4KPEC

Novel fluoroquinolones in complex with topoisomerase iv from s. pneumoniae and e-site g-gate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
208
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/inhibitor
total genus 56
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kpeC00
3LTNC 2XCQA 2XCOA 4KPFC 3K9FC 2XKKA 3KSBC 3FOFC 3L4KA 3L4JA 3RAFC 4G0UA 3QX3A 1BJTA 4KPEC 4I3HA 2XCTB 4KOEC 4J3NA 5EIXA 4Z53A 2XCSB 3RADC 1BGWA 2XKJE 4Z4QA 4FM9A 2RGRA 4G0VA 2XCRB 3FOEC 3RAEC 3KSAC 4G0WA 4Z3OA
chains in the Genus database with same CATH superfamily
3DDUA 3UJDA 4I1IA 4IILA 5TF0A 2EFCB 1W1IA 2XD9A 3AR4A 4FXPA 5D3KA 4MPRA 1OFHA 1J2YA 1I0LA 4QGAA 1AGXA 1T0PA 2IPNA 1CZOA 1N7HA 3H2IA 4LZZA 5AOBA 4P7KA 2PGNA 2Q27A 4G2NA 4H1HA 3UAYA 4FSDA 3H2JA 3UKJA 4JELA 3AINA 2V7GA 3DUFB 3LM8A 3DOUA 4POAA 4XWOA 5ICCA 4C6RA 4CF6A 2VNIA 4S04A 1X92A 4ASUD 1AQIA 3DAOA 3OEHD 4L3VA 4QHYA 2QX9A 4RACA 1B0UA 4YRRA 5CDHA 4ZALA 5LDDC 2F62A 1M54A 1WZEA 4ND6A 4QA9A 5HIIA 4TVKA 1VHTA 1YI0A 2PZLA 3GEBA 4OMFG 3GP3A 1A8PA 3OU2A 1R10A 2ZYVX 4OFBA 3HJUA 1Y1QA 2QPLA 1JFFA 1QOPB 5EIBC 5TPWB 3BFXA 2C97A 4M0CA 1VLVA 2IK8A 4WK6A 4ZTUB 4PZDA 4B09A 5AMXA 4BQQA 1UWKA 4HLCA 1H65A 4ALMA 3EXAA 5T41A 1OWLA 3PEVA 4Q34A 2FNAA 2CL5A 4ZAFA 5JAHA 1KO1A 1ZH6A 1YJAA 4ZAWA 1G7TA 3IQZA 2Y3IA 3PD0A 3NEJA 2I6GA 2ZBVA 2WD9A 3SHOA 2EATA 3P2JA 3HB5X 2BC9A 3O73A 1FS5A 1YQTA 2OHGA 4K26A 2XZOA 5FOQA 3UFXA 5CEEA 3G02A 3CJTA 1T13A 3VNQA 2G7ZA 3Q10A 2GZ3A 5DOZA 2YXNA 5CCBA 1B0ZA 3FOWA 3MLEA 1SD5A 2P40A 2X13A 3VYSB 3VSEA 5FT9A 2GPAA 3RTGA 2Q2WA 2C9YA 1CUGA 4UU7A 3JYOA 1RFGE 3C2QA 5KTPA 4PHGA 4YJHB 3VHLB 2COUA 5KNBH 3THYB 1N0UA 4CMGA 1P9OA 1H4SA 1WIWA 3FMPB 4X85A 4QUGA 1RZUA 2JFXA 3G8AA 1B93A 3KR0A 1CUFA 5ALMA 1GNSA 3LY9A 2GM3A 3OQNA 1TCAA 3AY6A 1HTBA 3E05A 4O0LA 3A27A 1Y33E 1DAHA 3OOWA 4JKIA 4PQFA 4M8LA 5JJBA 3ETCA 3QVMA 3MTQA 2UZ0A 4Y6PA 2IIPA 3KM0A 1TJPB 1OV6A 4IF6A 3QSGA 3PNQA 5K09A 5A4AA 2PAFA 4A7PA 1K8RA 3P32A 2Z9DA 3C4QA 4P7GA 3T5AA 1ZRHA 1H0SA 1KO7A 3NP7A 1Z2OX 3KJHA 4ALJA 1RQXA 5HEKA 1UT8A 1MJ5A 4LFAB 1O94C 2CXTA 4RHYA 1P81A 4XD7A 3IX7A 2NG1A 2OB1A 1CJSA 4ZQHA 3W5UA 5K8LA 2DQYA 1BW9B 3B85A 2GF2A 1J99A 3DMPA 4KRXA 1JV2B 1QQ7A 2DBQA 4RFVA 3LWBA 1N9KA 1SQGA 1V0JA 3TLMA 3L4BA 3O2NA 1GPKA 1UM8A 4FE7A 5H59A 1BWPA 1NKSA 3HWWA 2QG6A 3PC6A 2I2AA 1V3UA 3PEFA 3Q2KA 3QOXA 4X93A 2OC4A 3LX5A 1F4PA 4JLPA 2W48A 4C06A 4DLYA 3RK0A 5CEJA 1KK2A 1C7ZA 2X6TA 3OHMA 4M7OA 2ORYA 4M83A 1OGJA 3NATA 4XLTA 3VDXA 3U19A 1F2UA 4A5OA 2GKOA 4O8ZA 1TW3A 3HO8A 4YACA 1WY5A 1NXPA 3DWEX 2F3SA 2OKGA 5BSHA 2YOHA 1CW2B 4YRIA 4IQGA 5BOVA 2GAJA 3B5IA 4GR9A 5H82A 3RC7A 2ECKA 4AJHA 5A6VA 3ZX4A 1M1YA 2XAAA 4FFMA 1G8GA 4DV6B 3ZZ1A 1GNVA 2PUCA 3EVEA 4HC4A 4FR2A 2P30A 2DFVA 5LZ2A 3RJTA 1DWQA 2VQ6A 3TLXA 4C4SA 1O87A 3AEKA 3KCQA 3KOUA 3HDVA 4MPPA 1PJTA 3A70A 3CO0S 2CLFB 