1CJMA

Human sult1a3 with sulfate bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
286
structure length
223
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQRVPFLEVNDPGEPETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLGDWKTTFTVAQNERFDADYAEKMAGCSLSFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human catecholamine sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTEIN (ARYL SULFOTRANSFERASE)
total genus 70
structure length 223
sequence length 286
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cjmA00
3UMRA 2FSHA 2C04A 4IFEA 1GTVA 2HEIA 2WJHA 4Q02A 3QSYA 3AVPA 1Z0DA 2CL6X 2DB3A 1SGWA 4UNRA 3L82B 5JS7A 5DN6D 1ZNXA 2PCJA 5EZ6B 2Z4RA 1X86B 3GLGE 3K0CA 2R9VA 1YJ5A 3GEIA 1C4OA 5TB5A 4ARZA 1NJGA 2YC2C 1RPZA 1WQ1R 2GCOA 3VKWA 1S9HA 1R5BA 2ERXA 4DSTA 4ZKDA 3QUSA 5E7JA 1LF5A 1X1RA 2XOKA 3GJXC 4MUAA 5EXXA 1OXVA 4UJ3A 3LXXA 2FFHA 3NG1A 4QRHA 3KJHA 2IBMA 2OO7A 2A5JA 4GMDA 1E99A 3C7KA 4BLPA 3QXHA 4DLRA 2O52A 2OESA 4E5UA 2W00A 3PQCA 1AS2A 2KE5A 3C5HA 4KFSA 4IFBA 1FW6A 1FP6A 2ODNA 1WRBA 5E3HA 1NP6A 2D4HA 2X8AA 5DISB 4B33A 3CPHA 3TRFA 4JLVA 3TKLA 4RD2A 2NGRA 2XJ9A 1R0YA 3H0KA 1NN1A 3TMKA 1XEFA 1H8ED 4F92B 4PPFA 1OSNA 1SXJE 4QHTA 2G9NA 1K8RA 1UBEA 1YZKA 2B6HA 4IVQA 2ZSFA 3WNDA 2RCNA 4DCTA 2XTMA 2CXXA 4BLRA 3TUZC 1ZP6A 2V7QA 3I4LA 4JLDA 3OESA 5AJWA 3V4RA 2XJ4A 1RJ9B 4MUBA 2IWRA 4C2UA 1PLKA 3C15C 2VHTA 1BS1A 2J5XA 1KSFX 2KB0A 4XIGS 4Q4AA 4MYUA 5FUVA 2IYQA 3BRWD 4FMDF 1MV5A 4OBEA 5FUXA 2R44A 3PUZA 5CB8A 3V4FA 3THXB 4ESVA 1WXQA 4RD4A 2WPDD 3EZFA 1US8B 3A1WA 2V6IA 2P6NA 4B3BA 1AIPA 1FNNA 3SBDA 2ZJBA 4B44A 4YXWD 5KO2A 3CF6R 2HXYA 2IS6A 3W5JA 4Z51A 2OM2A 4PR0A 5LD2C 1VCNA 4MGZR 1XJ0A 2RGNC 4HLCA 4TL8A 1Z22A 1M34E 2ZQ5A 4Q1AA 5M04A 3KTAA 4HAUA 4AKIA 5KNCA 1IXZA 2BHRA 2KBFA 5JI2E 1LS1A 2DHRA 2ZI5A 4C7OA 1OIXA 1W0JA 3BH7A 5BYKA 3A8TA 1NJFA 3R9XA 3ZZTA 1LTQA 4C0KA 1QHSA 4DBLC 2YVUA 3AVWA 1NBME 4Q9JA 4Z8XA 5E95A 3U7FB 3MAAC 4IHQA 4PHGA 5B57C 3GEEA 4LJ6A 4I1UA 3CNLA 3T35A 3VR1A 2WWWA 1XD2B 4GOJA 1PZNA 1II9A 1XMVA 5EJEA 2GCNA 1IHUA 1E79D 1DOAA 3AQ4A 3F0TA 3PUVA 4P4SA 1WA5A 1J99A 1U98A 4FMCF 3AF0A 1HH4A 4TL6A 4PQRA 3Q5EA 2EFEB 5DI9A 2FSFA 3L43A 4DRZA 1E2HA 1KMHB 3NDPA 1XTJA 3WMGA 1G21E 1P9NA 3SI7A 1YRAA 1NF3A 1XU4A 3AVQA 2JA1A 3L8ZA 3B9PA 5ELXA 4B43A 1VCMA 1OE0A 4PHHA 3K70B 1SXJD 4MDEA 3B85A 1HT1E 4U02A 2W6JD 4JBXA 4L5BA 4OHZA 3BB4A 4A6PA 3PEYA 5TXGA 2QT0A 1E2LA 3OFND 5AK0A 1N6LA 2ZYWX 3X2SA 4JVSB 4DLYA 4V0LA 2NZ8A 3BB1A 2AXPA 2GBLA 2QT1A 1LVGA 1NVXQ 2FG5A 2IYRA 2JIZD 3KFXA 2JAQA 2GXUA 2REBA 2WOOA 2VP9A 4TMZA 4TSFA 3RS5A 1Z0KA 4BE7B 2EFHB 2ODEA 1ZINA 5IHPA 3K0AB 1D8TA 1JB1A 2NZJA 4LUCA 1XCGB 1QDEA 1SVMA 2FSGA 2HT6A 4B47A 1DAIA 2BWJA 5EXTA 3UIEA 4OJKA 2BMJA 2VHUA 2IXFA 3B1YA 2XOKD 3A4MA 4HAVA 5HKKD 1CR1A 4Q1EA 5HZHA 3WYAA 2PX0A 5JEDA 3K9HA 2PCLA 4RVCA 1UDXA 1OJLA 4A6XA 1EFRA 1CKEA 3NKVA 5JSZA 3VR4A 3AVOA 4LJ5A 3RAPR 3MD0A 2H7VA 2CE7A 3D6TB 2CDNA 3DMNA 4D2IA 1N5LA 3GLFE 3BK7A 4IOKA 3U4QB 4TYNA 3WMFA 4Q48A 5IDVA 4ARZB 5J4LA 1N6KA 4LHZA 3AGPA 1KGDA 1CJTC 1HY3A 3PXGA 3ZVLA 1GP2A 4DSNA 5JCPA 4JLJA 1IN7A 1RZ3A 2CK3D 2DPXA 5H70A 4QM7A 1H8HD 1QZXA 1XTRA 1AZSC 2QTVB 4DCNA 5TY0A 2WM9B 4WVFA 3P4XA 3CM0A 1RIFA 1K5GA 1KI6B 1P2VA 2CEAA 4BFUA 3MG9A 3BIFA 5FUWA 2OBNA 1N2CE 4K8OA 2GRJA 2HV8A 3LO5A 4IOLA 4OQNA 4HUTA 5JJLA 5FBLB 4PAMA 1N6OA 4TZ0A 3KFVA 3E2IA 2ASEA 1G6OA 1VMAA 4WA7A 2ZREA 4CEIA 4TTRA 1E2JA 1DTSA 2HUPA 1P72A 4LV8B 3VAAA 4TQ9A 1Z0JA 2WWHA 1NVUQ 1GDDA 2EU8A 1M1YE 4V0OA 1DPFA 5J40A 3EPJA 2CE2X 4DDTA 4Q1BA 2GA8A 2Q21A 2V1XA 4URVR 4AKEA 4KFUA 2J7KA 2I1QA 2NPIA 3BH6A 5E7IA 2RGNA 2WICA 4M8NE 4FIDA 1KI8A 4LHVA 5HCIA 3SBEA 4IDNA 4EQ6A 3ZVNA 2GJSA 2QN6A 1W4RA 1XBTA 4K46A 1FX0B 4NYMQ 5K8UA 3TNFA 2O8FB 2W58A 1Z63A 2IK8A 1M74A 3E5HA 3A1TA 1Z6XA 4AK9A 4NCKA 3EZ7A 4F93B 4MRRA 4CEJA 1BO6A 4GPTA 1U90A 1US8A 4AG6A 4Q5IA 3IHLA 1KZ7B 1QG2A 2OLKA 2F9MA 2Q3FA 2VHJA 1Q1EA 4TLCA 1CLUA 1GNQA 2BCGY 1W36B 4ZDIA 1H65A 2G1KA 4DLSA 1U0JA 1MO4A 1ZYUA 4BFYA 4NDZA 1CULC 3L0IB 3SOPA 3U61B 1EFCA 4TLAA 4UJ5A 2QA5A 3L2OB 4ACBA 1HUQA 2WBLC 4UXIA 1HYQA 1KK3A 5FL7D 5AJZA 1FZQA 1U81A 3DZ8A 5G41A 4NYJQ 2WWYA 4YDSA 3NBZC 2FEOA 4CZ2A 1ETUA 4HAYA 4A2WA 1ZC3A 2ANCA 3Q85A 4XD7A 4TYWA 3EZ6A 3ND9A 1G4UR 2FV8A 2RKOA 5FUYA 4B3FX 1U8ZA 3EA5A 4KLNA 1HV8A 3M1IA 1TU3A 4RD6A 4C0QC 1YR6A 1KZGB 4PPNA 5C18A 4PTLA 5G3YA 1E94E 2ZJ5A 1EX7A 1E1QD 1HE1C 3CONA 2RHDA 1YQTA 2IL1A 2B7BA 2AFHE 1YR9A 4A82A 2IUSA 2VYFA 2ZI6A 5DO9A 1W5TA 1IJFA 3NBYC 3J81k 4BZXA 4YMVA 2AHOA 1FUUA 1I2MA 2BM0A 3EC2A 3DL0A 2P3SA 1D5CA 1GL9B 3CF2A 2B7CA 1EFTA 3A58B 4LJ8A 2NG1A 2ZVPX 4G5GA 2H8KA 2PBRA 4RJLA 1Q22A 2F7SA 3CRW1 1ZUHA 1TQ4A 3JZAA 4E03A 3C14C 4ZCLA 4PO8A 3WP0A 4FWIB 1XMIA 4A0FA 5EXSA 1CTQA 1ZMXA 3GFOA 4GFDA 4QXAA 1GILA 4BRWA 4Q4AB 3U44B 3PG5A 3EWAA 2R6DA 2P67A 4V0MA 4GP7A 4B76A 2C98A 5EP3A 3WXMA 5KHOC 1KDPA 1YR8A 3QPUA 3K70D 3TW4A 3AKCA 1QHIA 2CJWA 4IXMA 4QBGB 1OHHD 3KKNA 1G7TA 1T9HA 1Y3AA 1Q21A 2F1HA 2Q9CA 3CBQA 1ONBA 1CR0A 1XEXA 1AM4D 3B82A 3P4YA 4ABYA 4G01B 2EQBA 2XNDD 2WSSA 3KX2A 4W5JA 3HU1A 2N42A 1DAGA 5A4JA 