1CJMA

Human sult1a3 with sulfate bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
286
structure length
223
Chain Sequence
b'SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQRVPFLEVNDPGEPETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLGDWKTTFTVAQNERFDADYAEKMAGCSLSFRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ARYL SULFOTRANSFERASE)
publication title Crystal structure of human catecholamine sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 223
sequence length 286
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cjmA00
2AXPA 4K46A 5E7JA 2B7CA 4H1VA 1OJLA 1VG0B 3PUVA 4NCNA 3SYLA 1E9CA 3W34A 1XTRA 1YVDA 1YZGA 3I1FA 1P2TA 5AJVB 4TLEA 2BBSA 3T12A 5CLLA 2GCOA 5FUYA 4V0ME 2ZR9A 4DLWA 2A5DA 2C98A 1S9HA 4HZIA 1R5BA 4YMVA 2GDJA 2OFXA 2F9MA 4N3NA 4S35A 4PQYA 3W8NA 1R6BX 3BE4A 1I4LD 4KVGA 2AKYA 4B6FA 3E70C 2CJWA 4LZZA 4CEJB 3B78A 1CBUA 1FP7A 1X1SA 1ZP6A 3EIQA 3L8ZA 4OHZA 1V5WA 3VMFA 2O8CA 4MDFA 3WBJA 2ZJ5A 3KFXA 2J45A 4RFSA 5KNCA 4DRZA 3L0IB 2IHBA 5DLQC 2EFGA 4MRVA 4QKQA 4JLBA 2WIBA 1BKDR 3EG5A 3KXKA 4Q4HB 2GTPA 3VFDA 3ZZ0A 4B3BA 3TKLA 1AGRA 1SXJC 2O0JA 4OQLA 4GP6A 1Z2CA 3K53A 1UF9A 2QENA 3NBFA 2XXAA 2AX4A 5KSOA 4BLPA 5TVKA 2PT7A 1H8EA 1TQ2A 3GJXC 1N6KA 2O8EB 1ZINA 2F1IA 3MWKA 4V02A 3A4NA 2WJVA 3U3RA 4B3DA 2H18A 1YQTA 2P65A 3QKSA 2ZRHA 4EJSB 1E3MA 2V7QD 4PR0A 3WBKA 4PPNA 3SBEA 1Q1ZA 1DTSA 1XJQA 2RGNC 2W0MA 1G9XA 1XX6A 2EYUA 2ZJYA 4KSBA 2GJ8A 3NHBA 1L7VC 1OHHA 3FWYA 4GRAA 2XTMA 2W6ID 2ZJBA 4US0R 2ASEA 3ZS8A 4XH9B 2R65A 1FNNA 2WMNB 2XNSA 4GT1A 1HT2E 4Q7KA 3QKTA 3CB4A 4TL7A 2FSFA 4IXMA 5CK4A 2IX3A 1R2QA 1M7BA 1E79D 2OSBA 3MAAC 4HLQB 4BFTA 5KTYA 2JA1A 3L0PA 1VG1A 3DM9B 2ZJZA 1AN0A 4NPHA 5DO9A 4D0GA 2QTHA 2MSEB 2X8AA 3TQCA 3A4MA 2QEQA 1G6HA 4MUBA 2F1HA 1DE0A 4OI2A 3QJYA 4W7SA 1VDZA 5HCIA 1JR3E 2VA8A 3K0AB 2WKQA 4FCVA 5FOTA 2Z4SA 3LBHA 3QSYA 5B2ZA 4QHYA 1E98A 2VSOA 1S96A 4BFWA 2GJAA 5E3HA 2X2EA 2JJ1A 1EFCA 2BC9A 4FIDA 1NJFA 3KKOA 2XTNA 2OEPA 4IOLA 3P27A 4LJ4A 4Q1DA 4PO9A 2AK3A 4TL8A 1NN1A 4OJKA 2Z83A 5KNBA 5H68A 1N6OA 2QAGA 4HLUA 3K1JA 2D7CA 1H8HD 1P72A 2OHFA 3BAFA 1KK1A 1ZCBA 3KXLA 1N6LA 5KSPA 3RANA 1Q57A 3LO5A 3UPUA 3QVVA 2ODBA 4JVMA 3THXB 1Z63A 1P60A 3IIKA 1XU4A 1JR6A 3FHTA 2ZI5A 1TQ6A 2Q3MA 1XD2A 3WRXC 4A1FA 3U44A 2LWIA 2L0XA 4IEIA 4M8NE 1VKJA 2JCSA 4Q1EA 4XIGS 1GUAA 1I2DA 3WRYC 1J90A 1W4RA 1EGAA 4TYPA 5FOSA 2GETA 1OIWA 4IRUB 3SBDA 1EG7A 4TL6A 4C0JA 1G8FA 5B64A 2FEMA 2R6GA 1VCOA 1KAGA 3DPUA 3GP8A 1W7AA 2BKUA 1JECA 2XEXA 2GXSA 5A0FA 4BLTA 4WZBE 2O0HA 1PLJA 2O5VA 3UIEA 1XP8A 3IIJA 4KJZA 4BRUA 2VH5R 2WWYA 1Z6AA 4M1WA 2AHOA 4TYYA 1N5JA 2J0UB 4A0GA 1D6JA 3W5JA 2Q3FA 3FTQA 3CZPA 5DNYB 3I92A 3PFIA 4V0MA 2FPLA 1PUIA 3ZIAA 1D9ZA 3ASZA 4IFEA 4QHSA 4W5HA 2WBLC 3F8TA 1Z6XA 4MRNA 2VF8A 2EQBA 2YINC 4URXR 4BFXA 4D4JA 3QPVA 2E9SA 4ABYA 4A36A 1E2KA 3W5IA 2F43B 2ZI6A 3K9NA 4LGMA 1ZD8A 3F0TA 4G5SA 1A7JA 1UADA 2GZAA 1KI1A 1J7KA 2A5FA 4HSEA 3SQXA 1IY2A 1M6NA 1U8ZA 3N70A 4GOKA 5FOUA 2QQ0A 2JLSA 3GEEA 4QBHA 3OIWA 5LB2A 1NLYA 2ZVQX 1ZUNB 5L3SA 2QGNA 2EWWA 2WKRA 4A0HA 3R9XA 1X3SA 2WZQA 2D4HA 1ZJ6A 1TL7C 1SHZA 5HPYB 1AKEA 3QXHA 4IEEA 3SFVA 3IKJA 2QMHA 3RS3A 3GJ5A 4OJQA 3R8FA 2VHTA 1JJ7A 3B1WA 4B76A 1U81A 1Z06A 2J7PD 1D9XA 3PR1A 1L4YA 2JEOA 3HYRA 4MRSA 1QG4A 3BGWA 4JZKA 4Q02A 3UMSA 2GEVA 1GL7A 2YYZA 1ZUHA 5KSZA 4YQFA 1CEEA 1R10A 4E07A 4JBXA 3MWJA 1BOFA 2ZRMA 3KKNA 2C95A 4WIAA 3REFA 5FBWB 1W5SA 5KNDA 4KCGA 4JSTA 2X77A 3C4JA 2QMEA 4D4LA 3FB4A 4WBSA 1W2GA 1E2GA 2HJVA 3C7KA 2PEYA 5L8VA 1AJEA 3H4MA 1ELOA 1AS2A 1FZQA 2R6AA 1GTVA 2UVQA 2FOLA 2KJQA 2OBMA 4M9ZA 3AP2A 4WOPA 3KL4A 1TX4B 2CVHA 4JLMA 5F98A 421PA 4BEJA 3QOFA 1WA5A 2QN6A 4TQUS 3AVXA 1NMXA 3P4YA 1SHKA 2O0KA 1SKQA 3OEED 4D26A 4NBSA 2J59A 4Q01A 4HLCA 1JALA 4EPTA 1NJGA 3QEJA 1XPOA 2AN9A 4NL4H 5J4YA 1OXUA 1Q3TA 2KBFA 1N6PA 2ZREA 5DI3B 3VQTA 2JLYA 3KKMA 4F91B 1J70A 4Q9IA 2P5TB 4PZYA 3F3YA 3FVQA 4HZUB 4QGAA 4JS0A 3VNUA 3RRNA 2WM9B 4GOXA 1W36C 2IYSA 2RAPA 1FMJA 1W48A 1YRBA 4O25A 4PAOA 1UDWA 1HEIA 3EZ2A 4C2UA 1OKKD 4B2IA 3B1XA 2V3CC 1I4DD 4QOSA 4ESHA 1HE1C 2WTUA 1PZNA 2PZEA 2XZOA 5D3MB 1OPXA 2X1VA 2J7PA 4JVLA 2NPFA 1NN3A 2QT1A 3BJIC 4LJ7A 4B34A 1DAEA 3ZQJA 2BDTA 2IXFA 2ZSEA 1P9RA 2QQEA 3B8HA 3NG1A 3O8RA 5C4MA 1KO8A 2ORWA 5LD2B 2G9NA 2JLRA 5FTNA 1AZTA 4DDWA 1KDOA 4QL3A 1KSGA 4Z1MD 1VIYA 2B6HA 3C8UA 4Y0VA 3SFZA 1W0KD 1II0A 1W4BA 3OIVA 1CJMA 2C04A 2ERYA 4PHGA 3TUZC 2IWHA 3GQBA 3LW8A 3MJRA 4LYAA 3UG6A 5CYPA 2YKGA 2KE5A 5K8IA 1NI3A 3VR5A 1T91A 3GLGB 5G53C 3GLHE 2UZ3A 3MCAA 2CL6X 2ZETA 2PH1A 2HXSA 2Z43A 3IGFA 4OHVA 4LI0A 2ZJ2A 3DO6A 4C0KA 1P9NA 5JHHB 4EPXA 4LJ9A 3KJEA 1RYHA 5DYIA 4TTRA 4FMCB 2CLCX 4PSVA 1N6HA 5JRJA 4CEJA 5K8UA 2JJ2D 5E7IA 3RABA 1Q20A 4RD4A 1XMJA 4QFMA 1SXJB 4DLSA 5BWMA 2NIPA 1BO6A 4K81B 1Z3IX 1IXSB 5CIQA 5EUMA 4PC6A 4N0DA 1OXVA 1FL9A 2XAUA 4G5GA 4TTPA 5EE3A 1F3OA 3P20A 2X19A 4Q4HA 2JAQA 2OCAA 4N1AA 2FSIA 3NWJA 1E96A 3K0CA 1OKKA 4C9BA 1G3UA 3HDTA 5IRCD 3RC3A 4GL2A 2OM2A 4B6EA 4A4DA 4UXJA 1PUJA 1N3BA 4QJ4A 5J5CA 1XD9A 1TU3A 3ND9A 2O8EA 1MABA 2A5JA 1NVVQ 3QG1A 2JDIA 1RYFA 2VPPA 1JXOA 