4KPEC

Novel fluoroquinolones in complex with topoisomerase iv from s. pneumoniae and e-site g-gate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
208
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/dna/inhibitor
molecule keywords DNA topoisomerase 4 subunit A
publication title Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 56
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kpeC00
4KOEC 2XCQA 4KPEC 2XCTB 3LTNC 3FOFC 4Z4QA 2XKJE 1BGWA 4J3NA 4Z53A 4KPFC 4G0WA 3RAFC 3QX3A 5EIXA 3RAEC 3RADC 1BJTA 4FM9A 2XCRB 2XCSB 4Z3OA 2XKKA 3FOEC 2RGRA 2XCOA 3K9FC 4G0UA 3KSAC 3KSBC 4G0VA 3L4KA 4I3HA 3L4JA
chains in the Genus database with same CATH superfamily
2OHJA 2PX8A 5I7OA 3LV8A 1HLPA 5A9TA 4EHDA 2EFJA 2PXCA 3EBLA 3OPXA 1N9GA 4O1IA 4HB0A 1Q21A 4Q02A 5LP6A 3SDSA 5K6RA 3HO1A 1HYEA 1N2IA 1RLUA 1ZGZA 4H60A 2B4AA 5ALMA 5FOXA 3ZQ4A 4AG6A 5KYNA 2PJRA 3K70B 1Q7TA 4C0XA 4HN2A 4Q3OA 3NAQA 1ZMRA 3HYSA 2HCRA 2I1WA 4OJKA 3K31A 2DLCX 3NHJA 5JAQA 3MXOA 4CIXA 3GJ7A 2J7KA 2O6LA 3CKMA 1TAUA 1TYCA 1LZLA 1VPTA 5C32A 3I5XA 2IHTA 1GAWA 1SHTX 5B4TA 1RWKA 2Y9PB 1PLLA 3QG1A 4RF5A 2XSZD 4TMKA 4EG3A 3T9EA 1LS6A 1ZN7A 3CLTC 2FFHA 2O0JA 3DCJA 3QUBA 4IQ8A 1CUAA 1IWOA 2JJ2D 1U7WA 3K72B 3V2HA 3V1NA 4CM8B 4XLTA 5LBTA 3OQMA 4BYGA 3FOAA 2R8BA 2OZKA 4MR9A 3DC7A 1CTQA 1IATA 3PNYA 4Q4HB 1YKGA 3K8OE 3X3HA 4A16A 5HOEA 1BIFA 3T38A 2GH1A 1V39A 4TOIA 2IGBA 2RHGB 4II3A 2G83A 3OQIB 3JQAB 1C5KA 3ORRA 4QBKA 4L4UA 4JXJA 1S2GA 1YZUA 5BMVB 2QTWB 2X0EA 2F1KA 5M2QA 3CVUA 2BCJQ 1F0NA 4KGZA 2VT7A 3PXEA 3WAGA 1QFSA 2ASEA 4B6OA 1ECGA 1FU7A 2Q3JA 4KQXA 5TVGA 5LXTB 4EY5A 1MR3F 1NZFA 2BGIA 1UBHS 1FP7A 1AKYA 3E7WA 2XD4A 3GDWA 3HDYA 3PC8A 2DFKB 4PPFA 3LT4A 2E48A 3T7JA 4C21A 1ZR4A 3OQPA 4Z0HO 1SXPA 2QTVA 2XVXA 2YR0A 1GPBA 1RWXA 1GUFA 1N2XA 2IXEA 4LOLA 2W58A 4MI1A 1WDKA 4C3ZA 1JN0A 3T5CA 1O3YA 1W581 3K1ZA 4F38A 5BN1A 2L69A 2QT1A 2RH5A 2XOXA 4KRXA 4GFDA 4G5SA 1HSOA 2AN4A 4ECEA 1KI6B 3QEBZ 1T10A 3D64A 5JXWA 1VDZA 1XEXA 4WZBE 4GO1A 1G2IA 1DPFA 4J1TA 2AYYA 4KR9A 3K09C 4E08A 1AN0A 3EULA 3H13A 3UJCA 1H94A 2Z04A 2XR1A 1C3OB 4I66A 2BBOA 4AF7A 5FFNA 4C0BA 3QOXA 3WGUA 3CW8X 3ODPA 4IQFA 4EYGA 1IRIA 5HG0A 4UDXX 1F60A 4AL4A 2WUVA 2PKYX 5IN4A 3Q8KA 3L43A 4XUCA 1Z4IA 1UXGA 3LNTA 7GPBA 2OWDA 4NCIA 2OHVA 3U5TA 3ZE8A 2P9YA 1HDEA 5G53C 5CA0F 2ZRMA 1YC2A 4IIJB 3LQYA 1HFKA 1XAHA 3A4IA 4OQPA 1B8PA 4BX8A 2IFTA 4Y6GB 4RPGA 1FNDA 2JEYA 1ZESA 3WZLA 3RT1A 1FYEA 5FF9A 4YAWA 1U2DA 4NPHA 4F3YA 1XF9A 2PGIA 3EG9A 1TA0A 2R8PA 2PL1A 4TLMB 2FNAA 3RVNA 2W43A 5BVHA 4DSOA 3G8YA 4D5GA 5EIFA 3RNOA 2LP4Y 2HXYA 4HZGA 2R8EA 4GP9A 2W11A 3EDMA 4A36A 2ZPTX 4ILEA 4Y67A 4MUHA 1PK9A 4QEDA 4CEJA 1GCOA 2C5SA 3DE5X 2F4NA 1F9EA 1FUKA 4M1MA 3U31A 3QQPA 4ITRC 5CT8A 1EH5A 2QWXA 4EY7A 3UGJA 2O8FB 4FDTA 1L8QA 2BGGA 2DJIA 2AB0A 4V0RA 4ECAA 2GB4A 3U40A 4Q93A 3BH7A 1YR2A 5C81A 3ZNPA 3BK2A 2GESA 5HE8A 3REGA 4I55A 3E9QA 1T4GA 2W6IA 4I50B 4HQLA 3O2SB 3OPYA 4LDPA 3R3JA 4RLHA 2WZBA 2O5EA 5IJ9A 2LRHA 1PFGA 1XTRA 1M33A 2CXTA 1DAOA 1V3UA 2OT3B 4PNEA 1KRXA 2YWFA 3I53A 3BWCA 4Z9AA 3IUYA 2ERCA 4FJ2A 4KP7A 4PLGA 5FYDA 3GLHB 3OPNA 4A26A 2G80A 4RTRA 2GXUA 1GYQA 3OUTA 4JJEA 4MKHA 1XVAA 2VTBB 2BYTA 3MINA 4L02A 5G0TA 2GAFA 3WLNA 3E9YA 3OD5A 4EK9A 5BN3A 2QSYA 2OCGA 3GEHA 3WFIA 5LXTF 2JHFA 1CNFA 5GIOE 1O0CA 5BV0A 2AXEA 1YZVA 4HEJA 1XKXA 2OCLA 3E48A 3PFIA 4E07A 1A3CA 2GEFA 4G0QA 5ALFA 3ZJTA 2BEWB 3OFNA 1KEUA 2CL5A 2IRWA 4QWWA 2Y68A 3IRUA 5EP1A 3ED1A 4M1WA 4O4JB 1JHOA 3SHWA 4KKXB 1V4NA 5CXQA 2YVKA 3VH2A 1OJLA 2FEPA 4MTCA 1Z5VA 2DKNA 3ZC3A 2H2IA 3LW8A 1S4MA 3RSLA 3VC2A 3PNMA 3N5CA 3KYCB 4UTOA 2CNDA 3ZVLA 3OPYI 4KSYA 1YVDA 2W42A 4CGZA 3MMPA 1J4AA 2A1TR 3EZNA 1V4VA 1Q0RA 2QY9A 4CIDA 3C5WP 4L1KA 3EDYA 3JQ8B 1TU0A 4NEQA 4AMVA 4FOTA 4BECA 1ULSA 1GZDA 1RFLA 1HUQA 4G1UC 3TLBA 5IBCA 2BBSA 3ESZA 2RMKA 1YKFA 4RF3A 1MXHA 3MIZA 3TB4A 4JI4B 1GL9B 3FNQA 3GB9A 5DGIA 2BVNA 3M83A 3O90A 2J9FB 3H9GA 4ZI2A 4KNYA 3FRIA 3WLEA 3WY9A 2ZIUB 5CD1A 2HA0A 2VH2A 3AR9A 4OYRA 3TIFA 1PWXA 3WP0A 4CM9D 3BQMB 2O2DA 3SNKA 1GKKA 4X71A 1NZDA 5A05A 1IEXA 3AVXA 1XRPA 4BMDA 2VQSA 5DBHX 2QROA 3WL3A 4MHOA 1B8VA 5G1PA 3KZXA 2Z5VA 4Z4HA 4UBNA 4FT4A 2GN6A 4A8JC 1KOJA 2W4MA 3D7SA 4TWAA 2R96A 3UH1A 1Q7CA 4Q21A 4RGVA 5LU8A 3SP1A 2WSIA 4RMGA 1JSCA 3C6YA 3OTWA 3WICA 4ZZ0A 4TSFD 2Q8QA 1NX6A 2YICA 3RTDA 2Q3LA 3TLEA 2X2PA 3WLHA 3CVYA 2BSQA 4ZRMA 1M8PA 3U37A 1P6QA 2WYIA 4RJ2A 1A8QA 3RFVA 2GM9A 2JLSA 3Q72A 4MARA 3L77A 3DEYX 1DC6A 2QRGA 1UXKA 5AXBA 3ZDFA 3OPMA 1PSDA 5EJ9A 4TL6A 3LI2A 5CDFE 4GPIB 1UEJA 4ZU6X 3UKJA 5AM3A 1TU4A 3A1CA 5KX5A 4I50F 4DRZA 5AIBA 2C3YA 1P5JA 3N6VA 2XLBA 2Y6VA 4WQMA 4N7JA 1P1JA 2JL1A 3H3FA 2ACKA 3H83A 5G0UA 4GKJB 4E3ZA 4XH9B 5BSHA 3HLKA 1XNJA 1QIJA 4MP3A 5L9AA 5I5EA 3CNHA 1K75A 2C5GA 3QBTA 1UJNA 5KQMA 3HKDB 1WRBA 1UK9A 1L7EA 1MG5A 4LQCA 3TEMA 1FP4B 3BSWA 1STOA 1JPJA 3C3BA 1EHIA 4KMSA 5PGMA 3VYTB 5B36A 3Q9SA 2QLLA 2X7XA 4Y6OA 2XCOA 4GMKA 5FBRB 4GLOA 1NVXQ 2YQZA 1MXFA 3T3HA 2QVXX 4G0VA 2O8EB 1H66A 1LBHA 2VHYA 3LPAA 3NGLA 4OO3A 1JALA 3T0IA 1J9GA 2J0UA 4O8CA 4OG2A 4AT1A 3HDGA 2PJDA 1Z7WA 