5I4CA

Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
b'NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein RcsB
molecule tags Gene regulation
source organism Escherichia coli (strain k12)
publication title Crystal structure of nonphosphorylated receiver domain of the stress response regulator RcsB from Escherichia coli.
pubmed doi rcsb
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5i4cA00
3LUDA 5DGCA 1RXIA 3DLBA 2MSKA 1SRRA 4G0OA 4MS4B 4RU1A 3HCWA 5TPZD 4D74A 4H60A 4H3KB 2WJAA 3KLOA 4LRQA 1EHCA 2ID9A 5DKFA 3BILA 5DLEA 4PICA 3TD9A 1NXWA 3SY8A 1T34A 4IILA 4XXHA 1JH9A 3QEMA 2E4VA 1DRKA 2FEKA 2X7XA 1YMUA 2FQYA 3OLWA 4ZPJA 4DQDA 5JNSA 1ABEA 2JB9A 2PL1A 3O2QB 2PL9A 3QELA 4RK0A 4OLAA 1U2PA 2PUBA 4RK6A 4O1IA 3EODA 3OO1A 1Z18A 1L5ZA 3F73A 1D4ZA 1USGA 4RY9A 5JNWA 1NY5A 1FFWA 4YO7A 1LK0A 2HQBA 1YS7A 4MR9A 1PUXA 1PNTA 3EAFA 3OQMA 1LBIA 5EWJB 4EYGA 5KWSA 3HZHA 4IMJB 5IEJA 1M5UA 2IKSA 3UUGA 3HO1A 2PMCA 5E3JA 2FSPA 3O1IC 4TMYA 5TQ2A 1ZY2A 3C3KA 3CRNA 2GI4A 4IRXA 3T38A 3QX9A 1A04A 5TQ2B 4N03A 3KLNA 3CG0A 3Q41A 4O5AA 4Z9BA 3RVNA 3JY6A 3CLKA 5FWXB 1JFTA 3RVLA 1RZRA 1DBWA 4NV3A 3RVSA 4KK3A 1YTUA 4RK4A 3O74A 4KQ9A 5KC8A 1Z16A 4G0ZA 5ED4A 3HUTA 2R4QA 1JWLA 2FN8A 4ETNA 1LJLA 4Z4IA 4ZJPA 3QX8A 3Q7TA 4Q6WA 1URPA 3KYIB 4E7OA 2FMKA 1PNRA 5C5EA 4WWHA 3GT7A 3QLTA 4PE5B 3S99A 3HVRA 1NXSA 2JVIA 4WUTA 1ZHHA 3I42A 4YGXB 1E6KA 4IMIB 3QLUA 3FFTA 3A0RB 4N0QA 2E4XA 4LDZA 1Z26A 2ID7A 4MS3A 3Q7SA 4JASB 4B09A 1CHNA 3NNSA 1QP4A 1DZ3A 2L19A 1LBHA 1ZGZA 1USIA 4IF4A 2NZUG 2OENG 4RZSA 4F06A 4P1ZA 3FFWA 1QP7A 4WT7A 1OXKB 2QR3A 3LUGA 4G0QA 3SQNA 4RDCA 3CG4A 1BDIA 3GL9A 4TLLB 4NICA 5ABPA 1FSPA 1M2FA 2FQWA 3D8UA 4MRMB 4L85A 3SNKA 2A9RA 1ZH4A 3B2NA 2R47A 5GOTA 4DN6A 1Z17A 1GCGA 3RQIA 4Z0NA 5CNKA 4NQRA 3H1GA 2LBPA 4JA2A 3N6VA 4G0MA 2GX6A 9ABPA 1W25A 5FBHA 4D6YA 3DLHA 3C3MA 1U2QA 3EJWA 1D5WA 2J48A 2ZAYA 3R0JA 4QPJC 1ZITA 4KNYA 5HM6A 5KQLA 4P98A 1AB6A 4KV7A 1W9HA 5KC9A 2WWVD 5IUNC 2Q5CA 3K9CA 4EVSA 4EYOA 3E61A 2H0AA 5EWLA 5TPWB 1DCKA 4MR7B 3OO0A 3GWGA 3LKVA 1APBA 1GLGA 3FGZA 2FLKA 3OMWA 2PUGA 5TPWA 3LUJA 3H5VA 2L2QA 2HPHA 2DRIA 2JVJA 4MS1B 1I3CA 5CNJA 3H6HA 3OM0A 1VRVA 4KFCA 1KRWA 2MYPA 3TO5A 4W5QA 1A2OA 3OLZA 5DCLA 1KRXA 2FEPA 3MQ4A 4QYMA 3RH0A 3EDCA 3KSMA 3N8IA 6ABPA 4RXUA 4JP1A 4Z4HA 2IPMA 5BRJA 2VK2A 3DGFC 2E4UA 3RVOA 1IIBA 3BBLA 1C4WA 3D02A 3LUFA 4KPYA 5IULC 3F7NA 4YS6A 1ZGGA 1H9CA 1PEYA 4RK5A 2PJUA 1QQBA 3M9WA 2PLNA 1USKA 1QP0A 3OLVA 3FMVA 2RJNA 3Q15C 2RGYA 2GWRA 1DC7A 3MM4A 3BREA 4HNSA 3IP9A 5KQGA 1FFGA 3KG2A 3CFYA 3KS9A 1SD5A 4WXEA 1E6MA 3IPCA 1FFSA 3F6CA 3UKJA 1TM2A 3H5IA 2LIVA 2P9HA 3O1JC 3QLUC 3VNAA 1GCAA 4F11A 2PUDA 3I5AA 3QEKA 4FB4A 5IC5A 2MYUA 2VYCA 4YCSA 2NUBA 1BDJA 3F6PA 3C97A 1JYFA 3IPAA 2GBPA 4G0XA 4MS3B 4F3TA 3JS5A 5FWYA 5B3JC 1L5YA 4MAAA 2I6FA 2VUHB 3CZCA 3HSYA 4XAQA 1WETA 4L4UA 3QEMB 4HNQA 4RXMA 4RKQA 3LOPA 1AB5A 2M98A 3N0XA 4XLTA 5C5CA 5TQJA 4S04A 4N76A 1NXTA 3L49A 3M6MD 3QELB 2FVYA 1J56A 5TE9A 4NCAA 3ILYA 2MSWA 4N0PA 4D6XA 3VNBA 4KREA 2HQRA 2RDMA 5HSGA 3OQOA 5HKOA 1K68A 1FQWA 4WZZA 4MRMA 5KI6A 1YVUA 1MB3A 1TVMA 5D2CA 1E6LA 3NNNA 2P4UA 3L6UA 4LDAA 4ZMRA 1U0SY 1QNLA 3TMYA 2FQXA 5GQSA 3A10A 4N41A 3OMXA 1VLZA 2W42A 3RVRA 5IX8A 1DG9A 5IUKC 1P8AA 3CHYA 4YR7A 3O21A 1D1PA 3EQ2A 2FXIA 1SXGA 1XHEA 1LJUA 2WJWA 3A3KA 2YHAA 5FWXA 4PEVA 1NXPA 2B4AA 1MAVA 2FTKE 4KRFA 4LX8A 2L17A 4CBVA 1DBQA 1GUDA 4N47A 1DP4A 4G0YA 1A0OA 3LTEA 2HJ9A 1QMPA 4ML3A 1DJMA 3CS3A 4MR7A 1YK0A 1RZRD 3P9YA 1VKRA 3C6QA 3H1FA 1UDRA 1Z2DA 3MYYA 3OLYA 4YP9A 4EY3A 4EVRA 2PE5A 3QLVA 3FFXA 3NBMA 1C0EA 3GV0A 3MA0A 2LP4Y 4LZLA 5JS2A 5JNTA 1JFVA 2F8TA 3QLVC 4G97A 1F51E 2WMYA 5BR1A 1Y1LA 3HUUA 3ROFA 3N0RA 1JHZA 5KQMA 2HSGA 2F8SA 3W9SA 1NXXA 4W5OA 4RK1A 4Y9TA 1MIHA 1EFAA 1CEYA 1JLKA 1Z13A 2VUIB 4RKRA 1YMVA 3QK7A 4EUKA 3RVKA 4RXTA 3OQNA 3LFTA 1QO0D 2QZJA 1VPWA 4RK7A 4W5NA 3GRCA 3H75A 4MQEA 3UK0A 4Z9AA 3URMA 2CWDA 4JOQA 4RWEA 4GNRA 3HM9A 3ROTA 5F64A 1NATA 4YRZA 4QICA 1BA2A 5EWMB 3MF4A 2JBAA 3SAJA 1Z12A 2NT3A 4ZYLA 1JDPA 4F12A 1P6QA 1DCMA 4KQCA 2JBAB 1YK1A 1NXOA 2PUCA 3H5TA 2PUFA 3C3WA 1D1QA 3KJXA 4HNRA 3IP6A 3HDVA 4FE7A 4MR8A 1ZAYA 4MYRA 2IPLA 4TN5A 2MSLA 4MR8B 5TQ0A 2WRZA 1NTRA 4GPAA 5BQ3A 1E2BA 2IPAB 2GKGA 3G85A 4UHJA 3E3MA 3LUHA 4XARA 4XFKA 1M5TA 1TLFA 1ZDMA 2JCGA 5FWYB 5T3YA 3SM9A 3G1WA 4OBBA 3LUAA 4OATA 5CNIA 1ISSA 3H6GA 3EQZA 2V0NA 5EWLB 4YLEA 1PHRA 1EWVA 4MR9B 1Z15A 3ILHA 4JB2A 5EWJA 3MMNA 6CHYA 1R8JA 2XDYA 2N9UA 3H5OA 4OG2A 3M9XA 1YIOA 1ABFA 3MIZA 4Z4GA 5JNRA 2E4WA 4MS1A 2B1JA 4IGAA 4LE1A 2E4YA 4Z99A 1F4VA 1KGSA 3BRQA 1JF8A 2R25B 4Z4CA 8ABPA 2L18A 4KVFA 4RY8A 1EAYA 1JBEA 2NZVG 4WXMA 1RNLA 2PKXA 3K4HA 4JB0A 3RVMA 2WY2D 3DGEC 1QQAA 3A0UA 2FMHA 1SXHA 3HDGA 1ZVVA 4W5TA 1RPJA 2M1ZA 2YHBA 4RV5A 3KTOA 5IUJC 4E7PA 1BVHA 5IBQA 3IDOA 1DBPA 3FDFA 3NNDA 1M2EA 3LKBA 5IEBA 4ETIA 1BDHA 4RS3A 1OXBB 1NXVA 3LMKA 3TB6A 4HYEA 2MYTA 3HK2A 4G0PA 3CU5A 5PNTA 5HQJA 3DZDA 2A9OA 4XASA 5JNUA 2BGGA 3HEBA 1RXEA 2LUOA 2JRLA 1MB0A 2CHFA 3CTPA 3NHMA 4JAVC 4RY0A 4QYWA 1B00A 3O75A 2FW0A 4OLBA 2FEWB 3IP5A 