2EYQA 1YR7A 4NONA 1W36C 4KODA 2CL7X 5L3SB 3I73A 5KPDA 2AD5A 1HA3A 1ZAKA 4HDOB 3AVTA 1E69A 3NBXX 3VNVA 3QXSA 4R2HA 2QAJA 1NN0A 3U3JA 4AYXA 2VP5A 2IS2A 2HF9A 2J7PD 3C16C 2K5UA 3EARA 3SHWA 1EFRD 4LPKA 1KJYA 1NLYA 4B2LA 4Q4LA 4JSYA 2QZ4A 3CNOA 4C4PA 4NL4H 4UKDA 3LVQE 4M9QA 2O8EB 521PA 3IEUA 1IQPA 1T0JB 3O8RA 2FX3A 4OQXA 1TF5A 1T3LA 2ZS9A 5CIQA 5GJVC 4KVAA 3CO5A 5JECA 5HZKA 1IM2A 5FPSA 4EKDA 2GJKA 3B9QA 2JCSA 3P1JA 1KTVA 3THWA 1BMFA 1SULA 2AKYA 3KL4A 4FMCB 2FZ4A 3PJRA 3DKPA 3PENA 1JPJA 4QGGA 3K53A 1KKLA 4B34A 1GKIA 4DB2A 3IO3A 4LYJA 2IF0A 3NHAA 1G7SA 3TSZA 3FFAA 1E2EA 5FBQB 4KBFA 1SVLA 2YOFA 4HAZA 2R8RA 1KHTA 4P32A 2AXNA 2HCJB 4LDJA 1FOEB 3U6KA 3LFUA 3MSXA 2JJ8A 4BZPA 4UXHA 2A78A 3A1SA 3K9NA 4DLUA 3EIHA 1VYTA 1Q1BA 4MYCA 4O2RA 1XXHA 2O8CA 3HDTA 4Q4JB 3TAHA 2GEVA 2A5DA 1FTNA 5DYGA 3T1QA 3B2EA 2XXAB 3UXMA 4OQLA 4D0NA 3LRPA 5JJIA 1G1MA 3OEED 3MUFA 1OPXA 3F3YA 3MJHA 1ODFA 3QXJA 5DLQC 5KPJA 1Q1ZA 2A5GA 5DIFA 1G8PA 2BM1A 4JLOA 4NH0A 4A0HA 5L3QA 1KO1A 1ZM4A 3KTAB 4EPWA 2IXEA 3KKPA 4HEJA 4JJKA 4PX9A 2VHQA 1KI4A 2FPLA 3TIFA 2O8EA 5J4KA 3ZVMA 3REGA 3DEFA 3TLXA 4ZKEA 3Q9LA 4RZUA 3KJEA 3RRZA 3SFZA 3AGQA 3NEYA 4LX0A 1XFAA 4A0GA 4BASA 3AEZA 3WBJA 4RZ3A 3OFNA 4W7SA 2WMOB 3GJ0A 3DVLA 1CP2A 2IEYA 2NO6A 1RRPA 3VTKA 3KXIA 5DHAA 3AKDA 1KO8A 2YKGA 4OI4A 3KJGA 5FPKA 3BGWA 2ZRCA 1EWRA 1VG9B 2NO9A 5FOUA 3DM9B 1DEKA 2X77A 1PLJA 3HU3A 4DVGA 4R7ZA 2F1RA 3IBYA 2V7QD 3GLFB 4MRVA 3ADDA 2P5SA 2WJGA 2ECKA 4EFNA 4BPBA 2ZRDA 1U0HC 1Z0AA 1OB2A 4CEJB 2PL3A 2IX3A 5EE5B 4M1YA 2OZEA 2V54A 3HPRA 2AN9A 2JATA 4WXRA 1NBMD 4XVUA 2AX4A 3LBIA 1M7GA 3WNBA 5JI3E 2QM7A 3FMOB 3RSOA 3I72A 3KQHA 1JR6A 1Z2AA 3PUWA 4CRWB 4D6PA 3NH6A 1NG9A 1WCV1 2GZHA 1MH1A 2LWIA 2EWWA 2VF8A 2Z6VA 2QROA 1MR3F 3AM1A 1AGPA 1QBKC 4A0RA 2WSSD 2CHVA 4XSHA 1T91A 1VECA 2Q6TA 1WMSA 1E9BA 3RS4A 3R20A 1VHTA 1MO5A 1XZPA 1MRNA 4WZAE 4X8LA 3IHWA 3Q7PA 2ONJA 1IY0A 4KYUA 2IC5A 5JWHA 5JBQA 5JHGB 3ZYCA 1PLLA 5DHFA 3LD9A 3FMIA 4Y0AA 2X2FA 1DAHA 4TYQA 5EE1A 3SYLA 3MRSA 2BMDA 1G3RA 2Y8EA 4AD8A 3W8NA 4DIEA 2DY1A 1GUAA 4IJMA 2P2LA 1NMYA 1XD9A 3SJCA 3MWJA 2ZS8A 1XEXB 1OH7A 3B13B 3KZ1E 2XGJA 1J8YF 4LRWA 2JLSA 5EE9A 4EAQA 5A5GA 2CLDX 3M0EA 4ZDWA 2GF9A 3BAFA 3IQWA 2YHSA 4CGZA 1CRQA 4BFZA 5BWMA 4BZQA 3R8FA 3ADKA 5L8VA 2DWOA 4A1FA 4NYJR 3EASA 2FPMA 6Q21A 1KY2A 2DR3A 2J87A 3QE0A 5CK5A 1J8MF 2QMUA 4Q7LA 2ZR0A 5C1BA 5CLLA 3SEAA 3QXXA 3OE7A 4NPHA 2WKRA 2B8WA 3QF4B 4XTCS 1N0VC 4RD1A 3RS0A 2FGKA 2QP4A 5SZKB 2NPFA 2PJZA 1DVRA 3N70A 1J2JA 3EA0A 2PT7A 3GFPA 2FMXA 1G4AE 3VU9B 3CRMA 2NOAA 5JZVA 1AK2A 4ZI3A 2YWGA 3UMSA 3U3RA 3U5ZB 1OT3A 1JQLB 3QF7A 3THWB 4B6FA 1PVOA 1KDTA 3TUJC 2X19A 1IN4A 3P32A 3QVVA 4EJSB 2QENA 5HCNA 1LS6A 5IK2A 2CK3A 5JJKA 3ZQ6A 4PZLA 3LQRA 1E98A 2FOLA 3FYHA 5EZ5A 5FBVB 4A8JB 4G3XA 3FE2A 1F6BA 2DFTA 1R10A 2GEDA 4O0MA 5CITA 3B1WA 1OKKA 3NC1C 2X1VA 2JLZA 1BH2A 1E2FA 3GJ6A 4TLBA 2HYDA 2OT3B 4LHWA 1VTKA 2GDJA 3CWZA 3P27A 2Z4SA 4Q7JB 4B2PA 3I3SR 4MH0R 3DZDA 1YZQA 5LBIA 4XWAA 1DG1G 1ZBDA 5FBRB 5AJXA 1N6NA 1G7RA 3QPVA 2RH5A 2ZJYA 3NBFA 4S35A 4TYYA 1XB2A 1G8GA 2RGAA 2XZLA 1E0AA 1B23P 4B48A 2VEDA 4A15A 1VCIA 3TW8B 1TNDA 4JLMA 3K0CC 1N0UA 1VG0B 1GZSA 4IOJA 4AYTA 2WJYA 1X8LA 1LF0A 3BFVA 2XSZA 1PV4A 1KDOA 4I81A 5C4GB 4GNKA 5D3QA 3IIMA 2QGZA 1Z47A 2CJWB 1CIPA 2B92A 2EVWX 2QUZA 1COWD 1I2DA 1G20E 1P2TA 3O8BA 4HLUA 5K8IA 1Z8FA 1XXHE 4GL2A 4M1SA 3BOSA 2Z5FA 5JRJA 1KMQA 5JEEA 3U2QA 1HEIA 2DFLA 3O8CA 4OL0A 4FD2A 2G0NA 1JBKA 2QMHA 1U94A 1ZC4A 4C0BA 1H8EA 2EFDB 2GXQA 3IDQA 3VX4A 1E79A 2GK7A 5AUNB 2ZRFA 5BQ5A 1Z83A 1DAFA 2YWEA 2F9LA 3X1XA 4WOPA 2BEKA 3K0FA 3HWSA 2PH1A 1W4AA 3ZS8A 4EIWA 4MYHA 4M0LA 4DT1B 2G6BA 2GILA 2V6JA 4URZR 3VR6A 4DB4A 2GJ9A 3SU8A 3R9IA 2BJVA 5FL7A 4C0JA 1J7KA 4BEBA 5SZJA 1AKYA 1DG3A 2BBWA 4TMTA 2WPDA 1SVOA 4Q9IA 2C9CA 4F4CA 5EP4A 1P3JA 3RSLA 4HDCA 3T1OA 1DO0A 3JVVA 1F2UB 1E4VA 1W0KD 2I3BA 1XF9A 1VYVA 1ZM3A 3FVQA 4URWR 5JMTA 1L4YA 3LX5A 1RRFA 1KI7A 1UADA 2NMVA 1S1MA 3BJIC 3SDZA 3S1AA 4Q7KA 4AG5A 2NO0A 1TTTA 4DEYA 4PAOA 4JVMA 3O47A 2ZRPA 3K1JA 5AUPB 1SZPA 4BFTA 3CX8A 4F91B 1YZUA 4GZLA 4ZIRA 1NVVQ 4O3MA 1RVDA 2V55B 2ZTSA 4RY2A 1NMZA 3B1ZA 3SYKA 3B60A 4C0SA 2DFNA 2HJVA 1ZU4A 3R8CA 1NKTA 1XPOA 2VP6A 1P9RA 1W5SA 2J7PA 1TAGA 2BVNA 3CRVA 4OI0A 4QGAA 1TL7C 2G77B 4PQYA 1LY1A 2ZU6A 1KIMA 2VF7A 4CEHA 1F2TB 4FW9A 2YOGA 3GP8A 1W36D 3ZZ0A 1BMFD 3W6OA 2D2EA 2WOJA 5DNYB 2OSBA 2PX3A 3BXZA 4YONB 3K9GA 4JYBA 3RHFA 4AIIA 1IXRC 1FMJA 421PA 2A5YB 1XPRA 4KI0A 4EJSC 3KB1A 3SNHA 3PITA 1U99A 3KKQA 4LBVA 2WKPA 4LC1A 1QHHA 1G5TA 5C2JB 4Q4HB 5KYKA 2ZI9A 5FPHA 1WE2A 4II7A 1KI1A 3D3QA 3HJNA 3T1VA 3T5DA 3EIEA 1UFQA 2BDTA 1N3BA 4DSUA 2AR7A 2FA9A 5AJYA 1G9XA 2IYLD 3K0AA 1P2SA 1TPZA 3U3MA 5F98A 1NIPA 2VSXA 1XDBA 1P6XA 2C03A 3Q3JB 2PMDA 1GG2A 4Z1MA 3EPLA 2QQ0A 5SZHB 2ZR7A 4L9SA 3OIVA 2XB4A 1KK0A 2RGDA 5BN3A 3ICEA 1O87A 4ZIRB 1R5NA 1E1RD 3CPJB 3QG1A 1VYUA 1JAIA 4JLBA 5GJWC 5H8WA 2ORVA 1UM8A 4QBHA 1G3UA 4R9UC 2R62A 2ATVA 3EC1A 1CJMA 2P6RA 3HR8A 3B1XA 5AR1A 1P2UA 2H18A 2ZRAA 2PLFA 1N6PA 2TMKA 1XJQA 1QHXA 1NN5A 4B6EA 3B7GA 1GNRA 1G6HA 2WZQA 2GWHA 3OHMA 2JLWA 1ZIPA 