3GLIB 1KKMA 1VHLA 4UQOA 4EJSA 3AVUA 2KSQA 2HLDD 4FD2A 1JJVA 3U3JA 2FF7A 1DAKA 3A6PC 4QM6A 1W0KA 3GEHA 3ND8A 4B43A 2P3SA 4IDHA 1NRJB 1NVUQ 1FMLA 5FOXA 5J4LA 1RRFA 3LXXA 1A5TA 4KAXA 4BLOA 3I5XA 3D31A 3WMGA 1LY1A 5TB5A 2ONJA 5KDDA 2BEJA 4QNMA 3TR0A 1OFHA 1HQYE 2CBZA 4BLSA 4DIDA 4L5BA 5GJCA 4HDCA 1GILA 4MRPA 2WJIA 4AKIA 1LS6A 4QM7A 4PC2A 2OCPA 1US8B 3BC1A 3ICEA 3T1OA 4WZAE 3W3ZB 3L2OB 2O52A 4LHYA 3K0AA 2GJKA 2HDNB 2JJ2A 4BZXA 4FI3C 2OXRA 1G3MA 3EZ9A 4OK6A 1X8LA 2QI9C 3SJCA 1JQJC 4KFSA 3HJNA 1HTWA 3JZAA 1Z2AA 1G7CA 1QF9A 2C77A 3ZZTA 4IJMA 2VYFA 4DLRA 2OFWA 3X2SA 3OAAD 2IEZA 2ATXA 4AK9A 2JLUA 4KITB 4GP7A 4Q9HA 1A1VA 1DS6A 3AVQA 2RGBA 4FINA 3FHOA 4MKGA 3GPLA 5HE9A 2F55A 2V1UA 1QHXA 3A1WA 1OYYA 1KO7A 2HCJB 4LBVA 3EA5A 4KFRA 5EJEA 5JEDA 1FW6A 4M0LA 3EPHA 2B8TA 4CVNA 3AGPA 4JT2A 5DISB 1OLOA 1XEFA 1E0KA 3QBTA 4HATA 2JATA 1TUEA 2DFLA 2QMOA 2Y8EA 3RS7A 3ZLJA 2FWRA 2IYQA 1WMSA 2HLDA 1GNRA 5AUPB 2QG6A 2JLQA 1MO5A 3K0EA 4BUJA 3AF1A 4ZV4A 2H1LA 2GEDA 4HYYA 2VHUA 3C5HA 3CR7A 5LPNA 4POAA 2GVDC 2EFHB 4Q1CA 3AVOA 3GFTA 5DGXA 1HY3A 5AWFC 3U44B 1U8YA 4KBGA 4RSGA 5KPDA 1Y3AA 2G3YA 1JAHA 2C9CA 3I61A 1X1RA 3EAQA 2J41A 1P61B 1YR9A 1FPMA 2HEIA 5J4VA 4GOJA 4E22A 4NHOA 4PPGA 3U7EB 4Q7MB 4JJZA 4L9WA 2AFHE 4PXAA 2QP3A 3I73A 3TW4A 4L16A 2X2FA 2V9PA 2YC2C 2J0UA 2ZUCA 5J47A 4KO8A 2ZE5A 4RD6A 3QXXA 5DHFA 5FOWA 1FQKA 1U2RA 1IJFA 1M7GA 3CRMA 4DLUA 4P3YA 2K5UA 3H0KA 1TF2A 2N42A 2ZR7A 4YXWD 3OAAA 3BWDD 2ZM5A 1HYQA 1OYWA 5JSZB 3K70C 4QRHA 2TMKA 3QKUA 1QRAA 2CHVA 1I4TD 2F43A 1GL6A 3TNFA 2Q6TA 2R6CA 5EUQB 2LKDA 1DPFA 3DZDA 4AG5A 1ZNXA 4TL9A 1EX6A 1PLLA 1ZMXA 5AUQA 2DFTA 1VCNA 3IBGA 2REOA 3T15A 2Q9BA 3EZFA 1TQDA 2WWXA 4U02A 3EIHA 4TZ0A 2C2HA 4CF7A 3HWSA 2JLXA 4CIDA 3AVVA 3C41J 4NDZA 2AKAB 3BH6A 3THYB 4A0FA 4RCZA 1CR0A 2OUKA 4C7OB 2IUTA 3BFVA 5JCPA 3ZD7A 1OE0A 1OW3B 3P26A 4X8HA 2PJZA 3Q7QA 4MYHA 1KO1A 2GBLA 2P6UA 1MRSA 4N0EA 1XMSA 3GJ6A 5AK0A 1XJ0A 1F2TB 2RGDA 4MQBA 3BK7A 1NBMD 1E9EA 4PQRA 1GAJA 2OESA 3GLFE 4Q4AB 4IDNA 4KFUA 3AP1A 4LJAA 2FN4A 5AJYA 4B71A 4A8JC 4LBWA 2CLDX 1E2HA 4ZCIA 1KSHA 2ZRNA 121PA 3HPQA 3IIMA 4Q66C 3RHFA 4G5OA 4PTLA 3SE0A 4RJLA 4FW9A 1L4UA 3SYNA 1W4AA 2J3EA 2VP4A 4QC2A 4DJTA 2GJ9A 4URWR 2ZYUX 2GZDA 3VNVA 2IF2A 2EYQA 4YXWA 2VQSA 2GEUA 2QPAA 3PUZA 4HAVA 1Z0AA 1WQ1R 3BOSA 2QP9X 4U00A 1LTQA 3NIBA 2VTKA 4E5UA 5HR5A 3CNNA 1SXJD 3JZMA 3BH0A 3K9GA 3M0EA 5DI3A 2ZJAA 2G0NA 3CR8A 4LSGA 4KODA 3CBQA 3CH4B 4HZUA 2WAYA 1XD8A 3B1VA 3UK6A 1SVLA 4RZ3A 1OH8A 1SQ5A 2ZU0C 1D2EA 4NYIR 1JNYA 1T0JB 1VCMA 2XSZA 3WHLA 3I8XA 3OFND 1Z8FA 5D3MA 2J0VA 2FZLA 4KLNA 1R0XA 2AWNA 2W2VA 2ZANA 3EARA 3GJ3A 5CJ2A 3TR5A 3RS4A 4CDGA 3B85A 3QQ5A 1H8ED 4NYMQ 2YOFA 3UWOA 2RGXA 5DSZA 5CK5A 4ZDIA 1PJRA 3SQWA 4JYCA 5JCZA 4DKXA 2G1JA 2H57A 1YR6A 2QY9A 5FPTA 4A6XA 2XZLA 3FGNA 4KFTA 3RYTC 2N1BA 3CPJB 2HT1A 5CIWA 3IHLA 4LBYA 1VMAA 5G40A 3FMOB 4OQXA 1TF7A 1W2HA 5FL3A 4B73A 2ODEA 1G64A 1II9A 3IPXA 4GFDA 2PCLA 3C16C 3WP1B 3VR3A 2FFAA 3GLGA 3I4LA 1KO4A 4LHVA 3SU8A 1OHHD 4I1OA 1WB9A 1YZNA 4PSAA 1CR4A 1XZQA 2XOKD 2XB2A 2XGJA 2ZRGA 3I8SA 2CXXA 3EASA 3SJBA 3TSZA 4ZDJA 2YVUA 1KI4A 3CF0A 3EIEA 5DHAA 5FR2A 2OE2A 4P0TA 2FG5A 4DLVA 5FI1B 3BFXA 4Q4JB 2ZRFA 3MLEA 4IOMA 4XSGA 1GDDA 1ZW6A 2ZS7A 2B21A 2OV2A 2CEAA 1SXJA 4BPBA 3SZRA 5K8LA 1WBDA 4JVNA 1M74A 1JEEA 4JL5A 5AJWA 4UNSA 2G83A 3LWNA 1UBFA 1TMKA 3BFKA 1Z0DA 4BFUA 2D62A 1B0UA 2FFBA 1X8KA 1QHIA 4BEBA 4LRWA 3U7GA 4DXAA 5E7MA 3OE7D 4TTQA 3KB1A 2F1RA 4LYFA 1G3QA 3DOEA 5TARA 5JJIA 3TLXA 3OFNA 2JJ1D 2D2EA 2WSSA 4C30A 3ZYCA 4PO1A 4O2LA 4WA7A 2RGNA 4NYJR 3AKEA 3QNUA 3GLIA 1L2TA 3UXMA 3ADCA 2OO7A 5FL7D 3R9WA 4GNKA 1ZRHA 5EP2A 5FTLA 1MABB 3TUIC 1OFTA 2R9VA 2J7KA 2NTYC 4KXFB 5EP1A 521PA 1NN5A 1OSNA 221PA 3LQRA 3ONWA 2WOOA 3FOZA 3AKYA 2ZI7A 3R7WB 1XEWY 3NVAA 1S8FA 1MT0A 1Q12A 1TADA 4QBGB 1E94E 1FUUA 4F93B 2GF9A 3GEIA 5JS8A 1EFRD 2QTVB 3BBPA 4AD8A 1F48A 3B7GA 3SHFA 2XOKA 4JBYA 2KB0A 4MYCA 2VP2A 3O8CA 1YZLA 4H9GA 2J9RA 3U3KA 2P0EA 3TBKA 2FZ4A 1E2IA 4M21A 2CL0X 2ONKA 4GZMA 1F2UB 1U0JA 1US8A 2D06A 2WOJA 3QBVA 2I1VB 2BMEA 3QKRB 2QAJA 1ZAKA 5H1YA 5F9FA 3WY9A 2VRWA 3P1JA 4G01B 1CJVC 1CRQA 4MA4A 1UEIA 1QHYA 1XEXB 5C4GB 1TF5A 2P6RA 4B47A 1X6VA 1UPTA 1SZPA 3A4LA 1DOAA 1Q1QA 1I2MA 5KO2A 4GMDA 3TAHA 1WE2A 2ZTSA 4Z8XA 3VX3A 3OIUA 4C2TA 2DB3A 2BMFA 3DM5A 4B3FX 2OZEA 5LDDC 1G17A 3OE7A 4BASA 4EFLA 3ZIAD 1OV4A 1EFTA 3B2EA 4LWZA 5DYGA 4X8LA 5FPHA 1TTTA 2ZS9A 2WJJA 1N5LA 3TRFA 4LJ8A 1E9RA 1E99A 1WBBA 5FTMA 2KBEA 4E03A 3KKPA 1NNEA 4L8GA 4F38A 3THOA 2EU8A 4DCTA 4UXIA 2H7VA 5GJVC 5UKDA 1XPRA 2RKOA 4MDEA 5FL7A 2FFHA 3F5FA 3RC8A 2I3BA 1ZC4A 1ZYUA 3EC2A 3VU9B 2VHJA 5CLQA 1X8JA 3RRZA 4UNNA 3AUXA 3WP0A 5SZHB 1E69A 1NSTA 2HYIC 1TU4A 5EE9A 5G41A 1GKYA 1ZM9A 2WJHA 3CZQA 4OYHA 2BM0A 2IF0A 1TUIA 4A2PA 1EFRA 1NY5A 3Q9LA 2DYKA 1E0JA 1XTQA 1AS0A 1GKUB 1A2KC 3HU1A 3SC3A 3QXSA 1E2JA 5FUXA 3GJ4A 2V8OA 1GP2A 4W5WA 4ERNA 1KAOA 3H84A 5TXGA 3TMKA 3KQHA 5FBLB 1LB1B 1CULC 4JL6A 1W1WA 1N0UA 4CGZA 1NLZA 4R2HA 1JQLB 4W5JA 2VL7A 1N6NA 2HUPA 1E2NA 3K70B 1E2LA 1W49A 2REXB 4JIMA 1TAGA 3GLHB 4DEYA 5HZKA 4JLPA 3IDQA 5FUWA 1T8UA 3H86A 