4KPEC

Novel fluoroquinolones in complex with topoisomerase iv from s. pneumoniae and e-site g-gate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
208
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/inhibitor
total genus 56
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kpeC00
1BGWA 3QX3A 3FOFC 4G0WA 2XCRB 4FM9A 3L4KA 1BJTA 2XKKA 3RAFC 3RADC 3K9FC 4KPEC 3RAEC 3LTNC 4Z4QA 2XCSB 4G0VA 4KPFC 2RGRA 3FOEC 3L4JA 5EIXA 4Z3OA 3KSAC 4Z53A 2XCQA 4J3NA 2XCTB 2XKJE 3KSBC 4G0UA 4I3HA 4KOEC 2XCOA
chains in the Genus database with same CATH superfamily
3G7NA 2P9HA 2X8LA 2ZZNA 1XF9A 1WUTA 2O3TA 2V54A 5FNVF 5AW4A 1OZFA 3O26A 5AOAA 1B8VA 1FZQA 5DRTA 4YV7A 5E8JA 1XZJA 2CLHB 3INYA 3DMDA 4ZVLA 3BJZA 5GJVC 1K8RA 4L9AA 2PJUA 5EMJA 2JCSA 3RQSA 4CM4B 5ITZA 5IWCA 4A15A 1YCHA 3G2QA 1VFPA 4CU2A 3ZWWA 3QU2A 4DLPA 5I7WA 2Y4OA 3G7UA 5DX0A 2HJGA 2PUJA 4IIXA 4X45A 4EVRA 1NJFA 1ICIA 1RHQA 1VGQA 1ZI6A 2VNKA 1HDXA 2YV4A 3DOEA 3FDZB 1SXQA 1N2ZA 1ZC3A 3PICA 5AVVA 1EFAA 3HADA 5CM2Z 2QN2A 1YA8A 2YQ5A 3ZOZA 2I7DA 2QSUA 4X7PA 1DKOA 1I3KA 3OIYA 1PZHA 4GDFA 4UE2A 1FSGA 2JBHA 3FKSA 3R7WA 3QXJA 1U81A 3ZVRA 4C5CA 3R2JA 4Z7QB 2DPHA 3QOYA 3ZXUB 2BPOA 1E1RD 2EHDA 3ZHVA 2H11A 4HXFB 2HCFA 4YHBA 3JWIA 2R8PA 2PL5A 4ZVQA 5GQSA 2BUCA 1A4IA 1J8VA 4W1RA 2WHPA 1RJGA 3AWDA 3DKPA 4NPCA 5CK5A 5IVHA 4D0GA 5LM3A 4CKBB 3FRJA 3OAAA 3P9CA 2JG3A 3U49A 3IEMA 3LP8A 3DBRB 2RGCA 2QN3A 3M82A 16PKA 1ZU5A 2F62A 4R2XA 3FOBA 5DHTA 5GJWC 3RRNA 1L7RA 4PYKA 2YCBA 3DPSA 2GA9A 1A72A 1OTYA 3I4FA 2ZROA 4WI1A 1Q11A 5CYOA 2GCGA 2YXNA 2J3JA 2FX2A 2BLNA 4CLEA 2BDEA 2X77A 3K73O 5EWMB 3PXEA 1DJOA 3I01M 1E7QA 4PRKA 3DE3X 3ND7A 2NZUG 3JPYA 4X71A 3LBIA 1INLA 1Q20A 1VBNA 1VC2A 2I2BA 3LQFA 3JYPA 1RQRA 3PX2A 1QZUA 1QWSA 4JXKA 1A4UA 1UH5A 1HK7A 1XPJA 2QSZA 1Q1BA 3R4VA 2ISCA 1K86A 2PX6A 5FWAA 1CQXA 4HF7A 1FYFA 2R6DA 1PZXA 4AZVA 5BSFA 3LT4A 1CYDA 1PJCA 3RKRA 3X1YA 1FSPA 3D8HA 4HWKA 1G3QA 3GZNB 3GQBA 1Z5NA 3D1VA 2D0OB 3IQEA 2Z3WA 2GJAA 1XWWA 1W46A 2C98A 2C8JA 3FFWA 2C2OA 4Z8YA 1T1GA 3S68A 5F9FA 4AKEA 3F8TA 3N9IA 4GGMX 1N0WA 3MD9A 4ITUA 2NPFA 3GLGA 2WWXA 4B6JA 4RK6A 5MN5A 2ZS7A 4KPUA 5I9MA 1ABEA 3EG5A 2ZIXA 2YFQA 2DWOA 4MQMA 4Z7NB 3KEMA 3ETDA 1U3WA 3L18A 3ZCRA 1CZOA 4QD3A 5IPFA 2WPDD 4OOEA 1HR0B 4HZGA 3WK6A 3L8ZA 4MS4B 1FDWA 3VV2A 4KXFB 5BWLA 3ZX5A 2XT9A 3CEAA 4BJ6A 5JH7A 1CUIA 2AFHB 2ECFA 2ZVDA 4JP5A 4RORA 5A5FA 4DMKA 1BD3A 4J1TA 3GAFA 4JQSA 2H1HA 4JLWA 6NULA 4M87A 1LFDB 4J3NA 4MAMA 2XXAA 4WNAB 1NJ6A 3CRZA 2ECPA 5I5EA 2I0FA 4RV4A 1KJ8A 4FGSA 2PWYA 2CVFA 2PX5A 4L08A 1BGXT 3V8MA 1YULA 1F2UA 2XE7A 2WUVA 1A8SA 2AJCA 2X86A 3TNDA 5IASA 2GTIA 4OREX 3N75A 3WK7A 3LSTA 4J49A 2AC2A 3K6SB 3KP1A 1OD6A 4OATA 1D9XA 1AUVA 3N86A 1JR3E 2ZQZA 5D6OA 3T5BA 3QUAA 4X92A 2A5GA 4UZFA 4C4YA 3WNVA 4QAJA 4R9NA 2W2XA 3EZNA 1JNXX 4JUIA 2KBEA 4Q3LA 4PAGA 4ZEVA 1TCVA 1N57A 1YIAA 3AWIA 5I7RA 4BZWA 1T8WA 2JGAA 4NBNA 3LUKA 3T9CA 3GRCA 3QVGB 4R98A 4KQ6A 5DW3A 4NCAA 4CG3A 3M1LA 3CS3A 2VWGA 1ZQ1A 4BLQA 2CJYA 3MRSA 4U9UA 3K0FA 3QEOA 2ET6A 1A9SA 1PGNA 4P3OA 4AWAA 1T9KA 5IVIA 3WQHA 4HGRA 4JU8A 4M54A 3PFGA 1SCAA 3MINA 1GGNA 2GVNA 3STXA 5LBTA 2VBFA 3KL4A 4AIIA 3AU9A 3WL4A 4O2BF 4DDVA 2AEJA 5J1TB 5KJ6A 4E5DA 5J2UA 3EX7C 3AEQB 4AQ7A 1GUAA 1UT5A 1UODA 1Z7BA 2RCYA 1POXA 1PYOA 5EHNA 5BQOA 2P11A 3VM6A 3DBLA 1PT8A 3S2ZA 4P8RA 2PA3A 1RWOA 4WXPA 1M7HA 1UFQA 3ACCA 3A6GA 4QNMA 2IU0A 1Q7RA 3LRPA 1MBZA 2YJ3A 2JAPA 4R2IA 2OB1A 1HLDA 2XLBA 3NCHA 2Q6VA 4IIHA 4PLCA 1D4ZA 1SUBA 2MSEB 4OI2A 1L1EA 3WB0A 2NZWA 4AM8A 5JXWA 2UUCB 2DC1A 1MABA 2MT9A 2VQFB 3B6IA 4C0JA 1G3RA 3BYZA 4ZV9A 1U0EA 2RGBA 4G0ZA 3WLPA 2D1FA 2P1DA 1NRJB 4Q4HB 4X3CA 3BCRA 3CW2A 4N39A 4MRRA 4MVJF 3ZKWA 2AZXA 1DKMA 4ZOLF 2AIRA 4MSUA 3OJOA 3ZJ5A 1QH8B 3CQ9A 1UAGA 1KH3A 3VU8A 5KTPA 4IIEA 5LC1A 2JFOA 4ZC1A 3C98A 2HA5A 1HRDA 4GKKB 5AJYA 4ISBA 3O73A 2GFQA 4YUZA 1HNXB 3CRW1 3D6HA 4TMFA 1PO7A 4CHGA 2VHCA 1DO2A 2GBLA 1NJ2A 4Y9SA 4EQ6B 4YR9A 2WHQA 5ALGA 4EBFA 4RTSA 4QRHA 3U48A 3HN2A 3I1JA 3LPLA 4FDUA 4OB7A 4BGIA 4F4CA 2POCA 3L4BA 4YRDA 1DXYA 3TRIA 4ZK6A 1VI6A 3IKLA 3UW3A 1PKEA 1E4OA 1UC4B 3BE8A 1QS0B 4W1SA 4R9VA 3MCZA 4Q3AA 3WLTA 2W6CX 1XVUA 3RC1A 4FFOA 4DPKA 2OMEA 5H4HA 4L76A 3D4BA 5IDQA 5BN4A 5B30A 4JJIA 1TPYA 2FAXA 3BD9A 4H59A 5IVDA 2C8VA 1SQ5A 1B74A 2X19A 3H99A 3I2YX 3KZXA 5EIBC 3QQ5A 1YE5A 2QVZX 1TM4E 1LBSA 3S1SA 3OBIA 3ZQKA 1PJ4A 4E1AA 4CEHA 1SD2A 1AHPA 3N2GB 4IIJB 3E2MA 3U44A 3GLIB 2Q7OE 1R7RA 1OAOA 2BLLA 1G2OA 1SBHA 4XUCA 2P40A 4MAFA 4MKGA 2AVNA 4A0FA 4QT4A 5EUMA 2XVAA 4J94A 3LBHA 1NMEA 3QMMA 3BB1A 3IR5A 5BSTA 1NKVA 1RHMA 4RZHA 3WMFA 4D97A 3COWA 4XCQA 2J3LA 4ICIA 3KVRA 2IPXA 4HDCA 1EXNA 5L3VA 1Z4IA 2OXIA 3FBTA 1H23A 1XRMA 1TF2A 2XE6A 4QDJA 3GPDG 4PAQA 4X0EA 5I9LA 3RS5A 2YVUA 2W2TA 1KKUA 4OMFG 4ZQFA 4YAOA 3DFFA 1G8KA 5JYEA 3UHAA 2N75A 3RYFB 1B0ZA 1MHPA 2VJLA 3S2GA 4P33A 3SR3A 2XRZA 3DLAA 4K8RB 1XR3A 4WVFA 1E69A 4KK4A 3M49A 1FS6A 1T9GS 1FUKA 3S2UA 4IF4A 4N18A 4OJKA 5FOUA 2RC5A 2QMUA 3OQOA 4EG0A 5FOWA 4PO9A 3QE9Y 2W6MA 3G13A 2ZPAA 3TAXA 4Z4EA 4MVCA 5FPTA 1BDJA 2BBWA 2VUUA 4Y9TA 4CEIB 