4QYWA 3CHYA 3ROTA 2H3HA 4YCSA 4S05A 1QMPA 1DC8A 2IDMA 1C0EA 7ABPA 5TQ0B 4MR7B 3RVOA 2PUBA 5HSGA 2L2QA 2LPMA 4YRZA 4N41A 3CLKA 3SAJA 2HSGA 4OG2A 3BRQA 3N0XA 5FBKA 2WRZA 3IP7A 2FQWA 1W9HA 1YK1A 2FEPA 3L6UA 1LK0A 5B3JC 4Z4CA 2AYZA 3SNKA 4RU1A 1M2FA 2MYTA 4W5QA 1RNLA 4NCBA 4EVSA 2PUDA 2QVCA 3O2SB 2HQOA 2QV0A 1QP7A 4EYGA 2E4UA 2FSPA 2QU7A 4H3HB 4EY3A 4S04A 2MSKA 3TMYA 5TQJA 1DBQA 5KC9A 4MRMA 5E3JA 1USIA 2L18A 3LOPA 4RSMA 3Q7SA 2GBPA 4YGXB 1AB5A 2JVIA 2FEKA 2ID7A 2A9PA 4EUKA 3O1JC 2CHFA 4O5AA 3W9SA 4Z9BA 1R8JA 1FQWA 4WXMA 1E2BA 3O75A 1JX6A 3GBVA 2P4UA 3FFWA 1SXGA 4PZ0A 3C6QA 2I6FA 4HYEA 4P1ZA 4TLMB 4H3KB 2WB4A 2MSWA 3GWGA 4KK3A 3N0RA 3URMA 1GUBA 1MIHA 4G97A 3EULA 4N0QA 5T3YA 5C5EA 2VUHB 2JRLA 1JHZA 4NCAA 2NT3A 4MQFA 1TMYA 4MQEB 4MR8B 3CFYA 3HM9A 4G0PA 2MYNA 2LBPA 2FN8A 1D4ZA 3CKMA 2NUBA 3RQIA 3ILHA 2PAFA 3QEMA 4KQCA 5PNTA 2B4AA 3RVMA 2WWVD 3NNDA 3RVKA 4D6YA 3HVRA 4Q6BA 5B3JA 4EYKA 3FDFA 4KQ9A 4MPTA 1EHCA 5TQ2A 4PEVA 4Z4FA 3QK7A 5TE9A 3ILYA 2RGYA 3LFTA 3A0RB 5BR1A 2CHEA 4HNQA 5CNIA 3LUJA 2FMHA 1JL3A 2XDYA 5F64A 1JBEA 2QSJA 1WETA 2OQRA 3RVQA 2JBAA 4Q6WA 2E4WA 3KTOA 4OATA 4QYMA 2F8SA 2FLKA 3CTPA 1SRRA 1PNRA 1I3CA 3SQNA 3N0WA 3OLVA 2PL1A 3R0JA 1DC7A 2VUIB 1M2EA 1JFVA 3KG2A 2A9OA 5DTEA 3LKVA 5JNUA 1Z12A 3QELB 4XXHA 1XHEA 3Q15C 1MVOA 2FW0A 4YR7A 3DLBA 5KC8A 2PUFA 4W5NA 1BVHA 1CYEA 1NTRA 4MRMB 4JOQA 1ZH2A 1FFGA 2IYNA 4RV5A 3UK0A 3RH0A 2W42A 4DQDA 2PUCA 1BDIA 3CZ5A 6CHYA 4W5RA 1LBIA 4YLEA 1KRXA 1KMIY 5IX8A 3KSMA 4O1HA 4KVFA 3TB6A 3P9YA 3FMVA 3LMKA 5CNKA 2O20A 1USGA 3B2NA 1EWTA 2TMYA 2RJNA 4NICA 2V0NA 5TPWB 1E6MA 3D02A 2N9UA 3KKEA 2NZVG 3MYYA 2YHAA 2JCGA 1D1PA 3OLYA 2WMYA 5I4CA 3EAFA 3H6GA 1ZESA 5FWXB 4RXTA 4D74A 5JNSA 3CS3A 3HV2A 3H5OA 3JY6A 3I09A 2GKGA 3H5IA 1JFSA 3CU5A 4WWHA 5BRJA 3G85A 3RVNA 3E3MA 4G0ZA 5GQSA 3MMNA 1DZ3A 4L85A 5IC5A 2ZAYA 1E6KA 4OBBA 1PEAA 3Q9SA 2F8TA 3O1HB 2E4XA 2VYCA 3KHTA 4TLLB 1NXXA 1D5WA 3H75A 3HO1A 1NATA 4WXEA 3QLTA 1ABFA 1K66A 2QW1A 4LE2A 4XFKA 3M6MD 4Z0NA 2QXYA 3DGEC 3CNBA 4M88A 4TN5A 2LUOA 4MGEA 3N8IA 3JS5A 5KI6A 5IUNC 3MM4A 5EWJA 5JS2A 3H1GA 1EAYA 4HNRA 4EYOA 1ZGZA 2PUAA 3I42A 4RDCA 2QZJA 4HNSA 3LTEA 3HUUA 2WY2D 2LP4Y 4Z4IA 1L5YA 3OM0A 1SXHA 4XARA 1ZDMA 3RVPA 2IPMA 3D8UA 3MQ4A 3H5LA 4QPJC 4XAQA 1FFWA 4KFCA 3A3KA 3HXMA
chains in the Genus database with same CATH superfamily
4GKKB 2ETVA 3G2OA 1UFQA 1CLEA 3D6HA 4EO7A 3HN7A 4B3BA 1Y5IA 4CYMA 4DSAA 2Q8PA 5SY6A 2D2FA 1SKMA 2XOKA 1KP9A 3F6SA 1U9IA 2NTEA 4AIRA 2ODAA 1QBGA 2QN8A 4IDNA 2EAUA 3G7SA 2XT6A 3I9KA 1EWKA 4JJAA 1G59A 1Q57A 2RGNC 2V98A 3AHEA 5DCUA 4I5EA 2PG3A 3FFTA 2NP7A 4R0MA 1NJSA 1ZHFA 2KLHA 1PR5A 1AV6A 1FYDA 3RG2A 4BEJA 2HJHA 1AOXA 4MW9A 2OHVA 3B3QA 2HHHB 1C8LA 4TL9A 1CIVA 2QLLA 4EJSB 2COKA 1GAWA 5JWHA 3ZHSA 3C87A 4B3GA 2C3YA 5EZSA 2VXOA 3PFFA 4KRXA 3C0KA 1IIRA 4WINA 1RWKA 4FN4A 4HHEA 1W85B 4MV7A 5JHGB 1DRJA 2VK8A 3ESBA 1TVEA 3B51X 2IZ5A 4PYOA 3AJRA 5EWMA 4BNXA 1LLUA 3AU9A 3PC8C 4NBSA 4PRKA 3WHPA 1WVIA 4PS0A 5FUVA 2TRSB 3OU6A 4JSRA 4O8CA 3PNOA 3BD8A 4MYRA 3M49A 1NR5A 1NPTO 1S2GA 2NQ2C 1G8PA 3KQHA 2UKDA 3CW9A 2XUIA 4ZI3A 2ZAMA 4LF6B 3PNVA 4CKBB 1ZNWA 1JR3D 3U3XA 1L5RA 3UK1A 3WVNA 3RADC 4EY6A 2V1UA 1IN1A 3LO8A 5HVNA 4D1YA 4O8ZA 1OPXA 4KXFB 3IC5A 1AB6A 2GKOA 3E1SA 3GD5A 4Y9TA 2DX7A 1L5WA 3O9MA 2HLPA 2NQ8A 4JDPA 5COQA 2ODEA 3RR2A 3BXPA 3C7AA 3MUOA 2BGKA 3K0SA 4M46A 3MGBA 1DTEA 5DYGA 4JI4B 4KQEA 1JHUA 3QKSB 2H9YA 3TUIC 2Q2WA 2VPZA 1Z13A 2IOFK 4IHKA 3W90A 2HO5A 3V2IA 1Q7EA 4HH4A 2EJBA 1A77A 2VSFA 1R8SA 4FN5A 4Y6QA 821PA 4C20A 1R0BA 2W48A 1QIHA 4RLQA 3LX5A 3SYKA 2GEFA 1G7SA 2IBSA 1A8IA 2C5AA 5T4BA 5JJLA 3E9QA 4TQAA 5FPPA 5B7PA 1SU8A 1U6JA 1PS9A 2E18A 1GN9A 2PPLA 3ABRB 2ORVA 3LHSA 1FRZA 3O4IA 4M87A 1QV9A 4MRRA 3RWOA 2DOKA 5F9FA 1FU4A 2ZJ7A 2O2EA 3GRRA 4M7PA 5F3DA 5LXTF 3V1LA 4C5CA 4EKGA 4I9GA 4QFMA 3VV3A 4D02A 1NUTA 4RNCA 1S5PA 5ANRB 1U0LA 2G5TA 3ZQJA 4JVMA 1GKUB 4RC9A 4W9NC 1T2EA 1J0EA 1YACA 3PT5A 3QPUA 1NBEA 3A58B 4FFMA 5EHIA 5DNAA 3MTDA 4LF5B 1RQRA 4QRDA 5TMPA 1SMKA 4KXMA 1QIEA 3STWA 3EC7A 1XJ0A 3U4AA 5HJ5A 1PUXA 2P1RA 3IVAA 3WWZA 1G60A 4IWNA 4IO0A 4NCIA 3WKDA 4DIKA 4E7PA 4HDRB 2XDWA 1G3MA 3QU7A 4PSDA 4DARA 1MA0A 2FMUA 4DWOA 3G1UA 4Y2PA 1BXGA 3V8MA 5C5CA 10MHA 3EMDA 1EX9A 3ANTA 1SGWA 3L7DA 3T06B 4EO4A 3WYEA 2VXBA 5L3SB 3KJQA 3L07A 4P4UA 4TKLA 2Z5GA 5DLEA 2UYCA 5E7QA 4IVQA 4M53A 4BQEA 1V4NA 2V5VA 3NANA 5FTWA 3PPXA 3NQ41 4MTCA 4U2GA 2WHXA 4PLVA 2HB6A 5B58C 1I32A 4CEJB 1ICEA 3KTAB 1JAZA 3HKEB 4X00A 2BEUB 5LOVF 1NAIA 1WUKS 4S1PA 4FD3A 1XMPA 4EAAA 5IT0A 1RQLA 1HURA 2AEFA 3PQ3A 1PEDA 2WOJA 3PUVA 