4RSMA 4KMRA 1KMIY 3JPWA 1DRJA 5JNVA 3N0WA 2IOYA 4YV7A 3KHTA 3N75A 2E4ZA 2FKAA 2PUEA 2QV0A 4ZMSA 3DBIA 7ABPA 4NCBA 3CKMA 1D2AA 4MPTA 1QKKA 2RJOA 4KZKA 1EWKA 1ZESA 3CNBA 4O1HA 1JL3A 3GYBA 4EVQA 3IP7A 3GBVA 3I09A 1SXIA 2NT4A 5CHYA 3EULA 3HV2A 2QVGA 2QU7A 3T95A 1JFSA 1QO0A 4Q7EA 5CNMA 5BRAA 5T7BA 1CYEA 1ISRA 3BRSA 3RVPA 2HQOA 3GA5A 4OTZA 4TLMB 2MYNA 2IYNA 3SG0A 4G86A 1EWTA 1S8NA 3T8YA 5EWMA 3CZ5A 1ZH2A 3H1EA 3NHZA 2AYXA 4MS4A 1PEAA 3O2SB 2IPNA 1HEYA 4F8JA 3RVQA 3HXMA 2JVKA 3LUKA 1JYEA 3KKEA 2LPMA 2QSJA 3KYJB 2ZWMA 1P2FA 3H5WA 4YWHA 4EYKA 1TMYA 4MGEA 4LE0A 3I45A 5TPZA 5TQ0B 2FMIA 5B3JA 3HJFA 2AYZA 4UHKA 4H3HB 2KYRA 3H5LA 1DCFA 2H3HA 4Q6BA 3RVJA 3Q9SA 3HS3A 4LE2A 4M88A 1MVOA 1XHFA 4KK4A 4EGSA 3JVDA 4ETMA 2JK1A 4MLCA 4S05A 3N53A 4PZ0A 5KQPA 3O2JA 3LUCA 2PUAA 2PAFA 1ZN2A 2CHEA 3JTEA 1TJYA 3OLXA 4PYRA 2R48A 2CD7A 2WB4A 5DTEA 2FMFA 3EGCA 4Z4EA 2QXYA 2OQRA 1XWWA 4EYQA 2FLWA 5FBKA 3Q7RA 4MQFB 5JS1A 1GUBA 4W5RA 2FN9A 1JDNA 1Z25A 4DADA 1QPZA 4MQFA 1YS6A 2IDMA 1Z2EA 4Z4FA 3TX6A 2O20A 2QW1A 1K66A 2A9QA 1DC8A 3JVIA 2QVCA 3KCNA 4FE4A 2A9PA 2TMYA 1U04A 3GBPA 4MLDA 1JX6A 3JPYA 4MQEB 3OM1A 3T6KA 1U8TA 3O1HB 5I4CA 1P6UA 1BAPA
chains in the Genus database with same CATH superfamily
2YXBA 4LHZA 4LWPA 1IJKA 1GZ7A 1EVZA 2V4UA 3QFCA 2PNJA 2QMHA 2GZHA 4YMWA 5JYCA 2UU9B 3JZIA 3BCUA 4M0CA 3B5EA 4X92A 4KQXA 3K2BA 5BVGB 3VNQA 1P7VA 4K9RA 1KYWA 1XNJA 2X1VA 4N4AA 1I2ZA 3D31A 3WJ2A 1PJBA 2HSDA 3BXZA 3EARA 3M7IA 4PQEA 1ODIA 3EXG1 1T8UA 3SXUA 4JVMA 3U44B 4P4SA 1LS1A 1VYVA 2WIKA 1BJRE 1ENZA 4K9DA 5J4KA 3V46A 1OI3A 2P8SA 4PZCA 4UZSA 5LQRA 3KKLA 3CRRA 4RZIA 4AZ3B 5EKSA 4LFCB 3SIRA 1PQPA 1GL3A 1M72A 5GONF 2QUAA 1JMVA 3KJFA 2BJHA 1YJBA 2NYRA 1C30B 1WCIA 2IZOA 4N40A 3IBFA 4W7HA 5CYFA 2JLQA 5TT1A 4BMDA 5AW3A 4DR6B 3QBTA 2CNBA 4O4IF 1QDUA 4K9NA 1SULA 3TJRA 5IG2A 4OQNA 5FPHA 3MINB 3CLSD 4TV8A 4Z1MA 1D8TA 1U8ZA 4BDTA 2Q3DA 2OR3A 3K1AB 3LCMA 4PG5A 2XNHA 2VDVE 1IOLA 4FWBA 1GRQA 1VP9A 2P4HX 1ZNWA 3K5IA 1FW6A 4R5MA 1PAUA 3PWSA 4YRNA 1Z06A 4WLOA 2QF7A 3KT0A 2O2GA 3D3NA 1EK6A 1KY5A 2XHZA 4G9BA 5CBKA 4BQNA 5CITA 1ZZEA 1XHLA 2Z4SA 1PLKA 3NOVA 1AQLA 2A5JA 4R05A 3CN7A 5BR8B 1BDBA 2XCRB 3PFGA 5DCUA 1QQTA 4BVFA 2R4QA 4H0FA 2E6KA 4NK4A 4BNZA 3P27A 3IOEA 2MINB 2QL5A 2PRSA 3B60A 4JXJA 4N01A 4BKQA 3FETA 5CDGA 4MWBA 4ZCRA 2Q3LA 1TM1E 4WOCA 5FJJA 3C85A 3DHNA 3T1VA 2Q6LA 5DK4A 4E03A 1M2OA 4TTRA 4BO2A 4B33A 4K6OA 3U26A 4A03A 2EF1A 1ZHHA 1TZBA 3PKJA 5EIHA 2C3YA 3LOQA 1EJBA 2ZREA 3R41A 3PQ5A 3SIWA 3R3SA 3ZCXA 2HA6A 3HLTA 4WIAA 2XQJA 3ZOKA 3IR6A 2BISA 2VA8A 2ZTVA 3JYHA 3G7SA 1Y6RA 1A3CA 1RZUA 3NTQA 2Z8ZA 4CQNA 2VLBA 1EWRA 2RH8A 3HRHA 4ES6A 2IYRA 2YUTA 2MR6A 4RMIA 5JPDA 1DAFA 3NC0C 1GNSA 2ZXUA 1H1LB 1N2IA 3RRMA 3RG2A 3HLYA 4NJEB 1TIBA 3R5KA 4HQLA 2OQVA 1SU7A 1QV9A 2GF0A 3SEZA 3VJKA 8MHTA 3K0AA 4FOTA 3AINA 4IS3A 3RUHA 1WVIA 4Q47A 4W7SA 3ZJVA 4EY4A 1G3RA 3L0BA 4DUGD 4E13A 3T1HB 2CMFA 2D8AA 2HCRA 4ZRDA 1KS9A 3OJWA 3QYJA 1KKLA 2Q3EA 3P2OA 4MUBA 5DNUA 1I4EB 5FI3A 5C51B 1TAHA 1SCAA 1Z39A 1TVKB 3DYBA 2FXVA 3S2ZA 4WN9A 3A8TA 2C96A 4F93B 4XOUA 3C6KA 3DOFA 4KVZA 5B6IA 2X42A 1AD2A 2RHOA 2ZROA 3PUVA 1I2CA 1JALA 2ACEA 1Y5NA 2VP0A 3FDJA 4IV0A 1PV4A 1LDBA 3RGGA 4IQ4A 2O5EA 1KIAA 1NW5A 2GRAA 2XYHA 4KQWA 3ET4A 1GEEA 3DV0B 3VC7A 5JSFA 4E5DA 3TAXA 4QA9A 2WR8A 4OHVA 4TLAA 2O0LA 1A5BB 5FUWA 621PA 4PG7A 3D2CA 1M7GA 1PR0A 4MV1A 2ZB4A 1F48A 1JH8A 5K3CA 4G5GA 2DM6A 4DFDA 3I1YA 1G8HA 1UBOS 3IRUA 4DLSA 3S8EA 3FTQA 4ZD6A 1SVOA 1OBOA 1XCOA 1YS2X 4Q82A 2O8CB 1B93A 3Q2IA 4I50A 3HDYA 1QYIA 3L43A 4QNMA 4L51A 2AG0A 4YJGB 4AS3A 3Q2OA 4KBFA 4C7BA 1VRVA 4KFCA 4GXNA 3ZE7A 3D6FA 1QE0A 1YBVA 2ZS9A 1RYHA 3HTXA 3AR6A 1Z6ZA 2CSXA 4DEYA 1UAAA 2WM8A 3FVTA 3LGAA 3ZWQA 1KNXA 4B85A 1GAQA 4IKEA 1NQOA 1Q0QA 3NKVA 4MW2A 2J3MA 4JP2A 3FCXA 4NAHA 3NVDA 1BRTA 4NV0A 4UUBA 1P4JA 4CKCA 4F9FA 5DGTA 4ZCPA 1G6Q1 5I7OA 5D3MB 5IULC 2DPMA 2QP9X 3IEIA 1LX6A 4JI0B 4BKUA 5IJ9A 4BQQA 1JEYB 1TKCA 3N3BC 3EIEA 2CKDA 1SKBA 4NEQA 3LM8A 4B3MB 3S70A 3UB4A 5DXFA 3DNMA 2Y71A 1AHNA 4GLJA 1ESZA 4XJVA 4WRRA 2BFFB 3QY9A 1OH6A 2F64A 2JFVA 1YOBA 4H77A 2X4LA 1OC4A 3P97A 4JT8A 3ZJ5A 3BSYA 1U3VA 2YASA 5BP7A 4QUGA 1O96A 3F6YA 4IJUA 1DT3A 2P9HA 4AVYA 5KUTA 1W85B 1RHJA 3SXJA 1CZLA 3Q8LA 2LR0A 4K9MA 4MB2A 3GJRA 5B6PA 3KXDA 5M5BA 2JIPA 1C2TA 4LC9A 3BGSA 1M33A 3F4LA 4I9HA 1OLXA 5KKAA 4JOBA 4F3TA 3MWLA 4R51A 2C4NA 4LRTB 3LBHA 4X3CA 3E7WA 1GNVA 4J7UA 1H8HA 3HSYA 4NYIR 2ZIFA 2Z8YM 2D6FA 1JMYA 3AKCA 4NU6A 2I1QA 3HRKA 4OREX 1T2EA 1XRLA 1JKJA 1G3MA 2G07A 2H06A 2J5QA 2MU1A 2NTEA 2XMSA 4KQIA 5C5CA 5JTTA 3B1XA 2G0AA 2O8VA 3DEFA 4EF5A 4NBUA 4F4FA 4QUKA 4YASA 2C04A 1CUIA 4JI1B 3HCFA 5LLSA 5DYGA 1L5GB 5A62A 5H3LA 4ZZ0A 4PHFA 3SLRA 3GFTA 3KTDA 1LCIA 1X3LA 2KE5A 4NULA 1E59A 2YN4A 2M2IA 4QDZA 4J0HA 5AUPB 3R3VA 3BULA 2NVBA 1ISFA 4HQKA 3R5HA 5DW3A 4AUKA 1DG9A 3MGBA 3JAKA 2G04A 3O21A 1IN5A 4K28A 1M1NB 3HC7A 1TJNA 3H18A 3CZMA 2RIRA 4KH0A 2BEVB 5KJFA 1RTTA 2CKMA 1MAVA 1CJBA 4F2PA 3R3XA 3QU5A 4FU0A 4U8GA 3W9BA 1U0OC 4KXNA 1DBQA 3ASVA 3IEUA 4MDHA 1O6GA 4XM0A 2HJ9A 1TA9A 3U4IA 4CF3A 1QOZA 4LBWA 