5I4CA

Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
b'NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein RcsB
publication title Crystal structure of nonphosphorylated receiver domain of the stress response regulator RcsB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gene regulation
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5i4cA00
2ID7A 4TLLB 1LJLA 3EODA 3QLTA 3OLVA 1QO0D 1USGA 3A3KA 1JH9A 1DBPA 3UUGA 4W5NA 4MS3B 3EDCA 1RXEA 1SRRA 1W25A 2CD7A 2VYCA 7ABPA 2HPHA 2OENG 3UKJA 4ZPJA 1Z26A 4MS3A 5TQ2B 5BRJA 4HYEA 5DLEA 1P6QA 3LUDA 3FGZA 4NQRA 5FWYB 4QYMA 4ZMRA 4G0OA 4KVFA 3T95A 5DKFA 1JHZA 3EJWA 3LFTA 2PUFA 1DC7A 3F7NA 5TQ2A 4RY8A 1ZGZA 3OO1A 4M88A 3KLOA 2RDMA 4RWEA 5FWYA 4FE4A 4IMJB 1ZVVA 4N03A 4CBVA 3GL9A 4PEVA 4JOQA 3TMYA 5KQGA 5JNUA 1DG9A 1DP4A 5C5CA 9ABPA 2B4AA 1DJMA 2TMYA 3QEKA 4N0QA 3F6CA 3H6HA 3LUGA 4Z0NA 2JK1A 4JA2A 4RKQA 2QR3A 1QPZA 4N41A 1XHFA 2WWVD 3H5VA 2QV0A 1QMPA 1VKRA 2GKGA 4Z4FA 5KQMA 2F8TA 1P6UA 2DRIA 1USIA 4RK6A 3MA0A 4WXEA 2PL9A 5D2CA 4QPJC 3OQOA 2A9OA 3JVDA 3DBIA 1MB3A 1JX6A 3LKBA 4KRFA 3Q7TA 3HDGA 1C4WA 1EWTA 4Q6WA 3QLUA 4YO7A 4YS6A 4N47A 1JDNA 3ROFA 4YR7A 5JNRA 3NHZA 1ZAYA 5KQPA 8ABPA 1MAVA 1ABFA 1K68A 3OMXA 1M2EA 1S8NA 3TX6A 2OQRA 4EUKA 2XDYA 4IRXA 1JYEA 3LUKA 3M9WA 4Z9BA 4XARA 1DBQA 3ROTA 5TQ0A 4XLTA 1TVMA 3Q15C 5IX8A 4F12A 1DRKA 3M9XA 1A2OA 4XAQA 4TN5A 3HV2A 1C0EA 1RPJA 2NUBA 1NXWA 3JVIA 1XWWA 2FMFA 2R4QA 5DCLA 3I5AA 4KQCA 4LE2A 4ETMA 1NXVA 3JY6A 2I6FA 4P1ZA 4PE5B 2WB4A 4G0QA 2VUHB 5JNSA 1D1PA 3HDVA 4MRMB 2IPLA 1U2PA 1XHEA 4NCBA 2CWDA 2PUDA 2QVGA 1BVHA 3HS3A 4LZLA 1Z17A 4QYWA 3NNSA 4Y9TA 3SQNA 1NXTA 2GI4A 3QELA 3O2SB 4MRMA 5KC9A 2VK2A 2M1ZA 1BDHA 5EWMA 5JNWA 5EWLB 4N0PA 2IKSA 4N76A 4UHJA 5E3JA 2FVYA 5FBKA 5JNVA 2FQXA 1TLFA 2FN8A 1DCKA 4O5AA 4KQ9A 3OM1A 2ID9A 4MR8A 2QXYA 4RK7A 5EWLA 5TE9A 3LMKA 4G0PA 2KYRA 4Z99A 1BA2A 4YCSA 4OTZA 2H0AA 1PEAA 3CS3A 3RVKA 3QEMA 4G97A 4G86A 4HNRA 1GUBA 5HSGA 1YMVA 3W9SA 4G0XA 1L5ZA 2R25B 1Z18A 4Z9AA 4YLEA 1ISSA 5TPZD 1E6MA 3GA5A 1PEYA 6CHYA 1M2FA 2AYXA 1DZ3A 2ZAYA 4LX8A 4RK5A 3C6QA 5B3JA 2PUBA 4ETNA 1NXOA 2PL1A 2MYNA 4S04A 4JB0A 2H3HA 2F8SA 1NTRA 1H9CA 3Q7SA 3OQMA 3LUAA 3MQ4A 4ML3A 2W42A 1J56A 1U2QA 3KYIB 4EVQA 4KNYA 5IC5A 1Z13A 3BRSA 1U0SY 3O1HB 4RS3A 3BBLA 4PYRA 4DQDA 1YVUA 3NNNA 3Q9SA 1USKA 4MS1B 5TQJA 3GYBA 4MR7B 4F11A 3EQ2A 3QLVA 4Z4EA 1DCFA 2IPMA 3OO0A 5TPWB 3R0JA 3CG0A 4RK4A 3KSMA 3H5LA 3O21A 4MS1A 3JPWA 3BRQA 4MR7A 1VRVA 2JVJA 3CZ5A 2WJWA 2LUOA 4Q7EA 5PNTA 3LUHA 3HM9A 5TPWA 3JPYA 4WZZA 3HXMA 3LUJA 3OM0A 1B00A 3G1WA 1DC8A 1Z25A 4FE7A 3E3MA 5HM6A 4S05A 2FEKA 2JRLA 3CRNA 1JFVA 3FFTA 3H75A 3O1IC 1JFTA 3IPCA 4MR9A 4F3TA 4EYQA 4KZKA 4RKRA 3GBPA 3KKEA 3RVQA 3CHYA 3OMWA 2IPNA 4MGEA 1NY5A 3ILHA 4HNSA 4JASB 3DLBA 3HCWA 3O74A 2WMYA 2RJOA 3CG4A 4RY0A 1ZDMA 2E4VA 3EGCA 4OBBA 4LE1A 1FFSA 5HQJA 1YTUA 1SD5A 4GPAA 2L2QA 3LOPA 4KK4A 1QP0A 3CU5A 5IBQA 2FEWB 4Z4GA 1IIBA 1ZH4A 3C3WA 1ZESA 3K4HA 1E6LA 1K66A 1R8JA 1T34A 4WXMA 4KREA 4EYGA 4PZ0A 5DGCA 2PJUA 1FQWA 4OATA 2VUIB 2HQRA 1M5UA 4D6YA 3T6KA 5TQ0B 2GX6A 3MMNA 3O2JA 3HO1A 5FWXA 2HQBA 1VLZA 1QO0A 3N8IA 4H60A 2N9UA 3G85A 3DGEC 4B09A 4ZMSA 4RZSA 3OLXA 5B3JC 5KI6A 2P4UA 3O1JC 4MQEA 1YS6A 1HEYA 2FEPA 3C3KA 4RY9A 1Y1LA 1U8TA 1NATA 1YK1A 3IDOA 3JTEA 4QICA 4OLBA 2WRZA 3MM4A 3IP7A 1Z12A 4JP1A 1QKKA 4YRZA 2A9RA 4TLMB 3O75A 1ISRA 1VPWA 4H3KB 2LP4Y 3A0RB 4KMRA 1JDPA 2A9PA 1PHRA 4G0YA 1QQAA 1QNLA 2IOYA 1JF8A 4YP9A 3QELB 3RVRA 2HJ9A 1JWLA 2RGYA 3CZCA 2FQYA 3P9YA 5EWMB 6ABPA 1BDJA 1I3CA 3IP6A 3QX9A 3OLZA 4RV5A 1LJUA 4WUTA 4H3HB 3RQIA 5ED4A 1RZRD 5IUJC 3H1EA 1APBA 5HKOA 3NHMA 2O20A 1A0OA 1ZH2A 4MR8B 2B1JA 1D1QA 4RK1A 1A04A 4LDAA 5CHYA 1D2AA 3QK7A 1TMYA 1YK0A 2CHEA 3MF4A 3TB6A 1BAPA 3URMA 3L6UA 3QX8A 2GBPA 3HUUA 2GWRA 3QEMB 2NT3A 1ZHHA 2X7XA 2FTKE 4MQFB 1FSPA 3UK0A 5KWSA 2CHFA 5CNIA 5BR1A 3T38A 5IUNC 1Z15A 5FBHA 1F4VA 4KV7A 4NICA 4MQFA 2YHBA 2PAFA 4Q6BA 5JNTA 3KJXA 4MYRA 1YMUA 3HEBA 4L4UA 2RJNA 2E4XA 3K9CA 4PICA 3HUTA 1GLGA 4RK0A 2R48A 1TJYA 1NXPA 5T7BA 2QU7A 3H1FA 3QLUC 4MLCA 3FFXA 1ZN2A 3I42A 4RSMA 5GQSA 4Z4HA 1KRXA 3A10A 2QVCA 1KMIY 4LDZA 2FQWA 1E2BA 2FMIA 1MB0A 3VNAA 3IPAA 3N53A 3RVMA 2LPMA 3GWGA 3H5WA 3KTOA 5BRAA 2NT4A 5ABPA 2AYZA 3H1GA 2YHAA 3Q7RA 2E4UA 3MIZA 3KS9A 1P2FA 2QSJA 1AB5A 5KQLA 4RXMA 2P9HA 3GV0A 4ZYLA 4G0ZA 4ZJPA 1GUDA 1SXGA 3MYYA 3DLHA 1P8AA 3F6PA 5JS1A 1NXSA 3C3MA 3LUFA 3RVLA 1QQBA 1KGSA 2E4YA 2R47A 4MR9B 4HNQA 5IEJA 3JS5A 1MVOA 2FMKA 2BGGA 2QW1A 4OG2A 3TO5A 1ABEA 4EVRA 3LTEA 3SAJA 2LBPA 4W5RA 3BREA 2JB9A 1CHNA 1BDIA 4NCAA 4MS4B 2JVKA 3OLYA 1Z16A 4DN6A 1RZRA 3SY8A 1FFGA 5IUKC 1EWVA 4W5OA 1JBEA 1OXBB 3O2QB 4YWHA 3H6GA 3EAFA 4MS4A 4Z4IA 1RXIA 3C97A 2IPAB 2MSWA 4YGXB 1URPA 1PUXA 4F06A 1YIOA 2NZUG 1L5YA 3L49A 4KK3A 4XASA 5TPZA 5C5EA 3TD9A 4RXUA 4EVSA 1TM2A 3KCNA 3N0XA 1JL3A 2FXIA 4W5TA 3HSYA 5FWXB 4O1IA 1UDRA 3SM9A 2PLNA 2IDMA 4UHKA 4MQEB 3M6MD 2FLWA 3KYJB 1SXHA 1EAYA 3KLNA 3KG2A 4RU1A 2MYPA 2E4WA 5CNKA 3D8UA 4KPYA 4XFKA 3RVPA 3BILA 4JB2A 4EGSA 4D6XA 5T3YA 3N0WA 3EQZA 2FKAA 2QZJA 4G0MA 3A0UA 