5I4CA

Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nonphosphorylated receiver domain of the stress response regulator RcsB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gene regulation
molecule keywords Transcriptional regulatory protein RcsB
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5i4cA00
2MSLA 5BRJA 1USKA 1P6QA 4ZMRA 3SNKA 3OO1A 1JYEA 1Z17A 3H75A 3G85A 1SRRA 3N0RA 1NXVA 3ROFA 3QX9A 4G97A 1DP4A 4RXTA 5TPWA 3RH0A 4MLCA 1T34A 1ZY2A 2NT3A 3EQZA 3DGEC 1NATA 4MQEA 1QQAA 2HQRA 3H5LA 5JS2A 4Q6WA 4YP9A 2RDMA 4EUKA 2X7XA 5JNWA 1QMPA 2CD7A 2PLNA 1K68A 2YHBA 3N0XA 4Y9TA 3R0JA 1BVHA 3RVPA 4N0PA 3CG0A 4G0ZA 4MR8A 3FMVA 4WT7A 3JVDA 2MYTA 1KRWA 1PNTA 1YK1A 3Q7SA 3ILYA 2JVIA 3HDGA 4F3TA 1U8TA 3GRCA 4MS1B 4Z9BA 4W5NA 2IPLA 1MAVA 3RVRA 2JBAB 4ETNA 1JL3A 1TM2A 3MIZA 2FSPA 2MSWA 3K4HA 4W5RA 1JWLA 4Z4IA 4UHKA 5DTEA 5T7BA 5JNSA 3DBIA 2FEKA 4QICA 1FFGA 3EGCA 2H0AA 3LUFA 2LBPA 1A0OA 4TLMB 3SM9A 4EYGA 2A9PA 2FVYA 2CHEA 3O2QB 5KQGA 1U2PA 4O5AA 1LBIA 4O1IA 4W5OA 2M98A 2TMYA 3LUHA 3OM0A 5HQJA 4ZMSA 1CEYA 5EWMA 1NXXA 3CU5A 4ETMA 1VRVA 3HZHA 4Q7EA 1TVMA 1IIBA 4PICA 1DCKA 1RXIA 3GYBA 3LUKA 1A2OA 1USIA 4B09A 3LTEA 4MRMB 1ZH4A 4D74A 3Q7RA 4EVRA 2PE5A 4KQ9A 3KSMA 4KREA 1C4WA 2E4ZA 2MYPA 4RKRA 3TB6A 2FKAA 1S8NA 4MS4B 1YS7A 4KZKA 3NNNA 4Q6BA 3OO0A 1A04A 3DGFC 3NNSA 2VUIB 3CNBA 3A0RB 2YHAA 4XXHA 1W9HA 3VNAA 1APBA 4D6XA 3KYJB 3QELB 1ZH2A 1Z2EA 1DRJA 2KYRA 1Z26A 2E4UA 3LKBA 6CHYA 1D1QA 1CHNA 4NQRA 4TN5A 1EHCA 3D02A 2AYXA 2PMCA 2P9HA 3GWGA 1JDNA 4IF4A 5HKOA 3KJXA 4KPYA 3OLWA 1SD5A 4EY3A 4FE4A 3RVLA 2QXYA 3LUAA 1DJMA 4W5TA 4F06A 4Z4FA 2L18A 3OQOA 2E4XA 4ETIA 3P9YA 5BR1A 1ZHHA 1MB3A 2B1JA 3I42A 1JBEA 3IDOA 3RVNA 4QPJC 4RKQA 1BDHA 3IPAA 1BDJA 4WUTA 4NV3A 1ZAYA 3IP5A 1I3CA 2FEPA 3N6VA 4JA2A 1JDPA 1XWWA 1JFVA 4PZ0A 2HQOA 2LIVA 1E6MA 1URPA 4MS4A 4RDCA 4MQEB 5JS1A 4LE2A 3F73A 3NHZA 4LZLA 4HNSA 1Z2DA 4EYOA 3QEKA 2L2QA 2PAFA 4GNRA 4MPTA 1OXBB 4HNRA 1NY5A 3QEMA 1DG9A 3C97A 3KCNA 4L4UA 3UK0A 1DCMA 4IGAA 3T8YA 1GLGA 4RV5A 4YRZA 5DLEA 2IPNA 3HO1A 4H3HB 4RS3A 1GUBA 4UHJA 3ROTA 4KFCA 3HK2A 5KI6A 5D2CA 2MYNA 4RK6A 1QKKA 2M1ZA 2N9UA 3G1WA 5KWSA 3KKEA 4S05A 3KG2A 2LP4Y 1L5ZA 2NZUG 3IP9A 3LUJA 3OQNA 4RK1A 4RSMA 2WRZA 2HPHA 5E3JA 1JFTA 1QP4A 4JASB 4EVSA 1RXEA 4M88A 1JH9A 5TPZD 3HV2A 4RZSA 1YMUA 4MR9A 5FWXA 1EFAA 2W42A 4MS1A 4MR8B 1PNRA 3C3WA 3KLOA 4JOQA 4L85A 3RVQA 1GCGA 3Q41A 1ZGGA 3OMXA 1FQWA 2QU7A 3RVOA 2FMHA 4RU1A 5BQ3A 2IDMA 5DGCA 3GBPA 1FFWA 1JFSA 4PEVA 2GBPA 4Z99A 1VLZA 3QLUA 5TPWB 1UDRA 3O2JA 1RZRD 1EAYA 1DBWA 2JVJA 4DQDA 1KGSA 1YS6A 3EDCA 2JB9A 3BBLA 1FFSA 4E7PA 3B2NA 1R8JA 2NT4A 2QSJA 2A9RA 1DC8A 3C6QA 5KC8A 1M5TA 3CZ5A 1PEAA 2FN9A 4MAAA 3NNDA 5EWMB 1QP0A 3KS9A 1FSPA 4FB4A 5IUNC 2JCGA 3UKJA 1QO0D 3KYIB 3SQNA 3MA0A 3LUGA 2IKSA 1OXKB 3CKMA 1TMYA 4TMYA 1LK0A 4KMRA 3GT7A 2PUGA 3CZCA 4G0YA 3FGZA 3MQ4A 1K66A 4ZJPA 2FN8A 5TQ0A 4F12A 5ED4A 5KQMA 1JF8A 1YMVA 2V0NA 5TQ0B 1NXSA 2WWVD 1E6KA 4XLTA 5CNMA 3RVMA 2OQRA 2GI4A 5IEJA 1XHFA 3H5WA 1JYFA 3SAJA 2Q5CA 2PJUA 4Z4GA 3KHTA 3OLXA 3L6UA 1GCAA 3I09A 3OLVA 4MS3A 2QR3A 5EWLA 1ZESA 5JNRA 3MM4A 5TE9A 5T3YA 4KNYA 2L19A 3RVJA 3HUTA 4XARA 5B3JC 5I4CA 2QW1A 4NCAA 1Z25A 2H3HA 1MVOA 4PYRA 2RJNA 4JP1A 2FMIA 4LDAA 3I5AA 3KLNA 3CHYA 1ISSA 1MIHA 3O1IC 1BA2A 3O2SB 4G0XA 2GKGA 4MGEA 2XDYA 3EJWA 4OLBA 4LDZA 2PL1A 1PEYA 4KQCA 3E61A 2ZAYA 1U04A 3F6PA 1TJYA 3CTPA 3K9CA 4MQFB 4JB0A 4RXUA 1P6UA 5HSGA 1U0SY 3S99A 3O1JC 3Q9SA 4EYKA 3JY6A 5PNTA 1VKRA 4JB2A 1M2FA 3JS5A 1W25A 4F8JA 4MS3B 3DLBA 3QLVA 3EQ2A 3Q15C 4N47A 1EWVA 2PUAA 4RY8A 5FWYB 4OG2A 1RNLA 4FE7A 3VNBA 4O1HA 5FWXB 5JNTA 2HQBA 2WJWA 4H60A 1C0EA 3JVIA 3CLKA 3OLZA 4XFKA 3L49A 5GOTA 5KQLA 4YCSA 1USGA 2IPAB 3LFTA 4S04A 1Z15A 4IRXA 2AYZA 1YK0A 2FEWB 2JVKA 4XASA 3KTOA 3FFWA 2FW0A 1DRKA 2MSKA 7ABPA 4OLAA 1D1PA 3MMNA 5CNIA 3FDFA 4KVFA 4LE1A 1NXPA 4CBVA 2B4AA 3M9XA 4WWHA 4G0PA 4LE0A 3H6HA 1B00A 3EULA 3HVRA 2P4UA 2R48A 3LUDA 4RK0A 3HCWA 3O75A 1P8AA 3HDVA 3QELA 2WJAA 2FXIA 4HNQA 5FBHA 3N75A 4N0QA 4OATA 2FQXA 4KK4A 2I6FA 4LX8A 2PUFA 4NCBA 4ZPJA 3EAFA 3QLTA 4RK4A 5KQPA 1Y1LA 2LPMA 2FTKE 2PUDA 5IUKC 2WB4A 3BRQA 4WXMA 5TQ2A 3TO5A 2PUBA 1NXWA 3A10A 4E7OA 2NZVG 3NBMA 1BAPA 1Z12A 3RQIA 1QP7A 1DZ3A 1AB6A 1ABEA 5IX8A 2RJOA 1E6LA 4N76A 5KC9A 4D6YA 3OLYA 3O21A 1NTRA 3GA5A 3MF4A 3A0UA 3JPYA 2E4WA 4RXMA 1EWTA 4DN6A 1LBHA 4H3KB 4ZYLA 8ABPA 1QNLA 4NICA 2VYCA 4OBBA 5JNUA 3LUCA 2LUOA 4P1ZA 3JPWA 5IC5A 4IMJB 2QVGA 3ILHA 1SXGA 2CWDA 4IILA 4XAQA 1HEYA 2OENG 1JLKA 2R25B 1DBPA 4WXEA 1RPJA 4YLEA 3T95A 3JTEA 3QEMB 5IUJC 4YO7A 2O20A 5TQ2B 1D5WA 2FMKA 3RVSA 3QLVC 3HUUA 3N8IA 2JRLA 5IULC 2QZJA 2ZWMA 2VK2A 2FLWA 1QO0A 4G0MA 1CYEA 3W9SA 1AB5A 4DADA 1F4VA 3HM9A 1ISRA 4KV7A 2WY2D 2PUCA 3IP6A 2FMFA 3HSYA 1KMIY 1LJUA 3M6MD 3OMWA 5CNKA 4Z4HA 3QLUC 4MRMA 1GUDA 1MB0A 4YGXB 4YV7A 4RY0A 4N03A 4G86A 1QPZA 4GPAA 1JX6A 3FFXA 2E4VA 3O74A 2A9OA 4JAVC 5F64A 3H1EA 3OQMA 4IMIB 2JK1A 4G0OA 5ABPA 3QX8A 1RZRA 3QK7A 1D2AA 3HXMA 2WMYA 3EODA 3GBVA 3N0WA 3O1HB 4Z4CA 1DBQA 1E2BA 2HSGA 2F8SA 1H9CA 4EVQA 1SXHA 2QV0A 