1J99A 1YF3A 4ZEXA 4S24A 1KOGA 1WU8A 3TI7A 1JPUA 2G9QA 3NV9A 3LPCA 2VRBA 3PDCA 1L5FA 4H7JA 3TMAA 3H2BA 3TB4A 4CMJA 2VDRB 3TLYA 2R8YA 1CBUA 1RQ2A 1AD2A 2FRXA 1GL9B 3ITDA 2XUZA 4NY1A 4PGHA 3CN9A 1NYQA 4TGLA 5K0ZA 1XDBA 1VJCA 4S0ZA 4TS4A 5T4FA 2FPGB 1PJTA 3IODA 2JAQA 2XUAA 3URKA 1FB5A 3CLSD 2V4MA 1EBUA 4R1QA 1YHYA 4JYMA 3JQAD 1BS9A 3W9UA 1DARA 3H9CA 2OECA 2W4QA 4HYYA 5JH7F 1VG8A 2JLCA 3G17A 2DCMA 5JCOA 3H0KA 4UEWA 3R9XB 1Q1AA 5F1OA 3SYTA 1ATZA 2J48A 2X2FA 1KHTA 4E14A 3Q6MA 1VLZA 4FSHA 1ISIA 1KE2A 1UPTA 4NDNE 5K3FA 3CMMA 2D06A 4MPJA 2HREA 3AEKB 3GUHA 2DJ5A 5DBOA 1WY7A 3U7RA 3VAAA 4BFUA 4EABA 5IG2A 5FNVB 1YONA 2DRIA 2P4EA 2OENG 3OA2A 1CQPA 3PHIA 3AFIA 3RFXA 2VDUE 1DG9A 2GAFA 4RY0A 5GONF 1D04A 2RHRA 3HBAA 4MWTA 2ZSKA 3RK1A 4C29A 1SHJA 3B20A 5DI9A 3NHBA 2A1UA 2EXXA 1PJ2A 2WOOA 4UXHA 3NC1C 3U7EB 3EXEB 1CJKC 4DOMA 1H2WA 3KB8A 1Y0BA 3HKBA 4OHBA 4I14A 3WBJA 5C8ZA 4DBLC 1C3XA 4RZIA 3IGFA 4OQPA 4Z0HO 4QVIA 2OQVA 5EQTA 2C2KA 3GVIA 2IV7A 1SC9A 4GH5A 1VJ5A 1C9MA 4BIMA 3M0EA 5KYUB 4QO7A 1SBHA 1CY2A 4IIJB 4QPZA 4YYEA 1PD0A 4HAXA 3PL1A 3IAS6 2ZLBA 2FX2A 1X13A 2Z83A 3E61A 3FMPB 1WB9A 1XN4A 3NONA 3FPAA 5IZCA 1XA3A 3TAUA 5JTTA 5DTRA 3NNSA 3RVLA 3JU3A 4YRGA 5HTOA 2I8CA 2D0OB 3ND5A 1GN8A 3SVZA 1IZ0A 1NI4A 2P2CA 3EDRA 2W70A 4TV8F 4V0QA 1A04A 1JNYA 1HDCA 1M6VB 4Q9JA 1HLPA 2NO4A 4QPPA 5DYNA 3EVZA 3VU9A 5BW5A 5IVHA 2GH1A 1EEXB 3ZS9A 2VDLB 1EI9A 1S4MA 1E6CA 3HS3A 1CDDA 2HNBA 4BO5A 1APBA 4PC1A 4EKIA 5SY9A 3OQNA 1MC5A 1MMFB 1V3UA 4DTCA 4DR3B 2FK7A 3PGKA 4U0JA 4EYEA 1T34A 3AHFA 3MT7A 3L6EA 3LPDA 1C9DB 2OGWA 3QBJA 1TUGA 5CVEA 1GZDA 1Z18A 3UMVA 4IF4A 4R9RA 1HUQA 3PDIB 4GLJA 5JHHB 1WKCA 3JQ8A 3Q11A 5E3HA 1D2AA 3QKWA 2QS9A 3CUYA 3ET4A 2WICA 2ZIWB 2VQEB 5LP6A 4JU8A 4YRDA 2BUAA 2ZR9A 1SD5A 2H4XA 3PPYA 1WKVA 1HMPA 4FBGA 4IFIA 1NXOA 2FEMA 3IVXA 3WMGA 3D3JA 3TLGA 3QTBA 4GLFA 4FGSA 5KNCA 5H02A 5ALSA 1R74A 3KQUA 3QYFA 4U9UA 3B38A 3DUFB 2GTHA 4RA6B 3UAOA 1XZEA 4GLBA 5AI4A 1U7DA 3C3XA 3WMFA 1A9XA 4P86A 3CWQA 1F8GA 5KVSA 1PL6A 1U2QA 4AZ3A 5JLJA 3GA5A 3SVLA 1K0FA 4F91B 4KPYA 4GSKA 2IH5A 3ESRA 2JJ2D 5J47A 1KWGA 3HSSA 3PFWO 2JGNA 3JXEA 4PSKA 4OGFA 2VPPA 3NHJA 5H5JA 1U3GA 4DABA 5BY2A 4CG1A 4K9QA 3ZYZA 2VSOA 1QMGA 2B94A 4ON9A 1KOFA 4QLOA 4MAFA 1AGXA 5DCLA 2H5IA 5LQRA 3S81A 3U7JA 1SOAA 3RASA 4M8NE 2P1DA 2BEVA 4KQWA 2H3HA 3A1VA 1UMBA 3BBPA 3JZMA 4Q4JA 4LGVA 4OIMA 1LH0A 5KHLB 3F7OA 3I4CA 3NHLA 4H15A 1H9AA 5J4KA 5LQCA 5AM2A 4JUBA 3TO5A 1ZPDA 1VJDA 5A4FS 3O8NA 2G1AA 3N07A 4JR1A 2PD6A 3BRQA 4LRSB 1XP8A 4PANA 1XZAA 3L1VA 4Q0MA 5EIOA 3IBSA 3F97A 3KHUA 4JHXA 2B2CA 2QBYB 5KWIA 5HGJA 3WL7A 1NE2A 4F9EA 3FHTA 2A78A 4XIJA 1DAHA 1VBMA 1D2NA 2TMKA 3SC2B 4CT5A 3B52X 5FUMA 2X8JB 1NVDA 1XZQA 4BNWA 4GWLA 4FX2A 3T4UA 4WKCA 2QV0A 2EQAA 4H6WA 1GUYA 4M7WA 3ZU5A 1K7CA 2W6OA 5C7IO 2FSPA 3ASYA 3LYHA 3WGKA 3TMYA 4M60A 1K4MA 3IOEA 4IWYA 2VP3A 3ABOB 4PYIA 4NZMA 2HMWA 4KLCA 1GNVA 4GKBA 3RVDA 3E82A 3E22B 1QGED 2FEKA 2ONJA 2ID7A 1FVOA 4JLWA 2Z5LA 5F5NA 5I7SA 4EJFA 3W2HA 4R41A 3TF5A 3KAPA 4Z9BA 1E0AA 3TCNA 1RE0A 1FQWA 3ZD8A 2O50A 3NIFB 3ZX4A 3U5ZB 4O4IF 1G42A 3CRQA 1UMCA 1MEEA 4R69A 4LGMA 4BN0A 4BNDA 3AETB 2AKEA 1SHLA 1VKHA 2FGKA 3G9TA 3IBFA 2LVBA 2I6FA 4JN6B 3U3KA 4PC3A 3H1BA 1Z0UA 3H13A 2IODA 3JYHA 4FSXA 1NZDA 2PS9A 4GZLA 1DUIA 2EERA 3P9XA 3URMA 1NDUA 4BNZA 2OBXA 1KBQA 4UHFA 5FA8A 3IA2A 5JAOA 4RD6A 1F60A 2Q27A 1KAQA 3RCBA 3MLAA 1G7TA 4HD8A 4TL6A 2GF2A 1EK6A 1AS3A 1NFQA 4NPAA 3R7WB 4WESA 1OAOC 2C99A 4KAJA 3CFYA 3Q8LA 4LTNA 4DLUA 3REGA 3L6CA 2WTMA 2EX1A 1UQUA 5IF9A 4IUDS 4LIPD 2C0PA 4YMWA 5EGNA 1ZIYA 1CPYA 1ORHA 1TTTA 3REQA 1C30B 2WSBA 3PHCA 3RWBA 1I4WA 2Q1TA 4FI3C 3AP1A 4X66B 4L4RA 1O5OA 2FPOA 4R0NA 2HADA 3DO6A 1YCFA 4MQLA 4N9QA 3W8DA 2RGYA 1YKFA 4IRUB 4BCBA 4RTQA 4IDOA 2ZUVA 3DR5A 3ORSA 1EFPB 2O19A 2X4LA 1J8YF 5K9ZA 5MN4A 1OCEA 1AKQA 2JC3A 4PRYA 1RRFA 2ILTA 3WADA 3L0YA 4J2OA 4LOHA 2O8FA 1N6LA 1WP9A 1OBFO 4DLWA 4Y2RA 3R9IA 1IN8A 1HFJA 2BH9A 2WHYA 2DHDA 3I73A 2XIQA 4LGYA 1E5TA 3ZBPA 4BNVA 1K6IA 5B7GA 4F84A 1OU4A 1G8HA 1A8UA 1T3HA 2BKUA 3NTQA 4XM2A 3U56A 1FVFA 5T4HA 3RUCA 4DC1A 5M04A 2HXGA 3OT1B 2G9RA 3Q6NA 1YZKA 3N58A 1VE3A 3CPSA 4CCSA 4B3RB 2ZBVA 3VDMA 4MGIR 3PXXA 1DDIA 4L9SA 4HAUA 1F5SA 5EEHA 4AIIA 3ZGZA 4J4BA 1JZQA 2X1LA 6PFKA 2G3YA 1TKBA 4G4GA 4LRWA 3TZ6A 1ZD2P 3IDSA 2Q3EA 2O2GA 4F4FA 1N2BA 1BWSA 2OBNA 4B75A 5HGXA 3W79A 1WMSA 4D0LB 3CB4A 4HB0A 1DADA 4ITVA 5D3MA 2RJNA 3DE4X 4UHBA 4ER6A 5JCJD 4JCCA 4WZ6A 1LX7A 1WUTA 3HDTA 3KAJA 5G0TA 1JA1A 3KKEA 2OCAA 4YRIA 3ZY5A 1O95A 3JSAA 5DNUA 1NRJB 4S1TA 5D1NA 3UK6A 3LRXA 5I7EA 3X1XA 2O1WA 3DTVB 