2B4KA 4ALLA 4EJ0A 2A84A 1MJGA 2J09A 3A9RA 4G1EB 4B8YA 1VA5A 3JARA 3IKVA 1N1MA 2C3PA 5GZ3A 4I55B 2I3DA 1SUAA 2QRLA 1CUFA 4J6EA 4B35A 4BNMA 1OUMA 2ZT6A 1IAVA 1TZJA 3LC2O 4IUCS 2M1ZA 4CRWB 2JNWA 3ADKA 4I8IA 3P20A 1TYEB 3K5HA 4YJGA 2WMDA 1KYYA 2AMYA 1U1GA 5EHIA 4BWYA 4D92A 3IFSA 4D9HA 1EGMB 3AUJB 5A4AA 4FLFA 1FYDA 5C7LO 4IDNA 2RI6A 3MGAA 1J2UA 4LXTA 3KDSE 4JB8A 1VE1A 3HUUA 4BIIA 1JHVA 3EMBA 3LK6A 4RXMA 4YRAA 5IWAB 2XQVA 2IOFA 5ELLA 3M2PA 5J58A 2NO9A 2FETA 4IXWA 1COWA 1WU8A 3SIXA 1ISHA 1CUCA 1GRNA 2B37A 4LRTB 3A9UA 2X14A 3DTTA 5IXSA 1C0EA 4H18A 4AZWA 2GQ0A 2Y77A 2I9KA 1GQRA 2A2ZA 2FY8A 3N6XA 4I50A 1EVJA 2NPIA 3FN4A 5CDUA 4MV0A 1GVHA 3K9HA 1QHXA 2VDMB 3A58B 4RVDA 3O0TA 2G36A 2HV9A 2BGJA 3OQVA 1EX1A 5AVSA 3FPEA 2ES4A 1FNBA 4QFDA 4RH0A 2QPOA 4F3RA 2PM8A 4ENQA 2JGRA 4LZJA 4OD0A 1B8OA 2WE7A 3M6VA 2BKAA 3UKDA 2Z8ZA 3H83A 4CQLB 1P75A 3FHLA 5CNJA 1U2PA 2ODBA 5JSZB 2YC2C 3DNFA 1CXZA 1C3OB 4DB4A 2O8NA 2OBBA 3G5AA 3F96A 5A4DA 2ZJ5A 3UAOA 4BLWA 3ET4A 1Z4PX 3PUIA 3RRZA 3RS9A 2HKIA 1ZRHA 3NC0C 3LCUA 3TCKA 4BL5A 1K0FA 3RYHA 5D3MB 1CWUA 1JALA 2YFHA 2V74B 2R4TA 3CC8A 4YN3A 1MC1A 5AW5A 4YCLA 4EY3A 3AVUA 2AD1A 4IR7A 4F38A 3E8SA 1CQJA 5EJ8A 1WRBA 4CT5A 1TA4A 3MUEA 3DCIA 3QA9A 3USES 1ZCZA 3H5IA 1BE8A 4N6OA 3GLFE 5I7OA 1TX4B 2A1TS 3RCBA 1PLLA 2CEKA 2D4AA 4G5OA 4AMUA 1GUYA 5DCYA 3PEVA 5AM3A 1I94B 4XPIA 1PLJA 5DV9A 4IFTA 2CT8A 1AMUA 1OI2A 2VHEA 3G02A 2G1JA 1PTJA 2OXRA 1S4QA 3I61A 1NSFA 1YAHA 2A5FA 1CR2A 2RAVA 3NEYA 3W2IA 1X8KA 1VJRA 1IEXA 2BTQB 2V65A 5T8KC 3SOPA 4AO6A 4Q3KA 4YJKA 3SYTA 4F5EA 4WESB 3VJMA 1SKBA 1OYYA 1XLVA 2WJZB 2GX6A 4L07A 4NCNA 4GS5A 1ZH0A 3LX5A 3WK8A 1L1QA 1BA3A 3EIEA 4HUJA 1IBSA 2DPLA 1FBTA 1TMOA 3JW8A 2HLNA 3C8ZA 3R7SA 3HYNA 2J9ZB 2XYRA 4MVJP 3GLQA 2IP2A 4NS1A 2O1EA 4KR3A 5B12A 4JJAA 3R5SA 3WP1B 3LYAA 1AS3A 1R9MA 1SVSA 2B83A 2Y3IA 4EKDA 2QV0A 4D7AA 1ENPA 4RXUA 3R9XB 1W44A 2WUFA 3W2TA 2AQHA 3VJKA 2ZWAA 1U80A 2VK8A 3M81A 4JR1A 5JCXA 3OLZA 4TMXA 3MELA 3FMFA 3A6EA 4GNRA 5JAPA 3VSEA 1FC0A 4W7SA 1NX9A 2F00A 1MIOB 1X77A 4BUZA 3M9WA 4E2XA 3VH4A 3VYWA 2XOKD 1XDDA 3SIPA 1II0A 4NAUA 3FGZA 1N9GA 2ERYA 3M6XA 4R2MA 5DJ5A 1YASA 5CT8A 4ZD6A 4A8JB 4Q1CA 4B4WA 5F33A 5LZ9A 4BUJA 4P3YA 2OFXA 5JYCA 4F3CA 1Q0ZA 5ARDA 4KE7A 1CZKA 1N4DA 2DFNA 3G79A 4QO8A 3EZ6A 3ZGVA 3ZR4B 3MQ2A 1X9GA 4AZ3A 1YBFA 2R1TA 1N5JA 2HU5A 1UK8A 5LN1A 2WILA 2OM2A 1PTKA 1LV8A 4DIMA 1TEVA 1YDWA 3EDYA 3OZFA 3GJ8A 1GIAA 1WDLA 4LYGA 5G3YA 2Y2UA 4QEDA 4WADA 4F92B 1J33A 4WSOA 3U3DA 2Q6KA 2TSYB 5BVHB 1C1YA 4MCHA 5J4KA 4XW2A 4AJ4A 2IZ7A 1V47A 3FJ1A 3KK0A 4MR7A 4R2JA 2CHGA 3AR4A 3LOPA 3WLSA 4X3PA 4EB3A 3COSA 5I7SA 5JECA 1C0IA 4FCVA 5DIFA 4MPRA 5AM5A 2QPLA 4F6CA 5KYTA 5BN3B 5JJCA 4YP7A 1RZUA 4MA0A 3KYCA 3THYA 1H0RA 2HL6A 4PQRA 5DULA 1XTBA 1XWFA 4GVXA 4UFPA 2NXCA 4WK6A 3L7MA 1EX6A 3MHPA 2JLQA 3QUSA 1NE7A 1ONNA 2R2GA 3EIUA 4D5GA 1KF0A 1LJUA 2QENA 1J8FA 4RSRA 5DTEA 5E3JA 4ENVA 3RSOA 3CCBA 4KLCA 1V5EA 4D1YA 1DBSA 4EL5A 3QYFA 3AB8A 2H1SA 1Y1PA 3ASUA 3LCJA 3BCUA 4ZZ2A 4BJHB 3CPHA 1ORWA 3GT7A 3JYOA 4MVJH 1YU6A 1O58A 3FTQA 2FJPA 2OFPA 1TO1E 4XVQA 3PNVA 4J0HA 1R12A 1U1DA 3STVA 3U39A 3UUFA 2GEBA 4YAKA 3RVDA 2X9VA 2CHEA 1G8YA 2OCLA 3NVAA 3CBQA 4RSGA 4HWSA 2DH5A 2WA1A 3NHRA 4CKWB 1M0WA 2VAPA 2B1QA 2VP5A 5EE1A 1W19A 1T8TA 4MDFA 4O4HB 4P36A 5JPIA 3GRPA 5KOIA 4WOPA 2JH9A 1DQNA 3B7WA 4WZAA 2ONZA 2QX8A 4UBOA 5LUAA 4AUNA 2XA9A 4EITA 4FNMA 4H2DA 2W2PA 3E03A 5ENZA 4CUZA 5MF6A 4B9EA 4YJ2F 1QIDA 1AJEA 5C7OO 3MOIA 2XSZA 2BHLA 1Z2AA 4RHFA 4O4LA 1SXJC 2RK4A 1N0VC 2BFCB 3U3RA 3QU5A 3GT3A 2QRUA 3MWDA 4NEGA 2YXBA 4MQ5A 4X8LA 4XDHA 3IBCA 3RSFA 3EVGA 2OLJA 3JZMA 3R0QA 1IDN1 4FJ2A 1IXKA 4EI8A 4DV3B 1JEYA 2ANBA 2WJWA 4RCYA 5HP4A 1NNSA 3KYBA 2IF0A 4GI5A 1C50A 3AFIA 3NIBA 3QI2A 4F5ZA 2I87A 5JJ5A 5JNRA 4BNDA 1R6DA 2OK8A 3KJXA 2ZUBA 2PAFA 2XUPA 3GFQA 1ZVVA 3U3MA 2XAAA 3KJIA 1O97C 4B34A 5JJIA 1GGKA 1EMDA 1WEHA 1T3SA 2I78A 3EJ6A 4UUBA 4MWBA 4V0OA 2RHJA 1P3Y1 3AYZB 4U3JA 4WQMA 2GERA 4FYHA 1G55A 1JEQB 2GCOB 2QAGB 2YQZA 4FC7A 4HVAA 4R7ZA 4RPGA 4RW0A 4DMFA 5JZOA 3KQUA 2XCUA 4AN0A 2ZI7A 1GZHB 1QE3A 4MIYA 4PV7A 4FR2A 3WHIA 2ZJBA 3GNLA 5I01A 3IC5A 2GZDA 1WZIA 4X1KB 3QKRA 1WP9A 4AO7A 3EEYA 4PICA 4FIDA 2H52A 3VNSA 2E3JA 2FZGA 4GX5A 4TUYA 4C07A 5TEWA 5L3SA 5J2TF 5B57C 4KDFA 1RLUA 1SVIA 3P9XA 3GB9A 3QQPA 4TVSA 2OQRA 3WGJA 4ZTZB 3VHRA 1U0SY 4JBGA 4C0XA 1XZ8A 3IT0A 5ALLA 3JD4A 3OPYI 1ZGGA 3KZKA 4G1FA 2QW0X 1W4CA 1M1XB 2WJVA 3K30A 2YVAA 3PHIA 4OKIA 4QTUB 2A9QA 3PUYA 3QTTA 4WA7A 3ZWQA 3NHAA 1ZK0A 4KXWA 1QQ5A 1XAHA 3TUZC 4DR7B 2Y0EA 4JC8A 5I7VA 5H3LA 1NV9A 1T5SA 1W88B 2VNJA 1PL6A 3DAPA 3WGQA 2O8DB 3HEAA 4MI9A 1QCYA 1XT6A 4FSDA 3DBHA 2OP0A 4MB6A 3IQHX 3K0CA 1L5SA 1CUJA 3LUGA 1YCGA 3B5IA 2GN1A 3CMMA 1LZLA 1AA6A 1K63A 4ZOEA 5JFGA 3GARA 3L8HA 4FDVA 2AXQA 2ODWA 5KTMA 2JKYA 2ZRJA 3GJRA 4H9GA 3MIIA 2HC9A 2PR7A 4QPNA 1Y8QB 1ZJYA 1FJHA 4W8HA 2N46A 3QA3E 2G63A 1ACJA 4RKFA 5KSYA 3H5RA 1WWKA 2EKQA 1HSOA 1MF7A 2B5WA 5LXTA 2R00C 3QPVA 3PIDA 2C1ZA 2NT4A 3EXEA 4GH5A 4YBRA 1YDFA 5AI0A 3THSA 5CD1A 2RIRA 4HEQA 1RYDA 3L7LA 2C2MA 1J4AA 3IP1A 1OYOA 