1JHZA 5GQSA 2PL9A 4MYRA 5JNVA 4RK7A 2R47A 5EWJA 1VPWA 3URMA 3CS3A 4G0QA 4Z0NA 1M2EA 3C3MA 3C3KA 2ID9A 2JBAA 3H5IA 3LKVA 4YWHA 3LOPA 2BGGA 5CNJA 1DC7A 1P2FA 1ZDMA 3N53A 4TLLB 2RGYA 3SG0A 3GL9A 4YR7A 4RY9A 4MR7A 2IOYA 2J48A 3M9WA 1J56A 3OM1A 1Z18A 3CRNA 3DLHA 5TPZA 3IP7A 3HJFA 2L17A 3UUGA 5FWYA 1ZVVA 2FQYA 4F11A 1NXTA 4W5QA 4ML3A 1L5YA 1QQBA 2A9QA 1NXOA 4P98A 2VUHB 2E4YA 4MQFA 1ZGZA 3DZDA 4RK5A 4Z4EA 3NHMA 1F51E 2QVCA 3TD9A 3GV0A 2CHFA 3IPCA 2IPMA 5B3JA 2NUBA 3FFTA 2F8TA 1LJLA 1BDIA 4PE5B 4EGSA 3Q7TA 3T38A 1M5UA 1TLFA 4HYEA 2IYNA 5DCLA 3TX6A 3F6CA 4QYWA 4LRQA 2PUEA 2DRIA 6ABPA 5HM6A 3HEBA 5IBQA 5C5CA 4WZZA 3A3KA 3E3MA 5IEBA 3H5TA 4N41A 1YVUA 3BREA 9ABPA 2HJ9A 1PUXA 4KRFA 1DCFA 1Z16A 3RVKA 4OTZA 5EWLB 4RWEA 3MYYA 1KRXA 1ZITA 2ID7A 2GX6A 4YS6A 2FQWA 5DKFA 4MR7B 1ZN2A 4KK3A 4MR9B 1XHEA 5C5EA 3T6KA 1PHRA 3H5VA 1ABFA 5FBKA 3I45A 3TMYA 2GWRA 1EWKA 5EWJB 3LMKA 4MLDA 5CHYA 4Z9AA 1YTUA 3CG4A 3H5OA 1WETA 2MYUA 3CFYA 1YIOA 3F7NA 3H1FA 4QYMA 1U2QA 3BRSA 3SY8A 1D4ZA 1Z13A 5BRAA 2PKXA 3HS3A 2FLKA 2R4QA 4EYQA 1SXIA 3H1GA 5TQJA 3BILA 3D8UA 3H6GA
chains in the Genus database with same CATH superfamily
1USKA 1SO8A 2WTAA 3HHPA 4N01A 4A7PA 2IYRA 1CQZA 4JJAA 5GJWC 1JYEA 2F3UA 3L7CA 3RRXA 3P97A 3THXA 3QJ5A 3BZBA 1JHPA 2H1IA 3HH8A 4WXHA 3KUKA 2PSFA 2C4TA 1DAOA 2YZNA 2J9ZB 5EJ5A 1CLEA 4NOLA 1AKNA 3NV7A 1XOIA 1MG0A 4I1IA 3OFNA 3VPDA 1T10A 2YV5A 5JS2A 4FHZA 4TS3A 1JHDA 1QAOA 1QMPA 1VPDA 2W6MA 4GI5A 4U3JB 1POXA 3OP1A 4Y1RB 3ZVNA 1XRPA 2DTDA 3AUXA 2Z43A 3ZUPA 1F2DA 2HNBA 3B5EA 1W87A 1SEPA 4FJ1A 4DJEC 4ENQA 4J4BA 1HBJA 2CVQA 4PNEA 1W76A 2CNKA 3GFSA 1Y98A 3H83A 3EZYA 4EHAA 1CQJB 5H3CA 4AD8A 4BMSA 5KYYB 3ZJVA 2C98A 3LD9A 2H5LA 2RK6A 4KB5A 4NLLA 3B20A 5IAKA 3WYCA 1O5OA 2ZDHA 1C3OB 2NYUA 1RT9A 3HCFA 1JG7A 2AKAB 4AQYB 4AKIA 3AFGA 1HEIA 3VPBA 4EVIA 3OIYA 2HLPA 2ZI7A 2ABWA 3EGIA 3SSMA 4C6HA 1RYBA 2OV4A 3KOYA 3TVDA 4PYJA 1ENYA 1W46A 5A2QA 2ZB3A 5AVSA 2XXAA 3V6LA 4DG5A 2A9PA 3N07A 1OILA 3KQHA 4Z51A 3ZXYA 3LNCA 3F5MA 1YJAA 4O1IA 5K1ZA 5GVRA 4PRLA 4CU5A 3OD1A 4R1SA 3T7JA 3IVAA 4XYEA 2QYOA 4HDAA 5AM3A 4QVKA 2NNLD 3KVRA 2PXCA 4JENA 1VJ5A 4PICA 2Z1DA 3GYBA 4MV0A 4YT2A 2D3TA 2P79A 2OESA 3FYDA 4ND7A 1WZIA 1E9CA 4R1LA 1YRAA 4RGBA 4KAAA 2P2NA 3QA3E 4NBLA 3ZCUA 4M54A 1NE7A 4P92A 1E62A 4DLLA 4X92A 3DB2A 2F67A 1PW5A 1BQ3A 1BMTA 1Z4JA 3G68A 3RK1A 1VXOA 3F5SA 5TARA 1P2BA 4Q6BA 3HR4A 1SURA 1LK7A 4R83A 1OLSB 3Q85A 4R1UA 3KFVA 4S35A 3U1VA 4V0RA 4BLSA 2EWMA 2IDKA 4QXMA 1L5GB 1WQ3A 3M3HA 3CO5A 3E8MA 3KCQA 3QTLA 5I7VA 1APBA 5BW8A 5F9FA 2H8GA 4QBKA 1ZH2A 4UFPA 2JJ1A 2A0YA 4KKXB 4U9UA 2BFAA 2VEOA 4E30A 3DC2A 2RB4A 5KWJA 4JUFA 3U2QA 1V95A 3GJ0A 4C07A 2QR2A 4M9CA 3TOSA 4G6ZA 4F3CA 2PMCA 5LC1A 3TSOA 4JGBA 5DHAA 3ZNPA 3T94A 5C5IA 1BN7A 2OHHA 2GFQA 3KZXA 3IFSA 2QAGB 4S12A 1S02A 3AHCA 2QSYA 3QPAA 4JR1A 4F8EA 1FVXA 4RVUA 2JDIA 2ZULA 1WZ2A 3I23A 1D2GA 4ABYA 5MFPA 2HKIA 5EXPA 1TT5B 2WK1A 4U9IS 3RADC 2VA9A 3K8QA 4OJQA 1PTKA 1RQRA 3KB1A 1QP8A 3EZFA 5BSVA 1HNNA 1ZSNA 3DLTA 5CP8A 2AJ8A 2QEQA 3PHIA 4JIGA 3GJ8A 3PJEA 1I3OA 1KVUA 4MPDA 3ZWPA 4ALNA 1C1DA 4BYGA 1EIWA 2B1JA 3WB0A 4TMXA 1FZQA 1J42A 3B1YA 3OCVA 1P2VA 4P83A 3FMGA 4KXUA 1RAGA 2Q5EA 4QPJC 3USZA 4P80A 5TMEA 2WKPA 2JPDA 2ZTMA 4AJLA 4ZT7A 2HN9A 3IUYA 3WWZA 1I3CA 3TQTA 1NUSA 3WK6A 3G59A 4P54A 4RVGA 4YP6A 5KYVA 1OBOA 5MN4A 1E6MA 1ISIA 1KO4A 2GXUA 2IVZA 2XUDA 3L9WA 4ZI2A 2D7DA 1T5TA 2H00A 4F5DA 4RA6A 5J4VA 4EI2A 1Q1GA 2X7JA 5I7EA 4QDKA 5C8ZA 1MHTA 4GI7A 3LNTA 4GNRA 4LDJA 3U4HA 4WI1A 1H3NA 3RRFA 3U5ZB 1ZMBA 3F9IA 3CXUA 1TJ3A 2X9VA 3HR7A 1GLGA 4EPXA 1ZC3A 2PTHA 3Q88A 1UQUA 1GILA 1NUQA 4M0EA 4A1FA 1K7EB 3OCZA 4RS3A 1NDQA 5BSUA 3HFRA 4P0PB 1I0IA 3AF3A 1E2QA 1K6XA 3HK2A 1YR6A 2YFQA 3IGFA 4M6WB 4MRNA 1DIHA 2HHJA 4RK6A 4N12A 1GP2A 4QOFA 4U00A 2EKZA 5FPTA 3TIVA 3JYOA 2HV8A 4YMSA 1XA4A 3IP9A 1L5ZA 2P3SA 4Q03A 1A5SB 3OQNA 1OZAA 3INGA 4I8XA 1WOYA 4MGKR 3K70C 3T9CA 1WSBA 2A3RA 4WLNA 3HU3A 1FF9A 1K75A 2BM9A 4N6OA 4KNWA 3I62A 3TNYA 2DEUA 3IBFA 4RZSA 1SVUA 4H1HA 2G70A 1JQ3A 2D5LA 2GA9A 3FNRA 5ULLA 4CI9A 5FUYA 3I5XA 3FWNA 3TQOA 1IN1A 1Y4DE 4MR8B 3AI2A 2FSHA 3C3WA 3H9EO 4FFLA 2H2WA 4JCOA 5FULA 4JHXA 1XELA 4QGHA 5IAEA 2H16A 1E8DA 2ODAA 2WF9A 4G1UC 3SZMA 2WM9B 1IFXA 5ES3A 5DM1A 3H16A 2GDZA 1NTOA 1RJ9B 1D04A 3VR4A 3GBPA 1FFWA 1UDXA 2LNDA 2YRXA 2JEOA 1H2ZA 3EZ6A 3LPMA 1RR6A 4WAUA 2IYOA 5K20A 3ICEA 3NOQA 2YCLA 3Q40A 1R0KA 2QL9A 1OX5A 4IMPA 4JLNA 1RYDA 3PPWA 4DQDA 4M7RA 3LO8A 1D9ZA 4E2WA 1MH1A 5EUMA 3HP1A 3ABOB 1EXMA 2P7IA 3IJRA 3WGKA 2HSWA 4MIOA 4NU5A 3KB6A 4JA0A 1EBUA 3PK0A 4MX8A 3K0SA 1CEEA 1FYFA 3TLAA 2VCHA 5FA8A 5E6UA 2A1TS 1J07A 1XCGB 3OC0A 1CIPA 1V7PC 5E6SB 4F4CA 2ZWOA 3SYNA 1EBFA 4QTZA 2GPSA 1TDJA 4DJAA 1RACA 2A30A 1OT3A 2QLFA 1WBJB 3UV7A 1UT5A 2OGWA 4O4JA 1HFEL 1QHEA 1H8HD 2PUWA 2UVPB 3BGOS 3II6X 4TTTS 4TMZA 2A4KA 3S6JA 3UC9A 4REMA 4QEKA 1ONSA 4TYPA 3IT2A 3DE2X 4RD2A 1WQ4A 3LGXA 3C1AA 4R54A 3AG6A 1WG8A 3GPBA 4ZV9A 4BE7B 4B7UA 4A4DA 3T4EA 5EHQA 1NAIA 1J7JA 1F9EA 1SQ0A 3CX4A 4HDNB 3LC2O 4KUEA 1PEKE 4L5CA 3ZV7A 4AYWA 3UK7A 3KJIA 1L5OA 1EPUA 1KL7A 