3I01A 1MTZA 1RZRD 4D5GA 1B0AA 1U7ZA 2C2OA 2QPAA 2XA9A 1C1DB 3EDRA 3HKDA 2Z98A 3M4YA 1O77A 4NH0A 4ZVSA 4WKPA 4AROA 1UDRA 2GXAA 5LVAA 4PY2A 4EGJA 2WB2A 2B2CA 5JSHA 1U9IC 2ZSDA 3KVOA 3STHA 5SZHB 2O5VA 4KUEA 3IMFA 1FNMA 3MS7A 1SBCA 3WWEA 1H3EA 3LDAA 4HXEB 4K3VA 3DDOA 4RPKA 2XYPA 1FMJA 1TJ5A 5D86A 1VI2A 4AP5A 2G0TA 3W7AA 2BELA 4AJEA 3H3XA 1NRWA 5E4FA 2PO5A 1J8YF 3MUFA 5FI0B 2ZBFA 1L7RA 3Q11A 4J03A 4RKRA 5GM2A 1AV6A 4IJVA 4PPGA 3AEZA 4GRAA 1FYFA 1QX3A 3VPXA 3DOEA 1RXCA 1XRPA 2A14A 4XZ3A 2IXGA 5CX1A 3UT5B 2QI9C 2X3FA 5CTJA 3ZE1B 2H1OA 1US8A 4RYDA 3OJEA 5IDVA 4AF6A 3FPCA 3ZI0A 4I6EA 5J47A 2J3HA 3QVTA 4ME6A 4EJ6A 4MWTA 4LVNA 1YFKA 1QTQA 2VPYA 2ONCA 1UR5A 3ZCTA 3KEQA 4QREA 4BNMA 3SAJA 1CUCA 3RUCA 3T0FA 2I4RA 4W99A 3KQLA 5CA1A 3RADC 2F1JA 5I5EA 3LCJA 1SXJC 3LXUX 3L6EA 5HP4A 5D5PA 2EHDA 3E9RA 3W7BA 1C1YA 2E5FA 1QRUA 1XEAA 1PLLA 4EABA 4ZHQF 2ZETA 3L0YA 4NCKA 4ZVVA 2AOXA 2VQDA 1XVLA 4J91A 4YT4A 2XVAA 3ANXA 1K9VF 2NP6A 1R8YA 3PFWO 4CWAA 4D9EA 1DE0A 4EKIA 2HW8A 1N6LA 4ZO7A 1LPMA 3QXHA 3UNXA 4Q03A 1JPJA 1EBBA 3DE5X 3KL2A 3KNZA 4KO4S 4P7BA 5A04A 3OIYA 1RJ9B 1YDGA 3B7PA 3DBRB 4C9BA 2R8ZA 2X5OA 1FDWA 1KHHA 2YJZA 2HK9A 2Z1DA 5J4YA 1KR2A 3DEYX 2WAAA 4DBVO 4LJRA 3O3NB 1K3TA 3WMRA 5LYJB 1LF0A 4EWLA 3FWYA 1TU0A 2XVMA 3FLBA 4H7EA 3R6LA 3IBSA 4LRXA 3EVZA 4BWVA 2B35A 3KAJA 4EOGA 3GUYA 1ZOLA 1SUEA 2G6TA 1PJTA 4U0JA 1PR1A 2J4CA 5AJXA 2FW9A 2QW0X 4FEYA 4AG3A 4CV3A 4P81A 2J0SA 2F8SA 4CMEA 4NDAA 3LNCA 3QKWA 1IG3A 4A2CA 1UC9A 5JPIA 5AVZA 1RE1A 4MW7A 3IKJA 2M1XA 3L1UA 1EAYA 2NZVG 4DDWA 1W5TA 2CHVA 4XVHA 2X1LA 3V4RA 4W5HA 2WKQA 3KWJA 1MH1A 3E2MA 1PV1A 2X8AA 3O8OB 2AKEA 4XJTA 3O73A 1ZVVA 3BIOA 3AF4A 1DL5A 5IUJC 3LDUA 3UT5A 1BVHA 1ZM9A 1P5RA 1EYZA 4MJ3A 4L75A 4MVJA 5DTMA 4L8YA 5I7AA 4P0QB 1TVCA 2ATEA 3ONFA 4FVTA 4R54A 3WSTA 3RR2A 1BYIA 4E46A 1U3FA 3H2KA 1Y6GA 3GCWA 4QULA 4U7DA 3T5DA 4HYEA 3X0DA 4BVHA 4HAVA 4IDQA 3PFHA 3SSMA 2PZJA 2JRLA 4RZ3A 2PR7A 1PJAA 2ZI3A 5KREA 2PZ8A 2O2XA 2ZJYA 1KI7A 3O75A 1RQLA 5TXGA 1CK4A 4KR3A 5KYUA 4YT2A 3C8DA 1DRJA 2KBEA 1D2RA 3C45A 3REQA 1ES9A 1D2GA 4MRRA 1UBEA 3ZWYA 1C9NA 2JI8A 1FX0A 1IN8A 1ZHFA 5FTKA 3IIJA 3SOZA 5GGXA 1EQUA 3CNBA 2OGUA 4ASUA 1JL3A 2NXEA 2VT6A 1NR1A 4HP8A 1GFIA 4G26A 4RL6A 4URFA 5E7MA 4EJ2A 4MPRA 4MMXB 2QRVB 1CQZA 4R31A 5EJ6A 4N3NA 3P8ZA 1OE0A 3EULA 3FWNA 4W9NA 2FW6A 2GDZA 4L27A 5T7BA 4AMYA 1A4XA 4BQEA 4C0QC 3I92A 1EA5A 3LSYA 1JFFB 3I04M 1NDQA 1EWTA 4UTXA 2BN4A 5BY2A 3U6BA 4NMXB 3N1UA 4JJIA 1LLCA 4JHLA 4KQGA 3LV8A 3CLRD 2UZIR 4QQKA 4RWZA 4UDXX 4IM7A 3ZUPA 4E4RA 3K0BA 4J07A 3R6DA 3CNHA 3O2SB 5IAJA 3VKFA 1Q2XA 2YJNA 1XZQA 3D4PA 3N0TA 3FWKA 3WO0A 1JYEA 5JE8A 2LPMA 4MJLA 1CQXA 3ZXXA 4BV9A 3AEXA 3IVMA 3VJLA 3ELDA 1ZMRA 4MAMA 1Z2AA 3VR4D 1RIIA 1WPRA 3BL6A 1BE8A 2H59A 3GJXC 1N3BA 3ENQA 4EY5A 3W5IA 3C43A 3WIOA 3E05A 2YMMA 3HJFA 1OPRA 1TC2A 1PEKE 1QRDA 1YZTA 1ODJA 2WMDA 5BSMA 4JI4B 2HI0A 4BFYA 2JZCA 5FA8A 4B45A 1A8IA 3BXXA 4YN3A 4HS9A 4ETMA 3KUKA 4DC1A 3A1FA 1E5LA 3IQFA 1GQRA 2ZVJA 1WS6A 3H05A 3ZJTA 3JV7A 4E22A 2ISCA 1GAXA 1CULC 3G0OA 1FMCA 2XKAA 1WHSB 2EWVA 1NULA 5I3ZA 2OMEA 3EIOA 1N2JA 3ZD8A 1ODLA 2L0XA 3EWAA 4BCBA 1M6YA 4FSDA 1NE2A 3OTQA 1KI2A 4R1QA 4ECAA 2BR4A 4DT1A 3D3QA 3TTSA 3OU2A 2BFNA 1XWWA 3LQKA 4FQ5A 4F5YA 3FFBA 1EGAA 1JA0A 1EBUA 2HU8A 3K35A 1RCUA 5LIRA 2ZB3A 1JSZA 3EX7C 3AMVA 4BKPA 4GMHA 1SU4A 2IEYA 121PA 4GOXA 4LOHA 4O3FA 2F3RA 3PR2B 3GG9A 2GR9A 3B13B 2BH9A 2QQ0A 3LKZA 3R3HA 3GC6A 2DQ4A 3FR7A 4JKOA 4COOA 2HOQA 1SVKA 1WF6A 2JIQA 3L4BC 3P45A 3OP4A 4RZHA 2WPDA 2YWXA 1P0MA 2QRJA 4QVKA 2FFJA 4DYVA 2FG7C 5D6NA 3PJFA 4BX0A 4RLSA 4PX3A 4EGQA 5L95A 4WN9B 3K70D 2XGJA 3DMNA 3R0IA 4N5HX 1VB3A 3DPSA 3CZ4A 2MJLA 4QUEA 1KDTA 3S1AB 2VDNB 1ZD2P 5EP1A 2CLDX 5KYXB 3IUYA 2DT5A 4QGFA 1VL8A 4ZOEA 2BAGA 2CYAA 2FZGA 3LC0A 1QTNA 2IYAA 2QDXA 4H3KB 4C3OB 4NS1A 1LS6A 4RD4A 5CH3A 3KUDA 4LRQA 5BNTA 3SDSA 1OLUB 4DXHA 3SBXA 4B6RA 1QCZA 1ZO8A 3VO9A 4DJEC 1MC4A 4E1BA 1W0JD 2Y1WA 1EDDA 3ECSA 4N7JA 1HTWA 4O2AF 4PYNA 5DYIA 4JVSB 2W0SA 1Q84A 3T9EA 1FJ2A 5C1PA 2C9DA 2ZAOA 1RM5A 3CMCO 3RHZA 4AY5A 3GFOA 3SEAA 2OGSA 4EYSA 3D7KA 2YHIA 3DV2A 3CSDA 4OLAA 5K7SA 4LKOA 4X3OA 3N8NA 1QTRA 3PT9A 4HYQA 4Q9HA 1GKIA 3DH0A 1GPLA 3U4CA 3LL7A 1LGYA 5I7VA 4JBHA 3ZCVA 4IOLA 4RY9A 1R0WA 3I52A 4AYTA 2DG2A 1YS7A 2R68A 5ERXA 3G2IA 1PUXA 2POCA 5LP6C 4Q3OA 1PS8A 4I3GA 3WGYA 1HEIA 1K08A 1QLWA 2C31A 3ESAA 3HCRA 1KI6A 1WXHA 1AX9A 2A0FA 4L78A 4YGYA 2GD0A 4E5VA 4CCYB 1FSSA 5K8VA 1O4VA 1E0DA 3BXGA 1NVTA 4Q93A 5IJAA 3T0IA 2VF8A 2WYHA 2ZVDA 4Z9BA 1I2MA 3EZ6A 3AV0B 1E7WA 1VLVA 2OCYC 3KK0A 3MAJA 5IBPA 5SZJA 4A23A 1P9OA 1U9YA 2XR1A 3KLMX 1UMCB 4NV3A 1QE5A 2JNWA 2REQA 4JQSA 4KK3A 1VECA 1YDHA 2P3QA 4HTAA 4JU9A 4NBNA 1A7AA 3C8HA 1K86A 3EUFA 2W93A 3O74A 4GSKA 2O23A 4NOMA 2W70A 1UKYA 4I5DA 4BVJA 3PFFA 1L4YA 1P2BA 2P6OA 1USUA 3CRZA 5KB3A 3JQ8A 1LJLA 5AW7A 3B5IA 2NTNA 2WT9A 3W04A 2GEFA 3VI4B 4RGQA 2EHJA 1CVRA 3PPXA 4P54A 2X0KA 3E58A 5EMLA 1T5LA 5SY4A 3JWGA 5A02A 3ZGZA 1P62B 1T9GS 3FSGA 4TT3A 3RAGA 3TAHA 2VHTA 4IMIB 4AUNA 1ZMOA 5A6VA 5JDCA 1EHYA 3ZC3A 4D92A 4IUDS 4DQLA 4MO2A 5DASA 2E4XA 