1CJMA

Human sult1a3 with sulfate bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
286
structure length
223
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQRVPFLEVNDPGEPETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLGDWKTTFTVAQNERFDADYAEKMAGCSLSFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ARYL SULFOTRANSFERASE)
publication title Crystal structure of human catecholamine sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 223
sequence length 286
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cjmA00
4EQ6B 5IF9A 4TZ6A 4Q4JA 2TMKA 3QENA 4UXIA 2Y8EA 4BEBA 1G1MA 2ZYWX 1P75A 4ILEA 4KODA 1Q22A 1T0HB 3CZPA 3KKOA 4BFWA 1JQJC 1D2NA 4JVLA 3RS2A 2IS2A 3NDBB 2QUZA 3WXMA 3EXAA 3A1WA 4EFMA 1QG2A 4LK2A 3DDCA 5L3QA 4HDQB 1SVKA 2BMJA 3C14C 5GJCA 5D3MB 4QOSA 5B64A 4B3GA 3RNLA 2EFCB 2C9OA 2OT3B 3GCGA 3ZD7A 1X86B 1T0JB 4LGMA 4DCUA 1AQUA 5CITA 3EZ9A 4BLQA 2F7SA 3ZJYA 2VH5R 4D4JA 1M7HA 5TV2A 4OJKA 1DO2A 2ZSAA 3MJRA 1MH1A 1NVXQ 2WKPA 4HLCA 4MUAA 4L9WA 1OIWA 3TSWA 3IPXA 4QHYA 1MO5A 2H18A 3NC0C 1S3GA 2HT6A 1WDTA 1XCMA 1ZAKA 2Q3HA 3Q9LA 1Z28A 4XWAA 4PC6A 4NONA 4BFYA 4D4KA 3ONWA 4JLNA 1KO7A 1XBTA 1KSFX 1ZNYA 3AF1A 3QBTA 3WP1B 1QHXA 3LRPA 2PX3A 1Z08A 2QP9X 2O8EA 4UKDA 3U3RA 1XCPA 1G8HA 2FEOA 3OF5A 5FOVA 3AH8A 3KKNA 2D74A 3I5XA 1BYUA 2J0SA 3QF4A 2OSBA 1OSNA 2WJJA 3QXSA 5JFGA 5KNBA 2QENA 4LHXA 4OL0A 1G41A 3BRWD 4LBVA 1M74A 2GETA 2ZAOA 4D0NA 3FOZA 1XF9A 5EQTA 1ZUNB 4B76A 1XRJA 4OK3A 1OYWA 2V1UA 2A78A 1OIVA 3GLIE 2P6UA 1T3LA 3CH5A 2QGZA 1G7TA 2GILA 3LBIA 4RKEA 2F55A 1M2OB 1R0ZA 2ODNA 4B73A 3CWQA 5IDVA 1ZU4A 4CIDA 4DB4A 4JIMA 1DADA 4PSKA 5B30A 4MA4A 2JDID 1YZUA 2WHXA 3BB3A 2UVQA 3ZZ0A 5JS7A 1OXTA 4XTRA 4B48A 2BBSA 4GP7A 1RRGA 4LX0A 1OHHD 4UNNA 1OT3A 1S1MA 1OPXA 2HV8A 2MSCB 3Q8XB 5GVSA 2CLSA 5IRCD 1GKIA 2QTHA 3T1QA 2F43B 4L4UA 1IXRC 2C5LA 4JLJA 2RGXA 3F0TA 3SYLA 3THXA 5JHGB 1UDWA 1W0KD 1YKSA 2FU5C 2IBMA 2OFOA 2W6ID 1GZSA 3U3JA 3UXMA 3OIUA 4Q1EA 4LV8B 3U60B 1IONA 1O3YA 1C4OA 1MKYA 1G5PA 1XCGB 2AN9A 1E32A 2NPFA 5JWOA 3RABA 4H1VA 4BZQA 2F9MA 3RWMB 2JLWA 2JGNA 3GEHA 4LJ9A 4DCNA 1TU4A 2XZLA 1CR0A 2K5UA 4DZZA 2ZE8A 3LX5A 3SBEA 3ZYCA 4NZYA 3LXXA 3O8CA 1KI2A 1W1WA 2EFGA 3L0IB 1II8A 1R5OA 4N3NA 5HKKA 2BKEA 1UBGA 3F3YA 1GL7A 4KBGA 4YC7A 2FWRA 3FFBA 3QKRA 1KY3A 2H57A 2BMDA 3PG5A 3AKDA 5B57C 4MYHA 2IW3A 2WIAA 3A4NA 4XD7D 4TTPA 1KK0A 3K70C 1GSIA 1KJZA 1KHTA 2PH1A 3EW9A 2IYTA 3I1FA 4Q00A 1WBBA 1N25A 2F1JA 4LCBA 4F4JA 2W83A 2I3BA 2FFBA 2OCYC 3PJRA 1Z6YA 4CVNA 4LJ6A 3QUSA 2OILA 3N5CA 2RGBA 4JBYA 4DLRA 4O3MA 1A4RA 2ODWA 3GFTA 4ZDJA 4AG5A 2A5DA 1DAEA 2GZAA 4D25A 2C9CA 8OHMA 4GSYA 2YINC 1OKKD 5LB4A 2XTMA 3K70B 1AA9A 1JXMA 2RMKA 4MRRA 4B75A 5CB6A 1YZLA 1M34E 4M1OA 5F9HA 2O52A 1GITA 4K46A 2H16A 1SGWA 2CHGA 2GCPA 2GJ8A 2B92A 3K0AB 1G6HA 4IDQA 1Q20A 2HJVA 4LBWA 2HF8A 3I8XA 3FMFA 2VTKA 2V6JA 1JALA 3FFAA 1YR6A 1OIXA 4GZLA 4JKYA 2GF9A 3GPLA 3A8TA 4RD6A 2QP4A 4Q02A 1KYIA 4KFRA 2QAJA 4E07A 4M9QA 1XJQA 2AKYA 3HPQA 2KI5A 5KSPA 1AGRA 4YMTA 4M4SA 4RVCA 1G19A 5AUQA 5F3WB 3IIKA 1UEIA 1VECA 1IN7A 3NXSA 2ZUCA 4GMXA 1XEFA 1NP6A 4DDVA 5KPJA 2GDJA 4AD8A 1Z2AA 1DAGA 1Q12A 5F2EA 3A4LA 4NKRA 4WW0A 2IXFA 2ZS9A 4C0QC 4FWIB 3IBGA 1E2FA 2ZVPX 4R9UC 4YMUA 1NVWQ 2C04A 3EG5A 3KB2A 1SVMA 2YOFA 4EPTA 3IILA 4TYNA 2ZRIA 2YOHA 4JSTA 2J7PA 1KGDA 1DARA 2QQ0A 1LF0A 4PO8A 5AJXA 4IHQA 5DI3A 4BLRA 4IOMA 4QBHA 4IOKA 1A82A 4MKFA 3AVXA 3TMKA 2XNDA 2FNAA 2QBYB 3C15C 4I1VA 4EQ6A 3IEVA 2RGDA 2ZROA 2QMHA 1E2MA 2IK8A 1W0JA 4B32A 2V1XA 4NTZA 4EIWA 4LJAA 1XJCA 2CMKA 3LW7A 1RIFA 2HUPA 3UWOA 3WYFA 4C0LA 3O8RA 1G20E 1NY5A 1KNQA 2KJQA 3GLHE 1HUQA 2CK3A 4FMDF 1OFTA 5D3MA 4LJ4A 1ONBA 1NMZA 4NBSA 5FOTA 2AK3A 2IYSA 5E95A 2IYRA 1DOAA 4B3CA 1T6NA 1CBUA 1VG1A 1GDDA 3RS3A 5DIFA 5FUXA 1Q3TA 2QY9A 2ZJZA 1GNQA 3IEUA 1N0VC 3BB4A 4AYTA 4PAMA 2FPMA 4HI0E 4TYPA 3AB3A 4UXHA 4A4DA 3NHAA 2VL7A 2QM7A 3C5HA 4ZIRA 5L3SA 2A7QA 2VP0A 4JYCA 1PVOA 4A15A 2C96A 1T5LA 2ZJ2A 5E3HA 4BZXA 2QA5A 4O25A 1NSFA 1CRQA 2ZI4A 2L0XA 1V43A 3DEFA 5FH9A 2RHDA 3EPHA 4OHVA 3QPUA 4A9AA 4BECA 4N1AA 3VHXA 4PHHA 5CLLA 1IN6A 4HATA 2DPXA 1CR1A 2F9LA 1P6XA 2G1JA 3RRZA 3P26A 2XB2A 4PAQA 4FW9A 1YE8A 1G9XA 1E1QD 2HYIC 3KUCA 5EUMA 2IYLD 2F1IA 4W5HA 1E2JA 1H8HA 5G3YA 5AJWA 1K5DA 1W2GA 1JEEA 4D4LA 2VQSA 4FCVA 3X1WA 2A3RA 2GEDA 1VG0B 3LBNA 5FOWA 2VA8A 4GOXA 2R65A 2XZOA 3EX7C 2D3WA 2VHJA 1OXXK 4KAXA 3CNOA 3GJ3A 4EPYA 2E1RA 1US8B 2PL3A 4II7A 2V8OA 1UKYA 1XD8A 4XWKA 3V00A 2ZJAA 4KLZA 3SI7A 4M1KA 4TYQA 3TBKA 1KY2A 5EE5B 5L3RA 3PEYA 2F43A 1NG1A 3NBXX 1ZIPA 1DPFA 1IN5A 1X8JA 1COWD 1R10A 2WWFA 1W4BA 1ZM9A 2J87A 2PT5A 1KNXA 2MSEB 3WRXC 1VG9B 2O8FB 1AS2A 3ICEA 2ATVA 2O0HA 2OFWA 1J99A 3D3QA 2CEAA 3H0KA 3FMPB 4DSTA 4G5GA 3ZVNA 5JMTA 3FHTA 3Q72A 3UMSA 1WE2A 3R8FA 3QKTA 4IDPA 1CJTC 3QXXA 1AN0A 5GVRA 1JECA 2FSGA 1W4AA 2QG6A 2AD1A 4JL8A 5EJEA 3AVWA 3WHLA 1HEIA 1RVDA 4LJYA 1W46A 5J4HA 2Z83A 3JVUA 3PITA 3P32A 5LDDC 4DCSA 1NVVR 3BXZA 1JR6A 1Q3HA 4OQLA 4ASUD 1WF3A 1N6OA 1X8LA 2O5VA 4FWTA 4QXAA 4HUTA 1BOFA 2JASA 4QRHA 821PA 4P4UA 2DFLA 5FBLB 1FP7A 1K6MA 2ZRBA 2GK6A 2J0QA 3KQKA 