5I4CA

Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nonphosphorylated receiver domain of the stress response regulator RcsB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gene regulation
molecule keywords Transcriptional regulatory protein RcsB
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5i4cA00
2IPMA 2FLWA 2J48A 1DZ3A 3CHYA 2MYUA 4Y9TA 4F11A 2V0NA 2N9UA 1JFSA 4OTZA 4WZZA 1TM2A 3GL9A 4Q6BA 1USIA 2NZVG 1NXXA 3H1EA 4L4UA 5TPWA 4YWHA 1U2QA 3HSYA 3FGZA 2FEWB 2CHFA 3NNNA 3KKEA 3LFTA 4NICA 1HEYA 3D02A 5EWJA 1Z25A 3CRNA 4WXMA 1VRVA 4O1IA 4KPYA 4ZMSA 3IPCA 4XARA 4F8JA 2VK2A 8ABPA 2IPAB 3SAJA 3EJWA 2NT3A 1GCGA 5EWLB 3O21A 1J56A 1Z12A 5CHYA 4F12A 1AB6A 1Z16A 4KFCA 4MQEB 2R47A 3H5WA 4N03A 5TQ2B 3IP9A 1EFAA 1DBWA 1QP4A 3RVSA 3RVLA 4L85A 3JS5A 4MR9A 3TO5A 2FLKA 2GI4A 3O2QB 4D6XA 1BDIA 2WY2D 4UHKA 2MSLA 5CNMA 3LUJA 4LE2A 4OLAA 4OG2A 1R8JA 3O2SB 4N0PA 5IUJC 2L18A 1F4VA 2IPNA 4DADA 1EWVA 3QLVA 3CTPA 3MF4A 2QXYA 5TQ0A 4LDZA 5KC8A 4KQ9A 3QLVC 3QK7A 4E7OA 2B4AA 3K4HA 4MLCA 4ETNA 2WMYA 3GT7A 4WWHA 5HKOA 4S05A 2VUIB 2OENG 4G0XA 3LTEA 1D4ZA 2PKXA 2PJUA 1ZH4A 2WB4A 5GQSA 1ZGZA 2PL9A 4FB4A 2H0AA 1S8NA 1SD5A 3LUDA 1C0EA 1PEAA 4Z99A 3I09A 4EGSA 3N6VA 4RZSA 2E4WA 3A10A 5T3YA 9ABPA 4KQCA 2TMYA 4TLLB 4LDAA 2ID7A 3ROFA 4RV5A 4IILA 4H3KB 5JS1A 4NQRA 2L2QA 4W5NA 2JRLA 4W5TA 4N41A 3QLUA 6CHYA 3MQ4A 4Z9BA 3CFYA 1YS7A 4Z4CA 3O1IC 3Q9SA 1XWWA 1NXWA 4WT7A 4EY3A 5JNUA 2W42A 4RK4A 1E2BA 1DBPA 2QV0A 4MS4A 1GUBA 1MAVA 3OLXA 3CNBA 3OO1A 4KVFA 2DRIA 2WWVD 5CNKA 1W25A 1U2PA 5KQPA 1WETA 5FBKA 3TB6A 1XHFA 4MR7B 3SY8A 2PUGA 4HNSA 1EAYA 1K66A 1U04A 4TN5A 3CLKA 3LOPA 1YMVA 4NCAA 1VLZA 3SQNA 2R4QA 4OLBA 3OM1A 3G1WA 4ML3A 2PLNA 1JLKA 1EHCA 3N75A 1FSPA 4MR8B 1OXBB 2A9OA 1JYEA 3HZHA 2PUCA 1VKRA 4G0MA 1F51E 1P6UA 1ZH2A 2JBAA 3FMVA 4RSMA 1Z15A 3LUFA 1BDHA 1YTUA 4MS1B 4YLEA 3TX6A 4EYGA 3Q41A 4IMJB 4RY0A 1QQBA 1VPWA 4N76A 4F3TA 1U0SY 3SG0A 2HSGA 3T6KA 4G0ZA 2LBPA 4IMIB 1B00A 3HCWA 3I5AA 1TLFA 1K68A 3EAFA 3GBPA 4TMYA 3CU5A 1W9HA 3KLNA 4EYKA 3OLYA 5C5EA 3C6QA 1QO0D 2FMKA 3H6GA 5HQJA 3S99A 3O2JA 2Q5CA 2LP4Y 1SXGA 4N0QA 3H5TA 3OO0A 5KQGA 2R25B 1DBQA 2E4YA 4Z4FA 1BDJA 2X7XA 3LMKA 3OMXA 4MGEA 4MS3A 3CG0A 3LKBA 2GX6A 1BA2A 2MSKA 1Z26A 1DC8A 2O20A 3HDGA 4RKRA 5FWXA 2HPHA 1JHZA 2RDMA 4RY9A 3A3KA 5F64A 4D74A 1NXTA 2E4ZA 3UKJA 2CD7A 3FFTA 3GWGA 3OLVA 1RZRD 4XLTA 5DLEA 5EWMA 1URPA 1LBIA 1NXVA 1APBA 4QYMA 4N47A 3HVRA 4RK6A 1JF8A 3F6CA 2P4UA 4ZPJA 2A9RA 3C3WA 2PUBA 2FN9A 3Q7SA 2FQXA 2JVJA 2FTKE 1KMIY 1MIHA 2E4XA 2NT4A 1P2FA 1JFTA 1NXPA 3VNAA 4LE0A 5DCLA 2F8SA 1LK0A 2MYTA 2R48A 2M1ZA 4MR9B 4MPTA 4WXEA 4Z4HA 1MVOA 1RZRA 2JCGA 4KMRA 2FEKA 4MQEA 5IUNC 1TVMA 3BBLA 1ISSA 2JVIA 3KSMA 5FWYA 1E6KA 5B3JA 5DKFA 4LX8A 1NXOA 1P8AA 4TLMB 4KV7A 3QELA 1JBEA 4ZYLA 3JPYA 2E4VA 4ZJPA 3HV2A 4MS4B 4W5OA 4M88A 3OQMA 5HSGA 5FWXB 3CKMA 3DGEC 4PICA 3O75A 4RKQA 3RVKA 4RK1A 3RVOA 3Q7TA 2P9HA 3QEMA 4KREA 4P1ZA 3HEBA 4Q7EA 1SXIA 3UUGA 3DLHA 3LUHA 3ILYA 4EUKA 6ABPA 1BAPA 1D1QA 3HK2A 1FFGA 2XDYA 3C3KA 1LJLA 1RXIA 1QP0A 3OQNA 3HO1A 3IDOA 3BILA 1CEYA 3H5IA 1CHNA 4JA2A 3QLTA 4IF4A 3O74A 3NBMA 4MS3B 5JNSA 2JBAB 1JWLA 4KRFA 4QYWA 4FE4A 1RPJA 1PHRA 4YCSA 2IOYA 3NNSA 3N8IA 1UDRA 3DGFC 1ZY2A 2PL1A 1USKA 3F73A 3EQZA 3N0XA 3G85A 2MSWA 5JS2A 3OLZA 5TPZA 4PE5B 5TE9A 3RH0A 1NXSA 5TQJA 2PUDA 2LPMA 2PMCA 4G97A 1FFSA 1Z13A 2QVGA 4RU1A 3H75A 5IX8A 2RJOA 5IEJA 5KWSA 2IPLA 3M6MD 4EVSA 1BVHA 2WJWA 3W9SA 2A9PA 1PUXA 3L6UA 1ABFA 1ISRA 5HM6A 2QR3A 3F7NA 5EWLA 1NTRA 2LIVA 3QX8A 5CNJA 1D2AA 4JB0A 2LUOA 1FQWA 5DGCA 1YVUA 3RVQA 2AYXA 4G0PA 5IC5A 4JP1A 3KLOA 4ETMA 2FEPA 3H5LA 2L17A 4EYOA 5ABPA 1A2OA 1KRWA 1JDPA 5FBHA 3QELB 2ZAYA 4MYRA 2WRZA 2PUFA 2ID9A 1YS6A 4EVQA 4DQDA 1RNLA 2FMIA 4IGAA 3O1JC 3E61A 3QEMB 4MR7A 3RQIA 2M98A 3NHZA 3LUGA 3MIZA 4RY8A 1FFWA 4B09A 4RWEA 4RXMA 1D1PA 1USGA 2IKSA 3KHTA 2OQRA 4RK0A 4Z0NA 4YV7A 2FMFA 1ZHHA 4EYQA 2F8TA 4WUTA 1DCFA 1M5TA 3OMWA 5FWYB 3H5VA 2PE5A 5IULC 3GV0A 1ZESA 3O1HB 1DG9A 3HUTA 4YRZA 5GOTA 1QNLA 1H9CA 1YMUA 2PUAA 5KC9A 1JH9A 3HXMA 3CS3A 4D6YA 1T34A 2A9QA 3D8UA 4GPAA 5EWMB 1Z18A 1ZN2A 4W5QA 3IP6A 4KK3A 2NUBA 1A0OA 1Z17A 2FN8A 3ILHA 1ZAYA 5KQLA 2ZWMA 1Z2DA 4JOQA 2HQOA 1KGSA 4FE7A 2VUHB 3BRQA 3KYIB 4Z4EA 5JNVA 1QP7A 4W5RA 2FMHA 4O1HA 3T8YA 3CZCA 1Z2EA 3JVDA 4JASB 2QW1A 5D2CA 4YR7A 1M2FA 2CWDA 4Z9AA 5PNTA 1MB0A 4PZ0A 3FFXA 1TJYA 3MA0A 4RXUA 2HJ9A 3HUUA 2NZUG 1QPZA 1ZGGA 1QO0A 4OATA 3KCNA 4QPJC 2RJNA 1U8TA 3M9WA 5KI6A 1PNTA 4RS3A 3TD9A 3OQOA 3DLBA 3LKVA 4O5AA 1SXHA 2FQWA 4OBBA 3HM9A 1QQAA 2JB9A 4MRMB 2QU7A 1D5WA 2IDMA 2L19A 4LE1A 5I4CA 1I3CA 1MB3A 3MYYA 4H3HB 3BRSA 4MS1A 3TMYA 1DJMA 3JVIA 1P6QA 4ZMRA 2QVCA 1M2EA 1SRRA 4KNYA 3QX9A 1JFVA 3IP7A 2FW0A 3HS3A 3MM4A 3R0JA 3KYJB 2CHEA 3I45A 4HNQA 2FVYA 2FKAA 3KJXA 4MLDA 3BREA 2KYRA 3RVPA 2PAFA 3KTOA 3NNDA 5BQ3A 5BRAA 5ED4A 2GBPA 3N0RA 4LRQA 4YS6A 5JNWA 5T7BA 4MR8A 2HQRA 4XAQA 1QKKA 4DN6A 1RXEA 5C5CA 3NHMA 1LBHA 1QMPA 2I6FA 3H1FA 4GNRA 3SNKA 1LJUA 4IRXA 5JNRA 3C3MA 3QLUC 4H60A 4KZKA 3JPWA 5IUKC 2WJAA 3JY6A 5B3JC 3LUCA 1GCAA 1JYFA 