1ZM9A 2CVFA 2VP2A 2WMNB 4F38A 2CCKA 2R6CA 5CLQA 2MSCB 4JBWA 5JCZA 1GL7A 3ZZUA 1JAHA 4J0QA 1R7RA 1S1CA 4KFTA 1CXZA 4PSAA 2QPTA 1JEDA 4LJYA 5FR2A 2FFBA 3LVRE 2ODWA 4QHYA 2IF2A 2J0UB 1NY6A 3W6PA 5L3QB 5CJPA 1KYIA 4OQFA 1XTIA 1UKVY 3BB3A 4DDVA 5J4VA 2IUTA 2OCYC 2WSMA 3MWLA 1P62B 4E22A 4H1UA 2QBYB 2OE2A 1XTQA 2J0QA 3HU2A 1K6MA 1OFHA 4P0TA 4JSTA 3ECCA 2L0XA 4NCHA 2GK6A 5J4YA 1N6HA 2FFQA 3QKRB 4JLNA 3T34A 4TWZA 2ZE5A 3FGNA 3W3AA 3RABA 5FFMA 1XD8A 1RYHA 1DS6A 3W6NA 4L4UA 2JASA 4BQSA 1AGRA 1G5RA 3GJ7A 1KNQA 2UZIR 3SYNA 1N5JA 2Q9AA 3EXAA 2ZYTX 2FF7A 4B32A 1B0UA 2GJAA 3LLUA 3ZD6A 2WWIA 4DKXA 3K0EA 3THYB 3VKGA 3L0OA 1E96A 1NSTA 2QAGB 4LK2A 2G88A 3GLGA 3FPAA 2IS4A 1RRGA 3I1FA 4MGYR 2C8VA 4U00A 3FHTA 2W6JA 5BN5A 2WKQA 1UKYA 1FQKA 4C0LA 4URXR 4RFVA 5DE3A 2QM8A 3CPEA 4JKIA 1IY2A 2KJQA 1BIFA 2CL0X 4XVQA 5JLJA 2A2ZA 1CBUA 2J46A 2CNWD 3UG6A 4A92A 4FCWA 5E4FA 5TVKA 4UQOA 1OV4A 1R4AA 3VFDA 3VKHA 4LCBA 1E2MA 1BKDR 3IBGA 4Q19A 4BFWA 1GM5A 1IJEA 3BFKA 2ZJOA 1I4TD 1IBRA 1F48A 4G5RA 1JR3D 1KSJA 3NHBA 3B1VA 3KXLA 3A37A 5E7MA 2FNAA 3OIYA 4M53A 4X8OA 2PMKA 2ZUDA 3IIKA 4ASUD 2V3CC 4B74A 4CVNA 1EWQA 2WVJA 1M7BA 3CX7A 3F5FA 3TR0A 1HTWA 1KI3A 5GVRA 3D7MA 2QG6A 3FKSA 4MRNA 4WXPA 2OFWA 4NZYA 4US2R 3RS2A 2O8DA 3FHOA 4H9GA 2HF8A 1T8TA 2WV9A 3RANA 1DADA 1KSHA 4HUQA 2JJ1D 1T5IA 3AP2A 4RD0A 4EFLA 4YMTA 2A30A 4KSCA 1GRRA 3ADBA 4Q4JA 2ZRHA 4PC1A 3A6PC 2C99A 2ZRKA 2VH5R 2UVQA 2WIBA 3V9PA 4JVLA 4LPSA 3RC8A 4OI2A 3CB4A 3IO5A 1HURA 1JJ7A 3TK1A 4KBGA 1KKMA 1PUIA 1N0WA 2FEMA 1DELA 2QP9X 3AV0B 4BLSA 3QF4A 1E1RA 4P4TA 4IEIA 3KXKA 1E0SA 2V4ZA 2QGNA 3C41J 1UEJA 3UK6A 3X1WA 1T3HA 2HJGA 4XWKA 3DMDA 2J0SA 2F43A 2AD1A 2O5VA 1FL9A 2PT5A 4URUR 1MKYA 1G5PA 1TUIA 1XNJA 2IUUA 3RRMA 3RRNA 5JFGA 1Z6GA 4B75A 1XMJA 3EW9A 4P33A 2RHMA 5FOXA 1XPUA 1P5ZB 3BE4A 3DO6A 5DI3B 1QF9A 2RGCA 2IWHA 2VRWA 2R65A 4CEIB 3T12A 2FWRA 3I92A 4GBMA 1NLZA 3EZ2A 4FMDB 3BS4A 1XJCA 4O25A 2EWVA 1ZJ6A 2XX3A 2F1JA 1UBCA 2JLYA 4KVGA 2CHGA 4OK6A 4RCZA 4JKYA 2DBYA 1XMSA 1P60A 4MRSA 4KXFB 3IILA 2VIIA 2YZ2A 1TF7A 4K81B 4ERNA 3SQWA 1ZW6A 1OW3B 4KV9A 4D0LB 1ZM2A 5CM8B 3H84A 3UKDA 1XP8A 2A5FA 2IYYA 3LDAA 3SZRA 1E0KA 1MABA 1OFIA 4POAA 4TN1A 1YZLA 4M9SA 1WB9A 2PLRA 2Q3MA 2FPKA 3SC3A 1UDWA 2ZJZA 1PJRA 1KO5A 3DM5A 2OG2A 3FMPB 5DH9A 2C77A 1RE0A 2IT1A 1U8YA 5CK4A 4FMBB 4H1VA 4I99A 4EJSA 4DLTA 3ZD7A 2RB4A 4TMWA 5KUTA 4I4LA 3PEUA 4UNSA 2Z83A 1A2BA 3GLHA 3MLEA 1DO2A 5L3RA 1DAKA 4JMPA 3A1VA 4WAUA 3ZGXA 3U44A 4A2PA 4CYMA 3U6BA 4B3GA 3OE7D 2VLIA 2BKUA 2IHYA 1Z28A 4JLPA 1TADA 4TQAA 1FQJA 4V03A 4HZUB 5J5CA 1FUKA 1SHZA 1V5WA 2AWOA 2ZRLA 1SVIA 1UF9A 2WWXA 3QBTA 1OXSC 2F3RA 4IEEA 1UPTA 1FP7A 1OYYA 1KJZA 1A4RA 1T0HB 4RD3A 1R8SA 4W5WA 4P4UA 4RFSA 3KQUA 4A36A 4DLWA 3UWOA 1TEVA 4RKFA 2H16A 4NP6A 1QG4A 2ZRJA 3HYTA 3THOA 3W3ZB 1RW4A 3HR7A 1JXOA 4W9MC 2ZI3A 3TH5A 3PVSA 1E9AA 3FWYA 1G64A 4TZ6A 4BFSA 3ZVRA 5CDFA 1JEEA 5CYOA 2GNOA 2JLUA 1NLFA 4M2LA 3RWMB 1C1YA 2ZETA 2XXAA 1E9FA 4EPYA 5FTKA 4ZDJA 5G40A 5LPNA 4JYCA 1P4SA 4CT5A 4TLDA 2V1UA 2QNRA 2XITA 4FWTA 5KU1A 2IYTA 1Z6YA 4NHOA 2D7DA 4CW7A 3THXA 4DUGA 1OB5A 1ESNA 2DFKB 1SXJB 5K8TA 3LBNA 1II8A 5EUQB 2I1VB 4M9XA 5LD2B 4O2LA 3LX8A 1E2QA 4MKIA 1P61B 4M9ZA 2FU5C 2ZI4A 3I8SA 2G1JA 2F3TA 4HYYA 2ZM5A 4Q1FA 3O8DA 1RFLA 2KBEA 1Z6TA 3CZQA 5FPYA 2XZPA 3PR1A 5JS8A 2ZAOA 5L3VA 3U4QA 2QE7D 2GVZC 1Z6AA 5KTYA 4AYWA 1ZD1A 4XVRA 3THYA 1CF4A 4IKEA 1CJKC 2QAGA 2CLSA 4NYIQ 2WWGA 3W90A 4LI0A 1KNXA 1NSFA 1XWIA 3VHLB 2AK2A 1HQCA 3UWKA 1G291 4DHEA 3K09A 2QSYA 4XSGA 4LYAA 4QNMA 3WYGA 2YNMA 4DDWA 4U7DA 2IYXA 3CF0A 1N6RA 4Q21A 1WF3A 4TMXA 2ZSAA 1NI3A 4DLZA 2D7CA 2YC4C 1QHHB 1NG1A 3MFYA 3OIWA 1EESA 2V9PA 4QGFA 2J0VA 3ZIAD 4N0EA 1TUEA 4JLAA 1BYIA 2O8BA 1F5NA 1XEWY 3QKRA 4KSBA 4ZCIA 4PC7A 1W4CA 4GSYA 2W2TA 2EFCB 3JVUA 3QXCA 4N0DA 2RMKA 3B5JA 2D2FA 3CR7A 1N5KA 2IEZA 4QJ5A 2ZXUA 4OJQA 3EZ9A 2Z0MA 5F9HA 2GCOB 2FGJA 3QJYA 1UKEA 3LQQA 5FR1A 5EP1A 3IGFA 3D31A 4QG7A 3K0FB 4C3ZA 1GKYA 1NY5A 4A8JC 3AVUA 2XZOA 5IK2D 1KK1A 3Q7QA 4G1UC 3CUEF 2C9YA 3KUCA 4FN5A 1QHGA 3T5GA 1W7AA 2X2EA 2OUKA 4NCNA 1UAAA 3CWQA 4RZ2A 4TLEA 2O8CB 1R5OA 1ANKA 1L2TA 4WIAA 5IF9A 2PJRA 4QM6A 5G3ZA 2XTZA 4EPRA 4WZBE 2P0EA 3T61A 1A5TA 2OEPA 2NO1A 1DE0A 1ZD9A 3W5IA 4FCTA 2HXSA 3ONWA 4GI7A 5DSZA 1JECA 1T6NA 2A3RA 2BC9A 4US1R 1OFTA 4AKHA 1KK2A 4QOSA 1AS3A 1JALA 4QHSA 4LHXA 3LV8A 4N1AA 4LYFA 4PSVA 4PO9A 2GKSA 1FTSA 2FJUA 1M7HA 1YE8A 3QI2A 2HLDD 5KNDA 1NMXA 3I32A 5FTMA 1N5IA 5JRZA 1E2IA 2D06A 2NTYC 1IN8A 3U7HB 2BEJA 4IDOA 1OH8A 1OIWA 1JR3E 1E1QA 2OCAA 4IVRA 3QVUA 3AUXA 4PC6A 4QNRA 2O8BB 1SHKA 2ZRBA 4I1VA 1Z29A 3QKSA 4HDQB 5GJBA 4X8HA 2IW3A 2WTUA 4XWOA 2NO7A 3T15A 5CIWA 1G18A 1JQJC 1S0UA 5HE8A 5F2EA 2ZUBA 4R2IA 4HSEA 2DYKA 2JLVA 2QPAA 4M1MA 2O0KA 5EE3A 4G5OA 4C0HA 1G8HA 4G5SA 3PEWA 4Q66C 4LJ7A 3TSWA 4ZDKA 3SJBA 2DCUA 1Z08A 4ZI2A 2G0TA 3IPXA 1FNMA 1D9XA 1GVNB 4YDHB 4TMVA 5KOYA 5HR5A 2WIAA 4TQUS 1U9IA 1V43A 2W6IA 4BFVA 1J90A 5DI3A 4BLOA 2OCBA 4MKHA 5KSYA 4MITA 1YRBA 2AL7A 4B3CA 1P75A 3LW8A 4IDQA 4ZPXA 1L8QA 3NH9A 4Q1CA 3KKMA 4DLVA 1A1VA 3PFIA 4M21A 3EPKA 4ZCMA 3VMFA 4OHXA 1G41A 3RC3A 