2CNWA 1UBEA 2VSOA 1NG9A 3NH6A 4ZDWA 1ELOA 3PUXA 3VMFA 4L16A 4L9SA 4ZCLA 3AF4A 4KXFB 2IYZA 3AGQA 1ZC3A 1FZQA 2EQBA 5K8TA 2GA8A 4K81B 4B71A 2V54A 2C77A 4Q1BA 4BLOA 2JJ2A 3CPJB 3DKPA 4DCVA 4NE2A 5AUPB 4V0ME 5J4LA 1NN1A 2BIFA 1EK0A 2BWJA 4PXAA 2C98A 3HU2A 2VP9A 3FKSD 2D7DA 2D4HA 1KI8A 2RGEA 1W44A 3PUVA 4GP6A 4CDGA 5DYIA 4F91B 1HE8B 4TSFD 5TVKA 4D81A 2H7VA 1F48A 4QJ5A 3T12A 2PEYA 4RD1A 5FL7A 3CF6R 3EASA 4I1UA 4D26A 4A82A 4OHYA 2B8WA 3SE0A 4DUGD 1FP6A 3N70A 4YONB 1VCNA 1JPJA 5JSZB 1G7RA 3K0AA 1GKYA 1UPTA 4C4PA 5DSZA 1KOFA 2EWWA 5FBVB 4LHVA 2IYVA 1Z0IA 4MGYR 2QAGC 4RFVA 4G1UC 1NBMD 2F1HA 4PAOA 1RC8A 1MRSA 1NIPA 1R0XA 1W5SA 1KO8A 4YLGA 3K0EA 5FUWA 3X2SA 5E7JA 2Z4SA 3K0FB 1XZPA 3FB4A 3OAAA 5HCIA 4C0BA 1HTWA 2V7QD 1N6LA 1QVAA 3CO5A 3GMTA 3REGA 4W9MC 4BPBA 2Q3FA 4KSBA 2QAGB 3VHLB 3CZQA 3VR4A 1DAHA 4KITB 4GMDA 4LY6A 4WZAE 2QP3A 1Z06A 2YWFA 4P33A 1WP9A 2GJKA 4IVQA 4V0KA 4IRUB 4PPNA 1QZXA 1DAIA 1SVOA 1T8TA 4KV9A 1BMFD 4DEYA 4TMXA 1XZQA 4LHZA 1AK2A 2GKSA 4BGDA 4CRWB 1CR2A 3HYRA 3BAFA 3TQCA 1WB9A 3TLXA 3GLFE 1KDOA 4DHEA 4AK9A 1U98A 1YR8A 2CE7A 1AKYA 2QRZA 1YZNA 5G41A 3KUDA 4BASA 2ZYVX 1J8YF 4HZUA 4NYMQ 2PZGA 1JQLB 1Z2CA 1XX6A 2Z0MA 3BK7A 3U2QA 2F1RA 2VYFA 2XJ9A 4Q47A 2Q9CA 4UXJA 4B47A 1W7AA 1E0AA 2ZR9A 3K53A 4Q4AB 1FUKA 1U8ZA 4BLSA 3A6PC 3WMEA 3A36A 1HT2E 1KI6A 3TUIC 4RSGA 2O8CB 1EG7A 3K9LA 2O0KA 5CYPA 4M1TA 5KSOA 2ECKA 1VIAA 1ZC4A 3T1OA 2JLYA 3A1TA 3RANA 4A2WA 1EESA 4JBWA 1ZM4A 1Z6TA 3RRNA 3ICQB 4RCZA 5JJKA 2JDIA 3DKVA 3QG1A 2QTVB 4MGIR 2CL0X 4JZKA 5F98A 2C95A 3QPWA 3FKQA 3HR8A 1QF9A 2H92A 3ZGXA 3OEED 4JT4A 2YHSA 3Q5DA 4ITRC 1KIMA 3B1VA 4I1SA 1W0KA 1RZ3A 4QGAA 2RGNC 4DCTA 5DN6D 3ADCA 1R6BX 5BW8A 4QNMA 1UM8A 2N42A 1M6NA 4MDFA 1XD9A 4CEJB 4DSUA 4DDTA 4CYMA 3F5FA 3NC1C 5SZKB 2OG2A 1XEXB 1QHIA 4XOIA 4B3XA 1Z6AA 4X8LA 2A5YB 2EFHB 2HEIA 2OCBA 4MRVA 3MWJA 3X1XA 3O8DA 4ACAA 3KFXA 3IHWA 3W3AA 2J46A 4FIDA 3VR3A 4LOAA 1R0YA 2V9PA 4KHZA 4R2IA 5J5CA 2GBLC 2H17A 3I72A 2YJTD 4GZMA 4YXWD 5CB8A 3BIFA 3LV8A 1CU1A 3ZH9B 2PJRA 1VYTA 1NKTA 3X1YA 3B1YA 3MCAA 1R2QA 1UDXA 1ZCAA 5C18A 2PT7A 5BWMA 3NBFA 2GWHA 3C8UA 2IUTA 2IL1A 4M22A 1D9ZA 1SKQA 3GLHB 4Q19A 5UKDA 4RD3A 5HR5A 1GOTA 1RYHA 1US8A 2WBLC 1OJLA 5EXXA 5AUOB 3T15A 3L0OA 1ETUA 1A7JA 2UZ3A 4NYJQ 1G3MA 1QHHB 2GF0A 3HJNA 3VKHA 4JMPA 4KYIB 4F4CA 2WWHA 3GJ7A 2R6AA 1AGPA 3DMDA 2IYWA 3REFA 3X1ZA 5HZHA 4B43A 1I2DA 4JVMA 5DHFA 3PENA 3PIRA 3SU8A 1VYUA 1GRRA 3EWSA 2VEDA 1N6RA 1KMHB 1UBCA 1OKKA 3CRQA 3PXGA 1YR9A 1IBRA 2UKDA 4E22A 3LW8A 4Y0AA 5JRZA 2NOAA 3ND9A 2ZRJA 3RSOA 4URXR 5CJPA 3Q5EA 4HAZA 2OV2A 3LBHA 4FD2A 2P67A 2ZTSA 4IOLA 4ESVA 2DWOA 4WXRA 3DZ8A 3EIEA 3FDIA 5P21A 4P4SB 4G5QA 4Q9KA 1N6PA 1L7VC 1S8FA 1KAGA 2GRJA 4A0HA 4KSCA 4WZBE 3BORA 4GL2A 2G83A 2CL7X 2ANBA 4XVQA 5AJVB 3SHWA 1UKEA 4BFZA 3LVRE 4IOJA 3RS5A 4ZV4A 2IYXA 4RZXA 3AKYA 3I92A 1XDBA 2OHFA 3DL0A 3PV0A 4DT1B 4LWZA 2QMOA 2O8DB 5C4GB 3K0SA 4B2LA 2AXNA 3UWKA 1D2MA 3CX6A 4TQ9A 2VLIA 4P32A 4XVUA 2GESA 3WYGA 1KZGB 2GCNA 4EDHA 5CK4A 1PLLA 1T8UA 4D80A 3KDSE 3RVBA 3VQTA 4MDEA 3NIBA 1EXMA 1T9HA 4IEIA 4KVAA 3AP1A 2FV8A 5D3QA 3THWB 2VHUA 4JL5A 4LJ5A 2ZR0A 1FL9A 1OE0A 3QKUA 4XVRA 3CKLA 2A30A 1RKBA 3TUJC 1G4AE 2R6DA 2GCOB 2HJGA 3BS4A 3QVUA 4HYYA 4RY2A 4D6PA 3IO3A 1KSGA 3GJ0A 1E2QA 3M4YA 2QMUA 1G8GA 3U7EB 1GRNA 4HAUA 5HPYB 3W5JA 2BOVA 4HB0A 3W3ZB 1JEDA 3KXLA 2EYUA 3NH9A 4AYWA 4QKQA 4NCNA 4DB2A 1AS3A 3DMNA 1OB2A 1Y3AA 1QVRA 5BYKA 2WKQA 1PZNA 1YZKA 3H2YA 4G01B 1F60A 3IIJA 2NQ2C 2ZSEA 1KDTA 1MR3F 3AVTA 2A5JA 2BM1A 4B34A 1OH6A 5J4KA 1XB2A 5JHHB 5IK2D 1QHGA 1XNJA 4CEIB 4EFNA 1E9AA 5EXSA 1N6IA 2ZJ5A 3E70C 4Q66C 1QHYA 4ZO4A 3PEVA 2ZRLA 3CUEF 4B3DA 3OIWA 2IHBA 2R9VA 5FI1B 2WOJA 3B6EA 2R6GA 3VR2A 2QAGA 3VX4A 4PQYA 2FPLA 3CM0A 1GVNB 5HE9A 2N46A 4RZ3A 2QL6A 4HAXA 2CCJA 4IXNA 4HLUC 2Q0HA 1KI4A 3PVSA 3AKCA 3KJIA 4A6PA 2R2AA 1S2MA 3RS4A 3B13B 3AVOA 2P65A 4S35A 3HU3A 4F4IA 1ODFA 2ZS7A 5GJVC 1LV7A 2IF0A 5LD2C 3W90A 1X1SA 1TEXA 3W6OA 2GXSA 2AL7A 4NPHA 5HZKA 4Z8YA 1DE0A 3U4QB 1P9RA 3CX7A 2ZSBA 2WSMA 3T5GA 4DXAA 1TMKA 1CS4C 5FPHA 3QOFA 1P2VA 2ZAMA 1EWQA 1AKEA 1RRFA 2HCJB 4BRWA 4B3BA 4Q4AA 1GTVA 3KKQA 3GLGE 2JJ1D 1WBDA 1NF3A 4D4MA 4POAA 3QVVA 2LCFA 3UMRA 1LF5A 5LD2B 3ADBA 1MABB 3NBYC 2BMFA 2QT0A 4H1UA 1B23P 2CCGA 1C9KA 1E9RA 4UNSA 3FPAA 2P2LA 3UANA 5FTKA 2ATXA 3HYTA 4HAWA 4ZKEA 1XPUA 2CHQA 1B0UA 3IHLA 1OV4A 2WAXA 4IJMA 4BLPA 4LI0A 3OFNA 1VMAA 1BIFA 2PJZA 1E99A 2PLFA 2WZQA 1SVWA 3IUYA 3I32A 1YJ5A 2CDNA 3EPKA 2JAQA 1L4YA 2OXRA 2QE7D 2V55B 3IGFA 2HCBA 4Q4LA 5AR1A 1COWA 3LDAA 5JJLA 5HCNA 4MUBA 4KFUA 2FPKA 2O8BB 1IM2A 2J0UA 1E9BA 1D5CA 2QPAA 1JI0A 5TMPA 2ZYUX 1X3SA 5EP3A 4EPXA 4TT3D 4DRZA 4CEJA 1T5IA 5BQ5A 4DLSA 5BN5A 1EX6A 4Z8XA 1YQTA 1XEXA 5CJ2A 3A1VA 3U44A 3THYB 1IY2A 5EZ6B 3EIQA 4S2EA 1GKUB 121PA 4L8GA 4ARZA 3NG1A 3OE7D 4PSVA 3VTKA 2GAAA 2BMEA 1XXHE 4ABYA 2RGNA 4QBFA 4EPWA 3U3OA 3GLFB 2CJWB 2ZANA 3S1AB 1SXJD 2P5TB 2QT1A 2ZREA 2VBCA 2ZU0C 4DKXA 1IHUA 2QPTA 1K5GA 4OK5A 2FN4A 3MAAC 3UK6A 1TTTA 2VIIA 1KK1A 4LHYA 1DG3A 3U7FB 1IN4A 1ZD8A 3GLHA 3ND8A 1IXZA 2NGRA 2UZIR 1KO4A 4CGZA 2ODEA 4A0RA 2J1LA 3DOFA 