3PNVA 3L82B 4PRYA 4UUNA 4BYMA 5ICGA 5LM3A 1H8EA 3B9PA 3PNQA 4HB2A 4KH0A 4O4JF 1NF8A 5FA6A 3T7RA 4M87A 1IZ9A 3T1VA 1NRIA 3KQSA 5BSWA 1W59A 5B4VA 3HWRA 1P39A 3AVPA 3FY4A 2FRVA 1J9EA 4B7CA 2FZWA 3EAGA 3R5KA 5CB4A 1E7SA 4ZYTA 4QGFA 2G1AA 1LPPA 4M53A 3D5TA 5FFFA 1CYEA 2E4YA 4DYHA 2W2LA 5CIWA 5LBUA 1OB2A 1KMMA 1IY8A 4H2DA 5A6SB 3LYLA 1E69A 1QS0B 3PHIA 5T3YA 4DPLA 1QZXA 1PAUA 4JJ6A 2JH9A 4EW1A 5ITZB 1ZJWA 1P8AA 3RAGA 1YS2X 2VSNA 3ORSA 4D3SA 4L95C 4RDIA 4EHNA 3ZD7A 1ACMA 2B4RO 4AZ0B 4QQ8A 4G0ZA 1RYZA 2X9VA 2POCA 5IZCC 1YS4A 3ONWA 2UXBB 4GPD1 3O4VA 4LV6A 4Z0PA 1DRJA 4PTZA 1WB9A 3BH0A 2FK7A 4NBLA 4OV6B 4CHTA 1Z7GA 2EJTA 1II0A 1SKYE 2XMQA 4UTXA 1CW2B 4S12A 5EINA 1REQB 3G2IA 4AKHA 3RS5A 2WABA 4JD5A 4PS1A 4TT8A 4B4VA 4MTLA 2B9EA 5H3LA 4ZEWA 2EKLA 3PHLA 3VKWA 4D8TA 1J1ZA 1HT0A 4M7RA 4PYMA 3U4AA 1QGDA 5E2BA 4DCJA 3PENA 3DE6X 1JHZA 3MJEA 2EKDA 1OXMA 2XCQA 5FAKA 5AHOA 1SKAA 1XKTA 2NUTB 3DP7A 1YQTA 2WR8A 4ISCA 2PUAA 3QFCA 4K9KA 4BB9A 2AX4A 3TR5A 1XZKA 3B13B 3M3PA 3WWZA 1YCDA 2FF5A 2Q8PA 3WSWA 4EZIA 3CVWA 1O9BA 1A77A 2VI5A 3AF5A 3ZDEA 3TW8B 4ENQA 3OX2A 1G7CA 3JASB 4JA0A 3INGA 4R7GA 5FO0A 4CCYB 3IBSA 4XYMA 3MTQA 4OI1A 2ZWIA 2QX8A 3GPCA 4I14A 5ALOA 2JK1A 1ZJYA 4FSXA 3G2OA 5EJAA 3STHA 4DT1B 5TQ2B 2MWMA 1FS5A 4NNPA 1DOZA 1JA1A 4L74A 4CMAA 3Q10A 3RS2A 4MYDA 2J3IA 3E3MA 3ISTA 3QUCA 2O1WA 2YXLA 4ILKA 1A95A 4QDUA 4X45A 3BWMA 3GRVA 3W2EA 3ZDXB 4KFTA 5CAEA 1SUFA 4FLMA 4XDYA 1M83A 1UT6A 2AE2A 2PWYA 2V6MA 4DR5B 4RVUA 1PUXA 5KYVA 2F3TA 3TEJA 2JFUA 4MPTA 3MGCA 3FGZA 2VJMA 2Q2QA 1I7DA 1CX9B 3D3WA 1WJGA 4EEKA 1X1AA 3AUTA 4O02B 3LS2A 4V0SA 2GVZC 5HRUA 3WXBA 3LLCA 1MB0A 1J2UA 4LC1A 2XXJA 1SD5A 5F12A 3MVEA 2OGUA 2Q3FA 1Z5PA 4FHGA 5EGNA 3ZK8A 4BQNA 3Q5GA 2BM0A 2WB2A 5TQJA 3JQPA 3WYFA 2GDZA 2PNFA 1SNYA 2VHTA 3D59A 3PD1A 3QYAA 1W2HA 4MS1B 1EFCA 4H18A 2QVBA 3ECAA 3I23A 3W7BA 1Q1AA 3JXEA 4KTTE 3DE0X 1DADA 3QPCA 1JZQA 4N5DA 2EV9A 2JNWA 3TM5A 1TB4A 1EVQA 2OYCA 4HGOA 3UV3A 4MV3A 1DCFA 1M6HA 1N1MA 4TV8F 4ZK2A 5HKKD 3CXUA 1LWNA 4PIVA 3RUHA 4FGJA 4PYQA 3NLLA 1RBYA 4ZOCA 3S27A 1TTQB 2AD1A 3TNJA 1XKLA 3LCCA 4LVOA 2I78A 2LIVA 2DPGA 3O5AA 1WZCA 4OQYA 4YP5A 3EG5A 3CW2A 4XIJA 4YMIA 2F1IA 4QUHA 2B7LA 3RT9A 4KXNA 1X7GA 3ND6A 3VJLA 4FYHA 3ZUPA 4KQEA 4BMVA 3ZU3A 3U3OA 2HWXA 4F7DA 1LPNA 2D7JA 3F2IA 5DXFA 4A2WA 4D41A 1O08A 4U4AA 4KUEA 4EY4A 4A9AA 4DLSA 5JHHB 3CJRA 3GLGB 2PZEA 2AMLA 3RJ5A 1MAHA 1LLCA 1MHPA 3GG9A 4BMNA 2C58A 2AHRA 2R9VA 4UARA 1R0ZA 3DV2A 3IPLA 1AK9A 1FRZA 4LBVA 1NMYA 4ZT3A 2Q1XA 1ZL0A 3L3BA 3P97A 2WD8A 4ZT6A 5JATA 5JCOC 3WKBA 3ZGXA 4MAFA 3R0VA 3DH0A 2XNHA 3HSYA 4PZLA 2XH8A 1N0WA 3L1IA 5EJEA 3EZ6A 3HUEA 1TMOA 4MVJF 3TNLA 1NLFA 5DTIA 2DC1A 3HJFA 5EA2A 1WSAA 2YZ2A 1J21A 2O20A 3BXPA 3WQRA 3O47A 2H52A 5BSEA 4FXOA 3ILYA 3Q8LA 2W6NA 1Y5MA 4BFYA 4EL5A 2WK1A 1F4VA 2F67A 4G23A 3SYRA 5IEBA 5AW0A 1XZBA 3JSAA 4MV9A 4GLLA 1HQDA 3ZWBA 2EJCA 2ZWAA 4Q34A 5REQB 3ZUGA 4AMYA 2J9YB 4ETIA 3L4BA 4AJ4A 4BKUA 2IH2A 4AS3A 4C9BA 9MHTA 1A7JA 1BS1A 3OIUA 4M0KA 1O94C 2YBEA 4E5VA 2FG7C 1I4OA 2Y05A 4AECA 2W2TA 2VR1A 2A1TS 2MOKA 3CY6A 1CYDA 1LUAA 3VDXA 5I9NA 2G71A 2GHQA 2XE4A 3E9NA 4YMLA 4JYZA 3ZLVA 3JQQA 3UFXB 4BV3A 3VPXA 3FCUB 5AUPB 1G5PA 4QWMA 4C6TA 1JIQA 2O2YA 4LQ4A 1EBBA 5D2CA 4B31A 2Q1SA 2PFSA 2YIVX 4HX9A 1S3IA 3IULA 3L7BA 3DHWC 4E5NA 3TSYA 1TTHA 3UAGA 4BFCA 2WHRA 3ZS8A 3D6FA 3B1ZA 3WNZA 3WL8A 2OQ2A 2AC4A 4FEYA 2MSCB 2X1HA 5TS3A 3BF7A 4DUGD 2ECPA 4JKOA 1WZNA 3MERA 3ZVMA 3H65A 1L7RA 3HTXA 1E61A 1Z75A 2JFOA 4P3OA 2GJKA 4MRSA 5HP4A 1P4JA 3V8BA 3W3AD 3T9AA 4C5AA 1WP4A 4YECA 5LOVA 1ZDMA 5EUMA 3V1KA 2A94A 3NWBA 3G9UA 4D97A 5IJ0A 1F2TA 4K9NA 3V4LA 5AM1A 1L4GA 3D54D 3WFZA 5IYZA 2XT6A 1I2DA 4P7GA 2HADA 1D9ZA 3LC2O 1RHJA 1C9YA 4JJAA 4Z9FA 1SKQA 2AOTA 4P9NA 4J7XA 2VQ6A 1SH7A 4W5RA 3D4NA 1QGED 1Z0UA 4OHKA 4AG3A 4WKPA 3CW9A 3EE6A 5CFZA 1PT5A 1X8JA 3ZDZB 3G9TA 3CH6A 4DJTA 4CKZA 3W04A 1QIFA 5CLGA 3TJZA 2IBSA 3SC2B 1MORA 3NAMA 4O2BF 1SZPA 3THOA 1TEVA 1YULA 3ZU5A 4QGSA 4LHZA 2J48A 2JD0A 4YBZA 3KAJA 2VAPA 1VPLA 1YE3A 2B34A 5CLLA 1F7UA 3R9XA 2ZSEA 1A4UA 1ZUHA 4GD3Q 5FAXA 4DUPA 3M9XA 2VOEA 1V9SA 1RXEA 2V65A 1X1BA 2CMKA 2HSDA 2YWHA 3AR8A 1GZ6A 1RXYA 2MU1A 4X1YB 1KI1A 1L9XA 2ZDQA 2MDTA 3GRCA 4HDMB 3R7WA 4EG0A 1I80A 2CHUA 5DGDA 1Z12A 4RA6A 5BUQA 4RNDB 4NCAA 1BHSA 2P4HX 3P0FA 2QQGA 4LV5B 1PJ8A 1QO9A 3R4VA 1GQYA 2UYHA 4DR3B 3EPRA 3MK31 3R3SA 3OEEA 3ETEA 4C5BA 1QP4A 4CCWA 3A2LA 2JATA 4JEMA 3MJCA 2BZGA 3K9QO 1M34A 2BMVA 3IT1A 5A3JA 2FW7A 1FSFA 2C00A 4PLFA 3GLFE 3SIPA 3UMSA 1COWA 3LQRA 1KMHB 4CVNA 5K3SA 3K70C 4OHBA 4ZOLA 1OLSA 4KQGA 3OWHA 2EKBA 2CB0A 2YJGA 4P4SA 1PJBA 3UGQA 2CF6A 4V1CB 4JI2B 1IUNA 5JRJA 1N6KA 1AHHA 1DQNA 1HQKA 4U00A 3DD5A 1HK7A 1XRJA 3FLMA 4UBIA 5CT9A 4DMFA 3VYRB 4L76A 3HFJA 3LBIA 2ZSHA 3WMRA 2JBAB 4YP0A 2ZRHA 1RI2A 4A91A 1CCWA 2PT7A 2FXVA 1E63A 2F8SA 5HHTA 1W88B 2CJFA 1T8RA 3K5WA 4FWTA 2YQ5A 3KYBA 3O3OB 1QLWA 1N2ZA 1U1CA 2I6GA 1J20A 2D74A 3PVZA 4ARZB 3E27A 4MSUA 5IC6A 3CJQA 3I9FA 4WZZA 3RFTA 3TSCA 1HSZA 1VTKA 3NBYC 2H63A 4K9SA 5B4UA 3LPLA 3TZQA 4G4SO 2D5LA 1DB3A 1HRKA 1ZW1A 3DQZA 4OFZA 5EEHA 4BGVA 