4X8MA 3X1YA 2A7QA 1FX0A 4RCYA 3GJ5A 5B2ZA 2ZE6A 1Q1QA 3H2YA 4EQ6B 1AS0A 5H1YA 1SXJC 2B21A 3DKVA 4KITB 3RWOA 4WW0A 4C9BA 5TMPA 2MSEB 3NXSA 3A36A 4E09A 4KO8A 4D0GA 1VCOA 3WP1B 1XCMA 4CDGA 4AC9A 2IYSA 2BBTA 4OKSA 1M2OB 2FH5B 5CJ2A 2VBCA 3EG5A 1ZCBA 1HQYE 2JGNA 2GTPA 1GIAA 1N6IA 3LW7A 3MWYW 4F4IA 4DDUA 1Q12A 3RDPA 3G0HA 4ILEA 1C9KA 1XXHB 1LB1B 2MMCA 2OAP1 2QY9A 4R98A 5HPYB 5L3SA 2OLJA 1KI2A 4HUQB 1OIVA 1KY3A 2C9OA 4Q47A 1ESMA 1ZUNB 2D62A 3P20A 3RLFA 1ZVQA 4BFXA 1UBGA 5EP2A 3HP1A 2QI9C 3PIRA 4P3YA 2W0SA 2YOHA 4QFMA 1AJEA 4KHZA 1NRJB 2G83A 3KQKA 2WJVA 2W0MA 4TT3D 5HE9A 1IN6A 4PZZA 1MOZA 1S3SA 3K9LA 4WBSA 1XCPA 1BOFA 4Z8YA 1YKSA 4A4DA 5KDDA 1ZCAA 3KDSE 3ICQB 1LFDB 1HT2E 2OHFA 1EFHA 1E0JA 2VL7A 2JJ1A 1ZUIA 3AKEA 1CRPA 2V8OA 3TVDA 1NBMA 2ZVQX 3GLFA 1DAEA 1G8FA 2CMKA 2RGBA 2BV3A 3EIQA 4C30A 5HTKA 1GRQA 1D6JA 3GLIE 2A9KA 2VSFA 5CDFE 2CNWA 3N2IA 4HZIA 3L0SA 2WJIA 3ZJYA 2KI5A 4MQBA 3TAUA 4PHFA 4A2QA 4D4LA 1W0KA 1E2GA 4B71A 1XX6A 2REOA 3WRYC 4UNNA 1IXSB 3SHFA 2F6RA 3TGPA 3AKYA 2J59A 3H1TA 4TSFD 4QGHA 2UZ3A 1UEIA 2QMEA 2AKAB 4PC3A 4ZV4A 121PA 1Q20A 2ATXA 2RGGA 3WBKA 1TEXA 1NL3A 5UKDA 1JI0A 3QNUA 4DT1A 5KDOA 2AWNA 2WAXA 5JHHB 2W2VA 3GLHE 1KO4A 3L8YA 2O8FA 3ZIAA 1QHNA 4LZZA 2ZI7A 3GJ3A 2GBLC 4D4JA 4HLDA 4US0R 4QL3A 4JT2A 1T3SA 3JZMA 3RVBA 3ZS9A 1A7JA 1XTSA 1MABB 4HB3A 1TX4B 2FN4A 3IUYA 1ELOA 2P65A 2FFAA 3WRXC 4TL7A 1CS4C 4LBYA 1JPNA 4TTQA 1E6CA 1Q3TA 2E87A 3IIJA 4BUJA 1JJVA 1EFUA 4BWYA 1QHYA 4DLXA 1OXUA 4ON9A 1E2NA 4D81A 1PUJA 1JNYA 3U3KA 721PA 1G3IA 4KAXA 4TTPA 4LY6A 2YJTD 3A4NA 1OXXK 4MGIR 4MDFA 2ZSEA 4YMSA 4HLQB 1LNZA 3OF5A 2CVHA 2ODBA 3SN6A 1F60A 2PZGA 1X8KA 2QMOA 3VU9A 1KI9A 5JWOA 1UJ2A 4YMUA 1XTKA 1W0JD 2RGXA 5A0FA 3OIUA 4DZZA 3BFXA 3SQXA 2BKEA 3EWSA 4FCVA 4DCSA 5C46F 4GOXA 3E1SA 1U9IC 3R7WB 4NTZA 4D4MA 2LCFA 4YLGA 2GAOA 3BWDD 1IY1A 5FTNA 2BCJQ 2OXRA 2GETA 1GKUB 2ORWA 5LDDC 2D3WA 1N25A 3CRRA 2JEOA 5AUQA 1R0ZA 4HLUC 2OFOA 1SVSA 3QENA 5KSPA 2GHIA 821PA 4I1SA 2H57A 1S2MA 4F4JA 4GP6A 1VIAA 4NCJA 4MYTA 3Q8XB 3W34A 3GFTA 1OKKD 1TQ2A 1GOTA 2FE4A 1II0A 4BEJA 1QVAA 5EUMA 5TV2A 2YYZA 3QEOA 4BGDA 2ZE7A 4L9WA 3W9YA 2QE7A 4NCIA 1TQ6A 3UANA 4LSGA 3BORA 1NKSA 2JDIA 4YXWA 1GFIA 2ZROA 4KYIB 3UMFA 4NE2A 4DWJA 1GSIA 5SZIA 3SJAA 2ZIAA 5GVSA 3Q72A 1ZNWA 2GZAA 1NN3A 3C5CA 3NC0C 3N5CA 4JL6A 4KCGA 3VQTA 3MJRA 1GNPA 3DPUA 3K8YA 2HYIC 2C2HA 2XSZD 2J41A 2YWHA 3GQBA 1OF1A 2GESA 1E9DA 5H68A 1DARA 3RNLA 4UXJA 1E2DA 3SE0A 5B58C 4OK5A 3AB3A 2P5TB 1P73A 1EK0A 3TVTA 3I5XA 5P21A 4NMMA 2WJJA 1Z0IA 4B73A 2LKCA 1MO6A 5TDHA 3CW2A 4V0ME 1U8AA 3C8UA 4HB2A 4ZO4A 2VSOA 4QJ4A 3C4JA 3ASYA 2DWQA 2QQEA 1E9SA 3FDIA 3GLIB 1MO3A 3M4YA 3EAQA 4JIMA 1CR4A 4HAXA 4MKGA 5KSZA 1CR2A 2ZRIA 1W46A 3KJIA 1Q57A 4LBWA 2ZR9A 5LB4A 3FB4A 1XD2A 1F2UA 5FOWA 4D4KA 4HAWA 2QP3A 1GITA 1KO7A 2OBLA 1CJVC 4GZMA 1G17A 1H8HA 1E2PA 4QJ3A 4Q01A 4Q7MB 2QTHA 2JLRA 4XJXA 4LOAA 3QEJA 4B35A 1YZGA 3OZXA 2VP0A 1ZU5A 3WYFA 1R8QA 3CIOA 5FOVA 1KSGA 2BMFA 3GD7A 1X6VA 1ZD8A 5TARA 3I61A 3AVVA 4DXAA 4AI6A 1L4UA 4PSKA 4GT1A 1NNEA 3GEHA 5FTLA 3LWNA 3IQXA 4LHYA 4DCUA 2BBSA 3LH5A 3CX6A 2VA8A 3SR0A 4L8GA 4BRUA 1XZQA 2VP4A 2I4IA 5IT5A 3P26A 2HLDA 2CCJA 2E1RA 2Z43A 4KLZA 3FKSD 2F55A 2KWIA 3X1DA 2QU8A 3GJ4A 3X1ZA 2R6FA 4M4SA 1CJUC 2MMGA 3ZLJA 3RYTC 5F3WB 2ZJAA 1G7CA 2R6AA 3IKJA 1SKQA 4OHYA 3E70C 1U2RA 1D2EA 1Z07A 4Q9LA 3ZH9B 3GLHB 5B30A 5JSZB 3B6EA 1AN0A 1QRAA 3BD9A 3V00A 1W47A 4EPTA 2XB2A 1L7VC 4D82A 2W2XA 2ONKA 1J70A 3ASZA 4IXNA 4Q1DA 3TQCA 1AZTA 4IVPA 4OK3A 5FI1B 5FOSA 3AVYA 4U5XA 4YMWA 3TE6A 1ZNYA 2IHBA 2WWFA 3ZQJA 2O8DB 5DYIA 2JJ2A 5CYPA 4D26A 3GCGA 1G8YA 2HT1A 3FFBA 1KAOA 4AY2A 1OH6A 2GAAA 2YINC 5GADl 3N2EA 3WY9A 2KSQA 2HDNB 2C96A 1KAGA 1QVRA 3IPYA 4DJTA 3EPHA 1DAMA 1TU4A 1D2MA 4LV6A 1G3MA 2IYVA 4QBFA 1SKYB 2E9SA 2SHKA 3DOFA 4JZKA 1VKJA 4Q4HA 4OYHA 1W48A 1Z2CA 1S96A 2OXCA 1LV7A 4R71A 4UNPA 4M1KA 3R7WA 4PFSA 4Q03A 4RSGA 1YU9A 1NVWQ 5CM9C 1Y63A 3CNNA 3KQLA 3A4LA 1Z3IX 4YC7A 4NYIR 3G5UA 1W2GA 1OLOA 2ZANA 2VPPA 1NIJA 1RJ9A 2BJWA 4L16A 2AK3A 2ZYUX 4TYPA 3QG5A 4XOIA 4G0NA 4DIDA 3W8RA 2H17A 2C5LA 3UG7A 1T5LA 1I4DD 2ZRGA 3PUXA 4URYR 3KUDA 3LA6A 3PCRB 3WHKA 5KNBA 4M1OA 5F9FA 4NKRA 1R0WA 5BYJA 2NQ2C 3DHWC 3TJZA 4LBZA 2C95A 4DCVA 2YV5A 4JT4A 3NEJA 4LV5B 3NTUA 2IA5A 2OAQ1 5K8LA 1II8B 3I8XA 4Q9HA 4XTRA 1TF2A 2JIZA 5G53C 2RGEA 4IDPA 2BMEA 5AWFC 1I4LD 1WDTA 4Z1MD 3K70C 5J4HA 3S1AB 4PQFA 2O0HA 1IONA 3VNUA 4C2TA 3AF4A 2VO1A 2BIFA 2QBYA 4IOMA 4IRUB 4JJZA 4NU0A 4A9AA 4PZYA 5C4MA 4Q18A 2ZRNA 3U7GA 2OFXA 1RKBA 1WBBA 3U3OA 2DWPA 1VIYA 5KSOA 5JWRA 2REXB 3AUYA 3LBHA 1NVVR 1SKYE 4PXAA 3TUIC 2ZPTX 4LYHA 4Q9KA 3IEVA 3TR5A 3Q5DA 1Q44A 1W49A 2ZSDA 1W2HA 4N3NA 4E07A 2J0UA 4KU4A 4HI0E 3QIAA 5B64A 3A1UA 4AWXA 3VX3A 2ZITA 1IOZA 2ZRMA 1RC8A 3QKUA 2XNDA 4WZ6A 4OHVA 4C7OB 3LLMA 1S8FA 5BXQC 2JDID 1W1WA 4EUNA 3MWKA 3QPWA 4GDFA 1ZNZA 1FMLA 3CKLA 1D2NA 3PEVA 3KQNA 3R9WA 2BOVA 4ITRC 1OYWA 2Q9BA 2VTKA 3T06B 2ZU0C 1IAQA 3VR2A 2GXSA 4IW3B 4KFRA 4P31A 1XEWX 3NWJA 3TBKA 3TSOA 5HKKA 1WP9A 2R2AA 4NYMR 4QBIA 2W6ID 3AF2A 2QRNA 1R6BX 4LJ9A 1OXTA 1G3QA 3AP3A 4GRAA 3QKTA 3MCAA 2FZLA 