4MUIA 3VVMA 3TJRA 4E5NA 4XVUA 4PZ9A 2YWDA 5LNK6 1MT3A 1P4SA 1IWBB 4F4DA 1DRWA 1UINA 4HL6A 3FROA 1KI3A 4EUNA 4X24A 3JQAB 3GA7A 5AJTA 1G41A 3PFHA 1ISMA 5D3KA 5DLPA 2BFFB 5L3RA 4DJFC 2B35A 5CDGA 2B4TO 5LD2B 7ADHA 4C03A 3V4FA 1ZCAA 4C7KA 4LQ4A 4DM3A 3U7QA 4YRZA 1LK7A 1Z16A 3HKCA 3EGVA 1UBUS 4EPTA 2C00A 2PMFA 3UXEA 1SOWA 4Q19A 1ZBDA 3N2NA 1ZGBA 4ZO4A 4LDRA 2XE4A 2XR1A 5BQPA 2FUG1 1IONA 4QATA 1T5BA 3KO8A 3SGLA 1I2DA 3MJRA 4Z9XA 1YMVA 4HH1A 1YFLA 4ZQCB 5EJGA 1WP4A 3IOMA 1ZXLA 2COKA 2BEWA 3I3SR 2VYQA 2C9OA 2E4AA 3P9PA 4JI2B 5LMZA 4G37A 4HR7A 3N74A 4JVLA 3PUWA 2WLSA 3NHKA 3PBKA 3WKCA 2AR7A 2EF0A 1OWLA 1UP4A 2Z83A 4NCXA 4ARIA 3MVEA 2PJZA 5TVGA 3HPRA 4AK9A 5M2QA 3HFSA 2VF4X 2HMTA 4FB4A 4EG5A 5HIMA 1TK9A 4D56A 3C3WA 1NYTA 1QE0A 4TRNA 1T9DA 3D59A 2JGEA 1XPRA 2GI4A 3FA2A 1J5XA 4MVWA 4Q3DA 1NN3A 3Q7SA 3LPNA 2WZQA 4P4GA 4DCTA 1DIGA 4AX4A 2ZREA 4CFYA 5JD4A 4B3BA 4E3ZA 5BNWA 2ZSFA 3MAAC 1SIOA 3PDJA 4M9CA 1T8PA 2CLMB 1JIVA 2FJUA 2FW6A 3A1TA 4BMPB 4HX9A 4L72A 3RS2A 4BO8A 4J1SA 1KK0A 1JXMA 3SLGA 3W9UA 1ZWLA 1NKTA 3AJ9A 4G2TA 3UWDA 4DA0A 4EMTA 5B7QA 1JBKA 2IP1A 2QQ5A 3K96A 5I8ZA 4MGYR 3DR5A 1D2CA 2Z9BA 3ESZA 3BTOA 2ZUVA 3GJZA 1DAIA 1GCAA 1H4VB 2BGLA 3W7AA 5BMVB 1DINA 4RENA 2GARA 2PS1A 3P1JA 1GEEA 2H59A 4D4MA 2BHRA 1UC8A 1LTQA 4WCDA 3UT5A 3YASA 4ZI7A 1KIAA 4LI3X 3WKAA 1UZMA 2OHXA 4GU5A 4H7KA 4BTLA 9GPBA 1OW3B 1XVAA 2IYFA 1U2DA 2I62A 4N54A 4P81A 2H65A 1QV6A 3TOVA 4CLDA 1RJEA 3A3NA 2RGNA 1FFHA 2XEDA 1ECCA 2PRIA 2QRKA 3FFXA 3S2YA 4XYEA 3NYIA 4EHKA 5IKXA 4U8HA 2VNSA 1UAYA 3FCEA 3UV6A 1P4RA 3CJRA 5KNCD 5ENVA 3Q87B 4A2QA 3DAGA 3H84A 1K6IA 2IT1A 3EG9A 4DQKA 2LVBA 4UHDA 1W85A 3CX4A 5TGZA 1C29B 1TKRA 4DM7A 2BGMA 2H2GA 4INAA 5ES3A 4E6PA 5C37A 1Z5WA 4RNCA 4Y1RA 3I64A 3QPBA 5K8CA 3AI2A 4S35A 2NXEA 4QECA 4HDMA 1BXGB 1DAOA 5BQ3A 4PO3X 2H1IA 3C45A 1M2KA 4TQGA 2F59A 3OQIA 2QJTA 3QX9A 1E6KA 4LXXA 3PKIA 4HAWA 4HWTA 5HILA 4FNAA 3K8OE 3A3OA 2YXLA 3RJTA 4DIEA 3AJDA 3EDRA 1OFGA 4ARVA 2WTUA 1TM2A 1FFBA 1GZ5A 3VSCA 3PQFA 1XJWA 1RBYA 2HJRA 1F8FA 4TXLA 1HQYE 1MNAA 2IV2X 3C6BA 1GV1A 4QJBA 4ZYXA 1W49A 4GX2A 2I29A 3X1JA 4IDPA 4BGUA 1YA4A 1F4LA 4YS6A 1XSEA 4RKRA 5EQFA 2XUKA 3D3QA 2O0LA 2IS4A 2CLOB 2HSGA 1YB1A 5AKXA 2EWMA 4BYGA 4Y1FA 1APBA 2NP6A 5DHFA 1QYRA 1GR0A 1LI4A 4HTAA 1F8GA 3KXIA 4RQTA 3WIBA 1LSSA 2V55B 3M7IA 1PT5A 4YRPA 4I3HA 3O38A 5HJ2A 1NURA 3VKGA 3KFVA 1S3IA 1WMBA 4X85A 1U3GA 3VTAA 2UVDA 2L42A 3KB2A 2CFCA 3ANYB 1I2MA 3T34A 4GQBA 1I1HA 4RMGA 3IB6A 3UXHA 2WAXA 3SQMA 2HJSA 2A9OA 3UMMA 2R5NA 4DJAA 2WP8J 1ITZA 3PVSA 5E7MA 3BIFA 1KPIA 5DN9A 3KTOA 2YWBA 3RT9A 4WLEA 2PH3A 1R5BA 4GBED 2O7NA 1VHDA 3MCWA 4LWOA 3ZGNA 5C9ZA 3U37A 4K9RA 3GEHA 1GZ3A 3DFZA 1W1UA 2CLIB 3VOAA 4C4RA 1KEZA 2NXNA 3BZUA 3O91A 4A5OA 4AJIA 1GPMA 1U65A 1Y4AE 4HUQB 4ND7A 4JK3A 4JLJA 1MB2A 2BBSA 3C6ZA 1MPTA 1F2TB 1M2VA 2ZIGA 5FBVB 5IEJA 4FTWA 1NQXA 3U40A 2YY5A 3WDLA 4MEBA 3TRDA 1N2BA 1QC5B 4A8TA 4EJSB 4L8GA 4EMBA 5JQGA 4N01A 1F7VA 1ZYUA 2OWDA 4Q66C 2QTWB 2JIZA 2O0HA 1XRJA 1S2MA 2RH8A 3ZWYA 5EHGA 2Y68A 3KELA 1FFAA 1RKVA 3H1TA 3ODPA 4DWJA 1GAXA 4LJ6A 1ZMTA 1E8MA 4OSPA 4O4IF 3QM1A 3EXHB 4XR4A 4B3MB 1LDBA 2QUBA 2QTVB 3D6NB 4C6HA 3UWKA 1QGED 4TS3A 2NSHA 3HJCA 1D4FA 4ZVOA 1IEQA 1MB0A 2EQBA 2Z4SA 3IQFA 3ZDEA 4PPNA 1YVDA 4CMAA 2HSJA 2AHOA 2QMOA 4L4UA 3ZWKA 3ZC3A 5CW1A 2VXCA 3RI3A 1EAYA 1H6DA 1MGOA 3T7IA 3H2GA 3C14C 3AERA 3TFWA 3TL2A 2P65A 3CNHA 3P9QA 1U0RA 4YPFA 4NFHA 4PSVA 2ZIWB 2X5OA 4F7WA 3E22B 5EJ6A 2YINC 4COKA 1HF3A 3I2GA 1Q7CA 5D8DA 4PG6A 4XIFA 3ZE9A 1U28A 3EXAA 3BB3A 2ZT8A 1DWPA 3GV0A 1XGKA 5CB0A 2JHCA 3WJ2A 1AZSC 2FZ4A 2GK3A 1N6NA 3PHCA 4LF5B 1GGEA 1UKBA 2ZJAA 3S1LA 3C15C 4JSRA 2VJAA 1ZN7A 2WE8A 2OHOA 2VJOA 3DE0X 4PYRA 1NATA 8ADHA 1I2BA 3DZKA 1Y80A 2XMQA 2JIDA 4L5CA 3B52X 3VR3A 4I66A 2WHEA 1T4DA 4MULA 1Z5VA 3OC0A 4NCBA 3ZCSA 1IWOA 2WWYA 3A9SA 3IMCA 4WVLA 2HRDA 3BMCB 3IDAA 3GRFA 1VCHA 1TIBA 2P1ZA 3MCTA 4DUYB 4JKIA 2C99A 1HX7A 1WEKA 1S02A 2IPNA 5EMKA 1J00A 4AZ0A 1KI6B 4Q24A 4LOJA 1QP8A 4CMBA 4D81A 1XK6A 4XE5A 2R6R1 1CV2A 3GVIA 3ACBA 4OQXA 4YH1A 3RNLA 2RGYA 3JR3A 4IQ0A 3SBOA 1ACLA 4RV9A 5C1DA 3E9NA 4PTZA 1R88A 2P68A 4YUYA 1Y6RA 3EDOA 5A5GA 3SEZA 1EVLA 1MC8A 2Z1MA 4OQLA 3PWTA 4F3TA 4WNCA 1U2TA 4K9DA 1KEKA 2C2WA 1B76A 1DUIA 1GNLA 1WHTB 3VMFA 3MWGA 4Y8VA 2OXCA 2DYKA 3ZNQA 1E2QA 1S8FA 3UJCA 1LRJA 5JDIA 3HO1A 3ENVA 3O3CA 3PUHA 3DAYA 3RSSA 3QBDA 3QPAA 1XTQA 3QJGA 4TVBA 5CLLA 2BFAA 2QXTA 4NEHB 4K9LA 2QD2A 2AKYA 3RG8A 5KYYB 4NH4A 1XKTA 4M8LA 1LUAA 1XAIA 4HMPA 3WTCA 3W5DA 1F51E 3EAGA 3R40A 4CW7A 1SM4A 2OVFA 3DOJA 3CUSA 1PSDA 4IJQA 3CLRC 3RVKA 3OA2A 1UBJS 4XVCA 4Y6LA 5JAMA 1YFZA 3LX6A 3GBPA 4CLXA 3OZAA 1O94C 1OB2A 4CQNA 4PTLA 2LD4A 1W34A 3HO8A 3SX2A 3IV7A 4NBRA 1DWOA 2XYVA 4FOOA 1J99A 5KSZA 1X7YB 3DDUA 4CBVA 1CY8A 2J0UB 4HEA1 2O5VA 1RJ9A 3UAYA 2GK7A 1FSFA 2VUSA 3EFOB 5H4GA 4F11A 1BAPA 2FSGA 2FZ5A 3RLIA 3ELWA 4EFLA 1RC0A 5JCPA 3GBSA 1YR7A 2BZ1A 3RTCA 3ISJA 3IHLA 1XKXA 4WASA 1P7CA 3BK2A 4FONA 4KU4A 1KORA 3JWJA 4Z8XA 4CTKA 2GZAA 5IKEA 4UBNA 2YJNA 4MWZA 1MAUA 4D6YA 5CB4F 2ORIA 1GGMA 3JQ7A 4XDZA 4WZAE 1TMKA 