5JSZA 4B33A 2H5EA 3LDAA 1RRPA 4FMDB 2Z4RA 1YKSA 3RS5A 2ECKA 5KSYA 2GKSA 3QIAA 3T5DA 1M7HA 3AVYA 4GDFA 4HAUA 3LQQA 1JR3D 1OFIA 2DWQA 1P62B 1E9SA 4NH0A 4RY2A 1F6BA 1PLKA 1N2CE 4B3XA 3PIRA 3IHWA 3MGCA 3BERA 2GK6A 2E1RA 1CLUA 4NE2A 4KV9A 4YMWA 2Q9CA 3FYHA 4WW0A 4D80A 2GF0A 1CS4C 3KZ1E 2ZAOA 3THYA 2B8WA 2G88A 2I4IA 4TMVA 4C7OA 5FPYA 3QI2A 1UBGA 2DHRA 3CIOA 2F1JA 3SYKA 3AVPA 5SZJA 1W4CA 1UFQA 4IXNA 1NG9A 3GJ8A 2GAOA 2FGJA 4A8JB 1U9IC 1F2TA 2GXAA 2CE7A 2CHGA 5AR1A 1KI9A 2A9KA 2YOHA 5TMPA 2J0QA 4Q4AA 3KXIA 4Y0AA 2Q0HA 3LVRE 4JLDA 2QUZA 3QG5A 2PLFA 3FMIA 4OQMA 3CLVA 4B32A 1SGWA 1Z5ZA 4WAUA 2AL7A 4BZQA 4C4PA 1G8PA 4ESVA 1DO2A 1NMZA 1CIPA 2Z6VA 2RGGA 2AD5A 4G3XA 3VHLB 3T61A 1TNDA 2E87A 3T1VA 1P3JA 3B1YA 3BH7A 1E1QD 3KX2A 4DLTA 2IT1A 4LV5B 4KI0A 4M1TA 1GOTA 3CPEA 5F2EA 2IYUA 3RWOA 3RAPR 1KJZA 1MO3A 1JR3A 4PAMA 3TVDA 3I62A 3BIFA 3I32A 5KPJA 4ZPXA 4RD2A 2J5XA 2W83A 1U0HC 2FGKA 2AXNA 3TK1A 5KOYA 4LDJA 3T1QA 5HCNA 1XTKA 2PZFA 2V55B 1MO4A 3ADDA 2GXQA 1AQYA 2HCBA 3Q3JB 4JLVA 3AKCA 4EQ6B 2EWVA 3B1ZA 3C14C 4JBWA 2VO1A 1LNZA 1KK3A 4I1SA 1RPZA 3W8RA 4I1VA 4Q03A 3DVLA 4LHXA 1R8QA 2IXEA 4M1SA 4KU4A 1AK2A 3CONA 1P9WA 1ZM7A 3UANA 2OAQ1 2IBMA 1AA9A 3ICQB 3OZXA 3PITA 2O8FB 4DVGA 1XXHE 3IEUA 3AF3A 3CKLA 1VPLA 5AJXA 4FWTA 2XJ4A 3K09C 3K0FB 2JDID 1ZNZA 1HA3A 1XEWX 4PHHA 3MUFA 1S0UA 1CR1A 2BIFA 3W90A 1G8YA 3KJIA 1GG2A 1HT1E 1ZD9A 3GD7A 3NDBB 1G291 1P2VA 4DCUA 1YZUA 4NKRA 4P4UA 4O2RA 5BYJA 1ZUIA 4MYTA 2FA9A 1IM2A 1DAFA 4OI4A 4IVPA 4RD0A 3P4XA 4LOAA 4M53A 5JJLA 1D5CA 2GRJA 2GJSA 1E1QA 2GWHA 2CCKA 3A58B 1G4UR 2GAAA 4GPTA 4JLKA 2N46A 4KLZA 4DSOA 5AUNB 1P2UA 2QT0A 4Q4JA 4KYIB 4MGYR 4CT4B 4URVR 4C0LA 3D8BA 2MMGA 3CUEF 5JZVA 1NIJA 2XX3A 5KU1A 1A4RA 1XB2A 4TLAA 4AYWA 2ZRLA 4DSTA 5CITA 3WYFA 5CB6A 5FFMA 4DC9A 1R0ZA 4D82A 3KJHA 2LKCA 2CHQA 2IS6A 3GFPA 2VF7A 3X1WA 5C46F 2VIIA 5E95A 2DY1A 2UZIR 3BD9A 1AZSC 1RIFA 4LCBA 4US1R 1UKEA 1XCGB 1ESNA 2B7BA 1ZM2A 1LF0A 1NP6A 3B82A 2QU8A 3DMNA 4ZI3A 3EWAA 5IK2A 3U6BA 4CEHB 1Z6YA 2QNRA 1XCPA 3NKVA 4DEXA 2IW3A 3VR6A 2WIAA 2NMVA 3NH9A 3PXGA 4ON9A 3WMEA 3UATA 1G21E 3ZVLA 3OF5A 4NCIA 4RZ2A 4CYMA 3L43A 4MRRA 4PZLA 4DDVA 4IDPA 2W00A 1E9FA 1E2QA 1G5PA 1YR7A 3PEUA 2BJVA 4Z8YA 3MFYA 3MSXA 4EKDA 1XZPA 4HAZA 5E4FA 1KMHB 3IO3A 4IVQA 1GSIA 2BV3A 3VKWA 8OHMA 4DIEA 4F7WA 3R7WA 4UJ5A 2J1LA 2WV9A 5G3YA 1YJ5A 1FP6A 3KQLA 1FNMA 4PC1A 4ASUD 4Q7LA 3ZVRA 2XZPA 2R6FA 4RZXA 4YLGA 4F4IA 3EPKA 4TSFD 4MKFA 2A5YB 2F7SA 4TYQA 3AF2A 3QXCA 5EP3A 1JXMA 1JPJA 3WYAA 1P73A 5TY0A 1Q1BA 1YRAA 3FPAA 5BYKA 4RKEA 4DB2A 3GLFB 2CCJA 1KKLA 1F2UA 1XF9A 3NC1C 3U7HB 1E4YA 2ZJ8A 3QKRA 1CKEA 2IYYA 3TH5A 2OLJA 4XWKA 2ZR0A 2VSFA 2WWWA 5CM8B 1R8SA 4HAWA 2VP6A 3I3SR 1XEXA 5DN6D 3W6OA 3K70D 3U61B 5EZ5A 1G16A 1E2MA 4U5XA 2C9YA 1SULA 2MSDB 1Q44A 2OCBA 4AG6A 2B92A 5DH9A 2BBOA 3A1SA 4BLQA 3NHAA 4C3ZA 2WMOB 5IT5A 2BCGY 3LLUA 4A92A 1XDBA 4BRWA 2R44A 4XVRA 3SHWA 1TEXA 4IFBA 3ZVMA 1GM5A 1KZGB 1D8TA 3EZ7A 4B2PA 4DCSA 4JT4A 2FFQA 3LW7A 1H65A 5IDVA 1HUQA 3RLFA 1UKZA 1K8RA 1VECA 2V6JA 4P4TA 1G5TA 2DR3A 1S3SA 3TAUA 2WSMA 2D3WA 2GVZC 3VU9A 3QPWA 5TV2A 2G1KA 2FH5B 4DLZA 2H17A 2WKPA 1J2JA 2A5GA 1GITA 1E2EA 1P4SA 4JYBA 2GESA 3IEVA 1XMIA 5GVSA 5K8TA 2FPMA 2ZSFA 4ASUA 1QVAA 1G6OA 2JLWA 3IPYA 3QEOA 4KYUA 4TSFA 1O87A 3KTAB 1VIAA 1W44A 3KJGA 2QPOA 2ZEJA 4JSYA 2CVFA 2ZE8A 2AD1A 3B5JA 5FI0B 1CU1A 1M2OB 1UKVY 1DARA 2GNOA 2BJWA 2IL1A 3CWQA 4DT1B 3LRPA 2YJTD 3IILA 2WWHA 4AKGA 5P21A 2ZSBA 1KY3A 4M2LA 1T5IA 4P32A 1XTIA 2LCFA 4TMKA 5DN6A 2ZIAA 2XNDA 3TIFA 3GLHA 1DAIA 2VBCA 4EFMA 1T9HA 4RKFA 3V4RA 2BBWA 4UJ3A 2QM8A 1ZM4A 2CE2X 2ATVA 2A78A 3WXMA 4RD3A 4DUGD 4M9XA 1XWIA 2D74A 2HXYA 1YR8A 4CEIB 2CK3D 2YV5A 1IQPA 3IQXA 2XTZA 3CW2A 4ARZB 4YMTA 1CF4A 1E2DA 1AQUA 1N5KA 1ZNYA 1ODFA 2C78A 2V4ZA 1ZIOA 4AYTA 4TZ6A 1ZM3A 4A6PA 1T3HA 4PZZA 4RFVA 4MH0R 3OIYA 5IHPA 5JS7A 4PQFA 1R5OA 3O8BA 3SJAA 1AKYA 1G8HA 3TSOA 1R0WA 1QG2A 1RC8A 1DAMA 4ZO4A 2JJ8A 2QROA 4HAXA 3LBIA 3GJ7A 3DEFA 3AP3A 3REGA 1XPUA 3KB2A 3MRSA 3BXZA 1BS1A 1DBSA 1S1MA 2BEKA 2ZRKA 1BMFA 1D2MA 3TW8B 5B57C 4HDOB 1Z08A 2XSZD 4PANA 1AGPA 3CRW1 4HDQB 4M9QA 4A8JA 4JLNA 2CNWD 5GVRA 2ZPTX 5FTKA 2CLSA 3PEYA 1ZC3A 2C03A 2WHXA 2OBLA 4C0QC 3QXJA 3SJZA 1P2SA 5JBQA 1WF3A 2J0SA 1ZBDA 5HE8A 4V0NA 2IC5A 1RKBA 2NZJA 2NO1A 4TT3D 3LD9A 5CYOA 2PJRA 3RRMA 1FUKA 3RWMB 2QORA 1GRNA 1BYIA 4IOKA 2JGNA 2ZU6A 3PQCA 3W6NA 2RCNA 2VLIA 5A5GA 2BMDA 3EPJA 1QDEA 4IDOA 4EDHA 1OH6A 1ZNWA 2G0TA 4QXAA 5JLJA 3WMFA 5GJBA 2PEZA 5EXTA 1U8AA 4LV8B 4DDUA 2OCYC 2JLVA 3GMTA 4Q48A 4J0QA 4LHZA 2ANBA 4O3MA 2ZITA 3FKSD 4NMMA 4DUGA 4URUR 1LW7A 2CK3A 4R9UC 4TLBA 1YU9A 1DAGA 2R62A 2DWPA 3EXAA 4ZCLA 4HB4A 4A15A 1S3GA 2HJGA 2EW1A 3PUYA 4JKYA 1UJ2A 1UBEA 1Z0FA 4B74A 1PVOA 3MWYW 2CDNA 4EUNA 5D3QA 2QRZA 1IN4A 4PX9A 1IN7A 3ZVNA 3KDSE 3VR1A 2GK7A 4EPYA 2GBLC 5EXSA 2FDCA 1W36B 1N0VC 3MMPA 3B6EA 4QHTA 4I1UA 3OESA 3C5CA 1OXSC 1VG8A 3A1UA 4PC3A 3UWKA 4EQ6A 3TQFA 3GFOA 1WXQA 3I72A 2ZE6A 4XJXA 3U3MA 3AEZA 1Z6GA 2CCGA 3DKVA 2YNMA 4AURA 1U99A 4KSCA 5EP4A 1Z07A 1XTSA 2CNWA 1ESMA 2O8FA 2WSSD 4XWOA 2IUUA 2ZYTX 3HP1A 4A82A 4F92B 1HURA 3DKPA 