1JDNA 3GA5A 4JB2A 3K9CA 4MRMA 1L5ZA 3Q7RA 1ABEA 4NCBA 5KQMA 4HNRA 3HJFA 3JTEA 1TMYA 3F6PA 5IBQA 5E3JA 2HQBA 3EULA 1DRJA 4Z4GA 4XXHA 1KRXA 2MYPA 3A0UA 3EQ2A 4RDCA 3H6HA 1DRKA 3B2NA 4NV3A 1DP4A 4RK5A 1JL3A 2VYCA 4P98A 3C97A 3OM0A 3RVJA 3T38A 3LUAA 1NATA 3QEKA 4YO7A 3ROTA 4MQFB 2JK1A 5DTEA 1OXKB 3KG2A 3DBIA 3Q15C 4E7PA 3GYBA 1Y1LA 1EWKA 1ZDMA 3EGCA 1PEYA 1DC7A 3HDVA 1EWTA 4MAAA 3IP5A 4XASA 5BRJA 1E6MA 5TQ0B 1AB5A 2IYNA 3KS9A 4YP9A 3UK0A 3SM9A 3EDCA 4ETIA 4F06A 2JVKA 3N53A 3OLWA 4PEVA 3I42A 3URMA 4G0QA 4EVRA 4UHJA 4HYEA 5TPZD 1L5YA 1ZITA 2YHAA 3MMNA 1GLGA 2YHBA 3H1GA 2BGGA 1PNRA 1XHEA 3M9XA 3GBVA 7ABPA 5TQ2A 4XFKA 3RVNA 3E3MA 2B1JA 5JNTA 3IPAA 5CNIA 4CBVA 3L49A 1ZVVA 1IIBA 1JX6A 1C4WA 2GKGA 3DZDA 3RVMA 4QICA 3CG4A 3GRCA 4JAVC 5BR1A 3LUKA 4G86A 5IEBA 3EODA 2FXIA 3FFWA 3H5OA 4MQFA 4Q6WA 1CYEA 2GWRA 4PYRA 3A0RB 4RK7A 3FDFA 1M5UA 3RVRA 2E4UA 2MYNA 4KK4A 1A04A 1YIOA 5TPWB 1YK0A 1DCKA 2QSJA 1NY5A 4G0OA 1GUDA 2FSPA 4Z4IA 1DCMA 2PUEA 3P9YA 3N0WA 4G0YA 4YGXB 5EWJB 2H3HA 2FQYA 4RXTA 3VNBA 1E6LA 3CZ5A 4LZLA 4S04A 2AYZA 1YK1A 3T95A 2RGYA 2QZJA
chains in the Genus database with same CATH superfamily
3A06A 1DAIA 2HA6A 1C8BA 1JJAA 2EX0A 2ODEA 4CF7A 2F3TA 2B2CA 1OA0A 2X8LA 3DSRA 3PXUA 1XT6A 2PGOA 3RJ9A 4G36A 2DFPA 3EBOA 3GG2A 2CZGA 2RBGA 4BFUA 1JRLA 4GC9A 2C57A 4L75A 3VZDA 2OCDA 4D44A 4RJKA 2ERCA 3VPDA 4D3YA 5FD8A 1K6EA 3TNDA 2Z6UA 3LBYA 1QR2A 4J0DA 4NFHA 1RLJA 3RS2A 1VE5A 1SBTA 4G5FA 1O0BA 2HLHA 1VRVA 3QG5A 4ZZ0A 2VTVA 5EERA 3BCUA 4RF5A 4U2FA 1H1LB 4Y98A 2QA5A 4OGWA 2FN4A 2NT3A 1NV8A 4L4YA 4DLKA 5CFLA 2YRFA 3FZYA 3O7MA 4JI5B 2O8BB 4CIWA 1BIFA 5AOCA 2ZIVB 3AEQA 4N03A 1MLDA 1P2TA 3MERA 1A8UA 4MVJF 3QXGA 4C06A 2Z5GA 3EEYA 4MCAA 3GDHA 5E8RA 3RVLA 2XEXA 3K1TA 3TO5A 4JL6A 4CKZA 4PN3A 1P2DA 3I58A 1JA1A 2FG5A 1E96A 3TFWA 1F8FA 1P33A 2R1VA 1SOMA 1YRQA 2P6NA 2ZWIA 4KXXA 2IE8A 4OG2A 3PQ2A 4WBNB 3V2GA 2G67A 3QNUA 4MEBA 2F3UA 3FWZA 2BLNA 1USVA 2B2XA 2V9CA 2XCUA 4K6FA 3QLVA 1FNDA 2Z2IA 4GD3Q 2LW7A 2UVQA 2YFHA 3HPRA 1NBMA 2NU6A 5FNVF 5A03A 2OZVA 2XQFA 5ALOA 1Q7EA 2P6OA 1T9KA 4FGUA 1TZJA 4AN0A 5LWQA 4G0WA 2WF9A 4G0XA 1BMTA 4YECA 2Q4DA 3U3XA 1V16A 4HUJA 3W8EA 4E5MA 4EHKA 2PKXA 3NVDA 1XRQA 2A5GA 2VZ9A 1SXJA 1UOOA 4HQ0A 5BSVA 2DOKA 5JCXA 2VJBA 1E7QA 1WVIA 1CULC 4B3XA 2A84A 3B5EA 2YJGA 3P2KA 1ENOA 2ZR8A 1S8NA 1X80B 2NM0A 2XOKD 5BORA 3TH5A 4US0R 1YRBA 1P0PA 3STVA 2J0EA 4AG3A 1OXVA 1JNYA 1QGYA 3MGBA 1FPQA 2PZFA 5ARCA 1PSDA 2ZE5A 3A7EA 4W5NA 2L2QA 2JRLA 4M86A 5FL7A 4N65A 3FVQA 2WT8A 3UB2A 1G4UR 2O5VA 1ITZA 1GU0A 1NXWA 3MINA 4RK4A 5HDBB 4HDKB 1KH1A 2GS9A 2K2WA 3V9PA 4IV5A 2QV0A 4BHTA 1ESDA 3JQBC 2BEJA 4YJ3B 1GUBA 3GFSA 1UWKA 2FGKA 4YAUA 1IZ9A 2IHJA 1GG2A 2PVSA 4WK2B 1E79D 1MNQA 3T4EA 5DOVA 2HRZA 4FFMA 4AWBA 4HX5A 1MIOB 4QJBA 5KQPA 4CDRA 4MGIR 1N2XA 5JSQA 4RWZA 1CCWA 4YC7A 1V1RA 1K0UA 4DDVA 1G98A 1U04A 4Q24A 1AUQA 2ZJ6A 1VLZA 2G40A 2YMMA 4FNAA 2QWXA 2W4QA 4HYYA 3FKQA 2OQVA 2YWEA 2VK4A 3H2GA 5KNBD 2VNHA 3BXZA 4TPKA 4MR8B 1HM5A 2DXIA 4CV2A 3EPLA 2J5KA 1QX3A 1WABA 2C59A 5FUVA 1C30A 1HA3A 1OLXA 1FDRA 2Q7XA 2QP4A 1Z62A 5HE8A 2OBBA 5IT4A 3WOVA 4NARA 4PPGA 4JU8A 2ZRMA 1VIAA 4ZAXA 3ZG6A 1V8ZA 2BFMA 2BEUB 3M6LA 5BY2A 5ECWA 2CDCA 2NPIA 1AGRA 1MV5A 2II6A 2W2NA 4HH1A 5CDUA 3WAGA 3EG9A 2ZVDA 3RSCA 3V1MA 1VM6A 4C6TA 1NM5C 4A4DA 1T8YA 3JQBA 4H2DA 2PR2A 2BBOA 1D07A 4L3OA 1D0VA 2VNAA 1CG6A 2F3SA 3HR7A 3KQPA 4GLOA 2MINB 3GJZA 4GXTA 4PYLA 5A71A 4F2PA 3L79A 3GEGA 4RCYA 3A6JA 4OI1A 4UC0A 3INNA 3LX6A 2BOVA 5JTUA 2QRGA 3VQTA 4XM1A 2G8LA 5C8XA 4J6FA 4A2WA 2HA7A 4I19A 3OI7A 5FLYA 1CJCA 1C1XB 3WQQA 1EGMB 3G6KA 5FBRB 3WLEA 3HCOA 4JBXA 2RH8A 1Z45A 3CJRA 1RTTA 1B8OA 4LTMA 3GAMA 4IIJF 4IR7A 4UBIA 2NTEA 4UNPA 3HCNA 2WM8A 4D4KA 4DDUA 1MFPA 4LJAA 1OGIA 1J2TA 3V7FA 5IWCA 1FX0B 3A3KA 3DEYX 1TMOA 3GQVA 1JBKA 2Q3HA 3FFTA 1GNVA 1RZRD 2Y6VA 4LZOA 1GGMA 3PIIA 1DLJA 3NBKA 5H70A 2CMDA 1URPA 5HPYB 2O8FB 1PT7A 3B9RA 5FB3A 3ZLTA 2WTAA 2H4JA 3WLHA 4RGYA 3FZNA 2H9AA 4J4BA 4X00A 5EOVA 3ZZNA 2PUBA 3GXOA 1A8PA 1BC5A 4NMWA 3SS7X 2ID4A 4QNRA 3AM4A 3TDMA 4R2XA 1LK7A 2NTVA 2QRUA 2QQ0A 3PQ4A 1V8PA 4UHDA 4BP3A 3P9KA 1PG2A 4Y7CA 5AW1A 1AZLA 1G42A 3O2NA 5AJZA 4YPVA 4FN4A 4LBWA 1GPH1 2ANBA 3E22B 4RORA 5JROA 1EFVB 2FX5A 3WJ1A 2JCGA 5C7YA 1ODKA 4NEQA 5JPCA 2NUPB 1ULZA 3NBYC 1RWBA 1NW6A 3E5NA 2LVBA 3ZWOA 4F7DA 4K9RA 3TR6A 4CV3A 2IHKA 2EF0A 1RVDA 4YJFB 5FO0A 1BHQ1 1D2RA 1E60A 4D4LA 3L82B 1WD7A 5JAQA 4EJFA 1Y7TA 3QYPA 3W6NA 3Q7TA 1ISJA 2XF8A 4GOMD 4V2UA 1R5JA 2PKYX 4HRYA 5JAMA 4RFLA 1B42A 2CY0A 2JLYA 4OFZA 2J9GA 1NTOA 2KWIA 3VO1A 2H1HA 4RVUA 5DIFA 3GI1A 3WR5A 4XIFA 1JEEA 1YDEA 1G3RA 1QP0A 5BNFA 2WE7A 3DDCA 4C05A 4GKJB 3EZ9A 3AK4A 1XAJA 4MOWA 4JA2A 1UODA 2CCGA 3B3JA 3QKUA 2DPGA 4PF1A 3ROQA 3QU7A 4C1NA 5JD6A 2G4LA 1BVUA 2XT9A 1PR5A 2OZLB 3B6JA 5KYGA 4K86A 4Q7LA 4NWIA 3BCSA 4OQ4A 3WIBA 4DSAA 1N7JA 2PKQP 3E7DA 3HHPA 3INGA 3G2NA 4XDYA 1J99A 4AMVA 4RBNA 1A8IA 3OCZA 2OBXA 2IZ1A 2XW6A 3KKLA 3PNKA 4BFZA 1Y80A 2H0RA 4RSHA 2YHIA 3T5BA 3S8EA 1N9KA 3KLBA 4AG5A 4K0KB 4U2CA 2HBZA 3RGWS 4OSEA 4TMZA 3H1PA 2JI9A 2CNWA 3DR3A 2IU0A 