3U9LA 1XROA 3RFUA 5DYNA 1RFGE 2HA0A 2EGUA 2IYQA 2TMDA 1W1IA 4OGGA 4JT2A 1ZM3A 2ENUA 2W6ID 2XNDA 4D4IA 3PX7A 3ILHA 1ZH6A 3MMPA 2Y27A 4MKXA 5HKOA 5K01A 5LLTA 2HHCA 5TGTA 3VX3A 1Y63A 2QNRA 3ZTTA 4WPGA 3EZ9A 2I2AA 4MP3A 3I1YA 1WSBA 1NI5A 2P9QA 3FVQA 3OEED 5B3KA 1M8KA 4GMFA 4RVCA 3WADA 1L4EA 4RTPA 2A6PA 4UC0A 4LUCA 3OP1A 1OF1A 4NONA 4GI1A 3WBKA 3C7CB 2BKLA 1XZBA 2KLBA 3KEFA 4RABA 3H7AA 2CVZA 3LCVB 1JDPA 3PC4A 4OJMX 4ZT3A 3U4GA 5KQLA 3DEIA 2VQSA 1E63A 3R0ZA 2J5RA 4LNAA 2VYVD 3NHBA 1CF9A 1R5OA 1NL3A 5EJFA 2A9KA 4AFNA 3BILA 1OE0A 3LNCA 4MRMB 1H9CA 4GXRA 1FF9A 2NGRA 9ABPA 1MQ8B 1RYEA 1VHTA 1XZCA 3PL1A 4J0GA 4M46A 3L82B 5BPHA 3REOA 1V4NA 4DLVA 5HZMA 3ZDBA 2I1QA 4HRAA 2RGEA 1W94A 4RQBA 2NT3A 4JLAA 5LA6B 1E79A 1NWCA 1PV2A 1DC5A 4QJIA 3RAEC 4BNLA 2EIXA 2JFUA 2PD6A 4J6FA 1XMVA 4U7WA 2IZOA 1Z12A 4RGQA 4ITVA 3CUYA 1NXSA 1E1RA 1QHFA 3P52A 2BFOA 4YB8A 5JISA 3IDZA 2P2NA 3U4CA 5K6AA 3AY7A 2OZVA 2Z5FA 3AIOA 3L46A 3GRUA 5DPMA 4BKOA 4MOWA 5GINE 2VQ6A 2GZHA 4O4JA 1ZWKA 5JIBA 4I4TF 5EIAA 1ZOOA 3G9TA 4LTDA 3PGJA 2J1LA 1SCUB 4AYTA 2BW0A 1IBKB 4HWRA 1IQUA 4GPEA 2QMYA 1DCKA 3KYCB 4BCBA 3ZGLA 3SR0A 1JIKA 3C3XA 4PZYA 4NV3A 2JFYA 1OBHA 3F2VA 2B3TA 4UPDA 5CP8A 4DCMA 4F9EA 4PLZA 3K9BA 1KQ3A 1TUIA 2VXYA 2V03A 2PDAA 2WTBA 3NIWA 3TRJA 3NONA 3H9EO 2HWXA 1IXRC 3EDCA 1Y8ZA 3CWZA 4RHXA 4KO2S 4DLAA 4OBBA 1N2CE 4IF6A 1ENYA 4WV3A 1WHSA 1XCGB 2NYRA 4XWGA 1OPXA 2WRZA 3WBJA 3BF8A 3BWEA 2NU7B 3JD0A 4ZMSA 5IBPA 3L77A 3A1VA 2X76A 5I5GA 1AKEA 3RR2A 2BUBA 1EE2A 1U3UA 4WHMA 4A26A 2LIVA 2XNCA 4EGAA 3VV3A 4D26A 1EBBA 3QVTA 3JRNA 2WG2A 5FBKA 2DWUA 4NAHA 2FPLA 3ZQ6A 3OU2A 3E1GA 2B92A 5CX1B 1N2IA 1O77A 4HEJA 5E7IA 5B4VA 4HX2A 2H2WA 2FQWA 2JK1A 3WWZA 2G5GX 5AVQA 4G85A 1I0ZA 3G9QA 3CURA 1BS1A 4HDRA 1IDOA 3HEBA 4MI3A 4N7JA 5ALYA 4YROA 2AOTB 3PQ3A 4R40A 5E1MA 5DM4A 3CUWA 3OD1A 5LDDC 3SVZA 1KJQA 4QQFA 3CVJA 5F3DA 1YE3A 2W2MA 2D13A 2XWSA 2WPDA 3KZ1E 2WWGA 3LUHA 1AF7A 1QX3A 1JT2A 4CCYB 2O2IA 1PJBA 4IINA 4L3OA 4NYJR 4C76A 4DRXA 4NU8X 2C61A 1I4TD 3BE4A 4D9FA 2NTVA 1A8HA 3GCGA 4RVUA 3UPUA 1HBJA 2IZ6A 4F4UA 1Q3HA 1MIHA 1M2EA 1XE3A 2IE8A 2W6NA 3PD1A 4FKZA 2GN6A 4ZHQA 3CA8A 3LDFA 1FS4A 3RHZA 5B36A 1FJ2A 2V9PA 3J7TA 3UMGA 1CJVC 1KZ6A 3QKTA 1Q0RA 4JSYA 5AO9A 4AJ1A 3SE7A 2VPIA 1JGTA 4GBJA 4BWVA 5C8YB 4FR0A 2AN5A 2DEUA 3H8WA 3NHMA 4EMUA 2EJTA 1Q5PA 1ZH4A 4BNDB 1RABA 2XCIA 1H4SA 3PXDA 4UTXA 2Q49A 1RJDA 3MWEA 2AD5A 2HHLA 2Y9PB 4A91A 3L4JA 2COUA 3TW8A 1NF8A 1XQXA 4FFBB 1L5RA 1F20A 1MR3F 3T5AA 3KQMA 3KD3A 1I10A 4KQWA 1AKWA 5EQTA 4YDQA 3NCTA 2B8EA 3OFND 5GONF 2ANCA 2I7VA 1IUNA 4YECA 5EZYA 3RV3A 4W5JA 4ZVNA 3RK1A 2PNFA 4DTCA 4URYR 1KU6A 1NQVA 4IV5A 1TIKA 4PVCA 4RNDB 1EEHA 1R6BX 1S8NA 1Z4MA 3E05A 1V4VA 1T5DX 2VP4A 1EA5A 3HFGA 3DTYA 1XJ5A 3U3KA 4G4GA 221PA 5DM1A 4LTMA 3LGSA 1X7DA 4P84A 3GRZA 4CF4A 4DWOA 1UQRA 3FCXA 2PE5A 1KR5A 1HA3A 4RLHA 2WMYA 3RODA 4PHCA 1VSQA 1I4LD 3JVEA 1QCDA 1ZL2A 4F2DA 3LBAA 4MWEA 1P5RA 3VUFA 4P58A 3RVJA 4AJ2A 1D1SA 1KGDA 4BFLA 1ZOIA 4O1MA 4EO9A 1IN5A 1MA3A 3IP8A 2P79A 1IRIA 3TEMA 3RV4A 1WLSA 5KNBD 3NU1A 2R84A 1CY4A 2WA2A 3R20A 4R8MA 1SVUA 3KPJA 2IZ1A 1L7XA 3FMGA 3H4IA 3JVDA 4M3NA 3KJNA 1N2CB 1UMDB 1G5IA 3B20A 3USCS 2WSSD 121PA 2VDLB 5C34B 3ON5A 4UHBA 1NV8A 4KZKA 1VSTA 5CAEB 5BY2A 5I51A 3L6UA 2P4UA 3QKSB 1N9KA 4KYVA 4YRGA 1V5FA 3PNKA 5BW4A 2QZJA 3AL0C 2XTMA 3KJGA 4LJYA 2HR1A 4GP7A 1XZKA 3HFJA 4YMWA 1IFXA 3NTVA 1ZH2A 4P3KA 1DJNA 3PWSA 2ZUFA 4JBHA 2WJAA 2RKOA 4L6AA 1PWHA 3DVAA 3E1KA 1W25A 4N4AA 1G8GA 4AMZA 4DPLA 3HM9A 1GFSA 1O6CA 1RKUA 3MGBA 1J70A 4GZMA 3BHNA 1R37A 1J09A 2WINI 4M88A 1RIFA 1MX3A 1S6YA 4TKZA 2C94A 2DMRA 2V9ZA 3ZHCA 4MV1A 4QEKA 1SG6A 1CRLA 2CXPA 1CEEA 2H7VA 3WYGA 1XQYA 4JBXA 5EEGA 5JZVA 4P3XA 1STOA 4HQFA 1UBMS 1THTA 1BDIA 2H29A 2OORA 3CX6A 4MRSA 4TTJA 3HDHA 2PD3A 4EFKA 3C39A 3VPBA 1JYSA 4Q7QA 4ZT2A 1P9WA 3IAFA 2V6MA 3O8LA 5K7SA 3IO5A 1OQAA 3BJIC 1JAIA 1W52X 3QY9A 3V6LA 4EA8A 3I8OA 5DASA 2Q2NA 4ISCA 1JSZA 2PVCA 3P2EA 3GJ7A 1UJ5A 1BWPA 1KETA 1J24A 4G8JA 1ZM2A 1UJ4A 1DMSA 2XCRB 1U1IA 3QLEA 5F7XA 3GVPA 4C43A 1KYXA 1MB9A 1E4EB 2JDID 4D0NA 4YV1A 1E66A 4RTQA 1G1AA 2EYQA 1HZJA 3O1IC 2NSYA 5TB5A 3ZE6A 1H0HA 3D3NA 3TDMA 5FA6A 4A1OA 2R0QC 2P0YA 3OJFA 4MMXB 5HJEA 3UOWA 2AG5A 1A4RA 1NP3A 2QR3A 2OOKA 1X0XA 1G9XA 1EXMA 1HLGA 1U4SA 2QEQA 4U9HS 3AIKA 1R4MA 2WYIA 3CKYA 3TZEA 4BQNA 3I0ZA 1KJJA 3CH5A 1UDWA 3LPAA 1VMAA 5CFOA 3WYEA 2OR3A 4NZYA 1MUUA 4JXXA 2ZUUA 4ZAWA 1NJ1A 4RK5A 2FUNB 3SZ3A 4B83A 5K0GA 1TQ6A 4Y0VA 5ILOA 3JVVA 3GN1A 4PBSA 4B87A 3IXMA 3ROPA 1XLTA 3B2NA 4IUBS 4V3BA 1DJMA 4R9UC 1ADJA 2GDZA 4N8SA 3R6GA 5ETJA 1NUQA 1QO7A 3IOEA 3PK0A 4QWMA 1Y6GA 2AF4C 3E9DA 3PEFA 1EIZA 4ZFNA 3FJYA 3GFRA 4LZWA 2ZVJA 2XUAA 1NZDA 1QRDA 3BWXA 1ZUD1 3GUZA 2HD4A 3DWGA 4ZT4A 4CDRA 5IJWA 4DUGD 1G5FA 1YBHA 3H05A 1LI5A 2BMAA 2KE5A 3R5FA 3IQXA 4OHYA 2ZSJA 3ELDA 4D4KA 4B3FX 4ZI7B 1OREA 4F9FA 4M0DA 1II8B 2CNNA 3IQWA 1T8UA 5CT5A 4F12A 1NBOA 2XV1A 5KX5F 2LUOA 2IL1A 4EUHA 4CF7A 3WOHA 3AP2A 4WUVA 2HI0A 2IXEA 2WTMA 3RBZA 4IRMA 1GUDA 2V1XA 2G1UA 4Z4HA 4A8JC 4HNTA 5JSFA 1B93A 5KTYA 4YHHB 1RXWA 2P5YA 