4OBWA 3SLGA 1N2SA 2W6ZA 3KWLA 4FR2A 4LQCA 1VGRA 2BR3A 3Q7SA 1A9PA 4HDCA 1CHNA 1YHYA 4MWGA 4RTSA 4HUJA 5HYVA 5B57C 4JBGA 3C8MA 3FI9A 4OJKA 4ITUA 4IF4A 4UNNA 2FA9A 2WJZB 1EI9A 1VL5A 3TL6A 3ZHRA 1HQYE 4CKCB 2DVMA 4JITA 1E1NA 1PSWA 1H2BA 1NSTA 1TJPB 3IAM6 4PQYA 4Y18A 4G1MB 3B1KA 4G0QA 3ZLBA 5FLEX 1CJSA 3OZCA 1T3GA 1IFXA 2QMEA 3NH6A 2DPHA 4OXQA 3CNQS 3HFGA 3UBTA 1E61A 1JQAA 4U7FA 3E03A 5AH0A 1ADCA 1SXJA 1Q17A 4YR9A 3ZJUA 2P2SA 1Z07A 4W82A 2KJQA 1Z88A 1FDTA 5K3OA 4PLFA 2GKSA 5CT6A 1Z0UA 3BJRA 5J23A 1VE3A 3NGXA 3JAKB 4ND8A 4EG8A 1BJKA 2Q2QA 4H1HA 3LP5A 4LV6A 1XVAA 2NUTA 4CMBA 4R98A 1Y7LA 4JB8A 2IQIA 2FEMA 3OFJA 4IFEA 5DTRA 3UG7A 3VAZA 2VJLA 4EPWA 3BFPA 5IM5A 3VOSA 2EXXA 4DR4B 3AC0A 1RXWA 3FW1A 1U6KA 1M66A 1XZPA 3VV3A 4HPXB 1BKSB 2DH5A 5IARA 3WYGA 1CUYA 1F06A 5CLQA 3AJ8A 2LTAA 4X71A 3RJTA 5LN1A 4BP9A 4MB0A 3BH0A 4G9GA 3GWGA 5FTMA 3GEEA 3PUXA 1UDXA 3AFMA 1GTSA 3OMWA 4GL2A 3CF0A 2ZM5A 4DLBA 2H9YA 3LBNA 5AVQA 5GIPE 2AG1A 2BZ1A 3VQTA 2EL9A 4OQYA 5CNJA 4WEQA 1JHYA 1QU2A 1TTQB 4HFRA 4EG6A 2B4QA 5IVPA 1E3WB 3SBOA 3PE3A 1J20A 3HR8A 3GROA 4QVGA 3C5WP 1JB1A 3NCHA 4MUJA 2QDKA 1F4LA 2PIAA 5D5HA 1EDOA 3AHHA 3S68A 2XCUA 3LY9A 1SQSA 5AW4A 2QM3A 1JSLA 3TZ6A 4ZAYA 3K9QO 2BLLA 3IE1A 2WJ3A 1CEXA 1Z6YA 1BCRA 3BB3A 3PVZA 1PWXA 3NW9A 4JFRA 4ZI5A 2VWQA 3N07A 5AVYA 1IH8A 1NVXQ 4M3NA 1HT0A 2E1RA 2G1UA 2IK8A 1N5OX 2QLBA 2Y66A 3OOYA 1S02A 4XKJA 3V4PB 2AK3A 1V5IA 2D5IA 2PLNA 1WE2A 3OLVA 1J0CA 2V5AA 2V8BA 4IJ5A 1EA7A 2AXNA 5BMVB 3PF8A 1SUBA 1YB7A 4OQDA 2ZPUA 3H2HA 4ZYXA 4ER0A 4G1VA 1R27A 1GIAA 2I1VB 3C4VA 4B46A 3ZVMA 2H4HA 3GMIA 5EIBC 3KS9A 2CL0X 2EQBA 2BY4A 3MLAA 1A98A 4OVKA 4MEBA 2C61A 4U6SA 4WXEA 4XSHA 3L04A 1GO2A 1Q0LA 3BMOA 4KWTA 5JQGF 2LKDA 2SBTA 5TMPA 3BK2A 1M1UA 1ZVKA 4PVDA 3O1JC 1X39A 1JU9A 4MV7A 5CFLA 5GV8A 3EY9A 1IM8A 4UTPA 1IJEA 5AK5A 3GLRA 2Z9DA 4JEMA 4OMUA 3O92A 4PSAA 1FTWA 4DM3A 2VSFA 5DU2A 1P0PA 2HCFA 2GLXA 3NDPA 1H4QA 1WNFA 1CZNA 3TVTA 5L3QA 3TRKA 4TM7A 3BD7A 1FVXA 1TLTA 1Y7TA 4R2MA 3UUWA 3BE6A 1PYDA 3IEXA 4LZOA 2Y6UA 3FPSA 2FG6C 2A35A 3QELB 4ZVPA 4QUIA 4HCJA 2OHXA 1DDOA 1G20B 4TLBA 4F45A 3K6RA 3OJOA 1YU6A 1IOVA 2R8RA 2P6UA 2RK6A 1EFPA 4QYTA 2H57A 5DXJA 5FPQA 3SVZA 1N8KA 1YZHA 3DOOA 3GLIB 1EEHA 4C08A 3NHWA 4IIJF 4D45A 1ZI9A 1XTKA 2CMKA 4YVFA 1YI8A 5FF9A 3JQAA 3T3PB 1I94B 1EFLA 4PAMA 2NZ2A 5E6SA 5JV5A 3DP9A 2ZUFA 4H7HA 5L51A 2HF9A 1ORTA 2ZDGA 4LXGA 3COZA 3A10A 4X66B 4NSNA 4C6SA 4N41A 3T3HA 3H84A 3IOCA 1L5VA 4AS1A 1VE5A 4E1AA 4IP0A 1ZUIA 1HV8A 2R1ZA 4JT2A 3MPOA 4K9OA 1WTCA 4WOJA 2ZJ4A 3A3PA 4PO9A 1TQ4A 4OXIA 1LLQA 2H1RA 2QI9F 3UYLA 4BVLA 2C8KA 1J25A 1EE9A 2B4AA 3CCCA 1KJJA 1DTWA 1G1AA 1XRMA 3Q5EA 2QR5A 5NLLA 2C7GA 4UHDA 1X7XB 4WCFC 3SHWA 5KQPA 1DP4A 2GXUA 1BA3A 2JJ2D 2OCAA 2XYGA 4U2GA 4EK9A 4HSGA 5CYPA 7ADHA 4RVDA 4CIAA 2C4MA 3S55A 4Q4LA 4ZT3A 2I34A 4MKGA 1O1YA 3EEYA 4TRNA 5K3DA 3VKWA 3UMYA 4NEGA 1SK8A 3OLYA 4ZV7A 4EY3A 4IIDA 1YGPA 4YP9A 3REQB 3D6UA 4FN4A 3AR2A 2XX3A 1B6SA 1BNCA 1OZAA 4KLAA 4QBHA 3I6QA 4TMVA 4XWGA 4D9BA 5JSZA 3SC2B 1N3LA 3AWIA 3W4JA 1X7HA 4HVTA 3CYFA 2EJTA 5DI3A 5FBLB 1K6XA 5L4NA 1C3OB 2PKQO 4OQFA 2YWEA 1V37A 1AHIA 1EGMB 1U5BB 1U1CA 3HBMA 5T8KC 4C7JA 2QVYX 3USZA 2PBLA 4DUYB 3GD5A 1MIHA 2F9FA 1UQUA 1S4MA 3PC8C 3QE3A 4G2TA 1E2EA 1E1YA 3WQSB 1CEYA 4NBKA 1OYWA 2D5LA 2GOYA 3QK7A 5AOAA 3WLHA 4DVGA 3WYAA 1XPOA 3TX2A 2O07A 1SCKA 4QDKA 1WVGA 3TE6A 1E3MA 2EERA 1EZ1A 2WLTA 3SHQA 1G20A 4FBLA 1JPVA 1BX0A 1WW3A 2AMJA 2J30A 2OO5C 4ARCA 4F92B 4GU5A 2XQKA 2PG3A 3O8QA 3QU4A 1H2ZA 2HH9A 3I9NA 3MF4A 4FHCA 2J59A 2AKYA 3QWIA 1M2KA 4U2BA 5K0FA 1Q12A 2R2GA 4CPDA 1GV1A 1JEOA 2QLNA 1MAAA 4E1VA 4ZI2A 4O8CA 5B1SA 4JU8A 4NC9A 4HNRA 4RGBA 1PYOA 1E1MA 3OQVA 4LYYA 4OJNA 5EQJB 3BIWA 3EFHA 3T12A 4KC0A 4ARIA 3DEKA 1ICIA 5GY7A 3L4BA 5A3JA 4DQUA 5TQ0A 4L6AA 3L9WA 3A06A 5E8JA 1LVHA 1FW8A 4LBVA 3U0VA 4B4UA 5CG2A 2GEKA 4W1PA 4V1CI 3MMPA 3CE6A 1JG6A 3IQGX 5H82A 4XARA 2GD1O 3SYTA 3Q1KA 3QQ5A 1N0IA 1BU8A 3I6IA 4RV9A 3UTCA 1RJ9A 4EP1A 1OAAA 3ZHYA 1RXUA 3IO3A 4TLEA 2DTEA 2GTHA 3PGA1 4NIMA 1C3XA 4C07A 3WQRA 3WK6A 2NVWA 1Z15A 3TXYA 2TSYB 1H2HA 2PWAA 3ANTA 1M6VA 1XV5A 4PLZA 4D4IA 2OLJA 4ZGBA 3IE2A 3BH7A 4YV2A 1SWVA 3AKEA 3TK1A 4B7AA 2V98A 4GWGA 1TQ2A 3UKDA 4HRAA 2W22A 3I9V1 3PFIA 4M1QA 5CPFA 4MITA 1QVAA 5CJ2A 4YAIA 1GNRA 3SR0A 2GS9A 2RGGA 1VMEA 2A6PA 4L0CA 4YT5A 4E0BA 4P7KA 2IDKA 1FUIA 5EHXA 1MABB 2EU8A 3F74A 1KP9A 4NYMQ 3UUFA 3KTOA 3OSZA 4RHUA 3UYKA 4E7PA 3IDOA 1G8MA 1U63A 2Z95A 1OH5A 2WVAA 1QRTA 4FFDA 1YFZA 2IUUA 2OFWA 3MJEA 1Z8NA 3M33A 3R4CA 1UOPA 3GVPA 2G40A 2RG7A 2D2FA 5U4XA 2GA9A 5L4LA 1NW4A 2XQFA 2OK7A 1JG4A 1LKZA 4IDBA 4A1FA 3WX0A 1CHDA 1V8DA 3EG9B 1HE8B 1WXDA 1VLMA 2I6GA 4OLBA 3BEDA 1ANKA 4RSMA 3DL4A 4FZ5A 4KMRA 5HDBB 3MCZA 5DXAA 4RQTA 3K73O 4YV7A 5ALLA 1SPBS 1AE1A 1IY1A 1PR4A 1UFVA 1G5HA 2WUEA 2YDXA 3IV9A 3MUEA 3O9MA 4CMIA 1L7OA 5TX7A 5JATA 1NNSA 2PUEA 3QMVA 4HYTA 4KFUA 4AYXA 4KGVA 2GYYA 4AQDA 3CM0A 1ZESA 2QUZA 1ZD3A 1Z6GA 1IXRC 3MWEA 3NAMA 3ZHCA 4MIKA 2ZPAA 4A6DA 1QWSA 1W47A 5IHPA 3AHJA 1C1XA 3NWPA 4C88A 3D3WB 1MPTA 1X7WA 2N42A 3ASZA 3FOCA 2Y2VA 5CEFA 