1WM1A 3HBLA 3PXXA 3TLJA 1NWHA 3TNJA 3O82A 5MN6A 3KK0A 2FV8A 2AI2A 4EGAA 5LWHA 5K0NA 2PHZA 3Q9UA 3OTHA 5A3QA 4LBZA 1RKUA 1HNWB 3R6WA 3ER8A 2O7SA 3UJDA 5KINB 1RRGA 3ZCVA 3M6MD 3ANXA 2P79A 2NO6A 3RHTA 2JJQA 2V54A 4OI2A 4R1QA 2XNDA 2A14A 1P62B 4FT4A 3ELUA 1XI2A 4REMA 4RV9A 1LWNA 3BULA 2RGUA 3KOMA 4ZYTA 5FADA 3VSBA 1LVHA 4INZA 3RRYA 1EUYA 2B7CA 1D8TA 2OV6A 1QB7A 3KIPA 4Z4FA 1L7VC 2Y3IA 3PGJA 4ZREA 3TIXB 3ZV4A 2L17A 3UAVA 2OZLA 3HLTA 1DI0A 1JDPA 5K4AA 3T7EA 3QELB 5KTOA 1H2RS 4EFDA 1OKKA 1J09A 5KVVA 2DFLA 2QRQA 2Y8EA 3F5MA 1NP6A 3SC3A 1D4AA 3B3FA 4RADA 2P0EA 1ACLA 1CUYA 1ZJZA 2GM5A 2IYSA 2M98A 5DNDA 2QUZA 4QDTA 4WK6A 1YVPA 4B9EA 4OJNA 4V03A 4YRLA 2YV5A 2XYQA 3KHTA 4MTLA 2R6ZA 4YV7A 2JFPA 5BQPA 2AQHA 5H16A 3DR5A 3KJIA 1FVOA 2QAGA 4ENQA 4YX9A 4RZUA 2J3EA 1J1ZA 7MDHA 6LDHA 1EZZA 1A9RA 2DQSA 4F86A 3NEJA 2HKIA 4N3CA 5B4VA 2HK7A 2XGOA 1M7GA 1A5BB 4LRUA 4ZC8A 2XCQA 3LIIA 5GJBA 5K3OA 3SZLA 3SZUA 1RP7A 2DLCX 1GXSA 3RFCA 4DB2A 1OPRA 5KC9A 1W8DA 2P75A 2C4UA 4MQBA 1R5NA 3I9JA 1ZC3A 5E7JA 4MKXA 2W8ZA 2ZBGA 3ZW9A 2D0OB 3ABQB 1UM9A 2ZIGA 4PC7A 5HF9A 3GMSA 2WJ4A 2WDPA 4PR0A 1A0OA 1XZLA 2W2OA 5JSKA 3ZD8A 4BNYA 1X87A 1YD7A 2JCVA 2FAXA 2WTBA 3W8RA 1ZR4A 2GEVA 3DBHB 1GRRA 1SA0A 1X42A 3V4LA 4E08A 3GEHA 4NC9A 3NTOA 3R3VA 1XCJA 1GFSA 1P9OA 4HFMA 4L0MA 5FI0B 2M32A 4I5EA 2QYSA 3GJQA 3C7AA 4B2YA 5EZYB 4ED9A 3WYDA 1I0ZA 4WNAA 5IDVA 1BHJA 1VYUA 2RIPA 1M8PA 3EZYA 1A3CA 4XWKA 3FNIA 1XJQA 4FCWA 1AKTA 5M34A 3K6SB 1O6BA 3M1IA 4CLHA 1CP2A 2BFEB 1DC6A 4YDQA 3MPUA 3Q88A 1UJ2A 4BL5A 1ZNYA 2WNHA 4S1NA 1GQOA 1GL7A 1Z4IA 2WVJA 4DC1A 5TLSA 4TSFA 3GP8A 4H3HB 3MUFA 1GAQA 4UMFA 1DJMA 4FHGA 1RMYA 4RFSB 1OJLA 3SMVA 1DQRA 3F9IA 4RJ2A 1LW7A 3WK7A 2F90A 1ZD1A 3HCRA 2ZYRA 5HQ3A 3BXGA 3IO5A 1HLDA 3KZ1E 1L4KA 5IMSA 4ARCA 1XDSA 1WLSA 1KFJB 3H4TA 4HNQA 2OV8A 1W34A 4RHCA 2PUVA 4W82A 5KAMA 1DC3A 3CPHA 2XE4A 2W37A 3FTQA 2BGJA 5ED4A 4GGMX 3FTEA 1YGYA 3MT7A 4F60A 3AOEA 2EL7A 1D2NA 3EVEA 1E1KA 4WDRA 5KYKA 3EOZA 3JAKB 1CZKA 1V95A 5JV5A 4TSRA 1SD2A 1Z33A 3DD1A 5FUWA 4X7MA 1Y8AA 1TW3A 5DWQA 2WIAA 3F98A 1EGHA 1KZ6A 3C7DB 3B1YA 3DW3X 1N2BA 3QLUC 1BNCA 2QTRA 4ITVA 2P3SA 4FC6A 4TZKA 1QR6A 2QD4A 4RABA 2D1YA 1LLCA 4F4UA 2YHIB 3WVNA 1GTZA 5IVKA 3R7WB 4OQLA 5LD2C 4I9HA 5B57C 1Z5WA 3EBPA 1QYXA 1FLNA 2QUHA 1RYHA 1ND5A 1XNQB 2GHQA 2VUTA 3P9SA 2ZETA 4RDCA 4BIIA 2CZCA 4BXOA 3TPCA 1QGOA 3CLRD 4RK5A 4LGYA 5E6UA 2HF2A 1OU4A 1W0KD 1O5OA 1UJBA 1VHQA 1W5EA 1CUGA 2IXFA 3AHIA 4GWGA 4X1YB 1K5HA 3PPVA 4OHFA 1E32A 4UMEA 1QHHA 4BX3A 1EXDA 4WOCA 2OXEA 1YHYA 5GONF 3NC4A 4RD4A 2XMBA 2ZRQA 1NV9A 1Y1LA 3H8WA 3FH0A 3GLKA 4W6QA 5D86A 1DQSA 4FCTA 1D7AA 2AL7A 3PXDA 4NOKA 4CKEB 2E1PA 2F8LA 4JQZA 7MHTA 3CO5A 2PN1A 2RI0A 2FW8A 4OI4A 3FWYA 4JH0A 4TQAA 3CRZA 1UZNA 1VL2A 2H2GA 4N5NA 1EKXA 1OQAA 2JVKA 3N53A 4HL6A 4V2IA 3ZYCA 3IOBA 2XAUA 2QJWA 5C31A 1M2HA 2VA9A 4RX1A 5LXTB 4UCFA 4UJ5A 1IAQA 1SVUA 1B6RA 2F3PA 4ZANA 3GMIA 3DQZA 3IRVA 5TQ2A 3G0IA 3I8XA 3K20A 4MUHA 3BD6A 1IIBA 1EFDN 3UHFA 5JDIA 1GL6A 4NX2A 4A5OA 3GGJA 3BIFA 1LRLA 1XDWA 3TWOA 3GNTA 1HTWA 1N57A 1H4VB 2VBCA 1RWKA 3ES9A 3NORA 4FNGA 2J41A 3LHIA 4G86A 1VCIA 1MN6A 5JQWA 1KOLA 1SVIA 5HK8A 5EJ6A 3I01A 3LSTA 2CJYA 3CF0A 5THQA 3KEOA 2WJZB 5EKSA 5JECA 1P2VA 2OY0A 3ZHZA 4R2IA 1Z6AA 3NDPA 4JUBA 2VWGA 3A6ZA 3W5SA 2FPLA 1HMPA 4G0OA 3AW8A 5CIWA 4ZVOA 4EJ2A 2YUTA 3ORYA 4NZOA 3EUAA 1KQGA 3OKAA 1JSRA 4AB1A 4ZO9A 3NHWA 1L1QA 1J06A 1AHNA 1DQNA 4I99A 5AOVA 3PXEA 3D7NA 3C0KA 2OOSA 3DUFA 3GP3A 3I4LA 1GQSA 3PEUA 3V4OA 3NFRA 3ZBQA 3S5UA 3ZWYA 2RGNC 1KVUA 4QYTA 1F6WA 1P3DA 1DMRA 3PWKA 1KWKA 3E9ZA 5J23A 2FPPA 1P29A 2PWPA 3CHYA 3DE0X 3TAXA 3VZSA 6REQA 4JS0A 2DWCA 2MYUA 1JH8A 3V34A 1NVMB 4F11A 2AZ4A 4R71A 1RJDA 1F20A 2JCXA 1TM2A 1ZM7A 1Q7RA 3JQFA 3PFIA 2VF4X 3RASA 2NZVG 1K4MA 2QVYX 5TPWA 2QDXA 1OX4A 2AOXA 4Y1RA 4RPHA 1W19A 1IYZA 4Y6OA 1XA3A 5ARBA 2IF2A 5CHEA 3EASA 2I7DA 4DG5A 2XE7A 2YMPA 3HVUA 4WEOA 4UPDA 5DEIA 5EWJA 1UMDA 4D97A 1T6ZA 3BHNA 1WSDA 4S24A 4G9BA 4EX6A 3K70D 1PZFA 2WTUA 4B87A 1J2UA 1AHIA 1JKFA 2VK2A 1N5DA 3P32A 1PW7A 3LY5A 4GKKB 3DW1X 4XPIA 3O21A 3SC2A 2PSEA 2YIMA 1UM8A 2VJDA 5A3SA 4F12A 4XIYA 1NY6A 1AIPA 2OCLA 2R47A 4GKVA 4TL6A 4BQOA 4TGLA 3ZU4A 1B23P 4X8LA 1TUIA 1XCMA 1XUOA 1TX4B 2CFTA 3HWWA 4HWKA 4KNVA 1QAMA 3GLSA 1T3HA 2D0PB 4MRAA 3D6TB 1GWNA 3G9ZA 3R23A 5HCUA 4TVSA 1GCUA 3BBPA 4IOMA 4QU5A 3UMCA 3LUJA 1QYCA 3MPOA 4JBYA 4JX9A 1EK1A 2WD9A 4N0PA 3WHKA 4JVLA 1F4VA 2FX2A 1HDYA 4UE6A 3OMLA 1OZFA 1PJCA 3ZGLA 4DADA 4DL9A 4M1YA 3KWFA 1XZHA 2EBUA 2PYDA 3L0ZA 5IAEA 2Q4OA 4ISBA 1WOYA 4JLSA 5CX1A 1J23A 3HBNA 5FBVB 1YNOA 3P4XA 2ES4A 3DDOA 4ZRNA 1N5LA 3IDAA 1R3DA 3U4HA 2A0FA 5KJEA 1HH4A 4E12A 3OJEA 1A8SA 1GQ2A 3CKYA 1P77A 3WDSA 1E64A 3F3YA 1ORDA 1R6UA 1U1FA 4M6WB 1QIFA 5EINA 5M5BA 1OR8A 2VPWA 1S1CA 3FROA 4LMPA 1GFIA 2OGWA 2ZS7A 5ILOA 4XPIB 3HU2A 2Q8PA 3SC2B 1R4NB 2JAWA 4MA5A 2G07A 4GPTA 3N2KA 4F4FA 1OYYA 4B80A 1WHSA 2EAUA 2KLBA 1RLMA 1CUCA 2PQ0A 1DV2A 3ILXA 2PNFA 4GR4A 4KUHA 3I12A 4PRKA 4A16A 4I9FA 4Z9BA 4QGHA 4YPOA 4D02A 1P0FA 3TE6A 1EVYA 4LHZA 1CXZA 1GAEO 3OEYA 1R8YA 5KU7A 