1UOOA 4OP2A 1UPUA 4RK4A 1T5BA 2LTAA 3DKPA 1JE1A 1NR7A 3PJFA 1OFTA 3S29A 2RE8A 4UEOA 3K8YA 4IDPA 1G5HA 1ZRNA 3U7IA 3SD7A 1U2DA 3REOA 5BP7A 3DOIA 3DMTC 1GFSA 2JC3A 3AUJB 3GEIA 4YIHA 5BVGB 1EJBA 2JFQA 4I1UA 2PJZA 3H9BA 2ON6A 1PDWA 4FEYA 3R9IA 4RL4A 3PQDA 2L0XA 1ZUIA 1T8SA 1G1MA 1FNCA 3LC0A 5FLKA 5E1DA 2CDCA 2FMHA 4ZD6A 3AERA 2WIFA 4ZI3A 4E5UA 4MB0A 1P19A 2FPIA 3QBJA 3CUUA 4Y7DA 4UD2A 3LQ1A 2AVNA 3A05A 3OJEA 1FS6A 3ND8A 3C7DB 3EN0A 4PC7A 1S01A 1SD1A 5FBKA 3QEMA 4ZCPA 3RC1A 4ZI7A 3UPUA 2ODQA 3CMMA 3DVQX 4LWPA 2ORIA 3G5MA 3REGA 1BQ4A 1FLVA 1A5TA 1MA0A 2DH6A 2ID9A 4ZOEA 3WRYC 4ZZIA 5IANA 4E08A 1ZUD1 4MJXA 2HLDD 4NSNA 2D1QA 1UJ6A 1XZFA 3OTIA 1YL7A 2H4WA 4G5HA 3UWOA 3ZWAA 3QKIA 4EAQA 1TKRA 2P2GA 5K01A 4KNVA 1BOFA 1CR1A 3K8QA 1IVYA 4MO9A 4Q4JB 4DRZA 1YFLA 2AI1A 3FYDA 4AK9A 1Y34E 4O02B 4QYTA 4GR4A 2RHRA 2XYGA 3OZIA 4HDAA 4UDNA 3SSNA 5LQNA 2G5GX 2B9EA 5AW2A 1V5FA 4HZUA 1Q15A 1NXVA 3H5NA 1EIZA 5CX1A 1XZJA 2BEJA 2QUKA 4XVUA 3TLYA 4F6RA 1GL6A 2P1ZA 5EMMA 2V4UA 4ZC1A 1BIFA 4BNFA 4LZPA 3NNSA 3TR5A 3NHMA 5IAEA 1ADYA 4TM8A 5JYEA 1SHJA 1UK6A 1TPZA 4NQZA 5K6AC 2XUDA 4C4RA 1HWYA 5HBGA 2NZWA 1ODJA 4DDKA 3R40A 5LP6F 4LNAA 1V8PA 3AP3A 1UBUS 1MFZA 3FYUC 3F49S 1GZ6A 3EUAA 3ZI4A 1PGPA 2P65A 1Z83A 1DFGA 4G0OA 4EVQA 4BQSA 4DIKA 4Q18A 5ALUA 4U00A 4BFLA 2XHZA 3LFUA 3OCJA 1QORA 2XWQA 1H4TA 3L01A 1TJNA 4NNPA 4YECA 1QYDA 2F3UA 3ROPA 5H83A 3NHPA 3EQ7A 1CEXA 4QUDA 1FXSA 1RJ9B 3DG9A 3E61A 5H16A 3ZIAD 4EGJA 1OX6A 2BELA 3ET5A 3MUNA 4JCOA 3NYWA 4KQGA 2OHVA 4MO2A 1YZKA 2G0AA 5DDIP 4EF6A 4YRMA 3G2JA 1F1JA 2MSDB 1EFRA 4OSEA 2VZ0A 5F76A 2R7KA 4DMLA 2ZBDA 4E7OA 4EJFA 2P5YA 2YINC 3PSHA 1JEEA 1VI5A 4NFSA 2WSSA 1KEUA 2IOQA 3LYUA 3QJGA 4AZSA 3MNFA 5A7HA 1A8SA 3GIDA 2J3HA 5CD9A 1YT5A 2YZGA 3R5JA 4RPGA 3N07A 3WAJA 1PDVA 3P71T 1H5NA 4LYJA 1SJ9A 3TQQA 1I7NA 2YXPX 3KKEA 4K03A 4LOHA 1XRNA 2X77A 4PBRA 5CT9A 1H6AA 3ZVLA 4WZAA 5D84A 4EZIA 1JHVA 5JADA 4C3VA 3VNAA 2I2BA 2R4TA 4S12A 1VMKA 5HCIA 4R6WA 3LUJA 4ZODA 2RIRA 1UFKA 1BS1A 1A9QA 1SZPA 1YJBA 2VT7A 3V1TC 3L1JA 4X44A 5I9IA 4RSMA 4TMYA 5EVJA 2GT1A 1Y98A 3HXPA 3PGVA 3IE0A 1E1QD 1UZMA 1FK8A 2VXCA 4NYJQ 2B82A 2XITA 3B3GA 2QPOA 4ROTA 2ZBUA 1BHO1 2AEJA 1ODFA 3S2FA 4PZCA 3KOYA 2C82A 3NM6B 4DV4B 2JLAA 4MIEA 1PT5A 4BTEA 1EVJA 3KTDA 4LF9B 4PW0A 4U5QA 3NMUF 3W2GA 1B0AA 4LI0A 1HYBA 2MU1A 4R98A 4DR1B 2BKLA 2VHUA 2BGWA 2ZPUA 3QG1A 4L4ZA 4QQKA 2CLMB 1GR1A 4BO9A 5J3JA 3BAFA 3RVJA 1V8BA 2NT3A 4UDOA 2H2HA 2IH2A 2A1UA 3PVZA 3OZDA 1E92A 3QPAA 2JGLA 3B9PA 4FMCF 2V4MA 3OBBA 3LMKA 4FT2A 4G4SO 4JI7B 1UDXA 5E9AA 4A03A 2IPXA 2JCSA 1PR2A 2W42A 1SB8A 2ZIXA 3JARA 4HAIA 1R9NA 2ZTHA 4MV6A 2GO1A 3RGGA 3AL3A 5CAEB 3HBNA 3LUCA 2NO7A 4YC7A 3HNRA 2RGCA 2BM1A 2VP2A 4MWSA 2PBFA 3UO8B 3ZKWB 4DC0A 1OFIA 4M54A 4DV5B 5KJ1A 1DG3A 4S05A 1WV0A 2ZIGA 1MJGA 3Q8LA 4G0UA 3EWIA 1E99A 2QL5A 1L8LA 5MN5A 2O8VA 1H2HA 