2QPTA 3K0FA 1JEDA 3BRWD 3SOPA 3VTKA 1KI8A 3W9YA 4TLCA 4TT3A 3KQNA 4G5RA 1R5NA 2FU5C 2GHIA 2JASA 5C2JB 3TSWA 3EW9A 4YMSA 1OIXA 2AWOA 4PHTA 5KYKA 3ZDQA 3T1TA 1UM8A 1LFDB 1KI6B 1NG1A 4Q7JB 4DLYA 5JFGA 2ODNA 1GZSA 3FKSA 1R7RA 3RRYA 3L8YA 1OH5A 2RB4A 4LY6A 4A9AA 3AUYA 3KQKA 2DWOA 1B23P 4OI1A 3FFAA 4OHYA 3UG7A 5JI2E 4PSKA 3QPUA 2WWGA 1KNXA 1U98A 3HPRA 1U0LA 4DBLC 3U60B 2A2ZA 2WAXA 5SZKB 3T34A 3ZD6A 5AJZA 1KY2A 4JMPA 3FFBA 2D2FA 1KOFA 3CO5A 4BWYA 3O47A 4HUTA 3TJZA 3DDCA 4IVRA 4LBZA 4MGIR 1K6MA 1WP9A 5KHOC 4D25A 3R8CA 1E0SA 2QGZA 4G5QA 4XD7A 3UMRA 2W0SA 1KDPA 3ADBA 4HUQB 4CEHA 3E2IA 4IKEA 1BYUA 2NO7A 2ZRDA 4KHZA 1NKSA 5FH9A 4JJKA 1QBKC 2WWIA 4U7DA 3IBYA 1RVDA 2ZI4A 3BB1A 2BCJQ 2JIZA 1D2NA 3Q85A 5F9HA 3CRRA 3FMFA 4P31A 1KMHA 4EIWA 4FCWA 4TMXA 2F3RA 2HYDA 3RDPA 4YC7A 4XVQA 3D6TB 5F3WB 1T5LA 5CJPA 4AWXA 1GIAA 4MKIA 4GI7A 4Z51A 5JWOA 3DMDA 1MO6A 4P4SB 1M34E 3EPLA 4ZDKA 5HKKD 4R7ZA 2PLRA 3B9PA 1NMYA 1E1RD 4TYWA 1FOEB 4MGZR 4IOJA 3TUJC 1R4AA 4BZPA 4D4KA 3T35A 1KI2A 5FBQB 2ZRBA 5GJWC 3GJ0A 5EE0A 4GMXA 3GLFA 1E2FA 1UDXA 4Q9KA 1O3YA 4BGDA 4HB2A 3Q5DA 4II7A 3PEWA 3RNLA 2YOGA 3B13B 2FJUA 3QF4B 2IYZA 1N0WA 2A30A 2PCJA 4X8OA 1DG1G 4DSNA 1Z0JA 3LY5A 4LC0A 2IYXA 3A1VA 3X1DA 2G6BA 5CDFE 4RD1A 2Q9AA 2D7DA 5TDHA 2DPXA 3QY0A 1KNQA 1YZQA 1NN0A 4BECA 3WYGA 2YWFA 3RSOA 2IXGA 4RZUA 4NP6A 5HTKA 5ELXA 4CT5A 4ACBA 3KKQA 5B58C 3J81k 4AKEA 3CNLA 3U4QB 1IN5A 1GFIA 4G0NA 4LJ5A 1HH4A 4TMZA 1CRPA 1SVSA 1W47A 3BB4A 3D7MA 1S9DA 2VSXA 4LUCA 4QG7A 621PA 1IXZA 1E4VA 4AC9A 3PVSA 2EFCB 3CWZA 1YZKA 5GADl 1HQCA 1E9DA 4LPKA 2GZHA 3P32A 5EE5B 4A0RA 4B35A 4C0BA 3HR7A 3U7FB 2F6RA 1KZ7B 1KK0A 1S4QA 4FN5A 3JVVA 1X86B 4RCYA 2IS2A 3FMPB 4OBEA 5IF9A 5HKKA 1NVVR 3R20A 3U6KA 2IYLD 1E1RA 3THWA 2PMDA 3DHWC 1C9KA 1YZTA 1Q0UA 3KTAA 1G7RA 3Q5EA 2CL7X 3Q7PA 4R2IA 2H92A 3CM0A 2R6DA 3EWSA 1KDTA 2GCNA 4EAQA 1XXHB 4Q9LA 1SVIA 4DT1A 2RH5A 4M1KA 1LVGA 1JBKA 2AFIE 4IDQA 3M4YA 5BN4A 1G3IA 1OB5A 2IHYA 3QF7A 1G7SA 2QSZA 4FMCF 2AR7A 4LJ6A 1TEVA 5DIFA 3SS8A 1LV7A 821PA 1IY0A 4DLXA 2V7QA 4V0LA 2BVNA 3QVUA 1G5RA 2ZI3A 4JLAA 4HB0A 2W6JD 2ZJOA 4RVCA 1RJ9B 2NOAA 2VP0A 2W6IA 4I4LA 2FEOA 2IEYA 3W6PA 4M9SA 3VR2A 4XTCS 1XRJA 2QAGC 4CEIA 3JVUA 4HLUC 1IJEA 4PO8A 4PPQA 4ARZA 1NL3A 1MRNA 3SNHA 2YWGA 3CX6A 3EA0A 3G0HA 4BQSA 2O8BB 2QBYB 2NGRA 3H2YA 4L15A 3TE6A 1E79A 3X1ZA 1MOZA 1Z28A 1EFUA 3HU3A 5SZIA 1QVRA 1XCMA 3AV0B 2HF9A 1XBTA 5DI9A 2R8RA 1W36D 2ODWA 4F4CA 3V9PA 3ZH9B 3N2IA 1OXXK 1ZU5A 4P33A 3ZS9A 1ONBA 1COWD 1U9IA 3VHXA 1ETUA 2IS1A 4Q9JA 5L3QB 1ANKA 3U3OA 2ZI9A 3EZ6A 4ZKEA 3LFUA 1QHHB 1GWNA 1GRRA 3T06B 1C4OA 1T8TA 5FR1A 1WRBA 3S1AB 3NBXX 1G1MA 4BE7B 5JWRA 1J99A 1ZVQA 5LB4A 2C8VA 1RFLA 4Q00A 3NDPA 2QMUA 3X1YA 4I99A 2OXCA 1DO0A 4V0KA 1Q1EA 2ZUDA 2GILA 1J8YF 4TQ9A 4WZ6A 4NYIQ 1EX7A 1H8HA 1VYUA 2ZRIA 4W9MC 4EPRA 4JLJA 1MV5A 4DZZA 4Q19A 1KYIA 4LX0A 4UNPA 4PHFA 3Q72A 5BN5A 1EWRA 3LNCA 4Q1AA 3B60A 2IYVA 2W6JA 2VHQA 3AF4A 5JRZA 4TWZA 1PV4A 3KUDA 3NC0C 2EFDB 3HU2A 4ILEA 4V03A 4BFSA 2ORVA 2ZS8A 4AYXA 3IO5A 3K9HA 3ZGXA 2PT5A 2CMKA 2QSYA 5CDFA 2QL6A 2XITA 3PUWA 3ZZUA 4LPSA 4M1YA 3AGQA 4BFYA 1K5GA 2OG2A 4BFVA 4NCJA 4D2IA 1FTNA 2PBRA 1LS1A 3CRVA 3N2EA 1WDTA 2WJGA 4ZKDA 4XSHA 5G3ZA 1EK0A 1Q21A 2XB4A 1KGDA 2GCPA 1W0JD 1W5TA 3RVBA 4C0AC 5CB8A 4AY2A 1YHNA 1Z29A 2HT6A 1COWA 3O8DA 5LBIA 5A4JA 4FXPA 1CXZA 4C0HA 4ITRC 2C5LA 1MH1A 4V0OA 3U2QA 1W46A 1YE8A 4R98A 3K09A 4YONB 6Q21A 2F9LA 3QE0A 4WXRA 5IK2D 2O8DB 3OHMA 3LA6A 4DCNA 2DBYA 2NO9A 1VTKA 3LXRA 2W2XA 2A3RA 4IW3B 5JECA 4QBIA 2NQ2C 1TPZA 1T0HB 2P6NA 3FE2A 3RS0A 1FTSA 4UKDA 1II8B 1QHNA 1V43A 4ZCMA 2NZ8A 3HR8A 3QUSA 1NVWQ 3SEAA 1M1YE 2ZXUA 3KUCA 2WICA 1Z6TA 1ZCAA 1M8PA 2ZSDA 4TMWA 1K5DA 4ZIRB 4Z54A 1FFHA 2MMCA 1KI6A 1KJYA 3MG9A 4OK5A 4UNQA 3K8YA 4NYJQ 2YC4C 1C1YA 2GA8A 2OT3B 1N25A 1FX0B 2C99A 1G20E 2NO6A 1NKTA 4QJ3A 3WNBA 3IUYA 3UMFA 4K8OA 5FOVA 5J4HA 1LF5A 3FHCB 3E1SA 5FBVB 1S1CA 4TYNA 3VKHA 1GL9B 5KDOA 1IOZA 1NSFA 2RGAA 3ZJYA 1Z0IA 1Z83A 2QA5A 2VP9A 3CRQA 3AVWA 3R9IA 3IQWA 2ZYVX 3PCRB 2BBTA 5JHGB 2IYRA 2PZGA 4F4JA 2BKEA 3PENA 2WVJA 2OAP1 3I5YA 1W0JA 2BMJA 1HE8B 3MJHA 1CP2A 3G82C 3NXSA 4L4UA 5FBRB 4HUQA 2OFOA 2FNAA 4D0LB 4B2LA 4JVSB 2WPDD 4ZDWA 3H1TA 3K9LA 3ADKA 4URZR 2BHRA 2RHDA 3RS2A 3L0SA 4PFSA 1KI3A 4OQFA 4Q1FA 4US2R 3KFVA 3NBYC 3OEEA 2VEDA 1G3RA 1Y63A 3E5HA 4YMUA 4DCVA 1CR2A 2GCOB 1GKIA 4I81A 5EXPA 4HEJA 1DELA 3UKDA 3GCGA 1KSJA 2PX0A 2W58A 3MWLA 3K0SA 1E0AA 1J8MF 4NU0A 4P4SA 1DVRA 1UEJA 4D81A 2CJWB 4FWIB 3LLMA 5BW8A 3NEYA 5J4KA 2WJYA 2UKDA 4OQNA 2VP5A 5EQTA 2V1XA 4NYMR 3X1XA 2O8CB 1DADA 1EXMA 1E32A 2PL3A 2QE7D 4RFSB 4A2QA 1RZ3A 4QGGA 4E09A 4AKHA 1OF1A 1N5IA 4S2EA 2ORIA 3DL0A 1R0YA 3D3QA 3LV8A 4HLDA 3A8TA 4D4MA 4D0NA 2ZQ5A 2H8KA 3HYTA 1CJKC 3QF4A 2FV8A 3TGPA 2XXAB 1GVNB 1UKYA 2DFNA 3BORA 2V6IA 4Z1MA 1NY6A 2I1QA 2Q3HA 3K0CC 2F3TA 1NIPA 5DE3A 3V00A 1G8GA 4XWAA 2ZSAA 3OEHD 1KDRA 3QKSB 2G77B 1XJCA 1IONA 5ANRB 4Q5IA 3PUXA 1F5NA 3U5ZB 2YZ2A 1SKYB 2RMKA 2XNDD 4X8MA 5J40A 1VHTA 4YDHB 5HZHA 3U4QA 3CPHA 2NPIA 5FTJA 5M04A 3ZQ6A 3PJRA 4EJSC 2WPDA 1IN6A 1JPNA 2DFKB 4QGFA 3ETLA 5C1BA 1SVOA 4TQAA 