3D8BA 5FBWB 3VHXA 3GLGB 1KMHA 1X3SA 1K5DA 2IYUA 3CLVA 2ANBA 2J1LA 3DOEA 2XTNA 4JS0A 4MGKR 3HYRA 4FXPA 3M6AA 1P7CA 1JR3A 3AF3A 3K09C 2WHXA 2YWFA 1CEEA 4XH9B 3KKOA 4CT4B 1Q0UA 3SS8A 2Q0HA 2J45A 2NIPA 2JJ2D 4OI1A 2EFGA 2IXGA 2CHQA 4DC9A 3BH0A 2W83A 5AUOB 1G19A 2LKDA 2UKDA 3GLIA 1IN5A 4KJZA 2BBOA 4LJ4A 4LJAA 4TMKA 4LC0A 2QPOA 1AKEA 1X1SA 5DGXA 3CRQA 1AQYA 3MGCA 1EGAA 1AA9A 1E4YA 3GMTA 4JL5A 4AURA 5AJVB 4FINA 4PHTA 3LNCA 1FFHA 2P6UA 4F7WA 1KJWA 4PPQA 1E3MA 4OHWA 3WHLA 3FMFA 1T8UA 2F1IA 4QC2A 2MSDB 4ESHA 2PZFA 1EG7A 2ZJ2A 1D9ZA 1S9DA 4EPXA 2VHCA 5D3MA 2GVDC 3B8HA 4PC2A 2N46A 2ORIA 4BLTA 3TQFA 1COWA 3QOFA 3QQ5A 3WMEA 4BECA 1G16A 1SQ5A 2PEZA 3CH5A 3HPQA 3PUYA 1KI6A 3SFVA 2R6GA 1OHHA 2QRZA 3H86A 4PANA 1S4QA 3GJ8A 2G3YA 3VR3A 2F43B 3RS7A 2GJ8A 1ZIOA 4JBYA 4PPGA 4MA4A 4M1WA 4ACAA 3CH4B 3DDCA 2XAUA 2XNSA 4OQMA 3UPUA 4FI3C 2H5EA 3NDBB 5FPTA 3AH8A 3OEHA 4B3XA 3SJZA 4MRPA 5FI0B 1YZTA 4D80A 221PA 3FOZA 2FSIA 4GMXA 1LW7A 5ANRB 3GPLA 2N1BA 3B78A 3RS3A 4YQFA 1VDZA 2ERYA 4ASUA 1O3YA 4M1TA 1RYFA 4CF7A 1S3GA 4I1OA 2HCBA 3BC1A 1A82A 4RKEA 3OAAD 1VPLA 2AFIE 1XRJA 1M8PA 3PV0A 2GCPA 2IYZA 2GZDA 3NIBA 5FTJA 2Q3HA 2WAYA 1A2KC 4BLQA 4AKGA 1ZRHA 4DEXA 2O0JA 4B2IA 2QORA 4GOKA 2ZE8A 5IRCD 2CCGA 4RZXA 2J9RA 5FH9A 2PZEA 4HZUA 1Z5ZA 2OILA 3F8TA 3OEEA 1GRNA 4DSOA 3BERA 1UBFA 3KB2A 5FL3A 3QY0A 5D3MB 3WNCA 2IYWA 4TT3A 1W44A 2C78A 1GWNA 4W5HA 1WBDA 4EDHA 1F2TA 1BYUA 4Z54A 1OH5A 3K0SA 1YVDA 2ZEJA 3FKQA 1T4GA 4JLKA 3RRYA 3ZDQA 2ZJ8A 1E32A 1MRSA 2ZAMA 2J3EA 8OHMA 1AQUA 4M22A 5J47A 4CEHB 5BN4A 4HB4A 3AVXA 1KDRA 4JL8A 2GEUA 2QTFA 3ETLA 4PAQA 1W4BA 3I62A 4B3DA 4QKQA 5KDLA 1TQDA 1YZNA 3ND8A 1E9CA 2ZS7A 5EQTA 5EE0A 2OBMA 5CB6A 4MKFA 1Z06A 2GF0A 1UKZA 1TMKA 1VHLA 2QSZA 1VG8A 5DN6A 2RAPA 2QEQA 1P9WA 2CBZA 1GL6A 3OEHD 2QL6A 3REFA 3BBPA 3H4MA 4P4SB 3MMPA 5FOTA 1EXMA 3EX7C 1JXMA 1RRCA 3QBVA 4JVNA 4HB0A 2ZSBA 1ZM7A 1SVKA 2JLQA 2VQSA 2ZUCA 3VR5A 2QAGC 1U0LA 1HE8B 621PA 3G82C 3OAAA 4A8JA 1OFUX 4V0KA 2ZYVX 5LB2A 4C0AC 4TL9A 3UATA 3QKSB 2H92A 1R0XA 4G5QA 3AP1A 4S2EA 2EYUA 3LY5A 4CIDA 1F3OA 4HATA 1GAJA 2PEYA 4V0NA 1E2KA 2OCPA 4XD7D 2GXAA 1M6NA 1CU1A 2EW1A 3NVAA 1E9RA 5EXPA 1R2QA 4Y0VA 4D25A 2CLCX 2XEXA 4RFSB 5GJCA 1FPMA 4LWZA 2JLXA 3LXRA 1VG1A 1Z0FA 1E9EA 1MT0A 4V02A 4Q00A 4L15A 4LGMA 4DUGD 1DBSA 1Q3HA 3FHCB 3L0PA 3LAWA 4PO1A 2OV2A 3AF1A 3CZPA 1X8JA 1KOFA 1YHNA 4EPVA 2FDCA 4IDHA 1EX6A 4UNQA 3ADCA 4EFMA 3FTQA 2IS1A 5BW8A 3U7EB 3I5YA 4NBSA 2H1LA 1SVWA 3U60B 1SXJA 2B8TA 3T1TA 2D74A 3CR8A
chains in the Genus database with same CATH superfamily
1TFRA 3HJHA 3MYYA 1WS6A 5CLGA 4Q6WA 2BKLA 3DVAA 3TQOA 2QK4A 1AU9A 1BXGB 3GRUA 3KR9A 4Q02A 3WDSA 4DQDA 2ZUVA 3L82B 2PXHA 5T3YA 4EW1A 3KKKA 1RAIA 3CVXA 1WTCA 5AKEA 1LNSA 4CKWB 2EHDA 1VFPA 2R9VA 4NENA 3AQIA 4N65A 4ZVOA 3BIWA 1SA0B 5TB5A 4D96A 4E7OA 2PKXA 2H65A 2GPYA 2YC2C 4XUEA 5EWMB 5ECWA 3FNIA 4M46A 3JPYA 1U2DA 5AKYA 3UBTA 4DSTA 2G17A 3QWAA 3KHUA 3MILA 4KIFA 5MFPA 1X1RA 3GJXC 4EF5A 5KVQA 1LKZA 2H1VA 1NLMA 4G67A 1TGYA 5BSHA 2Q6KA 1GTG1 4UJ3A 4OM8A 3W5CA 2W70A 5H80A 4GMDA 5JD5A 4M86A 1G8AA 5AT1A 2O52A 1Y3FE 3N7AA 3F8WA 3ZWWA 4Z4FA 3IE1A 3OTQA 2KE5A 2GTIA 4KFSA 2B4QA 3HWRA 1TZBA 4YHHB 4E5SA 2H2GA 5E3HA 2X0EA 1NP6A 4HPJB 1DC6A 3N8GA 2JJMA 4WCVA 4HV4A 2V45A 1ODKA 1GQSA 2XJ9A 3DXYA 5LDGA 3E8SA 4QT0A 1SXJE 3RHZA 1YZKA 4IVQA 3WNDA 4DCTA 3WWEA 4RETA 4DA9A 1WZ2A 4ND7A 4V2UA 4BO5A 3ZZNA 2GAIA 3TUZC 4KQ6A 1RI4A 1ZP6A 3R6WA 5BN5B 1H1LB 1SZDA 3I4LA 3MOSA 4P35A 2GPWA 3VYUB 4DRYA 3HXPA 3HJAA 1KH3A 5B6IA 2EJUA 3E7PA 2VNKA 1LVHA 3FTDA 5DPMA 1VA4A 3ZW9A 3LUFA 4DC1A 5H7XA 2XWPA 3RIGA 1PFKA 2IZ5A 4MYUA 5DHQA 1RWQA 1H2EA 2IYQA 2P9ZA 1MV5A 2B1IA 2J4DA 4OBEA 2R44A 5FUXA 4CQMB 4OXQA 3V4FA 3JYNA 4D9GA 4RD4A 5FNVF 1CUWA 1US8B 3A1WA 2V6IA 3G2MA 4P08A 1G21B 2MT9A 4CMHA 3PK0A 1WVIA 3DQPA 3VU0A 4RTOA 5BSUA 1NXVA 3P0EA 1V4BA 2XE4A 3FUUA 3GV0A 3EGCA 2FW9A 1QSGA 3QI7A 1LPMA 4B7UA 1ZUWA 2X2OA 1VMKA 2RGNC 4HLCA 1HTTA 4MGZR 4A7PA 4DMKA 3DV2A 1TLFA 1K68A 1D8AA 4XGIA 3TPZA 1FFAA 1V8OA 2B5VA 2CVPA 3HDQA 3QX3A 4XIIA 3F2VA 1OIXA 2WE8A 3BH7A 1TU0A 5BYKA 1RLUA 2JFHA 3NZEA 1E1CA 3ELDA 3FTFA 4DLKA 2YY7A 4GO1A 1AHPA 1QHSA 2YS6A 5HIAA 4NC9A 5E95A 3NTXA 4DM7A 2AE1A 3F2IA 4DKJA 1M6WA 3LQ1A 3O7MA 3C1OA 1DO8A 1YR1A 3WKCA 4MV4A 2CFTA 2WWWA 1XD2B 3GLQA 4XLTA 4C08A 1II9A 1T9ZA 1XMVA 3O1JC 3AJ9A 1L5GB 3I9V1 1W1UA 3AO0B 1DOAA 3AQ4A 3NYWA 3V7NA 2WYOA 2P91A 5BWBA 4II3A 1WA5A 1U98A 2X1LA 4EGJA 1V7ZA 1E4EA 1P80A 4X62B 5CCXA 2PBLA 3G59A 3DLIA 2FEPA 1QFYA 1DKRA 2SECE 3L43A 1J22A 2WT8A 2KYRA 1NVMB 4JUCA 1MENA 1FNBA 3R5SA 4GGOA 1NF3A 4MRAA 1VHDA 2FLWA 4QLOA 5ALOA 5ER9A 3B9PA 4WY5A 4YLYA 5DOVA 2BGWA 2A9RA 4BUZA 2ENWA 5B5SA 1O6ZA 4PHHA 3K70B 4FHCA 2IHVA 3FCOA 1TT7A 4RKYA 4U02A 5K0ZA 2HQOA 2YJ6A 4L5BA 1ACLA 4Z49A 4A6PA 5B36A 2D6FA 1FVXA 1OWPA 5I8ZA 5TXGA 1RLOA 2P75A 3OFND 4HGOA 5AK0A 4DLYA 4F6RA 5BSWA 3GNSA 4V0LA 3BB1A 3IVXA 4GYJA 1XJWA 5AM1A 1IZ0A 3G8CA 5CVCA 3TIIA 1IB0A 1NVXQ 2FG5A 2IYRA 2O05A 1GZ5A 2PO7A 1SELA 2ZG6A 2GXUA 3KFXA 4WESB 4CLEA 4WY2A 1R0RE 3L07A 1SO8A 5L3ZA 2A1UB 3HFRA 3S4YA 5JAOA 2EFHB 2ODEA 2VRBA 2E7ZA 