1UBRS 4N5HX 5EA2A 2WHRA 4UUMA 1K6MA 2DETA 2WJVA 5LU9A 1H94A 1OI2A 1TJ3A 2D1FA 3I9JA 1PN3A 1YS4A 1NVWQ 2PN1A 3N2EA 2BHRA 1B3RA 3PJEA 4KLZA 1E7MA 3UFBA 4BASA 4BU1A 3EVCA 1KZYC 2O20A 4CDRA 2H54A 2R68A 2PZJA 1TXGA 3R41A 4U2KA 4PQGA 1HYGA 2J0SA 1QANA 5BSKA 4MVCA 1CY1A 2H2WA 2PLNA 2A33A 4MLPA 3ZH9B 2FZLA 5C8YA 3UV3A 1AS0A 2OQVA 3H9CA 3NTLA 1XU7A 1JAZA 2ZSJA 1DWUA 4O4IF 3TNDA 5JAIA 1W52X 1CF9A 3EXIB 5TGTA 1XMSA 2A5GA 2CLDX 5M34A 1DIAA 4CMCA 4ZI2A 3O4VA 1MRSA 3KHTA 2A4MA 3FN4A 3EZYA 5CFMA 2VAPA 2A86A 3CEPB 3K2QA 3KOZA 4Y0NA 4UAGA 4GGOA 5AKYA 5AM0A 5K1ZA 3MWFA 3TWOA 5JSUA 1W0KD 3PQFA 3SS8A 4YONB 2NV2B 1JR3A 1Z7BA 1DQYA 1KI8A 2EGUA 4R9UC 1SIBE 3WGYA 4AKGA 1L4NA 1U6JA 3EEFA 4NICA 2UU9B 5JNWA 1CC1S 3FUTA 2Q7DA 3I52A 4D56A 1J97A 1V37A 3T4EA 2JAWA 2A0YA 3GBVA 4JOQA 4C0SA 1KYVA 2WA2A 3EX7C 1OXMA 3K2IA 4BJ6A 2P3OA 3F5SA 4D9KA 4M1YA 5EVCA 5F1KA 1PX0A 1P60A 1GAEO 1W88A 3EEBA 5D8DA 1SIWA 2QR5A 4Q9HA 4LC1A 1O08A 2Y99A 4IAOA 2OA0A 3M3HA 4FOPA 2GXQA 4OXKA 4RD0A 1EXWA 3ROZA 5K0CA 5KDOA 1LK7A 3L6UA 3X3HA 1J21A 4C6HA 3D7NA 4HRVA 1RZVA 1VCHA 1F38A 3GFSA 4NU5A 1O8BA 3K92A 4UCFA 4MULA 3UXEA 4YQZA 1NNUA 1V8DA 4KXQA 3UK0A 4CKBB 4B6JA 1SCQA 2VJMA 3HA7A 1Q16A 5HKKA 4DIUA 2HDOA 1JDNA 1HO3A 2ETVA 3U7QB 2J9XB 4INOA 2O1SA 1M2HA 2PL3A 3AFGA 3MLAA 4YP9A 2FJPA 4QKQA 1RABA 3GUZA 5C2JB 1A9XB 2XBUA 3BF8A 4C21A 2CJPA 4JITA 5CB4F 4OL0A 2G76A 3BE4A 4Z9YA 2F17A 2DEUA 1YF3A 1NE7A 2Q3DA 1CFJA 2REBA 3GXBA 4DGSA 1GNTA 2EFYA 1M0TA 2O5VA 3PZBA 1HQYE 3RB8A 3IUJA 3SOPA 4EY3A 2JHAA 1KU6A 1W4AA 4M9QA 3V80A 2C5FA 5I45A 2RGRA 2YZMA 3TQCA 2Q3CA 2SCUA 1G5PA 2L17A 3HLKA 4YDRA 2YNMC 4HQLA 1M10A 2GUWA 3GLHB 1DTWB 3EBLA 1NX6A 2I9PA 4IDDA 3V8BA 2RJOA 2WG1A 4J1TC 1MIOA 3CRZA 4Z1MA 5LJLA 4BL5A 1NZFA 2YZ2A 1PCXA 2R3SA 1FDIA 1W5AA 4BE7B 5JH7B 2JJQA 1NVMB 1D5CA 4EITA 3DBLA 2G1PA 3JRWA 5BO5A 2REXB 2HC9A 4R05A 1OBVA 3T3IA 3TUJC 1HETA 1YZFA 4N3CA 5J4KA 1H66A 4NE7A 3INTA 5CNMA 1P18A 1GA1A 1BX0A 1WMFA 2NACA 4BFSA 5CJJA 3TPFA 3BRWD 3WICA 2WSMA 4C5CA 4K0KB 1N5DA 2WUWE 4FFLA 2VEOA 4QTTB 1KGSA 3EXHC 3TQOA 3UMFA 5E4TA 4J0DA 2FLKA 3QVLA 1E18A 2VTBB 4UM8B 4JP8A 4N9WA 1C1DA 3EWSA 4PRLA 5DEOA 1E66A 3E53A 3CZQA 1C3XA 5JXJA 4LXIA 4KO1S 5BT9A 2OCAA 5LA6A 3RNOA 3I8OA 3PRHA 3D5TA 3FJYA 4TOIA 1FQWA 1N7GA 1PT6A 4H31A 2MINB 2WVAA 4MA4A 3ZXXA 4LHYA 2GZAA 3I58A 3ELDA 5AW5A 1Y82A 2WOOA 5DP1A 2WHPB 2QK4A 4MQBA 4N0PA 3SVTA 2V8BA 1UFVA 3FE2A 3DC2A 5J4VA 2IEAA 2GDJA 3A0UA 3ZVRA 3RI3A 2HMUA 1VKHA 1AB6A 3KJEA 2PRJA 2FG5A 3DQZA 4TKLA 2DCUA 1O0BA 3KYIB 3W5SA 5L4LA 4J16C 3J81k 3BIXA 3CLTD 3S7ZA 2PANA 2GR9A 3JXEA 4R7GA 1PZFA 1VE7A 3W7AA 4LRXA 1FLNA 1X2BA 4MCHA 3V4VB 4JT2A 2R4UA 4Y6GB 2W43A 1FQKA 1AD2A 4GOJA 5H02A 1F1BA 3R6WA 3W2EA 2F8TA 3IPYA 2Y1OA 1R1DA 1HDGO 3QNMA 1HURA 3V4OA 4PLFA 3W8FA 5LIRA 1MVNA 3H8WA 3JSAA 5KNDA 3ZE9A 4EEKA 4GOOD 2JGKA 4MLCA 1Y8RA 2YYSA 4ZGBA 