4P98A 3RH0A 1ZGGA 1LK0A 3SNKA 4KFCA 4RXTA 1EWKA 3RVNA 5GOTA 2ZWMA 1AB6A 3DZDA 5I4CA 1F51E 3QLVC 1Z2EA 2PUAA 2FN9A 3H5OA 1U04A 4IILA 1DBWA 3Q41A 3GBVA 3IP5A 4W5QA 1JYFA 1E6KA 1RNLA 3LKVA 3FDFA 3N75A 2A9QA 3OLWA 2NZVG 4E7OA 4F8JA 1JLKA 5IULC 3I45A 3CKMA 5JS2A 1D5WA 4EYKA 1CEYA 4MPTA 2HSGA 4RDCA 2M98A 1QP4A 2FSPA 3IP9A 1PNTA 4XXHA 5EWJB 2WJAA 1D4ZA 2J48A 3HVRA 2MYTA 4IF4A 3RVSA 4E7PA 2MYUA 1ZY2A 3GT7A 5EWJA 1EFAA 1W9HA 4O1HA 4MAAA 4L85A 3DGFC 3VNBA 4YV7A 4GNRA 2L18A 5IEBA 4EYOA 1FFWA 3H5TA 2PE5A 2FLKA 2PMCA 3HZHA 1ZITA 4WT7A 5KC8A 4LE0A 4DADA 2FW0A 3H5IA 3CFYA 3NNDA 4EY3A 4OLAA 1MIHA 3E61A 1WETA 4IGAA 3FMVA 4JAVC 3T8YA 1Z2DA 2HQOA 4NV3A 2WY2D 3B2NA 1GCGA 3SG0A 1CYEA 3LUCA 2JBAB 3D02A 2PUCA 4TMYA 3GRCA 1SXIA 1JFSA 2L17A 2PUEA 2MSLA 3I09A 3NBMA 1M5TA 1QP7A 1GCAA 1PNRA 3CLKA 5DTEA 3HK2A 2JBAA 2MSKA 2PKXA 3RVOA 3N0RA 3F73A 1OXKB 2JVIA 3CTPA 1LBHA 5CNMA 4LRQA 2FMHA 1NXXA 3N6VA 4ETIA 4Z4CA 4WWHA 3HJFA 2PUGA 3OQNA 4FB4A 1YS7A 1DRJA 5CNJA 3RVJA 4D74A 1LBIA 3S99A 1EHCA 3ILYA 5F64A 4MLDA 2Q5CA 3FFWA 3KHTA 2E4ZA 2JCGA 4IMIB 3CNBA 2IYNA 2V0NA 2L19A 1KRWA 5BQ3A 2LIVA 3EULA 1DCMA
chains in the Genus database with same CATH superfamily
4PN3A 2GN8A 4F7WA 4J0EA 4QU8A 4D0RA 1GG8A 1NHGA 3K8OE 4OHCA 1GU0A 3QZUA 5JCOC 2UAGA 1PJLA 3SXUA 5IVKA 4BNNA 1T2EA 2I2AA 2R8XA 2IOFK 2POCA 3MMSA 3U16A 2GO1A 2PUWA 3L8FA 5FOWA 1T36B 3F96A 4FEEA 3I53A 4QFBA 4LMAA 1WR8A 3ZYCA 1T0BA 3KR1A 3PFIA 8GPBA 5B30A 4N6GA 1YTLA 3FNRA 3Q2IA 4F5WA 1T36A 2A5DA 3N74A 4QGSA 2NX2A 3WK8A 4RL4A 1CY1A 4ZCSA 2GYWA 5JALA 1GGVA 1SJ9A 5T5QA 3SNHA 5IU6A 5JS8A 3PGVA 2QF7A 3CVWA 5JCPA 3EA4A 4JOCA 4OLJA 6Q21A 3Q8KA 4R9SA 3KE8A 1WNFA 1YIDA 3AFGA 1L4BA 4JGGA 1OYYA 4OL0A 4M1EA 3BXXA 1QIFA 3D4NA 3I9KA 1IWOA 3P5BA 1YFZA 3RODA 1G9XA 1PTJA 4M0MA 1JFFB 4R51A 5LXTA 16PKA 1K75A 4LWPA 4LJ8A 3SYLA 4KMMA 1WM1A 1KK3A 2HCFA 4X64B 4EOGA 3OBIA 4JU8A 3TRJA 2B83A 4BFTA 4XQ9A 3OQOA 2QD2A 3OX3A 4MUIA 2V1XA 2OXEA 4TLCA 1MPTA 1SWVA 1Y48E 1F0PA 1CZUA 2V7WA 3EAGA 1CUHA 4QODA 2I91A 1DFGA 1G5QA 1XEFA 4XDZA 4YAOA 1PQPA 1P2DA 4BWYA 4G8JA 5I3ZA 2WP0A 1VLQA 5ESWA 3I4LA 1RWXA 1F3OA 3RU7A 3RADC 4GLFA 4RJLA 3KJGA 4K28A 3EGIA 4XZ3A 3I3OA 2BGIA 4XYGA 3W34A 1TYEB 3QWAA 5I7SA 2VPQA 4ARAA 3LC1O 1E2UA 4UNNA 2ZJ5A 3O1LA 5A9TA 3JRWA 5GONB 1TVMA 3V00A 4D8UA 3V4RA 4F12A 4JLPA 4RAQA 4OMUA 1KI8A 1VDMA 2YICA 4BX3A 1E7YA 1H23A 2SKDA 5L3SA 2HYDA 3QI2A 5IJ9B 2HUPA 5FYQA 2XTZA 1AKQA 4HQOA 1I7DA 3ETGA 4Q12A 5G02A 5GONA 3Q0IA 2ZXFA 3T3MB 3CLSD 4H08A 5HKLA 3L4BC 5DCLA 1BMQA 3N7TA 3UB4A 1UPTA 3EY9A 2SBTA 3U1TA 1MOPA 1NWHA 1EJ2A 1IWPB 3LLUA 2WG2A 4RJIA 3PUKA 4XWAA 5BT9A 4AJIA 2XADA 4EFMA 4PR0A 2HHAA 2WU3A 4C0WA 4HNAB 3PFWO 4R81A 2H1WA 2ZJOA 3ZQJA 2LXNA 1NQOA 1PWYE 1Z5PA 4B7AA 4QYWA 1C9DB 3SX2A 2E3JA 2VHQA 3NATA 1NMSA 3ZCSA 1OY1A 4HNAA 2GEUA 5KC9A 1FFCA 1SIOA 2VK2A 3CX7A 2C8LA 2WFLA 1ISJA 4LRSB 4ZHQB 3PHGA 3PXCX 1GITA 3JQ6A 2HA7A 3BXOA 3P32A 2WU1A 3OIYA 3SZOA 1FLAA 2FN7A 1Z6TA 3WYNA 3W78A 1GAWA 1KEWA 4HVLA 1VQ1A 3RS2A 3AKYA 5AOVA 3UKOA 4RK7A 3F4BA 2D1TA 1TAUA 5L40A 1CZKA 1G6Q1 3EVEA 1FS6A 2WT8A 1P7PA 2DC1A 4QBTA 3BG5A 3QF4A 5LQNA 1J7KA 4BS9A 1QHYA 2C82A 2P11A 1J1ZA 5CXSA 4DCCA 4JMLA 4C03A 5H16A 4AYWA 5JO0A 3RVKA 1WDMA 4JEMA 3E4DA 1KPGA 1GNLA 2A4MA 3ABSB 3PC8C 4PLFA 2H2FA 5AKHA 2F9FA 4EHBA 4KWTA 1VA5A 4Q15A 3STHA 4BQEA 7YASA 4OP2A 1KAOA 3JQQA 2Y1EA 4GVPA 4PO9A 2HA5A 2WPNA 2ECFA 2VJPA 3GHYA 4ZV9A 3LXMA 2J9GA 1XRSB 4O4IB 3V46A 4TRMA 2BRUA 4M0PA 5U4XA 2QT9A 1V39A 2CJWB 3K9HA 1GZUA 4YTEA 3T12A 2A94A 4I2VA 3E82A 2CLLB 2HMYB 1EPUA 3C5EA 3P8ZA 3QJGA 5EHNA 1L5KA 2PQ2A 5EYPB 2BHRA 4OMCA 4O4IA 4EZEA 3WNVA 4LF5B 4U0KA 2ZJ7A 3NT4A 2WJ6A 2CJWA 3NEJA 2V7TA 3K6SA 3O1HB 2XZDA 1PKEA 2DOKA 1YVUA 3BBLA 3FPFA 4IJ6A 4L95C 5HK8A 1C3LA 4NCHA 2D2FA 1L8XA 3DWEX 5EXDA 5EYPA 4WCVA 4DRXB 2I29A 5HCIA 1OXMA 3GGPA 1ZEJA 4Q00A 2XODA 3II6X 4TZ6A 2J32A 5A6VA 3WC4A 5BQXA 4KE7A 4L4YA 4G56A 3SC6A 1Y3HA 5KCZA 4LYJA 4DRXA 1A4RA 1HNXB 5FNVB 3C3BA 1ST3A 5KNCA 1XLVA 1ZBDA 2Q1YA 1EIWA 4OHMA 2QY9A 3LUJA 4OQZA 1ZD2P 1QX3A 1YACA 3G1WA 2CL0X 4G4GA 4Q05A 5FUVA 5ESRA 1T2FA 5FNVA 4O2BF 1U0OC 3IPLA 5H80A 3UJAA 3NTOA 4I55B 2V9CA 4LOIA 1CW2B 2E82A 1IWBB 3AGQA 5I8PA 3RVQA 1UBCA 2ZS9A 3OVMA 4HNSA 1RBZA 3N1UA 3P96A 4I55A 4KVZA 1Y7PA 3N7UA 4LZZA 2CNLA 3O2NA 2J0UB 4L57A 4IFEA 3A6JA 4LHSA 4E94A 3O8QB 1SC4A 3I8OA 4TZ0A 3A4NA 3O0TA 1Z4PX 2YBEA 2OWDA 4BMSA 5K99A 5IAOA 1XDGA 1DCTA 4RDXA 3NEYA 1SD5A 1AS2A 2H9AA 4X45A 3MXOA 1XK6A 4TWBA 5IBQA 4D9EA 3O8QA 1RI5A 1QQ5A 3CKYA 2GCPA 2NO5A 1CR6A 3B8EA 2NYRA 2QZ9A 1UIRA 1YZFA 4QAQA 4BN4A 5BYKA 2VOJA 2V03A 2FE1A 3P2JA 2O06A 1GPDG 3AKZA 5BSVA 2O2YA 4Y9UA 3OZEA 4CUZA 1J8YF 3OPYA 2X14A 2PU7A 3O3MB 3WXBA 4EA9A 3HCCA 3R3WA 5F9MA 3X1JA 2P79A 1Z4OA 1GKUB 2RHLA 4MMZB 1H4TA 3CVYA 3P9SA 4MDYA 3VTKA 3VV2A 3EEYA 3AWIA 4Y2RA 1F6WA 5JSUA 1Y1LA 1JNXX 3OJWA 2LCQA 3LU1A 3FCOA 2DWOA 2FZ4A 5EIBC 3TTVA 5KYKA 4IDBA 3G6WA 3K70D 3IO3A 1DC4A 2HV8A 3R6DA 2C58A 4GF5A 3EXAA 1PJSA 1XO1A 1BHSA 3B1ZA 4Z54A 2UZ4A 2IBTA 2QI9F 1NKSA 1G20B 1NW7A 4QUEA 1QYIA 1JJVA 2FPXA 5SY6A 4ATNA 2XOXA 