3V7FA 3L7MA 1ESNA 1EUZA 1JDZA 4RKYA 3WQRA 1GZSA 3L6UA 2V7XA 3LLMA 4JVLA 3T3IA 3UAVA 2FR8C 4KV9A 1LSSA 4DVJA 3UHFA 1ODTC 1AN9A 4LFCB 3TQCA 1D2RA 3K4PA 2VDKB 1Y8RB 3K9WA 2ZT8A 2FJUA 1RZ3A 1LKZA 1RWWA 4JUCA 2C9YA 4ND2A 5JWOA 4TM7A 3L1HA 5CLFA 3NTOA 4S1OA 1W59A 3EJWA 1U2GC 4LCJA 1IEXA 3UJ9A 2XTJA 1Z4IA 4KQCA 1UJ6A 3K9CA 5H8WA 4MW1A 2EZ4A 1QDUA 3OFJA 4B6SA 4EGFA 3Q9SA 2I1VB 2PKYX 2J7PA 1L5HA 4O2AF 5EA2A 3SS8A 5CD9A 4PLZA 3DTVD 1EQAA 1P5FA 1W25A 3RI3A 3SQXA 3K9GA 3C8UA 3Q15C 4K6OA 1A8SA 2C7OA 2WWRA 4A73A 2VJMA 1ECBA 2FX2A 1FCJA 1L4UA 3B3QA 3OIDA 2H48A 3NLLA 4E4TA 5BV0A 1Y6FA 3KL4A 3AERB 2QZZA 3NO4A 3RKSA 1QCCA 4DHWA 1NHWA 3BDIA 3OLZA 2VK4A 1MX1A 1XYVA 4BEVA 4L5YA 4FPXA 3OPNA 2FR0A 3P9IA 4KFRA 3RABA 2W70A 3W8FA 1RC8A 2C3YA 1CY2A 1H2WA 1NBEA 1PZHA 4IVPA 3EGWA 3WC4A 1PJCA 2YXLA 2IIBA 4A10A 5TB5A 2IU0A 3GAMA 2DFLA 2FWPA 1F48A 1H8HA 3W5IA 4GZ3A 4HDKA 1NRJB 4RCVA 1RXWA 4DIMA 4G0PA 1M75A 5C8XA 5LMCA 1LFDB 2IXTA 4UVDA 1LPPA 3B78A 3A32A 4RE5A 3GLFB 4RK0A 2MDTA 3C5HA 4JLDA 3IO5A 1WY5A 2PTGA 1M3SA 2Y0BA 3AKEA 3FTNA 3FR8A 3BXHA 2CW5A 3FY4A 5H3LA 5P8WA 3VPCA 4Q1BA 4IJUA 4N49A 4Q9IA 5FBHA 4KRGA 4B80A 1M1UA 2FQXA 2DECA 4IHJB 1VE6A 4MW9A 6PFKA 1G8AA 2J9XB 4AY4A 5K8VA 3KNZA 5TC4A 4NMXB 3GLHE 5F7JA 3P9KA 721PA 2GPWA 4XR4A 3RPEA 2V96A 3VH1A 2YVAA 3LYUA 5KOJA 2IHUA 3AUUA 3ML1A 2CLSA 2FFAA 3RG8A 3D7SA 2WTEA 4YPFA 3T7EA 4D0LB 5ADWA 1SXQA 2BHLA 3NX4A 4ZPXA 1C8BA 3CKYA 1JFFB 3GJ7A 4U7GA 3R3YA 4YUZA 4ZI3A 2RJOA 3DAYA 2P41A 2RBKA 3COVA 2HUPA 2ZYHA 3WXBA 3DEJA 5B30A 1FMCA 3C5WP 3JYPA 3A0UA 3IELA 4MVJM 4IJWA 5BP7A 3IKJA 2E4WA 1CUZA 4FOLA 5AWFC 4B5LA 3GOHA 5JHHB 1H0KA 3CF4G 3PNVA 5I8WA 4RANA 3W6OA 4YUAA 3CPSA 3PBKA 1YQUA 3BAZA 1VG8A 2LUOA 4RW0A 4QQRA 3WBFA 5LLTA 4CEHA 1ZMTA 1JI3A 3OUZA 4M8SA 3BMXA 5HF6A 3FCUB 3EWIA 4RKWA 2KS6A 1DX6A 1CDZA 3RIGA 4CE6A 1VXRA 1X19A 2Q4BA 4YO7A 1K08A 2FUKA 4K9QA 4EHNA 4RPLA 3WQBA 2ZATA 4TT8A 4FONA 2P6OA 3U9LA 4DMGA 3OTOB 5K8JB 3Q11A 1U31A 2FFRA 3QVXA 4I4TF 5E6RA 1WY7A 1V5FA 4XGRA 1ZK3A 1S8AA 2MJLA 3AWIA 5TF4A 4KV7A 3X1KA 1GRRA 4LV5B 4BV3A 4E21A 5ICSA 1QR2A 2FMFA 2IS6A 1R4MB 4XSGA 1CY7A 4Q7KA 3WTCA 1XL0A 1IDN1 2AQ8A 3TINA 4PC2A 4YGXB 1ZGBA 3KQYA 2QX7A 3ADKA 1N2CB 3HKBB 1KMNA 3G7UA 2H1VA 4PU0A 1H6CA 3FHJA 3SBXA 3ANMA 1S2LA 2ZIVB 4YQYA 3V42A 3A3NA 2ECOA 3RTAA 2B5OA 1P4RA 4DM3A 5C5DA 3HXMA 4D9GA 1XTUA 4PY2A 1RCUA 4RQBA 4L02A 3BFXA 4DLZA 1XFAA 2LDBA 4E5KA 1UKBA 4RL4A 4XDYA 4AJHA 5EWJA 4AY6A 4WESA 1PK7A 4Q21A 1UWKA 3SF8A 2QD1A 1Z0DA 2VVTA 4G5RA 5CDGA 3KQQA 1HFJA 2ZAGA 3DDCA 1DMRA 1ETUA 2ID9A 3H5IA 5IASA 4D3XA 3R4VA 3V8VA 3OURA 2P6PA 3M70A 4UDNA 2XADA 5FV4A 1HV8A 4EECA 4P81A 4CXMA 2BRUA 3ZLBA 4DY6A 4MYSA 1XTZA 2SECE 5ISMA 2HA3A 3DONA 5EXTA 2DX7A 1FYVA 3GW8A 1A88A 1Z45A 3HY6A 3W5JA 3G3EA 2IZOA 4GRAA 1C41A 3GH1A 3USCS 4F2PA 1Y6QA 2GF0A 3K15A 3L01A 2D3WA 3LL4A 3L7DA 4FYIA 2FP4B 4N1AA 4ZVKA 1Z5VA 2GKSA 4DNFA 2AT1A 2J41A 1AK9A 1AURA 2EP5A 1V8FA 4Z4EA 1TMKA 3LQ4A 4Q1FA 3EEOA 1FZTA 2IPMA 1MQ8B 3FFTA 4TRMA 1RQXA 2OC4A 5EYPA 1KZ7B 2H7VA 2B9VA 3PTLA 1U0FA 5HQTA 2Y92A 3B1KA 4LZJA 3R6DA 3LAWA 4ER3A 2OCGA 1XTQA 1ZLYA 2V7EA 3ANXA 1CE8A 2ANCA 3EJ6A 5EY5B 5TVGA 3IL2A 4RORA 2Z6AA 2AC4A 3D0KA 3E3MA 4H7PA 3J7TA 2RGEA 3JQ9A 5F77A 1Z16A 4FFBB 4QNRA 3FX2A 3VC1A 3T52A 1KRXA 4CIXA 4XM1A 2ZRJA 3WYEA 2C7QA 2REQB 1JVBA 3TPZA 4K6KA 3NAMA 5IW8A 2C3OA 5LDGA 5DYGA 1UZNA 1GSHA 4BJHB 1JR4A 4PLCA 1VIYA 1E7SA 4N65A 4UEKA 1NJ5A 1IZZA 2EIXA 2VSQA 3EXFB 3BXGA 4L7QA 1GKUB 4GXNA 1LDYA 2BBSA 4IDDA 1VBNA 1Q17A 4MUGA 4US2R 4D5EA 2BH9A 4A6DA 5IKPA 2GWRA 2QTVB 1AQIA 1S2OA 3K9LA 3TN7A 3ZLUA 1ISMA 2AJDA 3CG4A 3H5OA 2MYUA 2GZ3A 4BQIA 4JLBA 3T3DA 2GEFA 1B4DA 1N0WA 2V5AA 5A4JA 3U7EB 5BV2P 3DUWA 5IKEA 5DMXA 4H08A 1TK3A 3IIIA 1KSGA 1UT6A 2NWQA 3AGQA 1Y82A 4GLFA 2AOTA 2EATA 4P38A 3VTKA 3W3AH 5AXDA 4ALKA 4JQSA 4M0FA 1P4JA 4BUJA 3ADDA 2ZS9A 3IQGX 4WBNB 3PRYA 3R5TA 1J9ZA 3QY9A 1T34A 4RD6A 5HZMA 4D96A 1ULAA 2GCEA 3QWAA 5SYMA 3L05A 1OF1A 4EELA 1HO3A 2PX6A 4M9SA 5JNWA 1W36D 1QK4A 1ZQ1A 1BNCA 2YYAA 1N3IA 2ORED 4WDQA 4KGXA 1VLVA 3DM5A 4BVJA 1Y63A 5KTYA 2HHHB 2I6TA 4MV4A 2EDAA 2R7KA 4D43A 2I91A 4MS1B 1PVDA 4YP1A 2AF3C 3NMUF 4NZMA 3K1ZA 4URYR 5HTKA 2P0YA 2X0RA 3OM9A 4I8IA 2RGDA 5ALGA 3KPWA 3ZVLA 2XHEA 1YKGA 4BGVA 4J0QA 1YR9A 2JFGA 1W96A 1PYDA 1CWUA 1U9IC 2BKUA 2J0UA 2QN9A 4XI9A 2ZT7A 3ZWYA 4G9EA 4P4SB 3ZV3A 1E1KA 5JNSA 2HU5A 4JI1B 2XMBA 2VJNA 4A15A 3QW4B 3QXJA 3ND8A 3CVVA 2ERXA 2IXFA 2JANA 5DYNA 1KNQA 1XLWA 4E0BA 1V6SA 4W5JA 2ZR7A 3PLNA 1U0JA 4ETMA 4O0MA 2F2TA 4UUAA 1IIBA 1DBVO 4UHDA 2XKKA 3LUKA 3G0BA 1DNPA 5T57A 2I2DA 2X0JA 3FVVA 4RX1A 4S1PA 2ZFUA 5ESDA 4Y6PA 1J1ZA 3NM5A 1ZK4A 4KQ9A 4MGIR 3VKVA 4IP0A 1AKYA 1GRCA 4KREA 2HCFA 4MW5A 4R2IA 4F6LA 3IUEA 1WUYA 2FKAA 1QCDA 2WIBA 1IVYA 4EW3A 3VKGA 3QKSB 1EJBA 3LT5A 3SI7A 4CM7A 4DCOA 4DLSA 2PEZA 3PT5A 4JOCA 4MB0A 4QFCA 4EF6A 2P30A 3TLMA 4X65B 1DE0A 1SA0B 1SUAA 2X0NA 1TRKA 3VSAA 5CX4A 1RWBA 3DL2A 3TW8B 3VR2D 1Q1AA 2HMWA 1F8YA 5KOIA 4OQXA 4WZAE 1TKAA 2WTMA 3NH6A 1R3UA 4CLXA 4NJOA 1W0KA 2HCTA 3MOGA 1WE2A 4CPDA 2ZYRA 5ALLA 1N3YA 4AURA 