1HEIA 1XI2A 2F64A 2Z6UA 2PJUA 4WXEA 5BSTA 1E3IA 2JRLA 1FJ2A 3QE4A 4KU4A 1OXUA 5EUMA 2GJ4A 5DM0A 4FFWA 3RG2A 4QTXA 3VYWA 1AGYA 1BGWA 1R0SA 3W5VA 4COOA 3Q15C 3QX8A 2D5IA 3ZWWA 2CUKA 2Q8NA 1Q7BA 3QY9A 3EMBA 4RX1A 4RQAA 4LVUA 1N4DA 2HF8A 2AI3A 4TL9A 4UHKA 3ZQ6A 2ALJA 4Q03A 1MV5A 4IUCS 1UH5A 3DZDA 2JGNA 2JS7A 4W6ZA 1ZUHA 3OP4A 3U3DA 3K6JA 1O94A 4DIFA 1M6YA 4KK4A 1B8PA 2C9OA 2XE7A 4MW6A 2H85A 2J3IA 4RD6A 4ZMRA 1UBEA 1VSUA 3FRIA 5FO0A 3C74A 2L18A 3OZEA 1HY3A 4NPCA 1GEEA 1GYPA 4Y1FA 4ZA2A 3R3HA 5DTIA 4Q3AA 5FFMA 1M6VB 5TMBA 1FNNA 2XGGA 2V7EA 3NG1A 4ANFA 4QUBA 5ITSA 5AVWA 1YDHA 1ZGBA 4F2HA 1VSVA 3VPBA 2FDXA 3QVTA 3VU3A 4QOGA 3NAMA 3DDZX 3NCTA 5HDBB 4C08A 1DKLA 4F3TA 1S2MA 4C01A 3ZW9A 5KOHA 2ZRFA 1QOQB 1XJ0A 2FQQA 1HYHA 3VZCA 3WLIA 3RIGA 1EAMA 2VDWA 1HZJA 2NNLD 3B7PA 4RSGA 1MFPA 4DA0A 3ENQA 3LVFO 1LSJA 3DNPA 1L4LA 3BMCB 3HVHA 3OZTA 4LK3A 3BDVA 3WIVA 4JNKA 3LUGA 3GJYA 3C4JA 4QODA 1EGMB 2C8JA 2WJIA 3WL3A 3ZYCA 1B2RA 1RCFA 2V7TA 3ANNA 4KPGA 4N3GA 4R5HA 4YHBA 2NYAA 5J9FA 1E79D 3VZSA 1E6KA 1X1TA 3AQ4A 4DR2B 1M5UA 3AVXA 1UBHS 3L7CA 4GLJA 4X5OA 1T0HB 1MO5A 1Q2UA 3DCIA 4QBHA 2O8EB 3E0QA 3MD9A 1S3FA 3KJNA 4LF7B 4YMGA 1DNPA 4PFJA 2V6MA 3FPSA 4P80A 1M7HA 3CFYA 3VI3B 4AZ3B 1NM5C 1VJ5A 4C7JA 1DAOA 2G80A 4KDCA 4NXMB 4JBGA 3I6QA 4FYWA 5F4BA 3I62A 3OIFA 4CEIB 4QVGA 1VL6A 4X91A 5K3SA 2FE4A 4UDXX 2UKDA 3IBSA 4R4JA 3AI7A 1YRQA 2ONJA 4RFSB 1TKCA 4NPHA 4B6RA 1P6UA 1PZEA 2JGRA 3VBCA 2ACVA 4LJ8A 1NVUQ 1AQUA 4RCZA 2B92A 2WFAA 3Q3EA 3TTSA 4PINA 3ZD9A 3AP1A 3WIDA 4W5JA 1JVBA 3WGJA 5BOSA 2ZT8A 3SK0A 4GP7A 5DLYA 2A1IA 5EWMB 1IOLA 3QELA 1VL8A 2J8ZA 4OM8A 3TPZA 4D98A 1CJBA 4Z8YA 4ZCMA 3PLAE 1IK6A 1EQUA 4N3BA 3WRYA 2ZB4A 1B74A 1PYDA 2OO7A 2Q4OA 2J08A 2K4MA 4J3JA 4RVSA 5KAMA 3M70A 1ECLA 4NBWA 4P5DA 2XMBA 1YULA 3O82A 1JIUA 4Z0TA 3KZ1E 4TPKA 5K4AA 1KMHB 4ZCSA 5FQNA 2XE6A 1CIPA 4FDTA 4G1MB 4DT1B 1FUUA 3KHKA 5L7YA 1RBMA 4GOMD 1LLCA 4R1TA 1HM5A 1F2TB 3FAKA 3QKTA 4CT0A 5AXAA 1Z4IA 4DR4B 2JATA 4CKZA 3U4GA 3MRXA 2PPVA 5A4DA 1ZNWA 1QK3A 3BBLA 4IZOA 4IDQA 2GMWA 5K4HA 3HXMA 3UV6A 2IHKA 4K40A 2BHTA 3LY8A 2Q4TA 3CF4G 3UN1A 3EPLA 2GBFA 1G1AA 5K6AA 1JDTA 3O1HB 4Z4QA 421PA 2HSJA 3LKZA 4YGXB 1K7SN 3NWJA 4IIYA 1P1KA 4IQFA 4KWEA 4ZZ0A 2XWJI 2PKYX 3HHEA 4FK8A 4MP6A 2BGMA 3U6KA 2VJKA 3FYUA 4DARA 4E32A 4EHIA 3PENA 1L5HB 5BVHB 5CBKA 1M6WA 2MMGA 3ZCVA 3UWMA 1XWFA 2AK3A 4BKPA 4B3TB 2RAUA 1FX1A 4L0DA 4LMAA 2QMZA 5GAJA 2RHGB 3EF1A 4CHTA 1FFEA 1GRVA 2AX4A 2F1IA 3HEMA 4RE6A 5DI3A 4UTNA 4W1QA 2MDTA 1DO0A 1PJZA 1LGYA 1Q0PA 2XE8A 2P9YA 3KD3A 1GARA 3KRTA 5TQ0A 4EFMA 4WBNB 2M6SA 3ER9A 2YHBA 2HTFA 4RM3A 4PO8A 1BGXT 1OPXA 3KIPA 5ERGB 5FWYB 1HGXA 1NVXQ 3UK6A 1OF1A 2J9RA 1HX7A 6YASA 4V1CA 1SXJE 4K6OA 1II9A 3CRVA 2PUVA 4LZWA 4MV8A 3U5ZB 3NBFA 2CVFA 1T1SA 3L82B 3SKXA 3FCUB 4UPVA 2MR5A 2OV3A 1UC4B 5KKNB 1E8MA 5B1SA 1ZAKA 3UATA 4I4NA 5CG1A 5G1OA 