3BH7A 1XZ8A 4KX5A 1Z8HA 4UBOA 3UATA 1DBPA 3TTTA 2DCMA 1L5MA 4CIDA 5DB4A 4J1SA 2X41A 3OO1A 2SBTA 4R8KA 1OWNA 2Q3CA 1XU9A 1SAYA 3R40A 3WV5A 2JZCA 4IHJB 2Q9BA 1GAXA 2YJTD 4QGAA 4TWJA 5CA1F 721PA 1X8JA 1M0TA 4ZO8A 3TB6A 1NJ6A 4OGFA 3ECAA 3FNGA 3MRSA 3EGDA 4KH0A 2KI5A 2DT5A 1GILA 3AUYA 3H4IA 3VC7A 4X7PA 4JEIA 3X1YA 3IERA 4ZGBA 1RWWA 4N4AA 2IVZA 3Q5EA 5A7GA 1MGOA 3DHEA 1A9ZA 1NN5A 3O8OB 1GPBA 1XD9A 4G8DA 1E2FA 4O63O 4IOLA 3WDLA 4BNIA 4NONA 3OWXA 1A7KA 4KWIA 2ZYTX 4XLLA 1U65A 3HZHA 2OCYC 2Q3JA 5AP9A 3UM9A 4V1CA 1D09A 5EXTA 5AKKA 2ZSIA 4BB6A 3O3OB 4LI3X 1DKMA 1T1RA 1BDHA 3DNFA 1LX7A 3OJWA 1V11A 3PPYA 2P4EA 5GJWC 2B82A 5JJIA 3L01A 3C70A 4LOIA 4M49A 4F92B 4L4XA 3I2KA 2BGNA 3AVWA 1XNJA 2LBPA 3NYQA 5E7MA 4YRPA 5CITA 1SPBS 3P20A 5SV2A 5FPHA 4J43A 4UCQA 4UTXA 4TMYA 5JBNA 1XO1A 3FTFA 4GPEA 3NTRA 3HXOA 3OLYA 3GRFA 3KEMA 3FHTA 2VHJA 1S7CA 3OZVA 1QO0D 1ZUNB 5HQJA 2R7KA 3DFIA 3HC7A 4LTNA 4AKHA 1Y7LA 2APJA 3F1KA 3IVXA 4U3JB 3V1LA 1ABBA 3I04M 4L74A 5CBPB 1QRAA 2EJTA 3WL5A 4KR6A 1IZ7A 1XTBA 2VG8A 3ZPXA 2JDIA 5DYIA 4A92A 2X7XA 4I7EA 1GUZA 3ICEA 3B7PA 2AN4A 3AESA 2MSKA 3PFNA 3HDGA 1Z26A 3L6EA 3K5WA 4WADA 1GRVA 5K09A 4LYGA 4OHWA 1GA6A 2G1AA 4QPPA 1RPZA 2V5AA 1XZMA 3MGKA 3QQ5A 4W5JA 4YI5A 3ROEA 3VUFA 1NHGA 3GB9A 3LYUA 5EWMA 1U2TA 4FSXA 1JHVA 1OA1A 5E1MA 4HEQA 4CV0A 2JLSA 4MVJM 3R6GA 3AKZA 3H2JA 2Z3WA 1NNLA 5IM4F 2DLNA 4EG4A 3IQGX 3U44B 2AXEA 1J2YA 1TCAA 3I64A 4K8OA 4TZ6A 3GP5A 3IE1A 2V74B 3E9YA 3TLGB 2VO1A 2FN9A 4TN1A 1QKJA 4UOEA 2Z2YA 5LDGA 5T5QA 4G0VA 1A9YA 2W00A 2FTKE 4JUIA 2W2PA 4QDXA 4AJPA 2GWHA 1R6XA 3EIXA 1CY1A 3WAKA 4LA4A 4BO5A 4OU5A 1G8GA 3W1VA 3E1KA 1IOVA 1H2EA 1PQWA 2FSUA 2OKCA 2XB9A 3I8OA 1JFRA 1UDWA 2H4WA 1FUIA 2PS0A 1MVOA 2C5LA 2I9PA 2IYVA 2FEKA 4KMRA 3EMVA 3LF1A 1TUBB 2JW5A 2NV0A 2B6NA 2Z0MA 4PZAA 4O4IF 1CJKC 1QFZA 2WDZA 4F8YA 3G0GA 5KX5A 4PW0A 1SIOA 2VP4A 4F2HA 2GKOA 3DF7A 3E7FA 5I7EA 3QYFA 2K5UA 2PJDA 5KYUB 4K6GA 3DGEC 3VKFA 3AJ8A 4TKLA 1NMYA 4BWYA 3DE5X 3UMFA 4DMGA 5BUQA 1NN1A 4X60A 2BKAA 5KYWA 1BDMA 4KREA 3KZMA 3AQIA 1A4RA 3VR2A 3BOSA 2LR0A 2VQ6A 2GKSA 1ORWA 1FC0A 4AQ7A 1BAPA 5AVWA 2REQA 1SB9A 2X5JO 3WC4A 5BOVA 4MI6A 4BLSA 4ESHA 5J4HA 1KZHA 4XRRA 2GZDA 4NU6A 3SR0A 1OFVA 1BE0A 2GEKA 5BMVB 5HJ2A 3SSAA 2C31A 1J6UA 2X4IA 3CZRA 4J7AA 1KWGA 3PUHA 3WDKA 1SCUB 2JBAB 3BRWD 3KBBA 3B3QA 4R9NA 3S55A 4ATNA 5JI3E 1CRPA 1PHRA 1POXA 3BEOA 1QOZA 3LT2A 1ZY2A 2ZYWX 3EH2A 3L0PA 3W3AA 5KYYA 1NMZA 1ZIDA 5AW4A 1TFUA 1EFRA 3VO2A 2AEEA 1SUPA 1R16A 1HNXB 4MGYR 3T9DA 3TI7A 3PFCA 2DUJA 2EEZA 3MBIA 3IC5A 3OLZA 5LUBA 5AESA 4FDTA 5TE9A 3EYWA 1L1RA 3LPCA 3WL4A 2PTHA 3BD9A 5CG2A 1QE0A 4JXZA 3C3DA 1Q95A 1XKQA 2OVFA 2VPQA 1BKYA 4I81A 1M1NB 4YMSA 1XPJA 2JDID 3MMPA 4K9KA 4QDUA 4ZDJA 1J4AA 2PVCA 1XF9A 3OJCA 3PDWA 2XQJA 4BNHA 4PU0A 1CY2A 4JVOA 1GOTA 2WZQA 1DSSG 2V8BA 2IXEA 2XNKA 4QFDA 4U7FA 5DV9A 3DWFA 3TLCA 1ISRA 1EK6A 2MU1A 2OK8A 2PMBA 1VJDA 4RUKA 1KR2A 1ETHA 4YEDA 2BFCA 4PBSA 1XK6A 1R6DA 1FDSA 3ISTA 1RXYA 3ESXA 1QGUA 3MOGA 4KO3S 2WM9B 1HE8B 4JD5A 2VHVA 1U0LA 4QTXA 4R2KA 2AYXA 4RNDB 4EL5A 4XUDA 2C4TA 2XMZA 1GYQA 2FSHA 1G2QA 3ANYB 1HRDA 1LV7A 2J3HA 1YDWA 1NMXA 2QU8A 3E8MA 4JEHA 1XTKA 4QVKA 4IJWA 5E1DA 4AK9A 3REQA 1JHYA 1L9KA 2ID9A 4D8VA 4EVQA 3KYDB 1GU7A 3QEBZ 4GT1A 1IBSA 3VPCA 2IYFA 1DPFA 2ZW9A 5HZGA 1DIRA 3QEMB 2P40A 2UAGA 4D4HA 1W0KA 3LUGA 3GGGA 3RU3A 2H54A 3FUWA 3MLEA 3WGZA 2D0DA 3KKZA 3PYLA 4MNTA 1XP5A 3F47A 3KQVA 5FL3A 5J3JA 4CKWB 1TJPB 2GHRA 4GP7A 3WGMA 2IY9A 2GZRA 1KNQA 4D9HA 1LB1B 2FRXA 1ZMRA 3AEYA 5CVUA 1E89A 2ZSKA 4XH9B 1J0EA 1YRLA 1MC1A 3ONFA 3TQFA 1WXDA 4QPNA 5KIAA 4RELA 2HHLA 1WKBA 2LGJA 2V6JA 4YRZA 4I3GA 4BJ3A 3RUCA 5FUQA 3W6OA 3BK2A 5H3LA 4D42A 2ASEA 5JBIA 1ZJWA 3BD7A 4DEYA 2P62A 3L0YA 2HMSA 4B3HA 3DMRA 4CKEA 2PBLA 3G9QA 4EHJA 3AF6A 4G8JA 1NFFA 4W5QA 2VCEA 3GY0A 3ZY3A 1A50B 4EA9A 3M2PA 3MBOA 4XGQA 4RD2A 4DRZA 4EJ0A 3J81A 3VYRB 2AZDA 4UUBA 3R20A 3UC5A 2D2FA 2GJ9A 1YR6A 2HAEA 3KAQA 2ZJ1A 3INRA 4LYYA 4ID3A 4UMDA 2N42A 2WYOA 1LFAA 1NLZA 3OTIA 4RACA 4QEDA 1TT5A 4HRVA 3V8PA 4B74A 4B3IA 2GDJA 4Y9UA 3V7NA 2R4UA 3GCGA 2B9EA 4ZIRA 1AV6A 3DV0B 2QW1A 2DCUA 3BL6A 1M2FA 1XDBA 1ZUIA 2O3SA 3CE6A 2R8BA 3LDFA 3SYMA 3V3TA 4PZ0A 3Q3HA 2BF7A 3ABZA 4X65B 1KBOA 1U80A 3IVCA 4HWTA 2E5WA 5CXSA 9MHTA 1VPTA 4OKNA 2WSYB 2WWIA 2P68A 1PFYA 3K09C 3OQVA 1ZMBA 1DX6A 4AYXA 4BRSA 2VAVA 1QQTA 3LKVA 3P2EA 1JWBB 4H9GA 3LPNA 4ND5A 1T2VA 1E9VA 1U2GA 1GRCA 3QXJA 1EWQA 3FX2A 1QF6A 2GPTA 4LE1A 4O4JB 1F48A 1OTYA 3SZ3A 2LIPA 4QYIB 1D6NA 5BMOA 1GNRA 5IJWA 3PJEA 4AZSA 1N6IA 3HI6A 1JSCA 1R1DA 2D06A 3EF1A 3OTWA 3VHQA 2ZPAA 1YA6A 1WEHA 1XZBA 4JGBA 2WHRA 3HL0A 1QSGA 3CSDA 3GVIA 4K7JA 1RADA 1P61B 4PZ9A 1PIWA 1QZTA 1FNSA 4S2UA 2JGJA 5A3VA 1NVUQ 1QFXA 1IONA 2ATIA 1SCKA 2UZAA 2JAXA 1KVQA 4I5GA 5GJCA 3RSQA 2ZCJA 4D1YA 1C50A 4NLLA 1W85B 2R96A 3WFJA 1A88A 1XDUA 1PS0A 1QH8B 5IF9A 1N5MA 2I6FA 5ALGA 5E3IA 3K1JA 1Q11A 2Q0XA 3ESBA 4WERA 1XQXA 3L8YA 1G38A 1JZSA 3VI4B 3O03A 4D5GA 3O6VA 2ZR7A 5AFSA 3OJ0A 4BNVA 2RGBA 3U26A 1QFJA 1ZVJA 4JDPA 1G5HA 5I4BA 2B8TA 1Y9EA 1QAQA 3D4IA 3FNFA 3LUCA 5DXFA 5FHRA 