1RJEA 4AZWA 2BN4A 5GV8A 1XPRA 1IVYA 1ZIXA 3TS1A 1QNLA 3TTSA 5CG1A 2JH9A 5D86A 2EQ5A 4G2NA 1G20A 3IB3A 4F86A 2F7SA 3D5TA 5SYAA 4GZLA 1U1DA 4IYJA 2YCLA 3UKDA 5DCYA 1KVSA 4EPVA 4MV5A 2MSDB 1GAEO 3N7AA 1ESNA 3KEFA 5TQVA 4BNXA 4RTNA 2ZIFA 2ZYIA 2R7KA 2WVJA 5HKOA 5K8VA 3DZ8A 5AKXA 2ZYHA 2B1JA 2TMDA 1OAOA 4H7JA 2P2LA 4OHPA 3AI1A 4PC1A 1X2BA 3BSSA 3EPJA 1EDBA 3PZBA 1YGPA 2OECA 4F5YA 2FJPA 2VPPA 4LW8A 1BAPA 3K0SA 5I4BA 3UYKA 3U4CA 3HUUA 3YASA 1PWEA 4C6RA 4GDFA 4ALLA 1VE7A 4IV0A 2OQ2A 1UBRS 3ZU6A 1PR5A 2JIOA 2YMQA 3HUEA 1XAIA 1RWOA 2XE7A 3NAQA 1UWCA 1WUTA 2BGWA 1ZU4A 5IUNC 3QX3A 3PP8A 1LPPA 3PQ3A 1WMEA 4W63A 2P6MA 5HF6A 1HL7A 3F5MA 3RHSA 3T99A 3RK0A 2WDZA 2OD2A 5FBZA 1DAHA 2WD9A 2V45A 1BYUA 3NV9A 3WGUA 5F2OA 4IIVA 5I47A 1Z6YA 2J30A 5ALZA 1G7SA 3W2HA 3RCBA 5K3OA 1G2QA 5JY6A 3WYAA 2NU6B 4F6LA 4B7XA 3OQ1A 1AN9A 1XRJA 2XMRA 2YV4A 2QTLA 1XTZA 4Q1AA 3QBDA 1JPJA 2DETA 1UJ2A 3ANNA 3NETA 2J9XB 1Y5IA 4DUYB 1S2IA 5A06A 1EMDA 2RGCA 4MPJA 4MIEA 1PW7A 4KXQA 2QMUA 3KQOA 2B34A 4OMFG 1HRDA 3C8HA 3SX0A 3CXUA 2B92A 3GUYA 2P1RA 1X1EA 3D6JA 2R6ZA 3JU3A 3WX0A 1P2FA 3G79A 2FRDA 1OU0A 1TZKA 2COEA 3H3JA 3GV0A 4NU8X 2P4HX 2ZIVB 1GUDA 5DBIA 3DHNA 4IZOA 4M99A 1J6UA 1QVVA 3BWEA 2I2CA 3KB8A 2PMBA 2Q4BA 3NWJA 3KVVA 3TQIA 1ZHFA 2IDZA 2CFCA 4LMRA 2DBVO 1Y82A 3JYNA 2P69A 3BDIA 3TJRA 5A0FA 1QE0A 2ZXUA 3QUCA 3NDPA 4BOYA 3TSYA 2YUIA 4AMBA 4QDTA 3AM3A 2K6GA 2VDOB 3OKPA 5E8JA 3L4SO 4KKXB 2C99A 4RYDA 3SFVA 2DQYA 2IYUA 3MN1A 1MOQA 4G4SO 1ADYA 3EARA 4YHBA 3UHPA 1EWVA 1HURA 3ZW7A 1IAVA 3AJ9A 2GPYA 4OXIA 5C8DA 2GD1O 3QVKA 1Q22A 3EYWA 3FETA 1F8XA 1ZOSA 3KZMA 2R751 2RGNC 2YXLA 5KIAA 3PUXA 4JNKA 1ZZEA 1MF7A 1PI3A 3EEIA 4LYEA 1VPEA 4ZKEA 3TIFA 3AQIA 4F9TA 1PUXA 3AEZA 4K9MA 1K2VN 3V8VA 4JUIA 3Q8MA 4AKTA 3FM9A 5ESDA 4EJMA 4XEHA 3VUFA 1E1MA 2QX4A 1KJJA 3NTRA 1GZHB 2ZBGA 4ONEA 1LNZA 2DTDA 4C7BA 1JQDA 4DJ5X 5JBIA 3S8EA 1L7OA 4M1TA 2H92A 2E5FA 4HQ0A 4H0CA 4NSNA 1Z28A 3RREA 4LNAA 4DTIA 2ZQZA 1SBTA 1D0IA 1SZJG 3R41A 5IW8A 3SYRA 2ATVA 1Z8NA 2WWXA 1D4OA 3BFVA 4F1JA 1MFZA 1R64A 2H52A 4RZ3A 1VCOA 4PY2A 1YNSA 2CKMA 5IBPA 1EFPA 4RM2A 3L8EA 3UA4A 4CGYA 2FKAA 2I9KA 3EGDB 1FFBA 4G2TA 3UB2A 1V41E 1UPXA 1GN9A 1KVQA 4B87A 3RVNA 4F4CA 4BVBA 3ORYA 5JZMA 1CDDA 2WVGA 4TXLA 5DASA 1W1IA 1SUDA 2XYQA 1LWNA 1NLZA 3AMVA 3KAQA 4DJEC 4DSTA 5CVVA 1HE3A 4N0MA 2YIDA 1YH3A 1AKNA 2HHCA 4E7OA 1BXZA 5D85A 4S1PA 4KGXA 3L7AA 5KCMA 4CL3A 4Y2JA 2I7VA 4LJLA 3SC2B 5C8VA 1T1IA 1UZUA 4RZ2A 1ZCBA 4XD7D 4A8JB 4W7HA 5E1BA 2P77A 1IRXA 1N2ZA 2O2HA 1LTKA 3QFTA 1CF9A 1PNTA 2R60A 2SICE 4BNZA 3LP5A 2QN6A 4NATA 1SHKA 3SC2A 3UC9A 3KQUA 3H05A 3GQVA 2VK4A 4A8JA 2G9RA 4E6PA 4I1OA 1LQTA 4EJFA 4RAOA 2QX8A 3AL2A 3FY4A 3JQGA 4MUJA 1DFHA 3TDNA 1NF8A 1W87A 1DLJA 1R8SA 4ZYTA 2AFHB 3FNBA 5TMPA 4NMHA 3S29A 5A3QA 4QPZA 1OH5A 3C16C 4EKEA 3T1HB 2AUMA 3QWHA 4M8SA 2VF8A 3CFYA 4QAJA 1BH2A 3TWOA 5EJ5A 5KKNB 1G42A 2AFHA 4A2QA 4RKWA 2WEKA 3UBTA 3UVEA 2QD5A 3RFVA 1E94E 2QORA 4E5KA 3R74A 4CM7A 2A0FA 2PMDA 1XGKA 2G1AA 4HHEA 3E4CA 4D8YA 4HVCA 4PGFA 3KL4A 1SXIA 3ROQA 1DWPA 2UUBB 2PUEA 1QJCA 5KOHB 1Y33E 4G9BA 1T91A 3IRUA 2PZGA 1MAWA 3DR5A 3DTNA 3K8QA 4TV8B 4DLPA 3AP1A 2VVTA 4YP6A 4R1QA 2YWBA 3K30A 1Z47A 2GM3A 3E8MA 1OXVA 4TV8A 2FWMX 3VSDA 1T8TA 4NH4A 4GX5A 4ZARA 3J7TA 2OG2A 4E07A 1R88A 4MV0A 4R2MA 5LQUA 5CDTA 2YNMD 4JI2B 7MDHA 1VE3A 1Y8RB 3V2IA 2C4VA 2H5JA 2PXAA 3UGTA 3X2EA 1XZMA 4KWHA 4OSOA 4BLUA 1SVOA 3GGSA 4J4TA 3PK0A 4BZQA 1NPDA 5HUQA 3MCAA 4WI1A 3JATB 2Y0EA 3ZV4A 5FHRA 3QLTA 4RVHA 4C4SA 3U4QB 2R2GA 3SICE 2M6LA 3DMYA 3P27A 3M4XA 1UFRA 1VBNA 3EPRA 1I5RA 2JEYA 5CGQB 4A27A 1ZUNB 2WIGA 3VVLA 3JATA 4EY6A 1XMQB 4OUKX 1FFYA 3L05A 1MDBA 1QONA 3ANLA 2ECKA 5E9JA 3U4QA 2IW1A 2RGBA 2VYNA 1OFGA 5ETJA 1SPBS 1M76A 2AQKA 3PB3A 1PKXA 1ZUNA 5BRJA 1UWLA 4IEFB 1A5BB 2PH5A 2XUKA 5CFOA 1YQTA 5DF1A 1L3BA 1MMFB 3F8TA 4KN6A 4ZMRA 3RC2A 3U6KA 1V5GA 3EJWA 1IFXA 2PUFA 2CXRA 3JWHA 2IITA 5JLJA 3H2GA 3OO1A 5AOAA 5KO2A 2D0PB 2Q29A 1BMFA 1XZCA 1GRCA 4N03A 3FTFA 5KQGA 1VKJA 4S0ZA 1XU7A 4P7FA 4WN3A 2IQ5A 3BQNB 4F9FA 5C5CA 1C3OB 2OFPA 1EDDA 2EARA 4W99A 2B4AA 2NXEA 3LT4A 2Q1TA 2ZI6A 4R6WA 5CEFA 5KTKA 1FJHA 4PF1A 2IYFA 3UXHA 5BOSB 1XDZA 1KQFA 1ZWLA 2PT7A 3FDZB 1C3OA 1D9XA 2PYZA 3F3KA 4J94A 4JJFA 3TLXA 1LS1A 4CDMA 4TWRA 4KE6A 3AOEA 5BOSA 3AHHA 4LK2A 2GH1A 3RIGA 4ZYWA 1TYCA 2VDWA 4HI0E 5ISMA 1QGYA 3FDZA 1AF7A 4RK6A 1L3IA 1Z3CA 4DLVA 4B2YA 4HPXB 1VM6A 3EJ6A 4N7JA 4LF4B 2I7TA 1A3CA 1TCVA 3ICPA 3R23A 1JX6A 4FXPA 3TNDA 1VL5A 5REQA 3GLGB 1HXHA 1WBJB 3L06A 1C4WA 2A0XA 5BP7A 4GMGA 4I50B 2X0NA 4ID9A 2ORYA 5IKXA 1PGJA 3GMTA 3O4JA 4ZO4A 4NC9A 4NBWA 4WK0B 3AVWA 2ZKLA 5FPQA 1HNNA 3U40A 4XYMA 1CZRA 2OQRA 4I50A 4Y9SA 3NYQA 2B99A 2FSIA 4B46A 3UMSA 3UWOA 3GLHA 1ZMBA 1DBQA 1PR0A 3LD9A 3G5TA 3UICA 4B7CA 4HB2A 3GK3A 1L5MA 4FFMA 1OI3A 5ITSA 1JUDA 1DXYA 5C34B 4ERNA 1YZYA 5AD1A 5IDVA 1Z4LA 4YRDA 5FTJA 2AI2A 3TPZA 5A02A 5AJVB 2H85A 2R97A 3HPRA 5HMMA 1D2MA 1WZUA 4DYHA 4ZO6A 4OB6A 4EFLA 4YRKA 2XKKA 5AW0A 3O9ZA 1V5FA 1G2PA 5AWFC 3UMGA 2VDLB 3F9CA 2PWBA 4P1ZA 2Y27A 3ZJ5A 5IWAB 2GZ3A 3COPA 3C6YA 3AHGA 3PEYA 2LNDA 