1Z82A 3DQPA 2X0RA 1GIAA 1YO6A 2PSSA 1F48A 3IR7A 3O93A 4QBKA 3TW8A 4PVCA 4EW6A 2D7DA 4CL0A 4BNJA 3DV2A 3VR1A 1XQVA 3BN3A 4GZ6A 2O2YA 2WJZB 1ZSNA 4DUGD 1AO3A 1I7PA 1COZA 3F4LA 2IGBA 3DMHA 4YPOA 4L2IA 2DPHA 2W6OA 4XM2A 3GA5A 3BBPA 3NHLA 2AJLI 3IUSA 2QF7A 2ZWAA 3D4PA 3VHXB 1MNAA 3FCEA 3BORA 3OIDA 5EIAA 3WTCA 2W2QA 1ZIYA 4DA7A 3WXMA 1XD2B 1O9BA 4KIWA 2GWRA 3AUXA 3BMXA 2X0KA 5HJ5A 3WJAA 3QWIA 4QUAA 2PWZA 1SHZA 3X1MA 2O59A 1L5MA 1FYVA 3P7MA 4RE5A 3RRBA 2J0UB 3T3HA 3K5PA 3TZLA 3W6ZA 3ZKAA 2ZI6A 1KAHA 1MF7A 3TOZA 3QKWA 2R1VB 3EOBI 3M34A 3CLHA 4MI9A 3PR3A 5ILOA 4LF6B 4IKPA 4L02A 3PHBE 3RUAA 1VFPA 1NR1A 3HCPA 5AVXA 3AJDA 2FPMA 4P98A 1DB3A 2I3ZA 3PCXA 3QPDA 4E5NA 8AT1A 3HFSA 4E21A 2CE7A 5MFZA 1D1TA 3GLTA 2ZDHA 2L82A 3BOSA 1O6CA 3DBOB 3OWOA 1JG7A 3EHDA 3BJEA 2IVFA 1I10A 2OBYA 2QUJA 2X6RA 3PTZA 4O29A 5C7OO 4ZZ1A 1BE6A 3HU1A 4O4JF 5HF5A 4IMIB 4B45A 1CHNA 1KFEB 1T9DA 2WTNA 3C3DA 1XP8A 2X4IA 5BN5A 3QXSA 5A4MS 3H9QA 2R9VA 3ORYA 1MJHA 1DL5A 3JVIA 1G3RA 4Q82A 1NPTO 3F5FA 2RHWA 3OESA 4HX5A 5GM2A 4HVLA 2NQTA 2ZS8A 3COYA 4RLHA 3H04A 1TMKA 2YIJA 2VF8A 4D6XA 3DLTA 5J1TB 1R9MA 1FP4A 1U8YA 3DO6A 5J2UA 1SKYB 3BQNB 1K6IA 4QBFA 4FJ0A 1IPEA 1KDRA 1NSYA 1U8XX 2GBLC 3WMFA 4E30A 3GFFA 2P4UA 5ITZA 1V48A 2PUHA 2TMDA 4ZIRA 5K7SA 5KVCA 2R7MA 1S8AA 2RH8A 3AP2A 4HVTA 1VQ1A 5HGXA 3U7GA 1JJVA 4MWEA 1G2IA 2N0SA 2VQEB 4R9SA 3DT9A 3BTUA 3PC7A 2JKVA 4DNFA 5LKAA 3EVAA 3T8YA 2FPPB 2GEUA 2EU8A 3VKVA 3WGNA 1XTJA 1YZYA 5ED0A 1YZVA 1T8UA 3TW6A 1WF6A 3O2SB 2NAPA 4L3OA 1Z25A 3VC1A 4F3RA 3TQHA 3B13B 1JECA 1GLGA 2R60A 2ZRDA 1KJYA 1NOIA 3GGPA 4KQWA 1VSBA 2VNAA 2J07A 1V39A 2V65A 2Q5IA 3KDSE 2XCIA 4Q05A 5DWDA 3FLEA 1ZC3A 3OO0A 3Q0EA 4PLYA 1E1KA 1JSZA 1O6BA 4ZHQF 1JB1A 1DKMA 2R25B 4N9QA 3VKWA 1MC1A 3PDIB 3KOOA 4EI2A 4ZJZA 4MZDA 3OZWA 4KQXA 1KO5A 2DR0A 2V5VA 3ESBA 3JALA 3K4QA 4WXRA 4DLPA 2UUPA 1NY5A 3GQBB 2OZEA 4R68A 1YBVA 3NTQA 4QGBA 2GFIA 2ZETA 3IGFA 3HXKA 5KUTA 1KYIA 2VHQA 4F5YA 5JWRA 3AVVA 4Q7KA 5AM5A 5IM5A 5CYGA 3DHWC 1E6UA 1QR2A 3CIOA 3E03A 4QFBA 2Q4EA 3FKSA 1XJ5A 4M8SA 4P1ZA 1JA9A 3OSUA 2Q49A 4EIWA 1PT7A 1EUDA 1LD3A 1V1MB 1NUUA 2LBPA 3BWBA 3D31A 1L5LA 3LHKA 1K66A 2KLHA 1K1EA 1P33A 3R7DA 4IL5A 5JRZA 2W6IA 3RUFA 1I4EB 3OX1A 2BVNA 3MUFA 5EMHA 2YJ3A 4AXXA 4D81A 2IPLA 1CV2A 3ANMA 4BO0A 3VJLA 3PTAA 4X41A 4OHFA 1U11A 2JCXA 3GZ4A 4UTZA 3SEQA 1DCMA 2DZDA 3C0KA 5AVSA 1DUIA 4ZYWA 3Q5EA 3INYA 3EMDA 4DJ5X 5JDCA 1OT3A 3OT5A 2V3WA 1QJCA 3F8WA 3NHAA 1T43A 3KALA 1HRKA 4P35A 4XDGA 4AN4A 1FSPA 5IARA 3C5WP 2C9DA 1A4RA 3FOEC 4J1TA 2ZYTX 1P72A 3AR5A 5DVZA 4DZTA 1X8LA 4RHUA 1GTG1 3NH9A 1IEWA 3RS9A 1U63A 1SG9A 4HWOA 1Z12A 3AFOA 2WF6A 4NAVA 1TDJA 1W76A 3HDQA 4FW9A 3TH5A 4FIZA 3ADBA 3DBRB 1P1BA 2QJTA 1JBEA 1E9CA 2H5JA 2YCLA 2Z5VA 3KZMA 3NJ4A 4ZK6A 4U0JA 5EQTA 1MX9A 5L3QB 4OY3A 2ZDQA 3EPJA 4ZOLB 1CJUC 3ABQB 5EZSA 3WFIA 4TMWA 4C30A 3VAZA 