2FN7A 3UWDA 4Z2YA 4BVJA 4YAKA 4HRXA 1J5PA 1Q83A 2CXOA 2OSVA 4GEKA 3SU8A 3S1AA 4E21A 3AL0C 1L7XA 1GGNA 2REQB 4AXBA 4ENPA 3PRHA 1CJBA 1XZDA 4I4TA 5E3JA 3ZWBA 2IT1A 3K15A 3PLAE 3IUPA 3N7UA 4W1SA 1NW5A 1WXXA 3R8FA 5IM5A 3K9WA 2Z5VA 2IEIA 1K86A 3JQAD 4RZIA 4P98A 2DLDA 1SBNE 3LJKA 3FSGA 3ZU2A 1SC3A 1E3WA 2OO7A 3C39A 4HY3A 4CDGA 5ESRA 1U5BB 4MXDA 3W04A 1I14A 1REQB 2EDAA 2J6BA 4L6CA 3ZV5A 5FPYA 2WV7A 3SQDA 1H93A 1I7LA 3IAUA 1FFDA 2YJ3A 4TTRA 2Z98A 4Z8YA 4EHAA 5AO9A 5B3KA 2PRSA 1G55A 8MHTA 1T9BA 1FDUA 3R5KA 1JIJA 2PDAA 4N6GA 4DREA 4H7KA 1PE0A 4NOMA 4BNMA 1KIFA 4PEVA 4E1VA 4IHAA 1Y3DE 4BQPA 5JW6A 1VHTA 2WICA 1G60A 1E1NA 2EHJA 2Y77A 2X0EA 2JRCA 4YUYA 4BGDA 5GIPE 1AN9A 3MMNA 1YS4A 3N76A 1I7SB 1R5BA 2XXAB 3MOSA 4UULA 1COZA 1Q19A 3G2IA 7ABPA 5CFPA 3FDZB 2AJTA 2B1JA 3A1EA 2XB6A 1CDEA 2W93A 3CH5A 1SUWA 4WOPA 4BZPA 3DMGA 3HXLA 4RJIA 2I4NA 1E20A 3MT8A 1KFBB 5GV8A 3W90A 5B4UA 3Q7EA 1QGED 3WL7A 1PGNA 4TRNA 3HMKA 3ICOA 3PC3A 2GB4A 1PJSA 3PCTA 5FTLA 5L40A 4OL9A 4ND6A 4GE0A 2IPXA 3GAZA 3NC0C 4IIFA 4IDGA 1FPMA 4MIOA 3TLXA 2O0KA 1M2VB 1VL1A 4KAAA 2G4CA 4OHPA 1HG1A 4G3XA 4PSKA 3PFBA 1KTIA 1ZK0A 3IP1A 1CQIA 1GGEA 4YP5A 3JAWB 3UCXA 3VR4A 2C3MA 5AVUA 5JISA 3NFYA 2QJTA 3AMVA 2NUTA 2H3HA 3BXEA 5EXXA 4GUDA 4NYJQ 1TJNA 3N3BC 5AKYA 3V00A 1TCBA 3F74A 4A6PA 3SQLA 2BFNA 4HUTA 5KNBA 1ZEJA 5E2IA 1D4FA 4RENA 4X61A 5EIBD 1Q57A 4DUPA 3QOFA 1UMCB 1SN7A 5JDCA 3HZRA 1UK9A 4A0FA 4DT1B 5BN4A 3U3KA 1SUAA 1DEXA 3SVLA 3KQUA 1MOQA 4GYJA 4ZAVA 4P3OA 5KTSA 3GL9A 1KJZA 1LF0A 3GFGA 3MRXA 1ULHA 3L8ZA 1C8LA 4N0DA 2CLFB 3CRVA 3O8RA 4CYMA 5KBYA 2G9NA 2QN1A 2XRZA 1KEPA 3KJGA 2Z8ZA 5CH5A 1NLMA 2VAMA 4KIWA 1WAMA 3AY3A 3U3RA 5CDSA 1RKVA 2J0SA 4DSZA 1R9GA 2JIBA 2GM4A 1HEYA 4MW2A 3WKEA 2QS9A 3SJBA 2Y9PB 4KWEA 4TL7A 1EINA 1W2HA 4BUJA 4OUDA 1MO2A 2VQSA 4RFSA 2XOKA 1GTG1 3FHJA 1M8FA 5JPIA 2HGZA 5LMUB 2BRUA 2IPAB 5HQ3B 1QGDA 2BH9A 4B43A 1H2ZA 4QHTA 4WL0A 1ZWKA 2XUHA 1BMFA 3C15C 4P4NA 3DTVD 4HDOB 4WZAE 3RS9A 4DRXA 4WKPA 1Z16A 4WKCA 2XKJE 1N3BA 5ICFA 4Q5IA 3RB8A 4C29A 4RTKA 1EFAA 4HLUC 1P1FA 3N6RA 3NKLA 4GMKA 2AN5A 5E2AA 1R15A 3G82C 2DJIA 4AULA 4G23A 3E9DA 2A0KA 3PQ7A 1BDIA 3UQYS 2XDAA 2FPMA 3TW6A 3Q5GA 4DBVO 1EM8A 2YVQA 4ILEA 1M2WA 4J07A 3V46A 4MB6A 5PGMA 4M9CA 1Z0KA 4G8BA 2QL6A 3H3JA 5CVCA 5IXSA 1Z7BA 1ZP6A 3TDNA 4UD6A 2XE8A 1YONA 3UOWA 2QZPA 1CP3A 3U16A 2AVDA 5JAPA 1W59A 1WNFA 3NIGB 4JBLA 4JC8A 5U9CA 4LNHA 1HG0A 2W58A 4D4JA 5HQTA 4ZT6A 3K8OE 5HIMA 1ZH4A 4YXWD 2C9BA 1USUA 2XBUA 3LDUA 2IW1A 1U8FO 1N7HA 2OHVA 1ZGZA 4H1HA 2V7XA 1E9SA 1Z2NX 5ER9A 2H0AA 4FB4A 5K8UA 4RTSA 1XJ5A 4GI1A 2Q7OE 2DT8A 3LLSA 3QY0A 5DISB 1Q2XA 1E2DA 1TO1E 2NADA 3AUAA 3NKVA 4X6LA 2BFPA 2CKDA 3LVFO 4UXIA 1WMDA 2JJYA 4A8JA 5JHHB 3PEWA 1Z07A 2QE7D 4IJKA 2VNJA 1SIBE 4MQ4A 1B8VA 2OA0A 1NF9A 1PT9A 2G3YA 3WIUA 5DBGA 1ST2A 5CG1A 4P5PA 1I1QB 3AKYA 5CA0A 4Z53A 3OX3A 1P0MA 4J03A 2NUAA 2FI1A 2R65A 3DVAB 5FBLB 1MMFB 3UMGA 3TOSA 2I3BA 2PD6A 3VYTB 3A14A 1EM8B 3AKEA 3AERA 2HHJA 2V7UA 1KDZA 1FA9A 4L72A 1VZ2A 2AQ8A 2YC2C 2YXLA 2CUZA 4KVFA 5T8KC 4L5CA 3WNDA 4YMUA 5CK5A 5BV2P 3CX4A 2H18A 3PR2B 3ZTYA 1M1ZA 4UUQA 1H2FA 1F06A 1XZIA 1ZQ9A 2JAQA 3VJKA 3BRWA 3LK7A 3U31A 4HNSA 4IMPA 3ROZA 2FY8A 3O8DA 4PG8A 4RIHA 1N1GA 4X1KA 1TA0A 3C85A 1JZQA 4S2EA 3N75A 4LV6A 4Z7NB 2FOLA 1GG8A 1OV6A 4HOYA 4MMZB 5A2GA 4JJ8A 4EFMA 3R7AA 2A9OA 4F04A 1W6UA 3OZSA 5H7XA 3ZQJA 4FB5A 3Q3IA 1YQEA 1G7RA 4B9AA 3TJMA 5HZMA 1B6TA 1ZRNA 4YLEA 1G6OA 1VPVA 1M72A 1LTQA 4B6GA 4JI3B 3RNLA 4OAQA 2XCSB 2ZTHA 4P3XA 4IMIB 3KXKA 5ITZB 3HO6A 4O1MA 3AXTA 4R9UC 3IEPA 1EJBA 3GZNB 3IVMA 3PWZA 1FMJA 4PHFA 2AV6A 3T5GA 4ZKEA 2QRNA 1QBKC 1SBZA 4F72A 4S1WA 5DNAA 4IUYA 3RO7A 4LF4B 3CEJA 4JROA 3PXGA 1CUUA 4Q12A 3S99A 1IBLB 3VR4H 1YBVA 3T15A 2ECPA 4GF5A 4IDDA 4X24A 3AF0A 4H6PA 1N0VC 3EZGA 3TSAA 1CS4C 4P3KA 1GSAA 4FMBB 1N2CE 3OMXA 3PQ5A 4DCPA 3D31A 3CG0A 5MGBA 3DFUA 4GQAA 2Q8QA 4CM7A 2VDJA 1E7SA 3ESZA 4XPZA 4XQEA 3BZUA 1Y48E 2A3RA 3EGXA 4FPXA 2X9GA 9ATCA 3VBCA 4KR0A 1EAMA 3TQQA 2FZ5A 2CD7A 3O0TA 4FBMA 4ZQIA 3NXSA 3FCYA 3QFCA 4EK9A 3V8EA 4U4AA 2DR2A 2D7DA 1RKXA 2JIPA 1FS5A 1UBJS 4HN9A 3IUYA 3TAHA 3R44A 1DARA 3HVRA 4V02A 1EIWA 4LI0A 4RK6A 3STYA 4Z8XA 2HBYA 3EZ7A 4MGKR 4YHBA 1OH7A 2JIQA 2B98A 3FYUC 4QRIA 4A9AA 1II0A 4D43A 3RS0A 1P2FA 1YKSA 4Q19A 2IYPA 1YS1X 3D3JA 3IQIX 1JHUA 3UT6A 1SG9A 1I3LA 3VNAA 5GZ3A 3PWSA 2HLDA 1VIYA 2PAAA 5T67A 2GN9A 4WXEA 1NGSA 2ECQA 2PKWA 3VJRA 3HJNA 3N2GA 4XTRA 5AW3A 3BBLA 3OPVA 3WXMA 2QDKA 4R1UA 2VDPB 1P8AA 3FUUA 1EFLA 4P84A 4GI5A 4ZYLA 2NXNA 4Q9KA 2C2XA 1MA0A 3PIDA 4QIHA 4ZJPA 1EA5A 4IJQA 2Y1WA 1TGYA 4KDRA 1L2TA 5BRNA 1E1YA 2BI4A 2F1RA 4PICA 5EIFA 1PG5A 3FG9A 5B5SA 3G2JA 2VVTA 3GPLA 5A4JA 1OV4A 1VMEA 4BDSA 2VYQA 3SYLA 5A9SA 2FDRA 2BMJA 3G0BA 3M6XA 4B47A 4CM5A 3DB2A 4Q4LA 5K3SA 2HUPA 2ZE6A 4XZ3A 2QUKA 2Q28A 3HO1A 1EE1A 1TQ2A 3IDOA 3SIWA 3S8YA 5T41A 2CEAA 3MCZA 1G16A 2P5UA 5K7SA 3BZBA 2X0FA 3CW8X 2R87A 1YFZA 3D7RA 4QA9A 3R74A 5KHAA 2FRDA 2O2SA 2W6OA 1M83A 3WB9A 3A4MA 5F2EA 5IJ0B 4IOKA 4GI2A 3OQBA 4Q1BA 3TW4A 2VJNA 3EFBA 3GPIA 4RTQA 2UUCB 2IXTA 3AIMA 3Q0IA 5LU9A 