2OFWA 2FUEA 1UK8A 5DV9A 3QKWA 4NNOA 5EE9A 3N2YA 1EFHA 1UQRA 4CBVA 4DEXA 4LBWA 3G68A 4OEHA 3WGOA 1YC5A 4TL7A 4QYIA 3TRKA 4EG1A 3BHMA 3V8MA 5TMEA 4PR0A 5B37A 3IIIA 2VJDA 4QG7A 4KGVA 4YQYA 3FAZA 3ADBA 2PO7A 3PT5A 3M89A 4DCMA 4OAQA 5DISB 1WXDA 3SLKA 5JCZA 4DCGA 2QRUA 2GPJA 1TNDA 4TQAA 3DVSX 3GJ3A 2CXOA 3ROKA 1EXWA 3DXYA 1J0AA 3IQHX 4P98A 4RJKA 1ZLYA 5LQUA 2YZMA 2ONZA 2YZ7A 2WQ7A 5TC4A 5LQNA 2Z8YA 1WAMA 3LUBA 3BJRA 1U2GC 3N53A 4EKEA 2LNDA 4KFUA 1VL5A 3NKVA 4L0QA 3RIMA 3K94A 4C7KA 1Z0AA 1Z5NA 2ZXEA 3UIEA 1GT6A 1EM6A 4JLAA 4UAVA 1QDLB 5LQDA 4A6XA 3AETB 4Q01A 4RSGA 2Y1OA 4PFQA 1CY8A 2JFYA 4UW9A 4ZEMA 1Y48E 1KYIA 2FI1A 3F46A 1E2LA 3IESA 4JIGA 2R1ZA 3AUFA 3S4YA 1WSBA 3ZK7A 4AAYA 2R8OA 3LLSA 4CLXA 2QRZA 2E85A 4EQZA 1B76A 1DL5A 4DNOA 3B6MA 1KYVA 4MA0A 5G02A 5HM6A 1GUYA 1N5LA 2IQIA 5FWXB 1SQ5A 2B8NA 1P0QA 2GK4A 1MB3A 4LRWA 1GUZA 4HAYA 2WM2A 4GAEA 1YZFA 2IV2X 1ZJZA 4WH0A 3PDUA 1EE1A 1AGXA 2XWPA 4MVCA 4DLUA 5C1IA 1XCMA 3D6AA 2FX5A 5GIPE 3O8CA 2BTOA 4FGKA 1SVLA 5LIRA 2OV6A 4TMTA 4IKOA 4X8MA 2ZJ2A 4HKTA 16PKA 1M6VB 2Z30A 3B5EA 3PTLA 4NTZA 3KPUA 2UUAB 1E1MA 1CKEA 2EKZA 1C3XA 2GA9A 5DLDA 1ICIA 2JAUA 2HHHB 1ZHHA 2O8BA 2FPLA 3N6XA 6CHYA 4XDGA 4PN7A 3E3LA 2GO1A 5BWOA 3A11A 3BRCA 3PVSA 5IBQA 3TUIC 4GE3A 4AUNA 1G8PA 5C5EA 3SJAA 4PXAA 2C4WA 2NZ8A 1DC7A 2A3NA 1P7VA 2OFPA 3FMVA 3PPVA 3WWDA 3TDKA 3AEZA 2HM7A 2PUCA 1TFUA 4I9FA 3PF8A 3F96A 3E5NA 1PFUA 3BXFA 3GFPA 4FBMA 4QUKA 2ZXUA 1WMBA 2I4MA 4I4TA 4K2AA 1M0TA 1ESDA 1VL0A 3K8QA 3ZWCA 1L1QA 1C41A 2OC9A 3EEYA 3HE3A 1AY0A 3LCJA 3QNMA 4D02A 4OK3A 2PH7A 2HU2A 4KXFB 3WJ2A 2DT8A 4Z2AA 4AYWA 1T3TA 2E49A 4POAA 2ZW9A 5B1YA 3KTOA 2C9BA 2GLTA 1XAJA 2OILA 2MYTA 1RLMA 3DCYA 4PICA 3GGGA 1DJPA 4CN8A 2HBQA 3LMKA 1EEXB 3MJDA 1CEYA 5EZ6B 1Z88A 4EKGA 3I12A 4UBOA 4W82A 1MRSA 4IJQA 1Q1QA 2ALJA 2J0SA 1HZZC 2EFCB 2VHVA 3Q11A 4JA2A 4YLEA 2NXJA 1WUYA 3QVKA 1Y8QA 2OD7A 3JD0A 4OBWA 4QT4A 4AY2A 3D6UA 1S4QA 2IQ5A 3FYCA 4FT2A 4GL4A 3RKRA 2FFJA 2M2IA 2M1ZA 4NS4A 4TVOA 1GNSA 4JBIA 4BEWA 1FMLA 1SB9A 5FP0A 2KMLA 4FN4A 2RK3A 1QH1A 3VTKA 2ZT6A 4YASA 5TMDA 4ASUD 2YZGA 4E2YA 4H3HB 5AKXA 1Q1NA 5HQJA 3T1YB 1H23A 1O6FA 1ADYA 2XCLA 3KR2A 1ORVA 3N8IA 2P9JA 3SE0A 2AGVA 4L9SA 5JJCA 4JYCA 5EERA 3PRYA 5D6OA 4KE9A 3B20A 1NMQA 4Y1EA 2D7DA 1Y7IA 3EMVA 3JPYA 3OSUA 4X7MA 4TXHA 4JB2A 5IKXA 2QTFA 5EZYB 1XZFA 2FQYA 3DFIA 4QHYA 2XB4A 2VYVD 4RTKA 5AW6A 4GKKB 1V43A 5K6AA 3FOCA 2C4NA 3NM6B 4PO8A 3CX7A 4YWJA 3FVQA 1H0SA 1Z17A 1ST3A 1H1LB 4HPXB 2WUFA 4TM8A 1IHDA 2H5EA 1ZPDA 3U3JA 2VK2A 3T3GA 1FE8A 1GNLA 1MFPA 3FPSA 3MWDB 5DK4A 1UKZA 3KJGA 1XF1A 5FPTA 1NI5A 1Y9JA 5J9FA 2C61A 3VVCA 1UC4B 2VWGA 1UOPA 2QD1A 4EO4A 5SY4A 3G0OA 3S6JA 4E30A 5JADA 1EGQA 4BQIA 1MX3A 4YRIA 1E5QA 2VH5R 4OLJA 3WQQA 1TT5A 5AW2A 2H51A 1IQUA 1C8KA 3P0JA 3X1JA 4AY4A 4F56A 5M04A 1CUIA 3BTSA 2ENUA 2B9VA 2ETVA 3HFSA 3KOYA 1LPSA 3ZQUA 4B4DA 3EMKA 5E9AA 1YZYA 4V0OA 3RS8A 4E0BA 3RUFA 1EVYA 1LTKA 1GZ4A 5KWEA 1KFJB 5EEGA 2ISSD 3CEPB 3H17A 2QTLA 4IKEA 5KKAA 1IYZA 5F23A 5KOYA 3WWYA 6REQB 3HXOA 2DHQA 3ENKA 4PO1A 1XJ5A 2QSUA 3D0OA 3CFYA 3IUBA 4DQUA 3Q7SA 4OH7A 2WPDD 5I9BA 2W00A 1JR3A 1GILA 2OENG 2RI1A 1T36A 5E4YA 2CN1A 2IEIA 1AKUA 1CQJB 1NNSA 4Y1RA 1CZHA 4HGNA 4NH4A 4HRAA 4LOAA 3IPXA 1LQUA 4YAJA 3ZJYA 1LTHR 3RIHA 3BFJA 2SNIE 1JXOA 4O63O 4ACBA 4GPTA 1KNXA 4HYTA 1X7ZB 2D62A 2CJXA 2EG9A 4XEHA 2V6JA 1X1SA 3WJAA 1PNTA 1F4PA 2J5XA 1VJDA 2Q6TA 3KQVA 3MCZA 1TUIA 3PITA 1GARA 4O4HA 1KH2A 5A4DA 3LZ6A 5E7JA 5LJIA 1LI4A 2A0KA 4E46A 4DA9A 1UIMA 4LI0A 4BDTA 1WXWA 4FHFA 4J9VA 1B1AA 2UYYA 3GVHA 3MJ4A 3S7TA 5JYCA 1PWEA 3KR1A 3R41A 4AWXA 1S9DA 1YDEA 4UMDA 1SC6A 4YRQA 3L4JA 1OGIA 3K1AA 1R0LA 1U98A 4EH1A 1UAYA 3BMQA 4WIAA 1BE0A 3OE7A 3H5IA 5DU2A 3TQQA 1X3LA 1N6LA 1WXHA 4HAIA 5HDBB 8ATCA 3IQXA 1G42A 1EVEA 1P31A 3EC7A 4KXQA 3S2SA 4BZZA 4C4AA 1DTSA 3R3XA 1Y8CA 3EARA 2ATCA 4AXXA 1BE1A 4QYXA 4GQBA 3N0XA 4CV1A 4MPRA 3TD2A 1SBCA 1F2DA 1YNSA 4PAMA 1JJIA 1SWVA 3I52A 1LDNA 4TYYA 4C2BA 1AGPA 3ETCA 4KQ9A 3UMVA 3W78A 4AJJA 1SKMA 3G6WA 3C39A 3DL7A 4N8SA 4M38A 3FWKA 3GNLA 4IF6A 1SA0B 3TTXA 3WOVA 1G98A 5KCMA 3ROGA 4BP1A 3K71B 3T12A 2N75A 1Z6GA 3PNKA 1RYMA 3EXFB 4FZJA 1JFSA 2HU7A 1I7PA 1WHSA 5JYBA 5JSZA 3QMVA 3IPYA 4PZ0A 3EA5A 2PLNA 3TFWA 6ADHA 2B8JA 4BNJA 4R1LA 2H3EA 1YS1X 3QBEA 1NG1A 2FCAA 3MRTA 2GD0A 3I6ZA 3VHQA 1JS1X 3KALA 1CY1A 5KSPA 3EEOA 2SCUB 5SV2A 3C6QA 2VNHA 4FFDA 5KJEA 5KB3A 4G89A 4KPUA 2B92A 1NI4B 3ZWKA 1ORDA 3PXAA 1VYHA 4JDPA 1MVNA 3AJ9A 3QJ5A 5LD2C 1MC4A 1Y4ZA 3BSSA 3K0CC 1RW4A 4K6OA 1P19A 4AVYA 2XXAB 1GY8A 1HFWA 3OTHA 4XIGS 1O5OA 2FSVA 2GKOA 3HYCA 4EFMA 5KQLA 2MT9A 2PCJA 1M1XB 2H1SA 3DOUA 1LI7A 1U11A 3WKCA 4DIUA 3JWEA 2H1HA 1HURA 2NUAA 3FYDA 4FU0A 4U3JB 3V80A 4F5WA 2IK8A 2QP9X 4X63A 1UPTA 3NEPX 4GVLA 4PFSA 4ZOAA 4EGCB 4HD8A 4M0EA 4YDSA 2R8XA 3R77A 4R9VA 1QQBA 4LCEA 4J2TA 1NQUA 4UDOA 3CU5A 4MUNA 2WDPA 3V1TC 3IURA 4GM0A 4MB2A 1J33A 3U2QA 3UM9A 5K0NA 3G2PA 4B17A 5CA1A 3L5OA 3GQBB 4FS8A 1KMIY 2FPPA 5DIZA 5DE3A 3IMFA 2AKEA 1KO5A 1NLMA 4LMAA 4TTPA 1LK0A 5BO5A 3JAWB 2JRLA 1A88A 5GV8A 1SXJE 3SY8A 1TCAA 2RK6A 4J2OA 4OGLA 2XOKA 2QX6A 1M1YA 