4FWBA 1AMNA 2RC6A 1T0UA 3ZLUA 1DC5A 4MMYB 3G85A 3RVNA 1G20E 2WTXA 4K9NA 4WBNB 2O4UX 2YFQA 5H3HA 1R66A 2O23A 2CUNA 2QRNA 4O29A 4XUCA 1ESZA 1NG1A 2E4XA 4M9RA 4OQYA 1D8TA 2CLFB 4M1QA 4DY4A 1NATA 2Q62A 4YHHB 1IYZA 3O3OB 1NUUA 1X1DA 1OHHD 1Q44A 3FVRA 4LXXA 4QU5A 2JDID 1P77A 3N05A 1P4HA 2LUOA 2W2PA 3HXKA 2H18A 3ZIUA 1ZAKA 5CJPA 3LFHA 1ZJJA 1NVAA 3GLQA 2OBBA 2AD1A 4Y0NA 3VYSB 5GPBA 4DV7B 2JCVA 4BNUA 3KQOA 1P2SA 4Q7KA 3VJLA 1DZIA 1JLMA 1E7SA 1GOTA 1BSVA 5ICGA 1AE1A 2HSWA 1JDBC 2Q07A 3BIFA 1ZDMA 3B48A 4R1LA 4XARA 4ZANA 2GRAA 4Q9NA 2I6XA 2H5EA 1N2ZA 3HMQA 4FBLA 2V3CC 2CDCA 3EW7A 5LYJB 4AW9A 4JJZA 2DFNA 2DZDA 2RHOA 1LC0A 5JC8A 3EEFA 1QV6A 2SKCA 1R4ZA 2FVYA 4FE3A 1YTUA 1KZHA 3KWLA 5ENVA 4MAAA 4O1MA 4A0FA 5HF8A 4EF6A 1Q17A 5KQLA 3DUWA 3T3NA 2HHLA 1JWLA 1L7EA 1BTOA 4AQYB 2CNWD 5FFMA 4OGKA 2H48A 4WJKB 4TKZA 5IVPA 1MLDA 3IS3A 4IL5A 3CWZA 2I87A 1N6KA 1O0CA 5KAMA 3C2QA 2MSNA 1MOSA 2BV3A 2X9GA 2RB5A 1TVCA 2P90A 1QHHA 4GPBA 4JELA 4NQZA 4O0MA 4H1VA 1N2GA 4YO7A 1JWBB 3T4EA 4EY5A 4E5MA 4F92B 4MIYA 3CWCA 1IB6A 1Z0IA 4IGAA 1BKSB 1GGVA 3RANA 4AURA 4QHYA 4B6GA 2X4DA 5CA1F 1EX7A 5TRTA 1SG9A 3VKGA 3PKJA 3NTXA 4HFJA 4UBIA 2FETA 4R8SA 1YQDA 4IGIA 3WOVA 1F06A 1NW5A 2A3NA 4ZPXA 3EF1A 4WNAA 2QJRA 1C1DA 3DZIA 5CB4F 5C9ZA 3ZY3A 3M6IA 2V4ZA 2QG6A 1GA6A 3KUUA 3EGIA 4U7HA 4RZSA 2HWWA 4XJTA 3Q9NA 4J8PA 2QD2A 1FRQA 5HILA 3PU6A 1J5PA 1N6HA 1UXHA 1RFLA 1ZGBA 4DSNA 2HYIC 2OGUA 1P5FA 4YCCA 4RCVA 3VNAA 2XXAB 1BW9A 1TAGA 1ARZA 1RM5A 4G1EB 2Z43A 2VOEA 4QEDA 2BELA 3HGQA 4WI1A 2BE9A 1GLNA 3KPJA 1GTSA 4EPRA 4O1IA 5AVRA 1TT5B 1VKJA 2Q9AA 3C1TA 3I01A 3B9QA 3NT2A 5BYJA 5TX7A 4A8HA 4BUCA 4HVLA 3HEAA 4MV1A 3BD7A 4WA8A 2A2ZA 2HWYA 3L79A 3VHLB 4NS1A 4NC9A 4GRAA 2QA5A 2GI4A 4Z54A 4E3WA 3NT4A 4NOJA 2F8TA 1YZ3A 4LHWA 2PQ0A 3NORA 2FWIA 1DBVO 3SE0A 2FPPA 4A2WA 5ECDA 4BBZA 1URPA 2J7PA 4NZNA 4PAGA 3RK4A 4ENUA 5IASA 5INTA 1XNRB 3JASA 2BAGA 2AFRA 4DV6B 3HBNA 4TKVA 5LMCA 1XQVA 1T9GR 3K0CC 3LOUA 4KXYA 4MV9A 3ZGYA 5HUQA 1FNBA 2UYOA 1CQZA 1SZCA 5JBIA 1T35A 3NBMA 3B5EA 4O3MA 3SR0A 4KJZA 1SXJD 4L8YA 4XSHA 1B41A 2NAFA 1TD1A 2YZGA 1CVLA 4G5FA 3NEJA 4JI6B 2WJYA 4B3TB 3CB2A 4RV9A 3KT8A 4FEGA 3AKYA 1E1YA 1VOTA 3L8FA 4K3VA 4IICA 4M9XA 5IEBA 5BV8A 2CFCA 5BN3B 3LU1A 2V4UA 4KQ2A 3OOEA 1H0SA 1UJNA 1Y1LA 4FCTA 4I4LA 4X1YA 1DAKA 2FQXA 3DPIA 3KR9A 4Z4HA 3DAHA 3BMOB 3CISA 3OZGA 4LQDA 5AVJA 2WAMA 4IQ4A 3SKYA 5IAAA 4JA2A 1PR2A 3T5DA 3C3WA 5FR2A 2BMEA 4M2LA 1SKAA 3CEAA 3FDZB 4MQ4A 5JNLA 5D3ZA 1KK2A 1A4RA 5J23A 3VNQA 3HLTA 2MYUA 4MV0A 3HADA 2EYUA 2Q1UA 4OTZA 4UU0A 4B7XA 4C0SA 1Q20A 3OZFA 3PEUA 3KBBA 4U3JB 3ZI0A 1BRTA 2B20A 3OJFA 3PVSA 3H6HA 4G6ZA 4TMVA 4C87A 3GP3A 3SEZA 1CVRA 2DPGA 2Z57A 4UE3S 1HH4A 4HEQA 2PYDA 2W8BA 5FLYA 4C4OA 2PKYX 3L7IA 4DMHA 1Z07A 5TQ2B 3UT5B 4FDLA 3GYGA 1ONOA 3HB4X 3SKVA 1Z74A 1WY5A 4X6UA 5AVUA 3A1TA 4RY2A 1Z3IX 1WF3A 4G5XA 1OLUB 2QRVA 2QYOA 4L6CA 1PZMA 5HK8A 5BWLA 2IVZA 4CKWA 1ZSVA 1GRRA 2KBFA 5JQGA 3RJMA 1BJKA 1GPWB 3QENA 4KDEA 1Y3DE 2A9RA 2O1XA 2QMZA 1J56A 1VGVA 2WF6A 5F1YA 3S40A 4C43A 1VIYA 2ZDGA 5EHZA 3HNPA 1YKSA 3P2IA 3VQTA 5K8VA 2BTOA 3Q3VA 2D5CA 2QLTA 4EHBA 1NNEA 1MHTA 4BO4A 1UFVA 3I3OA 1P5JA 2M98A 2R8EA 4HDSA 4KNWA 2XB4A 1GPDG 2BTQB 3CC8A 4MS4A 3WL4A 3R0VA 3ZKWB 3RBAA 4RK0A 3RAEC 4NENA 4W5OA 3TSOA 3MMXA 3ZEAA 1JKFA 4L4XA 5K0BA 5TVGA 3LF2A 1GVNB 1QVZA 4KC0A 2ZRGA 2CLLB 5DBFA 1N32B 1Q15A 1KYVA 4LDNA 3IIMA 4MGZR 1YMVA 4XB1A 4Y2VA 4QDTA 5EOVA 2P91A 2FE1A 4HNHA 1PGNA 1BDMA 2HTEA 2OO7A 4P08A 3AI3A 4QYXA 1DNPA 5IMSA 2G1UA 2PKXA 1P0PA 3CW2A 1CZKA 1NMZA 2ZAOA 4FDVA 3RU7A 1PQWA 1GKIA 3OEYA 4OQFA 4CIWA 3Q8XB 5LD2C 1M9NA 2Q0HA 5D7BA 3SEFA 3UAWA 3RYIA 4FS3A 4YJ3A 3HUEA 4NQRA 5JASA 4HH1A 3K4QA 5TLSA 4MO2A 4LY6A 3PE4A 3SSOA 1COWD 4JT4A 5F9MA 5T8KC 1BWPA 4B83A 2H5LA 1N1MA 2YIJA 2EFYA 2OPBA 3S6JA 3LK6A 1VRCA 3E9RA 2GJ9A 2X0IA 3PGVA 4B8WA 1T9ZA 3SIWA 1S8NA 3ZBQA 2EZ4A 1YU9A 5EUCA 2HRCA 4F6RA 1NY5A 2AC7A 3BHNA 4NJEA 5TARA 1FPQA 3UWDA 1P39A 2PZGA 4MLPA 3AVOA 2WTUA 3LZCA 2Z30A 4B8ZA 2IWRA 1N0UA 2ISCA 1HLDA 2VJNA 1USWA 2DWOA 4RJLA 1Z5ZA 2JLWA 1E9BA 5SYNA 5LWHA 2R9VA 4JLNA 2DXIA 1GSAA 1S01A 4IUBS 3KV1A 4BX3A 1TUIA 4CF4A 1L4UA 5LCXA 5JVDA 3EGCA 3C6XA 2XCIA 4DEYA 5LA6A 4AJJA 2WUWE 4I81A 2JFVA 1FMLA 3UG7A 3L8MA 3AHGA 1R27A 3HO6A 3OZWA 4YUZA 5BSTA 2SKDA 4YIHA 2ZRAA 1JJIA 1KTVA 1NMEA 2Q7OE 4DSZA 2D1FA 4HDQB 5FWAA 4X6YA 2VYVA 3D5TA 4I5DA 5FORA 3ENNA 4YXWA 2AQIA 2QTVA 4PX3A 3P0HA 4DIFA 5ALVA 1TTPB 5CDFA 5EIFA 1IJEA 1XDUA 1CB0A 2W6JA 1PUIA 2WFLA 3KNZA 3D6NB 3AEUA 3EE6A 3M3PA 4FFBB 4EA6A 1Q50A 3K71B 3BB3A 4BJ1A 5JMWA 5AVZA 1F17A 3MJVA 4M0DA 1C7FA 