4DMCA 1ZO8A 2EKPA 5HRAA 1OT5A 1EJ6A 3DTVB 1NSYA 2BUBA 2HRRA 4WIAA 5H80A 3GLGB 4I6GA 5AM1A 3C8ZA 3ZJUA 2P41A 3DC2A 1C5KA 5JTTA 1ZN7A 3USCS 4DIEA 4DQUA 4I55B 1LXCA 2UYHA 4YMHA 3T0FA 3LXXA 4NNJA 5K8IA 4Q3CA 3Q6MA 1IQPA 5F5XA 2D8AA 4BEJA 4YI3A 2Y9MB 3TRJA 3QVJA 1U7ZA 4X6UA 5B7NA 2AOWA 3GMDA 5GZ6A 1OH8A 2H9IA 2B7BA 2V58A 2O3QA 2O9JA 1NQOA 2PR7A 5DP2A 4BFLA 2WB2A 1E7MA 2ZFUA 2VRCA 4JENA 2Y68A 3MQ2A 4OQMA 2JGRA 3NU1A 2HTEA 4XYBA 1V9LA 5EWLA 1WPXA 2CXUA 2PQMA 5HF8A 5AI9A 3ZEIA 5M2QA 4ZRMA 1GEEA 2NVUB 1XZJA 1QMGA 1CHDA 1JI0A 4PZEA 3BB1A 4CMGA 2NYVA 2VBIA 3CSSA 5IC5A 4ESOA 1ES9A 5EQDA 3F6BX 5FWAA 5LBIA 1NF8A 1YQ9A 2QMHA 2E6UX 1A95A 1TTHA 2OEPA 4DM3A 5LJLA 5LVAA 1QE3A 4ISCA 4YT8A 4D8WA 2AOTB 1Z9BA 4M46A 3N2LA 1QHXA 4JKIA 3VPBA 4AM8A 3HKCB 5CCBA 1PYOA 3RSZA 1THTA 3WGVA 2YOHA 1MJFA 2ZOSA 3UH0A 4YCLA 2FYTA 3OEEA 3SVTA 1BWSA 3LQYA 3I1YA 1HKUA 3WICA 3DCYA 2MSDB 4FYXA 3UXEA 4TRRA 5HBRA 3QVOA 3FSGD 3W2GA 4GDFA 5JFOA 1XROA 1W1WA 1Y8QA 4Z0NA 3JVVA 4EGFA 2FUG6 2ZJ2A 3R5HA 1O03A 4FI3F 1UXIA 4L5YA 4HEA1 4AUKA 1ZL0A 2FR8A 1ZUD1 3B38A 3R2JA 4AW9A 4R54A 1ID1A 3O1HB 1FDTA 3W9YA 1XXHE 3C6XA 4D98A 5JH7A 1QNLA 1DRUA 3FDIA 2FMUA 3RREA 2Q3DA 3CLTD 3GUHA 5TV2A 4GR9A 2PUAA 1ZLYA 4Q9IA 3CW9A 1U0HC 1RLOA 4ND8B 4QBTA 4RANA 4U2EA 1KARA 4DXHA 3FMGA 4GPAA 4IIHA 1K8YB 3GN2A 1XTJA 1Z0ZA 5LM3A 4ZYZA 3OA0A 2I2AA 3A6GA 4OQFA 3PQ6A 2BFAA 4U9IS 1Z17A 3P2JA 4FIDA 1IN8A 1ZAYA 1B3RA 4KXLA 4GH5A 2Y71A 1ZSNA 2R6GA 4GBED 4X7BA 5FLEX 3WNCA 1PKXA 2VUHB 1PT8A 1TVKB 1ND6A 3E27A 1VGVA 4NPHA 2XUFA 4G0NA 2FMHA 5AT1A 4CCYA 2O5CA 1KZ9A 3PZRA 4FTWA 3CZCA 2O2EA 4GHWA 3ESCA 4RC9A 4C08A 4F93B 3DDUA 1SQ6A 3VR3D 3KJEA 4TWAA 3IVAA 4EUSA 2NZWA 4BATA 5JXIA 2GTIA 2P2YA 3JQDA 3E7PA 1YR9A 3EEBA 1G63A 3IAAA 3GJ7A 1USWA 2CJPA 1Y3HA 1JKXA 2GVZC 5EIHA 1CJTC 3EC1A 4L6AA 2NSJA 3PJGA 5JH7B 4PSCA 4BNGA 3DDWA 4MV6A 2P2GA 3CX3A 4JT8A 3THRA 1T3LA 4FFOA 3T9CA 5BVGB 3KQNA 5AR1A 1Y3FE 1DUIA 4I1UA 3LBAA 2ZRDA 4HEJA 4UUMA 2AG1A 1P6QA 3LHDA 1V47A 4AY6A 3NWBA 1UK7A 3B5IA 3M5CA 5E6SB 3PBKA 3ZHRA 3DL4A 2ZRCA 4RHYA 5GWXA 2GF9A 3I52A 3OOYA 1ADJA 4XDHA 1I94B 1Z4QA 4IWXA 3FJ1A 2D2XA 1OC4A 4UASA 3BSFA 1TZKA 2QMEA 5HHTA 5I5GA 4LQ4A 2O06A 3DBVO 2QE7A 4PO9A 1YKGA 5LB2A 3TLBA 2E85A 1TUGA 4ECEA 1NRIA 3SX4A 1LPBB 2J3JA 2C9MA 4E32A 1EUDA 1L5LA 1B6GA 3PT5A 2OBFA 2F4VB 3DTYA 4PTLA 2BFCB 3IBCA 3PNPA 1PF7E 1DT3A 1UJMA 4DCUA 1OFUX 4WZAB 3G59A 1RXCA 1LJUA 2H85A 1YHNA 1VFPA 4OJYA 1F6DA 4I5IA 5SYNA 5JAIA 3FNBA 1A9SA 1FFCA 4JYBA 1N2ZA 1F2UA 4UD2A 3FMFA 1DKUA 1T1IA 3AGPA 3GH1A 4P0QB 1YB4A 2PSJA 3Q7QA 5A5VA 3VU9B 1ZUWA 2A4KA 1O9BA 4C01A 2CVPA 1WU8A 3G0OA 5CD1A 3ZWWA 1N2JA 3UBTA 1PJRA 2HQBA 1KMMA 2F3QA 3D0KA 4BZXA 2NSDA 3QOXA 4RD0A 3UH1A 4CCYB 1T3SA 1TEXA 3VVBA 1JL3A 3QVVA 4P2BA 4TYQA 3DCNA 4LV5B 3X1XA 5DHTA 2A1TS 3HCAA 1MGPA 1BKDR 4C0SA 4XJXA 1C41A 3QEKA 5AQEA 1XFDA 5L53A 3RABA 1IHPA 4ZT7A 2WEKA 5CFRA 1ZNZA 4IKOA 1RSZA 4R40A 3WQSB 5GTDA 4HFJA 4BLWA 1XFAA 4QD3A 1NBEA 3TD2A 2ZZMA 3EGCA 3TSYA 3GFRA 2JEYA 4WVFA 3UF0A 5BRJA 5HYVA 4KUEA 1GNPA 2GZAA 2QTLA 2UYQA 4YXWA 5JFTA 3SDBA 3EW7A 1EUZA 4L3VA 3EDCA 4F06A 4QEKA 3EGWA 4HNUA 3EZ2A 2CLDX 2IYXA 4EVRA 4UQLA 1MRNA 3IL2A 1N0UA 2IIQA 3I0NA 5HEKA 4AZ0B 4J91A 4YFVA 2OG1A 1C0PA 1G8FA 3Q8KA 4D80A 3FOBA 1O6CA 2Q5EA 3G49A 4DLSA 3MCUA 1CU1A 1M8JA 2EZ4A 1NXQA 2GZ3A 3Q3VA 2GGSA 2FUG1 3DZDA 1RFLA 1UAGA 4NZPA 3OZRA 1TUBA 3BSYA 1GSHA 3IUNA 2EZTA 2TECE 4EKGA 1X7ZB 3OOJA 4F3NA 1W44A 1XD2A 2COUA 2ILVA 2QUAA 3W5BA 1NN3A 2M6SA 1E1RA 4YGYA 1QK4A 1ZCJA 3GUVA 4F4CA 2DG2A 3QRWA 4E11A 2PIAA 4UDYX 4B3TB 1U99A 2CLOB 2ET6A 2X5XA 4UZEA 1IK6A 4M1OA 1GKYA 2I2BA 3HFRA 4QODA 1PTJA 3ENNA 3VC3A 2ZBPA 3M4ZA 3A9SA 2LE0A 2ACEA 2YN0A 2ZIXB 3QKWA 4A1FA 1U9CA 2V7GA 3THWA 3ETDA 1CEQA 3VVMA 3PU6A 3SKYA 4S04A 1OBCA 3K1YA 5DEOA 3K9FC 1VKZA 3ZY5A 4X1YA 3UA4A 4CFZA 1OYWA 1PI3A 2ZBEA 3MN1A 3RTEA 1YF3A 1ECFA 1RYDA 4Y9TA 5HXAA 1XHLA 4FI3C 4FOTA 5E0KB 4OTZA 4AXXA 1PJAA 4J7UA 4Y2UA 4N5HX 1HSZA 3LBIA 4WOBA 3MJHA 3ZXSA 2Z6QA 2N75A 1NXXA 1M2JA 3OICA 4TQUS 4YWHA 3IDFA 2IIVA 2FEWB 2QGFA 2F9FA 2OE2A 1NQAO 3FUTA 5CLHA 2PFGA 4KI7A 4NICA 1RLUA 3D02A 3UK1A 3OZGA 3UGQA 4R8SA 3CH6A 2R97A 2XUZA 1PX2A 3MC1A 4AL4A 5MFPA 2YXPX 1F0KA 4JYCA 3OFKA 4NZMA 3H9CA 3G2HA 5CFZA 3F9CA 2XOXA 1WB4A 2FW6A 2CFOA 5BN4B 7GPBA 2G82A 4M38A 5F9FA 3COWA 1TIBA 2BFBB 4TV9A 1QP4A 1ADYA 4D8YA 1QCDA 2YJNA 3KD3A 3JS5A 4L50A 3X44A 1QDLB 2AFHE 3QA9A 2QG4A 3TRIA 5CCEA 1JQEA 5IJ9A 3R7SA 2CFIA 4PO1A 3NM4A 3W0LB 3LWZA 1QJ4A 3FI9A 2IPNA 2F6RA 5AM3A 2JGDA 2XZTA 1B8UA 1EB9A 3HU5A 1F3LA 2GRUA 2ATEA 1QLJA 3I83A 4BCCA 3F8WA 5CD9A 5L3QB 1WXEA 3KJQA 1GQRA 4OYRA 4BWVA 3GT7A 1BXRA 4WK4B 3L1KA 4FFRA 1US8B 1FXWF 5K0JA 3TB4A 4YP7A 1YQQA 4M1KA 4CGYA 3WYFA 3S2GA 2FWJA 3SHTA 1N3LA 4ITUA 4H7JA 2P9FA 3HDQA 1NBME 3MWKA 1G2IA 3RANA 1LC0A 2JHAA 2WB4A 3D2CA 4YRKA 2QMQA 4V0QA 3TGPA 3KKNA 1Q7GA 3R7LA 3RYTC 1RXWA 1XVVA 2RHMA 1YNSA 3C74A 5LB4A 3ELYA 1Y3AA 3EXG1 3ZKWA 1SU6A 1ZGHA 1ZM4A 4H3KB 2EBWA 2EP7A 3R77A 1R9MA 2IIPA 5FUMA 3BIXA 4XEHA 5JIBA 2QL7A 3FJOA 3MQ4A 5CB6A 1REQA 1JDBC 2A0WA 2W8BA 4PCVA 