3SYNA 2ZI3A 5TXGA 2GBLA 1G18A 2C9YA 3KZ1E 1QHHA 3FYHA 2OE2A 4BLTA 2OO7A 5FI0B 3KTAB 5H1YA 2CE2X 4YQFA 5K8IA 3SJCA 3SOPA 4AY2A 1KAOA 2IEYA 1QHNA 3C16C 2ANCA 2Q9BA 2XSZD 1OW3B 2IYUA 3FKSA 4LJ7A 4RFSB 1CR4A 3U3KA 2OLKA 3DZDA 1P62B 3SQWA 4TSFA 2C03A 3EAQA 4JLPA 3ZZUA 4IDNA 3SEAA 1PLJA 2GEUA 3NDPA 4DDWA 1RYFA 4DUGA 2ZRDA 3QJYA 4GOJA 1U0HC 4C0KA 3OEHD 2P5SA 2R62A 4L15A 4M1YA 1XTKA 2BHRA 3AP2A 3OIVA 5HTKA 1E6CA 1BH2A 3MLEA 4JL6A 5C2JB 5FUYA 5KHOC 2OCPA 1UFQA 4HUQB 1U94A 2YNMA 2XITA 4UNQA 2ZR7A 3HU1A 1JB1A 2RB4A 1KO1A 2PZEA 2RCNA 4HB3A 1NBMA 1Z5ZA 1KI1A 2XTZA 1W47A 1F3OA 2RGAA 4ZI2A 2ZXUA 5BXQC 4CT4B 4OI2A 2C2HA 2JLVA 2QROA 3TSOA 4KLNA 4AI6A 1NSTA 3SC3A 1E2KA 3QF7A 4LHWA 2Z5FA 1ZM7A 4DT1A 4Z1MD 3VNVA 3PR1A 1G5RA 2ASEA 3W6PA 2O8DA 4MKHA 2V7QA 1S1CA 3FWYA 1Q21A 1G4UR 2IF2A 5AUNB 5FPKA 2P6RA 4DVGA 4Z54A 1N0UA 4QGFA 5EXTA 2GZHA 1JAHA 4UNRA 2CBZA 4B44A 4MGKR 1TQ6A 4OKSA 2H5EA 2PCJA 2OAP1 4HB4A 3RC8A 4GT1A 2ZETA 2J9RA 4AKEA 4QM7A 2OESA 4JT2A 4Q7KA 4I81A 2BCGY 1Q44A 2NZ8A 1BMFA 3E2IA 2GCOA 4OQMA 2J5XA 2IYQA 4PC1A 4KU4A 1E0SA 5CLQA 3ZD6A 1RJ9B 3QI2A 3SN6A 2MSDB 1K8RA 4BE7B 2WIBA 1SKYB 1WRBA 3KJHA 1LTQA 1II9A 2JA1A 1HURA 4AIIA 4W5JA 1W5TA 4X8MA 5BN4A 2VHQA 1UAAA 4LUCA 3O8BA 1JJ7A 1ZP6A 2DR3A 2WJHA 2BBTA 1RRPA 3W8RA 3CRRA 5J40A 4Q7MB 2FDCA 1QDEA 1N6KA 1U2RA 1ZM2A 2GJAA 3K1JA 2I1QA 4PTLA 2IEZA 1Q57A 5FTLA 1GNRA 4MRSA 3RLFA 3VU9B 5JCPA 4CEIA 2FFAA 3MUFA 2B8TA 4G5RA 5J4YA 4HAVA 5EP4A 3BFKA 1Y63A 3B9QA 4E09A 4NCIA 5FR2A 3R9WA 2VHCA 2KBFA 4OHWA 2D2EA 2DWQA 4GBMA 1NBME 1ZINA 2FG5A 5JWRA 2DWPA 1P2UA 3Q3JB 1I4LD 1KKMA 4H9GA 221PA 2WWXA 4PZYA 4Q7JB 4FMBB 1M7BA 2VHTA 2WOOA 3ZIAA 3ZVLA 4CZ2A 4DIEA 2XXAB 4YMWA 2YC2C 5JS8A 1HH4A 3U3MA 5DN6A 2X19A 4V0MA 4LC0A 4B35A 1KJYA 1SXJC 5CM9C 3C7KA 3LQRA 3BH0A 5CIQA 2YWEA 4FI3C 3WBKA 3PUZA 4N0DA 3T06B 3K0CC 5DYGA 2I1VB 4HLUA 3TK1A 4GI7A 1EWRA 4PC7A 3I3SR 4LBYA 1GG2A 3AM1A 1NNEA 3ZLJA 4ZCMA 5DI9A 5JWHA 3UMFA 3KB1A 4A6XA 3R9XA 1LNZA 1T3SA 3KXKA 1SXJB 3D8BA 4U02A 2QMEA 4YXWA 4US0R 3TH5A 2XEXA 2WAYA 4RKFA 2DBYA 1J2JA 2P3SA 2ZJOA 2WICA 4ZCIA 2B21A 3CLVA 2EYQA 1G3UA 1LFDB 4DJTA 1W4RA 3P4YA 2ZRGA 3ZVRA 1M1YE 3LX8A 4PQFA 3MG9A 2LWIA 2ORIA 4RD2A 4DLTA 2IA5A 4TL8A 4LPKA 1OF1A 1AQYA 4V03A 4EPVA 4BZPA 1ZU5A 2JJ8A 4HAYA 3VFDA 2QM8A 5JI2E 2NZJA 1E9SA 1RW4A 2HXSA 3ZQ6A 2GZDA 1LY1A 2NMVA 4JKIA 2F6RA 1ZBDA 3FTQA 3VAAA 3QXJA 3SZRA 3B1ZA 3ASYA 2AXPA 1KJWA 2FMXA 3RDPA 3WBJA 1RPZA 1DS6A 1FQJA 1YZQA 2FEMA 1PJRA 1TF7A 5LB2A 4U7DA 4PO9A 2AD5A 2C99A 1CULC 3DM9B 4FN5A 1E1RA 2X2FA 1XWIA 4BQSA 3A37A 2QSYA 3MWKA 4KFSA 3THYA 3TUZC 3EARA 4D0GA 1XFAA 3LXRA 3Q85A 2ZPTX 1D2EA 1ESNA 2WMOB 3GLFA 3L82B 2CJWA 4B2IA 4HEJA 4P31A 2CLCX 2VP2A 1XTQA 3EZ7A 1VKJA 3SJAA 3TNFA 1U9IC 1ZNXA 3IPYA 5EP2A 3R9IA 5JEDA 1P73A 2ZI7A 4C2UA 1R8QA 3CBQA 3KQNA 3L43A 1JR3E 5AJYA 3OIYA 2FH5B 4QG7A 3GLGB 1J70A 1E9CA 4M2LA 1ZW6A 4ZDKA 3HP1A 1KDRA 1MV5A 3GJXC 3VR1A 5AJZA 1FW6A 1F6BA 4IEEA 4TQUS 2HDNB 4KVGA 4Q7LA 1Z47A 4GRAA 4V0LA 1W48A 1XTIA 1L2TA 4YMSA 4Q9JA 2C78A 2WV9A 1P2TA 4LZZA 4MH0R 1XEWX 2KBEA 3FVQA 3A4MA 2Q21A 3EZFA 5L3QB 1SULA 1OYYA 4RFSA 3C4JA 1E9EA 3NHBA 3CRW1 1R7RA 5EP1A 1NJGA 2ZQ5A 1DO0A 2ZITA 5DLQC 5DO9A 5FL3A 2G0TA 2ZVQX 3F8TA 1KK2A 1X6VA 1FUUA 3AKEA 1BYIA 3PUWA 4OHXA 3QIAA 2PMKA 4QM6A 2KE5A 2N1BA 3T5DA 2QQEA 1IJEA 2A5GA 2ZRNA 5B2ZA 1FNNA 1G3QA 2GJSA 1G21E 2REOA 4URYR 2HLDD 1UKVY 1CJMA 4O2RA 2G3YA 2OLJA 3PQCA 4W5WA 2J7PD 1YZGA 1Z8FA 3UIEA 3BFVA 1SQ5A 1VYVA 2CL6X 3L0SA 3QEJA 4R98A 2R8RA 4WXPA 2ZJBA 5G40A 1S9HA 1VIYA 2DFTA 5KSYA 2NIPA 3KX2A 1XXHB 2SHKA 1E4VA 3SS8A 4XWOA 2O8EB 4Q1FA 3MD0A 1G5TA 5IK2A 3DVLA 1P9WA 3WHKA 1Z22A 3QXCA 2QBYA 1W0JD 3WP0A 4G5SA 1WCV1 1N0WA 4AKHA 5DHAA 4UNPA 1SHZA 3LFUA 1OXSC 2ZRCA 4P3YA 4HDOB 4QNRA 4KYUA 2YOGA 1OFIA 4KCGA 4LC1A 1Q1EA 2CK3D 4KO8A 3SFZA 4QJ3A 1FNMA 1ZYUA 3K09C 4Q9HA 4OI1A 3RS0A 2YWGA 3GD7A 3EIHA 5BYJA 4D82A 2FE4A 1G8PA 4G0NA 1AZSC 4PC2A 4IDOA 1GIAA 2AK2A 4FCTA 4PZZA 4U00A 4IKEA 2G88A 2Q6TA 1U8AA 2V4ZA 1NMXA 3NVAA 4JVSB 3SJZA 3WNDA 4DWJA 1OHHA 4A0GA 2W2TA 2GAOA 2NTYC 3QQ5A 1YR7A 1TAGA 2X77A 4TMTA 2XZPA 5JBQA 3QY0A 3MWYW 4DDUA 2ZSFA 2W6IA 2MMGA 4C7OB 3AF2A 1W4CA 2ERXA 1GM5A 2RGGA 3VU9A 1WQ1R 2ZJYA 1ZUIA 1X8KA 1CJUC 2O0JA 4BWYA 4R71A 1SVIA 3CW2A 5CYOA 4XSHA 1WA5A 1E2EA 3KJEA 3BH7A 1N6NA 1JR3D 4I99A 1G8FA 3NEYA 1CP2A 2G0NA 1A5TA 2FZ4A 2ZE7A 4KFTA 1II8B 4A2QA 2XXAA 2QE7A 3C5CA 2AFHE 2CVFA 3IQXA 4JLVA 4B33A 2ORWA 4EPRA 3IIMA 2MMCA 1DAMA 2BVNA 4QBIA 4B2PA 2ZRPA 1ZJ6A 4JLMA 4MRNA 4JBXA 1SVLA 1RE0A 2E87A 3BBPA 4WZ6A 3K9HA 1E2LA 5G53C 621PA 5DISB 4XD7A 4FMDB 4M1SA 4MYUA 1E0JA 3W34A 4C2TA 2XOKD 4B74A 3OE7A 4LDJA 5EZ5A 2O8FA 4CF7A 3U7GA 1E2NA 3H84A 4TTRA 2J0VA 1SKYE 3EZ6A 1H8ED 3P4XA 3K0CA 4JSYA 1LW7A 4DSNA 2IT1A 1OXVA 1JPNA 3IDQA 1Z29A 1W36D 521PA 3B9PA 4RD4A 1U0JA 2FX3A 3V4FA 2ODBA 1U0LA 1CF4A 4KI0A 2J45A 1NL3A 1VTKA 1Z63A 1E94E 4OQNA 1HV8A 4F92B 2CHVA 4V0NA 5JZVA 1G7CA 4PSAA 3OESA 2G6BA 2JLSA 2QN6A 3P27A 1FPMA 2VO1A 1CJKC 3LO5A 4QJ4A 2ZM5A 1N2CE 2XSZA 1J90A 1BO6A 3EC2A 3AUXA 1G3IA 4M53A 5H68A 1WMSA 1DVRA 5FOUA 4N0EA 1MRNA 2NO0A 1AS0A 1F2UB 