3ECCA 5FPSA 2QP4A 2AK2A 5AUOB 2OBNA 4LYJA 2C9OA 1G7TA 2H16A 3CX7A 1EESA 2QM7A 2ZUBA 3RSLA 1IN8A 4OL0A 3WNDA 3NBZC 5JEEA 1SVMA 4TN1A 2V54A 4OI0A 1CJTC 3VX4A 4Q1BA 2J87A 1JAIA 3Q8XB 4JL8A 3BB3A 1IXRC 2HV8A 2NG1A 1G18A 1KTVA 1IY1A 4IHQA 4BFZA 1E9AA 4C0SA 3VAAA 5BN3A 4YDSA 1QHSA 2QE7A 5JWHA 1BMFD 1T3LA 1IBRA 1XXHA 3THWB 4Q4LA 4URYR 4L9SA 4XVUA 4CW7A 5JJKA 5BQ5A 4NZYA 3PV0A 4WVFA 3T5GA 1UAAA 1EFHA 1CJUC 1VYVA 2IYWA 3EX7C 5EE1A 2ZRAA 5H70A 1E9BA 1P75A 3DZ8A 1Z22A 2XJ9A 3AQ4A 4NCHA 2RGCA 2MSCB 1JI0A 1Z0KA 2OILA 3A37A 4HI0E 3THXA 2ZRCA 3LH5A 4PPFA 2QAGB 3B9QA 4CZ2A 5JI3E 1NBME 3NTUA 3OEHA 2IYTA 4M22A 1NLFA 4LK2A 3AVTA 1RJ9A 1VYTA 3VR4A 5KUTA 3N5CA 5L3VA 4AI6A 2NO0A 3WNCA 3W3AA 3KQUA 4TMTA 2Q21A 4R71A 4LHWA 4O0MA 1MR3F 1XD2B 4KBFA 1OH7A 5FUVA 1XNJA 2O8BA 1E6CA 2Z5FA 2QBYA 1KHTA 1RW4A 3DOFA 2ZRPA 1NVXQ 721PA 4B48A 3GLGE 4QGHA 1QHGA 4QJ5A 1UBCA 1HV8A 4MITA 4DDTA 4PC7A 4GBMA 4H1UA 4QBFA 3M1IA 2W2TA 4GSYA 4Q18A 5C18A 1KK2A 5CM9C 4OHXA 2P67A 2QTFA 1JB1A 1U94A 1SVKA 3QENA 5L3QA 4DSUA 4B44A 2FSHA 3A1TA 1DG3A 1QHHA 4NTZA 3CX8A 2R2AA 4JLOA 3NEJA 3WHKA 1SXJE 4LYHA 2QRNA 3S1AA 3AKDA 2IK8A 3LX5A 1GRQA 1OT3A 3A36A 4ACAA 2YWEA 2BWJA 1G41A 4M1OA 2P2LA 1KO5A 2DCUA 2PMKA 2FMXA 2EFEB 2J46A 5BXQC 3VKGA 1TQ4A 1KIMA 3C15C 1RE0A 1T4GA 4M1MA 3V4FA 4UNRA 3PG5A 1KSFX 3G5UA 1RRGA 3GLIE 1N6RA 5JMTA 1ZD1A 2IS4A 1AS3A 1P6XA 1N6IA 3M6AA 1OB2A 3BS4A 4OK3A 3TVTA 2PX3A 5L3SB 4LJYA 4D6PA 1SVWA 2FSGA 3MD0A 4MKHA 1QZXA 3LVQE 3CNOA 2ZYWX 3FDIA 1IAQA 2RHMA 1SKYE 1AIPA 2A7QA 2ZRJA 3AM1A 2YWHA 1BH2A 1G19A 2C96A 1KI7A 3LX8A 4FCTA 4CRWB 3LBNA 1XMVA 1DEKA 5H8WA 4OHWA 1KMQA 2ZAMA 1E2PA 2BOVA 4LC1A 4M4SA 3NH6A 4KVAA 4NCKA 4Q21A 2GXUA 4B3GA 2ANCA 5L3RA 4B75A 4EPVA 4OKSA 4AIIA 1RRCA 3CF2A 2IWRA 3SR0A 1DAHA 4NONA 3SDZA 3PEVA 5EZ6B 1CTQA 1XTJA 4MUAA 4DHEA 4PAQA 4XD7D 3ASYA 4XTRA 2FE4A 2O8DA 4BLRA 2YHSA 4MYUA 3EC1A 1F60A 1XFAA 1OIVA 3CF6R 1NF3A 3LAWA 4QNRA 2KI5A 4LV6A 2HF8A 1II8A 1L8QA 2WWFA 4EPWA 2JIZD 1VCIA 1G4AE 1OFUX 1GNQA 1P7CA 2FPKA 3CH5A 2KWIA 1T6NA 3SN6A 4B3CA 4HAYA 4FMBB 4A2WA 1VG9B 4G1UC 1P5ZB 4ZIRA 1EWQA 2EVWX 4DB4A 2REBA 1U90A 2P5SA 2FX3A 1ZU4A 1OXTA 3AB3A 2BM1A 3FKQA 5EXXA 2RGEA 2QZ4A 4UXHA 2Z0MA 2SHKA 1FX0A 2JLZA 1Z47A 4FMDF 1WCV1 5FPKA 2ZVPX 2OLKA 1S2MA 3L82B 4EFNA 1IHUA 1T3SA 1NBMA 1Q22A 4Q47A 4ZI2A 1GNPA 1MKYA 2IUSA 1A2BA 2ERXA 2ZROA 1KJWA 4WXPA 4MGKR 4DWJA 2ZE7A 1Q3HA 4TLDA 3AF0A 5B30A 4GZLA 5KDLA 3L0OA 4XOIA 2IA5A 1FQJA 1AM4D 3SI7A 2VHCA 1A82A 3AH8A 4JKIA 5LD2C 1BIFA 1ZIPA 4HB3A
chains in the Genus database with same CATH superfamily
2MOKA 2AXPA 2RH4A 1LI7A 3GQBB 4K46A 2B7CA 4NCNA 3ZHOA 2FSVC 3D2LA 3EVDA 3ZWAA 2HPVA 3ND6A 1E1LA 5AJVB 2WYIA 1EFDN 2BBSA 1CEXA 5CLLA 5FUYA 4BNXA 3G49A 1JG4A 4YBRA 5FHQA 4MUNA 4W8HA 5BMVA 2O54A 1OMOA 1GFZA 2F9MA 3ACCA 4N3NA 3DEYX 5BW6B 3CU5A 1BKYA 1I4LD 4WNAB 3R7NA 4DF3A 2CJWA 1ZZGA 2VT3A 1FP7A 1P4GA 3FYCA 3VBCA 4AL4A 3G8AA 3VMFA 1WXEA 5BVGA 1BDIA 5CU7A 2QRGA 3WBJA 1XWFA 3HYSA 1QH1B 3JYOA 4MWOA 4ZTBA 4ZHQF 3PGKA 5C8YF 1ECPA 3E7XA 4GG1A 1UC8A 3BSFA 2EFGA 4MRVA 5DLQC 3ZU2A 2O0MA 4BTLA 5BV1A 3AZQA 3FVRA 4JENA 3KXKA 3JQBA 2GTPA 4B3BA 4CODB 3TKLA 1SXJC 4AW9A 3VOTA 1I2BA 2YFYA 4XWGA 4GP6A 5KYYB 1H4QA 2CGEA 1F0NA 3A2LA 3K53A 1U6IA 4TOIA 4BQQA 2ZT8A 5A1JA 2HIHA 4EABA 2OKCA 5KSOA 2AW5A 3DCYA 1N6KA 3AEQB 1MIOB 4KLCA 3TFWA 4D02A 1ZINA 2F1IA 2NX2A 3T9FA 2O8EB 3S1LA 5K3CA 1PVDA 3O26A 2WJVA 1YQTA 1X7HA 3ELYA 4XJVA 1NXWA 2ZRHA 4RQAA 5EXDA 3LF2A 4UCXA 1NF9A 2V7QD 5AM5A 5KX5A 2ZJ3A 1MAUA 4F3CA 1PGPA 1RLJA 1DTSA 1JFFA 1NUQA 2H1VA 1T5BA 3I6BA 2GJ8A 2YQZA 3NHBA 1SBNE 3O4HA 1GRCA 1OHHA 2BGRA 4GRAA 2RJ3A 2W6ID 2J5RA 3RS9A 1V8BA 4OIMA 1WUKS 2C7PA 2D0OB 3NPMA 2XNSA 1BHQ1 4QE3A 1EP2B 2YCLA 4OHFA 2YTZA 2BW0A 2XQGA 3IP6A 4IXMA 4MQ4A 2AR9A 5CK4A 1R2QA 2Q2QA 3OJOA 1E79D 1P0PA 1NFFA 2RBEA 3MAAC 5C3UA 1NW3A 1W34A 2B69A 3TOZA 1MDFA 4R2KA 4E2XA 1VBKA 1W2WB 2JA1A 3L0PA 2JKVA 4M46A 1RHKA 1NLUA 4MAAA 1GFWA 1SG9A 2QTHA 2X8AA 3BJEA 3AL3A 1QIGA 3KWLA 4QU9A 1XIVA 3A4MA 5DF1A 1G6HA 2NLOA 2HQBA 1RWOA 4NDNE 3V1MA 3QJYA 4W7SA 2JFYA 1DBVO 4DYVA 1JLMA 2Y0DA 5AKIA 1ZWKA 1UXKA 3K0AB 1BCRA 2VT2A 3NEAA 4FCVA 3EVGA 4HWTA 3RYHA 2CV1A 4HFRA 1NI4A 1OZFA 3ILYA 3LYAA 3D6JA 3GHYA 3OQVA 4GNRA 1FDIA 1EUCB 1TCVA 3EXEA 4BFWA 1IOWA 3IB3A 5ETJA 1J9EA 3L79A 1U3DA 3IQZA 2GJAA 2CUTA 4QQKA 9LDTA 1SQFA 1W30A 2VPWA 3EHEA 3P2OA 1FUYB 1R9JA 4RVHA 4XGKA 2GRAA 3K2BA 5T3YA 3W5DA 3VU0A 1NJFA 1OI4A 3AETA 3KKOA 4XYLA 3OPYI 3EAGA 5LP6B 2O1SA 3NAZA 5HM6A 1YQXA 1D4OA 2AK3A 4TL8A 2C7VA 1R3UA 2VXYA 1GT91 2Z83A 4OJKA 3KQTA 4IDCA 3QU9A 4GXTA 2V7WA 1M2FA 4OSPA 3ITNA 2BH2A 1WR8A 2WWVD 1ZCBA 1BN6A 2AV6A 2X1LA 2FLKA 4S05A 2Q1YA 1Q11A 1Q57A 3LO5A 5TJ9A 4I2VA 4JVMA 1P60A 1V37A 1GGJA 2OZKA 2YXPX 1Y37A 4UM9D 4COKA 1IZ0A 3FHTA 2X5KO 1ZSVA 2ZI5A 4UU1A 3BCHA 2OV3A 4ZVOA 1VPTA 4LXHA 4A1FA 4EW2A 3U44A 3H83A 4JWKA 3HCPA 4MP8A 1ULTA 3FTPA 4Y1GA 4X62B 1VKJA 4Q1EA 1MAVA 1VZ2A 2OHXA 1I2DA 4XZ3A 3WRYC 1OXMA 4O2AA 1DCTA 2OFFA 2AMLA 1W4RA 3O3MB 4TYPA 4GC5A 6REQB 1KC1A 5H4GA 1XN4A 4QOEA 1T29A 3I1YA 3JQFA 4IRUB 2VYND 3NPAA 4I1PA 1V7CA 3NTOA 1WVGA 2B3TA 