2V7UA 3X2FA 2G04A 1EH5A 1FIUA 2OXFA 2A2ZA 1C3EA 4C21A 1C5KA 1F3LA 3MZ0A 2QRUA 2ZUUA 3MXTA 1KAMA 1E3QA 2QYHA 1R66A 3HXPA 3KALA 3AYXB 4K0KB 1YRYE 2VRWA 1IHDA 3UMGA 4I2VA 3RT7A 3ZZ1A 3T5PA 2P6RA 1XE3A 3UAYA 1DAFA 4G09A 5HFNA 1VCHA 4TTSA 4D80A 4L5AA 5FQOA 3WNCA 5BNIA 3AI7A 4W5TA 5JRDS 3D6FA 1ZFNA 4LMRA 4Z4FA 2VT7A 1Y5RA 1MC4A 2I76A 4B17A 1Z3IX 3DBHB 3K6RA 3AFMA 4Q5IA 3WRWA 2MR6A 1MB3A 2X3FA 4HWSA 3KWJA 3DAOA 1VCMA 2N1MA 2A35A 1KI2A 1C29B 1U6IA 3DOOA 1ZJ5A 2LDXA 3GLSA 1KMCA 3RVNA 4LA4A 4EHHA 5JNLA 1PGNA 4YA6A 2YHSA 4ZVTA 4UM9B 1XEXA 4RD0A 4U2GA 5CCXA 3DZBA 3UBTA 2VJAA 1ICIA 1IJEA 2NUPA 3MQFA 2XVAA 5DOZA 1RIIA 3PQ7A 4J6EA 4LQ4A 2I9PA 3EIFA 2FG5A 4Q34A 5L9AA 3NGMA 3NHWA 4ZOLB 3LQYA 2FE4A 2E5WA 4MAFA 5IBRA 2IH2A 3G5MA 4B7XA 5A9SB 2VXOA 4MPTA 4DNOA 4YLYA 3U7RA 3BKWA 1AK1A 3AB8A 3KTFA 1GL3A 3TFWA 1DCMA 1DPFA 2AG6A 2ETXA 2R96A 1FTWA 4J90A 4R2MA 1YJ8A 3RARA 3E22A 3OQ6A 1Y3FE 3HO1A 4OB7A 2YW9A 1NW5A 1HWYA 3QE2A 4L8GA 1N6RA 1PG5A 2AEMA 1N5MA 3LDAA 4MB6A 4Y9DA 4BFZA 5BYAA 1IZYA 2BGJA 5D2CA 5KYTA 4MP8A 1SXPA 1VI2A 4KQJA 3HKDB 4JCCA 2Y4NA 4LGMA 1CG6A 3VPSA 2CYCA 1YUNA 4ILEA 1L7NA 3VU1A 3PPVA 2WRZA 3UYKA 3GUYA 3T99A 4M88A 4PNHA 5FBLB 4B75A 4XFDA 5KQSA 1V48A 4BMXA 5DNUA 1OUMA 3EGDB 4OHFA 3N0VA 1V37A 9GPBA 1Q7CA 2I54A 1EUCB 3H5RA 5HTOA 3EVEA 4YK7A 1MJFA 4FNGA 3MQ2A 3KL2A 1CR6A 3GO4A 3HYLA 1BG6A 3VKFA 5H4GA 3OHSX 4PSDA 2EF0A 2FUEA 4FIZA 1E3LA 3ELWA 3G0OA 1Z2OX 1CUAA 3NT2A 1E5DA 3PXCX 4ZU3A 5FI1B 3R9WA 1FUUA 1OC2A 3VHXA 2WZDA 1GCGA 3MGGA 1NIPA 1FQWA 2CXSA 3NPMA 4GH5A 1YI8A 2JI4A 2O0MA 1DSSG 4WOJA 1R2QA 4BO8A 4LK2A 1QHSA 3BCRA 4TX1A 2QPTA 4G23A 2W6NA 1XF9A 1RM5A 2NOAA 4Q39A 1ID1A 3SQWA 3A25A 1M34E 1NPTO 4PYMA 2WF7A 3IDAA 3L0CA 4BPRA 2PZMA 3ADBA 4BOYA 3BIJA 3I34X 1RDFA 3RVDA 4W6QA 4CG0A 3SHTA 1N33B 1JBKA 3EDCA 1TLTA 3AI1A 3L7YA 1K63A 5CB8A 2Q99A 1T26A 1ORHA 3WLQA 1B14A 4TV9A 1XRQA 2HDWA 1SWVA 4ZN6A 3P96A 4W8HA 1KU6A 1ZCJA 4B31A 3FLMA 2O54A 2D06A 4EEXA 2FUG1 1PEAA 2UZ0A 2FPKA 2O6HA 4IIEA 5DNCA 2I62A 1G8SA 3RE1A 2WWXA 2XCSB 3DUFB 4WH0A 3KS9A 5CFQA 2JIBA 4H7HA 3AW9A 3RR2A 1P1BA 1FP1D 3L92A 4JYMA 1EK2A 3F6EX 4E5NA 3RIEA 1XMSA 1DUVG 5F2NA 3U44A 2WU3A 3JRNA 3T3GA 2WJ3A 4HAYA 4EZEA 1AA6A 1JWAB 1T4BA 2PRZA 4WADA 2JS7A 5EHZA 1CK4A 1DDOA 1FDSA 3C3AA 5C32A 1YMVA 1U9YA 4QUDA 4X41A 3ESRA 2ZUDA 1SCQA 1IQ0A 4XLTA 2CXNA 2GI4A 1SU8A 2VF8A 1LUAA 4PW0A 4OL0A 3U26A 3LLUA 3I1IA 3GJXC 2LVBA 2XQFA 2XF8A 3V1TC 1MR3F 1U1FA 1GZ5A 4FFBA 3W2GA 3WA7A 4BNKA 1RRFA 2IHBA 3MM4A 4D3FA 4E09A 4AICA 1SKAA 1QFSA 5IARA 5JCZA 5B7QA 3A7DA 3VGPA 4QEZA 4N5HX 1A9TA 1ZI9A 2RJNA 3ISTA 1B76A 1JTFA 2ZBUA 3H13A 5BQXA 4KQIA 3P94A 1FU8A 1UEIA 1NLFA 2PGXA 2WYOA 3DOFA 2ZIAA 3OQIB 1HDCA 2GHTA 1E7QA 1OT5A 1KTVA 1XNJA 2F43B 2HL6A 4N9WA 4UAGA 3L4SO 5H7XA 2VHCA 3ZW7A 2DFTA 1P9LA 4YJ2F 1CUBA 4CCYA 3T9DA 3EUAA 4UUBA 5SY4A 2I99A 2JI8A 3ISVA 2P9GA 2J9GA 1XCLA 4HBGA 2QAIA 4LOAA 3A1NA 5CDUA 2CLFB 1T5LA 2E0IA 5L7WA 2X1MA 3CZQA 1KC1A 3N3AC 2CNWA 3RDPA 4JB2A 2ZYWX 5JPDA 1ODIA 1EFRD 1M2VB 2AG5A 1NW8A 1S8OA 3LDHA 5DHFA 3U9SA 1U7PA 5ALJA 1W5TA 4DJ5X 4P9NA 4GOOD 3FDJA 4A92A 1SXJE 5AOCA 3LCRA 4S0XA 2Q8QA 3OTHA 4REQB 1OYWA 1VKOA 2QG6A 2JAUA 1TQHA 2GAAA 2OD2A 3ED5A 4MA0A 2X58A 3FI9A 3U5TA 4CTJA 4BNWA 3UHPA 3A4TA 4KR6A 3UMSA 1HNZB 1BVUA 4BQQA 5MHTA 3KOXA 4Q4DA 1Y4AE 3A26A 3FNGA 5F7ZA 3URKA 4BAUA 1YK0A 4NOMA 5ERXA 1J8MF 4NU8X 1YVDA 3GLHA 2BP7B 2B7LA 5E7QA 2PG3A 2ZWAA 3A2KA 1DKLA 1J2UA 3E3LA 5C3UA 3R3ZA 1LLUA 2QV7A 5C8YA 3H3XA 3E03A 4BX3A 4UUOA 3Q87B 2ODNA 4PVDA 2N1BA 4RHTA 3NBYC 1JLRA 1P73A 2BHTA 2RIPA 1JEJA 4QAQA 5LKAA 2O5RA 2C57A 3OOWA 3PUHA 2F3QA 2J45A 4E2ZA 3INTA 4I9FA 1W6UA 2JLQA 2IXGA 3L6RA 3RREA 1D4OA 4TZKA 5F98A 5JMWA 3G9UA 4Q3NA 4MW0A 3C43A 2PV7A 2WNSA 4JVMA 3V8PA 3SXJA 3C3JA 2I3AA 1L7VC 1PFVA 1YH3A 2JI6A 2VUTA 3H11B 4MRAA 4Y9SA 4YAFA 5BT9A 4LVUA 3PI6A 3VPXA 3R7SA 3KUCA 4OLJA 2YQ5A 3UJ7A 3H05A 3WB9A 2X3YA 3MOSA 1WQ1R 5IPFA 5LSAA 4S2EA 3U3DA 1OIXA 4WXMA 3ZI7A 5L7TA 3BA6A 3VI3B 2AN4A 4JJZA 4FZ3A 2HT6A 3GFPA 1T9DA 4HY3A 4R05A 3RQIA 4IJVA 3FNFA 1QP7A 2A78A 4MZXA 4CLDA 1NKTA 4TYQA 5CCBA 1WMSA 5EL0A 1TUBB 1E6LA 3KYBA 4F91B 3PL5A 1YHZA 3O21A 4GLBA 3P9NA 4WZBA 1JHQA 3IUPA 1XJ5A 2O2YA 3SJZA 4BUCA 3NJ8A 5ILGA 2O3QA 4RXMA 1D7AA 1O08A 3V2GA 4DLPA 1OGJA 5J4HA 2O2IA 2EDCA 2FMXA 4E88A 2ZE5A 2QL7A 4I14A 2QDKA 2B94A 1EYZA 1Q83A 1TZBA 2XHZA 3X43A 2VG8A 1LW6E 1U6JA 3ASYA 3BK2A 2Z5FA 2PGNA 3ZGYA 1F0NA 1DMSA 4QXOA 1X7GA 4G5SA 5JQGF 4FDTA 1UZMA 2OENG 3KV3O 3QYJA 3BXEA 3EA4A 4Y7DA 3NKFA 1HYHA 1OH5A 5EPUA 3IPRA 1Y7TA 3QFFA 1OFHA 3RIXA 4CMHA 2AOUA 2VBFA 4NJMB 3EUEA 5KX5B 4AL4A 4DR1B 5I5EA 3FMPB 4F3NA 2I2FA 3HDJA 3KYDB 3NUQA 3CX6A 2J0SA 3DD5A 4CLRB 1QKIA 2JGEA 2CXPA 1N2HA 1WNFA 3WJAA 4C5CA 1XRMA 1UZAA 1XROA 2VUUA 1PE0A 3B6JA 5DGXA 1F0KA 4KVZA 5AKHA 1I1HA 1WMEA 4QTXA 3L8ZA 4ZQHA 3W5SA 4B8YA 5B4VA 4ZANA 1C7RA 1JE0A 2PVCA 2I3DA 2ZJAA 1YZLA 3ORHA 4JAVC 1MRNA 5A7GA 5C7OO 5HQ3B 3ICCA 1TW3A 2GEVA 4AZWA 4GYWA 1NQWA 2CFCA 4DOMA 5J23A 3EOZA 4G37A 7REQB 2F8SA 1FVHA 3RTEA 2B4KA 5B2EA 2P77A 3RYCB 3FCYA 4I9UA 3DPUA 2P90A 1IM2A 2W83A 