2YYZA 3X1DA 3RWOA 4JLKA 1GRQA 2R6CA 3W6NA 1AIPA 4TZ0A 3B5JA 3LWNA 4MKIA 1HE1C 1KMQA 3D6TB 4KBFA 1P4SA 4DLWA 5EE3A 1WXQA 1IQPA 1NJFA 2EFEB 2YC4C 2CVHA 3UG6A 2ZE6A 4X8OA 3LQQA 4LSGA 3EPJA 4DSOA 4Q9IA 1U99A 1G3RA 1XJ0A 3BH6A 1CRPA 3CONA 3B1XA 3SYKA 3GLGA 2ZSDA 1F5NA 3L0PA 3U7HB 4F7WA 4AURA 1FMLA 1PUIA 5JSZA 3LD9A 721PA 2WTUA 2JLZA 2R44A 2RH5A 4Z1MA 1SXJE 4K8OA 1U9IA 1TU3A 2D7CA 4LYFA 2GVZC 4LV5B 3THOA 1J7KA 1BS1A 2IX3A 3W5IA 3CX8A 1GL6A 1GWNA 2XTNA 3OAAD 5FR1A 4NYMR 4TYWA 1HA3A 1AJEA 3K0FA 4ESHA 4PHTA 2OBLA 2W6JD 3L8YA 2FGKA 2GVDC 1DELA 2ORVA 2VRWA 1YU9A 3TAHA 2RAPA 4F38A 3R8CA 1S3SA 1NN5A 2BC9A 3AF3A 5C4MA 4DLYA 1KI9A 2BEJA 1F2TB 2ZEJA 3CNNA 4MITA 2QRNA 1XMIA 1P5ZB 4FMCF 4ZIRB 5L3SB 3SR0A 2VP6A 1G6OA 3U61B 1KDPA 1CKEA 4HSEA 3IQWA 3EPLA 3K9GA 1XXHA 3B85A 1I2MA 3D31A 1XMVA 5LBIA 2V6IA 1DBSA 4OI4A 1CIPA 2LKDA 2NG1A 1R8SA 4MQBA 3RC3A 4JLAA 1NLZA 1FMJA 3GJ5A 2G1KA 3UKDA 3ZZTA 1T4GA 4OI0A 3FMIA 3WMGA 4Q9LA 4UQOA 4TLBA 3W9YA 4IVPA 4RD0A 2BJWA 2GJ9A 4ON9A 4NCHA 4URVR 5A0FA 3VX3A 2H1LA 2ZUBA 4QL3A 4B3FX 1E1QA 3WMFA 4DBLC 1VPLA 1YZTA 1XPRA 3BOSA 3DM5A 2HF9A 2O8CA 2GTPA 1G16A 2W00A 2IUSA 3ZS8A 1I4DD 4M21A 5FUVA 2BM0A 3B82A 1XD2B 4NL4H 4M1MA 2AKAB 1XEWY 1MO6A 2LKCA 2PLRA 4EAQA 2A2ZA 3CPEA 5TB5A 2W2VA 4EUNA 3NBZC 1DG1G 3K09A 1N3BA 1S96A 3NKVA 3BJIC 1E2IA 5IHPA 5L3VA 3FMOB 1W36C 4PX9A 3TSZA 4GFDA 5ANRB 3LVQE 1TQ2A 3GP8A 1S0UA 3BWDD 3Q7QA 1JBKA 1E2PA 2ZS8A 5J47A 2BV3A 4MYCA 4MKGA 4C7OA 1M7GA 1SHKA 5FPYA 1ZMXA 2W2XA 4Q48A 4LRWA 4XIGS 2FJUA 4NYJR 2V3CC 2IXGA 1W36B 4Q4HB 2WPDD 3LLMA 5EE9A 2G77B 2REBA 5G3ZA 1HYQA 2DFNA 2GEVA 2AR7A 3QG5A 1G7SA 1G291 4TLEA 4C3ZA 1ZM3A 2OM2A 4PPGA 3JZAA 5GJBA 4C9BA 1ZUHA 3DPUA 2YKGA 2Z4RA 1N5JA 3M1IA 4OBEA 2KB0A 1VHTA 4WBSA 1E79D 4ASUA 4AC9A 2NO6A 3DHWC 3MJHA 2RGCA 5EE1A 2IS1A 1VCIA 4PHFA 2C8VA 1YHNA 3DOEA 2ONJA 1NVUQ 5FBWB 2JIZD 2RHMA 4OQFA 1RRCA 2NPIA 2GHIA 3CWZA 1XP8A 2DY1A 2KWIA 3GQBA 1L4UA 3EA5A 4C30A 4BUJA 2PZFA 2XX3A 1N5KA 5KU1A 2FZLA 2JATA 2XB4A 2ZI5A 5KNDA 3PFIA 2WSSD 3LA6A 1NVVQ 2ERYA 5JJIA 2P6NA 5FOXA 4ZI3A 1Q0UA 5KDDA 4QFMA 2GXQA 3U6KA 4OJQA 2FFQA 3B78A 1IN8A 3ADKA 4I1OA 1LS6A 1KMHA 1Z6XA 3KFVA 3KKMA 4LYAA 3MGCA 1Z07A 2QNRA 4UJ5A 2WWGA 3GEIA 4XH9B 5HE8A 4PZLA 1JJVA 2D62A 1TQ4A 3GJ8A 3FHCB 3IBYA 4M9ZA 4XSGA 3PUYA 4BFXA 1JNYA 3LNCA 1UEJA 3PCRB 4PO1A 2IUUA 3KQUA 4CEHB 4M9XA 4BFVA 4OHZA 1Z0KA 4P4SA 3TJZA 3U5ZB 1PV4A 4E03A 3B7GA 2WMNB 1EFRD 1UF9A 1E4YA 1ZRHA 2J59A 1A1VA 3WRYC 3H4MA 5C1BA 5JECA 1AZTA 3VR6A 5KSZA 1IXSB 5H8WA 4DIDA 2D06A 2ZRMA 1M8PA 2VP5A 4Q21A 4WA7A 1F2UA 3VKGA 2PEZA 4I4LA 4XJXA 2DFKB 4B6EA 1XPOA 4AG6A 2WJIA 3BB1A 1N5LA 1FTNA 1BKDR 2J3EA 1FOEB 1GUAA 3IKJA 3M6AA 1A2BA 4YDSA 1OH7A 3N2IA 4NMMA 2HLDA 3BD9A 4JJZA 1S4QA 1QHSA 4FXPA 3THWA 3A1SA 4MGZR 4NU0A 5KUTA 4TL7A 3AP3A 5GADl 2J41A 2BBWA 3A1UA 3M0EA 4FCWA 2PCLA 4DLXA 2ZE5A 2ZRHA 1O87A 5KDOA 4PPFA 4R7ZA 5JI3E 4M9SA 3CPHA 3D7MA 2YWHA 4M1WA 1XMSA 2BBOA 4HZUB 2P0EA 4US1R 4XTCS 1Z0JA 5ELXA 2OZEA 3TW8B 1OB5A 1E9DA 3NTUA 1HQCA 3ADDA 4IDHA 4PR0A 1FQKA 2ZRFA 4WVFA 3V9PA 3UG7A 2ZRKA 1TUIA 3GFPA 3QNUA 2WWIA 1P60A 4LJ8A 3NEJA 2AX4A 2B6HA 4Q01A 2RKOA 4A2PA 2WJVA 1KI6B 4M8NE 4RZ2A 4D2IA 1TADA 2XNSA 1KZ7B 3R7WB 5SZJA 2QSZA 3RAPR 1OH5A 1NKSA 2QEQA 3RHFA 1CJVC 1FTSA 4BFTA 1T3HA 2IHYA 3TAUA 2GK7A 3CB4A 3SJBA 1NN0A 2JLUA 1E2GA 2IWRA 2NO9A 2F3RA 4HLDA 4TLCA 1E96A 2EVWX 1R5BA 1VHLA 1XU4A 2VF8A 3FHOA 421PA 5EXPA 4TMZA 1UJ2A 4QGGA 5FTNA 1F2TA 4PC3A 3IO5A 3EC1A 5DH9A 4A8JC 1R0WA 1KSJA 2GXUA 2QPOA 2YZ2A 4A36A 2W58A 3CH4B 2ZRAA 2W0MA 4OQXA 1VG8A 3OEEA 1XTRA 2E9SA 2OEPA 3I8SA 2A9KA 3TQFA 1QG4A 4C0SA 3CF0A 5DGXA 4R2HA 1I4TD 1R4AA 3WYAA 4ACBA 4LPSA 3GEEA 3U4QA 4Z51A 4A8JB 2X2EA 2ZIAA 4TN1A 3G0HA 1JR3A 1Q1QA 1ZD1A 1Q1BA 2KSQA 3A58B 1U8YA 1IAQA 4FINA 2OXCA 4ZKDA 3ETLA 4RZUA 4Q1AA 3J81k 1LB1B 3WNCA 4C0AC 1EFUA 5SZIA 1KO5A 4A0FA 3AVYA 5DE3A 1MABA 4LYJA 5JCZA 2IC5A 3B2EA 4Q1DA 1OFUX 2JEOA 3CIOA 2QGNA 3KJGA 2F3TA 3QKSB 1XD2A 2REXB 3WNBA 3Q7PA 3QXHA 2QZ4A 2JLXA 4AKGA 2XGJA 4HB2A 1TUEA 3OFND 4YDHB 4DEXA 4HZIA 2X8AA 3B8HA 1EFTA 2BCJQ 3R20A 3N2EA 5L8VA 3LLUA 1ESMA 1YVDA 3TVTA 4U5XA 5FBQB 5K8UA 3AV0B 4V02A 3T35A 4LV6A 3K9NA 3T61A 1Z6GA 4DLZA 1TF5A 4DLVA 5BN3A 1E98A 5HKKD 2XOKA 2QORA 4BFUA 2Z6VA 3JVVA 1TL7C 1FFHA 1SZPA 4Y0VA 3TKLA 4IVRA 2AWOA 1V5WA 4QC2A 2EW1A 5AK0A 2FSIA 2R6FA 1P7CA 1NIJA 3TE6A 4NHOA 2O8BA 1YRBA 2A5FA 3MWLA 1D8TA 4EJSC 4GDFA 4X8HA 3AQ4A 2AFIE 1FX0B 4FMCB 1H8EA 2EFDB 1D9XA 2I4IA 3RSLA 1XTJA 4ZPXA 3GJ6A 5M04A 4NH0A 1TX4B 2W0SA 4PPQA 3K8YA 2IS4A 2JCSA 2QTFA 4Q4HA 2NO7A 2QU8A 4B6FA 5KO2A 1ANKA 2D2FA 3VKWA 4EKDA 3AVQA 3H1TA 1E2DA 1NLYA 3P1JA 2DHRA 4BRUA 4Q1CA 3H86A 3L2OB 5E4FA 1IY1A 1OH8A 1U81A 4LYHA 3S1AA 3VNUA 1Z0AA 3AVPA 3CF2A 4EJSB 5CIWA 4PFSA 1VDZA 5EE0A 3I73A 4IFBA 3EA0A 1AM4D 3HR7A 1TNDA 4NYIQ 4CW7A 5C46F 3RRMA 3MRSA 3GLIB 1NRJB 3BE4A 1UKZA 1XMJA 2WM9B 1R5NA 4MRPA 5TDHA 4Q4JB 4TWZA 4ZDIA 4HDCA 1MOZA 1PLKA 1ZCBA 3KTAA 4PQRA 3U6BA 4PHGA 3JZMA 2AHOA 1P2SA 2PMDA 1T91A 3PEUA 3QE0A 5H70A 4YMVA 3KXIA 1J8MF 4O0MA 1Z0DA 1GFIA 3AEZA 4L5BA 3SHFA 1G64A 4URWR 4DC9A 4ERNA 2DYKA 3TGPA 