1S0UA 2VSNA 3WYGA 2C2WA 1PDOA 2ILVA 1RACA 1TMOA 2IPLA 2FYTA 3GEDA 4HXGA 3RF6A 4MSUA 1SM4A 1M2GA 3S0JA 4C0AC 4EJ2A 1J8FA 2EU8A 2XMZA 3RIXA 4ZOLF 5TSDA 2YC4C 3DDHA 4LSGA 5CDUA 5F4ZA 1T5DX 3ON5A 1RADA 3DPSA 1YHNA 1VHWA 2FZEA 2EDAA 1XVIA 3A06A 3NBAA 2ZDGA 1B73A 4QDXA 2G9ZA 1VYTA 3SFZA 3VR6H 4CMIB 5AK3A 1X3SA 3KKPA 3PVCA 5J5CA 4O5AA 1U8FO 1SFRA 4WVLA 3C4JA 4YLGA 1MABB 4GS5A 1KEVA 3OM1A 4MCAA 4Q48A 5TE9A 4Q4AB 4XI9A 3UH1A 4CMIA 1PX2A 4OI0A 2KYRA 4QNRA 4RDHA 3AETB 5G1NA 4DSOA 2WKQA 1RRFA 2MIIA 2HBZA 1I9GA 1MABA 2I1QA 2XA1A 3HXKA 3IQWA 3W4JA 5FV4A 2GBIA 2ZYUX 3IGFA 3HB0A 4BBAA 4HN4B 1Z88A 4Q4AA 5JQGB 5JXIA 1YFJA 5CBPB 3L7KA 3MJCA 3QPCA 1MG5A 3AETA 4KBGA 2ZT6A 4W82A 3TAXA 1L5ZA 4EX6A 2J0SA 2RH4A 4X7MA 1BZYA 5AJTA 5JQGA 3JWEA 5TPZD 5B55A 4GPIB 4GX1A 4UBLA 5CHEA 5CBPA 4HNUA 2C7GA 3DMTA 3TNFA 5IFLA 1PO7A 1TD9A 1DZ3A 2PKCA 3G0OA 4UHFA 4D81A 5C1BA 1JG2A 2RHHA 4IHAA 2MYNA 3DE2X 3QE4A 4YRGA 1WL8A 4FPXA 1Z6GA 3MFQA 4UUNA 1KY3A 4ZDWA 2P7IA 2PFKA 3N2YA 4J3JA 1WCWA 1O6ZA 2H2WA 3R6GA 5HA5A 3U4HA 5KNDA 3LCRA 3CC8A 1RHUA 1Q74A 2YFYA 3OPQA 5KEIA 1I3NA 1UKZA 4PXAA 4BGUA 3EVBA 3B6KA 1QSGA 2P5SA 3QE9Y 1GQYA 5GVSA 2LD4A 4KRXA 4ZVOA 2JDIA 4HFJA 3EIXA 1K6IA 1PDVA 3R3ZA 3TR0A 5NULA 4KQHA 3O21A 3ZU3A 1FSZA 4JI3B 1NAHA 2W6IA 4KIJA 5BQOA 4HKTA 1LV8A 2C4UA 3UWMA 3DMPA 4R2WA 2ROQA 3HM9A 1ILEA 5L6LB 3RARA 4NBLA 1U9IA 5F3WB 3IAM1 1QCDA 3HB1A 2FP4B 3DLAA 4FE7A 3HI6A 4K8OA 3IAUA 3ETCA 4D3XA 3QEAZ 3ZWXA 2AI3A 4S05A 4PC2A 2BMWA 2XA2A 4DG8A 3CONA 1WV0A 2AHRA 2FN4A 2NZJA 4IGFA 5C80A 1EX9A 1W46A 1ZJJA 4GPBA 5AHXA 4MW0A 5C9ZA 2FP4A 1QOPB 3TTTA 5K6AA 1K0UA 2IPNA 4QULA 4Z0HO 1OFTA 3ISVA 1ULBA 4C14A 2GK4A 1U6KA 3HCWA 1D09A 4N54A 2ENWA 1EJ6A 4IIEA 4L8WB 1WSAA 3MW8A 3QMMA 3B6MA 3DQQA 1ML3A 3PWZA 4ZC8A 4U8GA 2FUKA 1P91A 1P1CA 1V8FA 5DT2A 4TKUA 1QYXA 1RBQA 4NEQA 1NX6A 2A92A 4F2DA 3LOPA 1IBLB 2NQ8A 1U8XX 2VS1A 2CLEB 3CU5A 3PGA1 5DV9A 3ZH9B 4PSDA 2FW1A 3C3WA 3K7EA 4D79A 3ZVLA 4IG4A 1FF9A 5ALDA 5DM70 1FDTA 4PXSA 1Q95A 3IEVA 1WO8A 1PUIA 2PJUA 3LW7A 2RGWA 4PX5A 2C5GA 3D8RA 3PITA 1DAPA 4IYRA 3THSA 4KGDA 1C41A 4UU7A 3UJ3X 3Q7QA 4JZYA 3UW1A 3F3MA 5LB2A 3GN1A 2IXDA 2Q6VA 4ENRA 1V4BA 1K4MA 5CX1B 1QZ3A 2F9MA 2J85A 4MQEA 4FFSA 3VU8A 2QTVB 1X92A 4KQWA 1GU7A 1XMSA 2AJ8A 1D6SA 4LHXA 3PRKE 2EFEB 1YB6A 2PMKA 4Q1BA 3OZRA 2P0AA 4TM8A 5AHRA 2HADA 4JSRA 5CX1A 5E1DA 5TARA 3PXAA 4YRZA 5C53B 3RBXA 4A9AA 4ARZA 1EGMB 3WA6A 2QTVA 2LP4Y 2JAPA 3WK9A 3DZHA 4FDMA 5E2AA 2OA0A 3SHWA 3U3RA 4X8HA 2RGAA 3PX2A 4DRYA 3NMUF 4YACA 3PXGA 5LOVF 3IOEA 1QIDA 3O8OA 4KITB 3OCUA 4ARSA 1A97A 4GX2A 4L3OA 3VOTA 4KG7A 1T4DA 2V7PA 3EVCA 3H9QA 4ACBA 2DUJA 5F21A 4YBZA 3K6KA 4DA4A 2QRUA 3OF2A 4MKFA 4BATA 1II9A 4Q66C 1OVGA 2RI1A 3L84A 2WWWA 3LV8A 1YQ9A 4GBJA 4R1TA 1NVMB 5ESXA 2Y6VA 4BYGA 1KR5A 3L7NA 3PUVA 2XUPA 4CM9D 2CV1A 4MHSA 1UBHS 1BEEA 1X8XA 2PLWA 5ALSA 2HWWA 2VXBA 2W71A 4MUKA 2CHEA 4NU0A 4PSKA 3T3DA 1ECFA 3EXHA 2GBPA 3F5DA 3IT1A 2ZUFA 2V7BA 3L02A 1IEXA 5SV2A 1SVWA 3WFZA 3W2IA 5JI2E 3BIOA 4JC0A 1QR6A 4HAXA 4DUPA 1F17A 4R40A 3EGOA 4DR4B 2E49A 2J3JA 5AVTA 1HLPA 2C59A 4F3KA 3ZLJA 2QN9A 3FCXA 3B53X 1IZ9A 1JU3A 1VMDA 1QRSA 3LT0A 3UV6A 1RAIA 2ZETA 2X6RA 5DWDA 1WLYA 3QPAA 1K6EA 1PGPA 5F12A 1GLGA 1E79D 1R5NA 5F2NA 2NP6A 4WKBA 5DGTA 4CZ2A 1R0LA 1ZMRA 4BNTA 1JALA 1EZ1A 3C5HA 4ZEVA 4OHWA 4BQIA 2QVCA 2OB1A 2AUNA 5DNDA 1MB0A 2XMQA 3C3EA 4A2PA 1BFKA 3IUSA 3FVRA 3WR5A 1KI2A 3RU9A 1VJ5A 2JHAA 3ILXA 4Z8YA 1KF0A 1V71A 4C7XA 2BY4A 4WN9B 1MD9A 4PSAA 3WYDA 4UTXA 4JGBA 1U0FA 3FI9A 1IG3A 1KC1A 1RYBA 1IHDA 2XCOA 1KOGA 3TQTA 3WGQA 3L6EA 4YMTA 1GTL1 3S1AB 4PGGA 3IC5A 1I3LA 5EQFA 3KBBA 4WN9A 1YL6A 5EJ4A 3CNNA 3ZD6A 4Q4HB 4TUYF 3U4IA 4LHZA 5KTPA 4OB7A 2OORC 3W2TA 3PRYA 3HEMA 3S1AA 4JR2A 4YCNA 3B8HA 3GRZA 1KPHA 1OREA 1TM7E 3MWJA 4FEAA 3WZLA 2OC4A 4PIMA 1VDZA 3CZPA 3NBKA 4ZQFA 1ABEA 1Q44A 2C00A 1GV0A 4W5RA 3VJLA 3ZVRA 4I8IA 2GRAA 2B7LA 1UXIA 3TCXB 3WLAA 4KHPB 1A4UA 1VE1A 2MHCA 3L7YA 1RQPA 5AUNB 2UVPB 5JFOA 2QP3A 1YDWA 3KXPA 1SXPA 3A6FA 2O6HA 4IJUA 3C97A 1L6IA 3AKEA 3ELDA 2UVPA 4Q3NA 2CDRA 2I78A 1URPA 1W5AA 4GWKA 2R8PA 1FXUA 2FPRA 2XVMA 4F2GA 3FHJA 1YCDA 4FEYA 4IFTA 2E9SA 3KYDB 2NZUG 1NVUQ 4LRWA 5C5EA 1IN1A 1FYXA 2P3SA 3MGBA 1XMPA 1W0CA 4BO5A 5JECA 3WP0A 3HM2A 2XSZD 1RYHA 4MROA 5FUBA 3QSYA 3KYDA 3MERA 3ZEAA 2Q62A 1J20A 2FEMA 3PT9A 2CNNA 4L5JA 2AEFA 2P4QA 4Y2YA 2D0DA 1YS1X 4IDDA 1XMJA 3M5CA 4OQYA 4WLFA 1SXHA 3F71A 4WERA 5AYVA 4BRWA 2QTTA 1SOAA 2DHRA 1P0FA 4G1UC 2W43A 3CO0S 2PD3A 1I4OA 4PO3X 3F6EX 3IT3A 1BCSB 3BMXA 1IY1A 5E9QA 5FTNA 4A26A 2XWBF 2GESA 4MLPA 3PIRA 1IZ0A 4XQEA 1NBME 3ZBPA 5J4LA 1UBNA 5K6RA 2XNSA 2RGRA 1S9HA 1BCSA 1L4HA 2HRZA 2BHLA 4Q37A 6ADHA 4IOMA 2WWRA 1OZFA 2ADMA 2VSQA 2H11A 5F7ZA 3SSOA 1JLRA 1SU7A 4PC3A 5LJIA 1XPOA 4ZO9A 5CT5A 1HGXA 3RAJA 3MCTA 3ZDZB 3M33A 4IILA 4N1AA 1I2CA 4QDZA 2Z6AA 1CJSA 4DA6A 3FX2A 3WMRA 3BK2A 2IVFA 2G9VA 2Y0CA 3V2HA 4JB8A 1M2VB 3N75A 1TT5B 1VPLA 3OLWA 2NZVG 4BE7B 1C7EA 3GXBA 2OXTA 4DQXA 1M7GA 4F8EA 2ZJ1A 1U0JA 4L5CA 1HT3A 5JD3A 3PEUA 2CXNA 2WIBA 4CE6A 1X80B 4CIWA 1TT5A 2ZPAA 3ELBA 1EFRD 3HADA 3SBDA 