1TA9A 5BR7A 5H9WA 1W5SA 1IC6A 1K6JA 2FSFA 2DQSA 4X62B 3TOCA 5LL6P 3BTOA 4ENVA 4JC0A 4BNVA 2CZGA 1UEJA 3FOAA 2ISSD 3K73O 1U3CA 1N4DA 2OO7A 2R6R1 1KOGA 2RGYA 1I1OA 1QM5A 3BCHA 1WA5A 4MR7A 1LA2A 3E0QA 3F1LA 4BZQA 5IAGA 1M2VA 3PX3A 2QX9A 1HT3A 2PO5A 4R5HA 1EP3B 1NVMB 2QI9F 5L3QA 2VJMB 3BXZA 5CK5A 4YRCA 2M6RA 2AZDA 4K3VA 3IP3A 4YMIA 1QBGA 3LFUA 2PUJA 1PKEA 4HMOA 3SEZA 3HYCA 4CKWB 2W2VA 1RYYA 5AI5A 2IIVA 2PU7A 2GKOA 2YZ7A 3LT0A 5LVAA 2IU4A 2BT4A 3RSQA 4DQKA 1F51E 1A4IA 3G49A 3VDNB 4QSHA 1QRTA 3OQBA 4LHZA 1LNZA 1B0UA 4LTDA 1BX3A 1PT9A 4EGSA 2I03A 5LN1A 2OXCA 3OKPA 1EUDA 3NC0C 4I1SA 4P7GA 3GVPA 4MUAA 5FR2A 2P2ZA 2XUGA 3MPOA 3IDFA 4IIJA 1E1QD 3U80A 2V3VA 4EENA 3MB8A 1Y1TA 3OIGA 4FBGA 3DXFA 2A1UB 1R0LA 4HGNA 2ZCUA 1DKPA 1R0CA 3A9SA 4MKHA 2Z56A 3WL7A 4RZ3A 1J9EA 4DCCA 1FUIA 4RIHA 3E9EA 3ZN2A 1J8QA 2IX9A 3QTTA 2GGSA 4BO3A 2Z08A 3GNQA 1CV2A 5DBOA 2XXJA 3JASB 4ARAA 3DWFA 5HF9A 1GU7A 1CUSA 4FCVA 2P1RA 3QNWA 1X2EA 4GNKA 4ZVVA 4TL8A 1N1EA 3ZNQA 4XEHA 3LQ1A 1J49A 3QWHA 2QP3A 5SZKB 1KEEA 1CNFA 4JC4A 1OYYA 3Q0TA 2Q7OE 1CDOA 1HA3A 1VA4A 2CB0A 4YVFA 2PPLA 1FNBA 2FPMA 3AZPA 4HNTA 1O2DA 2FDRA 4QA9A 1BH6A 2R4QA 2X4LA 2A57A 2O5VA 1OWLA 1XMPA 3BOSA 2VH5R 4RM3A 3ESXA 3WMXA 4UMDA 2W93A 3TSZA 2XA2A 2A1UA 3DWGA 1ZC4A 2A0XA 4OQEA 1OMOA 4U7PB 2AI2A 2PRKA 2PZGA 1TK9A 2FPLA 1VDMA 4DWJA 2VKQA 3E9MA 5IZ4A 2HF9A 2BZGA 1NVUQ 1IL0A 1F14A 3V8NA 3PQFA 3ZWAA 4BVLA 1Z4PX 1ZUIA 2CXUA 1CFZA 2FW6A 2NT3A 2OBFA 4YRQA 4PYQA 2JAXA 3HUEA 5EUQB 1D0SA 1EXDA 221PA 4H0NA 2O5EA 3H1PA 4K46A 3JYLA 4ZK2A 2GUWA 1KEWA 1KAHA 4V03A 4BP1A 4ZU1X 3VR5H 2NUAA 2CLMB 3EVNA 5FOXA 1NMZA 4X24A 4J07A 3EFEA 4IBOA 4R5MA 2NU8B 3OZUA 4ADSG 2NU7A 5L3QB 1Q1EA 2OBXA 1VKZA 1SUFA 1YK1A 2H59A 2PFKA 3NRCA 3HDGA 3NVAA 4I50F 4TPKA 1O95A 2ZXUA 1MW8X 1XQWA 1QV9A 3EGDA 3OJOA 1QUEA 2YWEA 4WK6A 2JBAB 5K8UA 1ZL0A 4PGGA 1KEZA 4R2KA 5A5GA 5AW0A 4DUGA 4RPHA 3NBAA 1YRLA 1PDVA 2BW0A 3UEOA 1FSGA 4U02A 4XR9A 1U3TA 1W4BA 3PNYA 5DSTA 2BFPA 1Q0PA 4B46A 4FSDA 1JJVA 4QICA 2DCMA 4JR2A 3O0DA 4AJNA 4DAEA 1TZMA 5IVHA 2O19A 2QZSA 3DMHA 3R41A 2FHPA 1V25A 1X7YB 5G53C 2IS4A 1LBIA 2V74B 1GTMA 4MKXA 1XKLA 3E22B 4OJMX 1TVMA 3ZU5A 4QYSA 3PVCA 1NYRA 3EY9A 5HUQA 2WM3A 3Q5EA 1GFIA 3H86A 3C14C 1W4AA 5AVUA 1ST2A 1KXZA 1O6ZA 1KF0A 4PS0A 5DXJA 3SFVA 2HLNA 1CUGA 3C8DA 4F2HA 1QFMA 3GLIE 1C4WA 2OY0A 4B6FA 2ZYSA 1P9WA 1D6NA 2V4UA 2VCYA 1U6KA 4Q1EA 5K03A 1HDZA 5I47A 3HB1A 3PQDA 2PX5A 4HYYA 5C18A 2JLUA 1NW3A 3IDQA 3DTYA 4NJMA 2YHAA 3EB9A 4I4CA 4X90A 4ITVA 4HH3C 4E4YA 3UM9A 2Q2WA 4XKJA 3C1TA 1Q7TA 1J0DA 5FI0B 3RBZA 4Q1VA 5CVEA 5KNDD 5LZ4A 4CT0A 3OA0A 3NHSA 5C2JB 1VGVA 4FYYA 2EARA 3ZDYB 2QMQA 3HLKA 3TZHA 3WYAA 1JXAA 1ZNQO 3ZWOA 1O94C 1X1QA 2W6ID 3HBJA 1I9CA 1NVBA 1E9EA 2XCQA 3M6UA 3OLWA 4X3PA 4BQFA 1V1RA 4DMLA 3RFCA 1BHJA 1FC0A 1U0HC 5FR1A 3MT7A 2ZK7A 3X1DA 4XGQA 2J6IA 2A59A 2HZ7A 3OKCA 5JD6A 5MN5A 5HILA 4GSYA 1VHWA 4CMIA 2GB4A 4M8IA 3GF4A 4MQ5A 3L1UA 4XD7A 1UJ2A 2O1EA 2XGGA 2Y1LA 1A8UA 3P9YA 5KO2A 2ZPTX 2PSSA 1H42A 4JJFA 5DYTA 2QTGA 3C0KA 1JBEA 1Q0ZA 4QTYA 5I45A 5TNXA 2OC9A 3OZWA 4MJXA 2HMYB 3UOAB 3RG2A 1U5BA 5BMVF 2AFIA 2IP1A 1KU0A 4JA2A 1U4NA 3D8NA 4FOTA 1FX0B 4IM7A 1N2JA 5IYZB 3NP7A 3L04A 4QD3A 3MS2A 5JFOA 4RDCA 4R9NA 5I7HA 3NJRA 4MVJE 1VL2A 3G1TA 5ECGC 1EVZA 1HORA 3PJDA 2XCTB 2Q3DA 5EP3A 3EWNA 4F2GA 3JQAD 3QXHA 4C4PA 1NU6A 4WTOA 2WV9A 4GZ5A 3VAAA 1JLMA 3QUSA 3VO1A 1E7WA 2H11A 2P4HX 2FNAA 3Q8MA 3PWZA 4G63A 2XUPA 2UYQA 1Q0HA 4AWBA 1ACLA 1ZVQA 3OEED 2QRGA 2XTZA 3WE7A 2ZJ8A 3W79A 2JZNA 1CUHA 2GPNA 5SY6A 5HPYB 3OOYA 2HUNA 2IUYA 2GCPA 2OAGA 3PNOA 5BUCA 4PVCA 1GYPA 1LVUA 3N2NA 4XB1A 5CT8A 4L74A 1ZU4A 3TTSA 3C4VA 2JGIA 2BHRA 3EQ9A 1GUYA 4FMDB 4PG7A 2G4LA 4UM8B 1VE7A 3KKEA 2V0GA 1Z4KA 1B8OA 1OA1A 1BRTA 1FXSA 4OAQA 4YJFB 1T9GS 2BKVA 4HSEA 4XDHA 5KJEA 2J4CA 3DFMA 3F6YA 3VO8A 1JA1A 1KYZA 2O07A 3D0RA 3FCOA 4ARSA 1F17A 2QQGA 2ZCJA 4X6LA 1A8IA 2CJYA 3HA2A 1E2LA 1MNAA 2BM8A 4BGDA 2E6UX 5LJLA 1MMFB 4Q7MB 5LNK6 4MUJA 3FVWA 3B6ZA 3HR8A 4HXGA 4LISA 2XGSA 5AKGA 3RF6A 5KYYA 1CQJA 1GDHA 3OF5A 1WDKA 2GASA 3DV0B 1C4KA 1RYNA 2Z9BA 3ZWWA 4LSMA 3ZD7A 3UPUA 4LXGA 2OK7A 5ECYA 4BLTA 3MTJA 2OO3A 4PEVA 2GBPA 1NUAA 1J4AA 3G2LA 4BB5A 4UUNA 3B3AA 1RRPA 4C76A 1CZNA 1YS6A 2X8AA 2Z5GA 1ZRNA 1KO5A 3JW8A 3Q5GA 4JD5A 4EKYA 1G7CA 1OTXA 3EYWA 2Q4OA 1W44A 3QFCA 3GZNA 1DC8A 2H2FA 1I2AA 3I9JA 3CF4A 3LOUA 3VAZA 4A6PA 5E38A 2CV1A 1N2XA 1FUEA 1U2EA 5G0TA 3EPPA 4GBMA 1XZKA 1X94A 4NWIA 1QJ4A 4M3NA 1UP6A 4YCCA 4TLCA 2GCGA 2FEOA 4KACA 5JD4A 4BLRA 4DUPA 4F21A 4HMPA 4JN6B 1OFTA 3V1KA 1ZNXA 3N6RA 2IKSA 4LRYA 3BD6A 3MGKA 3BWMA 1EJ6A 2EQBA 1C9MA 5LZ5A 3CZ4A 3R6LA 3QBTA 2BFCB 2CL6X 3KPVA 1Y37A 4G0YA 4FFSA 1O03A 2QTNA 3PHHA 4ZIRB 1SKMA 2ZE8A 3ETEA 3CW9A 3L4BC 1ADGA 4JIMA 3WB2A 4ZJPA 5E0KB 2I8AA 1IH8A 4LYHA 4F04A 1GZDA 5JQWA 1JZSA 3DE0X 3K20A 1W0JD 1CUXA 1H0SA 2DT8A 1S2GA 3OQHA 5K3CA 4LMBA 5JSQA 4YJ2B 4JI0B 4B9EA 1DKMA 2OUIA 3SAJA 5C3MA 1KO7A 4GZ6A 1JALA 1UBSB 3OPMA 3EXEB 5EZ6B 2C5EA 2OA0A 3MC1A 3LBNA 2ODBA 3R5SA 4HVLA 2RCNA 2PH5A 3OECA 4HLQB 5EQJB 2XAUA 3EA5A 2VJCA 3WKAA 4HNVA 3E8SA 1QONA 