4HN2A 1CETA 3ETJA 1G0OA 1UZNA 1W7AA 2EDCA 1JV2B 1JECA 4Q3EA 4BIMA 3QJ5A 1Q0TA 4NBUA 4I0WB 3ELBA 2FE1A 2I3GA 5LYYA 3L05A 3NBUA 1K89A 3KLOA 4KJZA 3DULA 3PFWO 4IIJF 3D4NA 4TYYA 2EIHA 1TUBB 3KWFA 5F2OA 5HJ5A 3D0KA 3IT2A 5JNUA 3P0IA 4EHLA 3FTQA 3CZPA 4B4KA 3I92A 1M2HA 3U5TA 4UUBA 4DAOA 3ZJUA 3QYAA 1HDRA 3ZIAA 1H2BA 1NNSA 2E4UA 4QA9A 3WL3A 4IZ6A 5KYXB 1NFRA 1J4AA 4W5HA 2WVHA 3G2JA 3HCAA 3F8TA 1NASA 1VE7A 2VNHA 3W2TA 4RJKA 2BRUC 4F2DA 5AOBA 3M34A 1KJIA 1Z6ZA 4BFXA 1BGXT 3DNFA 5EJ4A 1FMFA 3CCBA 3AX6A 2B99A 3OT4A 1ORHA 3NMUF 1IJKA 1M8GA 2R8BA 4JJGA 2H9IA 4WLEA 1C9EA 1NPYA 5LZ4A 2IV2X 2A5FA 4OF4A 3B70A 2NADA 3NTRA 2Z56A 1GNTA 4MDHA 5FOUA 3OTHA 3WL6A 1RXYA 1HG0A 1NLYA 2F3PA 4RAOA 3S2FA 1J2RA 4GYYA 3C3EA 5L3SA 2QGNA 2RHTA 2WKRA 4A0HA 4YJ2A 1M2KA 2XGSA 3RB8A 3WMWA 1QO9A 2B98A 2HMVA 3CKKA 3LX6A 3D2CA 3AK4A 3OWXA 1Q0PA 4FDAA 4O63O 4UM7A 4ENSA 2O8NA 2C7OA 3D4IA 4DR5B 4QRIA 1Q95A 2VA9A 2VZEA 1ZHHA 4B76A 1D9XA 3L6BA 1L4YA 3B3FA 1R5JA 3PS9A 1QG4A 3BGWA 3O4FA 4Q02A 4DA9A 3FBGA 5HOEA 3KTFA 5HWSA 1GL7A 1L1QA 1IIBA 2DFPA 2PGLA 3NV9A 3M2TA 4EG6A 2IKSA 3GAFA 5KYUB 2AR0A 2ZRMA 3KKNA 4CTOA 1O58A 4EHFA 5CA1A 5KNDA 3AHJA 1HYBA 2UUOA 3UMYA 1CUXA 1CUEA 2QMEA 4FFDA 4D4LA 3W9BA 1T15A 2PD3A 3NWOA 1E2GA 1AJEA 1Z7GA 3OU6A 3L7NA 3OKAA 1AV6A 5CFOA 4K87A 3IP7A 1FZQA 2R6AA 3HN6A 4FYXA 1GTVA 1KZ1A 1PL0A 1WNFA 2UVQA 3KZOA 3NC4A 4HG2A 4K26A 4M87A 3SVLA 1JHYA 4IIYA 1YBMA 4GKAA 4WOPA 1O6ZA 1EX1A 4YUZA 2P4UA 3SE7A 4PTYA 1UXOA 4BZWA 2JD2A 3CGWA 4HGPA 2F59A 3EF3A 3OUUA 2FYTA 1LBHA 1WA5A 3Q3IA 4TQUS 1U0TA 3V4PB 2A0KA 1XMQB 3P4YA 2O0KA 4PZCA 4ZOEA 2BGIA 3OEED 4U8GA 2O6HA 1V3TA 2FZWA 3DB1A 3U13A 1V8PA 1VI5A 7REQB 3EK2A 2J59A 1N2SA 2A9OA 2VH2A 1VA4A 1NONA 1NVBA 3FYUA 3OHPA 3QEJA 4FNOA 4JR2A 5EJ5A 5THQA 2VHVA 3P45A 4HNQA 4NL4H 2CB9A 4RE5A 1KP2A 2FUG1 2KBFA 3UF0A 1F12A 4R69A 3AJ9A 4C07A 3S2EA 2JLYA 5GINE 2H2FA 4PZYA 1ZUD1 1SMKA 3FVQA 3TRKA 4JS0A 2G0AA 4GOXA 2HZ7A 5JYEA 2V6FA 3KPWA 4BKQA 4Z9YA 2JCXA 4ZOQI 1IUNA 2RAPA 1W48A 2AEMA 5LMUB 4PAOA 1U3FA 1P77A 1NHGA 4C2UA 1Y1QA 4B2IA 1L7AA 3EQ9A 4KSYA 1PV2A 1MN6A 3JTMA 4O02B 4OP2A 4TTVA 1K4KA 5EIBD 1VCHA 3ZCPA 3E9NA 2X1VA 4OQEA 1DHRA 2RARA 4LJ7A 4WE3A 4R1TA 3T7DA 3UA4A 4B34A 3ZHRA 4N7MA 5HHTA 2ZSEA 1I9GA 1YDMA 1IU9A 4JOQA 1LWOA 1UBOS 4CCSA 5C4MA 2AJDA 3FNBA 2MCFA 4DDWA 1KSGA 2B6HA 1KAEA 2ECPA 4FYJA 1FFCA 5NLLA 1TM3E 1HTTA 1WXIA 3GU3A 1W0KD 2H1FA 5CB4A 2WABA 2VTDA 4OA5A 2RKBA 4JC8A 3LECA 2N3ZA 1G4HA 3DYBA 2IWHA 3HWWA 3AERA 2CLMB 5JQGF 1TB4A 3E3NA 3KYBA 3I2YX 3R3JA 5DWQA 4ZVSA 1NI3A 1RRVA 2I78A 1T91A 4ENPA 4KE8A 4R1SA 5G53C 2I66A 2SBTA 2UZ3A 2YDXA 3QY9A 2CL6X 1QLHA 4IAOA 5HIMA 2PH1A 2HXSA 5B36A 2JBWA 4UHDA 3DL7A 4XX1A 5TQVA 1H0HA 4LI0A 1ZD4A 3DO6A 3KSZO 4PLWA 5JAPA 4Z4GA 1P2BA 4B8WA 1KIAA 4G65A 4EPXA 4LJ9A 3KJEA 1RYHA 2ZJ1A 3DBRB 3CHYA 5E6UB 5DYWA 3H1AA 4LAFA 4QSMA 5DYIA 5F23A 2BGMA 4KXLA 2WLSA 3H5IA 4CEJA 3GRUA 5K8UA 1T6YA 3IDOA 2P11A 3IEXA 4CHTA 5E7IA 3RABA 5IX8A 4J91A 4KJXA 4QFMA 1SXJB 2JRLA 3DL2A 3PZRA 1BO6A 3RG8A 3O2JA 4DIKA 5BWMA 2F8SA 5CIQA 1YQEA 1FA9A 4G8DA 1OXVA 2ACKA 4YASA 1FL9A 2XAUA 5L9AA 2R1TB 3PRYA 5EE3A 3GUCA 3P0HA 2AFVA 2X19A 1B76A 1P3Y1 3F5MA 5E4JA 4MPTA 1U2SA 1I2CA 2FSIA 3UJAA 1E96A 2H63A 1RVV1 3BF8A 3LQYA 1WW8A 4HGRA 2XLCA 3RC3A 1AKUA 4YCSA 1LNSA 5K3FB 3ORQA 4FZ5A 3LUHA 4UXJA 2BTQB 2C3UA 3OCYA 3QKIA 1M1ZA 4PS1A 1N33B 4EG4A 2XCQA 5BYAA 3TXXA 1NVVQ 3QG1A 5LZ5A 1JEOA 1RYFA 4L8LA 1M75A 1TDJA 2VPPA 4L8VA 4QDOA 2L18A 3WQQA 4ZTUB 1Y1RA 3BL5A 3E15A 3FCAA 2HLDD 4XVCA 1JT9A 1L7XA 1SQSA 4FD2A 3HBLA 3T9BA 1JLKA 4B6QA 3INGA 3ZHTA 4PLTA 5FNVB 3GEHA 5CX1B 2XCRB 4B43A 3IOBA 4IDHA 3PEFA 3TAXA 1MEJA 2I91A 3FVWA 13PKA 5C51B 1A5TA 4UBIA 1AHHA 3C1TA 4HUJA 3UT6A 5C31A 4FOOA 2E18A 2FW1A 4NECA 3AHIA 2VJQA 3WMGA 2YWBA 3ZHZA 1RAAA 2BEJA 4FGZA 1KBQA 3N74A 4KACA 2HEGA 3C3DA 1FZTA 3GARA 3IVRA 5BNTA 4TWJA 4MS3B 1HQYE 5DM1A 4DIDA 1RJWA 3GVCA 6AT1A 2IDZA 1PHPA 3SM3A 4AKIA 1HGXA 5A3VA 2FPGA 4QARA 3E1GA 3DEJA 3ZLUA 4AJJA 1DJMA 3K16A 4ZZ3A 4Y2XA 4NQRA 3NHZA 3QV1A 3BC1A 1YBAA 3WLRA 5KQLA 2O8VA 3BHJA 4IV8A 3T1OA 1KS2A 4ZV7A 3L2OB 4CCWA 2HDNB 3FKJA 2NVBA 4FI3C 4I8IA 1G3MA 1ZY2A 2ZT5A 4PG8A 2WUEA 2W4QA 2P3OA 1HTWA 3PVCA 1TO1E 1X2EA 3U9TA 2J33A 4D7AA 3G0IA 3QVGB 4ZODA 1UXGA 3Q41A 2Z3WA 3FUUA 1W85B 4KR2A 2OFWA 4ZYWA 3X2SA 2PUVA 2IEZA 3OZDA 1S6YA 1M8JA 4KITB 2ZSUA 2BFEA 4ZGBA 4GP7A 4Q9HA 2VQ3A 4WK6A 3VH2A 4BBAA 1IBLB 4X84A 2RGBA 3FHOA 2F55A 1IZ9A 5HE9A 2V1UA 2GFHA 2XVZA 3E7PA 4UAJA 3CQ9A 4LOIA 4O4LB 2X8BA 4KFRA 5KHAA 3OWHA 5DULA 5FRDA 1FW6A 2B8TA 5ILQA 4CVNA 3OWOA 2FPPA 4QX6A 3ZCRA 3PQ4A 3X2FA 3RNOA 1E0KA 1V2HE 1XGKA 1DT5A 1KMIY 3GNSA 4G8BA 4GYKA 2VS1A 1E9VA 3LXUX 3RS7A 1P5FA 2DFLA 4CMKA 1DQRA 5LBTA 3ZLJA 1RE1A 2QG6A 2HH9A 1MO5A 2O6LA 2JHFA 2MSLA 4MV4A 5ALXA 4FSDA 1D6NA 3B3QA 4UUAA 1E8DA 4DPLA 3C43A 4B6GA 3CR7A 1R4NB 2QX7A 3O1LA 2B8NA 4AU1A 2R7LA 4NU5A 1MPTA 5AW7A 1EH5A 3A14A 3AVOA 5DGXA 4CL3A 2HNKA 1KQNA 2OOKA 1AGXA 1JYSA 2D1YA 5IANA 1Z12A 5FO0A 1VL5A 3DUWA 3H2KA 5IC4A 3IHKA 3BGVA 3I61A 4TXLA 2XCOA 4UVGA 1EFVA 2YBDA 4IKPA 4EI8A 1SUFA 2D54A 1YR9A 3MFQA 3FJYA 5CJJA 