2VAXA 4JSTA 2X5NA 2RGXA 5L4SA 1QO0A 4ZT2A 2A5DA 1VGVA 4MQ4A 1SOAA 5FAXA 2ZJAA 4RF2A 1QH1A 3LY5A 3WBFA 1JDJA 1ZIOA 5AI9A 1RC0A 4YAKA 2MSNA 3D7NA 4Z49A 4JLJA 1U7UA 4OB7A 4G5HA 2Q3JA 4PRLA 1KZ4A 3T99A 3GZNA 2GCGA 4OJTA 2HA3A 3RVQA 2H08A 2X9LA 4KX5A 2MT9A 2NPOA 2AI1A 4IGKA 4LFBB 2C98A 2FUNB 4PGGA 2J31A 3IT3A 4D02A 1TMYA 2WYOA 2VJPA 4ER7A 2A1TR 2HF2A 1XRQA 1ZW1A 2GN8A 5DBFA 3WKCA 5BW8A 1P1FA 1S2IA 2DHDA 1M7HA 3SFTA 2DJ5A 2VJBA 1BXGB 2J3KA 1LB1B 4Q6BA 1EM6A 4DSUA 3IBCA 1ADJA 3F47A 3ORFA 4L5JA 3FDXA 1Z68A 2ZIGA 2QZ4A 4Q3KA 4FQ7A 5DGXA 2SCUA 4O2BF 3QNWA 3E5RA 1TJYA 3IXQA 3JD4A 4HDSB 4H4CA 3EVDA 2ZCVA 4M0LA 4G36A 1BG6A 4BNKA 3GLGA 1DO2A 1NR7A 5FEUA 4TN1A 1CUHA 1NY6A 2FPIA 2GCOB 3HGQA 2I8CA 1T2VA 4MQUA 4NBWA 4N3CA 3AQIA 2IOFK 1PVOA 1DUSA 1NL3A 2NV6A 1JEAA 1VLJA 3KOWA 3SC2A 4DLUA 821PA 4NZPA 3RYIB 1GN9A 1M10A 1DX4A 3E7XA 3NZEA 2ZIXB 4LNUB 1QPZA 1K5PA 1YZLA 2IDMA 1X77A 2IIPA 3EASA 4KO2S 5AXAA 2I3GA 4OHZA 3TX6A 4EZBA 3A9TA 1O0CA 1DC8A 5HK9A 4O4LA 4PV7A 3OFVA 3L0PA 1NPYA 4QWWA 3WHPA 3LO8A 2Q7DA 1TEHA 3G9XA 4FE4A 3T7RA 3ZVRA 4F4IA 1U04A 1K7EB 3GBPA 3D5TA 2W2XA 1YBMA 4DLWA 3RK0A 1RHMA 1U8TA 4BQRA 4A8JA 1N25A 3CX7A 5J1SB 2P1RA 3JQ8B 3PEUA 4BU0A 2EP5A 4AJIA 4NENA 4TUYB 4WFQA 1LD3A 1NJSA 4M76B 2OECA 4JI5B 2C99A 1ZCJA 1GYPA 1T6BY 2PSEA 1UPFA 5IKPA 2G09A 4PZPA 1L4NA 1Q14A 4OEHA 1XN1A 5ESXA 4F2DA 1L8XA 5DLPA 2P3LA 4BLTA 3G2NA 1Q0PA 4QGSA 2D4AA 1VG1A 4W63A 2WU4A 2FK8A 2PJZA 3D6VA 5DNVA 4ZVQA 2W43A 3TD2A 5B2FA 4LVOA 2IL1A 3TQOA 3VHXB 3VU9B 5JTUA 1ZJ6A 1QVVA 1JH9A 4I4TF 4FGKA 1AK9A 3Q5DA 1N0WA 1WA5A 2X7XA 1TCCA 5JXWA 1AXEA 3HKCB 1FTGA 4B6PA 1YQQA 5GM1A 4EHHA 2Y3IA 4HBZA 2F00A 1N77A 4O1IA 3QVOA 4HPWA 2I8AA 3ZE9A 4B7ZA 1YVPA 1V3QE 4IHJF 3U4HA 2GFIA 4MRPA 3VPAA 1WCIB 1V3UA 3P1JA 4TQAA 1DC4A 3E82A 1C0PA 2DQKA 4CQLB 4KN8A 1PJCA 1E3LA 4U5XA 3BERA 2YFKA 1U9ZA 4RCVA 3IA7A 5KWSA 2QAJA 1OUMA 1SC9A 3KDSE 1UWCA 3BD8A 4HEHA 3QU9A 2WJHA 4IDEA 5P21A 2VDWB 3ZJYA 5CFPA 4YY3B 2WM3A 3QP9A 1MZPA 3HM2A 5EESA 3UGJA 2R60A 2ZYVX 3C3KA 5EVJA 4DV1B 3TI7A 1ZHOA 3RSGA 4GPBA 1KDVA 4ND8B 1SJ9A 4BLVA 5G0TA 2B6HA 1V47A 5ALVA 3JY6A 5CXSA 4B2PA 3SD7A 4GVLA 3G9UA 3RS5A 4I9NA 1F5NA 3FPKA 3C1OA 4RK4A 1TW2A 3B9QA 3NM6B 3PEVA 1A9RA 1UBUS 1VFNA 3UENA 3UMBA 2BP7A 1I36A 4KO3S 4L5CA 1H05A 4TS1A 3ZDXB 5DI9A 1CRWG 1GDDA 2QMYA 4HG2A 4IGEA 4MV5A 2IV3A 3SS8A 4NENB 4BNYA 1N33B 1N78A 5HWSA 2I33A 1YRLA 3L01A 3KYIB 1NBMD 1QC5B 1NFQA 3WFIA 2IHZA 3QLTA 4XDGA 2YJ5A 4BO0A 2WJYA 1TJ3A 1GT91 4BPRA 1HDZA 4AQYB 3T54A 4JI2B 3Q85A 1UBTS 4PXAA 2FP4A 1Z5PA 2I7TA 2RGAA 1SXJD 3GIDA 3TCXB 1OV4A 3FSJX 1ODKA 2JGFA 3JZFA 3ENVA 4MS3A 1T8PA 2I99A 4FP9A 3NNSA 2XB4A 3B1YA 3MCAA 3WB0A 2OD9A 1GILA 3TRDA 3LIPA 5LDHA 4L4ZA 1IXYA 4UPDA 5I8PA 5JRDS 1RLOA 1M2WA 2IZ0A 3SS7X 4MWDA 3OJCA 3RBZA 1ORHA 4JX9A 2ZCJA 4GE0A 1T2NA 2P5TB 1QGOA 1GPUA 2QUBA 1XXHE 2CHQA 4RBNA 4C4YA 3GL9A 2QAGA 3OU7A 1PW7A 2AG5A 1TOAA 2VT7A 4Y2RA 2CL7X 3C3AA 1UT6A 3U48A 5IBCA 1M2FA 2ZXFA 4NARA 3ZDYB 4LOIA 3WGJA 3VRHA 5K8LA 1XQ9A 2BM8A 2ZYIA 3DR5A 3KVVA 4ZJUA 5G2OA 2FPLA 2K7ZA 1RM0A 1GCGA 3OQHA 3RQIA 1P72A 3G5LA 4C6RA 2LBPA 5ARDA 1FFEA 2V6GA 3QMMA 1NJGA 4G0MA 1REQA 3E7PA 5JPCA 2IIQA 4X7MA 3UV3A 4I3FA 4NCIA 3EJWA 4NNPA 1AUXA 1J7JA 1DDGA 2J48A 3BXFA 2YOGA 1PQUA 3SSAA 3WAGA 3KHUA 3RSOA 4OX9B 3CSUA 3RHTA 1DEKA 2QVZX 2PCJA 3LLMA 2IXDA 3PGVA 3P7MA 3ANMA 4ZFNA 2LCQA 3KFXA 3D8TA 3E61A 3OIDA 4QXRA 5JRJA 4XGRA 2JA1A 2GEVA 2WUDA 3C5HA 4RABA 5JZSA 4F91B 3Q5GA 3GGJA 5JZ9A 1ULZA 3NHUA 3TZCA 1TFRA 1XZKA 1R0BA 2ZR0A 5BSEA 4A8HA 2CUZA 3I0ZA 1E62A 3PQ3A 4RPLA 4ZAZA 1JXAA 4M4SA 3VAAA 3NGLA 4K5QA 4MS1B 5LWQA 1R12A 4DQVA 1SD2A 2J09A 2VSQA 4BMNA 4FFSA 1KVTA 1L9XA 4RELA 3R0XA 2I3AA 4HUQB 5EJ4A 1NUQA 1VCOA 4XUDA 1K8XB 2VYND 1UP4A 3EFEA 2JGNA 3V1KA 4BJ3A 4DCPA 2VTBB 4YCBA 3COPA 1RM4A 4UBNA 4C7KA 1IIBA 2WWWA 3O26A 5KSZA 3RS7A 4JH0A 2FDRA 1Q5PA 4HJRA 4WGGA 3WAJA 1A9ZA 1B6GA 1P6XA 1K4YA 1N0HA 3K8YA 3IELA 4H4DA 2B20A 3S4YA 1XLWA 3FKJA 2V59A 3GR6A 3KR9A 5A5FA 1JECA 4MW5A 1ONSA 3P2KA 4NZOA 1QIJA 2VRCD 4ACAA 4BFCA 3HYSA 3RU3A 4C4TA 1KYYA 2XNCA 5HXAA 4MJ7A 3SKYA 1ODFA 3A28A 3P9PA 4JSRA 5H7XA 4TMXA 421PA 4V0RA 2YHSA 4OYRA 2AYYA 3BMOB 3DHWC 4OK6A 3FIJA 1GPAA 5ICEA 1PD0A 2Y05A 4NK5A 2HLNA 1FFSA 1I6KA 2AB0A 3B3QA 1J90A 4JFAA 1GPKA 3H5IA 1IQ0A 2QTRA 1FMTA 2WQ7A 4G0WA 1TO6A 3IVAA 4WBNF 2NYUA 4F11A 3UFXB 3RVDA 4JBLA 1HSOA 4NXNB 4MUHA 4Y30A 1KH2A 2RKBA 3L7YA 3JQ9C 2FR8A 5FLYA 5LL6P 3GLFA 3TKLA 1JYFA 1DWOA 3EWIA 5LU8A 3K70B 2OB1A 3JS5A 4REQB 3EGEA 2FZCA 3AR3A 1SCIA 3IR5A 5BT8A 1N4AA 2NPFA 2RE8A 1DC5A 3I2YX 4XIIA 6PFKA 2CCKA 3B6IA 4KR0A 1R0YA 2YV3A 1WJGA 1J9ZA 4X44A 3T7SA 3GEBA 4FE3A 3ZLTA 4RZ2A 5JMPA 2O8DA 3L49A 4A6XA 3CZ9A 3M89A 1K2WA 1YS4A 4YJ2A 4DM7A 2R7LA 2I2BA 1RAIA 1KOJA 1EB8A 3HB5X 4MRMA 1U28A 1SUFA 4Q1VA 3FVRA 2P4UA 4Z54A 4V02A 3DBVO 1VKJA 3ONVA 6REQA 2I80A 3THWA 3D5QA 3JQAD 1G9XA 3TQFA 4DA7A 2OAP1 3D9QX 1HI9A 2QSYA 1T43A 2YXEA 3CRVA 1SVWA 3AL2A 4KSCA 4ZI7B 1LJ8A 4YLYA 5IX8A 4FKBA 1X2BA 5IF9A 1A72A 4HQ0A 4NJMA 5DSXA 2QVLA 1YDMA 1XHEA 2CDRA 5AKJA 4JX8A 2G77B 2W90A 5FWXA 5JS6A 2B25A 4Q7JB 