1FYEA 2YQ5A 3PNYA 4OM8A 1KETA 1N2CE 1XKTA 2FSPA 4FX5A 2VZ0A 4ZEWA 2XZOA 4Z7NB 3DTVB 2HW8A 3AINA 5AK0A 3HABA 3WLOA 4MKIA 1X80A 1QV6A 1CQPA 1BHO1 2B82A 4ITVA 1OAAA 1NNUA 4W1PA 1NJ8A 2J9ZB 1RYYA 4ZGWA 2ZJZA 2Q1XA 4HYYA 2D5LA 3D4PA 4OV6B 1W85B 4RF5A 3RD5A 2F90A 3ZX5A 3E3OA 4OLAA 3VO8A 3H5TA 5B1EA 1XL1A 4BQRA 2G1KA 4FMDF 1TA4A 1E3IA 3OC6A 4BVLA 4XWWA 2JCVA 4B0PA 4LTNA 3OJCA 3QVGB 4H6WA 2BBTA 5A9SB 5JNLA 3H8VA 4LF8B 1TGVA 3MRVA 5EUQB 3BMCB 4ISBA 3HWSA 1EAMA 3BHIA 4KR2A 1PYOA 3A1EA 3OCXA 4KR6A 1FFDA 3QVGA 4UM5A 4EELA 3E18A 4RV4A 1T24A 3JX9A 1MA3A 3DEJA 2YOFA 3BMCA 3PQFA 4HB3A 3EBPA 4AAYA 1PVDA 3E9QA 2FDXA 3EW7A 4RKYA 5CXXA 1EVKA 4ZCTA 2AH5A 5DSTA 3S28A 3RRNA 5EKTA 4G9GA 4QYIB 2X2EA 5KDLA 2FI1A 3RRBA 4Q1DA 4QBFA 2GXUA 3CH4B 5LMNB 1HTBA 2R8RA 2Y71A 4TTAA 3T5GA 2BTQA 3TXYA 1VG9B 4UJ5A 3AY6A 4E88A 5KWJA 2CUNA 1FFEA 3BXEA 4QYIA 1CY7A 1X15A 3IDAA 3IMGA 4W9NC 1KI3A 2B4YA 1ZC3A 4RVOA 2VDKB 1VPDA 2NTJA 3X1WA 1I6LA 3RQSA 1U7PA 1DWQA 4RW0A 1YU6A 5DNVA 3CLVA 1AGYA 3EQ8A 5AESA 1RCTE 4J3FA 3D9QX 3EZGA 1C4XA 3GDHA 3TZHA 4YFVA 1Q0SA 2ID7A 5KOYA 3TG8A 1ZR4A 4JH0A 4TKLA 3IUPA 4N0DA 4B5KA 3MJDA 3CJRA 5DBHX 1JMVA 3G2IA 4DC9A 4WD3A 2HWYA 2EW1A 2UUPA 2A78A 5AI4A 1LLQA 1EP3B 3MTDA 3CMCO 5CFRA 4L7VA 3KLMX 3LQYA 4JGIA 5AVWA 1OAOC 3T7RA 1Z8FA 1MFPA 1Z26A 2C2XA 3WB1A 3U81A 4HYEA 4CQMD 4YY3B 3FOZA 3E53A 1MO3A 2H1HA 5IWCA 1GL3A 1Q77A 2OKCA 3BM5A 5AJUA 3THRA 2QK4A 3DW3X 3DOJA 1RZUA 4ZTBA 4S1WA 3MBIA 4OL9A 4W1QA 2IZ1A 3ZCTA 4CMJA 5F4BA 1SIBE 5LZ8A 5JAUA 2N75A 2W4IA 3L04A 1JU4A 2Q5HA 4N5MA 3PUWA 2J9FB 1T3SA 1XEAA 4IX1A 3TSWA 2ZE7A 1DJQA 3T7AA 4BRZA 1GJRA 1V35A 2WWFA 2ABWA 1XG5A 1ZW1A 2JK1A 2X6TA 5DMXA 1P3JA 5IM5A 2J9FA 3HJAA 5H83A 1XEWY 3TVTA 2F67A 2OGWA 4HVAA 5KSOA 4NE9A 3SIXA 3R5JA 2Q0XA 4EY4A 2HU2A 2J7KA 3MAJA 4UMVA 5DIZA 5FI1B 4UVHA 4RD1A 5GJCA 2OQVA 3DEHA 4Q4CA 1Y9JA 3OTWA 2D7JA 2HK9A 4L9SA 5LNK1 1NBIA 4UXJA 1A7JA 1J8QA 1OASA 3CWZA 3DHYA 1R66A 4QPJC 1QTNA 5BRNA 1J5XA 1P1JA 2HSZA 5DBFA 2B5VA 3H3FA 3KFVA 1EWTA 3ROFA 3QLUA 4EUEA 5TS2A 1V4NA 2J0EA 4PZLA 3NHZA 1AURA 2PT6A 8ABPA 1ABFA 1PS0A 1FQKA 1K68A 3OMXA 3AH8A 1M2EA 1QHEA 1T6ZA 4URYR 1NFQA 3ZY4A 2IPOA 3AOGA 3OEHD 2VQ6A 2XRFA 1TZBA 3AHEA 2YASA 3UMMA 4ASUA 1UODA 4YJGA 3A4YA 4IDGA 4RA6B 3ZHYA 3AB7A 1NBAA 3EDQA 3MRTA 5IX8A 5JWOA 2X1MA 4HNGA 5CM9C 1PRYA 3IA7A 1NMQA 1OT3A 2GM9A 2YHUA 3RI3A 1IXKA 4B40A 3E1KA 5KAPA 5AM3A 4RA6A 3R3UA 4N5HX 1NQXA 1U5AA 2FE4A 4EI9A 5HGJA 1YHZA 3B82A 3L46A 4P31A 5JCXA 1P5RA 1DIGA 1VSQA 4JJGA 4P3PA 3VZSA 4TVOA 3E23A 1WXWA 1ZJZA 4FZ5A 3HACA 5EIWA 5JNSA 1PS8A 4NYIQ 1PFUA 3ONEA 2J5XA 5ICSA 4M7PA 1O2DA 1Y63A 2AOUA 2E55A 1R6AA 4JKYA 1ZLYA 3KUDA 4YRJA 2CWDA 3WXMA 2QG9A 4J49A 2QZSA 1H05A 3H0EA 4TS3A 1U7WA 1Z35A 3O2SB 2J0QA 4A4DA 3JZDA 3OOEA 4L0DA 3I6YA 4FC6A 5JS6A 4I1PA 2HL6A 4JXKA 2YHSA 4LWZA 2JAWA 2NLOA 4N0PA 4YQFA 4A36A 3W1WA 1NTOA 1WU8A 3T94A 2WMNB 3TK1A 3E2IA 1N2HA 5H70A 3E3AA 1XJCA 2JGDA 2QN8A 1CUAA 2ZJ4A 1PJ2A 2ZI9A 3ISTA 3L6OO 4JJZA 1HE5A 2D00A 1CG6A 4QZVA 4G5SA 1BWPA 4EKIA 4BASA 4FGUA 1NVVR 3V1MA 2PK3A 4V0RA 2GEBA 3ZWDA 4HZIA 4DR6B 1NVAA 1VMIA 4QBKA 2YZKA 1IBCA 4LI0A 3C8UA 3CIOA 3HJRA 3W9SA 1P17A 5HSGA 1RYZA 1BDBA 1XMVA 1PFQA 1Q0QA 4OHUA 3ZE0B 1W2HA 2HCRA 1NOIA 2G9QA 1G5FA 3ICOA 1AZLA 1KJWA 2DWCA 5IMSA 3RIMA 4UNSA 4MI1A 4R7ZA 1RYEA 1XA4A 2PUTA 4A0SA 4ENTA 4MV8A 4D8TA 2ZTMA 4YCDA 3D0KA 1XTBA 2WF5A 4MEBA 2PL1A 3NX4A 5DMHA 1YQEA 4BTLA 5KUTA 2B5OA 1UPAA 3WGIA 1PQ4A 3Q9LA 3V5NA 3FLEA 4NMMA 1JAIA 3DWIA 4PONA 1U2QA 2PRYA 1I80A 2CD9A 3LNTA 3TLBA 2FZVA 4AZ3B 4EB8A 3DAPA 3PS9A 3B1XA 1VB5A 1NZFA 4LJ6A 1N9GB 3GHHA 4Q93A 3IB6A 1C9NA 2NNLD 5JPCA 4KO8A 1JTVA 3Q12A 2AA3A 3VVMA 3NR2A 2BYTA 1G6HA 2ACEA 4L76A 3CCFA 3COWA 1VBKA 2X4IA 2W2LA 4UE2A 4OXQA 4X7RA 3R9WA 1VGVA 1N9GA 3BBPA 3GAMA 5DBGA 2PA3A 3RT1A 3T3NA 4KOAA 4UOQA 1WMBA 1S2DA 3M2PA 4TPKA 4A8JC 4OFZA 3IVGA 3WQQA 1F0NA 2PJDA 1J22A 2AIRA 1Y6GA 1FJXA 4PYIA 4LOLA 4WZZA 3H65A 4EM6A 1R0XA 1W5BA 4KACA 5BSRA 1HUQA 2D06A 4J03A 4DCVA 1FCJA 2WHPB 4TTVA 3EXIA 5DN6D 2JRLA 4PCUA 1DTWB 1QWSA 3TOCA 1W6UA 4AF7A 4MR9A 8OHMA 1Y1PA 1YV9A 2HT1A 4OP1A 4UNIA 5ILQA 2AX3A 4ALMA 3MINA 2NZWA 4RF4A 5CEJA 4IV5A 3FYHA 3SQMA 2RHTA 2Q2WA 2ZB7A 4TLAA 2G0AA 2WHPA 4V03A 4O4LB 1NY5A 4RIHA 5I9TA 3UEOA 1DTWA 3DDUA 3BF7A 4GC9A 4XIYA 4BN5A 4RY0A 3BCRA 1O5OA 1WW2A 1TF5A 2DTEA 5DTQA 1HZZC 1SBNE 4PN7A 3K2IA 4AJEA 1PL7A 4LE1A 4O4LA 3SI7A 1QH8B 4MYDA 3ZQ6A 4XR9A 4ZQGA 4BE9A 2B94A 3D1VA 1BX1A 1ND5A 1NV8A 1ORVA 2ACWA 4KR0A 2FEWB 4JENA 5E38A 5BMVB 1BEZA 1CHDA 1QH8A 1WNTA 3WIDA 1EFDN 1NF3A 3ZDAA 4U2DA 1AOXA 2R4TA 1B93A 4C0QC 2IP2A 1F7UA 1DO8A 3ZE6A 1J23A 3O5AA 3ZX4A 3CMMA 4FWIB 4AF6A 1CEEA 1F4PA 1N0WA 2AC4A 4HMPA 3KOYA 4DARA 1EK1A 2FCAA 2O7RA 1ZJYA 2IC5A 2NMVA 1ISGA 2JGFA 3WTBA 1R2QA 1UC5B 5CU7A 4ZXPA 3QUTA 3OLXA 2WJVA 3O1JC 3HCOA 3QKSB 5TMBA 4C43A 4FOPA 5I7WA 1EK5A 3UJPA 1E2LA 2HREA 3UWDA 5F3DA 1AUOA 4A8HA 2J4CA 1KERA 3FI0A 4K9OA 4D1YA 5KINB 2IYYA 3KDAA 1QAQA 2H5EA 3SLRA 2EQAA 3BRCA 3PDUA 2PX5A 4QJ5A 1AUVA 3N59A 3KT3A 1E9VA 2AWOA 1UKYA 1GPNA 2E89A 2VHVA 1DFIA 1IZYA 3NWOA 4PWYA 2V5VA 