3HXKA 1FP1D 3HKDA 2QLLA 4RQTA 1RHJA 3KOUA 3ADOA 1I6KA 4MRNA 1HO3A 2PV7A 1HFKA 6ADHA 4FLMA 4LXIA 1TNDA 1YC2A 3CUWA 3R7WA 4C7KA 5TQVA 4EG0A 3KQHA 2VNKA 2GCGA 4ZU1X 3PK0A 1M6YA 2FJ0A 5COQA 3TYXA 2WTEA 1BHSA 3HBFA 3MWYW 2YOFA 1XHFA 4MV4A 4PRYA 4JI0B 2VYFA 4R5HA 1MW9X 1VJTA 5DW3A 4URYR 3SQNA 2C2HA 2GCNA 4NYIR 2Q4EA 2YJ4A 2NO4A 1EMDA 2XGGA 4ML3A 2OL4A 2X7HA 3QWHA 1EHCA 2PBRA 1W5TA 5DXAA 5AM5A 4AJ4A 4ZI7A 3K4QA 4Q3LA 4I50F 2GMWA 3IV7A 5IZCA 3NM6B 3DT8A 4BVKA 2GXAA 4H17A 4QPCA 1U3DA 3DFMA 3ZWNA 4MYHA 3E05A 1GQYA 8ADHA 2X2PA 1JG1A 3QTBA 3TX6A 2XYPA 1GSIA 4EYGA 2ZBDA 4PVCA 4Z3KA 3FYSA 5JALA 4DQKA 3GBSA 4M0PA 3GJRA 2GVNA 4G5GA 4WXPA 4CM9D 4BU0A 2DBRA 4IO1A 5A5FA 4EEZA 1Y3BE 4G81A 3DJYA 4OCZA 3TF5A 3NJ8A 1JN0A 3RUDA 5EXPA 2FE4A 4D8XA 4JL8A 1C1HA 1E2JA 1S0UA 1T5IA 5EXSA 5F1YA 4E14A 4HAZA 5C5DA 2R6AA 2IEDA 4DGQA 1EU1A 2EG9A 3ILVA 3R3SA 4MINA 2QLJA 2VDLB 1H6DA 4TOIA 1L5SA 4I8DA 3HRKA 4ZAWA 1V8BA 1M1YA 4MLPA 5HRCA 3EEFA 2BHLA 4JELA 3FYTA 3FM9A 1CX9B 1QWSA 1V2HE 2W98A 5D5QA 3RRZA 2QSZA 2D1TA 5KMGA 1XD2B 2BKUA 5DT2A 2L42A 3VSDA 4LYAA 1E1QA 3V32A 4R2JA 3ZGYA 1WSBA 5BVHB 1KYTA 3CXRA 3LVQE 4KIGA 2WSIA 4EW1A 3QM1A 4IZHA 4BNWA 5FO1A 4KB5A 1FRVA 1LSOA 2FPRA 4LRWA 1QAOA 4R8VA 5P8WA 5ICGA 1WS6A 1OE0A 1X2BA 3FPLA 2YVLA 3A4TA 4NY1A 3OQHA 3H8SA 1OXXK 1KI1A 3F6CA 3OQ6A 3WMWA 2C7VA 3SQXA 4YUXA 3FVVA 4MGHA 3WS7A 4PONA 2RSLA 3Q7SA 4AG6A 2FQXA 5HS6A 5F76A 2FWIA 3TSCA 2Z09A 2BP7B 1GLNA 4URXR 5G0WA 3AZOA 3X1MA 2F8SA 3PUIA 3OAAD 4MEAA 1Z0AA 3EUFA 3DO8A 3IAXA 3S81A 1M6HA 1QF9A 1Z74A 1TC2A 4YNBA 3AJ9A 4WFKA 4A8JB 2PPVA 4FMPA 2QRLA 4AO6A 4WQMA 2PD4A 5JJLA 5EJAA 4RTOA 3BF7A 1RYBA 4NU8X 5BYAA 1L8AA 1PWXA 3OWOA 2BC9A 2AD1A 2Y66A 3D5EA 1GA1A 3JPYA 3OZBA 5AOAA 1AKNA 2CYAA 5F7ZA 1SBQA 2AWNA 4W5OA 3QPAA 3EFHA 4NU5A 3HEAA 1X70A 1YZHA 5EUMA 4BAGA 5L4NA 4ZT3A 2G83A 1R0KA 1RRPA 2HK6A 3ESQA 4RPLA 3ZK9A 1CQJB 2NYAA 2Z2KA 1C3OA 1FU8A 3QIVA 3SXPA 4K1LA 1ZISA 1RKQA 2OESA 3UAOA 4MVJI 1ODIA 4JLBA 1IZYA 4HDSA 1DWUA 2A6PA 3AUUA 2XXAA 1T1EA 4L78A 4E6EA 3ZJTA 3OY2A 1E8DA 4JR0A 1E1MA 1H2HA 3GGOA 3BILA 4JJAA 4G1VA 2XWPA 5ED0A 5B1EA 4UUNA 4G2NA 4KRGA 2HDHA 3H83A 3S28A 1RRCA 1I1NA 5G41A 2VUSA 3BWMA 4M9QA 4REQB 2ZGVA 4FEYA 4YLYA 5I45A 2DPYA 3KOXA 3HJBA 4AMZA 4AROA 2VYND 3QMWA 4FIZA 5IJAA 5JC1A 4J94A 4F96A 1WEKA 3SYTA 4Y3UA 4BOYA 3IQFA 4D8TA 4E15A 4LW8A 4PHHA 3USZA 4MV7A 5EIWA 3CB4A 4E70A 1QRTA 5EMHA 1M34A 3G5LA 2VP3A 3F1LA 4IDCA 3KJZA 3MXTA 3WSVA 4ABTA 4UAGA 1GCOA 1KRHA 2B8NA 2OCPA 1NBMD 4YBZA 4CG3A 3MUNA 1QS0B 2I71A 3PFHA 4MLZA 3R8XA 1DIBA 2NU7B 3A1FA 3AHJA 2RFLA 2AXNA 3H17A 1ABFA 1YR7A 1C7RA 2HFJA 1GVHA 1R0BA 1CY8A 1NTRA 2I4OA 2QLTA 2X4LA 3LP5A 3QX8A 4FFPA 4JBIA 4YAOA 3TSZA 4NFYA 3H11A 2IWHA 3X1WA 3BWXA 1A1SA 2FZLA 1H5UA 4W6ZA 4PAMA 3DKPA 3KELA 5DFAA 1OW3B 4DANA 5HIAA 1S3FA 3CQ9A 1QH9A 2PA3A 1IB6A 5L45A 3T41A 1VI6A 4TYMA 4ZVMA 1UT8A 3JWPA 4P3PA 3IOYA 3FUVA 4PXYA 3MJSA 1JXQA 2RK4A 1CR0A 4K87A 5E4FA 1THGA 4JDUA 4G5YA 1J9EA 4JQSA 1CY7A 1SQGA 4KQKA 4P3NA 4LPSA 3P2YA 4OHMA 2QM0A 4RY8A 1PN3A 3JQAA 3WWOA 4R05A 4CU2A 4Z7OB 2LZ0A 2ODAA 5SICE 4CQLA 3DV9A 5KOJB 3OE1A 3UAGA 4TROA 2F59A 2D6FA 5TF0A 2VF7A 3RS8A 2EGHA 3TXYA 1BX1A 4Q4CA 3IMEA 1GTMA 4C14A 2B4YA 1LCIA 1DG9A 3D4PA 4HDRA 5EE0A 2QV7A 1RBQA 1PVDA 2IBMA 1OVGA 5CLJA 3EXHB 5EP1A 1B6SA 3CGWA 5K45A 1E5XA 1HYGA 4K6MA 4DV5B 2ZI3A 3DHNA 3GDGA 2H4FA 1FP4B 1KI9A 2NWQA 4E46A 5LMZA 1S9DA 1OILA 3D3NA 5E38A 4BLVA 4UHCA 2HI0A 2WF6A 4W7SA 1UZLA 1FLVA 4LHEA 1U7UA 1WY5A 1ZN2A 2VUUA 3DL7A 3IP6A 2PGAA 3LQ2A 2Z8YM 3QVKA 4HSGA 4CN8A 4D81A 2D5BA 4RF4A 3AFGA 8OHMA 1M76A 4O6VA 3NWPA 4EH1A 1SRQA 5I7OA 5B2FA 1IXKA 3LZDA 1NWCA 3FKJA 3THXA 2WINI 3PVSA 3ROPA 1FJXA 1E6UA 3E9CA 1VA5A 4H0FA 4X6YA 3BIWA 4JJ4A 4RMJA 1WB5A 3CUEF 1NVBA 3BC1A 2FUCA 1I51A 3RC2A 1ZXLA 2XUQA 4BJHB 5F33A 1S4QA 4GYYA 5DCUA 5JXJA 1EX1A 2EVWX 2X0KA 2XCOA 2DKFA 4HS9A 1UBOS 2D3TA 1KMQA 1Y6FA 4OATA 4DBLE 3NZEA 3GK3A 4ZCLA 3WGHA 5KHOC 5JE8A 4R0NA 1DLIA 2BKLA 3M9WA 3L06A 4NI5A 1XRRA 1Z0UA 4CTJA 3EFOA 3TIGA 2EJUA 5HA5A 4B6RA 1RCTE 2VDMB 4R1LA 3W3ZB 3I61A 3WL3A 2FHPA 3KSAC 2F1IA 3MJRA 4MWEA 3V8QA 1AMNA 2ZIZA 1C9YA 3LWDA 3OF3A 4KCGA 4DR2B 4K9PA 3BRSA 4KZPA 1EFRD 4W1QA 4U7DA 1SXJE 1KJNA 1V48A 2Q6VA 4PS1A 4ZMRA 1Y9JA 2VSQA 5IAJA 4Y2XA 5IG2A 1HF3A 4LNAA 2NAFA 2FW0A 2VKTA 2QKYA 4FW9A 2BTOA 1MX1A 1RFGE 4XWYA 3MTBA 1M6EX 2FVYA 1FMCA 3THWB 1DTWB 3RIEA 2N46A 2O4UX 3CUUA 3H86A 2H2WA 2RI6A 1CNFA 5C4GB 5DN6A 2GBPA 4PLPA 2PWBA 4H35A 3FBWA 2IRWA 1AXGA 4QPDA 4MR8A 1QKKA 3NIFB 3K8QA 4JGGA 4V0SA 5C5CA 4LKOA 2J3DA 3U1VA 3QVGA 1ML3A 2J07A 2JI7A 2GCEA 2D2IA 3F8SA 4PNHA 5F77A 4NCJA 3VR6H 5B30A 2EV9A 5IJ0A 2AW5A 4JMLA 3SS9X 1WG8A 5LR6A 1Z4JA 1EGVB 3ONVA 1A1VA 2JJ8A 1DQZA 3RTBA 1PLLA 3IMFA 4EPTA 4ZVRA 4LQCA 1G0NA 4ZCQA 1MKYA 3BH6A 1GLVA 1U7PA 3RYFA 1M54A 1YJCA 1GITA 3LT4A 4LJ4A 4HWOA 1N6PA 4P92A 1HYHA 2VOEA 4G01B 1MIOA 4LJ5A 2ZIWB 5JOQA 4B1FA 3FA2A 2PX5A 1KRXA 1AQIA 3EQ2A 1Q12A 3SR4A 3B6IA 2G9QA 4Y2SA 5AW9A 1DP4A 1V8OA 2EF1A 2DB3A 1AH2A 4EPYA 2I29A 1PG0A 4HZIA 2AMLA 2N47A 3E7XA 3JYQA 2GLUA 3LUAA 2J33A 3ZX5A 3IT2A 