1GO2A 5TR9A 2LZ0A 4DYVA 5ELXA 1F5SA 3N7UA 4RVHA 1GQ2A 1PG0A 4LOLA 5B1IA 5JS1A 4C1BA 3RS0A 3AVPA 1WMEA 2FUEA 1WDTA 2OPBA 4IDGA 4X63A 4ZAGA 4KXYA 1HZZC 1H9AA 4QGGA 4RK1A 4ZDJA 1ZIXA 4BFSA 1JTVA 4D99A 2QG4A 2QL6A 2OXFA 4N5HX 3UK2A 2V96A 4BV9A 3KOXA 1MZVA 5EWJB 4ND8A 5THXA 3JAMA 5BYKA 1R00A 3P4YA 4H3KB 2EFEB 4HDMB 4JWKA 4MLZA 1EK6A 3DDSA 3AR7A 4JHXA 1U0GA 3HBAA 4QU8A 4DLLA 2FSSA 5J4HA 3AIIA 3GWZA 3HDVA 1OA1A 2QTFA 1NVGA 2QG9A 4YNBA 1P2VA 4LXGA 2IOFK 4CE6A 1WD5A 4LE0A 4S24A 2VR1A 2Z08A 1JDZA 1A3CA 1SRRA 5IDXA 2VPXA 4KN5A 2NVUB 3FLEA 1P4GA 4C7BA 4P7KA 2QYOA 3Q3GE 4LA4A 4OQQA 3DZ8A 1T13A 1VFNA 1ZR2A 4RACA 1AQYA 4JL8A 4UE3S 3O1JC 5F9MA 1SXPA 5ALXA 3BGIA 3F9IA 5SZIA 3FZEA 3U3XA 4JBIA 3H0KA 3QWFA 2C4HA 1RP1A 2H5LA 4UNNA 3Q15C 2MSWA 3TF5A 5G4KA 1RPNA 2OV2A 2CE2X 3C7KA 4HUTA 2JGIA 1SY7A 3ZK9A 3TDNA 3JV7A 4WN3A 1XRPA 4UM8B 3UYKA 4B5KA 3EC7A 1Z17A 3K1ZA 4P1ZA 4RQUA 4BRZA 2PBZA 2YZNA 2VPTA 3G59A 3DTNA 1L7AA 1UC5B 2FSVA 4K03A 1P2GA 2WNHA 3AZPA 4KZPA 5TEVA 1ZZEA 5CLFA 1CF4A 2JH3A 5BWOA 2JFVA 2ORED 1IZ9A 2OBFA 3B9QA 2FEXA 2CXHA 1U2QA 2J87A 1KAQA 1JH9A 2A5JA 3GRYA 1VIVA 1OA0A 1RXUA 1IVYA 2PZEA 3CKLA 1LPSA 3I6BA 4RSMA 1YHYA 1YL6A 1S3SA 2G9UA 5A7GA 1X7ZB 1BCSB 2MYPA 3KUUA 2FEMA 1VRWA 3LY7A 1UBEA 2Y4NA 1I1OA 2V3WA 3LAWA 1JW9B 4ZVKA 1GRVA 1JIQA 5LIRA 2C2YA 5EZ5A 1G3MA 4B3SB 1BN6A 3HU1A 2A4MA 1SKYB 1L4NA 4J3FA 2ZIEA 3A6KA 3CUKA 3NHLA 3PCTA 4PSCA 3CZRA 3IKMB 1NNEA 5B7NA 2CZGA 2Y6UA 4IHKA 2IEGA 3QEMA 1M7BA 4GLBA 2Q8NA 2WAMA 3PV0A 4G0OA 3OPXA 1SBNE 3SQWA 2PMDA 5K2OA 3EEBA 1E32A 2PT6A 2H7CA 4BFVA 8ABPA 3QGMA 3DAHA 1ZDMA 2GWHA 3DNMA 1ILWA 3K9NA 3MWYW 1SU8A 3WGHA 2ZWIA 1H0SA 1VPEA 1W5BA 2IYPA 3BXGA 5LQNA 1GFWA 2Q5JA 4PQFA 4Q9JA 1B15A 4E5PA 3LRXA 4P31A 4ARCA 2G9ZA 2NSLA 2XOKA 4BWFB 4I08A 4R1PA 2AG0A 2FPPB 3VO9A 3C85A 4HXEB 5JYBA 1XLWA 2ADMA 1RE1A 1KMHA 3STTA 4YCSA 2OO5A 1C9NA 3L4KA 3TW6A 1PZNA 3WL5A 2ZJ3A 3RTGA 4GPAA 4FJ0A 3QEJA 1P0FA 3PNBA 3QELA 5CPFA 2HNKA 5TQ0A 2JBAA 4BX9A 2OQ2A 3D3WB 3JQFC 5JE8A 1EUCB 2WP0A 3LKZA 3VZPA 3UK6A 3M34A 3FE2A 1NVFA 1TVMA 1A98A 4OY3A 1P3JA 4BFCA 3Q88A 2HLDA 4CF3A 1D1TA 4JSTA 4CIAA 1C8KA 1N1EA 2JVKA 2DE0X 2D1SA 2KMLA 3HWSA 4I5FA 4DSTA 4RX1A 3PE3A 4RPHA 3NW9A 3FTPA 3V1LA 2AQ8A 2P3LA 1YRYE 2BD0A 3RYCB 4QICA 2P6MA 3AUSA 3WSWA 3IAS6 3A2LA 4DKXA 1H3NA 3OHMA 1CUVA 2KB0A 3F9CA 1LCIA 1X15A 1YR1A 1AZLA 1MO6A 3AF4A 4PXAA 5REQA 3UMJA 1H3EA 3N05A 3AW9A 2DERA 3U7RA 3LCRA 4OJQA 2H16A 3CZQA 4XM1A 4BNKA 3HACA 3LX8A 3NUZA 3U7HB 3UJ7A 2C5AA 4ZYYA 5HJ5A 3GOHA 4DMMA 3EWIA 3SN6A 4YFVA 3WV4A 5CLQA 1M1NB 1SK8A 5CG2A 5MGBA 3FY4A 2Q4EA 3RK0A 1A9XB 1PT7A 2J3MA 3D5QA 3FB4A 3TTSA 1QJCA 1PWZA 1SBZA 3ZWMA 3AUXA 2GPBA 3QEKA 1NAIA 1LF5A 2WMOB 2DJIA 3AB7A 4BASA 1PUIA 4DIKA 1J0AA 3VKFA 1A27A 5AUOB 1V8ZA 3C4QA 4DJDC 1JJFA 5IDVA 2VJYA 4GO1A 4OA5A 5DX1A 3WWCA 3L0SA 1P5JA 2GJKA 3IHKA 1ORHA 4MRAA 4U2GA 1X1CA 5JMPA 2CCKA 3AZQA 2QLTA 4PZLA 5T3UA 2Q0XA 3BDIA 4TTVA 5HM6A 3FTCA 1SCIA 1NXWA 4OHZA 4JB2A 1ZKDA 4AUEA 4CODB 1IY9A 1UAAA 2RHTA 2DR3A 1IK6A 2WM2A 1I7SB 4BV3A 2OUKA 2V97A 3CUEF 4ND6A 4HC4A 1L8AA 2AOUB 3R74A 3O9VA 1EK1A 2IZ0A 4MUAA 3VH2A 1LU9A 2AZ4A 1Y6FA 3KJZA 2GEDA 1WNFA 5KOHB 1DXOA 3QX3A 4XM0A 5IBRA 4UM9B 5YASA 3VKUA 1JU3A 2PSHA 1U6IA 3DVLA 3U3JA 5EXSA 4G84A 2Z04A 2VP0A 1UXOA 1VDZA 1DLJA 2EARA 3N5CA 3IAXA 4K6MA 3U4QA 1GA4A 3FNHA 1G9SA 1IHUA 1TQDA 1WOYA 2ACEA 3A6DA 3AUTA 3IR6A 4WFJA 2R1VB 2WFMA 3A2NA 2BJVA 3PJDA 4NG5A 5A7HA 4YMUA 4ZVMA 2CFSA 3RJZA 1Z26A 4ZANA 1VKJA 3OE7D 4IHQA 3NOOA 5H7XA 4MI1A 3VYRB 4IG9A 4OUDB 5JD3A 3HA5A 1I4OA 3SVTA 1DZ3A 2Q07A 1ACMA 1ZJ6A 4CUJA 1H5UA 4EHAA 4ERNA 3DO8A 4NZNA 4BDSA 5CA1A 2BDUA 1QVZA 3P0RA 3FUVA 3G2HA 4YONB 3GUUA 4HRXA 2G9QA 1QRAA 3IBGA 4HQNA 4G0NA 4AS3A 5KIAA 2YMLA 4UCFA 1WG8A 1TZKA 4LG1A 1IN4A 5KQSA 4LF9B 3THWB 3HZOA 1Z15A 4J1TC 3BHMA 3HDGA 3NR2A 4M83A 4UAGA 2YHIA 2HWUA 2FZVA 4R5MA 4V0SA 1WNTA 5B6PA 2E4WA 4ND2A 1H9BA 3DYIA 2X13A 1GGFA 2YL2A 2EHJA 2W11A 4IHJB 4L27A 2UU9B 1WO8A 3DZIA 4INPA 3VHQA 4NCJA 1IK4A 1C2YA 1VYTA 4GRIA 3IBFA 4IXDA 2GN9A 4D41A 5KO2A 2E1PA 3V7YA 4ZO7A 5FBLB 4QTTB 5LYYA 1MJNA 1S2DA 3DMNA 2HA7A 1JG1A 2OZLA 2Q1UA 3EPLA 3Q98A 5ARCA 2WJ3A 3VR6D 1CUDA 3MA0A 2GT1A 3B6MA 4HSEA 2F67A 3TCNA 3I3OA 3NATA 5IAEA 4F8JA 5ITZB 1VSUA 4N6NA 3S1AA 3S8EA 1IBMB 4E88A 1Y0BA 3SDSA 4AY5A 3OLQA 3HFRA 1JWBB 1TT5A 2HUNA 3OOWA 4EYOA 3N8DA 1NUTA 5C1OA 1OC2A 3G8CA 3PUXA 4G6ZA 5L51A 1KVSA 1OIVA 1Y7PA 2ZTLA 2AFIA 4HTFA 3L7NA 2NZJA 3HL0A 3WR5A 2NNLD 2NIPA 4ZDKA 5CBKA 4M1YA 1Y4DE 1XCOA 1GL7A 2BHNA 5KJEA 2W2LD 1UBOS 3DW1X 4LY3A 2Q5OA 1UXJA 6REQA 4YBZA 1E8DA 3DE6X 1KIFA 5JCZA 4WKPA 4M9XA 4XFJA 3ANNA 3H5TA 2XT0A 3HABA 4FHFA 6CHYA 1G63A 2ZSUA 5FV4A 1O0BA 2Q1XA 3WAJA 2DQSA 3FTFA 1L5HB 1N5DA 4A2CA 1B26A 3BFXA 3G8BA 3UCFA 5LP6F 3KXLA 3T3MB 3T5GA 3HJUA 3WWPA 2J5BA 2P9TA 4FFNA 1UJNA 1CE8A 3T0IA 3R6DA 2TMYA 1UJCA 1VG8A 4NYIQ 5G1OA 3ESYA 4GLOA 2J6CA 3A9WA 4M37A 4QDZA 3F1LA 2AI2A 2LTAA 2VDNB 2W5UA 1EDZA 2VQ3A 5DGXA 4DLKA 3HVIA 1A2BA 1DAFA 2Q2WA 1XVLA 4WW0A 4QZVA 1NY5A 5L7TA 2HH9A 3MOGA 4JBLA 1ZAKA 2VK1A 1C4WA 2ZJFA 4KNWA 3E4DA 4E08A 