3K0AB 1JQ3A 4YO8A 1D8TA 2H29A 1K7EB 4WEQA 5DXAA 3OT1B 1DV1A 1USIA 1TECE 5I9SA 5LP6B 1QDEA 1EVIA 2RK6A 1UP4A 1DAIA 1S6YA 2BWJA 3WMWA 4PSDA 3UIEA 1AGYA 4J7CA 3PZRA 1EP1B 2CFRA 2BMJA 3P9NA 1LI5A 2YJ3A 3ND6A 4H1TA 4LK3A 5AICA 4OAPA 1P1RA 2O2EA 1B1CA 2HBZA 3CEPB 3H5IA 1IEWA 2EW2A 3LHDA 1GQRA 1TA0A 4H27A 3K9HA 2PCLA 4Q1EA 5FHRA 4D56A 5I4IA 5JXIA 1U11A 1NQWA 3N0VA 1RHQA 1UDXA 1HR0B 4A10A 4BJ5A 1FF9A 3JQ7B 1TZMA 3G9QA 4NDAA 3AF5A 4YWJA 1YS6A 4GF5A 2OYCA 3RJ5A 4LJ5A 5DW0A 3RAPR 4WV3A 3WFZA 4CR7A 5ESDA 2H7VA 5FRDA 5HIJA 3VR3D 3N1UA 4G25A 4RA9A 1BRTA 4FR0A 3QWBA 5M29A 3TRDA 3ZCRA 1MPTA 3WMFA 4C88A 4KX5A 1SM4A 1L9KA 4KNWA 1NJ6A 3BFJA 4WZZA 4Z86A 3VDXA 1UAYA 4E4RA 3D0RA 5J4LA 1RWXA 3N2YA 4J3NA 5TF0A 3ZX5A 1UT8A 4NXMB 1GP2A 4DSNA 4TKLA 5I9TA 1T8RA 2M98A 3Q7EA 3LDHA 1DFHA 4JLJA 4Z2YA 2CK3D 2I3ZA 1X80A 3FGOA 5IBQA 3BRSA 2I03A 4NJOA 2WQ6A 1QZXA 3JQFA 2GB4A 5CD1A 4RMIA 5TY0A 1UBJS 2I33A 4OGLA 4JP2A 4TRNA 3VZQA 4AJIA 4CF5A 1XTZA 3L7DA 3DW1X 4BVHA 2GBIA 1PFYA 3BIFA 4Q47A 4YRJA 2OBNA 5F33A 1VJRA 4K8OA 3EAGA 1PFWA 1W5BA 4F5WA 3P5SA 3ZIDA 5A4FS 2N75A 5EL0A 1KYXA 5TPZD 2HRDA 4GM0A 2HK9A 2ASEA 5K3CA 1N2EA 1G6OA 4L57A 2J3KA 3JQAB 4WA7A 4FGJA 3GN1A 4I9NA 4TTRA 3UN1A 1PZEA 3FOAA 1FBNA 1RKXA 2CUKA 1OJ7A 2IP1A 2XB8A 4YCMA 2WWHA 5K45A 2FQQA 1KFEB 1NVUQ 2X7JA 3H8VA 4MI9A 4FFRA 1M1YE 1O5OA 1SK8A 4QDJA 1YL5A 3DQQA 4V0OA 3OKCA 3EDOA 5J40A 4BFCA 3LUPA 3EHEA 4Q1BA 2OO5A 2BL4A 4CMCA 4URVR 1R4ZA 3P9IA 4KFUA 5DB4A 4OUKX 5DDIP 1WSDA 3Q15C 1MFPA 1NP7A 4HWKA 4QO7A 3DBIA 4KP7A 1W8IA 3N87A 3RUPA 3T7DA 3ZVNA 2QN6A 3E9NA 2P4SA 3HUTA 3JAKA 3TNFA 3T5AA 4AM8A 2VNAA 2W58A 4GXTA 1YI0A 1Z38A 1Z63A 1QQBA 3E5HA 4RY8A 4L27A 1BXKA 2PX2A 4GYYA 5CFLA 4F8YA 3ZGOA 3O4HA 3R23A 3E58A 2QDXA 3HCEA 4D8WA 3EZ7A 2P8SA 1QH8B 5F1KA 2GN0A 5T3UA 3WLLA 3AFGA 3PKZA 5L4LA 5I9IA 4IWNA 4LE0A 1U90A 1US8A 1A5ZA 3IA7A 3IHLA 3JRWA 4IGAA 4QT4A 2F9MA 5DTMA 3LCMA 2DH5A 3BJEA 4IIJA 2QR5A 3ANXA 4IDBA 1W36B 5I3CA 4CKCB 5LU9A 3EF1A 3R3ZA 5HXAA 3CZRA 3IQEA 4DUZB 3JYOA 4BFYA 2WKWA 1UWKA 3CGGA 3CSDA 4NDZA 3L0IB 2L2QA 3QYJA 3IDOA 2Z5VA 1EFCA 3EXFA 3F4KA 1XELA 2OOSA 2XB6A 4Q12A 1OU0A 4NBTA 4B6GA 5G0UA 1EH5A 1QS0B 2COKA 3LFTA 5AJZA 1B76A 1D0IA 3DL4A 3L7CA 1U81A 5TQVA 4E3WA 1WSAA 2BSXA 3PDIA 3LUKA 2O50A 2WEKA 4CZ2A 3SM3A 3PD7A 3NCHA 3WGTA 4BU0A 2ANCA 3Q85A 1I7LA 4BNWA 4CTOA 3EZ6A 3DFKA 1G4UR 3ND9A 2RKOA 2NXWA 3PQEA 4BVBA 4BX9A 2Q3EA 4RVFA 1LJLA 3KQOA 4RK0A 4EHBA 1WXEA 3TCKA 1YQEA 1O54A 3EMVA 1XSEA 3PL1A 3TD9A 3H83A 3Q3HA 4HRAA 5KKCA 2COEA 2X9VA 4C0QC 4EYSA 5H3HA 1XK7A 4KIGA 1X15A 4PTLA 1A5AB 3PIDA 1E94E 3GGDA 1EX7A 1E1QD 2Q8NA 3HCOA 3W2IA 1JEQB 3DO5A 2AFHE 3ES9A 4A82A 2J3JA 4DMCA 4UHFA 4C22A 5HJEA 1I32A 1H5NA 1ENYA 1CF2O 3OQPA 3J81k 1WXWA 4KH0A 5TGTA 1E63A 2ZBEA 4YMVA 3K6SA 1VPVA 3ETJA 3EC2A 3F46A 3MT8A 2P3SA 1BXRA 3DEZA 1ISRA 1J8VA 1HLGA 1IOLA 1PJCA 1XAGA 2NVBA 2R1ZA 1SCNE 3OOHA 3Q3GE 1XA4A 3DOUA 1J0EA 4BNZA 3OCWA 1GY8A 3HCFA 3ZV4A 2IOYA 3KBOA 2XNKA 5IYZA 4RJLA 3UPTA 1K98A 1ULZA 3IXLA 4MIYA 1ZUHA 4E03A 4IIEA 4QUJA 4TVOA 2NZYA 1UJNA 3C14C 3IDAA 1FP4B 2BELA 2FDXA 4PNEA 2J08A 1EFVA 2JLAA 3NXKA 3BWVA 4JASB 5A7FA 4FWIB 2CNNA 1DBQA 2P2GA 4YP6A 4A0FA 4V0SA 5EXSA 2C5AA 1PL6A 3RO7A 1N32B 2YVKA 3VAYA 3FTEA 3E5MA 3GFOA 2G1PA 1HRDA 3ADOA 5F35A 5AXBA 3U44B 3DHVA 3MCTA 3OPQA 1CSEE 3HA5A 3KLNA 4V0MA 4Z0NA 2IV2X 2FKNA 2OAGA 2QU7A 2YICA 4FFOA 1WDMA 3DUFB 3LL4A 2WF6A 1Z35A 1YR8A 2FSUA 2Z9DA 1U0FA 4QBGB 3JQ8B 1H4QA 5EIBD 3KKNA 3RJTA 1G7TA 2JFWA 2F1HA 5LL6P 1C3XA 2Q9CA 4GZ6A 5J1TB 1YCFA 5ARDA 3B82A 4HJRA 4YP5A 3PE4A 2QNIA 3NT2A 3AZOA 4IIHA 3AF6A 4OLBA 2R2GA 3JD2A 1ZGJA 1Z6ZA 2AI1A 3KZOA 2VSQA 4CKCA 4W5JA 2CDBA 2N42A 3A1FA 1CQJA 1RQGA 4Z2AA 4KODA 5ERXA 4AJKA 2CL7X 4DMGA 1N2IA 2JFVA 3AWIA 2B25A 3M3HA 4NBNA 2C9BA 2WHQA 1IMJA 1VPDA 4Z9FA 3ROGA 1WZIA 1SURA 3VH4A 3EXG1 4PLGA 4UM5A 5SY9A 3TBFA 3BF7A 4BNNA 4Y1FA 3LPDA 2HF9A 2FUNB 3Q3EA 2CNBA 3EARA 5AFSA 4G07A 4LPKA 2HSWA 4WA8A 3HVKA 3FYUA 2AEMA 4Q4LA 2AC2A 3V1NA 2QZ4A 3CNOA 3H2IA 3QE9Y 3MLBA 4GPAA 3NTVA 4M9QA 4ZU1X 3A7EA 1T0JB 2NVWA 1MW9X 3UCXA 1TF5A 4I3FA 3OX3A 3HCDA 1M6HA 3EXIA 2YJZA 5LQNA 2ZS9A 5GJVC 1Z82A 2Z6QA 4R4JA 3TLKA 5JAZA 1IM2A 3CA8A 4EKDA 4YV1A 3R3SA 4REOA 4Y6SA 4HQLA 2JAWA 3F6PA 1KTVA 2ZFUA 1BMFA 1GPNA 3KKEA 3V8EA 1KP2A 3MBKA 4FMCB 5BT8A 4Q34A 5ECDA 1JHMA 1AV6A 4CL2A 3PJRA 3DKPA 3GPDG 2HY7A 2YX1A 3BEOA 1RBQA 4DCOA 1SUFA 3K53A 1DJPA 2HIHA 4DB2A 1W0CA 1Q14A 2V58A 3IO3A 1EM6A 1G7SA 2HMUA 2WKSA 3DEYX 3KT0A 3P9SA 1K3UB 4K40A 3ZQKA 1U2ZA 4QOFA 4BNGA 4RA6B 3RAFC 3GDWA 2YOFA 4UUMA 3FSGD 4FKZA 1KHTA 4OXIA 4M83A 4P32A 4R2WA 1HL3A 2HCJB 1NU6A 1PVDA 1VSVA 4LZAA 5F5NA 5HA5A 3KV3O 3X1JA 1PG5A 1BHO1 2LZ0A 4CN9A 4IIBA 3A1SA 3C87A 2NLOA 3K9NA 4ISCA 2GWRA 3V1YA 1Q1BA 2BR5A 2VYND 4BWFB 4HUQB 3TAHA 2PWYA 2AF4C 3M9WA 4LWPA 1ABBA 1T5SA 1ENPA 2FW6A 1HKHA 3ANSA 3CRNA 1G1MA 3FNQA 3OEED 2O0LA 3MUFA 1GLNA 1OPXA 4I8IA 3ICOA 1EUDB 3QX9A 3A10A 1ZA2A 3MJHA 3QXJA 5DLQC 4Q3NA 1OI7A 3MBIA 4I46A 4CIYA 1G8PA 3JCZA 4NH0A 1YCGA 3ILXA 3T38A 4A0HA 2EQ5A 2LIPA 4Y0NA 3D81A 1FNCA 1L4NA 2HSJA 2VP3A 4P4NA 4JJKA 1UC8A 3B3FA 4PX9A 