2FMIA 1NSYA 3CYFA 4LDAA 4OHCA 1DAKA 5CDTA 1EVQA 2REXB 3KQNA 3WKBA 1SUSA 4N5IX 1VL1A 3QA9A 1Z88A 4YT5A 5D5PA 2VQFB 4GL2A 3Q2KA 4ETNA 1R3DA 2YVQA 4Q02A 1MC5A 2G36A 3TM4A 1WX1A 2X1VA 3DBVO 5GONB 4BL5A 1XN1A 1K27A 4LC9A 3A6HA 3NBUA 1XVVA 3L8HA 3LZ6A 3UATA 5CFPA 1UBRS 1VKRA 4FDMA 4YJKA 1EINA 4AJOA 1W9MA 3I3OA 4XIIA 5DMHA 1JLSA 3UF0A 1B93A 3QLVA 4MROA 5FFMA 3HJCA 2FJPA 2COEA 1WEHA 4NKRA 5BSMA 1ND5A 5IWAB 1E8NA 4BAGA 4ODIA 1CKEA 3H2IA 1SXJB 3ONDA 5B1YA 4FK8A 1QIHA 4W1RA 3JVIA 2JNWA 3MUNA 5AHOA 4CT4B 4ZTUB 2EGGA 1T9GR 2FFHA 4QJIA 2NIPA 4NOKA 4BBJA 5KQLA 2BCEA 2WZQA 4BE4A 4BXOA 2J5KA 3LG2A 2DPXA 3G2HA 3WLFA 3CCCA 3K5PA 1TW2A 3LOQA 3ZHOA 1QYRA 1V1RB 1MO3A 4MP6A 2ACEA 3FD8A 4UBJA 4QLAA 1IHUA 5E4JA 5HE8A 4EG3A 5J58A 3ZWMA 5CNIA 1E6UA 4DDTA 2JLBA 4H18A 1CF4A 1I4LD 3PNPA 1X1EA 2A94A 1G98A 2CNBA 3DEFA 3E3OA 5AHKA 3H6HA 5JR3A 3AVXA 3EVCA 4E5VA 1LLFA 1QF6A 3VC7A 1KJNA 1XXLA 4N3BA 5FBQB 2VOJA 3ZDEA 4FDAA 1XTPA 2I2XB 5K3AA 1G8KA 3PNSA 3HCPA 4WMLA 1UP7A 1YFKA 3AJ8A 3AVQA 3NHBA 4DV0B 1N34B 1QF9A 5CTAA 4DM7A 2HFJA 4NC9A 4R2HA 2RK4A 1RPAA 5IYZA 3AVVA 4ONEA 2CUKA 4PXSA 1L7XA 2YMMA 2PYZA 3G2OA 4WFKA 2LPMA 5AKIA 3HLYA 2WF6A 4WINA 3I9NA 3TO5A 3JR3A 4C89A 2CLIB 3AM3A 2OKGA 3ET5A 1U2RA 3GIDA 3KB8A 3T7SA 5AM2A 1RJGA 2XA9A 1DZ3A 2XVYA 5LQNA 1E3WB 3E5RA 5DBFA 2F1IA 4KN6A 1KZ1A 3FWKA 4ND4A 1FL9A 4J03A 2C1EA 3ZY6A 2XEDA 1L9XA 3D6MA 3C24A 3A1UA 3H97A 4D8WA 3T0IA 3TZLA 1E79D 3LIIA 2IZ5A 2Z6QA 1KVRA 4FOOA 1TECE 2QTZA 1RWKA 3W4IA 1LBHA 1KJJA 4BCBA 4NG4A 1N9KA 2H4JA 3R23A 1DLIA 4DG9A 4G65A 1NVVR 1L5WA 1OGIA 5FUXA 5BR8B 3KSRA 3O82A 3JPWA 1ATIA 1E0KA 3B9RA 1Q0LA 2HREA 3F97A 4NFLA 4OB8A 4L57A 4R1NA 1L6IA 3HXTA 5G1NA 4Z1MD 4E5UA 1FRZA 2XUZA 4XIFA 3RWOA 3R24A 3ZHBA 4HVCA 5JASA 1TC2A 4U7HA 3OOEA 1U0OC 3VTAA 3KQKA 2NVUA 4YXWD 3NP9A 3OPYI 1N6LA 5BWBA 3DL7A 2IEDA 3HUUA 1GGEA 3LPNA 1HT1E 2A5GA 1JDVA 2ZWMA 1CXZA 3MCUA 4RMHA 4ZCQA 4D99A 1FTGA 2AQHA 5C8VA 3NETA 1QGUA 1CRZA 2VBIA 2EBUA 3T0FA 1WXEA 1WF3A 5EMLA 4BATA 1HDYA 2PUCA 1OB5A 3F4KA 3M6MD 1A4RA 5F78A 2PWBA 1TQ2A 2RBEA 2VDWA 3HYSA 5IMSA 1T2AA 1QRAA 1QB8A 2VPTA 3COSA 4G86A 2JZOA 3FCSB 4BTEA 4DIBA 4KBFA 3EX7C 4ZT5A 2W48A 3GHYA 4P7FA 4BP8A 3FTQA 4C43A 5B1HA 3OQMA 4UTPA 3P8ZA 2TSYB 1PT8A 3D4LA 3OIUA 2H1SA 4L2IA 3IDZA 4GKKB 1HYQA 4C0LA 1J06A 5E1OA 4DC9A 2Y66A 3A9WA 1YASA 2AG8A 4B4DA 3WICA 1OASA 2MMGA 2NG1A 2ZSFA 3ES9A 2YY6A 4ZKEA 4PN3A 3AUFA 1TKCA 2PL9A 2XR1A 3AJAA 1OX4A 4P7JA 2ALJA 3T7KA 1KH1A 1BVRA 1KZGB 3BORA 3G5LA 4CM8A 5BWCA 5KMGB 4MUKA 3ANTA 2JBAA 3F8WA 3QVOA 4CKXA 2BGGA 2HA2A 1MG5A 2H06A 3K94A 1JKFA 4OLFA 5JIBA 1SKYB 3ONNA 2H2HA 5EE1A 3GFOA 4U6SA 4DCJA 4PAGA 3L8CA 5IKXA 3MYRA 1RQGA 3NHLA 3HJFA 1G6OA 1PK9A 1YZKA 2QRLA 5FV7A 2PKEA 4TM8A 2FGJA 3OCUA 4W9NC 3CVWA 3TIIA 3EG9A 3HVUA 5F73A 2XT0A 3EW9A 1KVSA 3FZNA 4P2GA 4QG7A 4DLYA 2OR3A 4FGUA 4C4YA 5LP6B 4N0EA 3QFHA 2IJGX 1KSHA 1WHTA 1WVGA 2J5QA 2C94A 2QVCA 2X2OA 1FW6A 1XTIA 4W5WA 4DSUA 3ZKWA 4EAQA 4DMUB 4K6GA 4FFOA 4LEIA 1AXEA 3FYCA 4EG1A 3FF4A 1WLYA 4EG4A 1TLFA 4WBNA 2DFKB 3NRJA 1OTHA 1A2KC 2RHWA 1J2JA 2FX5A 1HLPA 3QPUA 5JYDA 2XQJA 3V7UA 4DSAA 3S2IA 1KDPA 2I34A 3QKRB 4JLMA 4GM0A 4WN9A 4MMXB 2QAGC 3GLGA 4MA5A 4PPGA 5FIUA 3FOWA 1CJSA 4HDRA 5A5DA 1WXQA 1ECJA 9ABPA 2Q21A 3M5WA 1RZVA 2AD5A 1SN7A 4G1EB 3VR3D 3TCKA 1ORTA 5CLHA 4F9GA 1GZVA 1BCSA 3CUWA 3U7JA 3HHEA 1DI0A 3IEIA 4M36A 5J4YA 2J33A 2DBZA 5CB6A 3TXAA 1FK8A 5DYYA 3SE7A 1OD6A 3FDXA 1EB8A 3H5VA 1TEXA 3NCHA 4LZZA 3PR3A 2P6NA 1W5BA 5FBKA 3I45A 3TMYA 2F64A 3FGPA 5U1PA 1GAWA 1JEAA 5A3RA 2IYVA 3A28A 2PT5A 4RSRA 1KSJA 1NVWQ 3QI7A 3TEFA 1CJVC 4LPKA 5JAMA 1T3SA 1G2PA 2QZPA 2HIHA 3KZKA 1EXVA 1I4EB 2VTEA 4WGFA 5FJJA 5BRAA 1I4OA 4H7KA 3V1LA 1YCHA 2K87A 2KW5A 2HSZA 1DQSA 2F1OA 2NXCA 1ZH6A 4MV5A 4H6WA 1G0OA 4YCJA 1WW2A 1L3BA 1PJ3A 3DHVA 1ISHA 4L1KA 3TJZA 1DZIA 3ZE2B 2P67A 1RMYA 4BO1A 2GAJA 3CVJA 2B0CA 3N2KB 1RC0A 1V6CA 1FBTA 2QVXX 3QIVA 2EL9A 4JELA 4KHZA 4BNZA 3K0AB 5HCUA 4G3XA 4XRRA 4U6QA 2QROA 2ADOA 1QQAA 4ZI7B 2GFHA 4NV0A 1JLHA 2WVHA 4PFKA 4JSYA 4GP9A 3OTGA 4H16A 3VISA 4PO1A 3ZCXA 3KC2A 4Q1DA 1PAUA 4IY1A 1BVHA 2MINA 1FDTA 4C22A 4L7VA 2K7FA 2W2TA 4LJKA 2BGKA 1EDOA 2D5AA 2V6IA 4G0ZA 4MR8A 5DB4A 3K0BA 5FP0A 3TSAA 5HRUA 4L9SA 3UMYA 3DAGA 1SG0A 1MV5A 1V9LA 2AB0A 3WBJA 1TYCA 5HIMA 3O4RA 3SJBA 3VZQA 2VXYA 4DA0A 4C6RA 5K8TA 4OGGA 4G5GA 4B6PA 5LMZA 2AOXA 1P3Y1 2QRQA 1TU4A 1PFUA 4A6XA 3UCEA 4V0KA 4HWTA 5DTEA 5E9JA 5IJ9A 1WUHS 4B35A 1S96A 1MHPA 2W6IA 5CLIA 4ZEMA 1FFGA 1RQ2A 2GHIA 2LBPA 3JX9A 5BORA 4LG1A 5FNZA 3L1IA 3UJBA 4NMHA 5KQGA 2VSXA 3RAFC 3ZV4A 1VGRA 3CU5A 3LLVA 2PNJA 2CKDA 1UM9B 1Z33A 2YFYA 4MZDA 3WADA 4DIOA 1SC1A 1JQKA 4B40A 3FUUA 5ARDA 1R9MA 2XVZA 3L07A 2V7PA 2IYQA 2BBTA 2XYPA 3P2EA 3WMRA 5H59A 3AR4A 2VHJA 5LD2B 4WUVA 1Q22A 2AI1A 3P20A 1BFKA 1R6BX 1RW4A 5L51A 3E48A 1R4MA 1UPAA 2H5IA 4OQMA 4DWWA 1O4WA 4MS4B 3F3YA 4R01A 3V55A 2XZDA 2B0JA 5AHWA 3NNNA 2YWFA 1JE1A 2MR5A 1NMSA 5A71A 4PYLA 5EJAA 2QX4A 4DXAA 1AHPA 4AJ9A 4I4NA 4ALLA 3PGJA 1GAJA 2HF2A 3CNBA 3OZBA 1YBHA 1U7HA 3AR8A 1G2OA 2CXOA 3E8XA 4QUBA 2WDPA 2PJZA 3IJEB 