3E3NA 2QV7A 4H0CA 1TUBB 3K9FC 1YT5A 1GTMA 5IAJA 3MEQA 1Y3HA 3QVXA 3E53A 4D80A 4G5XA 3P19A 2DB3A 5J2UF 1HDRA 1FLAA 2GBLC 4QJ5A 4ZDIA 4EJMA 1UFOA 3Q5EA 3LGAA 1SHKA 1T43A 1V1MB 2WDZA 2Q5IA 4HI0E 4K6GA 5TS2A 4Z49A 3L4BC 3NYWA 1VSBA 4NJEB 1CUYA 1UBCA 1W76A 1E89A 2NXWA 4GP9A 4XB2A 1TAQA 1L1RA 3BZBA 5AVXA 1G21E 2DZDA 3FYDA 1FE8A 4BVJA 1GLGA 1RCTE 2CF5A 3B53X 1SCDA 1ZOLA 4OQMA 5CFZA 5CJPA 4GEKA 3A10A 1B43A 3O4HA 2PRSA 4CKEB 1KYWA 1TA0A 1KL7A 2EV9A 2H3EA 4UPVA 5EVJA 4C7VA 1ZUNA 3S2FA 1ORVA 2OBYA 3N2EA 4R8RA 4Y9RA 1RYHA 4EJSC 4P4NA 4GMXA 4JP2A 3FSRA 2O3JA 1QCCA 5CH5A 1QONA 2PLFA 5H83A 4L5JA 1OAOC 4H4CA 1PJTA 2HHHB 2F9LA 2QQ0A 4L3VA 1Z75A 1NTRA 2G06A 2MOKA 3NHFA 3PHJA 2D54A 2I7XA 3AB3A 3QUTA 1P8JA 4HX5A 1IC6A 4Y6OA 5EP3A 4CV2A 2B25A 4AMYA 3DO6A 4LTNA 4PINA 4G9GA 1T5IA 1U7ZA 3R9IA 4NEQA 2ZRMA 3D3EA 2DETA 4Z4IA 1DKLA 1DJLA 4ZQBA 3MTDA 1GZVA 2IEZA 2Y92A 3BD7A 5D7BA 1SXIA 5FPSA 4H4DA 4KRXA 3MS2A 5E6UA 5FEMA 4EG1A 3K70D 3Q8LA 5I7UA 4C04A 4DXAA 3HKDB 2HF9A 4AF8A 4C0KA 3HMKA 1X7WA 5BUSA 1DBVO 5B1EA 3CEJA 4LE2A 3RW9A 4HGQA 4HWPA 3TZQA 4YLYA 5FCDA 3FNBA 3FUTA 4G0XA 5E1OA 1A96A 1Y9ZA 1CNMA 2AB0A 2FMIA 2I03A 3H11B 1VRCA 4MZDA 2J5KA 2WZDA 4P22A 5DNYB 1OIXA 1XD2B 2H7XA 3WRXA 4BB9A 4PZ0A 1KI9A 3I8XA 4IQFA 2O5CA 4TQ9A 1A0OA 5TX7A 4E30A 4JYCA 2BCGY 1QFJA 4QBHA 1KEEA 5JW6A 1JLKA 1FY2A 1KHHA 1ONSA 1A8QA 3D5EA 4GUDA 4PS1A 2HBQA 4PG8A 5AIAA 3PTZA 1JDSA 2CJWB 2Q1SA 2RGXA 2Z1DA 4HS9A 3KR9A 5H3CA 3RIMA 1O8CA 3UH1A 4HKTA 1ESCA 4AP6A 3L8MA 1T6YA 4NESA 4NFSA 5IUNC 3V5NA 4BBJA 4YJHA 3SU8A 3UKOA 1DGQA 1KERA 3NT4A 3EEFA 3AR9A 3FOFC 5ELMA 5BN5A 4REOA 1QFMA 4DGSA 1KI7A 2ACVA 3FZYA 3MCUA 2O4CA 3MJEA 3Q0TA 4HY3A 3WDMA 3GJ4A 2VVTA 3CRNA 2FPGB 2GF2A 4QUJA 4EY8A 1FNCA 2P2GA 1PZMA 5KYGA 2NO5A 4BC1A 5FOQA 4QOFA 4ALNA 4LNHA 1K08A 5JAIA 3H8JA 1KVUA 5FYQA 4EG7A 1DPGA 1WBBA 4JJ6A 2YDXA 1Y9DA 1KNQA 1XMXA 3SQDA 1FXWA 1DQRA 2LKCA 2OPHA 1PR0A 3G2IA 2PQ0A 2ETVA 1I24A 4IUYA 1BHQ1 1KAEA 3GF4A 4BFYA 2GBGA 2W6PA 1WKVA 1KDTA 1YTLA 3CRMA 1ISFA 3H5AA 2FE1A 1T8RA 3C5HA 3NPAA 2QE7D 9LDTA 2F55A 3F9RA 3OZDA 3TCXB 1EQUA 4BQRA 2XWJI 1CR4A 2FG7C 3WYAA 5JWRA 1IBRA 2HIGA 3ITEA 3MJTA 3D81A 4C14A 1E77A 1CRWG 1PEYA 1RHUA 3FIJA 3QHAA 3GGDA 1G21B 3MWFA 4GQIA 1EIWA 1U7XA 3PXBA 5JY6A 3S2SA 2KS6A 5KQRA 5C8VA 1JG2A 1UADA 3OOSA 2OCAA 3ZEAA 1DX4A 4QUDA 3R5TA 5E9WA 2OUIA 2VAVA 2EATA 2FQXA 4H1VA 3ZHUA 2CV0A 2HMSA 3PGLA 4AECA 4UQOA 4DQVA 2A1UB 3SBDA 1VCNA 2UVPA 3O4GA 1XO1A 3GJQA 1P9NA 1OFTA 2X1MA 4CMJA 3F3YA 3ORHA 2E6KA 1YDGA 3L0OA 3L92A 5AVYA 1JSCA 1UMBB 1UPTA 2AJLI 4CT0A 3AINA 1OX5A 4HADA 1EM8A 3WRVA 4I50F 5HGXA 1N6RA 1NKSA 3OECA 3JALB 3PLNA 3FPJA 4KKVA 3R3YA 1QZ3A 2O3SA 2Y6VA 4M0UA 4NBUA 4PSAA 2HRRA 5FH9A 1ORTA 3OOHA 1A5SB 2ASVA 1RWNA 2PYZA 1VP3A 4BQOA 4P0TA 4CMEC 2DBQA 1YB4A 5B6IA 1PTJC 1NIPA 2IEIA 2MR5A 2WU0A 3IIJA 3INRA 1UXGA 5EJ2A 5FR1A 4BAZA 2YYZA 1Y7TA 1ZNYA 3LWBA 2B5VA 4G86A 2XQKA 3K8ZA 5DHPA 1GZSA 4ZIRB 3ZU3A 3LQKA 1YNOA 2ORWA 3HCCA 5EYPA 1JFVA 3ZWVA 2JGFA 1DEKA 4JV5B 5DN6D 1Z7EA 1DXHA 1RLIA 3HRKA 4MV5A 5AW6A 4I46A 2D6FA 4B3HA 2WICA 2AXNA 4TLAA 1BVYF 3V46A 1I5EA 1QRRA 1T5TA 1UXKA 4EUKA 1N3BA 2HBRA 5DGDA 4GL4A 3L0BA 3DE7X 1TVKB 1W0KD 4G1UC 4TZKA 3RFTA 5KJFA 1BX0A 2GETA 1EWRA 4DCUA 3K94A 5CFRA 4QUEA 3B3QA 4MEAA 5JU6A 1HFKA 1S2NA 1E0SA 1JQ3A 2BSXA 4BMYA 4Y18A 5K3SA 3PIRA 1OWNA 3BT7A 1L7BA 4F2HA 3Q8MA 1JLRA 1XLUA 1PE0A 3NO4A 4KEAA 4MKZA 1UDCA 1GTL1 1ODLA 1ZJJA 3O75A 5EJ5A 1RRPA 3D54D 4A9AA 4A03A 2BFDB 4B5LA 4M98A 5IARA 3SSMA 4BVFA 5HS4A 4G0VA 2I4OA 1OZGA 2EAUA 3CIOA 1V8FA 3KEQA 4YC7A 4OQYA 3ZHZA 5FNVA 2R85A 4EI9A 1FRFS 4R8VA 5G53C 1AM4D 3BMOA 1R15A 4JQCA 3TAUA 2HSEA 3G1TA 2EGHA 4FUTA 5FQNA 3W1EA 4Q4LA 1Q14A 2V8BA 3GEGA 2BEUB 2RIPA 2XIQA 5CCXA 3Q3IA 2F4NA 1KEUA 1K68A 5K3BA 1FFSA 1YZHA 2G77B 3RRXA 3OX2A 2EFDB 5GGXA 3AG5A 4JJ4A 4PR0A 4ZMBA 4YMLA 1ZGCA 2Q3EA 3MMXA 2YWJA 2BGTA 1NXTA 3EAQA 3M5WA 2AEEA 3P32A 3TBFA 2O59A 4EHDA 3Q7EA 1PVVA 3ASYA 4BO3A 4ZJUA 3HSSA 1C7RA 3G0OA 3W9BA 5JROA 4QOIA 2QQEA 1JRLA 1TRHA 3O21A 3FLAA 4R0VA 3EVAA 2PZ8A 4HDKB 1XC7A 1QB8A 4P4UA 2XITA 1EJ0A 2I66A 3DKVA 3FUWA 2IUTA 4ARSA 5HKKD 4AWXA 3I6YA 3LCCA 1G3UA 1FFXA 4PZUA 5G4KB 4ZU1X 2HEIA 2QK4A 4LDZA 3MJSA 1T0UA 1RI1A 2C9CA 2GJSA 5HF6A 1G0OA 3LA6A 2DSTA 1XZEA 1X7XB 1EFCA 4I2NA 4M1KA 4MIKA 3QE4A 1QG2A 3BM5A 4Y7DA 2QBYA 2OL4A 4OLAA 3K72B 4O2RA 4LS3A 5EWLA 3JR7A 1FU4A 2QPAA 5COAA 4B2LA 2Z3ZA 2E4ZA 1BXRB 3IEPA 2X0IA 3ETGA 3BOSA 4Q16A 5LOVB 1R16A 4OHOA 1BMDA 1C7EA 2IUFA 4UDXX 3VR2D 2IWRA 2AK3A 2YV5A 1T3GA 5B5SA 3QJYA 4IGFA 1AK1A 4WACA 1H66A 1QIGA 1NOJA 4ZGWA 5K3OA 2JZOA 3V1KA 1Q6YA 4GE3A 3QYAA 3OT1B 3X43A 1XTJA 4KC0A 2J3DA 3IUQA 4CI0B 1CHDA 4MV4A 1JX6A 5IYZB 1BJKA 1UPFA 4HNRA 3VYUB 3AHEA 5D1HA 4EZIA 1GZ7A 1KEVA 1FIUA 3VR0A 3H18A 3BJRA 1O57A 1KPGA 2GKGA 3OEEA 2LGJA 2ZIVB 3A6JA 3AC0A 2JLYA 4DWWA 5EE9A 4Y2YA 5JJBA 4YXFA 3DCNA 2XVXA 1UK9A 4WEOA 1X1EA 2C3MA 1NW3A 4XR9A 4C29A 1Q44A 3GLHE 1BOFA 4B73A 5CYGA 5HCNA 2HJWA 2X0NA 2GNOA 5GPBA 1H2EA 4XUEA 4EYEA 2VPYA 5G0WA 3TN7A 2FXIA 2BCEA 4J7CA 4ZVTA 3W2GA 1TADA 1ZXXA 1P5HA 1CIVA 3VDRA 