5ITVA 3B1YA 1XNHA 3LA6A 3NOQA 3R5XA 1TZCA 3EXHA 4OXQA 8GPBA 5UKDA 1BQ3A 3O6VA 1JA0A 3FFWA 5T57A 1Y8QA 7ABPA 1AUOA 3PE6A 2BI4A 3L5OA 1SXIA 3GBSA 4E7PA 5KDDA 1ARZA 5A03A 2QVXX 4MQFA 1KJNA 3QUCA 1WXHA 2OLEA 3D02A 4F1WA 5K6TA 2FWRA 1WEHA 5C3UA 3UG7A 4CIVA 1F8XA 1II8A 2VDKB 3SXPA 5DBIA 1D0VA 3VVLA 3I23A 3B6JA 3E9ZA 3T35A 2UZIR 5IKOA 5K8UA 1SB9A 3QE9Y 4QJ3A 4Q3CA 4YRZA 2IHZA 4RCVA 1A5ZA 1V45E 1WMBA 1HT2E 3TSYA 1ECCA 3ML1A 4MEAA 1MJGM 2NU8A 4NJEA 4GZLA 4KR0A 4JJ8A 3MTDA 1ZGAA 3H97A 3WO0A 4UVGA 2PSJA 4DWOA 1V8OA 3UHJA 2UYOA 1BOOA 1H42A 4BX2A 2GF0A 3QLEA 4V3CA 1P2GA 2W93A 3CB4A 4RVGA 1T6BY 2NN3C 4X1KA 1WCYA 3U1TA 3SZGA 4CLEA 4YRAA 1A82A 5KI6A 1QO9A 3OEYA 3LCRA 4HQ6A 1O5IA 3CZAA 3HE3A 5JSHA 5TS2A 3MFYA 4Q3DA 4RVHA 3DF9A 3C39A 1M8PA 5DSZA 3LDFA 1E9VA 4MKHA 2HHAA 1XDZA 4DM3A 3VKGA 3T6KA 4D2IA 2H65A 3AYXB 2XV1A 4HBGA 4HH0A 5JMOA 1FMJA 1P5ZB 4BU0A 2QN3A 3TK1A 1Q21A 1S8NA 1JQDA 2I3GA 2BZ0A 4EA7A 1LS1A 3LT0A 3DZ8A 4K8OA 3MBIA 5AVRA 4B4KA 1PX2A 3JQGA 1DIRA 5IJXA 3MJCA 3OT1B 3WNBA 1V5GA 3A1VA 3FW1A 4MKXA 2CNWA 2DQZA 2XF2A 4O5OA 2FHSA 2J31A 2R6FA 1R5NA 5CNIA 4KHZA 3KQOA 4O2AF 5I7WA 4GT1A 3MRTA 1XDUA 3DFKA 1MH9A 1UKZA 3I32A 1GVHA 4FLFA 3HYTA 4J0JA 1JILA 3RUDA 1RT9A 2OQRA 2O1XA 2F9LA 2VDQB 3MB5A 3PTLA 3I5YA 2KW5A 2JVKA 1PZXA 4ZXFA 3VR2A 3ANLA 1TIKA 3AONB 3MWKA 5F9HA 3DKKA 4TZ6A 1TAGA 1FIUA 3HKCA 2X2PA 1REQA 2ADFA 1BFDA 2E7ZA 2IEZA 2GILA 1MO6A 1RYYA 4TXNA 1AH2A 1GV0A 3VPGA 4JT4A 4CCYB 3FZQA 2AEEA 2O52A 3IQGX 4N41A 2FLVA 5IC6A 1PWXA 3C8DA 1PG5A 4EGFA 1IBMB 3UANA 5D00A 2JIRA 5IG2A 4FQ8A 1E1RD 1SQ6A 2HLPA 2C9CA 1XNGA 1DV2A 4D5GA 3DFMA 4UCWA 3MWEA 4YCBA 1GZ5A 1LBEA 1MGPA 2QM3A 3H4MA 4NDAA 5KHLB 5LMCA 2E21A 2VWQA 2YVAA 3VPSA 3VO2A 4EG0A 1FS4A 3ZVMA 3S5JA 3V4FA 2ZRKA 5T4EA 1WB6A 2JFYA 2EJWA 3A3OA 4O4HF 5CW2A 5A2QA 1Z2CA 3RS3A 3O47A 1ST2A 3R9XA 4ENUA 1J0CA 1IQPA 1TB4A 2X9NA 1SAYA 1VKZA 3P4YA 3ESCA 1K75A 3GRKA 3OE7A 4CM5A 2PRZA 1ESNA 2BGUA 3SIPA 2VDOB 2X4DA 2HLNA 3BGDA 2H8GA 3DZJA 3GZNA 4YCSA 1UPXA 1ZVKA 3QUAA 4IDHA 4MR7A 2QMQA 4XQGA 5HS6A 3GUYA 3MD0A 1LLFA 1FJXA 2NUBA 3L79A 4ENTA 1A96A 4DJTA 1GPUA 3KZKA 3R8XA 4DJJA 3ZTTA 2IOFK 1V6CA 1DCKA 2Z2KA 3LCMA 1RMQA 5T7BA 1C1HA 4OHXA 3DVAB 3IPLA 2GM9A 1AKWA 2D7CA 2PUJA 3CH5A 3QIAA 4M1TA 3WC4A 4BLWA 4Z7NB 2NMVA 3PFCA 3EW7A 5B3KA 5ALLA 4BUCA 5AVJA 5E6UB 3JAKB 4KQ9A 2I2WA 3F1KA 3RSFA 2YASA 2PV7A 1K3TA 2J5QA 4H59A 3TPCA 2IHYA 5IUKC 1US8A 1YIDA 4HXEB 2NZUG 3WP0A 5BN4A 2YIVX 1JB9A 4E15A 4MSUA 3NDJA 4M1OA 3KL2A 3CVYA 2HM7A 1UEJA 4GLBA 4UMEA 3AUAA 3ZV5A 5DBOA 3BT7A 2HIHA 3FPCA 3P2OA 3WO1A 1M34A 3VKUA 3KFLA 1F8YA 4B8ZA 2IEYA 5LUAA 3KQVA 2OAEA 4QOSA 4NPAA 4AZTA 2GPSA 2QBYA 4G5XA 3H16A 4W8HA 2DAPA 2JJ2A 3HUUA 4PZYA 2ATVA 4RLSA 4BLOA 2VJYA 3AESB 3GHYA 2B36A 3KFVA 2Z9BA 1FYWA 1BFKA 3IE2A 1GPH1 2BEUA 5BORA 5AM3A 5ED4A 3HCOA 1WQ1R 1P9RA 4EY4A 1ECFA 3RSGA 3D2CA 1E0KA 