2WFLA 4ZEXA 1HEUA 1PYGA 2CD7A 5IP5A 5JD3A 4GOJA 3HEAA 2B37A 1JFRA 3OC0A 5AI8A 4Q7MB 2I3ZA 4DV1B 4B45A 2IDKA 3OZGA 2FEXA 3TW4A 3JRNA 4L16A 5GWXA 4YRJA 1YFJA 1MJNA 2NU6A 2YC2C 4FN4A 4OH1A 4FYHA 4KO8A 4UD2A 5J47A 4V3CA 4O4HF 2BGNA 3DV0A 2JI9A 3JWPA 3MM4A 4RD6A 3BMCB 1U2RA 5E3IA 2GQ0A 2R4TA 2R6R1 5CH5A 3SS9X 1SCIA 3DVRX 2N42A 1WJGA 2NAFA 2VAPA 2GF2A 2NP7A 3OAAA 2I62A 5JSZB 2GN2A 1PR5A 3DOCA 4ESEA 5FPQA 3ZVKA 1R00A 1DRUA 1UBJS 4ALKA 3T5AA 5T41A 1QNLA 4K28A 2F43A 1M5TA 3M6MD 5A0VA 2ZIEA 3E5NA 2GFQA 3IULA 2R6CA 2IYOA 2PS1A 3DLAA 2LKDA 4H3SA 5EUQB 4AG5A 1ZNXA 1CUDA 2C4NA 1EX6A 2C3PA 2Q27A 4TL9A 3ZOZA 1IVSA 3RTGA 5DHQA 3LG2A 1YUBA 3R3SA 4U2EA 5AUQA 4B0OA 4Y0NA 4QQ8A 1ICIA 3IBGA 3N07A 4ZOLA 4OJTA 1MOPA 3EZFA 3H42B 1EE9A 3E53A 1V9SA 4ZU6X 4KMMA 2V7BA 2JLXA 4CIDA 4UTNA 3PHHA 3AVVA 5KJ1A 1YR2A 4NDZA 2AKAB 4IJQA 1X3LA 3TTWA 4QWWA 2VJAA 3TLKA 4RCZA 1PQUA 2OUKA 2PZAA 5HQJA 5F7OA 4YJFB 4IMPA 4LZLA 5LDHA 1ZBQA 3ZD7A 4HLNA 3ETGA 3V2GA 1LK7A 2PJZA 2W48A 1CHDA 3N8IA 4MB2A 1KKUA 4K86A 5AK0A 1XJ0A 4CDNA 3CLUD 1GPAA 1WCWA 2P9QA 2ZZMA 2A3NA 1ADJA 2ETVA 3TNLA 4N5IX 4JJ7A 1GAJA 2OESA 2FR1A 3TOVA 3L4BC 4FHGA 1FW8A 4KFUA 1N3YA 4LJAA 2HUNA 3EH1A 2A0WA 4O59O 4IQ4A 4LBWA 1DTWB 2I4TA 1EWKA 5AJYA 4C05A 4RL4A 4ZCIA 2ARKA 3PQDA 1PZEA 1SXIA 4X0EA 3UK2A 3C97A 1P7YA 1ZGCA 1X80A 3LBAA 4JXXA 3L18A 3E27A 2Y0CA 3IIMA 5T4EA 1X94A 3SKXA 2SCUA 4B81A 3SE0A 4WEOA 2FZEA 1W5FA 2YRWA 3NW9A 4N3BA 3SYNA 1LDEA 1W4AA 2J3EA 2XEDA 2VP4A 2ZIUB 4TROA 4A73A 3S81A 5L7YA 3IB6A 5F64A 2GJ9A 2QGFA 4BO0A 1AQJA 1V45E 1C1XA 1DKRA 3KKKA 2OP1A 4LRUA 2PGDA 5TPZA 1U9ZA 4Y2GA 4WLFA 1LSSA 4BO2A 3LPLA 4DGSA 1CQWA 2ZAYA 2QP9X 1T0UA 4ER5A 2BMVA 1UP7A 2Y1XA 1S2NA 2JRCA 4ND8A 1GU7A 4ZQFA 1O57A 4DLNA 1CT9A 1F17A 1GGHA 2CZGA 1SXJD 3HNOA 2C5FA 3D8NA 3R5KA 2DT5A 4MMXB 3UJ3X 3ZJ4A 2RGRA 4IJ6A 3EZXA 4KODA 4G0ZA 4KXVA 4G1EB 5LJIA 1Y7HA 1A71A 2DHQA 3MWDA 3T94A 4IWXA 2D00A 2QRUA 2L19A 2HA6A 4H16A 4X71A 4ZALA 2NUAB 1KU6A 1XDUA 3IAS6 4AZVA 4ZFNA 1OH8A 5AVVA 1YB7A 1D2EA 3PA8A 1JNYA 2GN8A 4II2A 5FEMA 1U11A 4YRIA 2ZYGA 2NTNA 4CR8A 2XMQA 4QQFA 2H48A 1SHLA 2J0VA 5LKAA 4YHBA 1GTL1 5CCXA 4KLNA 3EARA 4IXTA 1UJ4A 5JZOA 1LRKA 3EXG1 1CB7A 4EW3A 2PO5A 1PS8A 2VOEA 4NYMQ 3VO9A 3UWOA 4ZRMA 3O2NA 4F0JA 4MS1A 1QCCA 5B7NA 5CK5A 4G23A 4H08A 4HNAA 3P9NA 1Q1AA 3B7WA 1T5OA 1YR6A 2QY9A 2X9LA 3ZPXA 3W2GA 4F2HA 4TLLB 3UAVA 3ESZA 5CIWA 1HYHA 4BNIA 2A0UA 4KXWA 1FS4A 1VMAA 2AQ8A 1X7YB 2P27A 3FMOB 5FL3A 4ICIA 2ODEA 1T8WA 4J4HA 2XA9A 3T3EA 1IBKB 1II9A 4GFDA 2XWPA 1V7ZA 1SD2A 3C16C 3FF1A 4B4DA 4MIEA 4NBLA 2HHJA 2H7YA 2QYOA 4I1OA 1FLVA 4GSLA 1BCSB 4GKBA 1CR4A 1ISRA 3NHJA 3P5SA 3P96A 4QEZA 2XOKD 3L01A 3TRJA 3VRHA 1U2GC 5LQKA 2JIBA 4MCIA 3SJBA 2GX6A 2YVUA 1KI4A 3EIEA 5FR2A 1AQLA 4P22A 1W1UA 3ZCSA 2OE2A 2WJ3A 2G25A 3U3XA 3UHOA 4P0TA 3UW3A 2X1HA 4D9NA 3BE6A 3BFXA 3NTLA 5EZQA 3SG0A 2BHNA 4Q4JB 3UC9A 4F4UA 2A1UA 4IOMA 1XAHA 1GG5A 3GN2A 4XSGA 2Q5EA 3PJEA 4PZDA 2CEAA 4O3FA 5HX7A 5IFLA 3A1EA 3EGXA 1T9AA 1JEEA 4FSHA 4R8LA 1DIGA 2G83A 4LYGA 2OXTA 3BFKA 1TU0A 1V1RA 1Y7LA 3RUHA 1Z0DA 3U26A 1AT1A 3EDOA 4BFUA 1I14A 4BFLA 3NIGB 5D5HA 1QHIA 2AG1A 3LQ2A 4NATA 5DU2A 5A3QA 3I5AA 3MTJA 3MLAA 2NZXA 3BXGA 4CLHA 2F1RA 2FCAA 4PCVA 1G3QA 3GLTA 4MI9A 4CCAA 2QN1A 4Z7JA 2FCRA 3N2GB 3OFNA 1RZRA 4IHJB 4MGHA 4IILA 1YJ8A 1XZEA 3IPAA 4P84A 2O2CA 3EQ8A 3IUPA 3MTBA 4XWWA 3WLJA 3X1XA 5CXUA 2RGNA 1N32B 2XYPA 1U80A 3LNTA 3GLIA 3AJRA 4EUHA 3ADCA 1C1DA 3BWCA 4W6ZA 4DIBA 5AVWA 4PCUA 5FL7D 3R9WA 4TTAA 3G2HA 3HHEA 5KQMA 4EITA 1XQXA 1K86A 3N3BC 3MTEA 1ARZA 2WOOA 2EQ5A 1HNWB 3R7WB 5LQUA 4JI5B 1XEWY 2CJXA 1Q12A 1TADA 1P81A 1H93A 5C53B 3LY9A 4F8EA 5EHXA 1W73A 1WO8A 2XMZA 3PGA1 5DM2A 3VSDA 5JQWA 3GEIA 5ICMA 2NU9B 1N5RA 5ENDA 4NEHB 1BX1A 2R5WA 2QTVB 4FPXA 1F48A 3EN0A 3BDAA 3EBPA 3AUSA 3UENA 1TEZA 4XKJA 3RFVA 3N05A 4RK6A 3OQOA 2H4JA 2ADMA 2VP2A 3N2LA 4ZQIA 3U3KA 3TBKA 2FZ4A 1LLDA 3L4EA 1T4CA 5BRAA 4M21A 3U7JA 2CL0X 2ONKA 3INTA 3W2IA 3ETCA 4LDRA 3FY4A 2D06A 2EZTA 4G1BA 1JDSA 4U7JA 2I1VB 3USES 4BKOA 3QKRB 1ZAKA 5AMXA 2P8JA 1X7XB 2Z2ZA 2JD0A 3DOOA 5KYVA 1CJVC 1CRQA 5HK9A 2IH4A 5IDYA 1E6EA 1DFGA 4FS3A 1D1SA 2VZ9A 3O1IC 2QYSA 3QVKA 4X20B 5HKOA 1BGVA 5IJXA 1I2MA 3L8GA 5KO2A 4KDRA 4LFBB 3QM1A 4C2TA 1NURA 1YR3A 4QXOA 3FCCA 1G17A 3KZCA 1PG2A 3ZX5A 2FQXA 4X95A 4TXMA 3HUDA 5IUJC 3W4JA 2GEJA 1E9RA 1TRHA 1WBBA 1MX5A 1SUDA 2Z3ZA 3WRXA 4DCTA 4R84A 5GJVC 3JASB 1P44A 5KEIA 1HDZA 2VTVA 3CBGA 1Z4NA 4QSHA 3L6CA 2YJ4A 1NYTA 1IN1A 3EC2A 1ZYUA 3VU9B 2AG8A 1QGUB 1Z18A 1A97A 2DC1A 2I4NA 4H15A 4RKYA 5J1TB 5HRUA 3KQMA 1BXKA 1HL3A 1C2YA 3Q9SA 5EE9A 1AF7A 1JLHA 2LW7A 2QDKA 2R2GA 3E81A 5KNLA 3CEHA 5EJMA 4KO4S 1UK9A 2DBRA 3MUEA 1ENZA 2UDPA 3DCIA 4A2PA 4CU5A 4QOGA 5EFOA 3Q9LA 3UJCA 2R6JA 1PJCA 4KDFA 5ICCA 3SC3A 4XLZA 5AW1A 4U9UA 4H27A 1ZRSA 1HRDA 2ADFA 2HDOA 3RQIA 3WQHA 4F5EA 2IE0A 2Z4TA 1EZZA 2PG3A 3TMKA 5K2OA 4L6CA 4BNDA 5HOQA 1KQGA 3EEOA 2AVNA 4UM9B 2Y66A 1H5UA 1ZJ4A 3KXPA 3R5JA 4KDCA 3ZWNA 3JAKA 4JNKA 2A86A 3P19A 2JAUA 2DRIA 4HH1A 2HUPA 2C2OA 1LQTA 2PMWB 3KT0A 4AUNA 4BAUA 2NYAA 4PNEA 1E2LA 1P1HA 1APBA 1C0KA 2DP4E 1E5QA 3C3XA 