4F93B 2GXAA 1MT0A 4G3XA 4UJ3A 5JLJA 2OCAA 3I4LA 4V0OA 5KOYA 1II0A 3LY5A 5IT5A 3I61A 2CXXA 3WY9A 1ZVQA 1ZIOA 4CEHA 1E2HA 4PANA 3TRFA 1ZNZA 5E7MA 2ONKA 5KDLA 1E3MA 4Q18A 1P9NA 2AWNA 4HUQA 2YV5A 1Z0FA 3FE2A 3VR5A 1X1RA 5E7IA 2HXYA 3V4RA 3AVVA 3FGNA 4JLDA 3PEWA 4GOKA 2EU8A 1E9FA 5EUQB 4D0LB 1NMYA 4HLQB 1QRAA 3RYTC 2CLDX 2OUKA 2XNDD 1YRAA 3SNHA 4URUR 4W7SA 3ASZA 4AWXA 2DB3A 1OXUA 4NCKA 3RRYA 4EFLA 1EGAA 3NWJA 5JRJA 3QF4B 2W6JA 4RCYA 3HPRA 3QEOA 4QHTA 3MMPA 1PUJA 4TMKA 1TF2A 2ZI6A 1DAKA 4AYXA 1TPZA 3ZQJA 4JYBA 2FSHA 1OFHA 4CT5A 3SQXA 3B60A 5DNYB 3ZVMA 4E5UA 1KKLA 4Q5IA 5B58C 4TYYA 3C41J 2B7CA 1W2HA 5KTYA 2ZI9A 3TVDA 1CLUA 4NDZA 3W8NA 5GJWC 1SVSA 2WWWA 2ZUDA 2ZU6A 4IFEA 2XJ4A 3TW4A 2WJYA 2HYDA 1JAIA 2FSFA 2FOLA 2BDTA 3CRMA 3EZ2A 5CDFA 3KQLA 1C1YA 1EFCA 4LBZA 2QI9C 1RJ9A 4P4TA 4GPTA 5A5GA 3G82C 3MSXA 1QBKC 3KL4A 1HT1E 5JEEA 4A92A 2OFXA 2ZJ8A 2VPPA 4WIAA 6Q21A 3UATA 1U90A 2HT1A 3THXB 1KI3A 2VSXA 4TLAA 3GJ4A 1KTVA 2H8KA 3MFYA 3R7WA 2JJ1A 4WAUA 5K8LA 4IXMA 4J0QA 1TEVA 1UBFA 4O2LA 5CM8B 4TL6A 4GNKA 3HWSA 1A2KC 1XTSA 4A1FA 1NN3A 1H65A 1S9DA 2IYYA 3CR8A 4RJLA 5AWFC 5FOSA 4BEJA 4Q03A 1MO3A 3QPVA 1DEKA 1LS1A 1RFLA 3QBVA 4WOPA 2OBNA 3E5HA 1EX7A 1G17A 1H8HD 1GP2A 2YVUA 3ZIAD 3RS7A 5LPNA 3T1VA 3EWAA 3SDZA 5KPDA 2BKUA 1HY3A 1GAJA 2J0UB 1G8YA 4G5OA 2OBMA 2IS6A 2CCKA 3QKRB 5TY0A 1CEEA 1IOZA 1GNPA 2NO1A 4AKIA 1CXZA 4TT3A 4JLOA 3U44B 3AVUA 1N6HA 1TQDA 4M0LA 1IY0A 4A8JA 5A4JA 4TLDA 4ARZB 3ZDQA 1OLOA 2WPDA 1N5IA 3G5UA 3UPUA 1VCMA 1ZNWA 2GNOA 4TTQA 3AF0A 3HDTA 1KI7A 1NLFA 2VP4A 5FPTA 3TR5A 5FPSA 5CDFE 3OZXA 1SXJA 2WKRA 4MYTA 4NCJA 4TL9A 4URZR 3KQHA 1KK3A 1E79A 5FTJA 4JVNA 3ECCA 3TR0A 1MO4A 2PX0A 2VF7A 1Q1ZA 1GL9B 1UADA 2Q9AA 3AGPA 1D6JA 2WJGA 3QKSA 1VCOA 3LAWA 2JIZA 4P0TA 4QHSA 1CTQA 3T34A 3BERA 2VSFA 1JXOA 1E69A 3CR7A 4TQAA 2JLQA 5CK5A 3OHMA 4KJZA 1NY6A 4JJKA 1E0KA 2Q3MA 3P20A 4QGHA 2ZYTX 2OAQ1 2PBRA 3CRVA 4TMVA 4NYIR 5TARA 3I62A 2EWVA 4C0JA 5J4VA 1Z83A 3B1WA 1KSHA 1Z3IX 2WSSA 5FBRB 3LH5A 5KYKA 2CNWD 2J7KA 1E1RD 4TMWA 2DCUA 2WWYA 4OYHA 4OK6A 1W49A 1FX0A 2G9NA 1LVGA 2X1VA 5FTMA 1DAFA 1P61B 2WVJA 3ZS9A 4US2R 2XAUA 3GFOA 3BC1A 1DTSA 1ZD9A 3E1SA 3AUYA 2FA9A 2FF7A 2IWHA 2BEKA 2Z43A 3T1TA 4JS0A 2IXEA 2JLRA 2JJ2D 3TIFA 3SFVA 3DO6A 3BFXA 4NP6A 4JLBA 3OEHA 2FGJA 1HQYE 1P3JA 2FFHA 1NI3A 3SBDA 5F9FA 5SZHB 5FFMA 4EJSA 4QBGB 3CNLA 3QSYA 1EFRA 3BGWA 3K70D 5KNCA 4DLUA 3I5YA 5FL7D 1IJFA 4IW3B 1EFHA 1L8QA 5DI3B 1P72A 2BJVA 3O47A 4BFSA 3L8ZA 3GLIA 3KKPA 4C0HA 1GILA 2B7BA
chains in the Genus database with same CATH superfamily
4BV9A 4TZ6A 3EY9A 4Q4JA 1E77A 4Y2RA 2ZLBA 1X19A 4MKRA 1UANA 3PFHA 1RRKA 5E9QA 3KR1A 1W1UA 2ZYWX 2UVPA 1T0HB 4Z99A 4WK6A 1H6CA 1RBQA 2Z6UA 1YOBA 2WD7A 3OHSX 3EAFA 3A1WA 3EXFB 4JUBA 1QG2A 4OCZA 3TM5A 3EFHA 2G36A 3DDCA 4LK2A 4MCAA 2BMJA 4NE7A 4U3JB 1GO2A 5D3MB 5TGDA 1PE0A 1IBKB 2CXUA 4OMCA 3VV2A 4Q12A 2KMLA 2OT3B 3GCGA 4BIMA 1UMDB 3A9WA 2QMZA 1Z0ZA 1QCDA 5FKJA 1Q0SA 2ILVA 4AP5A 3KS9A 1BDHA 3I9KA 4QXMA 2KW5A 3A9SA 3HCOA 3LQ2A 5TV2A 4OJKA 4HJRA 3RRXA 4LOHA 3AWIA 1ZS9A 2JFGA 2ZSAA 2B8EA 4EITA 5JAMA 1M2GA 5AXAA 2C42A 2AFIB 3AWDA 3WHIA 4X62B 1ADFA 1I5RA 1T2FA 2P3OA 3EHEA 3IPXA 4XR4A 4QHYA 3C6ZA 3GJYA 3AEYA 1Y9JA 5GY7A 5I48A 4QVKA 4X7MA 3OD1A 3OX2A 3H5VA 4GICA 4XWAA 5B3KA 5KC8A 4RTQA 3W2HA 1KZ9A 1FSFA 3SZMA 5ALFA 4NBWA 3AF1A 1KSFX 4HFJA 3LHIA 5H80A 1QHXA 4S1NA 5FNVB 3NFYA 4QUBA 3F2IA 2PX3A 3C70A 2I8AA 4L4ZA 1CUHA 4HNTA 2YIVX 1BHJA 1ARZA 1U5BA 1P2DA 3GLVA 3PXCX 1I7LA 4I4TB 1WCYA 1TW2A 5JT1A 3UUWA 2OSBA 2JIDA 2V1UA 2DMRA 3KD3A 3BRWD 4LBVA 1M74A 2GETA 5CLHA 4D0NA 3FOZA 4F4UA 2R11A 2IPXA 4H7JA 5EQTA 5IHXA 1IG0A 1T1GA 1ZUNB 2ADFA 2GPBA 3O4JA 4ID3A 5ADWA 1KP9A 4HY3A 2EL9A 5IC6A 3GLIE 4F5EA 1MX9A 5BT9A 3CH5A 1AUQA 4HYTA 3CS3A 2GH1A 1V11A 2QGZA 1YHZA 4WN3A 5F2OA 1JE1A 3KB6A 3FX2A 3EZYA 1RI2A 1KU6A 1A0OA 1L5VA 1ZU4A 3L1UA 5H3LA 5IDVA 2H3EA 4MNTA 3U19A 1DADA 4O4HF 1M3SA 2BJHA 4M46A 4PSKA 3DBLB 4EB0A 4BEBA 2OAGA 1YZUA 3FHJA 3I6QA 3L1HA 5G1PA 4E1VA 1VIDA 2A59A 2DVMA 4HFMA 3OTWA 4BJ6A 3RFCA 3WB9A 4UNNA 4DVJA 1E61A 2HTEA 5IJAA 5IRCD 4OM7A 5HEKA 1XCBA 4NNOA 3R41A 2ZDHA 1GKIA 2XA9A 3AF5A 4L4UA 3ZLBA 3H5TA 3DFUA 2W2QA 2JJMA 1J1UA 4G0XA 1QO0D 1D5WA 2C5LA 2RGXA 4JLJA 5B7PA 3THXA 1YKSA 2OFOA 3LXUX 4M54A 4YJ3A 3U3JA 1PQWA 3OIUA 1TAQA 4HGQA 2Q4DA 4GQBA 3IUBA 1JHYA 1IM8A 3HABA 1ZGZA 4H7EA 2KYRA 1ZD5A 3ZDEA 5J2TB 3A0UA 2DX7A 2D00A 1J23A 1YE3A 1XCGB 4MR8B 3DL2A 2NPFA 2QAIA 2GM4A 1B1CA 4GI3A 4MKZA 4PG6A 1JFLA 4H1VA 1GG9A 4XJVA 4DCNA 1WSBA 2B1QA 2HLNA 4KE6A 1YU6A 2K5UA 3NTLA 2NUTB 1H3NA 3K92A 3SBEA 4UVHA 3GYBA 4TS9A 4HH0A 1Z4PX 3ULKA 1R5OA 4C7XA 1W52X 4FZ5A 1T0PA 1HDEA 3MGAA 1P1CA 3G2HA 1GL7A 2DPLA 2QRGA 3OJFA 4R1SA 4G07A 4ANFA 3IHTA 4MS4B 3MINA 3FFBA 3WMRA 4B3TB 4WXMA 5CCDA 2PWPA 2AN4A 1ISGA 3AKDA 1BEUB 4LOKA 1P8JA 3QH4A 3PQ8A 2IW3A 1XHLA 1XZEA 4YJGB 3R3SA 1U2ZA 2MJLA 1HR0B 1B15A 1D8AA 1YS6A 2E4WA 4OBXA 1KJZA 1KHTA 2HWXA 3EW9A 5K2OA 4L7QA 2F1JA 4KQMA 4LCBA 3LT5A 1D7AA 2O7RA 2R1UA 4MQFA 5AW6A 5INTA 1VJDA 2PWAA 2OCYC 1PL7A 3K9BA 2EG9A 5EINA 4XEUA 1DQYA 4CMKA 4CVNA 3D8SA 4JBYA 1ZD4A 2IPNA 