2OG2A 4HAOA 1OI4A 5FEUA 1HTBA 4M0MA 4NF2A 4BTEA 2XQFA 2XCOA 4NIMA 5P21A 2GB4A 4RJKA 3T94A 3B2EA 1N9ZA 1KQ3A 4EG5A 5JSUA 1GILA 2PSSA 3OCCA 4NYMR 4DYVA 1O58A 2BONA 4N8SA 4PAWA 5AJUA 4DLTA 2SNIE 1H1LB 2E1PA 3H1EA 3I4LA 4A15A 1JF8A 3GLFA 3KZCA 3M5PA 4B43A 1NJ8A 5DMXA 4Y2GA 3RJZA 1D03A 2JLRA 2V55B 4OKSA 4ARAA 4K3UA 1TW3A 4EYQA 1K5DA 4E2YA 4U02A 4C22A 4P7BA 2ZS9A 2QXTA 5BOVA 1SIOA 5JZBA 3DBRB 3JVDA 4Y7CA 2B34A 4ZYUA 1FTQA 2YIVX 4URZR 4ZT5A 1IHOA 2WU1A 2YUTA 3A6GA 2JVJA 4WLEA 5LQAA 3ZWBA 1JKJA 3I2JA 5EMHA 3KR2A 4CDGA 1O6BA 5KAPA 5JEEA 3J81k 1XZMA 1G8SA 2ZSEA 2AJLI 3D6AA 5G3YA 2X76A 3LDAA 3O73A 3ZLVA 1P3Y1 3RYHA 4IMPA 2Q8QA 4OSOA 4ZHSA 1PDWA 1P29A 3T7JA 5KPJA 5BMVA 4DEXA 4AJ2A 4EPVA 5I9IA 5J59A 4ND8A 1RPTA 4IDQA 3G8YA 3UAZA 2BN4A 3S1AB 1B15A 5JE8A 2F8LA 3Q3JB 3VZCA 2JIPA 1LI4A 4RKWA 5IBQA 4ZZ1A 1PJLA 3HCAA 3K6SB 4UBNA 2HMAA 5B53A 3V55A 3AF3A 1K4YA 2WKPA 1ESEA 5TMBA 4RHCA 3UBMA 1YQXA 3F74A 5KMGB 2C7VA 1Y48E 1NI3A 1W4RA 2OB1A 4M49A 3WBFA 1V11A 3VNUA 4U2EA 5KKCA 4K40A 1H2YA 4IKEA 4RESA 5AUQA 1PK9A 2FN4A 2GTPA 3M4YA 3FLAA 5CYFA 7ABPA 1CJSA 2P35A 4I8DA 5KBYA 5TY0A 1TAUA 1MO2A 1RM4A 4AKGA 3OQIB 2W2KA 2RFLA 2J67A 3ZHXA 3DVAB 4W8HA 2O4CA 1ULTA 1OFIA 4F2PA 1RAAA 1SVIA 2WFAA 2QZSA 1YFLA 3MT0A 1A72A 2V0CA 1JIUA 1LI5A 1VE1A 3I5MA 2NSHA 3DAGA 3SZLA 4O6VA 2AFHE 5G53C 1TM3E 5LJLA 2R6DA 3K0FB 3ER8A 3TTUA 1ZAYA 4AG3A 2O2YA 2HRRA 2PKCA 2J33A 4GL4A 4CGYA 3IXQA 3PUKA 4NCBA 2R7NA 3KZOA 5HBGA 5L95A 2XOXA 1GL3A 3WYCA 2IS4A 1JQ5A 1DG3A 2SICE 3QSGA 3JRXA 3QWAA 1EVJA 3BRCA 4RHYA 5CLGA 3J81A 3KT0A 3A26A 2ZI5A 3FGOA 3OU2A 1QIJA 3G23A 3E48A 1Y42X 4OH7A 3U40A 2EFHB 3U4IA 2BJWA 1GIAA 1TVKB 2VQFB 3QHAA 5AKKA 1GXSA 2P5TB 2Q9UA 3BDIA 1F9EA 3HPQA 2BFFA 4FHEA 3ETLA 4JBGA 4F71A 4BPBA 5IJZA 1U8EA 4RD2A 1LWNA 5H0IA 5I51A 2BFCB 4MI1A 2W98A 2X14A 3ITEA 4JB3A 5L9AA 1RLJA 3UUEA 2FNAA 4IPTA 4MYTA 4Q4AB 2O6LA 5CCEA 4QG3A 1FXWF 1XE3A 3M7IA 3E3NA 4CFZA 3LXMA 4NYJQ 3FBTA 2V58A 1XNQB 1RLIA 4DLSA 3HKCA 1G7CA 1QCCA 2YHUA 5WRFA 1Z73A 5F12A 1F6BA 2QYSA 1Q1EA 3ELYA 1M2NA 5GM2A 4P7FA 1JHZA 4GBMA 3RRZA 1ODLA 4D9NA 1R6TA 3GLIA 1F0KA 2R4UA 3T12A 1CQJA 2M1XA 1YBMA 1KXZA 2XUPA 4Q3AA 2K87A 4I1UA 1EKXA 3BWEA 3BDAA 2Z2JA 3V2HA 2VDPB 3HFJA 4Y18A 4MZDA 1XNJA 3N7UA 4PLTA 4DDWA 2ZVPX 4DNPA 1F38A 3WQRA 4L5CA 3F3MA 5JAUA 1EFHA 4WKGA 4CT4B 5JDIC 1MXFA 1MPXA 3VGJA 4CLOB 1M54A 3DCIA 4L2IA 3HM2A 2OZKA 1EQAA 3QFSA 3W8EA 2XTMA 1SXQA 1Q3HA 2CHUA 1RCFA 3ILYA 3RSQA 3SYNA 4HZUB 1ZONA 3DMGA 5E1DA 3TEFA 1WD7A 2JL1A 4HGQA 4G85A 2DBYA 3LA8A 4AG6A 4AT1A 4PG7A 3EXHC 4JMPA 3VO2A 1G63A 5CDSA 4DV3B 4Y2SA 3AVYA 3NTLA 3CRMA 1NQUA 3AEQB 4BX2A 4IUYA 4L75A 4LWZA 2OXCA 4C0HA 1NN1A 3GIWA 3HFGA 4Q01A 5IHPA 3QUBA 5KTRA 3OFJA 4LF7B 1R37A 3ILVA 3UV7A 4OL0A 1SUPA 3GRYA 3A4TA 4EHKA 3EFOA 4J0KA 3KG2A 2A9OA 4P7GA 2I3ZA 2IYEA 5EE3A 3D64A 1OX6A 2IXBA 5DGXA 2C20A 3WLHA 4XWOA 4OF4A 3UV3A 1MB4A 1NJGA 3QVLA 4YAEA 1Y4DE 3B53X 3INYA 5SZIA 1A9OA 3CX7A 4QX6A 1ORTA 5LB2A 4ALMA 2ACEA 2A9FA 1II8B 4BVGA 1KMIY 1J8DA 2CLCX 2HU8A 5F7ZA 3EWIA 4MSUA 3BXGA 2EBFX 3EZ2A 2FA9A 4OOFA 3ZWDA 2XCSB 4AKHA 3LMKA 1A98A 1ZJ5A 5FTKA 4RX1A 2ZBDA 3OH8A 2EFCB 1E0SA 1EGVB 4WLUA 2BKVA 3SF8B 2PSDA 3PXUA 4HX9A 4TSKA 1HO3A 4I9UA 1EM8A 4XKJA 5FAXA 5HKKA 4FMBB 4BV9A 4ZP1A 3DL0A 3R5XA 2GZHA 2XAUA 3H6GA 3WBKA 5ICEA 1VB3A 3HXTA 1O8BA 2R85A 1BKDR 3OE1A 4MYDA 4NMXB 9LDBA 4OKIA 2CBZA 2XT9A 2JFWA 3SQMA 1XXHA 3C98A 3KP1A 1XU4A 1WB5A 3LQQA 4G0ZA 3SHOA 2ZRCA 1H2EA 2EJVA 1LPBB 2PLWA 1JHMA 4GKJB 1DZ3A 3NDRA 3BK7A 4D2IA 4DLYA 2Q28A 2ZAYA 4R2KA 3O1HB 4ID9A 4LPKA 5CTJA 3M6WA 4FBMA 2VPYA 3VR6D 1IG3A 4DXAA 1QGOA 1WRBA 5F98A 1KYWA 2VZ0A 1AKYA 3JQGA 2ONZA 2AW3A 4LX0A 4GDFA 3R0IA 5KI6A 2OP1A 1VSVA 1AN0A 2G40A 1W88B 1R1DA 4TTVA 4WY8A 3BWMA 1ZD1A 1Q11A 2H1VA 3EGXB 3OQHA 4KR9A 2ZANA 5FEMA 1QYCA 2ZATA 4UTNA 2Y1CA 3V46A 4RJTA 1SXHA 5I9NA 1DAIA 3M6FA 5FPQA 4TL8A 4OXIA 5AM0A 2OFPA 1LSJA 1N6NA 2HTFA 2FPIB 1LW7A 2BFPA 1FFWA 3OFVA 3GIDA 4HGNA 4NFLA 5I9MA 4D9GA 5IBCA 4IV0A 1MORA 2ODNA 1KAMA 3E2MA 4CV3A 2J3MA 3CY6A 3UEOA 2FLWA 4ZVPA 2JGEA 1A9TA 3ZK9A 3IVGA 3LG2A 1V5WA 1QNLA 2JHGA 3I28A 3LKZA 3O2QB 1YRYE 4CI0B 1KRWA 3PUHA 4JT9A 3HYRA 2IK8A 2RGWA 1E2UA 3ASVA 5B1SA 1J42A 2XVAA 5JCXA 6NULA 1G17A 2QN7A 4IHJF 3QX8A 5HFAA 4QAQA 3DM5A 3KTFA 4IIUA 3L93A 5JBQA 1PWXA 1JDPA 3OIYA 1HEUA 1MKYA 5JZOA 3OQMA 4W7HA 3LX4A 3NVAA 3C1AA 4ZI7B 3OKCA 3EK2A 4LHYA 2XUQA 4B34A 4CT0A 5HJ7A 3BXEA 1SEVA 1T25A 2JIRA 1XAIA 1UKYA 1K3TA 3E9MA 3KFLA 4J1TC 4XPIA 4MQUA 2Q2NA 3QXSA 4RY9A 2KQUA 4UUBA 3TZEA 4J3JA 2HJSA 2XJ9A 3OZSA 5L45A 5CLFA 3WKAA 3M1LA 2FR0A 3JPWA 4MW7A 