3DBIA 4Q4JB 2ZS8A 4IZIA 2Z2ZA 4FJ2A 1CTQA 3IEIA 4K2HA 1WNTA 2O1SA 4K9NA 4R6XA 5C1PA 1SHLA 4KWCA 3CRW1 3N2GB 4Z7QB 5IDWA 1VA4A 4JC5A 4DNXA 2BMWA 1IZ0A 1HWYA 4EUHA 3EK2A 3O3MB 4I4TF 4KOAA 4B3MB 3GELA 3LT5A 2JKVA 5TJ9A 4KXYA 1G7TA 4GPD1 4NE7A 1US8A 4K9MA 3V7UA 3WZMA 4D41A 5DN9A 1JLMA 3URMA 2Q2WA 2WWGA 3EWIA 2XUAA 4ZC1A 2XZLA 4CWAA 4WW0A 1QYVA 1J22A 1T5BA 3MJVA 4DWWA 4B3SB 2BEVB 1U4OA 4ZFNA 1X14A 4UQPA 1XQWA 3M9XA 2V6IA 1C9JA 2XSZA 1GZ5A 3A6LA 4NDNE 1X7WA 1Z47A 2DH5A 2Q50A 3AYXB 3RVNA 5CNIA 1JNXX 2HPVA 1AHPA 1EJ2A 2P3LA 1G1MA 1H69A 2OHHA 4RDIA 4YP6A 4QC2A 4YIKA 4CFSA 3ZS9A 3P27A 3ZZ1A 3BQ9A 1G6KA 1RAAA 1FIUA 2JLRA 4XLZA 3U0VA 3RSOA 3GXBA 1GT91 4E22A 4MMYB 4B5KA 4B8WA 3WBJA 2QX6A 1IM5A 5K3CA 4HTAA 2RC5A 4MDHA 5EE3A 2ZRJA 3K16A 1CPYA 5K3AA 3H8VA 5CT6A 5BYJA 4HKTA 1NUPA 1NN0A 4YGXB 2VJMB 4RA6A 3KYBA 3ZWQA 2CL0X 1W73A 1NQ5A 1Y33E 3B78A 1I9CA 3SM9A 3SIPA 5JQGB 2WWWA 4J3NA 3GLHE 1NVXQ 1DHRA 4IYRA 2I03A 2QL9A 3QMPA 3F5QA 5CYFA 1V5FA 1M2KA 4MWDA 1U1IA 3BICA 3ITEA 4NBSA 4LISA 3QVUA 3PD7A 3IPYA 1VJGA 4ZHSA 5JS7A 1RC8A 3ZDDA 5D84A 4RIFA 1HDCA 4QE3A 2EX1A 4LOAA 3WISA 1KZ7B 1RYZA 2RIRA 3AW9A 3ZY2A 1USIA 1WULS 3DWIA 1C14A 1Q7BA 3D5QA 3RJMA 1IHUA 3ZV6A 4C0AC 1H66A 5K03A 3KT0A 1IN1A 2V65A 2PZKA 4YYZA 1ZONA 4UM5A 1HX7A 3CY6A 3KKEA 3JAMA 3C6YA 3WNQA 3DEJA 1XK7A 3JYPA 4JYPA 2X2FA 4Y6QA 3T5TA 2ZR0A 2EKZA 2OAEA 2RH9B 4B4UA 1NNI1 4PYIA 1FVXA 4CIBA 1BCRB 4GOKA 4KE6A 3E4CA 5EE9A 5IC4A 4P32A 2G08A 3E1GA 1AB6A 1NJSA 1FY2A 3CO0S 3CWZA 3H5WA 4KN9S 4DUGA 2Q6TA 5DBIA 1T5DX 2DECA 1A4IA 4IJMA 3SQWA 1ZI8A 4E09A 3PQFA 4Y2JA 3K9QO 1V7PC 2FFHA 4KQGA 3QZUA 2CF5A 3M6UA 5D51S 2PVPA 1CZLA 1ZK3A 4OM8A 1AOXA 3RJTA 1HDZA 2R4TA 3TFOA 1T2DA 3HR8A 4C0LA 1QTRA 1U3CA 1P1BA 1GPWB 2Y0EA 3CPSA 1VG1A 4KQ9A 4E7OA 5DASA 2BSQA 1FJ2A 1U0EA 4C0HA 2VP6A 1R4AA 5F1KA 1AMOA 4QXRA 4MVJG 1O9GA 3O8LA 5DGXA 1LDBA 1LI5A 2VP2A 2OBMA 5D3MA 4EPVA 3ANNA 2BFBA 4LOJA 1UK8A 2FJPA 3ME5A 1RJWA 3HEMA 2FEAA 3GDFA 2E4WA 1IXRC 1L4UA 2BDUA 3CKLA 3ZUGA 4B3CA 1EK0A 1MOSA 3FFBA 3OZAA 2P5TB 3QOYA 3LRXA 3B2QA 1CUWA 1MFZA 2W71A 4BIMA 5IH7A 1AQUA 2ZJYA 1AA9A 1RPNA 3O1IC 4BNFA 5IS2A 1FDVA 1HORA 2FZEA 1Q0HA 1YDMA 3DOHA 1IJFA 1K5GA 1VBKA 1P74A 3DNPA 3TNLA 1B0AA 2AF4C 1SUEA 1T4BA 2DUNA 1U28C 3DKVA 1U90A 1RRMA 4S1PA 3LGSA 2YBEA 4M9RA 2VT7A 5JG7A 1LH0A 4UVIA 3VV3A 5JMOA 2GUGA 3GFTA 2DF8A 2HIAA 2QRZA 5D00A 1M1NA 1M1XB 4CI9A 1R27A 3T4UA 4X20B 5JLJA 2GD1O 5JZSA 1RHMA 3D9QX 5HWSA 5D3QA 2XDWA 3FVRA 1AK9A 1JW9B 2C8VA 2YL2A 3BMNB 1XAGA 4RL4A 3VR4D 3FTNA 4ZVTA 1PNQA 1YMVA 1FMTA 4MV1A 1G3QA 2P9QA 3CH7A 1O94D 3F6RA 4EIWA 1Q44A 3N9IA 3UQZA 3PQ8A 5IKEA 1GUAA 5DNUA 5I9LA 1QGUB 3ZBPA 2SKDA 1PU2A 2PUCA 3WRXA 2O6HA 4BKUA 5K99A 4O3FA 1H85A 1Q0UA 2O8CB 3FWNA 2HT6A 4G0MA 1AVTA 3Q2KA 3HMQA 3PVZA 1Y7PA 3I8SA 5LDHA 4DLXA 4EM6A 4H0CA 1I4OA 3C6MA 3AC0A 3Q41A 3B82A 4NJEB 1F7UA 4Y2PA 2RHRA 3LCCA 3DH0A 1TVEA 1WW3A 4N0MA 5K9ZA 3VR6A 1P80A 5BVHA 4RA9B 2OFWA 4DVGA 3F4BA 2ZQ5A 3EXFA 1PFQA 1SOUA 3T3PB 5FTNA 1KAMA 3CU5A 1Q1BA 1S96A 5DP1A 1GIAA 3I9LA 1U6KA 2ZZNA 3M3HA 1WZCA 3C6QA 3DB1A 2YV3A 3P1JA 5A9RA 1U0BB 5H5JA 1V37A 1QBGA 3KU1A 2B25A 3RUIA 2WE8A 3V4PB 1BYUA 1XXHB 2DBQA 3MBKA 1E3QA 5KX5F 1T9HA 1FQOA 4O4IA 2ZYSA 1NJ2A 1P81A 6GPBA 5LDDC 2X1VA 1X1RA 2JAHA 3AFIA 3N87A 5JCJA 2O20A 1DAFA 1B73A 2HDOA 1B2LA 5H1YA 2JZNA 5AW5A 1G5PA 4RKRA 1G3IA 2NSHA 5KSZA 4GRAA 4F85A 4UEWA 2PMWB 3WKDA 4H6WA 4ZV9A 2X4DA 3B9QA 3AWIA 2I3DA 1KFEB 1S2OA 3DYIA 4N49A 4ASUA 4DEXA 3A27A 3O3CA 1OGYA 5MN4A 3HKEA 4CZ2A 1UUFA 2Q8NA 1JLSA 1UR5A 4MPJA 1ECPA 2P4UA 3GVHA 4R84A 4Z5XA 5LIRA 3IODA 4QYIA 3EF0A 2HJWA 2IJGX 1O5TA 3ZTWA 1P19A 1C7FA 4ZI7F 2DQ4A 4HWRA 1Y5RA 4LE0A 2WHXA 5JAUA 2BMEA 2QGZA 5LMNB 1YQDA 1HYEA 1K8QA 2QX9A 4HN2A 4MR9B 4PQGA 1FUKA 5T8KA 3NJ4A 4GYKA 4C0BA 1UPAA 1BS9A 1D6SA 3WLSA 4LBYA 5I3ZA 2Y1OA 1E3JA 2XMRA 4MQEA 3NKFA 1R4NA 4R83A 3RS5A 1IBRA 2PH5A 2JLWA 3ASVA 3C4QA 4X93A 2UVPB 5B58T 4ZK2A 3TLEA 3NTQA 2COKA 2QNRA 3QELA 4KO1S 1DT5A 1BXGB 2W2KB 3GZJA 1FVFA 2VQDA 3EWAA 3OCJA 4XVQA 2PZLA 3TZCA 1NJFA 1WV0A 2J9FB 3K5IA 5FI1B 3TOCA 1D1SA 1QQ6A 4OJMX 2NXCA 4GWKA 3TBKA 4B85A 4UTVA 3ADBA 1T9GS 1TAGA 2FVXA 2P65A 1JXOA 2Q1UA 4NCHA 3CLVA 3QMMA 3X1ZA 2VH5R 4DHWA 1I8TA 4A10A 1UWLA 3CCBA 4QUBA 4B84A 2F64A 3PF8A 2CLSA 4IIJB 2O6LA 3OQNA 1DNPA 1QS0A 3BHIA 4N0EA 1KIMA 5ALMA 5TS2A 4CF5A 2XV1A 1CHNA 1Q5PA 3KD2A 3ZV7A 1B14A 2NXEA 3ESYA 3QLEA 3CM0A 2O1EA 4TX1A 1A9XB 3F6SA 4ZO4A 2AD5A 1TLTA 2FMTA 5AICA 2BE9A 3NNSA 3WE7A 5JYBA 3L2OB 2HLDD 1KFCB 4E5PA 5F4BA 5MF6A 2OM6A 1E0KA 3F4KA 4LN1A 4UDOA 1G9SA 2IUUA 1G1AA 4DLRA 3EXEA 5CA1A 1CQIB 3IQZA 1J9ZA 5KTPA 5GOZA 1S2MA 3AIOA 3OZ7A 5TB5A 5J4YA 1NXSA 2MOKA 4EFLA 2PUDA 3GUCA 2IS6A 2CFCA 2LPMA 4X44A 5LZ9A 5MDHA 1HDEA 1KY5A 4FCVA 4Z6KA 2J45A 4ZPXA 2YVUA 3VR5A 2RGAA 4CKBA 5H82A 2RJOA 1L8OA 1AM4D 3JALA 2QTCA 4Q3NA 3WO0A 1W0JA 2IHTA 2WU3A 4DT1A 2OCBA 3L4JA 1T8PA 2ETXA 4V24A 4PR3A 2WT9A 4J7CA 1XWIA 1P0CA 3K73O 4UKDA 2CWWA 1QC5B 4XFDA 5IVHA 4QYSA 1GKIA 2C2MA 5EKTA 1NVKA 1C81A 4INOA 4NJOA 5HRUA 2LUOA 1A7UA 4WX2B 2GNAA 4AD8A 3E2IA 4C0WA 1AXRA 5ALNA