3KOOA 3W79A 3H9EO 3G9UA 2FPLA 2MR5A 9GPBA 2HMSA 4IR7A 5J4KA 4EECA 1IWOA 2PNFA 1B0PA 3RRZA 4IDDA 4XM1A 3EGXA 4A0GA 4BASA 3GFBA 3KAJA 3WBJA 4LCJA 2YNMC 3S5JA 3IVGA 3KBBA 1CP2A 2IEYA 5IKMA 1C4XA 2XBLA 4WCDA 3WLNA 3E18A 4MQUA 2F8SA 3JRXA 1UPUA 1Q0HA 4C5AA 2YKGA 3KJGA 1SZJG 1TCAA 1UFVA 2PGAA 4NV3A 1GPWB 2BSQA 2AN5A 1JTFA 2PBFA 5FOUA 1U5BA 1W6UA 2X77A 1OYVA 2VTBB 3ONEA 4FONA 3IBYA 4QODA 2V7QD 3JQCA 4R7ZA 1EK2A 5JXHA 3GLFB 4ZGGA 4R16A 5IT0A 2PS1A 2JCGA 3SIRA 4BNHA 1A50B 1JB9A 1JVNA 1P1FA 1R4MB 2JCBA 2Z2YA 2WJGA 3DG9A 5CFMA 3BPSA 2MINA 4EFNA 1Q84A 2AXEA 2DEUA 2SICE 4G24A 1M66A 4CTNA 3CTPA 1RI2A 1C30A 5CTJA 2PL3A 4CEJB 2VJAA 1QV9A 3PXUA 4UBNA 3M3PA 2OZEA 3EDRA 4MYDA 2XW6A 4ZHQA 1RXIA 1NBMD 3QJ5A 3BT7A 1WKCA 4MP8A 2HJRA 4TVBA 3BIXA 1UBNA 4WFQA 1ZHHA 4XAQA 4ZOBA 1M7GA 1J0CA 2XXJA 2CV1A 5JI3E 2QM7A 2YIJA 3WRWA 2IY7A 1ISMA 2G72A 5DCYA 4FLEA 1A2QA 1XZBA 5ETJA 1Z2AA 3P2YA 3VNBA 4CRWB 1KRXA 2XADA 3NH6A 1DXHA 4BNIA 2Z6VA 4Z0PA 2ILVA 4GDMA 1MR3F 4A0RA 4BE9A 2B69A 3KJZA 1LEHA 3G0BA 4N5DA 3TB6A 1VECA 5ILOA 1Z0ZA 4IUBS 1E9BA 3H9QA 3RS4A 3O2QB 2W2NA 1VHTA 5T67A 4EL0A 5E2BA 4IG9A 4U7GA 1MRNA 4X63A 4X8LA 3A04A 3Q7PA 3Q7TA 4MKXA 2ONJA 2IC5A 3RHTA 1WO8A 2YQ5A 1QH1B 3BXXA 2GM3A 4TYQA 1SH7A 3ON5A 2OCKA 5EHQA 2Q41A 2Y8EA 3A1NA 2QW1A 4C04A 3U37A 3W2HA 6ADHA 3CVVA 5ALUA 2DY1A 4IJMA 4Q6BA 2P2LA 4K8RB 4BWVA 1KFBB 1P8JA 3R5TA 1SU8A 1XEXB 4UCWA 1RE1A 3B13B 1KPGA 4ESOA 1I3OA 2C83A 4LRWA 2APJA 2JLSA 4EAQA 1LLCA 2CLDX 2ZSJA 4LJSA 4DV2B 3F3KA 1NW6A 5AK6A 4Q7EA 1AKUA 1N34B 5IFLA 3RYFB 2QTWB 2AG1A 2XNJA 2I4LA 3I04A 4GG1A 4A1FA 2QQGA 1C1XB 4NYJR 4EB6B 5CH8A 2E85A 4NAVA 3WLAA 5LSAA 2IELA 2YJGA 2Q3LA 3KSAC 5ITVA 3COZA 2AG8A 4PTYA 1L4FA 4NE9A 3RSFA 3D2BA 1Q74A 2B3TA 2FLKA 4FZJA 3TG8A 1ZQ1A 1YR2A 2Z3WA 4RD1A 4RY0A 3K9FC 1TJ5A 4RFLA 3EA0A 1KAMA 2ESRA 4J0GA 4PBSA 2PV0A 3ACDA 4RDIA 2FMXA 3CH6A 1G4AE 3PFCA 3VU9B 1NW8A 1AK2A 1YC2A 1P1CA 1BFUA 7MHTA 5ALMA 3A25A 4MGEA 4B6FA 2EEPA 1WL8A 3FGPA 3Q0TA 1TYAE 2X19A 4PNHA 5CA0A 4IIGA 2QENA 4X61A 3TUJC 1I01A 1YQUA 1X1QA 4H4EA 4HPXB 4RHFA 5BWLA 5C4IA 1CLEA 2FMFA 3PWSA 4QU9A 3LQRA 3ZQ6A 4EI7A 1TCCA 2BE7A 5I7OA 3FYHA 2X8WA 5EZ5A 5LMNB 3DAHA 4AB1A 5FJJA 4L73A 3FYDA 3UFXB 1F6BA 3WQHA 3FTCA 2XMZA 1LI4A 5A1TA 4GI2A 3L0YA 1S2GA 3KVNA 2PUEA 2V6GA 2JLZA 3PQ8A 3BICA 1DJQA 3E9DA 4RO0A 5BSEA 4OLFA 4RXTA 1G59A 3LPAA 3NHSA 5HIMA 3RV3A 3P27A 4DUPA 1MX1A 3LC7O 3G0IA 5KTRA 1CQJB 3I3SR 4YRAA 4MH0R 2BZGA 3I1IA 1L5OA 1Z7YA 2ZIWB 4ZI7F 3GNTA 2GMWA 3D4IA 1KZYC 1O4VA 4P4GA 4EARA 2JD1A 4KLCA 4X20B 4LI3X 1HL7A 2HSZA 3DXZA 3F6SA 3NDJA 4TYYA 1O95D 2VAPA 1G8GA 2LPMA 2YUTA 2XZLA 1E0AA 1GGNA 1PGOA 3AL3A 3ODPA 4ZU3A 4WOKA 4A15A 4JYPA 4BZZA 2XGOA 4LC9A 2LBPA 1GZSA 4X71A 4AYTA 1S2DA 1X8LA 1LF0A 2GARA 2WJYA 3ZQUA 4D9FA 1PV4A 1KDOA 1N2ZA 1SCBA 1PIWA 5C4GB 1MIOA 3PQ4A 4J1NA 1WULS 4ZOCA 2CJWB 3CZ5A 5HK8A 4PZUA 5DMXA 1COWD 4HLUA 1P2TA 5CA1B 1A8IA 2F8MA 1W87A 2OCIA 1A04A 1Y9DA 4I9HA 2HQRA 2Z5FA 5JRJA 1KMQA 4ND8B 2C58A 1ILEA 1HEIA 4CNBA 4QVIA 4UHBA 5L40A 1H8EA 2EFDB 2GXQA 3B3GA 3VX4A 3VGPA 2P9HA 4RPIA 1GSAA 3N74A 1QUFA 4HNGA 2VYNA 1EUCB 4UU7A 5SYAA 1RBYA 5BQ5A 2R66A 3K72B 1Y1SA 2J6HA 1T4CA 2QN7A 1TAQA 2BUBA 3EEYA 2XWQA 3UZUA 3FWPA 4K28A 5EZYB 1CFJA 1NDQA 1VLQA 2BEKA 2JK0A 3NHRA 2PH1A 1DKNA 4RL6A 4NAHA 4UBIA 3A2KA 4D02A 1Y6QA 3ZS8A 2XZTA 4E15A 2OO3A 4LMAA 4LZPA 4OH1A 3B48A 2G6BA 3UAVA 4ENVA 1L5QA 2IFTA 3H5AA 1PSDA 2IDKA 1JEQA 3V97A 4B85A 4O6VA 1K7XB 2BRUC 4I55B 4PYQA 5DTEA 3A6DA 2BBWA 1T2UA 4LVNA 1HEUA 4JI3B 1X1DA 2NZXA 1NW5A 1STOA 1ZICA 4RACA 2G1UA 1QGZA 2GHRA 3KL2A 3R44A 3RSLA 4KIUA 2CDRA 4IO0A 5THKA 3V8PA 3QUAA 4JJAA 3FVQA 4ZA2A 4FQ7A 1VYVA 5KQRA 3IMGA 1RZVA 1RRFA 3IEXA 1O94D 4RTNA 1CVRA 3GFFA 3VR5H 4XQEA 2IVFA 3AL0C 2VQ6A 5F21A 5JCOC 1S1MA 3BJIC 1TO1E 2ZGVA 1BWSA 4P22A 1JEYA 4Y6PA 1C2TA 5CAEA 4CLOA 1RVDA 4ZQGA 3U09A 1GRCA 2VKTA 1DG9A 4FKMA 4C0SA 3AU9A 3KOZA 5ALEA 3R8CA 1SC9A 1NKTA 1XPOA 5EWJA 5LMCA 1P9RA 1Z7BA 4I1PA 2A0WA 2XNHA 3CRVA 5CDSA 1YT5A 2OCXA 1BKYA 4G1EB 4YTEA 2WLTA 5BUCA 5L6MB 3G2HA 4FNMA 4PXSA 4CEHA 1HXHA 1C7QA 2AFVA 2CW5A 3K9BA 2V5AA 1GPJA 4MQFB 2ZR8A 3GP8A 2XMDA 1BMFD 1OWMA 1TI7A 2WMYA 2FK7A 3ROKA 4E1VA 4ZFNA 2NUTA 3RHFA 4G0OA 1AB5A 3K9GA 4JYBA 4FFWA 2VG8A 5FNZA 4AIIA 2Z8YM 2ZT5A 4P7FA 4YRLA 4C87A 4CTJA 3ZPXA 2EBHX 2Y1KA 3SNHA 3B89A 2BTEA 2FR8A 2VRCD 2HBQA 4UULA 4WE3A 5FORA 2D13A 4IQ4A 3H6HA 1CZOA 1QHHA 3OU7A 1G5TA 1U0BB 4DWWA 4GBJA 1RC0A 4BJ6A 1G2PA 2WFLB 3MTJA 1ST3A 1V1RB 5KYKA 4ABTA 4OSOA 1NX9A 4FOLA 3O8LA 3A6LA 3CRZA 3U40A 1I6KA 3GA7A 4DSUA 2AR7A 4RK1A 1T1JA 2PJUA 1GTSA 1P7VA 1G9XA 2NU7B 4V1CA 3BKXA 4XWWA 1P2SA 4AJEA 1REQA 3U3MA 5F98A 5HQ3B 1HSZA 1DWPA 1FTQA 4AWAA 1QAQA 3KQYA 3RREA 2GPJA 4W7IA 4Z1MA 5ITWA 3GBVA 2B82A 2XNCA 4L9SA 5I7FA 2O20A 2XB4A 5HIIA 3VO1A 2X0DA 4B0PA 2RGDA 5LMZA 3B6IA 3IKMB 2G4LA 2XA2A 2HW8A 2OGWA 3H87A 3V9AA 1R4MA 3E2MA 3NATA 4L4RA 1LVUA 2WWVD 3QG1A 4ZYVA 1RLJA 5LCXA 1VYUA 1JAIA 1RJDA 2FHPA 2NTVA 2ZIUB 3NAGA 4OV6B 3QOYA 1RT9A 5GJWC 1I2BA 2PH3A 1TUBA 1G3UA 4QBHA 5JVDF 2YMLA 3LL7A 3DZCA 3EC1A 3RUFA 2RGUA 3JYPA 1XCBA 2PUCA 4DNXA 2OG1A 2YS7A 