1DRVA 3N8DA 1MT0A 5CH8A 2BR5A 2WF8A 2VATA 1SCDA 2C2WA 3KQQA 2FW1A 3P4UA 1Q19A 5AM1A 4MA0A 3DOFA 1TZMA 2IV3A 1VSUA 3OT4A 2ZDHA 1ZWKA 3G1WA 3F6CA 2OORA 4J7AA 3ANLA 4LVCA 5KYWA 5LU9A 1KHHA 1VJRA 3PHJA 3QQ5A 2ZRHA 5HF6A 5HG0A 1MGOA 4FIDA 4RZUA 2IHTA 2HBYA 4UJ5A 3QYJA 4WNYA 3JWJA 4O4JF 4B4WA 5AW4A 1BEZA 1KVQA 4DCMA 2Z58A 5KVAA 2UZ1B 2QTLA 3CPJB 3W77A 1YDFA 1I2AA 2F3PA 4PBRA 2A1TR 3EGWA 3Q5DA 2Z9DA 1EJ2A 3IMCA 3KS9A 4MUHA 4QOFA 3V4FA 4X3CA 1C2TA 2ASEA 3IT3A 3WLPA 3GRKA 4MJLA 4B4OA 4OPMA 1MENA 1QQBA 1KIAA 5F7XA 3GNLA 5K5EA 4C88A 1FSPA 2CLIB 2FJ0A 1J0BA 4BHTA 1OT3A 2NUPB 3T3OA 1M0WA 3ZDFA 1T9CA 2AOWA 1ZQ9A 2FEXA 2XMPA 5IVDA 3RREA 3U4HA 5TJHA 5JADA 4EFLA 1KDPA 1N2CA 2AJ8A 2OM6A 3KDAA 4EHHA 5HDBB 5C52B 1LBTA 3ONEA 1E3TA 1YL5A 3EQ7A 4V0SA 2UUAB 2H29A 2CZCA 4QDOA 4TTTS 4WT7A 4YDRA 4DJEC 4O2AA 3GCDA 1CSEE 1GAEO 4Z9YA 1OWOA 4YJDA 4QYIB 2BMVA 1NY6A 2E5WA 4MR9B 3LX8A 4RD3A 1BOFA 1V7PC 1IEQA 1YR3A 2PVPA 3D81A 3B6EA 2I3BA 4IKPA 2IEYA 3SHQA 4ETMA 4YRAA 1L3BA 5DNDA 2DHRA 5A2GA 2BFEA 2ICAA 2XLCA 5FDFA 4L4SA 2IOHA 1V3TA 5IWAB 2B92A 3FTNA 2V7PA 1WSAA 2P0EA 2UZ3A 1USKA 2VDQB 3D6JA 3F7NA 4DTIA 3ZCQA 5BUZA 2DKNA 1NA5A 2IYSA 2D7JA 4JJGA 1RFGE 4UDXX 3PV0A 4ZVSA 1LTHR 1E3DA 3L4BA 3RM3A 3C6BA 2RHLA 1SAYA 3W7AA 3GXOA 4ARIA 4FMCB 1V48A 3P27A 2YQ5A 4JENA 4KZKA 4FC7A 3C7DB 4GYJA 1OVMA 4KQKA 4N6NA 5A5DA 5C1BA 5KYTA 1O87A 1B7GO 4YV1A 1KYTA 4JD5A 1Y5RA 2WNSA 1YR6A 2IH4A 2D2EA 4YPOA 3KQTA 4L07A 1QYWA 1W73A 1QYIA 1U7ZA 4IQ0A 4WSOA 2HC9A 1E0KA 3I3SR 1T1SA 3TL6A 3GJ4A 5KQRA 1E96A 3WLEA 4QD3A 5G4KA 5HR5A 3HG7A 3JD4A 1RLMA 2GK3A 4CG2A 1NP7A 3MIIA 4GPTA 2GHTA 4MKHA 5FBHA 3GV0A 1YOBA 4GOJA 1ZISA 2VK2A 5IUJC 2OWEA 2J0QA 2QGZA 3FLEA 1ULAA 2UAGA 3T1YB 4FMPA 2LIVA 1K3UB 2ZWVA 3FRIA 1OSNA 5TMDA 2C92A 3VSBA 3PX2A 5HYVA 5I5GA 4LFBB 3E3LA 1Z47A 2WA1A 2RD2A 2RCYA 3L8EA 5JMPA 2ODBA 2JFFA 3ML1A 1JI0A 1UBRS 1ZMOA 4FLFA 4BKMA 1J23A 4IX1A 2P3SA 3QSYA 4XGNA 2FGJA 1WXIA 2ZRPA 3IDQA 3HNRA 5IK2A 1XG5A 3ZG6A 2ZZNA 1OFUX 3C7CB 4RH0A 5BNWA 1AK1A 3IAHA 2ET6A 1US8A 2HSJA 4GUDA 2G80A 2C98A 3PC3A 2A8YA 1XTRA 1EFVB 2EHDA 3HDHA 5C8DA 4RGYA 2QK4A 1GCAA 5JJ5A 3ZGVA 2FKAA 5HDQA 4XQCA 4KR2A 4DEVA 1O9BA 2NTJA 3NS7A 4HDMA 2DE0X 3IP9A 2OMEA 5GIPE 4ZWNA 2I6SA 4IWXA 3CJRA 3VHRA 1CY7A 2ODPA 3TOZA 1PSDA 3B9PA 3EY4A 3GPIA 1FQOA 2R86A 3LYLA 4NMHA 3W2EA 4CQNA 3D9QX 3B7PA 6ABPA 5FNZA 3MPUA 2Z56A 1S9HA 1JRLA 3S2FA 3VOTA 1MRNA 3E23A 3KD2A 4PX2A 4EZEA 2E4YA 4M83A 4ZXFA 3O1LA 4WKBA 1LVGA 5FO1A 4NBTA 5H3CA 1CZHA 3IKLA 2BHTA 1F2VA 3TFQA 4F5EA 1FXUA 2RIRA 3ZGXA 3L0OA 3AM1A 1C14A 3PE3A 1FU8A 4CBVA 1SZDA 4G8JA 3ROQA 2YHIB 5SY4A 1PK8A 4MO9A 2FSIA 5F1PA 3CONA 5ALRA 1XCLA 3RBVA 1XQ1A 3MCWA 3KXKA 3HH8A 3O92A 4D4HA 4EFNA 2PTGA 2PSFA 2NP6A 3AY6A 2E55A 2NU6B 3CNLA 4QVGA 4GX0A 1WD5A 2Q5OA 1WW8A 4Y1RB 1PAUA 1XEWX 5DLDA 2E5FA 4YREA 4L08A 2CXQA 5B4VA 4GFDA 4C0LA 1K6JA 1S2IA 1E6WA 1WL8A 3MCTA 3R6TA 4BFVA 1W1WA 3PF8A 3S2ZA 5FD8A 1V16B 4NK4A 4PFKA 3WLKX 3SP1A 5B1HA 3LT0A 2ZBEA 4YVFA 3II6X 2WIKA 4X91A 1LF0A 1NMYA 3ICOA 5D2CA 2QR2A 4MLZA 2ZIVB 5JR3A 3M34A 1QPZA 3FTPA 1MVLA 1N0VC 1Z4IA 4MVJM 2CVQA 1YB4A 3MAJA 1JDNA 2F3TA 4X6LA 3DE6X 1C8BA 1QCZA 2ZCVA 3IBYA 3W9YA 1P6UA 2ZRBA 3R5JA 2GXSA 3VH4A 1QSGA 2GXAA 1J1UA 1R5OA 1NF8A 3NJRA 3K96A 4V1CA 2QE6A 3K6RA 5DT9A 3ROFA 1ZN9A 2HPHA 4EA8A 1WO8A 3HCCA 4F3NA 2H07A 2AXPA 2GPYA 3BWYA 3RI3A 3ZDQA 4E5KA 2DERA 2FWBA 2XNDD 1KEWA 4HF7A 4CV0A 2GAJA 1MH1A 4MV5A 5HRAA 1S6YA 1NXVA 4GPEA 4IH9A 4CW7A 5JFOA 2X15A 4KYTA 2FUNB 1M34E 5ALLA 1QUFA 2V74B 3BCUA 3HKDB 3T3EA 4FB5A 1W0JA 5C46F 3A4MA 4HY3A 1SVWA 3R5SA 2O3JA 3QKRA 1WEHA 4PZEA 1DELA 3MTQA 4I6JA 5E1BA 4YMGA 3F73A 3ZDBA 2PL9A 4YAGA 2ORWA 3RRFA 4E51A 2K6GA 3EAQA 1QHXA 4UQLA 4DN6A 2EU8A 1D7OA 4EJSA 4JWKA 2FEWB 3BXHA 3BERA 1KZ7B 3D8RA 3MB5A 3T4PA 1E3JA 1FNCA 1JSLA 3PIRA 4KXQA 4N47A 2ZRIA 3DZGA 4QBIA 4LJ5A 4AX4A 3ZBTA 1BYIA 1JFFB 2GF9A 4YJKA 3CA8A 1W85A 2D1TA 2WJAA 1MFZA 5D51S 4G63A 2FUEA 4PZCA 2P9YA 3O0TA 4I1OA 5EERA 2WUDA 3HXLA 3MXTA 1TL7C 2X0RA 2BHRA 5HUJA 3A11A 1T5LA 4LI0A 4RTNA 1BMFD 1DL5A 1PLKA 1X7HA 3SZ3A 2F9LA 2L2QA 3RWMB 4F85A 2Q1XA 4R8LA 3ZC3A 3F3SA 4CKBA 1E8NA 2Q5HA 2VP9A 2ZJ6A 4OO3A 3SAJA 2EWVA 2P5SA 3WJ7A 4E5YA 4KDRA 1TI7A 2ZCUA 4PGAA 3NHUA 5A0TA 1GNTA 3PXEA 4FWIB 3CZRA 3TVYA 1E2FA 1F0YA 2FRDA 1JG7A 1RXSA 1NIJA 2PUTA 2PV7A 5AVYA 3HVUA 5CM8B 3SNKA 2B83A 2RAVA 4JY7A 5ESWA 3HMKA 5KO2A 3OQJA 3HEMA 5DK6A 4I19A 5A0FA 2GPTA 4QOIA 4FMDF 4XGRA 1PQYA 5H59A 1SVSA 4Q9AA 4MKGA 4R3WA 2FFQA 3V8RA 4UULA 4OQQA 3BX1A 3OP1A 5LD2B 4EY3A 1HG1A 1OY1A 2WE8A 2PU5A 2YS7A 2WF5A 4ZVRA 2W0SA 2RHTA 2YWGA 3A9UA 