1JIKA 3B6EA 3EZ2A 4Y0VA 4M36A 4Q9JA 1PL7A 5LNK6 4DE5A 4OK6A 1U0JA 3BWYA 1OX4B 3VI3B 2P9EA 1AMOA 1KZGB 3GRFA 1EAYA 1R6AA 3JQGB 1WPXA 4BLWA 4C22A 4G01B 3MTAA 3VX4A 3K8ZA 1I0IA 5MN5A 1TO2E 1VHQA 2XNSA 4IJWA 1SXJD 2OFOA 4BQQA 1UJCA 5KNDD 4IVNA 1NVVQ 4ND7A 4DKJA 1OGYA 4XX1A 5A5VA 3LXUX 2VTKA 1C0LA 1ODLA 4FYXA 3AHFA 2GK7A 2X14A 5FV7A 4BU0A 2HZBA 3RRMA 2FP4A 4DMCA 1V26A 1E7WA 1O58A 3KZMA 5A5EA 1Z2DA 3WLKX 5IS2A 1X94A 1RLJA 3EWIA 4WOJA 4RVDA 4GX0A 3L5KA 2E7ZA 2RAVA 4F45A 3RVOA 3C7TA 1TIPA 3LAWA 4Q47A 5JW6A 2JCYA 1P2VA 1J6UA 1W5FA 1JHQA 4BNUA 2F9MA 4XARA 1R4MB 3X1WA 3FAKA 3JTEA 3TVTA 4ZOQI 2INGX 2OO3A 1XD2A 3HY6A 4TLLB 1QO7A 1S8AA 1VBFA 1ZMBA 1JHVA 3AZOA 4XM2A 1U7UA 2G04A 4DIBA 4CIVA 2QAGB 1HF3A 3ENZA 3D4IA 1FIUA 3QXJA 4RTSA 1FMFA 3GNTA 4D80A 2FN9A 5ADVA 3K6RA 2JD1A 5FBLB 4Z1OA 3FPAA 5JFGA 5ICSA 4QXAA 5AJVB 1EUQA 1E9RA 1G5FA 3A4YA 2CGEA 4IJVA 2IS6A 1HNXB 2OLJA 3WL7A 2OEPA 1FFAA 2ZYAA 3CLRD 3ZYCA 1PD0A 3D2CA 1E1DA 2C4TA 2PUWA 4OGGA 3OCZA 3G5MA 4TTJA 1Y37A 1TX4B 5BWLA 1G8MA 3GD5A 2FMTA 2ZM5A 1GCIA 2HRBA 2X8JA 3AFIA 4DEYA 2O2IA 1BMFD 2D8MA 5U1PA 2HNAA 4PU0A 1TA9A 3IJRA 1GKUB 5G1OA 2CJWB 1KJZA 2JDIA 1DEOA 2D1YA 3DBRA 1C9MA 2Z2JA 3H2SA 2A58A 1Z4JA 2LPMA 3MNFA 3FRJA 1R8XA 2C3MA 2JGRA 3MF4A 3UHFA 3VKUA 4ATNA 2C3UA 3GOHA 1U8UA 1ZA2A 2GCEA 2O0KA 3FHJA 3LWDA 3QI7A 1X92A 4RY9A 2VF4X 4DXHA 4EUKA 4KN9S 1NBHA 4ZC1A 4ARCA 2IHZA 3ICQB 1YIAA 2RHDA 5TMPA 1RWMA 3EXG1 1I30A 1H2HA 3O2JA 2VZLA 1PGJA 4DYVA 1NXSA 4Z3OA 1IXRC 1I36A 4MV5A 3DTYA 4DNPA 1KPHA 2BJWA 1HTTA 2A4MA 3S5UA 3EPLA 2R3SA 4O2AA 5AUOB 3UT0A 4CM3A 5ALIA 1RQLA 4IFTA 4H35A 4N49A 4F8EA 1NOKA 1UXHA 2NX2A 1W52X 1T8YA 1BU5A 3KD3A 3SAJA 2NO5A 3VO8A 3KU4A 3OKFA 4G0PA 3P9IA 3D3EA 1AK1A 3N8GA 5ALWA 1OPXA 4YWHA 3AOEC 5F7ZA 1ZUIA 1F38A 3OQVA 4OP1A 4A3SA 2AQHA 5KOJB 1TYBE 1E79A 4FMCB 2PPVA 3AEXA 4UNRA 3M8KA 1PR6A 3AVYA 5FOSA 4CE6A 1V11A 2ABWA 2DRIA 5BSRA 821PA 3NJ4A 1V5GA 5C8YB 2CHEA 1FNNA 4LYGA 3OM8A 2UUOA 4NBUA 2ATIA 4WSOA 2G88A 5JSFA 1P2BA 2CXPA 2PD3A 3A6DA 4JL5A 4RQUA 3TZLA 5H59A 3NEJA 3O8QA 1RTKA 4IIDA 3SXJA 3QU2A 1HG0A 1QX4A 3VSEA 3UVEA 3C5CA 2QYSA 1SG0A 3G8DA 3L7JA 4OKSA 4OU5A 4ND8A 4NULA 4LC9A 3TCNA 4EVIA 1XXHB 2QR2A 3MD9A 3II6X 1YRWA 3SS7X 2P6RA 2P2ZA 3L7OA 4KV7A 4N12A 2CKDA 3BRWD 3THWA 1KYYA 3NIDB 1DG9A 3COSA 4UHCA 2B8EA 1E5TA 2WWFA 5AJXA 5IK2D 4NV0A 3ZV5A 3FMIA 2WF5A 5JWOA 1UZLA 3W05A 3JY6A 3AUXA 3GUCA 2Q0XA 2WMYA 4WHMA 6GPBA 5DULA 1WL8A 1NW8A 1XZNA 3PZRA 1C7IA 1XZEA 1N7HA 4M4SA 2OAQ1 2RH9B 4JLMA 3OZFA 2F8MA 1GXSB 3EASA 2I9KA 1N2OA 1EK0A 2H0AA 1UFOA 2ZI4A 3UQYS 4BJ3A 5HS6A 3R6WA 3K20A 3DDSA 1CEEA 2G82A 5H1YA 3AONB 3RSZA 4HYYA 1FNMA 4FOOA 2CLDX 2I2WA 5K09A 3URMA 2A0WA 5HJ7A 3ZCXA 3FCEA 2IS2A 4PHHA 1OB5A 3S99A 2VRNA 4N0MA 4M7PA 1H2YA 3MJVA 5JQGA 5ECYA 3F8TA 3W5CA 3WA6A 4IZIA 2IHJA 2H8GA 2V55B 3KQNA 3WDLA 2A0YA 3PA6A 1OWPA 1VXRA 1B16A 5JRZA 5AKHA 1QFMA 1ATIA 1YMUA 3KJXA 4W6QA 3UHAA 5BPHA 3ZTWA 2FN8A 1RWWA 3J81A 2HA5A 4JLWA 1ABEA 2BZ0A 2IZ5A 4N5LA 4XGNA 3K32A 5TPWA 3O9MA 3Q0TA 3V33A 2WHXA 3W2TA 3G5LA 3PXBA 4ZTBA 4IDOA 1W0JD 3DFMA 2GN4A 2VP6A 4JUCA 3NNNA 4KO3S 4TTRA 3NNDA 4MJ7A 7REQA 3D3NA 3E22B 3KR0A 3F98A 3L07A 4PEVA 2WHEA 2B35A 5HZGA 4J0CA 3DL2A 3FUTA 4HLCA 1ODKA 4LZZA 3LFUA 3ROQA 4Q03A 1K7SN 3Q3GE 5IHXA 5E9WA 3EDQA 2HSEA 3W8RA 1RZRA 2COKA 1WHTA 1PR5A 4MIYA 3AEKA 1KAQA 1EXNA 3KDSE 1ML4A 1SHJA 1L5KA 5B57C 4C89A 4RVFA 3CNEA 2XTZA 4TZKA 1HEIA 2NV6A 4I8DA 4KQJA 1EM8A 5ER9A 3LZCA 4EPYA 3PXGA 3I1IA 4JV5B 3BBPA 2P2NA 1PQPA 3R3VA 3R8CA 4F85A 1VKOA 2PKWA 3PDJA 4FMCF 1E4OA 4D4LA 5AESA 2LWIA 2BMWA 1CP2A 2HPHA 3O3CA 1ZQ1A 4BN0A 4JSRA 4D0GA 5B3JC 5BORA 1VG1A 5C8YF 1U9ZA 3D6HA 1FS6A 3QLEA 4DB4A 5CGQB 1GOTA 1RZ3A 4HMOA 1VLVA 1V6CA 1A9ZA 1H6DA 1Y7HA 1B2LA 1ZGGA 2F17A 4TS3A 4E5DA 2R1VA 2CNWD 3E15A 3UC5A 3V00A 1ZA1A 3WRXA 2BEJA 4HH1A 1CF4A 1E6EA 3I30X 5TGTA 3ZNOA 1DIAA 2W98A 3FI0A 1EXMA 1Z07A 5DNDA 2BE9A 4EW2A 3EYAA 3O8RA 3ENWA 721PA 4RCZA 1R5JA 3IV7A 5IKPA 1TZ2A 2WAXA 4H08A 1FOEB 3ZCTA 2AFHB 3HDTA 1H2ZA 1C7ZA 1QWSA 3GWZA 3ONVA 2I3AA 2O8DA 2WTBA 3CG0A 3RSQA 3LKVA 1BNCA 2R6DA 5FWYA 5KHLB 1D0SA 1VYTA 3H84A 4I2NA 4KVZA 1A2BA 4I6GA 3ZLBA 4JYBA 3ISVA 3P9PA 4BV8A 4XASA 2QN7A 3G1WA 2VT3A 3LQQA 4G1CA 3B3JA 4KWIA 1TJ5A 1X86B 1LVUA 2CMHA 3AHDA 4NONA 4XI9A 5F2KA 4A6DA 1B74A 4FCTA 4C7MA 1EI9A 1ZVKA 5A0TA 1EFPB 4NBNA 4BNWA 5I7UA 1AU9A 1MF7A 3H87A 3OP4A 4OHVA 5T8KA 1TIBA 4WZBA 1ECFA 1OHHD 3A1FA 4XVQA 4D74A 3PUJA 5KVCA 1WLYA 1NBIA 1Z8FA 1ZH6A 1KO4A 2Q9BA 3OG9A 4ZAZA 3VAYA 2PGNA 4ER6A 1UZNA 3P0RA 4XIFA 4EVQA 1SCQA 4ZVVA 5BSGA 5GZ1A 3DSRA 1O95D 4HLQB 4JC5A 4YNBA 1U8XX 2H1CA 1PUJA 2R48A 2I8AA 4HB3A 4KK3A 3TD9A 1J8VA 1LPAB 4NCHA 4P4LA 3WB1A 1N1EA 4JHLA 3AYZB 3PWKA 3ZWWA 2BIFA 3JRXA 3R7DA 3K0HA 2DSNA 4QZVA 3M4ZA 5ARBA 1M0EA 1XRMA 1R0KA 3RG8A 1V8ZA 1L3CA 3B9QA 4KYTA 3F8WA 3ZWNA 2ZJFA 4WNIA 4DN6A 4PPGA 4RPIA 1FMJA 1ODFA 2F90A 4F5DA 2WVGA 4ME6A 1OI3A 4YRNA 5CEJA 2D06A 1TE2A 3NP7A 1Q1EA 1DDGA 3PUWA 4E31A 5B12A 3OZCA 1GVHA 4P5DA 4Q1BA 1VJCA 4PGFA 4FD2A 2FFBA 2WT4A 4X1KA 4W1PA 3VPFA 1F6DA 1E3DA 1L7VC 2C29D 4XWWA 1NHGA 2ZIVB 4F8JA 