2FEMA 2XWBF 2RI6A 3HABA 3SC4A 1NN1A 2BR5A 3TRFA 4ZKDA 1EAYA 4M86A 2W0SA 4TZKA 4UZFA 3W4IA 3TNFA 4QT0A 1NNSA 4P33A 5KOJA 1BEUB 3PT9A 4DQ0A 4YXWA 1TLLA 4QL3A 2DKOA 2PWBA 4UUQA 1WUJS 3OH8A 3VU9B 4KGDA 5D86A 5AUOB 2PUFA 1EXVA 1VPTA 1L7DA 1KYYA 2XMSA 3AFIA 4V0OA 1P75A 2EW1A 3QBTA 1WABA 2F6RA 2YIMA 3RH0A 2DOKA 2A6PA 4BJHB 5G2OA 1YHZA 3JASA 5A4JA 3RRNA 4BYGA 2W2KB 2RGXA 3DZCA 1FTSA 1IHYA 2PO7A 1VJ0A 2YV1A 1O6ZA 1VYHA 4FTWA 1MRZA 1Z17A 1XQ6A 5PNTA 5LMUB 2OP0A 3HA2A 5I7FA 4EK9A 3DYBA 4XR9A 1GCUA 2YV4A 4DNXA 3FY4A 5BYAA 1QE0A 2G70A 4MWTA 2AR0A 4V38A 4E07A 6NULA 1QQBA 3RAPR 4QDOA 4D3FA 2OGUA 1E3JA 3KT6A 3KWJA 1QKJA 4LYGA 5HX7A 1KAOA 5LQAA 1QYCA 2I8LA 3NUQA 1DELA 4HQKA 4S2UA 4R7ZA 4DCJA 4W1SA 2GEFA 1VG9B 2AZMA 3H5OA 3MJDA 1DRJA 2FSUA 1EFHA 2R8XA 5KOIA 5IBRA 2G06A 4AQ7A 5LXTA 1ZGCA 1VYUA 4P7BA 3E2PA 1GTSA 3K9GA 1WSWA 1U0OC 1FY2A 4KE8A 1ORRA 5DNDA 5ADWA 1I4WA 4OJKA 3AUKA 4YJGA 5E7IA 3I2IA 1XMQB 3PYMA 4G84A 3N6XA 3ZOKA 4ABTA 4LCJA 1YGYA 2P79A 2ENUA 5CP8A 4A10A 4BNNA 5BWMA 1SXQA 1EGAA 4FCTA 5DTQA 3EIEA 2GK3A 1T8WA 1KFJB 1HE4A 1NP3A 1QVVA 2TRSB 2WNHA 1VKJA 4NC9A 4PBSA 4PPQA 4U3JB 4MUGA 5HOEA 3ZWBA 3HSKA 3IBGA 3GLFE 2W8BA 4K86A 2I6TA 2AEMA 2O6LA 2X41A 3QTTA 5K3FB 1F5NA 2W2OA 3IULA 5LYJF 2JGDA 4R0NA 4F8YA 1DAMA 1RAEA 2CFOA 2QY9A 3VZRA 1H1LB 1DC4A 1L4BA 4TTJA 3ZBUA 1Z35A 2J3KA 4DIOA 2PU7A 3C98A 1K27A 1E3WB 2IZZA 4G5OA 4WKOA 3K05A 3WLMA 4TVSA 3P0IA 4OQLA 2P5UA 2IWRA 3AT1A 1SRRA 5DHFA 5CCDA 4IFBA 5DK6A 3SHVA 4MVJE 3E7WA 1NKTA 5FUMA 1D6SA 1JMYA 1U5CA 3MTIA 4IIEA 5EP2A 1NASA 3L5KA 3S27A 3F7NA 2JDID 4NOLA 4PIVA 1RAIA 1JEYA 3R75A 1E2HA 3GARA 1AZWA 4ASUA 1WE2A 2KLBA 2AFVA 4IYJA 3OEHA 3SICE 5AW3A 3HV2A 4PSKA 4UHHA 4X3OA 3A0RB 4KH0A 4LX0A 3WLPA 1YQGA 5LKRA 1VGRA 1XA4A 4XVCA 3IBFA 2XXJA 1PHRA 3QI7A 1PGOA 3B70A 1GZSA 3RYIA 1HNWB 2A9PA 521PA 8ABPA 3WIEA 1SURA 4MDHA 1TA9A 4MGYR 4MMZB 3I92A 1ESZA 1VE6A 3B51X 4CF7A 5IYZA 2CWWA 2D4AA 4UUOA 4QASA 5T4HA 5A1JA 1FDRA 4KSBA 4F4HA 4UNRA 2TECE 3JQQA 3UV7A 4F71A 2GBLA 2FP4B 2VTDA 1T5LA 2AE1A 3DPSA 4V1CI 4GX5A 2PGDA 2QTAA 1QCZA 4GYYA 3ID6C 4H3SA 1PEAA 3UXYA 2BBSA 1NQ5A 2EBFX 1XDSA 2ZYIA 3DDSA 3UQZA 1DOZA 2YJ4A 4C6SA 2OWDA 1QVAA 4KFCA 2OFWA 4IO1A 4ND8B 1NLUA 1QBKC 1SCDA 1DC6A 3GZJA 4MHSA 1ZVJA 3F8SA 4LHSA 4P8RA 3EVNA 1E20A 3PQ5A 2NVOA 1G4HA 3K70B 4QTZA 2KBEA 1W2GA 1DEHA 4DTCA 4ZICA 5K3OA 1KRWA 4BXOA 3W5BA 1JJFA 1TRKA 2TMKA 4REQB 2G5PA 2FW1A 3W2FA 5A4IS 3HR7A 4DNPA 3CX3A 5JI3E 2ODBA 2DUWA 2PSHA 5JSKA 1HFKA 2OYCA 1SOUA 4CKCB 2VK8A 2EZTA 3RS0A 2VT6A 4HB0A 4L07A 1DXHA 1HEUA 4JLAA 4N0MA 1VJGA 2TMYA 5IHXA 2GAFA 4LPKA 5KYWA 2O8DB 1Y7IA 1QUEA 5I8PA 3LLSA 3ZCTA 3IPXA 2ROQA 2WP0A 3IQDB 3GJ5A 5TF4A 4P4UA 1K8ZB 2V6FA 3FTCA 1P1FA 1WDLA 4YASA 3A58B 2ONZA 3IELA 1ISJA 2LCFA 2WWHA 1XEWY 3CH7A 2R2GA 3Q9NA 4LOLA 4R31A 4XPIB 3WLQA 1RVDA 2HZ7A 5CURA 1DJOA 1Q6YA 3CH4B 4OHYA 