4P3OA 2C1XA 3FPBA 5D3MA 4HAVA 5HK9A 2B8NA 2OECA 1Z08A 3DT9A 3R5XA 3QYFA 1DRVA 1YNOA 1YFJA 2VPXA 4MVWA 1G8HA 4D9CA 3NWOA 2ZJ4A 1T4CA 4C78A 5JBNA 1ODKA 4YGYA 1LF5A 5HKOA 3RT1A 4DLNA 4KPYA 2ECQA 1SXJC 1P0PA 5HYVA 1SD5A 3ASVA 3ZTWA 4DTCA 2QXYA 4BVFA 2IZ0A 3D2AA 3E9ZA 4K9DA 3KVVA 4XWYA 3WFZA 7AT1A 2JFNA 3GQVA 3K32A 2KB0A 5JOQA 2R8BA 2XQVA 3EGVA 3UWMA 3QNUA 1J00A 4IDGA 3GPCA 4RV9A 1O95D 3TJRA 4AUKA 4DE5A 4BQEA 5KTNA 3G2IA 1DCTA 4ARIA 3REGA 1ZZGA 2RHBA 3DMGA 4NZOA 2Y0EA 3SD7A 2XNHA 2NO7A 2ZJBA 1PSZA 1UM8A 1XLVA 2C5GA 1BDHA 3AVWA 4XM2A 3LV8A 3DVRX 3ENWA 4XGNA 3UOGA 4WUTA 4U0JA 2J59A 2I2WA 2QZ9A 2OSVA 3DW1X 3G5AA 4RL6A 4AB1A 4IIFA 3WB1A 4AZ0A 2BKAA 3RTGA 4Y9UA 3P9PA 2D2VA 3LHIA 3K0CA 5BN4A 3PFBA 5LXTA 2Q1TA 5DV9A 3RUIA 2V1XA 4OX9B 1U7ZA 1Z73A 4QX6A 3CEJA 3IHLA 4IHJA 1JDBB 4Z0HO 3QXXA 3ELDA 4L3OA 1COZA 3FE2A 1BVYF 1FX1A 1NKSA 3AG5A 1MB2A 3AF5A 1Q0UA 2CDBA 3KEMA 3VHQA 3VJKA 4MUNA 1SY7A 2JIPA 4HWRA 3ZXUB 2J5XA 1PR9A 3C3CA 3P2MA 4RTQA 4IV5A 3NHUA 4L4SA 1G63A 2CVHA 2XCUA 2EL7A 5EZSA 2HDOA 3B51X 3SIXA 2BV3A 4IQGA 1NUTA 4HDKB 3G0HA 1SBQA 5HFJA 3K9NA 3I53A 4YRPA 1UXHA 2M32A 4CDNA 5A4KA 2LP4Y 1BU5A 4KSBA 1JQ5A 4TKLA 2VP0A 2OFWA 3MTGA 4NCHA 5A4IS 2DWUA 1VLMA 1YBAA 2YQZA 4GVXA 2WQ7A 3QVMA 4EVSA 4JT8A 2XT6A 5TPZD 1GFWA 1Q16A 4M87A 4OU4A 3MXOA 2BUAA 2C31A 1GSAA 4MPPA 4HTFB 3RD5A 4BWGA 3JR7A 1BCSB 1UBEA 4FLMA 1P3DA 4L3VA 4Y98A 5IK2A 1FDIA 1VE9A 3QU2A 1E2GA 1PNRA 1H9BA 4LIPD 1CVLA 1FTYA 4ZXPA 3PGVA 5H9VA 5FPHA 4F3YA 3ICPA 1C7QA 1S2NA 2P2SA 1XDZA 4H4DA 1ZKDA 2Q3HA 2ZBRA 4IEEA 3TRIA 1PJ4A 1GDDA 2P9ZA 1GGNA 3K8YA 3QLJA 3PF8A 3MPUA 5BRNA 5FPQA 4HV4A 3VKUA 4CCYB 5CA0A 3MN1A 1YTLA 2HMSA 5HG0A 1D4FA 3KO8A 1KGSA 2NPFA 4ARZB 3BBLA 4DIKA 4P3YA 1FFSA 5IDVA 2F9LA 1JT2A 2ACKA 4IAOA 2PLAA 5CH5A 4CM9D 1O96A 2OMEA 2C07A 4ZZ1A 4AWAA 4WJLA 1PJ2A 4W9NA 1G20A 3E84A 1M5TA 3TLGA 5KSOA 1NX9A 2BGWA 3H3JA 4Z9XA 3RU2A 4U2KA 2H63A 3IQXA 4PBSA 3ZGNA 4IVRA 1DKRA 3C6ZA 5AI0A 5BPHA 1H0HA 2QP4A 3EG9B 1B6GA 1FNDA 4AWXA 3ZIDA 1KZ6A 2OO5A 2IOHA 1TMYA 5HBRA 3ESCA 1U7UA 5HR5A 2PUGA 2IEGA 3P2IA 4EB6B 2ZVQX 3GEBA 4E46A 4MV9A 2HR1A 4QDUA 3EXHB 2ISQA 4RUKA 5IBPA 4YAGA 3CBGA 2ZM5A 4DC1A 1WDMA 5IJWA 1UWLA 2ODTX 3FBTA 5KYGA 4B4VA 3KV1A 5HKKD 2G9QA 1MO2A 1T0PA 1TLLA 2O8NA 2VZLA 2WWWA 2OQRA 1TEHA 1KFJB 3GNTA 3PGLA 4GAEA 4LDPA 4P22A 3SXUB 2R6FA 4FLFA 2Q5CA 4PN7A 3M6WA 1PL8A 4FX2A 4MS3A 4F2DA 1MB9A 1QFYA 1V47A 1ZINA 3D1LA 4OM7A 2K4MA 4BQOA 1MJGA 1KC3A 2PKQO 2FSSA 3RRBA 3ZBQA 4BNUA 1WCIA 2RK3A 1U1CA 3ORRA 4XARA 4ME6A 2BFOA 3UO8B 2GWHA 1LV7A 1O97C 4QOHA 2G40A 4KFTA 4ZAGA 4CQMA 1XDUA 1ZONA 2Z8ZA 3O0TA 4TV9B 4UQPA 3BL6A 4JYZA 4N48A 2OHXA 1TM3E 4QE3A 4ZZIA 1MV8A 1ORWA 4NZPA 1W1IA 4P8RA 4R9RA 1B3RA 2W00A 4C01A 4LWPA 1OV6A 4URFA 3I8OA 3MGAA 3O5AA 4PYIA 5U4XA 5GIPE 3F5QA 2ZB7A 2AD1A 4DQXA 4ZI7F 1KJZA 4KJZA 1XNGA 3NHFA 4CNBA 4Z7OB 1A8PA 3OFVA 4K9NA 4EYKA 2IWRA 3RTCA 1RWPA 3IAXA 1X7HA 3SF0A 2Z98A 3TLJA 4F6RA 5JFGA 4B3RB 2W6QA 3V4PB 2C7VA 2QVLA 4RMJA 4MS3B 3UK2A 1G5QA 1XPRA 1ISJA 2ZITA 2Y1DA 3TLKA 4A3SA 1OQAA 2BTOA 1QE3A 1Z9BA 4UC0A 2C5LA 4FSHA 4O1HA 2AXQA 3A3YA 2HSEA 4NPAA 5CW2A 1EUCA 2YOFA 3KZVA 4G8DA 2V4MA 3L8MA 1KK3A 1SXJD 2WHPA 1JP7A 3IRVA 2QYSA 2AJTA 3QP9A 4Q9DA 5IVKA 3I4LA 1ULTA 3CXRA 1G8PA 2JASA 4NSNA 1XKXA 1ZD3A 2F00A 2H52A 3CCFA 5A4DA 4UZFA 3L8FA 2O8BA 5CXUA 2ZE7A 1EG7A 4RLFA 5JPCA 1X3LA 1CLUA 1KGDA 2WVAA 4M49A 4GXTA 1U7XA 4ESOA 3I0NA 4YRFA 3FDFA 2YNMA 2C2HA 1R6TA 2X14A 5BOSA 2R7MA 4PCLA 4LE0A 4BYMA 2ZJOA 3TL2A 1X1AA 3OJEA 3WP1B 3UPTA 3EULA 4XTRA 3HN6A 1WOMA 4P4UA 3TAXA 2VP3A 1C9NA 4RD4A 3GLQA 3UJHA 4CG3A 3ORQA 1O4VA 4LK3A 3GFFA 4Y6RA 2OB1A 2XMGA 1ZICA 3OA2A 3VKWA 3U4QA 1XALA 3EFHA 1K8ZB 3G9QA 2VJLA 4CDRA 4LI3X 4PFSA 3R9XB 3HU5A 4ZO8A 3BHIA 1JLLA 3H5NA 4PC6A 1JJAA 2HW8A 5A0FA 2FPPB 4H6PA 3C6MA 4GR9A 5GV7A 2UXDB 2HCJB 1C8VB 4OA5A 1N6KA 1OPXA 4A27A 3E6AA 1A77A 2QK4A 5D1HA 4KPFC 4BVEA 3JQCA 4J16A 4TZ6A 1NJ1A 3NBMA 1Z12A 5FAXA 4ZAXA 4W82A 4AN1A 4JX9A 3VC2A 1NX6A 1RM4A 2O8CB 3LCCA 4OJKA 3M4ZA 4D6YA 1CQIA 6NULA 4C4AA 2OAP1 4I99A 5IJXA 2WBLC 3SC2A 3ZE9A 3P0HA 5K6AA 2RGRA 4YUWA 2D0IA 3C45A 3I12A 2R2GA 1TT5A 1SBCA 1ZXLA 1VHJA 3RKRA 2RB5A 621PA 4UZSA 3AHHA 4OBBA 3B7WA 1QC5A 5DEIA 3IAEA 5GM2A 5JZBA 3GD5A 1WKVA 3AFNA 3BPSA 3EBPA 1LY1A 1DQNA 1HDGO 3WWCA 1TL7C 5A04A 2H4ZA 4DBLC 2AKYA 3FW1A 3HJTA 3K92A 4TRJA 1SHKA 3S8MA 1N0HA 1QHYA 2EP8A 2PL5A 4OGKA 3RWMB 1Z6XA 4Y1GA 4ECAA 3RROA 1Q74A 5KHAA 1RPZA 4N18A 4I5EA 4NMWA 2V7VA 1Z0FA 2W98A 5CFMA 2BZSA 5A2GA 4JBNA 2YMLA 1S3GA 3WV5A 1TCVA 3OJWA 1UT8A 5ALSA 1QZXA 2DFPA 3OMWA 4JI5B 3J81A 2UUOA 3CZMA 3HKCB 3W1EA 2AXEA 1B23P 4O8CA 5JY6A 1ZN8A 3P5SA 4RY0A 3ZY5A 1Y7LA 3K09C 2QGFA 3ZXSA 3COZA 4CGYA 2AN5A 5LKRA 1F8UA 2G63A 4NHEA 4GKJB 2H9YA 1L8LA 1DIOB 1FTNA 5F64A 2ZUEA 1IM8A 1EX6A 2PZFA 4HHEA 1L6RA 1RZRA 5A0VA 4IRUB 4FNOA 2SHKA 3DZKA 4TSFD 4PC1A 1WTCA 2OFFA 3ZZTA 4RTJA 1H4QA 1ZW1A 4FCCA 1QFJA 5CT4A 1P7ZA 3CF6R 4OQFA 4EKEA 4KQXA 3AJ9A 2QTVA 2LIPA 2PIAA 3D6JA 4PZPA 2C95A 5ALKA 3O6VA 2OQIA 3E1GA 2Z30A 4Z0NA 3RFFA 4DV3B 1R5OA 3C3MA 1XLTC 1B0PA 3GEDA 3L5KA 1ZDMA 