2WIKA 3I2KA 4EJ2A 1BXZA 1K8QA 4ID9A 5EMLA 3COYA 2DP4E 4ZDJA 1G55A 1QZ3A 3ZE1B 5K4HA 2IU4A 1XZNA 4GXRA 4ZP1A 1AKVA 1GPH1 5DHTA 2YZGA 1FLDA 1C7QA 1ULHA 5IG2A 3DW3X 1OKKD 1JQEA 3ZE0B 4C3UA 2XTMA 5IPFA 1AA9A 2RMKA 1F4VA 4PLYA 4E5KA 1M34E 2FY8A 3EFOA 3PE3A 4NX2A 5F9HA 1I6KA 1ENOA 3PTLA 1QPBA 2DC1A 5DTRA 5CB4A 1C0EA 1X1CA 2GJ8A 3K0AB 4IDQA 4QTTB 2X0EA 5EJ9A 2HJVA 3IAHA 1GPWB 3AERB 3I8XA 4RC9A 2XUJA 3OZRA 4ZCSA 4AP9A 5EYPB 2I6SA 2ZYIA 5ITSA 1JALA 3HDYA 4L0CA 1RWKA 3B2NA 4FNOA 4PQEA 1YR6A 1ZW1A 3HUFA 4KP7A 3T5MA 5KTKA 1NMSA 1VJCA 2WNHA 4A1OA 3AEQA 4G37A 2QP4A 2AXEA 3B3JA 4Q02A 3R0QA 2EWMA 2QAJA 2OQVA 4CKBB 1EU1A 1R5JA 4I2NA 4IGKA 1Z88A 3H5LA 1ZOSA 2KI5A 4NESA 1KS2A 4DQXA 5IAOA 4UUNA 3FHLA 1EHCA 2XRMA 2ZBRA 3AOGA 4P3OA 2ZTLA 1XVAA 1VECA 4JV5B 5JMPA 1O0CA 1ST3A 4GMXA 3MGBA 3O7WA 1NASA 1GRCA 1ZO8A 5KPJA 1QU2A 3HXTA 1RQLA 2GDJA 4AD8A 1Z2AA 1DAGA 2IUYA 4ZGWA 1VE6A 5CDTA 4WW0A 5DDIP 4PZAA 4TUYF 4I4NA 3IBGA 3ORQA 4H0CA 2YJGA 4YMUA 2BH9A 4NJOA 2I8CA 4F3CA 2RGRA 4R8KA 1F7UA 5DK4A 4E3ZA 1JMVA 2YOFA 2W71A 2DRIA 3IILA 3PXXA 4TYNA 2YOHA 4JSTA 1IHOA 4ZCPA 2XTJA 1HMYA 2NO4A 2EJCA 4MW0A 4IHQA 3C3KA 4IOMA 2VQEB 2QRPA 1A82A 4MKFA 5CCBA 3AVXA 4H31A 3V4SA 3TMKA 2XNDA 3HN7A 2FNAA 7REQA 5KOIA 3TLYA 1DSSG 4KIGA 1KR5A 1A7KA 1E18A 4OUDA 5DX8A 3HM9A 5HBGA 1PDVA 2IZ1A 2QMHA 1B73A 1R4NB 4CV2A 1J00A 1N2BA 3I64A 4IGAA 3ZWPA 1A5BB 3F4BA 4LJAA 1A9PA 1J8QA 4ZQBA 1EVZA 1DZIA 4AO6A 2DR2A 3WYFA 3GAAA 5MGBA 1G20E 2WMDA 1DJMA 1H5QA 3DCNA 3OO1A 4J2OA 1NU6A 3KHSA 2CK3A 1RJEA 2DWUA 1XVUA 4QLOA 1QVWA 3M34A 1JIVA 1OFTA 1CQWA 1ONBA 3M6LA 1NMZA 3DMTC 5C8DA 5FOTA 1TB4A 2AK3A 1G5FA 2XI4A 2IYRA 5JXGA 1JAYA 4H7DA 1VG1A 4CL8A 3PGLA 3ZY6A 4KWTA 5FUXA 5D7NA 3KWMA 1AY0A 2IOHA 3CE6A 4ZVVA 2J3MA 5B36A 4PAMA 2FPMA 4TYPA 3UK7A 4N47A 2E7ZA 3GLUA 4B8YA 4EYQA 4IQFA 4P3NA 1RQPA 1SBNE 3EXEB 3OZCA 5EZSA 2ZYHA 2VL7A 1E1KA 1M75A 2QM7A 1JEJA 1T8RA 3BMNB 3F67A 1K7YA 5K4AA 1B8OA 1L5NA 1YCFA 2AQKA 4IH1A 4U9IS 1R00A 5HK8A 3RV3A 4YQYA 2GI4A 2ZJ2A 5E3HA 1D3AA 4MKXA 2AUNA 2YIDA 4FOSA 1P17A 4K9LA 1L7RA 3PX3A 4O25A 4DR1B 1D0SA 2ZI4A 4KKXB 4WY2A 2VJCA 3OOWA 3OQIA 2RHDA 1J20A 2WTEA 4N1AA 2F9LA 4GW3A 4PX3A 4E1BA 4JI7B 1GG8A 4MV5A 5JW6A 1L9KA 2X6RA 1JF8A 1QO9A 2GBIA 2WVHA 1YKGA 4N40A 1E1QD 4NS4A 3BICA 2HYIC 2FSUA 4UHHA 4X85A 4W6QA 2IYLD 3DBIA 4OP3A 4W5HA 5ERXA 3C3PA 1VLLA 4S04A 3U0BA 5G3YA 1UFOA 2VQSA 4OLFA 3II6X 4MPRA 4POOA 4B3CA 4TKUA 4YCAA 3ZCTA 3LBNA 1PRYA 4GOXA 4OX9Y 1V1MB 3FPLA 3IAAA 4NBTA 3EX7C 2IFTA 2VHJA 1DLIA 3CNOA 4TT8A 1A8HA 4LI3X 2RJ3A 1RCTE 2HMUA 3VTZA 4DNQA 1P7ZA 2PL3A 5P8WA 3D7LA 3PA8A 2V8OA 4II7A 1USKA 1T35A 1XD8A 1FUEA 2BFBB 3E0XA 3N76A 2ZJAA 2SECE 3AMVA 4OHOA 4QGSA 5F7OA 2HSJA 2GJ4A 4MUKA 1KY2A 4BZZA 2MTBA 2F43A 1NG1A 1M0TA 3NBXX 1DPFA 4ZYVA 3FTCA 3AEKB 4J2TA 1V5EA 1W4BA 1OTHA 3M3HA 3SSOA 4ZCTA 1MB4A 1RQ2A 4JEUA 1ND6A 2YICA 5TJHA 1M33A 2ATVA 2ZJ7A 2O0HA 3DT9A 3T7TA 1QVZA 2VHYA 3ZHSA 1J99A 3D3QA 2LPMA 5LWQA 3H0KA 2FYTA 3OCUA 3GPDG 4QAQA 3ZVNA 5AW0A 5JMTA 3R8FA 2FP4B 1AG9A 1ZOIA 3GBVA 3B1KA 4UPEA 3PX7A 1CJTC 3CN9A 2A88A 1PQUA 1JECA 2QG6A 1W4AA 4JL8A 3AVWA 3UOWA 3QEMA 1HEIA 4PIVA 3GP3A 1PHRA 1H2ZA 2XCOA 2P68A 3P32A 1SIWA 5A2QA 2FSSA 5T5QA 2PUDA 2HLPA 3A6JA 1BVUA 1A1SA 3VR0A 4YUZA 1WF3A 3FRHA 3PRYA 3SM3A 4KMSA 1JWLA 1FU8A 3FDXA 2B4YA 2I65A 3FYTA 1KPIA 5FRDA 3L4KA 3L02A 4QUKA 4A5OA 1M2FA 4JROA 4ND7A 2ABWA 2ZRBA 4TLMB 1TE2A 4AROA 4WZAA 1W4ZA 3QLUC 3TLMA 3VZDA 3NH6A 1LPPA 1SAYA 3H2IA 4G1CA 2GRAA 5JPIA 1DWPA 1W94A 1CRWG 3PUXA 4L9RA 3VMFA 3S6JA 1GU1A 3PSAA 4ZCLA 4MK4A 4ARUA 4KXFB 3AGQA 2PR7A 1VLQA 5K8TA 2GA8A 2I0FA 1X94A 2XE8A 5C1BA 3EUEA 3CPJB 1ZEJA 2VXCA 1Z12A 3DKPA 4NE2A 3IE0A 1JKIA 5BXYA 2Q4BA 4H7PA 3QPBA 2ZIZA 4UASA 4ZGBA 1U1CA 1P1KA 2HPHA 2JW5A 2VP9A 3FKSD 4YRTA 5ALLA 4JB3A 3ZYZA 2QRMA 1I7SB 2D7DA 1EE1A 1R16A 4GP6A 4ZI7B 5I7VA 2X8JA 5TVKA 5HFJA 4HD8A 1F48A 1JWAB 1R74A 1U1IA 4NICA 4D26A 3CF6R 3NDJA 2JI4A 5KTOA 4NJEB 1Y6GA 1C1XB 1WD7A 1WPXA 1J42A 3WLMA 1FP6A 1ZDMA 1FS5A 5CDHA 3QMWA 4FFLA 5GZ3A 1JFFB 1GTMA 2QW0X 3BMOA 1KOFA 3GG2A 4LHVA 4WFQA 3OZTA 5AVUA 2EZ8A 1A69A 2XGMA 1NF8A 3HKEA 1SHLA 1U2GA 1JIIA 1QXSA 1RZUA 4NMHA 2W22A 1Z4LA 5ENVA 3ZIUA 4BNVA 4DNXA 2JLWA 1T4CA 3EEYA 2YRWA 3K30A 4WCFA 1NIPA 4LRSB 4MEAA 3GDOA 4ZCQA 5LNK6 1FVFA 1KYYA 4YLGA 3FUXA 2X4GA 2C88A 3X2SA 1C9MA 3HNRA 2O0MA 4I1RA 5E7JA 5FIUA 2Z4SA 3FCOA 3K0FB 2AZMA 2CLLB 5HZGA 2IP4A 1RJWA 2DTEA 2ST1A 4C0BA 2A0XA 4NCXA 5IMBA 1NGSA 3R3JA 4GMGA 3H2KA 5DYTA 1TA9A 2JAPA 1N6LA 1KIAA 3ZWBA 4G9GA 3MLAA 3ZDXB 1QQBA 1J7JA 3R5JA 3ISJA 3WB0A 5FWYB 4RMIA 2IYOA 3FJ1A 2PDAA 3FGPA 1YCHA 2GK4A 1ZG3A 4GMDA 3TX2A 1E1CB 2QXYA 1Z06A 3HA7A 2YWFA 1TAHA 3AYZB 1GFSA 1WP9A 4P33A 3F6SA 3UXEA 1YVPA 2D2IA 4D8VA 5I4IA 1DAIA 1IAVA 1UXIA 5KEIA 2DLCX 4I8DA 4LHZA 2GKSA 4BGDA 4CRWB 3HYRA 2BSAA 3BAFA 4YPVA 2C4KA 5ALWA 2DQ4A 2Q6VA 1KDOA 4DHEA 2IXDA 2VNSA 1AKYA 2X58A 3ACCA 3OQ6A 5KQSA 4E13A 3LPLA 2IV2X 1JEAA 3GQVA 4B3IA 2QNBA 4K6OA 3FVWA 2X41A 1PV2A 2XZDA 2Z0MA 1GPBA 1I1QB 1QG6A 1VPEA 2X5XA 1FYEA 2NZWA 2IELA 3PGKA 1W7AA 2BGNA 4OP1A 4BRZA 3F4LA 1U8ZA 3QA9A 4BLSA 3A6PC 1H42A 1GPNA 