3BXZA 2VEOA 1O97C 1XPJA 1VCNA 4LXXA 4CKBB 3IUQA 5I6DA 4PYNA 3RVRA 1K92A 2FR1A 5FNZA 2HJ9A 4MUYA 3U3XA 2H2HA 1HYHA 3D3KA 4KWIA 4FMBB 2HIHA 2PLRA 1N5OX 2C31A 1QFYA 1YSCA 3RQIA 4BJHB 4LXUA 1G7TA 3BEDA 3HA5A 4P8RA 3U48A 1NYTA 3IV6A 3AEQA 2CLMB 1BOOA 5CHYA 4ZT7A 4YJKA 2BFDB 1ATZA 2J6CA 5DOVA 2HIAA 4I4TB 1KO1A 4D45A 2UZ0A 221PA 4BNUA 5C5DA 5K8LA 3RRZA 2WJIA 4DV2B 2XE6A 3ZWWA 1QHXA 2EHJA 4YMVA 1IQRA 2BFDA 1CDZA 2OOKA 2G4VA 2WIAA 2WTXA 1NP6A 1SC1A 3CR7A 3H1BA 3MJSA 3N8HA 2HA0A 3PEVA 3BF8A 4MQFB 2PGOA 2NXJA 4R2IA 4O4JF 4XUDA 5CNIA 4TLEA 2BEJA 1TPZA 3UT6A 4AROA 1Z15A 1RBMA 4OMDA 1F4VA 1E1KA 3MD9A 3NALA 2G8NA 1DELA 4MQFA 1WXHA 4FDUA 5FOSA 3WRXC 2V65A 1DIRA 1R0KA 3CPSA 3DHEA 3N9IA 5FO1A 3O4FA 2OD9A 1FMCA 4KQGA 1GR0A 1DL5A 4IX9A 2WOOA 4UE6A 4IJ5A 3PD1A 5ICCA 3NVKI 1SQ0A 1ZNQO 2QU7A 1PLJA 4M1ZA 3KQMA 2X2FA 2NXCA 1G8KA 4MVJM 1D4AA 3UAGA 2ORED 3W04A 4KLNA 2NO0A 1YR6A 4HS9A 1R4NB 1UBSB 4BP9A 4KOEC 4E4RA 1E2BA 3ED1A 4EBBA 1AHIA 3GEMA 5JZ9A 2QSZA 3TB4A 4AYXA 5LLDA 1EVYA 1QYDA 2PWZA 3I8XA 5BR7A 1R4NA 1WG8A 3WIOA 3ZZNA 4Z9XA 4KX5A 4AS3A 4UVGA 1H9BA 3GUHA 1WU7A 1YZLA 2BZ1A 4HYQA 5EIOA 3DULA 4R8VA 1AB5A 2PS3A 4GT1A 1G6KA 4RXMA 5I9MA 5CA0A 1T9BA 2C3OA 2Z3ZA 3C3YA 1EESA 4G0ZA 4IHQA 2PSSA 4KIUA 1M74A 3EASA 1S4QA 1PJ3A 2VPIA 3CO5A 4P32A 1QIJA 3TW8B 4EY7A 3ZHBA 4AF8A 1XTVA 2EJVA 1J5PA 2PXHA 1JR3E 2TSYB 3DO5A 3NGXA 1ZUIA 4FJ2A 4LZOA 2XD9A 4YN3A 1RYDA 2A59A 3KEGA 2KBEA 1YFLA 3TW8A 2CZQA 2XUJA 3EX7C 3Q7PA 5BN5B 1Y34E 3IEXA 4J6FA 2L82A 2NSLA 3C7TA 3VPBA 4NCAA 5LXTF 2RI0A 3LKZA 5GADl 3QU2A 1FNNA 3SY8A 4Z3DA 4CTKA 4W5OA 3OJOA 2BPOA 5BN5A 2GDZA 2XB8A 3P4YA 3ETNA 2P65A 2ZS8A 3OUZA 2O2EA 3H84A 4ND6A 5JAQA 3KPYA 4TYPA 2BDEA 3W1VA 1N9ZA 1NJ2A 1Q21A 3E81A 2OBXA 1R12A 1IRIA 4NBKA 4G0WA 1CFJA 1U28A 2XUGA 3TRHA 1L5YA 2HLDD 3FWZA 3AO0B 4BVFA 1WQ1R 2C20A 3K32A 4YQZA 1M1YA 5LMCA 1SHTX 3C7DB 3MCVA 3VSBA 1Y3CE 4I7EA 4F2WA 3CRMA 2IYQA 2X3FA 4O1IA 2AW3A 2PX0A 1E3WA 3UJBA 4F46A 2EFHB 2PUJA 4UHKA 4DL9A 3K0BA 1AHHA 2IXFA 4V0ME 1JHPA 1BXGA 3DMTC 1VZ2A 3X44A 5EMMA 3TLAA 4QTUB 5KVAA 2QMZA 1YZVA 2P90A 4OU5A 5FOXA 5G3ZA 3R40A 2AEJA 1E2PA 2NOAA 4US1R 3WNQA 2XVZA 2RKOA 1Y1RA 3LY9A 5GONF 5JCOA 4BFCA 3SZ3A 3D4IA 3EXG1 3PICA 3TXAA 5EJIA 5AKYA 1Y89A 2IX3A 1RWVA 2O2IA 3FHLA 3K92A 1QB7A 1I8TA 5FT9A 1Z4KA 2FUG6 3CSDA 1XUOA 2GUWA 1HDOA 1H65A 2OSVA 2DF8A 4CR6A 2IYAA 2QTNA 3DZDA 4OEHA 2ZIGA 2Z5LA 4FLMA 4NMLA 4A03A 4DZTA 3L07A 4X6XA 2IOFA 1G8YA 3MMPA 3MT9A 3PYMA 2J3EA 2EJCA 4R1UA 4QJ3A 1H2AS 2FW6A 1KKLA 4NENB 3KOXA 4J7CA 2ZIAA 1E3JA 4Q9AA 4CTMA 3D7NA 1EUZA 3GDFA 2JGEA 4BVAA 3U7HB 3OT4A 4EZBA 5JSZB 1T9CA 2ZM6B 1CEYA 1WX1A 3Q7IA 1DI0A 4R01A 1F06A 4ESHA 3G8DA 2AW5A 1A9QA 1XDUA 1DKOA 2HSGA 3TOSA 4ZHQF 2QN7A 3O3CA 3PBKA 2HU7A 2JJMA 1L0BA 4IF4A 5K6AC 2BKVA 3H2BA 4AJ4A 1ZOLA 1AV7A 3B6IA 3TE7A 2ZSDA 1OBFO 4IVPA 4C87A 4CL8A 3RV4A 1RZ3A 2HN9A 5BNWA 1YZTA 2R9VA 3UG6A 1FX0B 3ZHCA 2QBYB 4EHLA 1V0JA 1ZMXA 1BN6A 2ZCJA 1KHHA 3UGQA 1GDDA 1FTGA 2ZB2A 3K09A 3KR0A 4EDHA 4HRXA 2F6RA 3I4CA 4LHVA 2BVNA 3VMFA 2QBYA 2AKAB 1FX0A 3AV3A 5EP4A 2Y1WA 1MIHA 3M7IA 4UE3S 3TIIA 5CFPA 1K7SN 2R62A 4PYOA 3E05A 1BX0A 1N3BA 1M7BA 1Z2DA 2F4VB 1ILWA 1WAMA 1EP9A 3V7YA 3M4JA 1UMDB 1W34A 1J97A 1I7LA 1NI4B 3JVUA 3PJEA 5AI6A 4O4IF 4K6GA 3LCJA 2H48A 4ND2A 4N39A 4FDTA 1KO4A 1W76A 1CP2A 2WVHA 2X41A 3E2MA 3I2IA 5DTEA 3B1JA 4P3NA 4EJ6A 1NI4A 1V7QA 3OE1A 1L7XA 1P33A 1SBYA 3H13A 3RVOA 1ODJA 3GF4A 1XYYA 2VRCD 1E5XA 4PBTA 3EMVA 3GLIB 3R8XA 1SHJA 3K0AB 4JKIA 1ODTC 2WSSA 1HE2A 3GLIA 4P36A 4X60A 3C5CA 2AJDA 4UM9D 4RTOA 2REQB 3VNVA 1I2ZA 3K0AA 1FQOA 4Z2AA 1KI7A 3DB2A 3WI7A 1O0SA 5FNVF 4LCEA 4D4JA 2WFAA 4TYQA 4E30A 2QX7A 4REQA 3ADBA 1IVNA 4A6PA 4B6GA 1KMHB 4UARA 3VR5D 3IR5A 3SSAA 1VB3A 5IYZB 3JAWB 2SECE 4I55F 2P2YA 1JH9A 2C61A 4HQ6A 5FOVA 1UOEA 1H2XA 3AR7A 3OA2A 4WX2B 5CB6A 3ASZA 1KMHA 4IOLA 4L4RA 4PLVA 3PFFA 4RKEA 4XM1A 1JS1X 3S27A 5EE3A 5KNBD 1ZIPA 1BW9A 4GLLA 5IYZA 1DEXA 2O1EA 3JAWA 3L6RA 3DE4X 3MUNA 1RHJA 2J41A 4ZVSA 1Q50A 4A73A 3S5UA 4I3FA 3F1KA 4C4PA 3VGPA 4EA7A 5JI3E 4FWTA 2DKFA 1LDYA 2UDPA 2IK8A 3FE2A 3VR2A 3Q8LA 3CCBA 3EXHC 2PZEA 3CRVA 3EG9B 2UVQA 3LS2A 3LFTA 2OK7A 3ZGNA 2RK6A 2HUNA 2IXTA 5EJGA 1N6LA 2BJWA 1YQWA 2RDMA 1OLUB 2Q49A 3BGOS 3BZUA 3P20A 4I08A 4R16A 2VRBA 2OY0A 2VO1A 4RHXA 4XJXA 3QE2A 5B37A 3ICVA 3TOVA 3FSEA 2YOGA 1H3FA 3IUYA 1UJ5A 1ZRHA 2C78A 4KBFA 4B4WA 3DE0X 1DQRA 3UUEA 4E2ZA 4DMRA 4UXHA 1ZGJA 3QMPA 4PHCA 5C3MA 1Q7BA 1QGOA 1W9MA 1FYDA 2MWMA 3LUGA 3REOA 1P73A 2OVBA 3AR6A 3H9CA 1BU8A 4LGVA 3DHVA 3FSRA 2GGSA 4YALA 5F77A 2CLOB 1EFUA 3TAUA 1DEHA 3B2EA 3UJNA 3KBOA 1DJNA 3K9WA 4IDEA 1J2EA 1KDTA 1W36B 2JLVA 2R7MA 3VM6A 2VPTA 1WXIA 5JVDF 5CCXA 1S1CA 5KQMA 2UXBB 4HWGA 1W96A 2DRIA 3WGTA 1PV4A 1U3DA 2JHGA 3U37A 4BN0A 1OU4A 2EP7A 3BD7A 3C3PA 4KMOA 2O5EA 1XF1A 5EINA 4GOXA 1QIKA 3QV1A 1K8QA 1VMEA 1ZN9A 5ENDA 1SG6A 4N6NA 3ZWMA 1II0A 3HDGA 5KB3A 1JKIA 3SC3A 3T5PA 4JQZA 2XNHA 4YS6A 4MUNA 4QRIA 4G8CA 4I3GA 5BNZA 2LDBA 4HJXA 4IO1A 5KQPA 1FXWF 3C98A 3IAHA 4R98A 4D82A 3NBXX 4EUKA 3LGAA 1OFUX 3ZGYA 3PE6A 2XB9A 4KQ2A 4KI7A 2XUOA 1LFDB 4TMKA 