4GXRA 3GG2A 1U0BB 3A3OA 4C14A 1GTVA 3OJEA 2XUOA 4BLWA 4X84A 3THYB 4YGXB 1W2HA 2G6TA 3ZU3A 3TTSA 3V6LA 3LQKA 4Q1CA 3A6LA 1DTWA 2A9PA 3DE0X 5LIRA 3ZVLA 1K8QA 1T5OA 2HAEA 2JK0A 2P2NA 1GTL1 2FZ5A 4F1KA 5KYGA 1N5RA 1DIOB 3MJCA 1KZGB 1QQ5A 2HA0A 3AJDA 4L4ZA 4WFIA 3OWXA 4X85A 3L7AA 3ZXXA 3WRWA 3G59A 1LD3A 2F67A 1ODKA 1SXGA 1N78A 1SKUA 4LJSA 4C01A 4X7RA 2D8MA 3DAPA 3HZRA 4ZQEA 1C4XA 2JGRA 3WK7A 5CA0F 2Y4NA 1LLDA 1BROA 1VCHA 2WD9A 1P19A 3KWMA 3MXOA 4G4IA 4LQLA 5ED0A 5J5VA 4CODB 2VUHB 5E6UA 4ENVA 1QBKC 1U9YA 4MUYA 4YX9A 2O8NA 1RMQA 5KWEA 3TNYA 1DKPA 2ALJA 2I4OA 3FWPA 1P75A 2JLAA 1AQUA 2PD4A 3NZEA 4OYLA 3ZHCA 4GXQA 5A1JA 1N3YA 4G0PA 1A3CA 4CWAA 1JQJC 1E2HA 1ENYA 1KIMA 1Y7LA 2WVHA 4JSYA 1PV1A 2PAFA 3KOXA 5BSRA 2PH3A 1A8HA 2AX4A 2P9JA 3K9BA 1JVSA 3QI2A 4IS2A 4NYIQ 4U2FA 3NNDA 2BDTA 3KVRA 2FDXA 3EGDB 4S1VA 3HVRA 3GK3A 3F5DA 4HGRA 2GVDC 2PKWA 4DCVA 5I7OA 4L8LA 2WWYA 2WJ6A 2C84A 2AQ8A 2Z4SA 2ZWPA 3K1ZA 4Q4LA 5JDCA 3SEQA 3MMZA 4CEJA 2VWPA 2HCFA 3KTAA 4MUKA 3SHWA 3FM9A 1U7WA 2V6BA 2DBZA 4OA5A 3SICE 1FF9A 1V1RB 2Y1KA 3W34A 4C4TA 4BQPA 2OQRA 2YJZA 2UV8A 1ZLXA 3GRUA 1SXPA 5LN1A 4PIMA 3ZHQA 2QT9A 3QJGA 2XX3A 3LBIA 1OXSC 1IBSA 3O4JA 3OC6A 4HRVA 1VE9A 3WGUA 5B1EA 3SM3A 4OHRA 4LVUA 1S02A 4HLQB 4QTXA 1SKYB 1QB8A 1GZHB 2FPGA 2GO1A 3BJZA 3QEOA 2GHIA 4AKTA 5I3ZA 3JYNA 1KQOA 3UMCA 5B55A 4GBJA 4X60A 1NVVR 1UWLA 2PGAA 2JAHA 5B2ZA 1N3IA 1CYEA 4AWBA 1TTQB 2SBTA 2IYNA 3BCSA 3UK0A 2CHGA 5I8WA 2PUCA 3TRHA 4OUDB 3BE4A 4H18A 1SQGA 4LMBA 6CHYA 4UTVA 3ISVA 4CIDA 1FDIA 3AGQA 1WZUA 4MVWA 1Z4OA 3VV2A 2PKRA 2V7BA 3KSMA 3T99A 4DPMA 5IX8A 4KVFA 3R9XA 2A9VA 1RKXA 2Q0QA 4Q3BA 4RNDB 3PI6A 1JEQB 2WNHA 4BLRA 4RM2A 2F1KA 2B4RO 1ZGCA 5JZVA 2VJQA 3WICA 5K4HA 2REQB 4ZCQA 3EASA 3UJ9A 5AW0A 1B6GA 1U0TA 4YV2A 4MDEA 1WV0A 1J00A 3EUEA 3E9YA 1FTWA 1BCRA 1EUDB 2EKQA 2NVOA 5EIBC 3W6OA 4ESOA 4A36A 4ZAWA 2FPXA 4FYWA 4RYDA 521PA 2HA7A 3NWOA 3ACDA 1WVGA 3TZBA 2AWNA 3VTAA 4LZZA 5E9JA 1E5XA 1V4BA 3OQ1A 3QPBA 1VLMA 2HK6A 3IMFA 1KOJA 1S3FA 1ZBQA 3PDHA 3EXEA 1QNFA 5J2UF 3FSGD 2OD2A 4JC8A 4PZPA 4BPRA 2VJDA 3ZDDA 1QAMA 1YH3A 3OPYB 1X8LA 4OHMA 3KYDA 1JNXX 1TZCA 1Z5UA 2ZAIA 3FMFA 3OZBA 1NVGA 3Q7EA 2EJWA 2JGJA 2F59A 3H3XA 2FZ4A 4L9WA 2WSSD 5BN5B 3LLMA 3LFUA 1FBTA 1XTIA 3PLNA 4GKAA 2PFKA 3KZ1E 1M1YE 2XD9A 3G49A 1L4BA 4IIJA 5D87A 5KYUA 3RF7A 4F5YA 4Y9DA 4JP3A 3MM4A 5ALIA 3WK9A 4W63A 1B4DA 1ECJA 4OJTA 4HNRA 4UU8A 4BP3A 5DFAA 2PUAA 1SQ5A 3KUXA 4HNSA 3UHPA 5BR8B 2FZCA 4OUKX 1C7RA 4Y6RA 5MN5A 1YI0A 2AKAB 2FHSA 4LMAA 5DIFA 2VF5X 1PF7E 2FW7A 3AUKA 1QDUA 3I62A 1ZMBA 4HNVA 2YJ6A 5J1SB 3FROA 4OFWA 4OB7A 4P4NA 2ZT5A 3UOAB 1MX3A 1JMKC 3EIQA 2PMBA 1R0SA 1XI2A 4DW8A 5TV2A 4RXUA 3QGMA 3GRFA 2XWBF 3BA1A 3KHKA 1H1TA 1YI8A 1D2GA 3EDOA 3LY8A 1DRUA 1XHFA 4ZI5A 4QU9A 3N70A 2EIXA 4ALLA 5LUAA 2OT3B 1RYDA 2CDRA 2WA2A 4TLAA 3Q15C 5H3LA 1AH2A 2H1HA 2QUZA 5FQOA 5D6NA 2BM1A 4NAHA 1XFDA 1EQUA 3HNOA 2O3SA 3ZOZA 4QXPA 1HFEL 2CMKA 3R8XA 1JW9B 1XXLA 4Q02A 3DUFA 4RA6A 4C1NA 1XZIA 4UVDA 3FLBA 4U2KA 3ZCSA 1CUUA 3DYIA 4L4YA 4TSFD 1BVYF 1K5GA 4G0MA 4ZVOA 1N0HA 5AUPB 5GAJA 3WQSB 3GJXC 2J0UB 4BFTA 4C0WA 7GPBA 4UPVA 4ASUA 2YWXA 4QQKA 5FI5A 1NFRA 5L7TA 1ORRA 4NU8X 5DBGA 5BQXA 4H27A 4INPA 5KREA 2B2NA 4AY3A 4BMPB 2XVZA 3OT5A 4D0SA 4LHZA 5L7WA 3NYIA 2JIDA 1MAWA 4B2IA 2MINA 3EXHB 2X7JA 4MYHA 1JKIA 2RB4A 5IH3A 4I5FA 3T3MB 3ZQ4A 1R7RA 4PTLA 2RGRA 4B8YA 1JFTA 3VU1A 1XTPA 1LZLA 1XVAA 4N18A 3QJYA 3A4IA 2DEUA 3EDCA 4J3FA 2FFAA 4QQFA 3UH1A 5LZ4A 1EESA 2FR1A 2E4AA 1RCUA 1PS8A 3ZVKA 3UKOA 1EHYA 1ENOA 1SC4A 1POWA 5JW6A 3WB1A 3O74A 4AP9A 3FI0A 3VH3A 4JUFA 3JAKB 2QBYA 3D7RA 5EA2A 2Z4TA 1M1XB 4KVAA 2QN1A 2R6FA 2GARA 4PHFA 4M0LA 4PCAA 4CUZA 3FPLA 1Z0ZA 1FY2A 1ATIA 4Y0VA 3LBFA 5EMJA 2O2JA 4D3DA 4I5GA 2OHOA 5A4JA 1UKZA 5I7VA 5IULC 1DKQA 3ET5A 4F1JA 1L1FA 1DE0A 2R2AA 3X43A 1TCVA 2HLDA 3ME5A 4ZOLA 4AO6A 3KOWA 4O63O 1OA1A 4Q37A 4YEDA 4BX0A 4F9FA 2R1VB 4M4SA 4BN5A 2GAAA 1W87A 1DKOA 1VMDA 3DBLB 3QPDA 3DOHA 4YJGB 2R7LA 1RIFA 4FGZA 5BYKA 3KU4A 3HVHA 3TSCA 2H65A 3AR3A 2IYLD 1YZFA 1ZHHA 2CZQA 1NYTA 4FNAA 3HCNA 2I3DA 6AT1A 4B71A 2I22A 4HX2A 2OXRA 1Z2PX 1J5EB 1O4VA 4FFVA 4YJFB 3LE8A 3V32A 4KNVA 1E1NA 4FGJA 1K06A 1EFAA 3FGZA 4PG4A 4BCDA 7REQB 1V4VA 2BZGA 3G2PA 3T1HB 5A7HA 3E18A 4TYQA 2QTHA 1VHJA 5E4TA 2GM5A 3PJDA 4J91A 1G0OA 2P2ZA 2A5GA 2WC1A 4FLMA 2G63A 4CMCA 1RXYA 1IUPA 1ETHA 2FW9A 3MCZA 2H1LA 3PD1A 4LF9B 5EKXA 3REFA 4W5QA 3R7WA 4HLCA 4B2PA 4OGWA 3H9EO 1WNTA 5HXAA 3DWEX 4OGLA 1DX6A 4RGQA 1XZPA 5DCYA 1E58A 2QN3A 2XUKA 4KO8A 3UYKA 4Q66C 3TD9A 5IT9A 1UJBA 3S2YA 4AJEA 4DG9A 3D1JA 3ER9A 1C30A 3ZHOA 3GFBA 