4DV1B 5JARA 3N87A 3NO4A 4Y9SA 2FRDC 1ZN9A 2HCJB 3DUFA 2GZSA 3MBKA 3CJTA 4NWIA 4JB0A 2HN9A 1F12A 1H0KA 3CINA 3FWZA 3BDIA 2O14A 2R6FA 4YPVA 3HPRA 4J03A 2PMKA 2QRLA 4MNTA 4NAUA 4HTFA 4RD2A 2JHCA 1YAHA 4N76A 1N0UA 2VDVE 1LWOA 2W90A 1GG5A 2EZUA 4G1EB 1QQ7A 2G6BA 3C43A 2X86A 3CLUD 1PYGA 3E0XA 4WKBA 1DRUA 4GOLD 2R5NA 5E7QA 4AQDA 4Q0MA 1WKBA 5BW4A 2EYUA 2R6R1 4BO8A 2Y8EA 2DEUA 2XWBF 4Y0AA 3U49A 1CETA 4BP8A 2RD2A 3CLSD 3DVLA 2J0VA 4OKNA 3NS7A 3QSYA 2VNIA 4XLZA 4XPZA 3SOPA 1FJXA 1KOGA 4ND1A 2IY8A 3FCCA 2XUZA 2PX6A 2ZR7A 8ABPA 3ZE1B 4WERA 5IJWA 2R65A 1N77A 3KVRA 1MB2A 3HBMA 5K1ZA 3WIEA 2XE6A 5I3ZA 1MAWA 2ZZKA 2PV7A 2WY2D 4Q1AA 3DT9A 2AMYA 4BMCA 2NU6A 3CLVA 1YAJA 3GFOA 4JEUA 5LQAA 2A5FA 5BV1A 4P6VF 3FOBA 4IV8A 4PZUA 1CSEE 4AN4A 4TMFA 3L4KA 3OIWA 2IXBA 2M6LA 5IANA 3OA0A 4RD6A 4O5AA 4LF4B 1W46A 2H08A 3JAKA 1IZYA 2Z09A 3EC2A 1OXUA 1FDIA 3HU1A 3CUYA 3C98A 4R1SA 5ILOA 4Z53A 2VWHA 3HYLA 4TUYA 4UBLA 5J63A 4BNLA 1MTOA 2ERXA 1R9GA 1P9RA 5BR4A 4RZUA 2JB9A 4NE7A 2O05A 4G63A 2R68A 2ZRJA 1XKQA 2JA1A 3L8MA 3P20A 1W0KD 4GVXA 3H5VA 4KXWA 1TKCA 3SR4A 3VV2A 2ERYA 5K0BA 1O87A 4NXNB 3I6BA 3L6UA 1QC5B 1W44A 1PDVA 4P7FA 4IVPA 4B45A 3F67A 4WY8A 4UASA 1Z8HA 1G20A 1GKLA 3P9CA 4HEA6 4MLZA 2JPDA 1ONBA 1KO8A 2IXFA 4GDMA 3VKVA 2L17A 1UDCA 2P6PA 2R86A 3Q7QA 1IEVA 4LX8A 1ONNA 1DKUA 3D7KA 3JQ7A 4B4WA 2IIQA 2DUMA 1MPXA 2H1VA 4Q4LA 3PEVA 4Y2UA 3X2EA 4JASB 1MC1A 4JQCA 5JANA 1XI2A 1V1MB 4MV0A 1CZKA 2X8BA 1P4RA 5CFOA 3KS9A 5BUCA 3AV0B 4QXRA 2TMGA 4DR1B 3F9RA 3JQAD 3VBEA 4YAGA 1N3LA 1X9IA 2BDEA 3WJ7A 4I1VA 2B7BA 4Q3DA 2OV4A 2YS6A 5EFZA 3SF8B 1PX0A 2JLBA 2OLKA 4QGHA 3C41J 3UWSA 4Z6KA 1IM8A 1FFWA 5DSXA 5LMZA 1W36C 8AT1A 4AB1A 1KE2A 3VKFA 5L3VA 1XN4A 2RJ3A 3S2UA 1IZ0A 2ZATA 1E3LA 1GGEA 1YL6A 1ZI8A 2L2QA 1BHJA 3GGOA 4RELA 3EVTA 2IZ0A 4N54A 1DT3A 4NCKA 4TL8A 5DYTA 2XF8A 2LXNA 4LHWA 1T0UA 3HZHA 4PG8A 4CZ2A 4UJ3A 5CFMA 3ASUA 1FFGA 5CVEA 1P4AA 4XJTA 4XJSA 3ZHSA 4WJKB 1YB6A 5HTOA 3MT0A 3PGXA 2GJAA 2X0KA 5DLEA 1ISSA 4EA8A 1C3EA 2VP0A 3I9V6 1QORA 3D5QA 1GZ7A 2JH3A 2BPOA 2RCNA 4R68A 5KIAA 4G26A 5JE8A 2Q5QA 1O0BA 1VCNA 5LP6C 3WZMA 1NJ1A 4AXBA 1ISPA 3ZBPA 2YNMD 4PQRA 5JMPA 3M1AA 3U0BA 1PEDA 3CTPA 4NMLA 3QEMB 4OIFA 1ZEMA 4E1AA 5FOTA 3AG5A 5F5NA 2HHLA 1E2DA 3INNA 4G56A 4JKYA 4KRYA 1C1XA 3DXXA 2JI9A 3EFEA 3MWYW 4G5YA 4DJEC 4TKZA 1G9XA 1Y80A 2ISCA 3QKSB 4UUPA 3K2EA 4GZ5A 4UAUA 1IBMB 3O1JC 2ZBUA 1JE0A 5FPQA 2ZUDA 2UYCA 5AKLA 3KT6A 3L01A 1CY6A 2B20A 3AEUA 2WJYA 4D9GA 2QZ4A 2ZTVA 2J9XB 1JH8A 3LP8A 2WSLA 5DNCA 3CZ5A 2ZBFA 3IO5A 1XTSA 4IHJA 4BV2A 4AS2A 2XADA 3A31A 3D4OA 4MWBA 2HX1A 2XZLA 3C0KA 1IIBA 3LUGA 4GYJA 4MHSA 4D79A 1KO1A 4PVCA 1JHYA 1RXSA 3D7MA 3ESCA 3R74A 3QXSA 5JNUA 1ZU4A 1ZNQO 3DHNA 3HUUA 3N2KA 1QHHA 1N5DA 3K05A 3NETA 1MDFA 1XWWA 3QE3A 3JYPA 3L40A 5TNXA 3QQ5A 1HYBA 2WFLA 1Y8AA 1I2CA 2BFCA 1VHLA 2J9ZB 3O92A 3ESRA 1X6VA 4LCBA 4LY6A 2YMMA 3G23A 4QLAA 3WLTA 1CWUA 4KO4S 2JFFA 4FSHA 2V8OA 3MWEA 4ARVA 4M83A 4IW3B 4HGQA 4Q00A 1Q7RA 1ZS9A 2FOIA 1KK3A 2Z95A 1P1HA 4HDSB 3EQZA 4R1PA 3UKDA 3UT5B 4CKYA 5IEJA 1KKLA 5ITWA 3UJ9A 4UAGA 5JS7A 2ATVA 2EZ4A 4BFZA 3W8EA 2XECA 4RIHA 3GLHE 2VEOA 2EU8A 1UBOS 2RCYA 2NVUB 2Y1GA 2CXRA 3AF0A 1JHXA 3ENQA 4DWJA 3NIWA 4NZMA 4WK4B 4CM6A 1JDPA 3GF4A 4YV7A 3LP5A 5C0OE 1CUEA 4ARUA 2YYYA 2AW5A 3RYFA 4BRSA 2A5GA 3CWZA 1OU0A 5KWSA 5HA5A 4DDWA 2XBLA 5TPZD 3H8SA 1GKYA 3NJ8A 4XPIB 2GI4A 1AO0A 1JLHA 3NDIA 4QJ3A 4X8LA 1KTVA 2IX3A 4C4XA 3E9DA 4OYYA 3CBGA 1L9KA 3EGXB 4I3GA 4U7HA 1SHLA 4AM8A 3BXXA 4B0PA 5F1KA 1F14A 2W6JA 4H16A 4DSZA 1IK4A 1QE0A 5LB4A 3IIEA 5FTWA 2P79A 2WNSA 3K53A 4WXYB 3TE7A 3ESAA 2PZAA 3TF5A 2Q7OE 1JTVA 1PS8A 2XA1A 3W7AA 1Z47A 3R7BA 4I5GA 2P2GA 2IELA 3VR5D 2GTIA 2HRRA 1QSGA 3IXLA 3MCWA 5AOVA 4QYSA 1ZC4A 2DQZA 4RHUA 1NSYA 2DFTA 3LUJA 3NC0C 2G4LA 1Y89A 1ZK4A 3FMOB 2LV8A 1T4MA 1Q44A 4P84A 1N4AA 2HA3A 1KZ1A 3KDPA 5C31A 2PVPA 4U7TB 2JGKA 2NO9A 3L93A 4PV7A 4ALMA 1VIVA 1YBHA 2R6ZA 1WO8A 2FGKA 3BXGA 4J0JA 5D3ZA 1IG3A 1PE0A 2VNKA 2J33A 2NVBA 1DG1G 1OZ0A 3M1LA 1SUSA 2Y77A 5CNIA 4ER7A 1L4KA 3JZAA 2QAGC 1NY5A 3EQ7A 3OT5A 3FHLA 2PZMA 5IBPA 3DZ8A 3L7DA 3ANXA 3PEFA 4IX9A 3T3DA 3WTCA 3W6NA 1V45E 3TINA 4BAZA 1ZRNA 2BF4A 1XQ6A 4QNRA 2ZE8A 3AJ8A 2ARKA 2GWHA 3KJHA 4DA4A 3KKKA 3V7WA 3A4TA 3S2EA 3QFSA 5J4VA 1V1RB 5JXIA 1Z34A 5I01A 3VH1A 2P6NA 2XGSA 1DC8A 2VHWA 4A0SA 5MN4A 4X95A 3HKEB 1CG6A 1FLVA 1KRWA 2F48A 1E32A 4P5PA 5DGTA 2QUIA 1RQ7A 3L7AA 1OLXB 5CYGA 2FWBA 3CRRA 2D59A 3IAAA 1M2KA 2VF7A 2JIBA 1EUDA 5EXSA 5EWJB 1ZW6A 2YMPA 3INTA 4E6PA 1AF4A 1SCDA 3RRJA 4BVJA 1E4EA 2ECOA 5JEEA 1K92A 1NYRA 1IDOA 2A9JA 4B40A 4G36A 2EP7A 2V0CA 3DDZX 3HDJA 3IDFA 2H18A 3NATA 2NNWB 3KG2A 4KVGA 4GKBA 3V32A 5I3CA 1PIWA 4XQEA 5CVTA 2QLFA 4IJKA 3PJRA 2LIPA 1ZYUA 2E4WA 3CNNA 1U8AA 3FZEA 3Q3VA 4QELA 1TJ4A 5TF4A 3MHTA 4C0HA 4NZPA 2GBCA 5G0WA 1BW9A 2V4UA 5EHXA 1X7YB 3EGCA 3QFHA 3RKUA 3VHXB 4INAA 5FUMA 5KNCH 3IDAA 3EZFA 3GRUA 3IGFA 4HLUA 4ER5A 1QRTA 4QO7A 1FX0B 3DTVA 1Z82A 2EJBA 3I1JA 3NHLA 5EYPB 1VIDA 2X40A 4HZUB 3VPBA 3AW8A 4C6HA 3ZBQA 4AUMA 1V8PA 3AF3A 2XF2A 1X7WA 2P65A 4FEEA 4MWGA 4HP8A 4WN9B 3PGVA 3CWQA 