1LC0A 2BM0A 2NM0A 5DM2A 2WFMA 2QL5A 1IOWA 2UV8A 3CNEA 3RC3A 1JA9A 2Q6VA 4EMUA 3PJRA 2B6NA 1SKYE 1YQDA 4MARA 5BYBA 4LBVA 1N8TA 3UUGA 4CL0A 1N7GA 3JQAA 4LSWA 4PFJA 4TLBA 5ALNA 5BVGA 4IWYA 3QWIA 5K3OA 4AI6A 3OI7A 1SR8A 5IKOA 4EEZA 5ALVA 2CL5A 1B73A 1CFJA 2P5TB 1YDEA 1SCNE 4MEJA 1E96A 2W8BA 3ECSA 1YZHA 1X6VA 2MOKA 4M0DA 4YIHA 4I19A 4FGJA 3R76A 2HBQA 2NZWA 1OIVA 3M4XA 3L8GA 2GN0A 1VLQA 1HZZA 5DULA 4GG1A 3A2MA 5BQOA 3SKVA 4OUDA 4FYPA 2P2YA 3E1SA 3AHGA 4BGUA 1W88B 3IHWA 4O2BF 1SFRA 3N3BC 3ZTYA 3EUWA 2B4TO 3OSZA 2F3SA 3NBZC 1ZO8A 5FLYA 4ZDIA 4C6SA 5J2TA 2DWQA 1PFYA 1XQ9A 4EX7A 1ODSA 3GJ4A 4KSCA 3TSCA 2G71A 3TSYA 5AVTA 3LWNA 2MU1A 4D8YA 4Z54A 5AQEA 4P0QB 4D0NA 3A9TA 4YFYA 4NECA 3DV0A 4MVJD 5LYJA 1KZHA 1MOQA 3QPCA 3DLHA 2PH3A 3IIMA 4I46A 5CEFA 2QJFA 4H9GA 5CPFA 4U2FA 4EITA 2AW3A 3EZ7A 2W6JD 2W71A 5DNAA 3GCGA 4N5MA 3QZUA 3UV6A 1WBBA 4KLRA 5DISB 1XXHA 1NOKA 1CZHA 1ULUA 2QN3A 5ESRA 5CG2A 4F9TA 3A6PC 5JLJA 1QTIA 1MX5A 2OCKA 4E2YA 4CEIB 3TOXA 5AI4A 2F8LA 4YMVA 1MX9A 2G5TA 2I1WA 2PEYA 2XYRA 2FZWA 3N2GA 4UW9A 1A27A 3TMAA 3V4FA 3GFGA 3RHTA 1THMA 1QRUA 3QVVA 3MMXA 4K9PA 4O5OA 3SLRA 4ZEXA 3JD0A 1CE8B 2JDID 2V6FA 4PGHA 2CLHB 1DS6A 2PX4A 5BRJA 4Q4JA 5T4FA 2A5DA 4IEIA 2W58A 1XB2A 1NBWB 1N2CA 1COWA 3HKBA 3FETA 2X6QA 3GRUA 5JZ9A 1QK3A 1NXVA 1CJUC 4FFRA 2Q07A 1QIKA 2AQKA 3IUSA 3S7ZA 3R7FA 2OXTA 2A9VA 1R9JA 1TTTA 4OOFA 2JGRA 4G81A 4YO8A 1M0EA 1GT6A 3FCXA 3QU9A 1OREA 1CR2A 1TYZA 3CUTA 4EUKA 4MQMA 2WD8A 1KYIA 1DEOA 1NP3A 1HE5A 2AA3A 4L73A 2GD2A 3NOXA 4MTLA 2VRCA 1KIMA 2JJMA 2O2EA 3IR5A 3WFIA 4BE9A 4WNAA 4YJ3B 4CM1A 4D9JA 6GPBA 1P91A 4B2IA 4WLUA 2VJYA 3JSAA 1BHQ1 1KPGA 1KH2A 1Q2UA 3JVDA 4TL9A 4DUYB 1JAXA 3ZJ4A 1CR0A 2FR1A 1HZJA 2QG9A 2QTCA 3ECAA 4R69A 3W5BA 4CEHB 1PZMA 1Y9EA 2YFKA 4FGLA 1NQTA 3U7QB 1KEVA 2IYTA 3T4XA 2BJVA 3JD4A 4LXHA 2X8WA 3ZBUA 1QRSA 2O48X 1XZHA 3PEUA 1OI3A 3OEHD 3D7NA 3SF8B 4AMYA 4HLCA 4F5EA 5MGBA 4W5RA 3SIRA 5JQGA 1XAHA 2ODPA 1T4DA 4R68A 4DCSA 2JFUA 2P4EA 5T7BA 2NLOA 1XZMA 3T06B 2PD4A 5CDHA 2P75A 3QFSA 4RHXA 3VOBA 3A2NA 1N2CE 1KYXA 3GEGA 5LDHA 4JWTA 2M98A 4D4MA 4ZMSA 5T8KC 1CEYA 4B6EA 2EJBA 5EWMA 1SVKA 4JH0A 4CV3A 1Z0KA 2VC2B 3F8TA 2D2FA 2BDTA 4JZYA 5TGDA 4DIDA 1RPTA 1SCDA 1OFVA 1WIWA 2HDNB 4IG4A 4CL3A 1P4HA 4E1VA 1Z06A 2CJWA 4LECA 5IM4F 5JLAA 3FJOA 5DHPA 1ZUWA 2FWMX 4UCFA 4IX1A 4UTOA 1NVXQ 4LBWA 5HDBB 5ARBA 3NANA 5CA1A 1MORA 2YZ2A 3NNSA 3AEUA 4JL6A 3AF0A 3A7EA 4JJ6A 1K5PA 3D2BA 1SHTX 3R9IA 1N8SA 3PRJA 4KGZA 1N36B 5B58T 3FUXA 3ODGA 2BJHA 3W34A 2IUEA 2ID8A 2V4ZA 3C4JA 5DTQA 2DPLA 2YDXA 2RAVA 4E6EA 3LKBA 3AVOA 4XIYA 4KO8A 3HC7A 1J21A 4LV6A 3UAGA 4CMKA 4Z6KA 5BWLA 5BVHB 4OQYA 4IG9A 4L8FA 2YVKA 3EEBA 3TE6A 4NBSA 4XCXA 3TXYA 1E4EB 1Z83A 4Q66C 4OREX 5LIPA 1HQCA 3E58A 1QIMA 2C9CA 5E3IA 1E60A 1XR3A 3G0CA 4IWXA 4YDHB 1E1CB 3NT5A 1CVIA 1OX4B 2V1UA 4HD8A 1N8KA 1NVFA 2VPWA 1N7IA 3DL4A 2A88A 4FJ2A 1JIIA 1A5ZA 4TXNA 1K92A 1E1LA 2HK6A 4B6GA 2GPAA 4JLUA 3RS9A 4GDFA 1DAIA 2ECFA 3M4YA 3W06A 3V4RA 5I9IA 3CLTC 2OV2A 4FXOA 5TEWA 4X8MA 3L41A 5LBUA 3OC6A 2FU5C 3MERA 5IC6A 1TD9A 4DV2B 2ZU0C 1L7PA 3AIKA 4C4TA 3WMGA 4BJ1A 1AHIA 1T35A 2D13A 1TA0A 1U9CA 1VRWA 5FCDA 2EG9A 3P0IA 1IY2A 1N5DA 1N9GA 1F3OA 2D8MA 1W93A 2VN8A 1MC8A 3AHDA 2GN1A 3OBBA 1QO9A 5DP1A 1J99A 4LY9A 4HNSA 4GBED 5E1MA 521PA 5CBPA 1ZD5A 2GM5A 3H8WA 4CG2A 3RSLA 3WGQA 1RBYA 1Z0AA 4M1KA 3C97A 3CZRA 2IXDA 3OFSA 4O33A 4IIUA 2NX2A 4ZO4A 5F33A 2CJWB 1K0FA 2ZI3A 4I5DA 1GTSA 2IYYA 4L8LA 2IPNA 4OJTA 2YBEA 2F3TA 4AXBA 1RP7A 3AUTA 5IYZF 1N2GA 4FT2A 5C37A 4EJ0A 2EW2A 1X87A 1N7JA 1HG1A 1VLHA 2R87A 2WEKA 3IILA 2H9IA 4NYMR 3E82A 1Q77A 1UR5A 2AXNA 4WCFA 1G6Q1 4DZZA 5D86A 1I1QB 5EP2A 4X66B 4RLQA 3VZSA 1FP6A 2DWCA 1P5ZB 4X7BA 5K0NA 4DCUA 4LJ4A 1E1CA 3RFVA 4GOJA 3YASA 3PVSA 4FS3A 4AO7A 4J29A 1AKQA 4BU0A 1O97D 1T13A 1QX3A 2OCDA 1MO5A 5ALTA 5HEKA 4E2XA 2HQSA 3ZPXA 1XZPA 3QVTA 3R3SA 1YMUA 2JRCA 2VIIA 2HC9A 4UE2A 4CMCA 1PR4A 4O29A 5FWXA 5E9QA 1MJGM 1S1CA 4TSKA 3FPKA 3ETJA 2WU1A 3M1LA 1NT2A 3MCWA 2LE0A 3MSXA 1XK7A 5U4QA 5CB4B 2XBUA 5AMXA 5CM2Z 2WUVA 5I7AA 1AHNA 3LBAA 2LWIA 1T5HX 3Q1LA 3Q9UA 4TKZA 1SG6A 4RU1A 2WHEA 3ZH2A 4BUZA 1QWOA 3MWEA 3OMLA 3T1VA 4CHGA 5CA1B 4G9GA 1JXMA 4B3JA 1FXWA 3RUFA 4LSZA 4K5QA 3BGVA 4NYMQ 5B2ZA 1QZZA 4E3ZA 1PR5A 3KSAC 3PLRA 3VU8A 3KU1A 4LYEA 4OXIA 4DWVA 4FQ8A 3K9BA 4IZHA 2ZBQA 3F1KA 1GG9A 3IIKA 4YI5A 4HNGA 1TF2A 5TJHA 3VYVA 4GL4A 1YA8A 3NNDA 4QIHA 2EKPA 4XEUA 1FFHA 4L6IA 2W2LD 5K51A 5ES4B 1OVGA 4B4OA 4LHWA 1VM6A 3GG2A 4ZVUA 3KYIB 2QD2A 3LBHA 3FG9A 4HAWA 4Z53A 2RGCA 4NE7A 3P5BA 3G2NA 3PCRB 4BNJA 3CSSA 1YRHA 4BVKA 2Q46A 4QU8A 4E13A 5LJIA 1R8SA 4B76A 5T4BA 3V9AA 1YZQA 3I6MA 3UMRA 3LC7O 2GK6A 3B8EA 4F12A 1W49A 4O08A 5B1SA 5KQMA 3TGPA 3VOTA 2UVQA 4GPTA 1SXJA 1HL7A 1B2RA 1ABBA 5MF6A 1RYMA 3I01A 3ZJYA 3I6BA 1QGDA 4K86A 2O0HA 4UU1A 1OZ0A 1P7CA 1G0NA 3LC0A 3OM8A 3WHIA 3RUHA 1E4OA 1WJGA 3ZZUA 2QR3A 5LQCA 1TM1E 3KETA 3WOVA 4BZZA 1UAAA 1FP4B 5J2UB 2CNWD 3L43A 4HS4A 5I4CA 2R00A 1SCKA 4GMXA 4CHTA 4JP1A 1P4GA 3JVEA 1EDZA 1ML3A 2WHQA 1K86A 1YI0A 2PH7A 3O1IC 1MIHA 2RI6A 1M0WA 4O2AB 2J67A 5LLSA