2EWMA 3N05A 4DARA 3JYNA 3QVUA 1HG1A 2CE2X 3OEWA 1LSUA 2C4HA 2OFPA 4CETA 3TLGB 4GXTA 3AXTA 3UJ9A 4WX2B 1N6OA 4TUYF 2OXIA 2R8XA 3KJHA 3RLFA 4PLCA 4KMSA 2RGCA 1Z6PA 4ENUA 3RK4A 4IZHA 1HG0A 5IW8A 2C58A 3GRPA 5TGZA 2XYVA 3MXTA 5CRIA 2C9ZA 2LGJA 5DO9A 2ADMA 3IXMA 1N5LA 4YJGA 4HD8A 3CQ9A 4FWTA 1F51E 3ENKA 3GPCA 3F4KA 3QG1A 3TLJA 4B43A 5BR1A 3R9KA 4CEIA 3ZBTA 3RYTC 3FKSA 4DRZA 3DTYA 4I4TB 1Q7GA 1OTYA 4Z3DA 4AG5A 3OOJA 1QFYA 3HVHA 3W9YA 1EFAA 1TJ4A 1YZYA 4GI1A 4P4GA 2NU7A 2HWKA 2FJ0A 2IGTA 1EB9A 2Y1FA 3DKRA 2IV2X 2X13A 2A84A 4QTTB 2G1JA 1PDOA 2GM5A 3SJBA 4HMPA 3MWFA 4R3WA 2O14A 1D2HA 3DCIA 4UVEA 1D6MA 2Q07A 5DX1A 4FYKA 3B5JA 1PFQA 3MCUA 4GX2A 3ND5A 4QYSA 5C31A 1KJNA 1VBFA 3TSYA 1W36D 2JBAB 4JA0A 1Z7YA 5E4JA 3T41A 2EC5A 1NLFA 2NM0A 2JGAA 2WKPA 4Z3KA 5LQUA 4HS4A 4Q3CA 2PTGA 3W5DA 1QVRA 3HDQA 3MJRA 4UZFA 5IDXA 1JB9A 1BWQA 3VSDA 4IEEA 2CL6X 4RVSA 3LFUA 2G5TA 1P7PA 2YRXA 1P9LA 2BFBA 3AKZA 3X1ZA 1ZCAA 4DLNA 4PRZA 3KKOA 4GXQA 2PL3A 3DP7A 4G1EB 4HMQA 3GG2A 4LHEA 4X8HA 2QRNA 5D87A 3P5BA 2QENA 4EUSA 1WUTA 3HVJA 3W8DA 3N6XA 1QYCA 4FMCF 4WV3A 2O3RA 1PHRA 2WSSD 4LI3X 1VJ1A 4C0LA 2I2AA 1WIWA 4J16A 4Z9FA 1ZXXA 2H7CA 4TV8B 5B6JA 3RC3A 4GMGA 4A0RA 4DBZA 5ALNA 4IRUB 2I66A 4OG2A 3WKAA 4AI6A 4PC7A 4WLFA 3WK7A 3TRIA 4QLOA 1THGA 2HJSA 1Y8RB 1WCXA 1ZOSA 3CRW1 3U5ZB 1YR3A 5F33A 4GPEA 3HWX1 1JF8A 2F67A 1L4FA 4I4TA 4LXQA 1U0BB 1JLHA 4KWHA 1ISPA 3GNQA 4IRMA 2BMWA 3FSGD 4TT3D 3BL8A 1RKXA 5HIIA 2P4EA 3AZQA 3ZZ0A 4KKVA 2IF0A 4JQCA 3WLNA 3AERB 4NPAA 2XZOA 3ZCPA 4NZ9A 3QSYA 4CLXA 3CEPB 3JVEA 5CDFA 4J0EA 1DMRA 2A0UA 3I76A 3IDAA 5LSAA 4GGPA 3NWJA 2CLIB 1PVVA 3EWNA 3VISA 1PZNA 1ZM7A 2D59A 3A4NA 4FCTA 3U1TA 4UDNA 2CVHA 1W5FA 2VRCA 3R7DA 3QUQA 3LBFA 1KNQA 4MKXA 3RIGA 3DZDA 4RZQA 1Q6ZA 2Y0EA 1GGJA 1PBNA 3VR3A 1HO3A 3GHHA 3HJTA 1XZEA 2AR7A 2IDJA 3FNBA 2FEWB 3IP5A 4GI3A 4E12A 3ESRA 3V55A 4W9MC 1EFDN 3RDPA 5JNVA 2Q4TA 2RKWA 1Z47A 3N0WA 3MTAA 2XWQA 2Q28A 1HNNA 3NYRA 3TCNA 1T3ZA 1WB9A 1XMVA 2MR5A 2Z08A 1SC4A 1UC5B 1IQUA 3S28A 3RS3A 3VGPA 3RAPR 1WCV1 3EIUA 1E6WA 3QWFA 2JF0A 1JE1A 4PS1A 3TSZA 3T3OA 2I55A 1J0DA 1JQ3A 3EXHB 1O97C 1WL8A 3GF4A 3I09A 4M8LA 3UK2A 1FRVA 1XYGA 5LYJA 5AVSA 1T1EA 2P9GA 3HV2A 3BDIA 1D2MA 2IT1A 2OCLA 4Q7EA 1OX4B 4EAQA 1ISRA 2PRYA 1ULSA 4TRJA 3Q40A 3KQSA 1KEZA 1MNQA 4Y2QA 2SHKA 3FBWA 1MAUA 4MINA 3HCDA 2PMBA 1FRZA 1JV2B 3CZ5A 4QUDA 3MUNA 4KSBA 2VF4X 2W2QA 4TTPA 5BNWA 4D3DA 1Z3IX 4LECA 5JDIC 2I2XB 2IPNA 5CP8A 3I01M 4AJ9A 2J33A 2R11A 3EEIA 3FROA 4L76A 2IBTA 3KKEA 4K8OA 1IY9A 4FCWA 4EEKA 5FRDA 3TZHA 3C4JA 1XK7A 2ECPA 4HWPA 5DNWA 4LA4A 4BQIA 1DAEA 1JKFA 4LE0A 1RBQA 4BB0A 1L3IA 3B3JA 3O4GA 2XRMA 4TSRA 2W6CX 3RF6A 2BMDA 3IE0A 3HSSA 4JI3B 4U3JA 4O1MA 1PCXA 3VAYA 1A5TA 4JMPA 3KETA 1ZJ5A 3MTEA 1WXXA 3V9AA 1J0BA 4AZ0B 1MVOA 1F60A 2WABA 3ISJA 2JK1A 3JVUA 1U3UA 1KPIA 4RIGA 4Y9SA 1NDUA 2GJ4A 1P60A 1Q2UA 3B1WA 1N57A 3O93A 3U39A 3R5XA 5IHXA 3JTEA 5C4MA 3EA0A 2KX7A 3T7JA 3V1LA 3PEWA 2J46A 1K3UB 4JT9A 4UCFA 4BV2A 4HDSA 2WF7A 5ENDA 3NT2A 1TKAA 3C7KA 4Y3UA 1OHHA 3EDYA 1O5OA 4QJBA 4CCWA 1OIXA 3IVCA 3OIWA 3QPUA 4KXVA 4ID3A 2B4TO 1NT2A 4FUQA 4P4UA 3TQCA 4CU2A 4IIJB 4CUJA 4YIHA 3L8MA 5F2NA 1NNLA 2CNKA 4NCXA 1STOA 2Q50A 1C5KA 4B4OA 3TNFA 2A9QA 2VDKB 3OWHA 1NYQA 2NZXA 2AMLA 3LYLA 1JDBC 1E0KA 3D1VA 3FD8A 1OXSC 5JQGA 1QGUB 2OOSA 4YIKA 1SQ6A 3SX4A 1Z36A 1TD9A 1UPTA 5KYGA 3GFVA 3SBDA 1TEXA 4YNBA 4JOCA 5K0NA 1F8GA 1PTJA 4GYKA 4DA6A 2B5VA 3E23A 1I7SB 4P82A 4KDFA 1K4MA 3UBMA 3I2GA 3X1YA 1N9ZA 5I4CA 1NG9A 3A05A 5I7HA 2WWXA 4FD2A 5E7IA 1XNQB 3N87A 3NBFA 4GC5A 2O7NA 4HDQB 2VRWA 3AEYA 5JHHB 2O1XA 1UIRA 4X6LA 4DDKA 1H0HA 1X9HA 3UCXA 5JYEA 4XWAA 4CIWA 1GPBA 1EDEA 3Q72A 1GGFA 4UW9A 5DLEA 2EW8A 3LE8A 1Z4OA 4EIWA 2Y68A 3IPRA 2O3JA 1KC1A 1TE2A 3F97A 3ZJ4A 3QEMA 3RABA 5CCEA 1VE1A 2E4VA 1PE0A 2ASEA 3DVQX 3PXXA 4BFXA 3BTOA 2PD3A 2GK7A 5DSTA 5F5XA 3RKSA 2IELA 3A6EA 3GAZA 3NBUA 4YMUA 5JVDA 2A57A 4TZ6A 1OOEA 2Z2YA 3GPBA 4YJFA 1TM4E 3EODA 5KPDA 5CFZA 2Y1CA 4H6PA 1GWNA 2UYCA 3IDSA 4YTEA 2XE7A 1PO7A 2PCLA 4IEIA 1AU9A 3A6JA 1ILEA 3R6TA 4Q34A 3TOVA 3GX1A 2JJ1A 3G0CA 4IXDA 3KO8A 3IBYA 1LBIA 3GP8A 4PLPA 3VDRA 2I4IA 1JFRA 2SKCA 2WIFA 3NTRA 4CNQA 5BSFA 1EVLA 3PFCA 4RH0A 2V7XA 5KOIA 1ZCBA 3EIHA 4RD6A 2YN2A 1P3JA 2CXRA 3RRBA 4IRXA 3HYRA 1N2GA 2J9FA 3T3GA 3JAMA 5CMLA 5EA2A 1ECLA 4RHTA 1XZGA 3UV7A 4F38A 5IXJA 2WUGA 4UNQA 4K0KB 3ZX5A 2YNMD 3E9NA 2HF8A 1VMDA 3KSRA 2O2SA 4UPVA 2XMDA 4GPD1 4RSRA 2C5HA 3WIEA 4KMMA 1QPGA 1DQNA 1OFHA 3PZRA 2OAGA 3HL0A 4MULA 5SV2A 2DLDA 3G5MA 1W1WA 3DUFB 3PG5A 4P4TA 3C7CB 1VCNA 3VC3A 3VTZA 1K0UA 3HCPA 1UPAA 3PJDA 4ETNA 4DSNA 1ONOA 2QJRA 2UZ4A 1BE0A 3QX8A 3I9LA 3Q7TA 4KR9A 4ZDIA 3Q3HA 2WWTA 4DAEA 1PNRA 3OPXA 4DY4A 1X86B 3WLMA 2HBYA 3I3SR 3HVRA 3S99A 3G9QA 3EPKA 1YF3A 2FSHA 3SFZA 2HK8A 2A9JA 5CK4A 1TI7A 2PN1A 3HO6A 3BRCA 2EYQA 4YGXB 1P0FA 3ZKWB 1KWGA 4KQMA 4KOEC 1PJLA 4QT0A 3FFTA 1VC2A 3SF8A 2HWUA 1WB5A 4IXMA 4PYMA 1XA4A 5IXSA 1E5TA 2QTTA 1ZU5A 3GLFB 1U7TA 4ZQEA 3DD5A 5H3HA 2XIQA 3QVWA 3UWOA 3UMVA 3OG9A 1SVMA 2FZEA 2PWZA 1WDMA 1MEJA 4QBTA 1PX2A 5IH7A 2E82A 2WKWA 3VYUB 3JQ9A 4F06A 4GG1A 