5CT5A 2L18A 1KZ7B 2YASA 2HLDA 3C4QA 3LCUA 1EUCB 1QFXA 4Y2JA 1M76A 4R7ZA 4WW0A 3LSYA 5AI9A 1JEEA 1K4YA 3VC7A 2FWMX 2Y1KA 2QUAA 1N92A 4K26A 1BH6A 4N0DA 4CKBA 4KRFA 5LQMA 1PTJC 1WBBA 2ZBVA 2YV4A 1VG9B 1E64A 1E3WB 1R8SA 2GVNA 2R6AA 4NBSA 5B1IA 1Y9EA 4MUXA 1PVDA 4TLEA 4KBYA 3F6CA 1DXHA 1CE8B 2TYSB 1F0KA 3O2NA 4G8CA 4OH1A 1A72A 1Y5NA 5GOZA 4ZHSA 4NMMA 1IUOA 2DPMA 4JC0A 2P1RA 1QIIA 1V7CA 4OJNA 2Z9DA 4F2GA 2F4VB 3OETA 2RAUA 5IT0A 1NQTA 3I83A 1GTJ1 4QPDA 1F9AA 2FSHA 3AWDA 4TTIA 4NOJA 2GN1A 2JW5A 3TE6A 2RI0A 3I5YA 2AWOA 3FKQA 2BEUA 2ZDGA 4PQYA 4M98A 3K0AA 4R1UA 4YRLA 2XI4A 4PLTA 1QRUA 1JJVA 2YBDA 1IMOA 4F04A 4JT8A 5FV4A 3BK7A 3A0RB 4G1FA 3FR8A 3RLFA 4QOEA 3E03A 2IKQA 4ZO4A 4RTNA 1KIFA 4P58A 4Q12A 1YJBA 4YFVA 1WB6A 2WTUA 1IIRA 3NTOA 1V4BA 1Y3HA 2QORA 1ODCA 4MVJE 2YHSA 4XWGA 3WOHA 4O4LB 1H3FA 4E32A 5LKAA 3GIDA 1VJTA 3DEHA 4RQAA 4I4IA 5ALTA 2GS9A 3IUEA 4H1VA 1BE8A 4NG4A 3BB1A 1BDBA 3PKJA 4B71A 2IPMA 2P3QA 1BH2A 3P0HA 4TKVB 5K3EA 3WGIA 1WBJB 3G1TA 3I9LA 4LY3A 5LBIA 3U7HB 3TJRA 2WJAA 4MVYA 1FBTA 3LP6A 4G5HA 2Z3WA 4Q66C 4H6XA 3QMPA 1P0FA 2ZSFA 4L0MA 2YOFA 3HJNA 4MVJD 3RUIA 4B6PA 4HVLA 2DBZA 2HK6A 3FI9A 4GPZA 1FXWA 1LA2A 1SQ6A 4TN1A 5DNAA 4KPFC 4BX3A 4UUQA 1FRNA 1UOEA 3U62A 1QTIA 3ZU6A 2C8JA 2FPWA 2XYGA 2YJ6A 4N48A 2Q99A 4QTYA 4NOKA 2ZI7A 5B1SA 3EVGA 3PNOA 3ETDA 1ELOA 4UCFA 1VLMA 2JGIA 1WDTA 3OJCA 3TRJA 2XAUA 2R7NA 5TY0A 1R8JA 1QYDA 5A9RA 1I3OA 2DBRA 1PW7A 4B2IA 1DPGA 1JDJA 3HCAA 3FNBA 4BBAA 1MX9A 4FW9A 1LQ2A 4HMPA 3UICA 4CU5A 4OHXA 2M98A 3ZXXA 5E3IA 2IHVA 4RFLA 4H31A 3U6BA 3P9RA 4B83A 1NJSA 4REMA 2QQFA 3GLFA 1TQ4A 2FQ1A 4CV2A 4U2CA 1AUXA 4LYAA 2FSGA 4U2EA 3QWFA 4TYQA 5HF8A 3IIKA 2DP4E 3E18A 4IMRA 1RYBA 4LA4A 5AI0A 5EJIA 1R6VA 4JJFA 1NTRA 2QENA 5FXMA 2C96A 3TLGB 4D8YA 4LYYA 4YMWA 2WMNB 3R09A 2CYAA 2P5TB 5CM2Z 2A1UB 4FMDB 3N05A 4BL5A 4U8HA 2X1MA 3OIYA 3UJ8A 4DDVA 2C1XA 2MSDB 5EMHA 1DG3A 3WHLA 2NPOA 3HRHA 5TE9A 4CR7A 2ZJYA 3RU2A 4LDAA 1LK5A 4CETA 1ZOOA 4B8WA 2PBZA 4L9RA 2BEKA 5AJYA 2WSMA 1VSVA 2DUJA 1LS1A 2YDYA 4J2HA 3RBZA 4AUKA 2QGFA 4XQ9A 1T8UA 4HSEA 1R6BX 2OZPA 4OGWA 4OX9Y 2NGRA 4FFBB 5AH0A 3TTUA 1GGVA 1L6RA 3AZPA 4RV4A 1SCUB 1XTUA 3NEAA 4CMCA 4JJIA 4W1RA 4Y2RA 3FYUB 2BGNA 3VFDA 4BKRA 3GLGE 4M3NA 4U5XA 1RPNA 2BSXA 4M1EA 1J1IA 3K6SB 3IKVA 2Q62A 2RKOA 4EJFA 4NCNA 1OZGA 1FYDA 2FUG1 4REQB 1BS2A 3HSSA 4F12A 2ZZMA 4YRRA 2BZSA 4CTMA 3OCYA 5JD5A 4NJOA 2XMPA 5KTKA 3EWAA 4XWYA 4HQKA 2WU3A 4AJKA 2IEGA 1ESMA 1JQ5A 1QR6A 4L9AA 3RFUA 2UUCB 2APJA 1GTL1 1V8FA 4N4AA 4O4LF 3VVMA 1I10A 3IEPA 4MR7A 5AXDA 3PNPA 4Z9BA 3NT2A 5SYNA 3AOGA 4LYEA 3ZY5A 4B48A 4ZVTA 2PS9A 1E2MA 1K7CA 3FB4A 1NVFA 3P5BA 4OTZA 4U9IS 2OO7A 3DZCA 1KR5A 4GSYA 4K9MA 1XO1A 3A05A 1U6KA 1X3SA 1ZITA 4HDOB 4LKRA 4O59O 5I7SA 1YRHA 5IXYA 5KNCA 4C2UA 3RIEA 1XZ8A 1IRXA 4WEQA 3RPEA 5TJHA 4F71A 2K5UA 4WXHA 3BFPA 3LT0A 4F1WA 1VLJA 2WP8J 4GMGA 2WHPA 2HA7A 4IOLA 3P27A 5IT9A 1FW6A 4GOXA 1VOTA 2HSJA 1JILA 3P2IA 5JROA 2ZIEA 1FLAA 1ZJ6A 1RMTA 4MV7A 1N1DA 2C2GA 2IYLD 4IX1A 1T9DA 4S05A 1D2RA 1Z3IX 3PD0A 6PFKA 1C8BA 3KTAB 2AEEA 4NMXB 1V3QE 1GGHA 1ZNWA 2NUBA 4GBJA 2AJBA 1V95A 3D9QX 3ZU4A 5T5QA 1WXFA 2Z58A 2IUYA 1K3TA 3EYWA 3G13A 4RZHA 5FPYA 4EAAA 3DFUA 1YJ5A 2QLJA 1P2GA 1B14A 2A2ZA 3MJSA 4IWNA 3GQVA 4LOIA 2H4XA 4NBKA 4TPKA 1VQ1A 2H3HA 3LLVA 3AIKA 3AYXB 5DZSA 1A71A 2QQEA 1R50A 2YVQA 3TSOA 2OGWA 2RGRA 3CZMA 2NSYA 3HHEA 3ORFA 3U3KA 3K9FC 4OSOA 3RWBA 4BZWA 2W2KA 5B2ZA 5ELLA 1LRKA 3O93A 1KQGA 2V59A 1LFDB 4HNVA 3J81k 1U9IC 2FY8A 3KYDA 1K97A 4E70A 1G8AA 3EGVA 3GFSA 4RJLA 4TWZA 1V5FA 1VIYA 3KXDA 5KJCA 1XELA 3SX2A 2BGWA 5TEVA 1Z15A 4G25A 2EWMA 2FA9A 2V3VA 2PX0A 5GJCA 1QRRA 3WBKA 1XMQB 3GLIA 4DOMA 1AXGA 2NV0A 2PPLA 2RH4A 1R66A 1TF5A 1FNSA 4Y2HA 2VYFA 4M0CA 3EZGA 3GMIA 4MRAA 4IR7A 3TAUA 3V8EA 4R69A 1N5JA 1KC1A 5KDOA 1E2UA 3OJFA 1G16A 5DBGA 3EAFA 1DLIA 4KEAA 2X76A 5CVVA 4GPAA 5K51A 5LKRA 1U1FA 4RHYA 1QJCA 2CCJA 3DR3A 2HMAA 4HDKA 4TLDA 4QUDA 4MGZR 2CDAA 3DO5A 2GX6A 4GMDA 1J0XO 2R1TA 3EH2A 3M1YA 2AXQA 4WOPA 5B1EA 2IODA 3UA3A 1T9GR 2NT4A 1E6WA 2QTCA 3KPYA 3E6AA 1OROA 5F76A 3WLSA 3U4MA 3UWDA 1JQKA 2PL3A 3P5SA 4WNAA 5ALNA 2ODEA 4ARSA 1O8BA 2PKQP 1F8UA 2G0TA 2LDXA 3GEMA 2PZKA 1RCFA 3I72A 4A0GA 2Q4EA 1MO5A 2Q46A 2ZRFA 4RKEA 4YMTA 3T06B 5F1OA 2C97A 2GUWA 2JIZD 3E23A 1VE1A 5HQ3B 3TVDA 2RB5A 3IEKA 2P91A 3ZDQA 1KY2A 4HDRB 1ACLA 1XA3A 1YE5A 3M3DA 4PG4A 4CTKA 4ZGGA 1YBFA 4KQ6A 1M0WA 2XDAA 3QHPA 4GECA 1I2BA 3MEQA 1AKVA 2BAGA 2OOKA 2VPZA 4GZ3A 3X43A 5CNMA 1BXKA 1M8GA 5CX1B 3GJQA 3L0OA 2ZKIA 3QWHA 4F86A 5TX7A 3EGDB 1XCGB 2D1FA 4RVHA 3FWPA 4AKSA 1ZN8A 3ZZ1A 4Z4CA 2AJCA 2KS6A 3DV0B 3AW9A 1YHNA 4CKCB 4YCCA 4XGIA 4PC2A 5CVUA 3HY4A 2VNJA 4MH0R 3LBNA 2EBFX 1YIDA 5CLQA 5E0KB 4QXQA 1OWLA 2LDBA 3L1JA 3OICA 5A04A 2V1XA 2H8KA 1LJ8A 4MROA 2QM8A 3TOVA 1MU0A 1XCLA 2HRCA 2W8BB 1L5LA 3F1LA 1Z6XA 3GGSA 2HQRA 1ZHFA 3LBYA 2XRZA 1TUGA 4GGMX 4JOSA 4N0PA 1P62B 3K5IA 1Z4OA 3WYBA 5IAOA 3AVWA 2J67A 4GMFA 4OQMA 3T94A 1KARA 2OYRA 1TCUA 4NYMR 4BNKA 4DAOA 2EX4A 2VJQA 1YTUA 1YDWA 3DPSA 5JFTA 2H17A 1T2NA 1CUCA 5A0FA 4YI3A 3DOJA 3REQB 2VK1A 3ZXIA 1O6BA 4FB5A 3T1NA 