1R6UA 5C1DA 3L0OA 1GFSA 4G0VA 2HTFA 4EI2A 4C3VA 3CUSA 3S81A 4CFSA 4B4UA 2PR7A 3SYTA 2FPOA 2OAQ1 2QUHA 4PLYA 1NY6A 3T9AA 4HVTA 2HJGA 5FWAA 2FMFA 4OXRA 2HB6A 1Z0KA 2V58A 2B61A 4HFMA 5ALKA 1NXVA 4NI5A 3WSWA 4RLHA 2JLUA 5D8DA 1NE2A 2VUSA 3BK1A 4XVCA 4YRRA 4TV9B 1DV2A 4KVAA 2AQHA 4ER3A 5JJBA 4K05A 4Q4LA 2QVGA 1KI4A 2J33A 1QH0A 1JXAA 3G9TA 4H3VA 1FRFS 3JWPA 5EE1A 1EEXB 4KXXA 2NIPA 4M2LA 5LP6C 2GI4A 2AG5A 4JC5A 1U31A 4H4EA 4F97A 4BGEA 5FEUA 1OH8A 2VQDA 3DDNA 1ZQ1A 5JNWA 3WICA 2XJ9A 4ZI5A 1GQRA 4FBGA 4BU1A 1PJCA 3UK2A 3DEAA 2VQSA 1KFJB 3ISJA 4DUGA 2GUGA 2Q0QA 1KZ6A 1M2HA 3LMKA 4XUCA 5JVDB 2F1RA 4INJA 2IUSA 2AV6A 1Y3AA 3O8BA 2WF9A 4JEIA 5F5LA 4WNAB 5FR1A 2I3GA 3ZOKA 3ZI7A 5AR1A 4CG0A 2H0AA 4DMKA 5AUPB 1WKCA 4RUKA 4TGLA 3HR8A 1CC1S 1NR5A 4UZEA 4R3NA 3RV3A 5JVDA 1IMOA 1SU6A 1BX3A 2QMEA 5F9FA 5IDYA 2PZBA 4GSYA 4I6JA 1INLA 1UK6A 1SUEA 3IEIA 4YLEA 2P9CA 4TT3A 3HFRA 3R5SA 3O73A 1E6MA 2RHCA 2VPZA 1FDWA 2JI7A 2M2IA 3D3NA 3L0IB 3ODPA 1M2FA 3I32A 1HFEL 3BGVA 4DM4A 3HVHA 2QMHA 3DYVA 3A4IA 4BBJA 2Q0SA 3UCXA 4ETNA 4YJ2A 2O0KA 3B78A 3SF8B 1H9CA 4TS1A 1IY0A 2BEKA 2PS9A 5FTMA 2XNDA 1VHJA 4UUBA 2XPCA 4EVQA 3WJAA 3G2HA 2K2WA 3FPBA 3JQDA 5F73A 1Z13A 4EHJA 3E8SA 3SF8A 1ZR2A 2G1UA 2OFWA 1FVHA 1GM5A 1UL1X 3ROKA 1G17A 2CZCA 3PHLA 4R1SA 4XR4A 5T4EA 4ZI3A 5JCJD 3DOHA 1P8JA 2IPMA 3LYHA 4WLOA 3ZQUA 3BSYA 3H18A 4MYHA 3B1KA 1DC3A 3R0JA 3P0HA 1F60A 4N5LA 4KQEA 4D43A 2HXYA 4XSHA 4BNFA 2JHFA 3LC7O 3T3GA 1NU6A 1FFHA 4MWCA 3I4FA 1ZXBA 1J8VA 2BEVA 1N1DA 5DYIA 4AJNA 4B3FX 2YWCA 4C2AA 4AZTA 3RSFA 1B00A 1GO2A 1EM8A 2H4YA 5HM6A 2AZDA 1MR3F 1T2VA 3CRNA 3R5HA 4J0DA 5BXYA 3O1IC 3A9WA 1XCPA 1N9KA 1G3RA 4JOBA 2GBFA 3RTBA 3OAAA 3DA8A 5KKAA 5AW5A 1HLDA 2BZGA 1VZ3A 5E7JA 4DHWA 3H4TA 3ZN2A 1O4WA 1TA0A 4M4SA 3UF0A 3DLBA 2OAEA 2YKGA 3L8GA 2WT9A 3GX1A 2H31A 1PSDA 2RJOA 2XOKA 3KPUA 4WFIA 3EIOA 4UHDA 3NDJA 3HPQA 2YWXA 3T9DA 3W5IA 1ID8A 4FB5A 3A25A 4S1OA 2YV5A 2JI8A 4QUHA 1NX9A 3KXDA 3SZUA 4WA8A 4GPAA 2WQZA 2DM6A 3DEYX 4FZRA 5IJAA 1ZH4A 3KZVA 1EXVA 3L7CA 5BWNA 1ZJ5A 5COAA 1W0JA 1E4EB 3PDCA 1RHMA 3QVMA 4EYGA 3QFFA 3UIEA 2BF4A 1BRMA 4HH0A 2OYRA 1YA8A 4EFKA 3TKLA 1HH4A 1A9TA 1SCDA 4HG2A 1HT0A 1X7XB 1TNDA 3MMNA 4TKVB 3TLKA 4QHSA 5LZ2A 5FUXA 3HY6A 3K05A 1V7ZA 2BT4A 1X7XA 2F4NA 2IYSA 2OV2A 3JRXA 3KVRA 4GMDA 1UXGA 4IJWA 1M6YA 5ER9A 4A8PA 4JYBA 2OCKA 1NATA 4I81A 5TNXA 4TKVA 4Q1CA 3OHPA 4BPRA 1Y8ZA 3GNQA 3P9ZA 3ZXYA 1QKKA 5HTKA 1LPNA 4IRMA 3REGA 4YEDA 1Z37A 4H3KB 3GQBA 1UJMA 1Z0ZA 4RHEA 2EG5A 3INGA 1LJ8A 1PYDA 1SQGA 2GA8A 1WD7A 3HDJA 1JDPA 2BBOA 4G0YA 5D5HA 1I30A 1YASA 1XALA 3O38A 4DPLA 4V0NA 1JF8A 3PQ7A 3QELB 4CBVA 3KJEA 1ZNZA 1T9ZA 2RGYA 1NJFA 4G24A 1ISMA 2O2GA 3LC0A 4IDOA 2VQFB 4CF4A 1NVDA 5I9SA 4Q1FA 1L5NA 4P82A 3DXYA 2H8KA 3E7PA 4B47A 1LJUA 5AM1A 1ZD3A 1RZRD 3PL1A 4KXMA 5CEEA 1R0RE 1M6NA 4DNQA 1U90A 1SOVA 3V1LA 3FKSA 4GVLA 4EKDA 5JAMA 1EX1A 2ONKA 4WACA 2CVQA 2C83A 4G5YA 1UWKA 2ZJAA 3MF4A 4REOA 3W7VA 5LUAA 3CLTC 4TV8F 4DV7B 5KPJA 5FLEX 4GU5A 4J0JA 2XCSB 3VC2A 4HD8A 2ZTHA 1NZJA 3QBJA 1K5HA 1RRMA 2M6KA 1W4ZA 1Y1QA 3OCYA 2B98A 4R69A 4DUZB 1OWLA 2WYWA 4H4CA 4HQFA 1M8KA 3WKEA 1SCUB 1ZA1A 2FDRA 4UMEA 5KNCD 3E7XA 1UBUS 2JFVA 5LQKA 2Q8QA 3AEXA 1QIGA 1N5KA 1QFZA 1V1RB 2B9EA 3BSFA 3HEBA 4GM1A 4HF7A 1VPVA 2G17A 2FETA 1TLLA 4L72A 3L7BA 1SCUA 2JJ1D 2W4QA 3G8CA 1F8FA 4F3NA 1AC5A 5T7BA 1V37A 3QLUC 3F47A 5AKGA 1PQUA 2BELA 3HCBA 3T35A 3VYVA 5I7HA 2OB2A 3NO4A 1E3EA 3QG1A 2B1RA 5GQSA 4KYTA 3R7SA 1TTHA 5FAKA 5HUHA 4DV5B 3ZK9A 2YXEA 3NYIA 3Q11A 1CUVA 1LVGA 3C7CB 1P0PA 3NWBA 4QBGB 3T9FA 2H2IA 1VSUA 4YRLA 1Z39A 2H0RA 2NT4A 2PYDA 2W6MA 3IAEA 2P67A 3WO0A 1KDPA 2C5BA 4FHCA 1CJKC 1FSGA 2XA9A 4E09A 3HUDA 4RTSA 3QU4A 2QM7A 1D4FA 3S40A 3IVMA 4YQYA 2XAAA 2QKYA 5EUCA 2GZAA 4XQ0A 4Y2HA 4XSGA 5MFPA 2RSLA 3P0EA 1F12A 2DFPA 4L28A 3FVVA 3MQFA 3IEPA 3T7JA 1ATIA 1TJ5A 2FR8A 2IEGA 3VI3B 3H4MA 5FRDA 2VBIA 3G68A 4NU5A 5F1PA 5H9WA 4EG4A 1QHFA 1NQTA 3BJEA 1NAIA 1YZQA 3NQ41 3QEOA 4YA6A 3ZGVA 1RLOA 4MK4A 2AB0A 3QUAA 4OG2A 3SE7A 1LLCA 4FYIA 2ETXA 2PZAA 2JAOA 3VHLB 1XD9A 4FHGA 2P0EA 3WLRA 2OKGA 4GICA 2QVBA 3RIHA 2C5SA 4FM9A 4B3BA 4YRCA 1ZL0A 1Z62A 1ECJA 1GFZA 2Q5LA 1CFZA 3NDRA 1ZK0A 4B34A 5UKDA 3FCCA 3DEKA 3ND7A 5ALRA 2FK7A 2D3TA 2PRZA 3H2IA 3I8SA 4EJSB 3IRVA 1RWNA 3I04M 4G81A 1G64A 4L8LA 3VI4B 2O8BB 4IRUB 4J07A 1VJ0A 2EERA 3VRHA 4DREA 3L49A 4RVFA 1NN3A 2ZSAA 3PQ5A 5EC8A 4A15A 3HN6A 4WLUA 5D3QA 3GRFA 1OI7A 4FILA 4GLBA 4I50F 4RMJA 3ZLUA 1L2TA 3F6YA 1R9MA 3PNOA 2KQUA 2PLNA 5TRTA 3GT4A 2WNSA 1XZEA 1R6DA 3HCDA 4XPIB 5IAAA 1G0OA 3RYTC 2VHYA 3ENVA 4LDPA 4PYMA 1WEHA 5ES3A 5E6UB 3RJ5A 1KVUA 4D9KA 4E0BA 1EGVB 2H57A 1U81A 1RRKA 4MV9A 2ZUDA 3B36A 4RY2A 1REQA 1XDDA 5CIQA 3W9BA 1XNRB 1U3FA 5AJXA 2CHVA 1AKUA 2IL1A 3G02A 1X87A 3P19A 2Q46A 3GELA 3TAHA 3EQZA 3CVJA 5LKRA 2QL6A 1JR6A 1ZK4A 3GEHA 5CLLA 3TEMA 3RJ9A 2C2YA 1MT3A 1XQYA 3BZWA 3CW9A 4W9MC 4PFJA 1BH6A 2GF0A 3AF5A 2WV9A 3NHPA 1PWXA 2DT8A 2VAMA 4NOJA 3PR2B 4PZEA 3NV7A 2OESA 3PXXA 5G53C 3SQLA 5BSWA 4P80A 3ONWA 1H0RA 1PV1A 1U2GA 2HJRA 2XNCA 4KSYA 4PAMA 4ADSG 4YUXA 3S1SA 1IN5A 2X4LA 