1GNRA 2XTJA 3D6TB 1TVCA 3NWPA 3PQ8A 4XD7A 4XTCS 4TMYA 1QDEA 3PCXA 4Q9HA 3P5SA 4JVNA 3ROKA 4GPZA 3DMHA 2I4NA 2BAGA 1WSAA 1S2LA 1XL0A 3EEQA 3OC6A 3WJ1A 5I48A 5JOQA 1Q0SA 3MRVA 5B2FA 4BMOB 1VE7A 1T26A 2A8YA 1Q83A 2PU7A 3WTBA 2P1RA 3HBJA 4BLSA 1YTUA 2EKPA 3GJTA 2DY1A 2H0RA 3I9V1 1CF2O 1FVOA 2HIMA 3H2BA 3I72A 3ED5A 1V16A 3Q6NA 4GXQA 4TSRA 3T1NA 4D57A 1VA4A 1YB2A 3RIEA 1MAHA 2FZCA 1U99A 3DDZX 3QH4A 4GWLA 4N9WA 5TQ0B 1ODIA 5IKMA 3B6EA 1Z5UA 2VYCA 2NACA 2PMEA 3TW4A 3VC1A 4KREA 5FOSA 3HCAA 2J3IA 2P7HA 1CHNA 2C7OA 1D1QA 2HJHA 4W8GA 4KI7A 4NY1A 1JPVA 3A1SA 3GNSA 4LV6A 3FBGA 3PC3A 4RMNA 1ZNZA 3JZAA 5DFAA 1PR2A 2B8WA 2FSIA 2JGJA 3CPEA 2W2VA 4QODA 5EG5A 4C0QC 3PJRA 4MYCA 5A3RA 1KQFA 5A9TA 2QTTA 4EVSA 3EC1A 4JLDA 1V48A 4KO8A 4PS0A 5BR7A 1G18A 3OIGA 3ADDA 1KWGA 4OQEA 2WJ6A 3E9EA 2ZATA 3LLUA 5F1PA 3TVYA 4FWIB 5DYGA 3QFCA 1X1SA 2B94A 2WIAA 1XTZA 1J7JA 2I65A 4FHDA 4FKMA 3K0CC 4OMCA 5JDCA 2OKCA 3W5IA 2FP3A 2V7WA 4O2BA 4R1NA 1DP4A 5CGZA 4XWWA 1UKYA 5CR9A 5CIWA 2GHIA 1YHNA 1JP7A 4F9TA 2WOJA 3QLVC 4TTTS 2DXIA 2W6JD 3G6WA 3NBXX 3PRJA 3PQ4A 1D04A 1YBAA 1SVKA 4I1OA 4O0LA 4FI3F 2ZTUA 2HMAA 4TT3D 3GLKA 4YVFA 4ESHA 3U7FB 3NHJA 1E0DA 4UHCA 1C1DB 3NETA 4PYNA 3V4RA 2ASEA 1R9JA 3AKEA 5ITVA 1AF4A 2H2HA 3MNFA 4JJKA 4O5OA 4JEIA 1J97A 5K20A 5AHWA 5D86A 5FPHA 3TWOA 2IXTA 3THXB 1PEKE 2CNBA 1HQKA 4ON9A 4HQKA 3UGKA 5IFLA 4IRXA 1Z36A 3ABSB 3U61B 4IYRA 3H2IA 1EHCA 4GR4A 3R6TA 1TQ8A 2JLBA 3C1UA 2ZR9A 2DECA 3SMVA 3KKLA 1XKLA 2ZRBA 4ZOLA 4B33A 3N8IA 5AK6A 2Q3FA 4NJMB 5DHAA 1N77A 1SZJG 1CFJA 3AFHA 3P9RA 4ZREA 3ZV6A 4IS2A 3R5XA 5D2CA 2O8BA 4A27A 1I32A 1I3LA 1XTPA 3AUYA 4CTMA 1U8XX 3GJXC 3MT0A 5ALNA 5BSRA 2GYVA 3C5EA 3INGA 4CHTA 2ID9A 1KQPA 2HA4A 3I2KA 3OOJA 1FP2A 1EDBA 1QCZA 2NWQA 3M3PA 2EG5A 4NBSA 3GLHB 4KR9A 3TKLA 4F84A 1BIFA 2I8AA 5ALIA 3W5HA 2FX5A 1I5OA 4Q4JB 1J2EA 4AJHA 2QU8A 2F64A 5LXTF 4AYXA 3OJWA 4LNUB 1XMSA 4DVGA 4HAIA 2DGDA 3HU3A 2YW2A 2V3CC 3V2UA 2OM6A 4IFEA 3I0NA 3K16A 1IXYA 2Z09A 4LHWA 3HLKA 3I83A 4MPDA 4WNIA 3GVHA 5F2KA 3S5JA 3OFNA 4KHZA 4YJ3B 2QRZA 3PPYA 4DREA 4DTIA 3F5DA 4HV4A 1QAMA 4H3HB 2WJHA 3WC4A 4TV8F 4X7BA 4XOIA 3L7IA 2QUHA 2HNAA 4PBTA 4TV9B 4XZ3A 2XDAA 1XU4A 3MUOA 1YRAA 2Y99A 3I30X 4N0PA 2F4VB 2FVXA 1EUDA 1J6UA 1UJ6A 3ICVA 4JYMA 4PG4A 1JJ7A 1ZD8A 3DOUA 1SA0B 2GKOA 2WFLA 1SPBS 2JC3A 4MPPA 3TW0A 4FZRA 3E82A 2UZ4A 2Q0HA 1ZW1A 1I4EB 4GXNA 3MERA 4L5YA 4B09A 1IVSA 2ODQA 2JFNA 3LL4A 1LD3A 3UAXA 4D9NA 4OHUA 4MJXA 5CA0B 5E2BA 2XE8A 1DE0A 1MO2A 3EWAA 4P34A 4BFZA 1YNSA 5EFZA 4E5YA 4AP5A 2HXSA 3Q0IA 1OZAA 1Y9JA 2QIPA 4IAOA 4J1QA 4JWTA 4QYIA 4UBJA 5CX4A 4RZIA 5G0TA 4C3OB 5A9RA 4CFZA 5KNBA 1DV1A 2WHYA 3EIQA 1G8HA 1M2WA 2IXAA 2XMCA 5A9SB 1EINA 1TJNA 1PYGA 3EZYA 1C30B 1V9LA 5CYFA 3U16A 1SD5A 1TAUA 2AOWA 3DDWA 3JVUA 1PU2A 1U3CA 2WSSA 3N58A 5EERA 1E4VA 2K87A 2O2EA 1W0CA 5J63A 4YV2A 2ZG6A 1SUFA 1TCUA 2ZJ2A 3WIVA 1T2AA 1OLOA 4FB5A 2ZSEA 1TT5B 3MYYA 4LSMA 1D9ZA 2OENG 1J8MF 2GESA 5IJ9A 1BJTA 1U0HC 3IP5A 3V4ZA 4ZCMA 3DHEA 4HTFB 1NUHA 3TLXA 4MS3B 1KY2A 2BKVA 5JT1A 3G5MA 4FYMA 1R0KA 4UCWA 2V7QD 3G2NA 4QSHA 4L22A 1NR7A 1SOMA 3TQHA 1EGAA 1UBNA 3MGGA 3PVCA 1IM8A 4R7GA 3P0EA 3PS9A 3EWSA 3JQ8A 4L4SA 2O5EA 5FD8A 4FOPA 1OGYA 3M3DA 4L75A 1GPNA 1YCFA 2I2CA 1CZUA 3AF2A 3QRWA 4M21A 1V7ZA 1Z22A 4PRLA 4YRIA 1AZWA 3IRVA 1L0BA 1M83A 1XPUA 5CDHA 2DUUA 4ZJYA 5F7JA 3CJTA 3ZW9A 2C4NA 5BYJA 3WK9A 3NDIA 1SCKA 5JPCA 3NUGA 2D74A 3AEUB 2VRNA 4K2AA 3EDQA 3IHTA 3PGMA 2WJ4A 4MP6A 1EZZA 4GLFA 4PHHA 5DI3A 4DOMA 4DR6B 4TYYA 2HFJA 1U8FO 3EIOA 2FRDA 1LSOA 1KYQA 2OCYC 4EX6A 2JDIA 1QDUA 3JQBA 2YQ4A 4CIBA 2QNBA 3TS1A 1BRTA 4C6TA 4C6RA 4PQEA 1Z25A 3I2FA 5C4MA 3KSAC 4B6PA 4QNNA 1W6RA 4UU8A 2VBIA 2ZBDA 4UVIA 4NDZA 2ODPA 2PWZA 2HYIC 2E48A 3HR7A 1NF9A 1F0PA 4MXDA 5HFNA 1K3TA 2E55A 5ESWA 4HYEA 5JG7A 3TR0A 5TMBA 5AVZA 2VDWA 5DNAA 5ICEA 1CY1A 1HT2E 1M0SA 4U4AA 1U11A 1L5WA 3COPA 3PVZA 2C2GA 2D00A 1IJKA 1OC4A 2RK6A 2YN4A 4QA9A 1EI9A 2GPJA 4P5EA 3TTWA 4CKCB 3D3JA 4XIYA 2HZ7A 3HA7A 2NADA 1JEAA 4YP9A 4LFAB 3CF2A 4B3IA 421PA 4AKHA 3RVRA 1NMQA 1U8TA 1SIBE 4BV8A 3FFBA 1JXQA 2FFAA 2JLXA 721PA 1XPOA 1ZUNB 1FMCA 1G7RA 2CFRA 2J9XB 3CUTA 4EYSA 5AW3A 3TLGA 1C8BA 2ROQA 3DXZA 1SUWA 2VJCA 2VWHA 3BF7A 3K0HA 4DUGA 1U0TA 4E2ZA 4Q4DA 5JCOA 4CZ2A 5AXCA 3A3KA 5K6TA 2O8EA 1GGHA 3S44A 4DDHA 1HWYA 5KNDH 3GUCA 3HJAA 4V2IA 4V0ME 3C24A 3E0XA 2FG5A 4PFSA 4PGHA 3DL4A 1QFSA 2NU8B 4TTQA 3IOYA 3QFFA 2X0DA 5IBQA 1HYQA 2RGAA 3EGDA 2R7MA 4LCBA 5J5VA 2FMUA 4CVNA 1ZUHA 5JNVA 3DMPA 3UMCA 2WKSA 1JKIA 3W5JA 2PSJA 2YNMC 4X60A 5ITSA 5AVJA 1I3NA 2NZVG 5K3FA 1H6AA 1X7WB 3MSCA 3MS7A 3QPCA 3A9TA 1GM5A 1S7GA 2IXFA 3BAFA 3A14A 1Y89A 2IYEA 1PD0A 3WMXA 3SNKA 4K40A 3BUSA 3HDQA 1AQIA 9ATCA 4TROA 4KMOA 3UJ3X 2QAJA 2XXBA 3L4SO 3WNBA 4CN8A 5HRCA 1U28C 3WMRA 4PM4A 3NYQA 4KO1S 2G25A 2Y8EA 4J91A 5C8ZA 1BRMA 1DC7A 1G42A 3K15A 4RFSB 4AY4A 1Z4QA 2VEOA 5JQGF 5E9AA 4FK8A 1LPMA 3CZ5A 3A31A 2HGZA 1Z74A 3GT4A 2Y1EA 3LHSA 2BUAA 1NIJA 4FS8A 3Q7RA 1NLZA 3NWBA 3TQCA 3SFTA 4WIAA 4OH1A 3U1BA 3TSYA 1UPXA 2F48A 3N7TA 3OURA 1NDQA 1WE2A 2XCQA 2AJTA 4YAUA 4L02A 1N5IA 1IBCA 