3GJTA 4O4LA 3WMEA 2PNJA 1DKUA 3WYEA 2Q8QA 2TRSB 3V4ZA 4Z7JA 4AQDA 4RSGA 2O0KA 4AIRA 2F8LA 4MRMA 3FUWA 3A1TA 2DPMA 4OHUA 1H4TA 4UNQA 1M2VA 3GLRA 5LMNB 2X5JO 1RJFA 3TLJA 3MUEA 4OIMA 3ICQB 3GFGA 4IDAA 3D0QA 2JDIA 4I3GA 4RIIA 3BSWA 4F4HA 3OLVA 3PLAE 2QTVB 1MP0A 2CL0X 3LGXA 4JZKA 1E1MA 4MGIR 1ZA2A 2B34A 3F74A 1O94D 4PE5B 1WZIA 1QFXA 4F4FA 3HR8A 3WK7A 2H92A 1S2NA 2VWPA 4MAMA 4J75A 1EAMA 4QARA 1I9CA 1NDQA 4ITRC 4I1SA 2W5UA 4DCTA 3JVEA 1SC1A 1UM8A 2XLCA 1TMYA 4KXXA 1PFGA 3OCJA 5A0TA 1OMOA 4EY4A 4R68A 1DCKA 1HNNA 1FLVA 1ZL2A 1CZRA 3GFSA 4CEJB 3Q7SA 1N1DA 3PFCA 1I0LA 4DDTA 5K0GA 1AHIA 3NC1C 1Y6QA 2GX6A 2RARA 5E6UA 4ENSA 2OG2A 1XEXB 1O0SA 3A6FA 3VRHA 2QYTA 3DDOA 2M1XA 2HEIA 3G7SA 3JR3A 3F9CA 4MLZA 3P2EA 3X1XA 1E3DA 1A5SB 2XCRB 4ACAA 1O9BA 3W3AA 3CW9A 4AT1A 4BMNA 4LOAA 3AR6A 1L9XA 4OP2A 1CUYA 1QH1A 4R2IA 2H17A 2CMHA 2HPAA 3PZBA 2GQ0A 2I54A 5DFAA 3NQ41 2PJRA 2E89A 3KJFA 1WR8A 1E5LA 1RI4A 3B1YA 3MCAA 3GMDA 3LPNA 4PGGA 1XAIA 4UBOA 2GWHA 1Y34E 4M22A 1GGMA 4N7JA 1EA7A 5UKDA 1XAHA 5JISA 4RD3A 1A9ZA 4FR5A 1JW9B 2JFPA 3VOAA 2R25B 2IY9A 4HN4B 5C8XA 1VKNA 3T15A 2ZYSA 3CUUA 4XQ0A 4B3SB 5KTMA 4KXYA 4ND1A 2UZ3A 2X8WA 5T4EA 5CEFA 4ZAWA 3T5AA 2GF0A 2XE7A 3U48A 1JDVA 2BP7B 3KELA 2P8JA 3R40A 1Z45A 1AGPA 3REFA 2IYWA 5K1ZA 1Y7TA 3RKUA 2ZUSA 3SS7X 2E48A 1O97D 1OTXA 3PENA 1MGPA 1VYUA 3PIRA 3RBVA 2BRUA 2A35A 2V03A 3A4VA 2DBRA 2VEDA 3E9ZA 3EWSA 3DDHA 1HYHA 3L01A 4MWDA 3ZXIA 5HMMA 4I36A 3PXGA 4AICA 1C7JA 1IBRA 2ZOSA 5E2AA 4KPUA 3C0KA 2R751 3H8SA 3GZTB 5J43A 1Z4QA 2ZRJA 1HTTA 3RSOA 3UUGA 5JQGB 3PXUA 4WRRA 3Q12A 3LBHA 2OKGA 2RE8A 1ABFA 5A3SA 3LKZA 3EQ6A 2DWOA 3HU5A 4WXRA 3WSWA 4BP8A 5CDUA 4TWJA 4ESVA 3EIUA 4L08A 4MR7A 2MR5A 1HC7A 5P21A 4BEVA 2WM3A 1TYDE 1L7VC 2GRJA 4BAZA 2SICE 4WZBE 1GU7A 3BORA 3PC7A 3H6HA 4P93A 3I9V6 5DEOA 3UT5A 2BZ1A 4L0DA 5ALUA 1XTBA 4RBNA 2I9KA 1UKEA 4UEWA 2DQYA 5H9WA 5BV7A 3RWBA 1T1SA 2J32A 3GJZA 3AQIA 5BO5A 4D9KA 2A4MA 4CIYA 1C3XA 2ORED 1P0FA 3Q2KA 3WIDA 4ZQHA 2IEIA 1VQ1A 2V58A 3RT1A 3QUAA 4LWZA 2EGHA 3FTNA 3F78A 4E4TA 3ZHVA 4JQOA 2I29A 5BNFA 1N3LA 3AETB 2VLIA 1SBZA 1UCFA 2I62A 4R1TA 4F9TA 2GCNA 5CK4A 4D80A 3KDSE 2UYHA 1ADYA 1NR7A 4HNQA 4IEIA 1Z74A 4KVAA 3A3YA 4LOIA 5D3QA 5B3AA 3THWB 1ZI6A 4LYDA 4ZJZA 1JQKA 1IEXA 3A14A 3QKUA 3C3JA 3EE6A 5A5DA 1U3VA 2J3QA 1B00A 1D0IA 3CJRA 3TUJC 2GK3A 1SG0A 4B80A 4EJ6A 3FPKA 3S55A 2R6DA 2GCOB 2HJGA 3ABSB 2O2YA 4H3VA 5E9WA 3BQMB 3F73A 5THKA 4PM4A 2XLBA 1SFRA 4Q16A 3N0XA 3GIDA 4RLFA 4JI1B 3SX0A 2OO3A 4EHHA 3AG6A 4JENA 2DLNA 3VHQA 1GRNA 1JSLA 2NYVA 1R4ZA 1EXDA 5B4VA 4XYEA 2OM6A 1L1EA 2EYUA 3JASA 2JFBA 5C37A 1XCLA 1QDLB 4ALNA 1Y9DA 2P78A 2IV3A 2GR9A 1ZK4A 3D4NA 4DXDA 1OB2A 1VZ3A 3FZEA 4GLFA 2O05A 3IKVA 2JIOA 2WKQA 3IEKA 4O0LA 4BJ5A 2WYOA 5BYKA 4G01B 3IVAA 1F60A 3GNSA 3UHFA 3MS7A 5AMXA 1O94C 1KDTA 1HPLA 1MR3F 5AI5A 2NVOA 2HSDA 4EDFA 1U7PA 1QHGA 4R31A 3WGOA 2I71A 3LY9A 2FN7A 5JASA 4JQZA 3H97A 4F9EA 2I6UA 3E70C 4YUYA 4N3GA 1QHYA 4QREA 4FJ1A 3RUAA 1WY5A 1UJNA 1RI3A 5DCYA 1ENZA 2IHBA 3LC1O 4O29A 2WOJA 4OHFA 1CUSA 4JMLA 5G1OA 3S3TA 3VR2A 1SB9A 4GZ3A 3SPXA 3TIIA 3K8OE 1RXWA 1A5ZA 1WS6A 1LTHR 3CM0A 3CZ9A 3L7NA 5HE9A 5T41A 5KYXA 3C7DB 4N6GA 3DAGA 3FTFA 5K05A 2FF5A 4IS3A 2CCJA 4IXNA 5D6OA 1OGJA 1WAMA 3KJIA 1FB5A 4EA7A 3IC5A 5T6MA 4S0XA 4CTJA 1JG2A 5EHGA 4AMGA 4S35A 5E6RB 4WKNA 3V7NA 2QUKA 4F4IA 3QOYA 1XG5A 2IF0A 2WTNA 2WUWE 4CU5A 2RHCA 1X1SA 1TEXA 3ZU4A 2OVFA 3W6OA 1EEXB 4NOMA 5I7WA 2AL7A 5JZMA 4EG0A 1HGXA 4Z8YA 1P9RA 2YJ3A 3GP5A 3T5BA 2WSMA 3A6GA 3VA7A 5J2UF 5HQ3A 4DXAA 1CS4C 4EHLA 3AFOA 1HYEA 4G1EB 1AKEA 4FHEA 1JS1X 2HCJB 4LXHA 4ZEVA 1D0VA 2PUWA 3F1KA 3KKQA 4H7HA 4HPJB 4Q4AA 4LWOA 4JOSA 4RELA 2VRCD 3IE1A 2CXSA 1LF5A 4OHCA 2HFKA 1A8UA 4H1UA 4EHKA 3R3HA 1JHMA 1H2XA 1QKKA 1XDZA 2CCGA 5HMLA 4C2BA 3P9SA 2Q5HA 3DEKA 5ERYA 2XQIA 5DBEX 3LKBA 2ATXA 3ASUA 3DXFA 1O97C 2EDCA 5I8PA 3QWAA 2FDXA 3MT9A 1B0UA 3UFXB 2PZKA 3DMGA 5ALZA 2L18A 4Y18A 4KPFC 4YRMA 1BIFA 2PJZA 2QYOA 1JIQA 3EH1A 5L53A 5C5EA 3B1FA 2WJPA 4MJLA 2A0FA 4CF5A 2CDNA 1YJ5A 1ZQ1A 4ITVA 3UJ7A 4X91A 3V97A 2HA5A 3T5CA 3Q8LA 1R6VA 2I80A 5M3BA 2CWWA 2QM3A 3RVMA 4NWIA 1STOA 2D5CA 4XI9A 4KFUA 1CWUA 2FPKA 2YX1A 3A4YA 2ZBDA 4GH5A 1D7OA 1D5CA 2OXTA 3VO1A 4D42A 5TMPA 2IE8A 1NBOA 2YMPA 2OZKA 3VKUA 5ILQA 4RIGA 4P2BA 3SYMA 4RULA 2BELA 5HRAA 5LZ9A 2W11A 2OCKA 5CJ2A 4H17A 1TUGA 2NSJA 3I1JA 1GKUB 1NQWA 121PA 3UF0A 3PI6A 4PSVA 2GAAA 2BMEA 4ABYA 5E1MA 4YAFA 1ORIA 2O4CA 5L95A 4QWWA 3U16A 2X1HA 5CRIA 4GE3A 2WW8A 2P5TB 1MPTA 3AOEC 1ODIA 2VBCA 5B7NA 1SC6A 1PQ4A 2J85A 5AXCA 4X71A 5GOTA 2RB5A 3MAAC 3UK6A 3UK0A 1QBGA 2CVOA 3U7FB 3DG9A 2DY0A 4N5MA 2J6BA 2Q1YA 1E6UA 3ESDA 3ELWA 4PGAA 4EB8A 3GLHA 3ND8A 4KLAA 2WYIA 4WQMA 1IXZA 2QD3A 3TXAA 1I2ZA 2UZIR 5I7UA 1DDIA 2AVNA 2QDKA 2Z1MA 2Z8YA 4PZDA 4Y2XA 4XVHA 4QT4A 4W8OA 1NDHA 4QLBA 2J1LA 3E8XA 2ZI3A 2GPJA 3VNQA 5K0NA 2GBLA 4R6XA 2C9YA 3RFVA 1O0BA 2I5PO 2I6TA 5H1YA 4C3VA 4HSGA 4YQFA 1VE1A 3SJCA 3S2ZA 4MYDA 1XZFA 3ANTA 3SOPA 2F8TA 3RREA 4AY2A 3N3BC 4MARA 4TWBA 3COPA 1QHNA 3C16C 2O50A 4GLOA 2XSZD 1OW3B 3W05A 3O84A 4ARBA 4CLRA 3FGOA 2PJDA 1CY7A 4NR0A 1ETHA 2PX5A 