3VMFA 1AQUA 2HJWA 2B82A 1I30A 4R1SA 1JJBA 3IUMA 3NEJA 1SR8A 2W4MA 3L1IA 4ZOLA 1BCSA 2WOOA 4OI1A 1FQOA 1VE6A 1BDIA 2JBWA 2NSJA 2XITA 1A95A 4B32A 4C6HA 3G8YA 5F2OA 4AKIA 3CBQA 2XBMA 3IMCA 5BN5B 2CYCA 3L02A 1X1CA 1SAYA 3GA7A 3ORSA 3OPYA 5AHRA 3SE0A 3SNKA 2HRRA 4DYDA 2CVFA 1AQNA 5ALUA 4LK2A 1ZIYA 3HKBA 4MXDA 2MDTA 2PGJA 4CM3A 3PPWA 3L7MA 1DJNA 4CHGA 1XTRA 3T5AA 3F5DA 1XQVA 3IQWA 3N2YA 1UJCA 3RIHA 3EPJA 3QKSA 4D6YA 4M21A 3QEAZ 2QD3A 3P0FA 2OY0A 2G9QA 1DSSG 2V7EA 2CVQA 1A76A 1N2CE 3K8QA 3SYRA 2LDXA 2VJOA 4GBGA 1A2BA 4GW3A 3IVRA 3ITKA 4D46A 2NACA 3LF2A 4FHGA 3R74A 5HILA 4EI2A 4IVQA 3R2JA 4TXNA 1DZIA 1VHJA 2P67A 4EMSA 5FL7A 3NX4A 1HTTA 4LRYA 4NG4A 5FR1A 2D1TA 4NZZA 1KDZA 1JR6A 2RMKA 4B83A 2QTVB 3BC1A 2W2VA 3QBEA 3COYA 1CF9A 1Y8QB 3OE7A 2G6BA 5CJJA 4D0GA 5CFRA 1LK7A 4F4DA 1I5RA 2QYTA 3I72A 3MFQA 3FGZA 2FLKA 2H0RA 4YP7A 1COZA 1FJXA 1YH3A 1EHIA 2JVJA 3MGKA 2JLXA 2NZJA 2JIOA 1H93A 4N9WA 3K7EA 2ISQA 1YBAA 3BHNA 4Y2HA 1EFHA 1KQ3A 1U8EA 2F3TA 3OLZA 5DCLA 3WGOA 4HXYA 2P6NA 3X1DA 1ENOA 1Z9BA 1ZNQO 3G0DA 3ZTWA 5KTKA 2DAPA 1C4XA 4I19A 5A4IS 4B81A 2Z04A 3OQPA 4UEJA 1QZ3A 2A92A 2E4UA 4XX1A 2W2TA 4YMSA 1D2CA 2VQFB 2R6R1 2AIRA 2GTPA 3ROXA 3L8EA 4G4IA 4JJGA 4UZEA 2IA5A 4RETA 3U81A 3K0AB 3CURA 1OFGA 2GVZC 1PEYA 2PJUA 3NR2A 2CV2A 2ZSEA 4HQRA 4P86A 3JQ6A 4FFBA 4EJ0A 5I9LA 1BSVA 4OMDA 3N3AC 2O1SA 4P53A 1TVEA 2XNKA 3ZNNA 1KJZA 1J2RA 3CF4G 1DC7A 1WQ1R 1Z7GA 2OHIA 1S1MA 4DA0A 4FNOA 2DR2A 3KG2A 4C0WA 4BCCA 1JQJC 1E98A 3RUIA 3PX3A 2EARA 1Y6JA 3K9BA 3CEJA 3ABRB 3GGSA 3N39C 4QDXA 4R16A 5DIZA 1H23A 2J3LA 2Y4NA 1GCAA 3C70A 2NU9B 4N7MA 3QE4A 2ZRCA 3KL4A 4RNCA 4AAYA 1WZ2A 1LLUA 5DM1A 1FPQA 1IZZA 1W49A 1XLUA 2IC5A 4ZT5A 3F6PA 2V0GA 3RARA 3RC7A 1GQOA 2O5RA 2JJ2A 2HBZA 2VIIA 3FCAA 4ISCA 4MCIA 2CXXA 4BEWA 4PAQA 1XDUA 3P9SA 2EFGA 3AEQA 2PSSA 2G72A 2ZJ5A 5BOSA 3B70A 3EC2A 1K8QA 1P39A 1B42A 2RK3A 2CZCA 3DE4X 1NXTA 3DXZA 4AY2A 1U0HC 4NS4A 5H59A 1J56A 2LCFA 3NRJA 5BW5A 4N0PA 4DCTA 2F48A 1D5CA 5TR9A 2PRZA 5AKHA 2X86A 4X97A 4INAA 1XVUA 4QUHA 3H86A 4K40A 2E21A 4EKEA 1CZHA 1QMGA 2VSXA 1KEKA 3OQOA 1FQWA 2NYVA 3BEOA 4N1AA 4RSHA 2F3SA 3ZR4B 3D7MA 5KYWA 2C7VA 3NRCA 3NJ8A 3EF3A 3ZZTA 4ZMRA 4MPJA 4XRRA 5JEDA 2BEJA 3MINA 4Q00A 3Q8WA 4ND3A 4G3XA 5ELXA 1HT1E 2Y1LA 1DIBA 1K2VN 5DCYA 1U4NA 3OMXA 2DBVO 1BZYA 1DXYA 2BBWA 1S2MA 2EGHA 2V54A 3C1UA 4Y0VA 3ZZMA 5FH9A 4O4HB 3C6XA 1CVLA 1YWGO 3H19A 5TGDA 5KNCA 4HBGA 4XWOA 4E2FA 1H4TA 5EZQA 4CM1A 3WYEA 4ED9A 2V7TA 3P9RA 1W96A 4DLKA 3H16A 1DFGA 3BF8A 3W6NA 1TK3A 2F1IA 3KB6A 2FDCA 3NETA 2G67A 1X9IA 2IHTA 4EY6A 2DPLA 1H0RA 4CM9A 5KWVA 1V16A 2JAPA 4XQ0A 2NTJA 3BTSA 2XE4A 4L2IA 4UDYX 4D7AA 4QE3A 1HPLA 3OOEA 5TMDA 3KOOA 4EF6A 4GZ5A 5F7JA 4CIDA 1G7SA 3HH8A 1Y7PA 1YDWA 2GPJA 5JS2A 2LP4Y 3FNGA 4CLDA 2VEOA 4ARUA 1Y1QA 3BWBA 4S2UA 4ENWA 5REQB 5JSYA 1R2QA 1AH2A 4KQ2A 2BSQA 1ST2A 4B35A 1OI2A 1OXVA 3S2FA 5BWCA 4WY2A 5B36A 1NUUA 2ZJ1A 3BH6A 1J24A 1Z13A 3A1EA 1E4YA 4EYEA 4FFWA 3WLOA 2VAPA 3FVQA 4G1BA 3WWCA 4OSPA 3QVXA 3AFHA 4HGOA 4RM3A 4RX1A 1KJIA 5MN4A 3AB3A 4Q18A 3STWA 2AVNA 2EFYA 4CMGA 4ANFA 2CCJA 3T7TA 5CH5A 4DANA 7MDHA 3VDMA 3KIPA 4JENA 3ANYB 5TJ9A 3HJBA 4MCAA 2NT3A 2VK4A 1JDPA 1K3FA 3LH5A 1RYEA 4MYUA 4F12A 2VSNA 2ODEA 3EVTA 5BVGA 5F12A 2PZFA 3G23A 2C2BA 1M0WA 3EN0A 1VJRA 3KQQA 2BHLA 4XPIB 3STTA 3BX1A 5HDQA 1D1QA 1EUDB 3FYUB 1DG3A 5DF1A 5JXJA 4KLCA 4AUMA 4QUJA 4ESOA 1W19A 1Y42X 3KT8A 3C5VA 4U39A 2JLUA 3EGOA 3KLPX 3AVPA 1W2HA 3V8VA 5MGBA 1NYLA 5JLJA 3GMTA 1ZA2A 4Y2TA 1B3BA 1L5KA 3DAPA 4GPAA 4K0RA 5A5DA 1Q19A 4KB5A 1NP7A 2WF5A 5TARA 4CLRB 2XKJE 1NQVA 3AY0A 3NWEA 4UHJA 3MELA 4CTOA 4EMUA 2IS6A 1M5TA 4ND4A 2V7VA 4IV8A 3VUFA 2AJCA 1U9IA 5JCOA 2CMGA 3SX0A 2FPOA 4IIBA 5J40A 3DT8A 3E9DA 1ZRSA 1ZRHA 3IIEA 3DD1A 2E49A 4N48A 4ON9A 2Y1DA 4XLZA 1IG0A 3M3PA 2X23A 5CVJA 2Q99A 3I30X 4OKIA 4E88A 1N0VC 1DOAA 1FIUA 4HLDA 1LC3A 1KAOA 3BGVA 2CYBA 1MO6A 2I29A 3M34A 1ZQ1A 2BL4A 4LK3A 3I5UA 3TH5A 1F6WA 4BB9A 1XD9A 4DCSA 1MX3A 5LJIA 2C7BA 4PLHA 2P35A 4A6PA 4A2PA 8ABPA 5EZSA 3HJGA 3ROZA 4WXMA 3PE6A 3PA6A 2VYFA 2EAUA 4C7OB 4W1QA 1KF0A 3B3FA 5CAEA 4HVAA 1LQ2A 4OB6A 2B5WA 2P6PA 3HDGA 4CEHA 1RPJA 1T8SA 3KBOA 3TXAA 4RV5A 5E3HA 1AKUA 3DTVB 4YXWD 1LX7A 1QE3A 1IYZA 4PNEA 4L95C 3PUZA 1F14A 5KTOA 3I5XA 3D6NB 3W3AA 3ECAA 3ADOA 3LT4A 4J4TA 1SQ5A 1T3SA 1I1NA 4IIUA 5JSKA 1E4EA 2FUG6 1LTHR 1W5BA 4FDTA 4QRIA 4RY0A 4QXAA 1J8FA 2DQSA 2HHAA 2YCLA 4NCBA 4UHHA 1CUWA 3WRXC 1OWMA 2VYVD 4I4NA 5DEIA 4JOSA 5EP2A 1ZN7A 4ZVKA 2GHTA 4IWXA 4MDEA 3RS4A 3TLEA 1I3OA 1XWFA 3IEPA 3JASA 2XMRA 4BB6A 2B30A 4UNIA 1QQ5A 3DZHA 3QIVA 1K6JA 3ON5A 4IR7A 4Y9DA 5ALXA 5DM0A 2A3NA 1W46A 2J41A 3FIUA 4H6VA 4YB8A 4BWGA 4LHYA 3SX2A 1AQYA 5L3SB 1WNTA 2XZTA 3CCFA 5F2KA 2ZSHA 4UE2A 4WACA 3C8UA 1NVGA 3T95A 2JH8A 5CNMA 1XD8A 4BFZA 1HDYA 4JELA 3TWOA 1FDUA 2WM9B 4DLRA 1A27A 3SG0A 1WBJB 1ZUD1 2IYNA 1M2GA 2QSZA 2QYOA 3OF2A 4D0SA 2GPTA 1FNBA 4MARA 4CMHA 2PEYA 5EWMA 2G4CA 1U6IA 3V97A 5KS2A 5T4HA 4FYIA 1GA4A 4KSYA 4YUZA 2N47A 3OF3A 1TT5B 1HEYA 2OK8A 3AEUB 5TS2A 4EJSC 2JVKA 2QK4A 3KDAA 5I6DA 5DDIP 3ZDRA 4D9CA 3M8KA 2FOLA 3QXXA 1TU4A 