1ECBA 3ABQB 3OTGA 3NUZA 5TT1A 4N5DA 3AUSA 2WJVA 3JR3A 4TQGA 3BF8A 1P5ZB 4QASA 3HC7A 1E92A 3QMPA 4YUXA 1ZYUA 4HOYA 1M8KA 4DLKA 5IZCC 3AXSA 3DMDA 2ZJ0A 1C0LA 3RV4A 3GR6A 1IK4A 1CQXA 5H9VA 5JYCA 1ZC3A 2OCBA 4KYIB 1FRNA 1KQGA 4OBWA 4YHBA 5ICSA 3I32A 4MGYR 5EFZA 4CKEB 1NNI1 4D3ZA 2BUBA 1MO5A 3ZCTA 5A05A 4BNJA 2NMVA 4WVFA 5FQNA 2B9EA 3UIEA 3W5AA 1NT4A 3PYMA 4M7OA 4U7FA 4YRLA 3SQOA 3L1KA 2JF0A 3G6WA 3VJRA 2QTAA 5HOQA 1X7YB 3LYUA 4H35A 4R3UC 1DIGA 3QXXA 3SX2A 3OCYA 2IZ6A 3OT1A 3UZUA 5KX5A 2XMQA 3PLAE 3I4FA 1AK9A 3U39A 3VZRA 1I4EB 2IKSA 4JSTA 5F52A 2EC5A 1EK5A 4HPJB 4JJ8A 2ZQYA 3G0IA 4FHZA 3RVJA 1G98A 3MNFA 3MOIA 4BTLA 4ZHQB 5FAKA 2QM3A 2NO1A 1YQGA 3RSSA 1YR1A 1U0HC 2G77B 2WJGA 3ED1A 1E94E 1SOVA 4MPRA 1E9RA 1UR5A 3QE0A 5AQEA 1J9ZA 4F96A 3FG9A 4Y6OA 1P8AA 5LP6C 1BO6A 3A1FA 3L49A 3DXYA 3KQKA 3NIGB 4DMUB 4GXTA 4AKSA 2UYGA 4S1WA 1XMIA 2PJDA 1DEHA 2CEAA 1XPOA 2XADA 2W6ID 4ZREA 4FR2A 4UXJA 4JL8A 1JXQA 4G01B 3T0FA 5JZ9A 3LUAA 2JFZA 3HWX1 5DW0A 1II9A 2BFDB 2C4WA 4E1AA 2PAAA 1M5RA 3IEVA 3I83A 1I1OA 2JGKA 1I2MA 2W4MA 2ZVDA 1QGZA 2Y0BA 4QGSA 3E81A 3U9TA 2W43A 5KVCA 3C39A 4Z9FA 3EIEA 2ZM5A 1YUNA 3AEZA 4P4LA 4A8JC 4B76A 4V0OA 1Z6ZA 1A7AA 1NHWA 1VRWA 3T9DA 3WK6A 1FP2A 1GSIA 3UGQA 3H86A 5C35A 4MRPA 1DSSG 3KVVA 2Z2KA 4ZVUA 4LDQA 4N5IX 1IE3A 4RAOA 1CD5A 1ZMRA 3GUYA 5AI9A 3H3JA 3SIPA 1H2BA 3BE5A 2WJIA 1KORA 4CI9A 1WULS 2QTCA 2QJOA 1ZL0A 5BVGA 2R1ZA 3G8AA 4YWHA 2IHBA 4YUYA 1J7JA 3DQZA 4M9UA 5ERGB 3T7RA 4F4UA 3HN6A 3MA0A 4X71A 1BGXT 3EIFA 3RIHA 1I13A 2GYUA 2ZSUA 4NCHA 4B4UA 1YS1X 2X3YA 5IPFA 1B6SA 3GUZA 3DO8A 3M3HA 3N53A 2XTNA 1SQSA 3RYFA 4RACA 5K0CA 1OBCA 2GM3A 5LYJA 1U8ZA 1EWRA 4U2CA 1KDRA 4GPAA 2X3FA 4LN1A 5AHKA 3MGAA 5C4GB 3SKXA 1EDBA 4JLSA 1QG0A 1T4CA 3KUKA 5A3SA 4BO1A 4FEAA 1FRVA 4X20A 3BFPA 3HQ4O 2OVBA 4IDPA 3D7MA 1I3OA 4B4VA 3OLWA 5D6OA 2LR0A 5JUWA 4PLZA 1OYVA 1DU4A 1FTGA 1L7NA 2G4CA 2VPQA 3EJ6A 4L5YA 1ZH0A 4MKRA 5DH9A 3V5NA 5F9HA 2XJ4A 4O08A 2YHBA 3FSJX 3I53A 2XB8A 3IV6A 3W5JA 1P80A 2AVDA 1UZLA 2FLVA 2GDJA 4URUR 2AFIB 1Q1ZA 4DM4A 2BGMA 1FEZA 1TYCA 4EFDA 1JSZA 4YP5A 4I50A 3EY9A 4C4ZA 1JPVA 4OH1A 1I1NA 4K26A 4KZPA 4LMPA 1WBDA 5AQ1A 1MB0A 2C5FA 1Z6TA 2DLDA 4IW3B 1V5FA 1FMCA 3VZQA 4JI0B 5E8JA 5JT1A 1W46A 5K8LA 4G86A 2W8ZA 4BEVA 1ZUD1 2F6RA 4B33A 3KR1A 4I1PA 3FHJA 2IXAA 4L27A 3O84A 2Z2YA 2N42A 4JXZA 1TM7E 3QEAZ 1O94A 2BJHA 3AGPA 4QYWA 4E3ZA 4KPEC 4DR5B 2YMMA 4S05A 3P19A 1ZG3A 4LVNA 2IDMA 5ALYA 3UXMA 1FFXA 2CVHA 4YASA 3HVJA 3RVOA 4EI9A 5EJ7A 5ARBA 2PFGA 2Y1XA 4N41A 2IHKA 3GNSA 5MFPA 4OMUA 3NHWA 6REQA 1E7MA 3BJRA 3M6LA 3C70A 4ZFNA 2NU9B 4KR6A 4AQDA 2WRZA 4YRMA 1Z6XA 3IXLA 4TROA 2WZBA 1N4AA 1KK3A 1JU3A 3AJ8A 1G6KA 4E22A 1TT5A 3HR8A 2QJFA 3MWKA 5C34B 1TYEB 2CFOA 1E63A 2QSUA 3QA3E 3J7TA 1JIQA 4EL0A 1WG8A 4EVSA 5IH7A 2KMLA 4RPKA 4M0CA 5DRTA 1TA0A 3ORRA 3ONFA 5ENZA 3HZZA 2J3EA 4MEBA 4EIWA 2E4UA 1E9SA 2V7QD 3IEMA 4PVDA 3WYFA 3UWOA 1VJTA 3I2GA 4CIXA 3JARB 3ADCA 2AZ4A 5KC9A 4L7VA 3GJ5A 3RKSA 1L6IA 2QQFA 2C5SA 1GQYA 4V39A 1P3JA 2CFSA 1ZIOA 3L0SA 3DEIA 4MAMA 5IT4A 1B0UA 1NUSA 2IYUA 4KGDA 3ZCRA 1VMKA 3O1JC 4PHCA 1N7HA 2XCRB 3CLUD 4U63A 1NVUQ 3NWEA 3V3TA 3K70C 2CMFA 2O2SA 4JI2B 3DSRA 1P4JA 2NZXA 4JK3A 3SYMA 4BNYA 2BIFA 1MV8A 5BNFA 3RS0A 4J1SA 3CBQA 4PO9A 5L8VA 2RHCA 3CUSA 3ROPA 3MRVA 3L6BA 1ZS9A 4YN3A 4P1ZA 2ZYTX 4DV5B 4GI2A 5FBZA 2PH1A 1IU9A 1F8XA 1XGKA 2WB4A 2WMNB 3AC0A 3DOJA 4H3KB 4I4TF 1DQSA 1I3KA 5BN3A 5LQUA 4JYBA 4MWBA 3CE6A 1GGKA 3HDYA 3RRBA 1IJKA 1V8PA 3LUPA 1UKVY 3DL2A 3UJ3X 5IYZF 2O2DA 4EQ6B 5C5EA 1QCDA 1Y5MA 3QLJA 1PJCA 2JRLA 4H7EA 3HXQA 3FDZA 1O95C 1VI2A 2YBDA 1GCIA 4XGKA 3D6FA 2C83A 3OZXA 4XTRA 3K6KA 4MR8B 4YV0A 2RHBA 3HM9A 2RI0A 3FSRA 1D4ZA 3AILA 1YS2X 1VP9A 3QOYA 3TXAA 4U3JA 1YBFA 2QN2A 3RDPA 4JGBA 2AOTA 4CMEC 2JJ8A 3OX3A 3AG6A 3M4XA 4RZ2A 5AK0A 3G68A 2CF5A 2ZRJA 3IBGA 3DHVA 3NC4A 5TQ2A 3UT5A 3WLJA 2NSYA 3SDBA 3GPDG 2X2PA 3HP4A 1WUJS 1T0JB 4H59A 1OLUA 5FL7A 1RE1A 1GLVA 2PBFA 1PSZA 4RMHA 4NNJA 4F5ZA 2ZBUA 3BXFA 1BS1A 5F64A 3VPHA 1XRQA 3QWHA 2QSJA 4P2GA 1M8GA 5LKRA 5K8TA 3GB9A 2GD1O 5AM4A 3EG9B 4EP1A 1L4HA 3I8XA 3G2LA 1DFHA 3HB7A 3RUFA 4BMYA 3QEBZ 2A94A 1R00A 1O77A 1RHUA 1T3ZA 1TF2A 5DYWA 4A2CA 4CQMB 3KBOA 4IOLA 4PC7A 3VPXA 5K1ZA 2B82A 1NW7A 4QGBA 4Z1MD 2PL1A 1ZIDA 4BLPA 4XFJA 5KNDD 1DC7A 5CFPA 1ZFNA 1YCHA 5JNUA 3TZCA 3DEHA 4UZEA 3AV0B 2OLKA 1L3IA 2RMKA 1BXKA 3DLBA 1L5HB 3ECCA 2AN1A 3DB2A 3R6WA 5H4GA 2IBTA 1BVHA 2BR4A 5I8ZA 5LMZA 2IP4A 1INLA 1XSEA 1CUBA 3P45A 3D31A 1G5FA 3VBCA 5CD9A 1LBIA 2ZRLA 2M32A 3C3PA 1KRHA 3NGXA 4J9VA 4GQIA 1P7CA 5HF5A 1XO1A 4MQMA 3T35A 4A6DA 4CKXA 3VZBA 