2P0EA 3AR3A 3LA8A 1EP3B 4LRYA 4GGOA 3TLJA 1OFVA 3P94A 4RA9A 5FO0A 2O2DA 4L6CA 1KKMA 3I9OA 4MUMA 3DMTA 1QHNA 5KPDA 2GLXA 2JRCA 9LDBA 2PEZA 3T5MA 1M6EX 4ZAXA 4DQ0A 1SVMA 1VPLA 2D3TA 2JIQA 1DQYA 2PPLA 3OCCA 3PB3A 3TI7A 2FWNA 1HE1C 1VL5A 2RSLA 3DT8A 1VKNA 2PZFA 1NMZA 3GJ3A 4PXSA 2HBZA 4S0XA 3WLHA 2XADA 5KTRA 2I8LA 4YRFA 4IV8A 1L3CA 4DMLA 5EE3A 1EESA 1EZ4A 1XVVA 1YZ3A 2OAGA 3UUWA 1JHPA 1SEVA 2VP2A 4I3GA 3LRTA 1P17A 2PK3A 5JDIC 1P0MA 4FMCF 3F97A 2FMHA 1XTRA 2UDPA 3DZBA 4NZ9A 1R66A 4YR7A 5AIBA 2C0CA 4ID9A 3UNXA 4A10A 1OLUA 4V39A 3E1SA 2FUCA 1IRXA 2BCJQ 3E4CA 4FCCA 3M6FA 4L28A 1RWQA 4A0GA 4HLCA 4TXHA 5U4QA 4YP0A 3TQQA 3ZDCA 4P54A 2PTHA 2WD7A 1JL3A 5CT9A 2XUQA 3H2JA 2W9XA 1ZEJA 5DXAA 2JHPA 3CFYA 2FU5C 3DJFA 5TVKA 3OPMA 1Q6ZA 2WYVA 1NAHA 3K1AB 2FGKA 1UQTA 4OXRA 1KZGB 4LBYA 4M7PA 1D2MA 5ERYA 3R4CA 1DKQA 2AXEA 1PUJA 6GPBA 5JZBA 3DQZA 1SUPA 2NUPB 3H87A 2YFKA 2OQIA 4CMIA 5KOJA 4TKUA 2FPXA 1GA1A 1Q2XA 2HJVA 2QY6A 3OFJA 3R7LA 3ROFA 5A6SA 1A4XA 3T7EA 3CR3C 3BMQA 1ZRNA 1ONPA 2FP4B 4JLPA 3LW7A 2PU5A 1A5TA 3MJDA 1E9EA 3P9NA 2VJNA 4R4JA 2TMKA 3R6LA 4V03A 4MMYB 1RAEA 3H13A 4TMTA 3ESQA 2FSFA 4AVYA 1JR6A 1H8HD 1BE0A 4D98A 4WFKA 5SZHB 2ONCA 2EFCB 4F2GA 4PC1A 4KFTA 1Z56C 3EZLA 3FYTA 3GCXA 4M0EA 1IVNA 1E1MA 4RIEA 2VUHB 3VSAA 4F2WA 5B7PA 5CBPA 1JFFA 2C82A 4FZ5A 4OQZA 2VG8A 1I9CA 1OWOA 1L5FA 3PP8A 4HPXB 3JATB 4DLSA 4IIFA 2ICAA 3TLEA 1RM3A 4FXPA 5F12A 5F76A 2H0AA 2A30A 4OGWA 3SHQA 4QYXA 4EY5A 2BMDA 1LFAA 2QVYX 4FX5A 4KH0A 4V1CB 4IQ8A 5CFNA 1WSDA 2Q2VA 4E7PA 1HETA 1U04A 4PNEA 3COJA 2B7CA 3ADOA 3M6MD 3L7BA 2IH4A 3CVUA 1AKQA 2R8XA 4BN0A 4ENWA 2R6CA 4RO0A 2OC9A 4AI6A 5IDWA 2C07A 2IDJA 3RVPA 1XZHA 4HAOA 3GYBA 4INZA 3OD5A 3OX1A 4IICA 3CNOA 2YWGA 1GTG1 3FZQA 2SKDA 2Q4RA 1CUWA 1JAYA 3GYGA 1JSRA 4ZEOA 3MPOA 1PGPA 2R96A 4V0NA 5ERGB 2YWEA 2WUDA 1SRQA 1HDCA 2AWOA 5B64A 4RJJA 5C5EA 2E9SA 2JL1A 1GPYA 1ECJA 3FWKA 3QNWA 4JI3B 3RSQA 1GQFA 1AQUA 5B4TA 5BV8A 4EYKA 5K0CA 3RK4A 1W5SA 1HEYA 2EZ4A 2HA6A 2B0CA 5TF4A 3ZD8A 3HJNA 4OJNA 1MT0A 4Z2YA 4N0DA 2Q4DA 3QMWA 2YUTA 2BMEA 1DKRA 2A5LA 1LJ8A 2Q5HA 2WKQA 2FKAA 2X7JA 2SECE 1ES9A 4RCVA 3W6NA 5K6AC 3FGNA 1FX0B 2BH9A 2APJA 1U31A 2WF7A 4CN9A 1Z63A 3OQMA 2BTEA 1ZH8A 2O6HA 3TL6A 4ZOBA 5CU7A 2CLDX 3U5TA 2VHWA 3I5MA 3BCHA 1B23P 3FFTA 1R8QA 2ZXEA 5ALHA 4TRRA 1IATA 5F77A 3V32A 4RD2A 4D2IA 4AJ9A 4GOND 4MDYA 4ENSA 3AONB 3MTEA 4BP3A 8ATCA 4LC0A 8AT1A 2W2KB 4LDNA 5AVOA 3ROQA 3Q9LA 4HOYA 5CUQA 3DW3X 4QYWA 1JDBC 1E60A 2NUAA 3O47A 4F4JA 2EKLA 3LKBA 3S99A 2TECE 4U7FA 5LU8A 1RQPA 3OA0A 1NLFA 1H2ZA 2WM9B 3EVNA 2WIBA 4J9VA 5FOTA 1QLJA 3T3OA 1SQ0A 1BEUB 1ZLYA 1ISJA 2E0IA 2W7TA 3EJWA 2QM7A 3Q4GA 4DCJA 2RGRA 1M74A 3FKJA 4U2KA 3L8YA 2UYQA 1T4MA 2Q2OA 3CF4G 1Q2UA 1TM5E 3CLKA 5EPEA 5LQMA 5IHPA 1JMVA 2NU9A 3OE7A 1WUYA 4Q4AB 4WK4B 1JQJC 1FP7A 1NBAA 2C5LA 3H1AA 3NEJA 4O4JF 5HTOA 4FGUA 1M10A 2I7CA 3K9GA 1WCV1 4HZUB 4BIMA 1CNEA 4GOXA 2CJFA 4JLMA 2HPAA 3KHTA 5BQXA 5F2OA 1EUQA 4MVJE 3CSUA 4KO3S 4P7FA 4BOYA 3BKXA 4HVLA 7ABPA 3OOYA 4I55F 4ZDWA 2WWWA 4FLMA 3O1LA 1Y34E 2ZEJA 4OXIA 2O8VA 3C3AA 2E6UX 2OYCA 2GA8A 2R66A 1RLOA 4GOJA 1GPKA 2C5BA 4LGMA 1SHJA 2X2FA 4L2IB 1WKCA 3FWHA 2WV9A 1SKMA 1V9CA 4MYUA 1AT1A 2F8LA 2OB2A 4QG7A 4HRVA 4CR7A 1JWLA 1P0IA 1UZUA 4GM1A 3S40A 4UOEA 1NP7A 1IHYA 5DBIA 5K3CA 1WUIS 4NXNB 4JHLA 1C2TA 3N2LA 3EMVA 3U09A 4KQ1A 1G6HA 3WGZA 5EIEA 2HO5A 3IQDB 3U3OA 4M0KA 2HEGA 3EQ7A 3K2IA 1V5WA 4RDCA 4BRSA 4UNRA 1OOEA 3LJKA 4ND5A 4E46A 3EFBA 1E1QD 4BO2A 2N1BA 1I30A 2ZZKA 3AHCA 3PA6A 3QMVA 5AJUA 4PPFA 2BEJA 4P82A 3VR6A 3LHIA 2R9VA 5KKNB 5BYBA 1YQTA 5K3EA 1YOVA 2AHRA 6ABPA 1U2ZA 4EUEA 5B3AA 5PGMA 3WLKX 1CX9B 3DB2A 2MHCA 3KKOA 2PZGA 1ZINA 4FCTA 5FTNA 2OFFA 3V4VB 1Q0PA 3VJRA 2FUG6 4F7DA 5IMBA 3K92A 1PLKA 3AUUA 3SK0A 1OLXA 1FUEA 2BEVA 1ND5A 3KV1A 3VI3B 4CLHA 1W4BA 4I9FA 2Z2YA 3BK1A 4ZHQF 2J41A 3KC2A 3HVRA 1YQ9A 1P45A 1NQAO 4K26A 4OYHA 2PLWA 2ZBEA 1XCLA 4QAQA 1SULA 2W2LA 2GEUA 1W5AA 2FZEA 3HVJA 4ETWA 3G85A 2RHWA 3QE0A 4KFUA 3E3AA 1O0SA 3C6XA 3B9RA 4ZI5A 4OFZA 2WWVD 3AOEA 1S2OA 3TB6A 4WLUA 1TFUA 1AQ6A 2NQ2C 2BBOA 2GJ8A 3BERA 2LCQA 3TRHA 2HREA 1TOAA 3R3ZA 4AZSA 4Y6PA 2VDVE 4RE6A 2OD7A 4BKRA 2H9IA 2PCLA 3MLEA 1XEXB 3F5QA 3OZTA 3WRYA 5F2NA 3C3YA 4RD0A 2GF9A 1UZNA 4WXEA 5BSVA 3N8KA 3V48A 1ULHA 4AO8A 4BVHA 3WAGA 1P6UA 3DUFA 4HNAA 3ICEA 2DHQA 1SUIA 1YUBA 2PG3A 1EVQA 2IBTA 1KFCB 3ANXA 1NA5A 2VUTA 1C3JA 4KMMA 4FFMA 3ACDA 3P96A 2GEFA 4QX6A 2VNIA 1WDMA 5BVGA 2GR9A 1J56A 2SCUB 2J4CA 2JKZA 4JUCA 2RHGB 2BT4A 1E1YA 1JU9A 3EODA 1BVUA 3GEDA 3PDIB 4ZQGA 2FN8A 4BB0A 4F86A 3VAYA 4CIXA 4BZZA 3L0YA 4EOGA 3N2IA 4LXIA 1S0UA 1HKUA 3GHHA 4XAQA 4YALA 1UEIA 3K2QA 1TTPB 3P4XA 5AXAA 3PGVA 3M9LA 2EVWX 2QU7A 3NMUF 3O4FA 3TNJA 5JLJA 4R2HA 2PCJA 1GLNA 2D2IA 2BOVA 2VPQA 1DI0A 3D3KA 3VDMA 2WWTA 3N76A 1VCMA 3REQA 2YBDA 4PLTA 1WW8A 5A4KA 3MC1A 2VTKA 1HKHA 4G1MB 5I45A 4C08A 1FDVA 4DNQA 2AN1A 3DEZA 5DOVA 3F3KA 1SVWA 3IOBA 3OEYA 4XX0A 4I1RA 4M8SA 1KOJA 3NFRA 1N1DA 4ENTA 3TNYA 5AD1A 2GRUA 2WSLA 1J0DA 3LLVA 3ZZTA 4I4IA 5ECDA 3RBVA 1XDGA 4JLSA 3EZXA 4IGKA 1ICEA 4Q1EA 3EH2A 1XZNA 1GV0A