4MMZB 3IMKA 4UZEA 2H9AA 3A6FA 3A4LA 1M74A 1A5BB 1D4AA 5B7QA 4W9NC 1NVWQ 2I55A 4W5WA 3ICVA 1WEKA 1SU8A 3S2ZA 3AHIA 1OR8A 1NFQA 1OTHA 3R5FA 1SPXA 3D1LA 4M89A 4TS1A 3O9ZA 1LD3A 1PFQA 3ZD8A 1A69A 2OV3A 3JYQA 3NX4A 5EXEA 2QRQA 4CEHB 2HUNA 5JMWA 3C70A 2WG1A 1FFBA 4B9EA 5AVVA 3RC3A 3SF0A 4RIGA 3W2GA 3MUEA 4PCUA 3KQPA 1L7NA 4X3OA 1IG0A 2CCKA 3E9MA 4ZVMA 2I2XB 2HK8A 3L1UA 4FB4A 4IRXA 2A9PA 1ULZA 3CF2A 3LWBA 3FSGA 4L07A 1Z35A 2GHIA 2FKAA 3NHRA 4YMVA 1VKHA 2WUDA 3N8KA 4AF8A 3TLYA 2CVQA 3AL0C 1QV6A 1JVBA 1OW3B 1UM9A 4IH9A 2RE8A 4JP3A 3BWEA 3B3QA 3PQFA 4XWTA 1YONA 3AG6A 1GRRA 2OBMA 4ZQGA 5J43A 1UBEA 4W9MC 2PXAA 3GBVA 2CXHA 2FLVA 3I2FA 1P60A 4KMMA 1BN6A 2UYOA 3PQ3A 2X3FA 4EKNB 3V4PB 4EG5A 5KC8A 2VPWA 1JGTA 1ZNYA 3AI3A 4QFMA 1ZVJA 5MHTA 1WXXA 2Z2YA 3B7GA 3O03A 4G4IA 1SC3A 3K09A 1UMCB 4CKWA 3NMUF 3ETGA 4W5NA 1RC1A 2NTJA 3O3NB 5G40A 3TZBA 5MGNA 5KYKA 4ERNA 1H2AS 2A78A 1ZH4A 2JKYA 4N1AA 4LHEA 2EGUA 5H3CA 5YASA 1CEQA 4IXDA 1ADBA 2AW3A 4XRRA 4ZCPA 3TR6A 2Z8XA 4CM7A 4FFNA 3D0QA 4PPYA 4B7ZA 4KU4A 1USVA 5KYYB 3B12A 5F7XA 1OBCA 3E9CA 3EVNA 3M6WA 1QYWA 5DBEX 4A92A 1CD5A 3DOIA 5CRIA 4EFKA 1T9CA 1V35A 1GQOA 1E3MA 4AJ9A 1RPAA 5K4AA 3GCXA 1SIOA 3GFBA 2QHXA 2ZSAA 2QLNA 1Y1LA 4KAXA 4I3HA 2ONYA 4PYOA 5E6SA 2R87A 2YIMA 1TCVA 5F1PA 4JIMA 2OB2A 1E5DA 3Q40A 3ZX4A 4AWBA 3PG5A 3BMNB 4L8VA 5I9LA 3ABIA 2FX2A 1WA5A 1HOXA 1TUEA 1Q0UA 1KJ9A 2B1JA 2IYNA 2WTXA 3OD1A 5D5QA 4AU1A 5AVYA 4G0WA 3DB2A 4QPNA 4H6WA 4GG1A 5K0FA 3FFXA 3A6PC 5HF6A 4EG8A 5KYWB 2P9FA 5KTYA 2D2EA 2ODQA 3P45A 4C30A 2GLUA 5EIEA 3FLAA 1KDOA 3HLYA 2YFHA 1BGVA 4NFSA 4BBJA 5L7WA 2BDTA 4J6EA 4MI3A 5TQVA 1RC8A 1E62A 3WL6A 2RK4A 5IFLA 3R0QA 1U0NA 1E18A 4RTJA 2DHDA 1XU9A 4B73A 3IV6A 2B2XA 4CDMA 4BLUA 4M0MA 4ZGWA 2DUUA 2I4LA 4ZCSA 3CVJA 3R6DA 5FI3A 3PX7A 3OIFA 4TWJA 2ZYDA 1RZVA 2CLEB 3E61A 5GADl 4EZEA 1L8OA 2AK3A 2GF9A 1LFAA 2R4QA 3KQKA 4O1MA 3KD2A 1Z0DA 3SYKA 1W35A 1L7MA 2ZK7A 5CT6A 3CT6A 5KYXA 4EJ0A 3V1LA 1DRVA 1Y81A 3SR0A 1XQWA 2QRJA 4ZVLA 4CN9A 4B5KA 1FBNA 1BTOA 2XT9A 2AFIA 4EG6A 1CVRA 1THTA 1ZXLA 4MIOA 4OI2A 4TXJA 3GA0A 4UBJA 3QSGA 3VMMA 4DQLA 4BZPA 5C3MA 1Q0TA 1CUXA 1JW9B 5JV5A 5AK6A 4JVSB 2QMZA 2GFQA 3CRMA 5HSGA 1UUFA 3KEFA 3NTXA 4KB5A 3TLKA 3FNGA 1UAAA 5HBGA 3P4UA 4Q3CA 3W9BA 3QITA 4G0XA 1JLLB 1YJ8A 3U3MA 3QEJA 1H8HA 4K6MA 5DI3A 1U80A 1HE5A 1D6SA 4GEGA 2NQ8A 3DNFA 1H69A 2AVNA 2VJOA 2IYFA 2JJ8A 3A10A 4BQRA 4EBBA 3B78A 4R71A 3NALA 4M9XA 3U7QA 1QGZA 3TZCA 2D7CA 3PQ2A 4QPJC 3FF1A 1T4CB 4UMVA 1L1EA 3O7WA 2XQGA 2XBUA 1S2MA 4DR6B 4Q9NA 2X1VA 5KKCA 4BLSA 4JITA 1Y1SA 2WWWA 1CQZA 2WYOA 3FKSD 3KR9A 4P3PA 2RBEA 1L8XA 2QLTA 4KJXA 2VRCA 4A8HA 1YZKA 4EQ6A 2HRZA 3OFJA 1TIKA 3H6GA 2NPFA 2QDKA 3GWGA 1ZH2A 2J3HA 1TQ2A 4Q82A 1G5QA 1GTVA 1S2IA 1WV1A 3EZ7A 1OAOC 3NDPA 4EP1A 5A62A 5AD1A 2ZJBA 1E0JA 1JKJB 1N57A 1K7FB 4RE6A 4NENB 2G5TA 1MD9A 3U4DA 4OJTA 3HXTA 2MINA 1P77A 2WLTA 2JAWA 3EIQA 3I04M 1VA5A 3VR3A 3GNQA 3WAJA 1Y6GA 4FSDA 4DM4A 2QUZA 1NULA 1ZZGA 2YS7A 1NVEA 4F1KA 3ZZNA 5JC8A 1HT2E 2BN4A 1DKOA 4XGQA 1B0PA 3P9XA 3N8DA 5FPHA 1XD9A 4KFRA 3OQ1A 4GXTA 4UFPA 2G8LA 3F6YA 4G85A 2QM7A 1N2JA 3WXMA 4CLHA 2J59A 4JKIA 1G60A 1O96A 3JS5A 5EE5B 5G4KA 2O54A 4YK7A 1XZHA 5JSUA 4A8JA 5IXSA 1QDUA 4PAOA 3BBLA 1AB5A 2QR5A 2V58A 3L0IB 3LPNA 4LJAA 1T8WA 5FBQB 2HNKA 3TSAA 3CEJA 3IDSA 4H3SA 3R1IA 4KIWA 1QK4A 3W5DA 4XB6B 4Q5IA 2WJPA 1I5OA 3RRBA 1DXOA 1OASA 1U99A 2ADOA 3E5MA 5LMUB 3RWOA 2BKEA 5J2UF 2P4SA 1OXXK 2GDJA 3K30A 1HMPA 3CUEF 4G9GA 4MRVA 2J3LA 3N59A 3D8UA 4MW6A 1VPVA 5I9TA 4TGLA 2ZJ5A 5DW3A 4D9KA 1JIIA 3I4LA 1JSZA 1XEAA 2NZ2A 2DBQA 2I2AA 1T9GS 3V9AA 5HS4A 5IDQA 3JALA 5EVCA 1CLEA 2COUA 5FNVB 4BNIA 5T7BA 5FLXA 2XUFA 5MFZA 2GAJA 5FL3A 3M4JA 3NPAA 1VKJA 4W5JA 5IZ4A 1VGRA 2VRWA 2I91A 1YZTA 5KTPA 4MGHA 3ZCVA 4BDSA 2Y76A 2B0CA 5FHRA 1XG5A 2BGRA 3HWX1 4GQIA 2BFEA 4M9UA 2F62A 4IH1A 4WJZA 4XWAA 1P9OA 3RVPA 3BEOA 3DAOA 3RW9A 2WJIA 2VYCA 2JGDB 2ZOSA 4EUNA 1QYCA 4E2WA 5KQSA 2ZT8A 1FDVA 2PRZA 3BXHA 3I61A 4FKBA 4L6IA 4CFZA 5E6UA 2HQOA 4MV1A 4ANFA 1OUMA 2EKQA 3V5NA 5AHXA 5DEIA 2P2CA 2PL9A 1N9KA 2VYND 3P9NA 4HFNA 3HXPA 3DOHA 3T5PA 1Y9ZA 3IX7A 3DKPA 4TMYA 4MR9B 4OPMA 3SBDA 1CQIA 1J2JA 1HA3A 1YHZA 2A86A 3CT4A 4CQMA 1PR0A 3W9UA 4HNQA 2OTCA 1T6NA 2QE7D 1PGPA 1II8B 3ECSA 5EJ4A 4KR0A 3U1VA 2AK2A 3BGSA 1AJEA 1CVLA 3FTDA 1LLQA 3FTNA 2A9VA 2AG6A 4JBXA 2JEOA 1CFJA 3H3JA 2FSFA 4G5QA 5LC1A 4K9DA 1YH3A 2YW9A 4LV8B 5BOVA 3HP1A 3UAYA 3TLXA 1OH7A 4BX0A 2O3TA 1D8AA 4D9CA 2RI6A 3ZZTA 3QVXA 3V6LA 3OKPA 1XPJA 3QX3A 3RIGA 5DYWA 2YWCA 1A8UA 3HA7A 1U8YA 3PQ5A 4FFLA 1SG9A 5C4GB 1MTZA 4LE2A 2Y0DA 4ZHQB 3AVVA 1I32A 4OAPA 1OT3A 2PS3A 4UXJA 4HNGA 3SZRA 2HSGA 2RG7A 4F91B 1QWOA 1ONOA 2VBFA 4QULA 3QUTA 3RS3A 1DBSA 3U4HA 5IZCA 4KQ1A 3CGGA 3RIXA 4IM7A 1PZEA 1HLDA 1EYZA 3AF2A 5DRTA 3ICOA 1V7QA 4G67A 1A8SA 4QQRA 3L4EA 4RSHA 5EJ5A 1V3TA 1XEXB 4I1YA 2WLSA 3KLNA 4Q9DA 3FDZA 4K0RA 3ET4A 2VBGA 2FW6A 3EZ9A 3I4FA 4L22A 4J3NA 4WBNF 1LB1B 1MOQA 1KJNA 1K4MA 2X9NA 2OOSA 4KXMA 2F9FA 2DR0A 3F73A 5EKSA 1US8A 2QLBA 3THYA 3U4QB 1EJ2A 1TGYA 5CJJA 4EHBA 1IFXA 3G49A 3G0IA 2QQ0A 4M60A 3VSBA 4BFTA 3G9ZA 3SE7A 