5EEHA 1DHTA 2H18A 3CYFA 4GXNA 1LWOA 2PLFA 1N6PA 1Y9JA 2ZRAA 3BWMA 2VJMB 4L5YA 4UHEA 1GQ2A 1PU2A 2ZTUA 2TMKA 1XJQA 4KO4S 4RGBA 3T3HA 1L3IA 4C06A 4B6EA 2XUHA 3U4AA 3B7GA 3QKIA 4OREX 3O0DA 2P4EA 4OXRA 2Q2NA 2YJ4A 5DZSA 4XOUA 1MJGA 1PR4A 2IRWA 2PH5A 3DAYA 3HN2A 3KSDO 2VI5A 1XDSA 1C8BA 4ER5A 4ZMSA 1I13A 4J0QA 1VL1A 1S1CA 1DGQA 3RQIA 2AV6A 1ZN7A 2Q4OA 2QKYA 3E8MA 4YUZA 1Y33E 3NRBA 2AMFA 4GKVA 4BNTA 3QBEA 2O48X 5K3DA 3WS7A 2IF2A 4M0UA 3W6PA 4RJIA 3UWDA 4EQ6B 4LA4A 4EKYA 4HEHA 3I76A 3BMOA 5J4VA 1VKZA 2IUTA 3E82A 1OFUA 2G5CA 4EH1A 2V4MA 2OUIA 3H1BA 3K96A 2B4TO 1XTQA 2OE2A 4EA7A 1K6MA 1BCRA 1NLUA 3OZFA 2QDKA 3ZCUA 1ZMTA 1CUBA 4JSTA 1BHQ1 1JA0A 4RW0A 3NDIA 5ALNA 1PFUA 5H5JA 4BMSA 2GK6A 4R40A 4BV3A 5GOZA 2ECQA 3QKRB 2ZVDA 3T34A 2EDCA 1FXSA 4E7PA 3FGNA 3RABA 3Q41A 1CT9A 4QAJA 3PHBE 3TGWA 4A0QA 1RYHA 3FD8A 3W6NA 3F97A 4JXZA 5KCMA 2JASA 1JKXA 3NHPA 4IS2A 4NG5A 5F7OA 4RULA 1KNQA 5IVKA 1Q0LA 2HJHA 2Q9AA 1UMCA 5HF8A 5EIAA 4E51A 4IVNA 3X1KA 3M5WA 1B0UA 3QK7A 5IYZF 3NTQA 1ZJZA 2VZLA 3H1FA 5C1DA 5JISA 2GZMA 3L0OA 3DF9A 1DKLA 1IPHA 2W22A 2G88A 3KCNA 2MSNA 1M1YA 5IBRA 1UBSB 3HJUA 4G1FA 4MGYR 4NU8X 2ERCA 3C6KA 3FNHA 4ZHSA 5JC1A 1P8AA 3ND7A 4C0LA 3CKYA 3K6JA 3ISTA 1OLXB 1C4WA 3PPYA 2P1ZA 3OETA 4AJNA 3CPEA 4JKIA 4K9PA 5J9FA 4MLCA 2O3RA 1Q11A 2MOKA 2O6LA 3KLBA 3LYLA 2YHIA 1BD4A 3GNLA 1Z8NA 4H4DA 5JLJA 1W19A 1K0FA 1ZCZA 3FZQA 4FCWA 4K6KA 5E4FA 1V9LA 1OV4A 2R85A 3IH5A 4GUAA 1WF6A 1V8PA 3CCFA 2IV3A 4DQ0A 5HYVA 4Q1VA 3ZHVA 3WSTA 3BFKA 4V0QA 3L0CA 4PX5A 1I4TD 4JB8A 2BDEA 2IU4A 4MEBA 5IJWA 1E7WA 1RTTA 4IINA 2XE6A 1ULUA 4BNDA 1Y8QB 1VLHA 1ZPDA 4KE8A 1HFKA 2BUAA 1JZSA 3DLCA 3OIYA 2PMKA 3IIKA 1XZNA 3QE2A 3L4EA 4R68A 4U8GA 4B74A 4CVNA 3AINA 3D7MA 2QG6A 3FKSA 3FWNA 3MAGA 1JGTA 2OFWA 3FG9A 4MRNA 4NZYA 3FHOA 4F7DA 3W4IA 4H9GA 3WIEA 4KR3A 1T8TA 4N49A 3RANA 4AP5A 4OGWA 5HKLA 1KDYA 1NPTO 3I2HA 1T5IA 4OMFG 4PRZA 2YZKA 3PXBA 4OUDB 3RYCB 4RH0A 3IPAA 1ODTC 4PNPA 3NETA 2VPWA 1RPNA 1SCUA 2DJ5A 2G76A 4H15A 5BR7A 3A6PC 4BB0A 2Y1GA 3EN0A 2UVQA 2WIBA 5KQMA 1B0AA 1B93A 1D5WA 4LPSA 3JD1A 1LV8A 4OI2A 3UUGA 2X5XA 1HURA 3L8FA 1PL7A 1CUGA 1QMGA 1KKMA 3HJRA 4A6DA 1EB8A 1WVMA 3H4IA 1CERA 3AV0B 3ASUA 1Y4UA 3JQAD 4FBLA 3O21A 4FU0A 4LDAA 4BLSA 1E1RA 3O8OB 2DBZA 2B2NA 1C3LA 4MR8A 2QGNA 3CGWA 4HDRB 3ZWVA 5L53A 3VJRA 5HVNA 3A4VA 3OX4A 4K05A 4KDEA 4O4IB 4QYSA 3VU1A 3X1WA 4KZKA 4XWKA 2F43A 3F3MA 2YFQA 4EYQA 2EX0A 1NZJA 2H63A 3GG2A 3D6NB 3MRVA 4JB2A 3HBLA 3HYCA 2IDMA 1Z36A 2O8VA 4DWVA 1SG9A 2H7YA 3Q9SA 5AK4A 1Q19A 3FZEA 3N0XA 4F4FA 5A02A 1Y6GA 1OLXA 1XMJA 2FZGA 1MQ9A 1ENZA 3DO6A 1TXGA 2RGCA 1PG0A 2I2XB 5HF6A 4NS4A 1L5VA 5E9WA 3GROA 1UBLS 3T12A 3QVGA 1DT3A 1UXKA 1XWWA 3D1LA 2Z3ZA 4H3SA 3RWBA 1NLZA 4X5OA 1XJCA 1RS0A 1ZJ6A 3HO6A 1GYRA 1TKRA 4ZYXA 1MW8X 2JLYA 4KVGA 1DFIA 3IPCA 2VQDA 4NPCA 4D3ZA 3E3NA 1T8PA 4JKYA 3GJZA 5EESA 3RTBA 1P60A 4KXFB 3CV3A 3ZNOA 2UZ4A 3D43A 2Y05A 2C2WA 1CHNA 4MAMA 4ZAWA 4CIAA 5DTIA 3RF6A 1L7OA 1D09A 4BCBA 3E9RA 4D0LB 2XLBA 4YROA 1YE3A 2ZWMA 4H59A 3T4UA 3VRHA 1I4OA 1CY0A 2GX6A 5KYVA 1XRQA 4POAA 4YDQA 1WB9A 4M9SA 3C3KA 3LZDA 2PLRA 3DBRB 1XO1A 2JHFA 1I2ZA 2Q3MA 4P1ZA 1E1KA 3A3NA 3KZKA 3TZHA 3HWX1 3UV3A 1P91A 1IVSA 3HJGA 3GUVA 4KMSA 1BX3A 2Y9MB 5BSTA 3KT8A 1DIHA 4Z5XA 3Q9NA 2V96A 4FMBB 4H1VA 1Y34E 2B35A 5BN4B 3BREA 2C3MA 4YUXA 2XA1A 3FNFA 2IGTA 5AI6A 1P2FA 4I5IA 3BTOA 1LTKA 3MLEA 4ARVA 1DAKA 4JMPA 2K7FA 3A1VA 3DVAB 6ABPA 4WAUA 1HDGO 1NW4A 2XV1A 1DQZA 3V2UA 4BQOA 4WKBA 1D4ZA 3ZK7A 3ZGXA 2BF4A 4BQRA 2W4MA 4A2PA 1L5HA 1B6SA 3BAZA 4B3GA 2BW0A 3H5TA 5GONB 3ZHYA 1JHVA 1LJUA 2UAGA 3CB2A 2DRIA 3VJLA 1C9YA 4DGSA 2WA2A 4IQFA 3C8HA 4G89A 2ISCA 1QYWA 2B30A 3WGYA 3TTYA 3ZWNA 3NEPX 4CPDA 5JJBA 4N03A 1C1DB 3P7MA 3UTDA 2P30A 3U48A 1UF9A 1ZMRA 4R8LA 8LDHA 4MW6A 5DRYA 5TGDA 1G8JA 1PR1A 2RHBA 1DINA 2JLWA 5DOZA 1OYYA 4UFNA 1KJZA 1A4RA 5JSYA 3RD5A 3KD3A 1R8SA 3ANMA 2Q8QA 4RYDA 3A32A 3UGQA 2GNAA 1WAMA 3M6MD 1S02A 4RKFA 1JEAA 1PD1A 4NP6A 4B4DA 1QG4A 3V4SA 3MK31 1DFGA 2QSJA 2ZRJA 3HYTA 4O4IF 4Q4HA 3THOA 2WJWA 5C32A 3CUKA 4S1TA 4FSHA 2ZWPA 1KZHA 3A9TA 3EBPA 3K2BA 4DM3A 16PKA 1MN6A 4D79A 5CDTA 5EHZA 1JH9A 4V1CB 4NBLA 2EJTA 4YJHB 4ZJPA 4R9NA 1Z2DA 3REQB 3X2FA 4M3NA 1IYZA 1JIVA 4PZEA 3FJ1A 4M2LA 3QXGA 4EHIA 4PCLA 3BIJA 1QOZA 2CZGA 1JHQA 4EPYA 4OOFA 4B80A 4KAFA 1QRDA 1N9GA 2CC2A 1J25A 3QA3E 2V1UA 2Y0EA 5JFOA 2QNRA 4ZMRA 2IYTA 3QW4B 2KQUA 4BNDB 1JSRA 4CKXA 3L7NA 4Q4CA 4G0VA 3THXA 2HU5A 1LK0A 6LDHA 4P98A 3WLHA 1YVPA 3O73A 3THRA 1SXJB 2RG7A 4LWQA 3W5SA 4JROA 1B16A 4RNCA 4C5BA 2YZMA 2ZW9A 4ZZ1A 2I1VB 1YQWA 3VSEA 1QMPA 5LD2B 1K6EA 1LTHR 3NFYA 2WFZA 4F1KA 3BHJA 4YCCA 4BHTA 2F3TA 4P0PB 4H7FA 2OORC 4Q1FA 5A1JA 5PGMA 3DP7A 5AVXA 3T5CA 2WG1A 3D3WA 4FYIA 5I8WA 1Z6TA 1J2EA 2VDPB 2X1MA 5JS8A 1J06A 1SU6A 2FW7A 3U26A 2L19A 1KWKA 2GVZC 1A1SA 1Z6AA 3SVZA 1P5FA 1Z9BA 3BJRA 2M6KA 5INTA 5KTYA 1V71A 4DW8A 4IGEA 2EV9A 3KYCA 3LNTA 3THYA 2QL7A 1BTOA 1CF4A 4IKEA 1CJKC 4E5PA 2CLSA 2P9YA 2WWGA 1JYFA 3IESA 4KQEA 2FN7A 1KORA 1P3Y1 2AK2A 3WVNA 3UWKA 4RV5A 2H52A 3VGJA 3T9DA 5BMVA 1LK5A 2IOQA 1OTXA 4XB1A 2JFNA 1B3RA 5BURA 4NCBA 1P5HA 2BFEB