4INPA 4KXYA 4BQPA 3GD7A 4LY6A 4CMHA 3AUSA 4KPGA 1H6CA 2NAFA 2HWXA 2H18A 3AJ8A 3HJGA 2J48A 2EVWX 1BKDR 4JIGA 5CB0A 1XOIA 4MQ6A 1VSBA 4WOBA 5K0LA 3AERB 2IWRA 2GVNA 1WABA 4FQ8A 5CJJA 1E2DA 3UCFA 3D6HA 2JFWA 4E7PA 4TMVA 2FPWA 4X85A 1NVWQ 1SY7A 2QY6A 2OCGA 1M1NB 4UFOA 2H4XA 5ERYA 3AF1A 4DA9A 4RMGA 3HEAA 2RKBA 3Q4GA 1A88A 3Q7EA 5ECGC 5KYGA 1FFWA 4WSOA 1KH1A 1U0GA 3ABRB 1WUHS 3KJNA 5JQGF 2GVDC 3EIFA 5JMTA 3OQBA 3HDQA 1PZNA 3ZDYB 2ECQA 1IBMB 3G6KA 4PSCA 2ZJ3A 2C84A 3DYIA 2EEZA 4FFLA 4AIRA 3PC2A 3TUJC 1SXJB 3OLQA 4EY5A 4PPFA 3MMXA 3LUCA 4D3YA 3K70B 3Q72A 5ADWA 3NTLA 3OQ6A 5K3SA 4GSLA 4KFRA 3T3HA 4OSEA 1NVEA 5GGXA 3NBMA 4P4GA 1M5TA 4BCBA 3X3HA 1SXJA 1ECCA 1UBTS 3PPIA 4Q21A 4BLWA 3HK2A 1NW3A 3EOBI 2P3QA 1OXUA 1PJBA 3KTAB 5FBLB 4GOJA 3U1VA 3OTHA 1RLTA 3E22A 3WLEA 1E2QA 5CH5A 3MB8A 5F35A 4Z4CA 2FGKA 5FDFA 1I94B 5FTWA 4A91A 1XAJA 4NLLA 2W6QA 3ZYZA 1YBFA 2H29A 4K2HA 1DRJA 3KTAA 4V1CA 2IZ7A 4AXBA 2YJTD 3K5PA 3O4RA 4NBSA 1HYBA 2H51A 3OCZA 3UK7A 2H1LA 1GP2A 2R3SA 4HXEB 4PQYA 2PL3A 1DAKA 1DC5A 2X9LA 4PG7A 1JJ7A 3W2GA 2QRVB 2V0NA 3KPJA 1EVQA 2AMFA 2H1IA 2PSHA 2JJ2A 3BL8A 3NKVA 4OK6A 4OXYA 5ES4B 2LIVA 1JHVA 4YQEA 2NU9A 4C4XA 3LXUX 1CZOA 2AUTA 2Z9CA 2QRVA 3KHSA 1QO0D 3LZ6A 2MSNA 4FZVA 1OX4B 4TTTS 3FYCA 4J9UE 3EDCA 4AI6A 1Z0SA 2KLHA 2VYCA 4NS1A 4JZKA 2AZ4A 2IJGX 1JSXA 4BO6A 2XUIA 2PKQO 3FLBA 5JYDA 1OX4A 1S7CA 5EGSA 5DYWA 5TQ2B 2JASA 1B6SA 4JWKA 1C9MA 3RSOA 3TRIA 5FWYB 4C5AA 3EK2A 5A4MS 3HBMA 5EMNA 4NOKA 1OMOA 2PTHA 4KQ6A 4P34A 3ANSA 1J24A 1JHZA 4WNYA 4ABYA 3L0YA 5CCEA 4K9QA 5TQ2A 3PYLA 5C8YB 2MMCA 4BNKA 5FWYA 4FE4A 4LFCB 4B1FA 1ONOA 4ND3A 4IMJB 1LF0A 4YMWA 2J6HA 3MGGA 3OESA 4IFBA 1CWUA 3W5SA 4UHEA 5C8YA 1U98A 1PR3A 4UD2A 3QNMA 3ZLTA 3LTNC 1SKAA 1FP4B 1USVA 3PGLA 1PN3A 5IBCA 5JXGA 1E0DA 3UM9A 4G5OA 4IDPA 3KT6A 5IZCA 1G41A 3CRW1 3DQZA 3WMFA 2DFNA 2DFTA 2P8SA 1HF3A 2ZYRA 4AP9A 3OM8A 1QMPA 1TEZA 1NNI1 2WHEA 2W2VA 3AU9A 4D9GA 1N8KA 1YOVB 2OK8A 4PFSA 2QDKA 2R6DA 2FLVA 1OZ0A 4P3YA 4KE9A 4RLQA 2VHZA 2KHZA 2EP5A 3EEBA 3TPFA 5H02A 4F6RB 1XVVA 1YOVA 5GV7A 4DM7A 2DWUA 1FS5A 5JG7A 3O83A 1JDNA 2CLDX 4M9UA 3TW0A 1X9HA 3B9BA 4D57A 3DAOA 3ESZA 3MZ0A 3TL3A 4RCVA 5HRUA 1E6EA 2IIBA 4TYMA 4TTIA 2H5IA 4L8YA 3WOVA 3OQIA 3CR8A 1EU1A 5BN1A 4COKA 3K9NA 3KQVA 1MC8A 2RG7A 3B3QA 3EC2A 3GP5A 1GTG1 4JP3A 2V54A 5ALNA 2Z3WA 3I2JA 2I1LA 3GJ7A 1OPXA 1G55A 4ZVRA 4D0GA 1YO6A 4XAQA 1V7PC 2G7MC 4WKOA 2P2SA 3G88A 2I8LA 3GLHE 4DNOA 3VBCA 4DLWA 1FC0A 4K6KA 1UAYA 4YONB 2J09A 3U9SA 2AG8A 3B3GA 2ASVA 1D1TA 4LE2A 3ACCA 1Q20A 4B3JA 3GRKA 1I0LA 2HLNA 4LJ5A 3NXKA 2RGXA 2VUHB 5JTTA 3C3AA 4CT0A 1CEQA 2PXXA 1QHSA 3NZEA 1YUMA 1VSTA 1SZCA 1TI7A 3VU9B 4YCLA 4WJKB 2WUFA 2QLBA 3NNSA 4RZIA 1D04A 3SMQA 4EG6A 1U8AA 5F7JA 4F72A 1KFKB 5HNKA 1TXGA 1U28C 4UQLA 3QKWA 2D6FA 2RC6A 1M75A 1XLUA 1O4VA 4F60A 4A8TA 3ZWYA 1L7AA 1WSBA 3RM3A 3VU9A 4GH5A 3RFTA 2CFTA 4LGMA 4N76A 3ZW8A 3SN6A 3OICA 5G2OA 2FN8A 5DFAA 2G06A 3WADA 3NRJA 3WKBA 4MR8A 4YR9A 3UN1A 4RENA 2QXYA 1RQRA 1XTPA 4GHWA 1ODSA 3RS3A 1KGDA 2GETA 3KYCA 1XXHB 2AOTA 2NXWA 3GA7A 1AGNA 5DHAA 3PTAA 3LXXA 5EFOA 1ICEA 4QM7A 1RWBA 4DCTA 4CCSA 1C7RA 3QEMA 2XY4A 1L5FA 1KDOA 2IIQA 3EF3A 4G86A 4I5DA 4MW4A 1EK6A 1XXHA 1KDRA 3ZEIA 4ENWA 5FI5A 4QGAA 5JSYA 4B76A 4BRSA 1XQWA 2BI4A 1H6BA 1ULUA 1HV8A 1HYEA 5D6NA 4OQDA 3TKYA 1QDUA 4ZK2A 5IH3A 2W2XA 1XDWA 1E4VA 4K2AA 3WK7A 1R3UA 2BMAA 3ZHXA 1M2KA 4BAGA 4HRYA 3QFRA 5DX8A 4CQNA 3O31A 2AT1A 1J0BA 1OWPA 2QXTA 4XD7A 2VA8A 3SS7X 1NTRA 2MMGA 4OLHA 2OMEA 5AVYA 3IQFA 3FTDA 1F6BA 2VTEA 3BX1A 4K6OA 1QFJA 4R5HA 4W7SA 2AYYA 3D5EA 2HDWA 1FDUA 2GERA 2G88A 4M38A 1TUBB 3ZE8A 3FMFA 4KAJA 1A9RA 1XAHA 2VK1A 1J0XO 2P3OA 5DX0A 1U0SY 4C5CA 3MS4A 2IWHA 1X6VA 2QLNA 4RFSA 1D7AA 1UQTA 5BSMA 3ASUA 3GGOA 4Z0PA 1TUBA 3UK1A 3NM6B 3AK4A 1SQSA 1NPYA 3JQ7B 1LNSA 3IQIX 3ZTYA 3KSMA 3U4DA 1X38A 3WQHA 2F2TA 2AD5A 2FSVA 3GUCA 2Q5IA 3D2LA 4GQAA 2RCNA 4H7KA 2IUTA 3HU5A 4PNPA 3JQ7A 1LQ2A 4I99A 2YIVX 4JLDA 5DOZA 4G36A 4G4JA 3QHAA 4I1RA 3WBBA 4C9BA 1N6OA 1BG6A 3GRAA 3T9BA 4A3SA 3UAOA 4I3HA 5GVRA 2ZIXB 1B41A 1XZBA 2P4SA 3L79A 4LOJA 1H0SA 1RQNA 1KEEB 1T0PA 3K0CC 4MQ5A 3AUUA 3OP4A 2QSUA 4AY4A 5IZ4A 2ERYA 1UQUA 4PZDA 4JASB 2X0DA 4D80A 2ZIXA 4EW1A 1EP1B 1KEEA 3ZIUA 4JLWA 4QLBA 3ZE1B 3VBEA 4CM1A 3AZOA 1C2YA 2Q0HA 4JKOA 2VF5X 2R00C 3A6GA 3Q10A 5BWMA 1VE9A 2WIKA 3B1FA 1IY2A 1ZSYA 1NVKA 3ZNNA 2C4HA 1UPBA 4YDRA 1I5EA 1GQ2A 1IIBA 1QYCA 2YNMA 4A1FA 3BTUA 5A4KA 3BH6A 1EVZA 3HZRA 1SVSA 4H6VA 5DYNA 5EQTA 3LDGA 1PK9A 4BFUA 1BCRB 3T6KA 1IAQA 2JLSA 4U2FA 4EHAA 5EHQA 5FWXA 4YIHA 2JHCA 6PFKA 3B48A 2Z8YA 4BNVA 3G85A 5B3JC 2B36A 3N8KA 3PR1A 4RIEA 4H1TA 4EF6A 1BCRA 1GZDA 1HEYA 4FFPA 5EGNA 1AQJA 1YK1A 3MTJA 3DSRA 3PLAE 1T9GR 4NEGA 1S02A 1Z12A 2W8BB 5LZ5A 4HZUB 2CSUA 1G3MA 2ZT7A 2VF4X 2CZGA 2CJFA 2NU8A 3I52A 1L7EA 1W5TA 2FWPA 2FZKA 3H42B 1WZCA 4MEAA 5IC6A 2W8BA 1IL0A 2BMJA 1PP4A 2GJKA 4HZUA 4PO8A 4Q47A 2ZP1A 2EL7A 1F7VA 1SH7A 2HNBA 1TEVA 4YP9A 3W3ZB 1Y4UA 1K7CA 2OFOA 3LDAA 2BGUA 1CUXA 2VHEA 5H68A 5HJ2A 2JEOA 4XM2A 2FGJA 3AV0B 4JODA 2JIRA 3COVA 1KDVA 4MLZA 2CYAA 4QHYA 1OWOA 2FHSA 2XVXA