4GBMA 2W6IA 4EYKA 2EKLA 3H5WA 4BWFB 3MQFA 1I4OA 3F6EX 3DT9A 4U3JB 2ES4A 4YYEA 1HY3A 3FZQA 3TVDA 4ENTA 4MPPA 5B3JA 5LMZA 2O19A 3VTFA 1NVBA 2YH2A 4D2IA 5AW8A 2IOHA 3EZNA 4XPZA 4YHBA 5DRTA 4K9SA 1KVRA 3W8FA 2P65A 5IDYA 4O3MA 1BXGA 3CX6A 3IHLA 1ECBA 2O8CA 3WKDA 4HLUA 4AZ0A 2IYQA 5DWDA 4I6JA 3MXOA 4B8ZA 2PUAA 5K0SA 1M6NA 4J2OA 4O2LA 2OCGA 1G5QA 2HWYA 1ZISA 5KDOA 4L22A 2R48A 4RJ2A 2E0IA 4R9RA 5GZ3A 2FPIB 3KQYA 3BUSA 1PSDA 3H0CA 5BUZA 1JRLA 2P3SA 3U7FB 1CUAA 2Z8YA 3NM4A 4ZCSA 1XDGA 1BIFA 2CFSA 3FB1A 2OL4A 4KACA 4US2R 1AQ6A 4RADA 4YAOA 2QNIA 4EG3A 1GUBA 1A9XB 2X7HA 3BDVA 4DV2B 5HQ3A 2G5CA 5BWLA 2B6NA 1NRXA 2J67A 1FP7A 1MMFB 3AONB 3P9IA 3PZBA 2ETVA 4Y2XA 1BJTA 5F3RA 4C4OA 4DRYA 4YRGA 5FOSA 5FTNA 1ZD1A 4Q39A 5AXBA 1PGPA 4INZA 4IMPA 5DIFA 3T1NA 3TVYA 1YGYA 1U8YA 3H2JA 4CM5A 1QRSA 3JSXA 4UOQA 5CT9A 6NULA 5HZMA 4C04A 4MHTA 3E9CA 2EIHA 2I54A 1JKXA 3HBFA 2WWGA 4BTEA 3VR0A 1YAHA 3LUDA 2FQ1A 4OHWA 3ZUGA 3DLBA 2Q5QA 1SRRA 2P90A 4G0OA 2Y9MB 1KZGB 1M34B 1OIWA 1T8TA 3GZNB 3IH5A 1LBQA 2BHRA 4K2AA 3PUHA 1UDCA 2ATCA 4D74A 3GEGA 5ALDA 3I9FA 4DSAA 1C50A 1N0UA 5IXYA 1CZKA 3LCCA 1R00A 4G5RA 2EJBA 4FM9A 1EK2A 1LFAA 3PVSA 2YFQA 5AESA 3W2GA 1FXSA 1SZPA 2JCXA 4WJKB 2QE6A 1XYVA 4XR4A 4Y67A 5B4VA 1R4ZA 4W9RA 4AZVA 1BFDA 4RK0A 1V4NA 3QELA 4UEQA 5J63A 2C8LA 8GPBA 2C00A 3I04A 1Y1SA 2JFUA 4HOYA 4M0UA 5LQCA 3HL4A 3KQMA 5AI5A 5C7IO 3H87A 2QN6A 4NU8X 1ONBA 2B7LA 4KAFA 4BZPA 4EB6B 4UM9B 4IFIA 4IHAA 1NY5A 1E2IA 4YJ2F 4TROA 5HIJA 2X1MA 1V1RA 3CN9A 2QIPA 4DNOA 4EI9A 4Q7QA 3SU8A 3K15A 2DYKA 3OX2A 3Q7QA 3QOXA 4KNWA 3MILA 3OPYB 4KBGA 2NZYA 5KMGA 5F51A 1L8LA 2FRVA 4KIJA 1I7LA 3P96A 3NFYA 2F1RA 2P2LA 3EVBA 3AF2A 4LOKA 1E77A 3TTVA 3UB2A 4OP3A 4GLOA 5CJPA 2QE7D 3H5RA 1HFWA 3IDFA 3QX9A 4LQ4A 2HMAA 5LXTF 4PF1A 3RVNA 4AC9A 1ISHA 1KFEB 5DFAA 1XZ8A 3WZMA 1EP3B 1DBWA 4E15A 1OH7A 1QPBA 4RA9A 2PANA 3T1YB 1SCQA 2HJVA 1FA9A 4ZZ2A 3RUFA 3TL2A 1J9EA 2FN4A 1L6RA 3KALA 1ZOIA 3OQJA 1UT5A 5F5LA 3P9KA 3PK0A 2AQIA 2J3JA 2ONYA 5BQ5A 4RTOA 1T13A 2J45A 2GEBA 2IPXA 5I4IA 3NEPX 3FYCA 5ALJA 3ZKWA 1NNUA 2C4KA 1XU9A 1Y9ZA 3UPDA 2ATXA 1R3DA 3SZRA 2C2ZA 1FRNA 1SOMA 1Z0ZA 2F62A 4O2AB 2OYRA 3KVNA 1AKWA 2JJQA 2WF6A 2Q5EA 5FUXA 4LF5B 4A26A 4OBEA 2AR9A 8LDHA 4IJMA 4OYHA 1R9MA 3K5WA 4EGFA 4JVLA 4C0SA 1NW3A 4JLBA 5ALWA 4YQZA 2BPOA 1Y63A 4DA9A 2BFCB 3DT6A 1U99A 1LDNA 2EV9A 3KZOA 4GMDA 3R8FA 2NUAA 3DULA 1CEEA 3LQ4A 4B76A 3KAQA 3BXHA 2NNLD 1T9CA 3ZDCA 1WXQA 2RAVA 4B3BA 1VPEA 2CFRA 3D64A 4FMDB 3IYLW 5IJXA 2FCRA 4OXXA 5ABPA 4LY0A 5H3CA 3PKIA 1T6NA 2FQWA 5AKXA 1USVA 2D7CA 3HVKA 3QA3E 4NOJA 1JZQA 2MCFA 4YCLA 1Z17A 5EIFA 4Q4CA 4L02A 4MYCA 2ZR7A 3DAOA 3T3IA 3BGIA 4QDUA 3EBLA 1SWWA 3N6VA 1P91A 2ACKA 1FTYA 3N70A 4ZU3A 1N9KA 4HNUA 1A2QA 4N5MA 2FSSA 4OFXA 2A9VA 3OZDA 3JQ7A 4YHHB 3G13A 3BIFA 4RVHA 3LBAA 3MLEA 3JYLA 4KNYA 3EXFB 3H0KA 3RC1A 2JKZA 1AK2A 3EH1A 3L6CA 3MLBA 4L16A 3T4UA 4YPFA 1H94A 4P31A 1PT5A 2G76A 3AM3A 3ER6A 1E2FA 2IY8A 4DMCA 2ID4A 4EYOA 4XYLA 1KDPA 1V8OA 4BVGA 3GJQA 2ZIAA 2XIJA 3N74A 1FYXA 1ZGHA 4UQPA 4BASA 1DAMA 2VR1A 4IMRA 3SQLA 5L8VA 2FKNA 1NVVR 3IEMA 1A9SA 1RQNA 1YRYE 3A31A 3FFAA 3VV2A 3TEFA 1T3LA 4B4WA 1QGZA 4YX9A 3CY6A 1TQ6A 1I80A 3EWSA 2P9FA 2QP3A 3KJEA 3KEMA 1H4SA 3OE1A 5ISMA 5AO9A 4OQQA 2IV7A 2VTBA 1N2EA 3GRRA 3N8IA 3TNYA 4LZWA 5EN4A 5FLKA 2Z4TA 5TEWA 2ILVA 3FHJA 4JP1A 4Z4HA 1TYEB 1WBDA 3H5AA 3KEGA 1V7PC 4AZWA 1P5ZB 1ESEA 1NJ6A 3IA2A 1Y4AE 4MLZA 4QTZA 2OE2A 4RKFA 4EG1A 5CT8A 4EG0A 3DOIA 1B14A 1RFGE 3EXEB 3OPMA 5AI8A 1H9CA 2RHWA 3FKSD 1CX9B 4EUNA 2ORWA 1QP0A 1SM4A 5MFPA 3A04A 2OZLB 3H7AA 4PIPA 1KFKB 1Z2CA 1A9TA 1R5BA 2JCYA 3BWXA 4MA5A 4D4GA 1IMJA 4G67A 5CFQA 2OD2A 3Q9NA 4RIIA 1TAUA 5KNCD 1II8A 5E4YA 2QTFA 3INNA 2D3WA 2R6DA 4Q21A 4BNLA 4E08A 3EH2A 3C4QA 3PYXA 4R7ZA 3HJCA 3ZHUA 4KFRA 3A1UA 1E6MA 1KJ9A 1QC5A 5F1YA 2P77A 3UOGA 3ZBPA 4CFZA 3H11B 2C7OA 1GDTA 5ALYA 4FFNA 4X63A 5FOXA 1XPRA 2DHRA 2HMUA 4U6NA 2G9UA 1E92A 3LWZA 3QEKA 3L07A 1YS1X 1U7OA 1UIMA 3K1ZA 4AW9A 3WRYC 2ODBA 2AHOA 2QRQA 1RYBA 1U2EA 1CFZA 3ADPA 3THYA 1RWNA 4K9LA 1MZVA 4WZAB 4ZO8A 2AFRA 5LMCA 3GJ5A 2J3QA 4OX9Y 1BE6A 4XAQA 2EBHX 1IRIA 1Z4QA 3CW9A 2HGSA 1L5MA 2HRDA 3PQDA 3R40A 4JXKA 1AB5A 2Q2OA 2ZBQA 4XLTA 5DE3A 5ER6A 3V33A 3VH3A 1SOUA 1FXWA 2OCXA 2R1VA 4PTZA 4DLPA 3EHDA 5JCZA 5IJZA 2VNSA 2GETA 4XR9A 5T3UA 3KPVA 2EJVA 5FUQA 1K68A 1V71A 4O59O 1X7ZA 4M8SA 3UJHA 1RKUA 4PIMA 5D51S 1R7RA 3WLPA 4D44A 5KTYA 1H5QA 5JXHA 2OTCA 1U0SY 3E9EA 2EFCB 3WZLA 3FUXA 2X3YA 3GLHA 4FFVA 5GQSA 4EQ6B 2J6CA 3D4OA 3K2IA 5EQDA 2VFAA 3QPDA 4LYAA 5LLDA 1HFJA 1DBVO 2ZJ2A 3OUZA 3DCYA 5IBRA 2O2CA 5BR7A 2CLEB 1SXGA 3FNFA 2I4TA 1LJUA 2BKLA 4EDHA 1JHOA 3GD7A 5DOVA 1EVEA 1CTQA 3AIOA 2G70A 5EXPA 3WOHA 4CXMA 1NPDA 2DY1A 1WKVA 1SHUX 1U1IA 2Q0SA 3H2ZA 1VOTA 1H8ED 4FSHA 4V0LA 1CP3A 4XWWA 1QMPA 3JZMA 3Q3IA 2FEXA 1Y4ZA 3CS3A 2AUTA 1LPPA 5DP1A 4CF6A 5TEVA 1A8HA 4KO8A 3FCOA 3VKUA 4D0NA 5I01A 5EC8A 1X15A 4RENA 5TIIA 1P1IA 3QLVA 4FZRA 2ZBRA 3W8NA 4M9ZA 3W78A 4IINA 4PZZA 1Y8CA 5ILGA 4MUEA 1XPJA 3EDOA 4YUAA 1JE0A 1ZFNA 2DSNA 3ASUA 3DXXA 4Q1CA 4Y9RA 1E3SA 1XU7A 1VE7A 2GHRA 5ANRB 5EZYA