2H1RA 2OLKA 4L8LA 4TSFA 3O1LA 3TFWA 1PLJA 2GEUA 4YJ3F 1VDMA 3NDPA 1KPHA 1ULBA 1RYFA 1N2EA 2XADA 2YXEA 4HMOA 1UQRA 4R8RA 3VV3A 3NUQA 1U0HC 4C0KA 3OEHD 2P5SA 5LP1A 1LXCA 2APJA 2H65A 4YR7A 4M1YA 2EIXA 3W9SA 3OIVA 3KQSA 3M6VA 1AURA 3A9RA 2ZWMA 3G5LA 3L8CA 3EBLA 3MLEA 1QZUA 2Y93A 3DT6A 1JG6A 1FMCA 2OCPA 3IODA 5CT4A 2YNMA 2HJWA 4PG5A 4CKCB 4AY6A 1NRXA 4UUQA 3NYWA 2Q5OA 3URKA 3RAGA 1G5QA 1KKUA 1KO1A 4MUIA 1OX5A 3AUJB 1NBMA 2E5WA 3R3WA 1LFAA 2E18A 4JLSA 1KI1A 4JUIA 1F3OA 4EBBA 2G9QA 1TA0A 2X9LA 3QVXA 4XGIA 3I39X 4U7WA 4ZAGA 4CT4B 1ILEA 4FT2A 4MP3A 2QROA 1GAEO 3TSOA 3LXMA 2W4IA 4IHJA 3H6GA 2HNKA 3IJ5A 4KLNA 4Z9BA 3QF7A 1QH9A 2Y1OA 1ZM7A 2R5NA 2Z5FA 2C2XA 3PDJA 1NZFA 1G5RA 4Z1MD 3W6PA 3WAJA 4MKHA 1DRKA 1LPSA 3QBEA 3EGXA 2IZ7A 2C82A 1E7SA 3I1IA 1Q21A 2IF2A 3GN1A 4TRMA 4Y6OA 5CAEB 4YYZA 4DVGA 2P6RA 1ESZA 4WECA 2BGLA 4K7JA 2CBZA 1TQ6A 1UPFA 2CHEA 3E5MA 3LPDA 3QPCA 5DX0A 5EJ2A 2H5EA 4A8TA 3ZC3A 5AM3A 4HXYA 5JNTA 3UICA 4P4NA 5G4KB 4QM7A 2OESA 4Q7KA 1PV1A 4K0RA 2BCGY 4I9GA 5EIBD 1Q44A 3A31A 1BMFA 3I2HA 4OQMA 1F4PA 1R18A 2J5XA 3NHWA 4L75A 3GH3A 1RZRD 1PJZA 1KU0A 2WM2A 5A1JA 1R8JA 1Y8RA 1YA6A 3IXQA 2QE6A 5BV1A 4BE7B 2E4ZA 4UDXX 1V3VA 1IPHA 2Q4TA 4IGIA 1LH0A 4JJ8A 3BJZA 4GUDA 3D6JA 1HURA 5TPZA 3CCBA 3OEWA 3ZHCA 1ID8A 4LNHA 4HDSA 4ZODA 3M3PA 1VL8A 2NVUB 1C9JA 1NULA 1W5TA 1RHMA 1ZJJA 3A10A 2E4YA 4P81A 3ZWDA 2VHQA 1CS0A 5BN4A 5CB4F 4PU0A 4LUCA 2NYAA 4F6RA 3J81A 2HMWA 2BBTA 3SR3A 3W8RA 4MW4A 1X7ZA 4QD3A 4PTLA 1WHSA 3QUTA 1TECE 3DDWA 5BOSA 3VPAA 3ZNPA 2FFAA 3Q9NA 1DNPA 1S6YA 2UDPA 3VPGA 2OZLB 4WZBB 3A1NA 2PL9A 4KC0A 5EP4A 1Y63A 3B9QA 2D6FA 2UXBB 2ZWOA 3VAYA 2DERA 3S7TA 3K4PA 4FW8A 2DWQA 3Q2OA 3PYXA 1TTPB 4OYYA 5DW0A 1P2UA 3UY4A 1UK8A 2IPOA 3PL1A 1EFVA 221PA 1EB8A 2KQUA 1UP4A 2WWXA 4GPZA 4Q7JB 4YRDA 2ECQA 4FMBB 4L6IA 1M7BA 2WOOA 2OV1A 4X54A 4WACA 3TGWA 2XXAB 1MTZA 2R87A 4LTMA 2YIJA 5JS8A 1HH4A 2H0RA 3G7UA 3U3MA 2BDUA 1MO2A 2QTWB 4LC0A 4V0MA 2LBPA 2OGZA 1KJYA 3M1LA 4WI1A 3RF6A 3V34A 3C7KA 1H5UA 1QYIA 1S2IA 2H9AA 1HRKA 1CDZA 3BH0A 3M70A 4OHPA 3TRDA 2AQHA 4PLFA 2H4WA 4J3FA 4MI9A 3JQEA 3Q10A 3PUZA 3SKXA 3T06B 1ORDA 3ND5A 4D8YA 4CMIB 1ZSVA 4J1QA 4UDNA 1K5HA 1SELA 1XE3A 2O3QA 1BSVA 2OORA 3L41A 4EM6A 2GAFA 4HLUA 4BP1A 3PC8C 2NSYA 4GI7A 1V9LA 4PC7A 4LBYA 3SXJA 1GG2A 2HQSA 2HSGA 3ZG6A 3AM1A 3SIXA 3ZLJA 3V48A 1GQRA 3PSHA 3QSGA 3LY7A 5ECYA 5JWHA 4RSMA 1N36B 3ROZA 1Z7BA 3MUOA 1BC5A 2BI4A 3CE9A 3WS7A 4QYIB 1QGUA 4H1WA 1F6DA 2QMEA 4MWGA 3EXIB 3T9DA 4RKFA 4MVJA 3NC4A 4K2HA 1ORRA 1UT5A 1ZN8A 4QELA 4G0YA 2WABA 2WICA 2ZJOA 3IXMA 2AG6A 3QFFA 4OKIA 4WH0A 4DJTA 1G3UA 2CNOA 3ADDA 1W4RA 1YMUA 2JZNA 1UDRA 1M1YE 2O1SA 2ZRGA 1EVYA 1H4VB 3CFYA 4IM7A 3ZGZA 5M7EA 2LWIA 4XKJA 3CEAA 2BGRA 3WV5A 1JYFA 2X76A 3CLRC 5J5VA 4TL8A 3NIGB 1IUKA 3RJTA 1KMMA 4QA9A 1ZU5A 3CINA 1AMOA 2W93A 1SUPA 2Q0XA 3BRSA 5JI2E 5ALOA 1DC3A 2NZJA 2EOAA 2HXSA 3O82A 4RVFA 4XIFA 2PKQP 1PJSA 1DRUA 2EERA 2QGFA 1LY1A 3CF4A 1ZVJA 2F6RA 3BIJA 3KOWA 1T1JA 1WOMA 2FW6A 4BB0A 3MOGA 2AC2A 1Z2NX 5LC1A 3VAAA 4DLPA 2IY8A 2QVZX 3GEBA 4MMZB 1VHWA 4R7TA 4U2FA 4CI0B 3CW8X 3A27A 1M76A 3ASYA 4MW6A 3T41A 3RDPA 1DUSA 4JUAA 1RPZA 3EOBI 1H05A 1WB5A 2O6LA 3HBAA 4CM3A 1JHAA 4FN5A 1E1RA 4R4JA 5C3UA 1JR2A 4WSOA 3WJ2A 2XECA 1BXKA 1GU0A 4LFCB 2P9FA 3TUZC 4F2GA 1OBOA 4D0GA 1W5FA 1T5TA 3BD7A 1D2EA 2IQIA 1TK2A 1ESNA 5KNDD 3GLFA 3L82B 1SOUA 1AGYA 4MJXA 5AJTA 3W6UA 5BR8B 1GNTA 1SVUA 1U28C 4IIVA 4P31A 3RU9A 1XTQA 3EZ7A 5AVXA 5LMCA 4I2VA 1ZNXA 3R9IA 1ZONA 1W34A 4YO8A 1GLGA 3VM6A 1LTKA 2CNLA 3ND6A 2IITA 1EUDA 3EDYA 2WYVA 1GTZA 1JR3E 3L43A 3NHFA 5AJYA 2FH5B 4QG7A 1V6CA 2ZAYA 5ALEA 1E9CA 4OGWA 4G4IA 1WV0A 3ONEA 5E4YA 3HP1A 1KDRA 3VPFA 4IHKA 3VR1A 4EUFA 4GHWA 4LDAA 4TQUS 1NDUA 4V3CA 5EIBC 4KVGA 4AJ4A 4GRAA 4C05A 5C32A 2C2WA 3EVZA 3ZI0A 5CDYA 2V3WA 3ITEA 5DOZA 4F12A 3OZWA 4KQ6A 4YMSA 1L2TA 2UVPB 1RDFA 4KR2A 2WV9A 4N49A 1ZLXA 2NSLA 2Y4NA 2WD7B 4DUPA 2JFZA 3SLGA 4BX2A 4ENVA 4M7RA 2FZGA 3A1DA 4F9GA 3P0HA 3W2IA 1T1EA 5GWXA 4U0KA 3HUUA 1IU9A 3H8VA 1VGVA 4GXQA 5EP1A 2ZITA 3UWPA 3MAJA 5DO9A 2XAAA 2QVGA 4DREA 1X6VA 2W2LD 1GTRA 3CBGA 4DWVA 4C7MA 3DOJA 1JQBA 3RH0A 2FHSA 2YRFA 3A9CA 5JYCA 1NVBA 2R8OA 5JSHA 2ZRNA 1CT9A 1FNNA 2GJSA 2REOA 2MU1A 1BD4A 1L4FA 3HYNA 1ODLA 5L45A 3T0FA 4W4TA 3AY7A 4N5NA 4URYR 4OLAA 1Y1PA 3MAGA 1CJMA 2AX3A 4GVPA 2OLJA 4O2RA 4O8ZA 4EVIA 4LJRA 4W5WA 4KDCA 3MRXA 1YZGA 2P4EA 4UUAA 4MPTA 1J8FA 3AB7A 1SQ5A 3BFVA 2OWDA 2BM9A 4QRIA 3D0KA 4E7OA 5G40A 5A4IS 1NUPA 5HVNA 3HWWA 3PFWO 2NIPA 3HZOA 2SHKA 1E4VA 3H4IA 2NZVG 4BNUA 1Z17A 5BSRA 5HFNA 2RK3A 2C8LA 2JGIA 1G5TA 3OU7A 3DVLA 1RQGA 1EFPA 3E9MA 4LRYA 4Z9XA 1Y37A 3DNFA 3MRTA 5KIAA 1ZN2A 1DBIA 4AKHA 3EVGA 3LX4A 3LFUA 4FYPA 3H2SA 2ZRCA 4JN6B 4LC9A 4PLPA 4KQKA 1I5OA 2XKJE 2QMYA 4HDOB 2YOGA 4KYUA 4UU8A 5E1DA 4GLJA 4UTRA 2ODQA 4W1RA 3WTBA 2RAUA 2UYCA 1VMKA 3ISTA 1YZYA 4KO8A 3T8YA 3W78A 2BGGA 3SFZA 1U0EA 4AJEA 5CP8A 1JVSA 2ZBQA 3MFQA 2FE4A 4CQMD 4ZRNA 1YUMA 5AVYA 4H2DA 4LY9A 4CMEA 4LF9B 1X7YA 1RQRA 1PS8A 4G56A 4IDOA 1GIAA 2QVBA 4JELA 2C4WA 1S3IA 1OX4A 3JRWA 3PQ3A 1T2CA 3DTNA 3RSSA 4JKOA 1EVJA 5ENZA 3V9AA 2YMQA