2J3QA 3TH5A 4YDHB 3EUWA 4AJIA 4E03A 2D4AA 2R4UA 2KB0A 2WAYA 2DPYA 5EHNA 2WQ6A 1NJ5A 4ACAA 1INLA 2OSBA 3OEWA 2NO6A 4XIYA 4EB0A 4XQ0A 3ITEA 1FVFA 3FVRA 4J7UA 1YVUA 2GRUA 2IYZA 3FYHA 1B41A 4YRCA 4WY5A 5A7GA 1L5RA 4FFRA 4WK2B 5JG7A 4JLSA 1BCSA 3VU9A 5CIYA 4TXLA 4ZO9A 2O06A 5DRYA 5FWAA 1PJQA 2GRJA 3KKNA 4G81A 4ZAVA 1CZUA 4CKEA 2OXTA 3RAPR 5BVHB 3GUZA 2PX3A 2VK4A 3NI2A 3A9WA 1FFHA 4RNCA 5DCWA 4JY7A 5LQKA 4R3NA 1E4YA 1ODIA 3K6KA 4TS9A 4UZFA 1TYDE 1TVMA 1U6IA 1OGJA 3LKZA 5HDQA 4AN1A 3DMDA 1SC4A 3CN7A 3NXKA 5DB4A 5K3AA 4D4MA 5HUQA 5K20A 1O6CA 3RE1A 3CNLA 3P9SA 1K8RA 4OUKX 1XK7A 1ENYA 2KBFA 2CYBA 3DO6A 1IZZA 3M4XA 4RL4A 1Q14A 2YHAA 3GDOA 3SIXA 4XE5A 4C3OB 4WBSA 3V8PA 4P34A 2GEVA 1YOVA 3MHPA 2HTEA 3ZY3A 2J3MA 4URVR 1Z56C 3F2VA 1UK6A 1IQ0A 4I55B 3RM3A 4KLCA 3T95A 2IU6A 5FJIA 2AJTA 3M82A 4D8VA 3M5WA 1RD4A 4EABA 2I34A 1KETA 1HETA 4BNDB 2IU0A 1IPHA 1DTEA 1NP6A 3WBJA 4DCOA 1HDXA 2FGJA 1TM1E 1H1TA 1HE2A 4DLXA 1DP4A 1MMFB 1R9JA 1FYFA 5HIKA 3KJIA 3UK2A 2HYDA 1IBKB 3LUPA 3WIDA 4EECA 2HV8A 1LDMA 2ZRIA 1R6UA 3JWHA 3MINB 2XMDA 4NDZA 1WUKS 4UCXA 1JIVA 2WD7A 5LYYA 3S8MA 2A9OA 2BL4A 5BN3B 3RROA 1G8HA 3T9BA 4BLVA 2Y1EA 4AIRA 5TT0A 2CK3D 2IYEA 1OI7A 4ZHQF 3WQHA 1J7KA 2ORWA 3JWIA 2LE0A 5AW3A 4RIIA 3TYXA 2GNAA 3UG6A 4D98A 2NSDA 2V7BA 3QKRB 4UPEA 2GFHA 1BWSA 1NYQA 4FDMA 4DCCA 4DANA 4EVRA 4FE7A 4YJ2A 4R8KA 4UUMA 1RWBA 3HEBA 4L51A 3K4PA 4WLFA 2JZNA 3KQLA 2P5SA 4ZCIA 1VL8A 2FCRA 2P78A 3AHHA 1ZGJA 3OOWA 3WX0A 1YKSA 3AKYA 2QM0A 5K8VA 1L4LA 1PR3A 5LUBA 4KIJA 1JNXX 2XOEA 4O5OA 1C7JA 2HTFA 1Z5OA 3EDCA 3HB9A 1EB8A 1WULS 1E6MA 1XWIA 4HY3A 2F3SA 3EGIA 3E8XA 4PZEA 5GONA 1EZ1A 4IEEA 3WYEA 4UNIA 1GZSA 2WSSA 4XCXA 4AO7A 1FXSA 5FB3A 4BO1A 2RB4A 3Q7EA 3ONNA 1OHHA 2QTHA 5FNZA 4BGEA 4KQ2A 2B25A 1G21B 4D3ZA 1NQWA 4ZI7B 2GEDA 3F7NA 3R4CA 1QVRA 1B8OA 2CNNA 3DAPA 2I4RA 2X4GA 2RG1A 3LXRA 4I9HA 1MZVA 4IZ6A 5FA5A 4ETNA 2QU8A 1WVGA 4UTVA 5JH7B 4BFWA 1E4VA 3UKOA 1VBMA 4FE4A 2J0QA 3TECE 5CLIA 5JJ5A 2IDKA 4PZAA 1XB2A 2BGLA 1JDZA 4C20A 3EXIB 3DWEX 5D87A 1G8FA 2OAEA 3GFGA 2NO0A 1TMKA 4O33A 2CV1A 1TO1E 2YJ5A 5KU1A 4L2IB 1IQPA 4EOGA 3H2HA 3DMHA 2HV9A 4JUFA 3SD7A 3PDCA 4BAGA 1A9XA 4RF4A 1N5RA 5HUJA 1QVZA 3MZ0A 4S1VA 4A2PA 3CLHA 1X13A 1AHPA 3N8NA 5AKYA 1F2UB 5L51A 1NF9A 1OIWA 2JC3A 3IIMA 4MICA 1FTSA 5B55A 5I9SA 1SZJG 2YWGA 1L0BA 1A4RA 1NUTA 1P45A 2EVWX 2QT0A 2Q4BA 2ACWA 4EVSA 5IVDA 3CA8A 3CNOA 1CU1A 2IOYA 2MR6A 1XXHE 4BNYA 2O8CB 1A76A 1ZIDA 4HFRA 2DUNA 5FUWA 4TMXA 3HUTA 3LZDA 5JD6A 4DILA 4OSEA 3LC1O 4N3GA 3TWOA 4I55F 5H02A 4BX2A 4QTXA 1V71A 1YB1A 4MMXB 3ZJVA 3UWOA 3T3OA 3L8HA 2MSKA 5ALZA 2O3JA 1QH8B 2HF8A 2SKEA 2DTXA 4PO3X 3GT0A 3B1VA 3H9EO 3IQDB 1QGAA 4NEGA 1FTYA 3QELA 1K2WA 3BWDD 4ZJZA 4PRZA 4UUAA 3FF4A 3HVRA 3RRNA 4QU0A 2FE4A 3T5DA 4G41A 1GQSA 3CMCO 4UUBA 5IM5A 1Z7BA 2XTAA 5EPEA 4OAOA 3T9FA 2GJ8A 1B4DA 2GZ1A 4M7WA 3TOZA 4MS3B 4YAOA 5B2EA 5JZBA 4UD2A 3U1BA 3HA2A 1BKSB 1U0RA 1EGHA 2FMKA 4FLEA 4LCJA 4MCHA 4V0KA 3UMGA 2J0UB 4XVRA 4EKIA 1WDWB 2QN1A 1GM5A 1RE1A 3A58B 4I6JA 1BEUB 1NDUA 4LPKA 1NXOA 4HPJB 3TLCA 4EHLA 3GJSA 3J7AC 4KSBA 4R05A 5ER6A 3GT7A 3CS3A 3NW9A 1DU4A 1KSFX 3HP4A 2GA8A 1Y1RA 2QGNA 4ALJA 1YK1A 4MCAA 1JKIA 3S8EA 3QKUA 4UVDA 2PH1A 2MCFA 3QENA 1XCPA 3ZHCA 3ZWYA 5AVQA 4ENSA 4ZQIA 1D0VA 1GVNB 4HLNA 4JI1B 3IVGA 3LDHA 1HYGA 2YHIB 1L5MA 1NBMA 2C9MA 4GHWA 5KX5F 4RTOA 5F5XA 1F5NA 1YJXA 1IVYA 5EIBD 2Z6UA 1N2SA 2PU7A 3IR5A 4DB2A 3SYLA 1KTIA 5DWQA 2X22A 4AKTA 1SQFA 5BV7A 4ENRA 1G1MA 2PD6A 1I3KA 1ZCAA 5KQPA 1DO8A 2XDQB 4TZ0A 2V8BA 4H27A 3JATB 4UNPA 2XUJA 5JH7F 1U7XA 3A9RA 3SVTA 1FSZA 2P2DA 1G1AA 3AUYA 2Q1UA 3LGXA 4ZC8A 2XWQA 3O8BA 2DVMA 5E4FA 4OSPA 3LTNC 2OAP1 3ANMA 4WBXC 4IUDS 3BA1A 4RDXA 3AI2A 4LW8A 1WTCA 1G59A 4HJRA 5T4FA 2DU8A 2PMDA 3GFFA 3KZNA 1CJUC 1GRVA 3UGTA 1NYLA 1G63A 4H17A 1D6NA 2X6TA 4KDFA 2DQ4A 4YHBA 5F1YA 5A3SA 5F9HA 4HVAA 2I33A 4TN5A 2PZJA 2DE0X 5KAMA 2QL6A 3PR3A 1E20A 1SK8A 3DBHA 4LHYA 5B53A 4NLLA 2BM1A 3ADDA 3MB8A 4D8UA 2M6KA 3U44A 1G5RA 1SGWA 3V8VA 3OQIA 1NONA 4Y30A 1JR6A 2BRUC 1RLTA 3PNLA 3STXA 4QSHA 1IXKA 5BMVA 3BE5A 1ZSYA 2OZVA 2NXNA 4XTRA 1LZKA 4FHCA 5H16A 3TLJA 1JA9A 1VZ2A 4ZK6A 1VL1A 4EJSC 5D6NA 2EQ5A 4KK4A 5LXTA 1S01A 2ISQA 4QEKA 1E3TA 2AE1A 4QJ5A 4QICA 4D3FA 3DOFA 2NOAA 5EG5A 3I9NA 4XVCA 3BHNA 5JAZA 4ZAFA 3NU1A 1XLWA 1R0WA 3A6EA 4R2WA 4EW3A 5ICEA 2DHRA 2AZ4A 1SBIA 4JB3A 4CLRB 1C9EA 3HXKA 3T8YA 1R0YA 4WESB 5CAEB 3W79A 2K87A 2VAMA 3QPUA 5IVIA 1U2GA 3K0FA 2I3DA 2ZYRA 3AUUA 4YIHA 4YEDA 1Y82A 3QJGA 3DZKA 3V1UA 4ARIA 1XTJA 1OZAA 1VHTA 3DHYA 4MEAA 1J0CA 3DT8A 3UJ6A 4NFYA 4QOHA 1XQXA 5KZMB 3OQOA 4JP5A 5FCDA 1SBNE 3I6MA 4E4RA 4EY6A 2DCUA 1C3OA 2B8WA 4R1TA 3DJYA 4K46A 4FDUA 1MC5A 1MC8A 1O94D 1PD1A 2Q0HA 2ZIAA 2J3JA 4U2DA 5FHQA 4B44A 1NC1A 3SC3A 4HEHA 3H42B 4IIEA 3VC1A 1OLUB 4TTQA 3WBBA 5BSUA 3UY4A 2AQIA 4YALA 5CB4F 5CTAA 2F55A 4FHZA 3AY0A 4GP6A 1XPUA 3MW8A 1LQTA 2O7VA 4RMJA 2FSUA 4NU8X 4LGMA 5TXGA 3P26A 4IIJA 3Q3JB 2VXBA 3EBPA 4P53A 2MYUA 2WJWA 3W3ZB 1OFVA 2CKMA 3FETA 1EPUA 3AFNA 3ZV7A 1JXQA 3C1UA 2LD4A 4FCWA 5DWDA 4E11A 4Q3BA 1Y5RA 4K3UA 2ADMA 1ZZEA 2IP2A 4ZVOA 1QBKC