3QUBA 4CCYA 5HZKA 1PZFA 4RK0A 1AG9A 5FUWA 1MDBA 1T8UA 2VWGA 4JB3A 4K03A 2O7VA 2PX2A 5AVOA 3DUFA 1HI9A 1YKSA 1IM5A 1I32A 3OCXA 3QWFA 1C81A 4W4TA 2IBTA 3EHDA 4BVJA 3N2ZB 2GKSA 1PTKA 3T5DA 5B4VA 2Z6QA 4YUAA 3AVYA 5JT1A 2QU7A 3G79A 1X1QA 1JR3D 4LXXA 1OFIA 2HV9A 1V47A 5BY2A 2E49A 4DADA 3CSDA 3PNBA 4RQBA 5E8RA 4J75A 1YXMA 3IHWA 5C52B 3MGCA 4PF1A 2GK6A 1C0PA 2X6TA 1GGMA 4JVOA 4QUBA 1F4LA 1K0FA 4Y2PA 2NW6A 3LLVA 4W9NC 3WK4A 4KV9A 3FYHA 3CW9A 4GPAA 5B3JC 5TQ0B 3TLGA 2B9VA 1CS4C 1RAGA 1V4VA 4R1LA 2ZAOA 1SUAA 2B8WA 4S1VA 4F2WA 2CXOA 4C7OA 1J06A 3L7LA 3OTOB 3GWGA 3ESQA 4FYPA 4EX6A 3PZBA 3CIOA 1QQBA 3L1HA 2QQFA 2HK9A 2BFOA 3H7IA 5DNVA 4FZJA 4IXNA 3PI6A 1QIDA 2HM7A 3LMKA 1A9YA 1TQ8A 3O6VA 1DX4A 4JUAA 1U9IC 1F2TA 3IUBA 4QGBA 1CS0A 3QTBA 1PNRA 2GXAA 1DIBA 1MD9A 4ZV9A 5AR1A 3BG5A 5ALNA 2VRBA 2J0QA 2ZBRA 4KOEC 1J49A 1CNEA 1DDIA 5I9NA 2SKCA 4JLDA 2QUZA 3QG5A 3D4PA 3IMKA 4HNHA 4JJFA 4UBNA 1RRMA 3DMTA 4B32A 4RDXA 2IZZA 1IBMB 1Z5ZA 2G5PA 2PSSA 4WAUA 1FP4B 1SOVA 1L5VA 3UT5B 4E6PA 4XUEA 4L9AA 4BWVA 1Z33A 3G68A 4A0SA 1JLLB 3KSAC 1RLOA 1KEUA 2I3DA 3R6TA 3RUCA 2RGGA 4J1QA 2Z8ZA 4OHBA 4TKVB 2H0AA 3ISVA 3TNDA 3EB9A 4X1OA 5A02A 1E6UA 4TRMA 5C1DA 5I9LA 1U2DA 4KWCA 4F6RB 3F98A 4JGGA 4MS4B 3T5BA 3BH7A 1JQBA 3OLCX 2YWDA 2QW8A 2DMRA 2HY7A 1RHQA 4FDLA 4YDRA 4HO1X 1RP7A 4M1TA 2PUWA 2BR3A 5EJ9A 3QITA 5AKZA 1EWTA 5HIKA 5F2EA 5JS6A 2IYUA 3GHHA 4MYSA 1KJZA 5BNFA 1XQYA 5KJFA 3L6OO 3NTQA 3OJCA 4MDYA 1GGVA 2VXCA 3WB0A 4RD2A 3SXJA 2J5XA 1FNDA 3AM3A 2ZUWA 1UK7A 3F9RA 3MQ2A 2C84A 4MP6A 5H3LA 4OL9A 4BJ3A 3KVNA 1TMYA 5ECDA 4P9NA 4DA6A 5HCNA 4AFNA 5JAQA 2C59A 2V55B 4W5NA 5KVQA 5EXEA 3ADDA 2P2DA 1RU3A 4K6KA 3Q3JB 4JLVA 3ZZ1A 2EWVA 4R31A 3KYCA 4JBWA 1IPHA 2OUIA 3K30A 3QX8A 1HNZB 4M0FA 1LNZA 4QDZA 1ABEA 4I1SA 5ICEA 5AOCA 4LHSA 4Q03A 5GOZA 3A6FA 4M1SA 4KU4A 1AK2A 3FSGA 3O31A 5FWYA 5DFAA 1EJBA 5DZSA 1G5FA 1ZH6A 2WSBA 4WCFC 1QIKA 1MORA 1OXKB 3GBPA 3OZXA 4QTUB 3RYFA 1XZ8A 1XXHE 2OQRA 3IEUA 1KEVA 5HFJA 1Q92A 3CKLA 3S2SA 3SR4A 1AU9A 3IVCA 1UFVA 4JIGA 4S04A 1WQ3A 3RHTA 4RGYA 1HA3A 3N8DA 5IXSA 1CRZA 4OAQA 5B7PA 3ZJTA 5ER6A 2R8ZA 1B8VA 1P6UA 2V3WA 4IZHA 3CEPB 1TO2E 1AKMA 4MQFA 3W90A 1FFDA 3Q7SA 3ZUGA 3GD7A 4DSAA 3A6JA 2YWCA 1XMOB 3O8OA 3UHPA 3F6CA 4LFCB 5IT4A 4RLHA 1CY4A 2ZW9A 4RLFA 1MJ5A 1VHDA 3WFJA 1VIMA 4CI9A 4RVNA 4NNJA 2FA9A 4TMFA 1IM2A 5I9IA 1DAFA 1HLPA 3MJSA 5AICA 4LOAA 5ENZA 2J9FB 1GPJA 3O1JC 4IGIA 4XI9A 1VRWA 2XVMA 1E1QA 2XMGA 3B6JA 2GWHA 2CCKA 5IUKC 1QOZA 4BNYA 3U4IA 5KBYA 2MDTA 4JLKA 5AUNB 3S8YA 4DSOA 5KCZA 1HE3A 1P2UA 1ZJWA 4WZBA 4ID3A 3JWEA 4IV5A 5AI5A 4Z99A 1DUSA 1EJ0A 5JZVA 4J6FA 2G4CA 4ZQEA 2FWBA 4B1FA 5KU1A 1A4RA 1FYVA 2H1RA 3OE1A 4N5DA 1O7JA 2ZRLA 4AYWA 3FIJA 3NETA 3SC4A 4DSTA 3IP3A 4M3NA 3FW1A 1M1NA 5TMDA 4DC9A 4DPKA 5FUBA 3KJHA 2CHQA 3R5SA 1DDGA 1EINA 1YDWA 3IVGA 3FZQA 4US1R 1TZCA 2IEAA 3P0RA 5JNSA 1MTZA 1NP6A 4TTIA 4ZU1X 2GPJA 3U6BA 5CB0A 4X54A 2QNRA 4EYOA 4L5YA 1JAYA 2IW3A 2WIAA 3NH9A 2GUGA 3WLLA 1ONSA 1R4MA 4RPCA 3BFPA 3WISA 2PFSA 2WYVA 2RJOA 3GGOA 3NHPA 3UATA 1JDZA 4NCIA 5AVTA 3K8OE 3L43A 1G59A 1FSSA 4D9BA 4AUEA 5K0EA 2DXIA 3OI7A 5EQTA 4NU6A 5TLSA 4YP5A 1A04A 1Q7TA 1RT9A 3MSXA 2HU5A 1XZPA 3DLCA 1HC7A 4C7KA 3IO3A 2IVZA 1GSIA 3VKWA 3M1LA 3R5HA 3IUSA 2PWPA 1QS0A 3AONB 4WRRA 4M7PA 1WKVA 2Z58A 4GPZA 2PANA 2BGUA 2BFPA 2DERA 3HLTA 1FFAA 1R16A 3KQLA 1FNMA 1WMAA 2IOQA 4PC1A 5AXDA 2X0FA 3N3AC 3JXEA 3ZVRA 2R6FA 4RZXA 4F4IA 4MKFA 3K94A 5C35A 1XL1A 1KFKB 1TKCA 3EQ7A 3TTXA 5I7HA 2P1ZA 1U31A 1KXZA 3G88A 4RHCA 3DCNA 3IA2A 3WYAA 3G2OA 5BYKA 3OLWA 3PWZA 3PI7A 1RXIA 5KIAA 4M1EA 1KKLA 2XMCA 3NC1C 3RASA 1YQDA 2JGDB 3U7HB 1E4YA 1SM4A 1SNYA 2F3QA 1CKEA 2IYYA 3NIWA 1L5QA 1VL8A 1W6RA 2VVTA 4JQOA 4Q34A 3OQMA 3E22A 2RHJA 1IMOA 2VP6A 5AKLA 4AJ1A 4HADA 3AM5A 1UIMA 1Y89A 4FJ2A 4V2UA 5AI4A 3W6OA 5KTTA 1K7XB 2GD2A 2NP6A 3PFKA 1EBBA 1YA6A 1VL1A 4U5XA 2YYAA 2C9YA 2H5IA 1QQ7A 1K0UA 2VYVD 2X0DA 5B6JA 1JT2A 4PIMA 1OLUB 2BBOA 4QJBA 4C7JA 4ARIA 4DZTA 2XZTA 3W1EA 3ZD8A 3GX1A 2WMOB 1NLMA 4BKPA 5JSUA 2FQ1A 4S1WA 2ISCA 5EIOA 2BCGY 2YVQA 1M67A 1J8QA 1TJPB 5K0GA 1LBSA 3OA0A 2V5AA 2O3TA 3SHWA 3H0EA 4G4SP 2TSYB 4DFDA 2CUZA 1T5SA 4RO0A 4TVOA 1KZGB 2DR2A 2UU9B 1XR3A 5DHPA 3ICCA 4B2PA 4JT4A 5TQ2A 4YUXA 2QRVA 4UVDA 4F5DA 5DM70 1Q91A 3RUEA 2QL9A 1IRXA 4NV1A 2C4MA 2PO7A 4UBOA 3UMJA 3RSFA 1G5TA 3TAUA 5ICGA 4RXMA 2BFBB 4X94A 3ZNOA 4CMHA 1QZ3A 1CQIA 3DQPA 3G8DA 2NVWA 4RIGA 4WKBA 5TV2A 3T9DA 2G1KA 2GN1A 3QELB 1D04A 2FH5B 4OLHA 1C14A 1TFRA 2K2WA 3HVKA 2A5GA 3VI3B 1TE2A 1GITA 4LHEA 1K98A 4N76A 2OP0A 3WG9A 5GVSA 1N2ZA 1AKRA 2Q6KA 1NXQA 2I4MA 4ASUA 1QVAA 2O1EA 3LVBA 3HZRA 3I28A 2ZLBA 1F9AA 2D13A 3KTAB 4TSFA 3TWOA 2Q3BA 4LOLA 2QPOA 2DUWA 2ZEJA 4WK4B 3IODA 3L6EA 4WECA 4MW0A 1J42A 5A5VA 1RKQA 2AG0A 3RJMA 1M2OB 1DXHA 1NOJA 5FB3A 3CWQA 2QD3A 5ENVA 2WUFA 2WMYA 2WWHA 1U8TA 5P21A 4KLRA 4G4GA 4GYJA 4TSRA 1W8IA 3VPCA 4X91A 1JA9A 4C2BA 2UYCA 3I9V6 3UC5A 3B9RA 2O19A 4BU0A 2LCFA 2PV0A 3LQ4A 3T3PB 2X4DA 4E88A 1YA4A 4DR2B 1Q3KA 4JQSA 2DM6A 3GLHA 1JKIA 1DAIA 4TZKA 3TIFA 4PCLA 1HM5A 1G55A 1JQKA 2QM8A 3QA3E 3ECAA 3LT4A 3PWTA 2ATVA 2A78A 1RXEA 2O2IA