4TRRA 4LNAA 2PIAA 2PR2A 4Q1BA 5B7NA 4RABA 2LWIA 5IXSA 5H4HA 3H1TA 3KPYA 5CFRA 3FCYA 2PGOA 2Q5EA 4K6OA 2X8WA 2QAGB 3OP4A 4MULA 2WYVA 4Z0PA 3W8RA 1DJQA 3KVYA 4GX2A 3WYGA 1I7QB 3BJIC 3HO8A 5D3KA 3T7DA 2IPOA 4PO3X 1T4BA 2OC4A 3ZGOA 2YHAA 4GOXA 2XHEA 1H94A 5DI3B 4BFLA 4H1UA 1PUJA 3K0KA 2X5KO 2R7KA 2PEYA 3IP8A 4P5PA 3T15A 1C41A 2WJHA 3D6VA 3EEQA 4AYWA 1E6UA 3GA0A 5FWXB 1C0IA 4QOGA 2GTIA 3H5OA 4LC1A 3QITA 3T5PA 1UBUS 1Q7CA 4HNTA 5KYXB 3MSCA 3CU5A 3PWTA 3OZRA 4XJVA 5BRJA 2WT9A 3H18A 1R5JA 3KPVA 3NATA 3QNWA 3ZZNA 5KTKA 3MMNA 2D54A 3KJZA 1T9AA 4AUNA 3UUFA 4Q3KA 2V6MA 3PRKE 1N5LA 1V8ZA 1ZD4A 2FUG6 3AINA 3KHTA 1T6NA 2DBVO 3TW0A 4JODA 1LGYA 4PLHA 5CP8A 3STXA 1NRXA 2HDWA 4Q7QA 4EG0A 3WRXA 1XEFA 4YCMA 4DUPA 2C29D 3OEHA 4G5RA 1ORIA 3HY4A 4L9AA 4GL2A 2F1HA 1L8AA 3KAKA 4U8GA 4CQLB 1ZU4A 1XTZA 1V6CA 5JS2A 4KIGA 3L77A 3UGTA 4AZVA 4M1ZA 5EESA 4PYLA 2HO4A 1Z3CA 3BICA 5CGQB 4YIKA 1I01A 2PZMA 5E6RB 5IKMA 3UWMA 2FEOA 3L8CA 4EI7A 1P31A 1X19A 2P9EA 2DP4E 3C15C 3ROEA 4RBNA 3FZGA 5IP5A 2H4YA 4LF8B 5GGYA 3C8MA 5BW4A 3DVSX 4RVCA 2C5EA 4L4UA 2ODTX 3O6VA 5A06A 2ODWA 3HYCA 4KUGA 2NYAA 1E2MA 1OBVA 2CMGA 4KAXA 4BKQA 4AY2A 4WK0B 3GDGA 4LYYA 4D9KA 2HBQA 1H1LA 1UT6A 1GG5A 2YY7A 3DTTA 3IQZA 3R44A 4D4JA 3GDWA 4C89A 3O21A 2XCLA 2C54A 1I0LA 4GD3Q 4IDDA 3KQSA 1L1EA 4IEEA 4QVKA 4RPJA 4E21A 1L7PA 1PJZA 3BTUA 4DUYB 1M3SA 4WXYB 3H16A 3QUQA 3AV3A 1JN0A 4AD8A 4PAMA 4AUEA 1WOYA 3DBRA 3KSDO 3LQYA 3WWCA 5HKBA 5A0VA 1DJMA 3WGIA 1KVUA 3CUVA 2YUIA 3PC4A 2UZ0A 2JS7A 3CH4B 3L6OO 2PLAA 3MTGA 3G79A 4BVJA 2PA0A 1J8VA 3F4BA 2VZ9A 4QYSA 8LDHA 4CMHA 4ZICA 3BCHA 5BWMA 3P8ZA 4E2ZA 1KBOA 3VO8A 1PBNA 1U6KA 4JNKA 3SK0A 4CJXA 1UANA 3L6RA 1CF4A 1RT9A 3R2JA 3G8BA 3HB5X 3WDSA 3PC6A 1W36D 1C7ZA 4DZZA 1Z39A 3N6VA 2ZW9A 3OEED 4GR5A 5C37A 1I9GA 4HAIA 2AVNA 4YPFA 3F2VA 3S1AA 3D2AA 4ZT6A 3K6SA 4QQ8A 5F3WB 3CXRA 4GU5A 4WX2B 3ZQ6A 1VXRA 5HKOA 4YNBA 4IY1A 1NL3A 1SC6A 1YZTA 5KMGA 4TXNA 3PRJA 1OXTA 1RMTA 4A0SA 4E88A 5CCXA 1C0KA 5LA6F 3OX4A 3EZLA 4XR9A 1W8IA 1EFKA 2DCUA 3R6LA 4GNKA 5AICA 3AJEA 4ZT3A 3U9LA 2OZEA 4TLBA 4Z7OB 8ABPA 4MVCA 2QDXA 1DJPA 2DFPA 1EB8A 3A6FA 2IGBA 3OQIA 2HA6A 1T8RA 2EP7A 1G6OA 4RS3A 3DPUA 2P4SA 3T5GA 3C97A 4QUGA 3H7AA 1ZSYA 5AVVA 4PLPA 1NF2A 1UDRA 2H17A 1C7EA 5A5FA 2DBRA 2XI4A 3MPOA 4PZUA 3OBBA 2MR6A 3BQNB 3NFRA 2Z2IA 4GOND 1YVPA 1EINA 2G5CA 3GZNB 3V48A 3L01A 5EIHA 3CINA 4RANA 4J0FA 3ZXIA 1CQIA 1ZOSA 2GPWA 2V6GA 2UVPA 3ZIAA 5H16A 1N3BA 2IH2A 4GG1A 1CYDA 4YQYA 3R4CA 5G0UA 4F2GA 3B6KA 1E3IA 3ANXA 1GFWA 2OBFA 3T61A 3TQFA 4ENTA 4W99A 3TIGA 1B16A 3MJSA 4RULA 3KSAC 3DDWA 2RCNA 2VF7A 3LJKA 1QHSA 3Q85A 3JAWA 2EG5A 2ZTVA 7AT1A 4KTTE 4BO7A 1HWYA 5AK4A 4PIVA 2QDKA 1TVKA 4Q9IA 6GPBA 4EHNA 1Y1TA 3C14C 1EVZA 4GOLD 3Q8MA 3OM1A 3DKVA 4PZDA 5EC8A 5LKAA 3ACCA 1BS2A 1J70A 4QHSA 2GN1A 2C4MA 4QECA 1QGYA 4PQEA 2CYBA 3R24A 1EUYA 4NFHA 2LXNA 2VJOA 3OUUA 1PWZA 4BS9A 4DIDA 1QDEA 3C3JA 4J2HA 5EWMB 2QMQA 3IYLW 4J3NA 4PRLA 1PRYA 4JJ7A 1ZGHA 2WIGA 4DADA 2CT8A 3LY9A 1R9MA 1P7PA 1TCBA 4KQ1A 1UADA 4YCAA 2C1ZA 5ALQA 1PGQA 4W5TA 2WKQA 1RCTE 1L7RA 3B1WA 3OPMA 2DQYA 5KSPA 4J0GA 3N0TA 5BSMA 1ISSA 3HDGA 1U31A 4UEOA 4R9VA 3RJTA 3WTBA 2HGSA 4ZALA 4U8HA 3TI9A 2EFEB 1ZL2A 2VQ6A 3GDOA 4QJ5A 1KXJA 4ZDJA 1XZCA 2QI9C 3JQCA 5MGNA 1EWYA 3PUZA 4WUTA 2C31A 2VSYA 1XJQA 4LOJA 3LKDA 4F45A 1ECGA 3O5AA 2V5UA 1RIIA 3D8SA 3VPBA 2WIBA 1E7RA 4FYJA 4FZVA 3NIDB 4HZUA 1UDBA 2IYOA 3CLTC 3BYZA 3ZJYA 5DM0A 3ZH2A 3GLGA 1R6XA 2HIGA 3RNLA 4EX7A 4K9RA 4R9SA 3G5TA 3AEQA 3BWDD 2GAIA 1B6TA 3EVEA 3LLCA 3VR1A 4MJ3A 1JEYA 4R31A 1ONSA 3FPKA 4LWPA 4H1HA 2H3EA 5CDHA 4W9MC 5CVUA 5FOTA 3VBEA 4YAWA 4UBMA 3G0HA 2YFYA 1PFYA 1PR4A 2VTDA 3RS9A 3TG2A 3RT1A 5TF4A 4YUWA 2VZLA 1Z7EA 5GJWC 4JLVA 1REQA 3LUHA 1T2UA 5K4GA 4ZMRA 1XZHA 2CMHA 1HKHA 1II8A 1LTQA 1TO2E 3DLPX 2EP8A 4K7JA 5JSZB 3FH0A 2VZEA 1T9HA 4JX8A 5JZSA 2X77A 1VIAA 1T24A 4DDMA 2IPXA 3GEMA 4Q9KA 1VKRA 1TJ4A 1TVMA 3MWLA 2X2OA 3FOAA 3H4MA 4PWYA 5KWSA 2PBZA 2NW6A 4GECA 5T7BA 1TGYA 9ATCA 1BXGB 2J6BA 5CFMA 2ZREA 3O95A 1B0ZA 3K0EA 3M5DA 4JBNA 1R6VA 4LRTB 1TCUA 1AGPA 4TTRA 3HJHA 5B12A 4NV3A 4RA9A 5G1PA 4AJ4A 4Y6GB 2C42A 3Q9LA 4PSAA 1T8PA 5TQ0A 1IVNA 1CJCA 4JASB 2YFHA 5FUBA 5CHEA 1PJAA 5ITZB 2BFAA 2NYUA 3NAZA 2FWPA 4ID3A 4IGKA 1SWWA 2EX0A 2FSGA 4TRJA 4CN9A 5C3MA 4TYYA 3V8EA 5FHRA 3FFXA 2Q4TA 3HYLA 2O2ZA 3Q8KA 4PAOA 2YRXA 3QBDA 2DPXA 3T7CA 4I4CA 1P2DA 1LEHA 1UP7A 3W1VA 1W88A 3KXLA 4CMAA 4HUTA 2MJLA 4URXR 3GYBA 1NN0A 3EGXA 2V7WA 1H42A 1YSCA 3HBFA 3KHSA 2P8SA 3Q3IA 2BFWA 1L3CA 4HQRA 4IJ6A 5GINE 4X54A 2MU1A 3VR5A 3I9LA 3C41J 3KEQA 4LYEA 1DINA 3VR3A 1FU7A 3ECSA