3R7NA 4E1AA 3LT1A 3GJ0A 4GPAA 2AN4A 4O4LA 4HFRA 5I8WA 2FEAA 4A8TA 1N34B 4G07A 4GZMA 2F90A 1QZUA 4YIKA 1O57A 1TYDE 3DDCA 5KTRA 4OAPA 1Q7GA 1U3VA 2FZCA 4JSYA 3QVGA 4XJVA 3ZC3A 2OCIA 3EH2A 4FYVA 1M2NA 4GECA 2O0JA 4U2CA 3U7EB 3RHSA 2HMVA 1YA4A 1IK4A 2I3AA 5A7GA 3RAFC 4NKRA 3ZLTA 4NECA 1JSXA 2XDQA 1HE8B 1BMTA 1T9BA 2MYPA 4YV7A 5IK2D 3A8TA 2A9VA 3BDIA 1WUKS 1Z4KA 2EGHA 3L41A 1JU3A 2Q99A 4LGYA 1GAXA 1VJDA 3OQMA 4D41A 1OI3A 3LQRA 2F8LA 4EHBA 1ZUNA 4YJ2B 2NTEA 3ZDZB 1TE2A 1LXCA 1RRCA 5DBFA 1FVOA 2B35A 2CHVA 1H0KA 1DC5A 1RADA 1WXWA 2FWBA 4Q19A 3Q7QA 5AH0A 4DA9A 4ES6A 3CCCA 1JIJA 4UVIA 5I3CA 3ILSA 2QMYA 3N8NA 5JQGA 3DEIA 3HKBB 1MTOA 3CKYA 3X1KA 2CMFA 1NXTA 2GQ0A 3GT3A 4JFRA 2YFQA 4PG4A 1M2OB 3ZDXB 1YTUA 3PQCA 4I3GA 3O3CA 5CA1B 2J7PD 1M1NB 2GEVA 2MYTA 3HWSA 4MUJA 2YVLA 3RJ9A 3UPTA 3E82A 5T8KC 2NU9A 4MWZA 1K86A 5AKJA 5LFAA 1DKQA 1FDUA 1NJ6A 4OQXA 4DBLC 3PWTA 3L7OA 4LEIA 1DPGA 3WK7A 5THKA 1BTOA 2I62A 4UQOA 2CXNA 3O8DA 4MW4A 2FWNA 3R7WA 1Z6QA 2XOXA 4QBIA 5TMEA 4WERA 3EZ7A 4M0MA 2H4YA 1VTKA 1JYSA 1W85A 1YR1A 3I9FA 4OLFA 4CFYA 3W7BA 1IZ9A 5GWXA 4ALKA 1B42A 1H2RS 1W30A 4H7PA 3ZQUA 2PUEA 2AT1A 1M0WA 3OKCA 1IY9A 2W6MA 4GWKA 3BXGA 1WVIA 3PFGA 4I50B 4JJGA 5KNBD 2E4UA 2HLDA 3PGKA 3UMSA 1K63A 2OV8A 1TFRA 1PUXA 1AS2A 2AG1A 4ZWNA 1SZDA 3L7KA 3DFUA 1RPTA 2YBDA 3PFWO 1Z8DA 2A67A 2WWRA 4A8JB 3G1UA 5I7RA 1JBQA 1QIDA 4BLUA 1IHPA 1NIPA 3QKSA 2JLSA 3EASA 4OIMA 5ARCA 1GQYA 5FPPA 2WM8A 3WLKX 1YBMA 5EJ7A 1MH1A 2X1LA 1HLGA 2D5AA 3PRYA 3NT2A 3EVDA 5HCUA 3T3GA 4D8UA 1M6EX 2FE1A 1YJ8A 4F84A 4MRSA 3CEJA 5LDGA 3S8MA 2IHVA 2X42A 5KTMA 1E77A 2Y27A 1L5RA 4KSYA 1HMPA 5FUQA 1JEQA 1C30B 4CBVA 5HF6A 4BP3A 3VXKA 4U7HA 1YVEI 4GBGA 3S55A 4HDNA 5HIMA 2GEBA 2JHFA 3KYJB 4YMLA 1SN7A 3THWB 3UB3A 3E7PA 1JSRA 3OJ0A 4ZAXA 5TB5A 2VSQA 3GUHA 3H87A 3KNZA 1R00A 1LVGA 3E4CA 3FVTA 4Q5IA 4UW9A 5BSRA 1NQVA 1NXQA 1CVIA 3SP1A 4MYDA 5ALHA 1AU9A 1RAFA 1R8XA 3NIWA 3ZIAA 2EP5A 1I1HA 3P9SA 4LZAA 3WGTA 2D5CA 5AFSA 1GDHA 3T54A 2D2IA 3LYHA 4GICA 1V26A 5J4HA 4MLZA 2AWOA 4IVQA 3PQ7A 3VQTA 3GEPA 4AY2A 3I9KA 4WVLA 4Z5XA 1MG0A 5KYNA 2BBWA 1DRVA 4KO8A 2F9FA 2PU5A 3K0CC 3D0RA 1A9SA 3HJCA 4NK4A 1N2XA 1FA9A 4V0LA 1Y3DE 1U4SA 4Q66C 3KQHA 3W05A 3EC2A 2EBHX 1S2OA 3JWIA 4E5VA 2UZ4A 1ZCZA 1OLUB 1U99A 3RSSA 3CG0A 4DPKA 4G0ZA 1UBMS 2G8NA 4JP5A 3JYNA 4PYKA 4X64B 3IHKA 3P2EA 4V02A 1AOXA 1QHHB 4WX2B 4PZZA 1ZM2A 3LTNC 2DJ5A 2RK6A 4AZ0A 1KYQA 4BGIA 1N6KA 2ZT7A 4CEJA 1WBBA 4P54A 3U40A 2AW5A 1HC7A 2FH5B 2IHNA 4RWZA 4GXQA 5DKFA 2JBWA 1NLZA 4KREA 3DLBA 1M8GA 1UC5B 3PJGA 4IX9A 2YN4A 4RY2A 5FEMA 5BWNA 4IIJF 1E1QA 3MA0A 1M2GA 3R77A 4ICIA 4UMDA 2C77A 2R6AA 5EIHA 1XZKA 1PWZA 2INGX 2PXAA 4EKIA 1WY7A 3GYBA 3OFND 4QUIA 3ZJVA 4N39A 2VSOA 2R44A 3CTMA 1SO8A 4MCJA 1L8QA 2YVQA 2GN0A 4WCVA 1M1YE 2EJBA 2MSCB 1KI6A 3AI1A 7REQB 4AG3A 1JLLA 4W6QA 1PU2A 2AOWA 4TVOA 5IH3A 1V9CA 3GXOA 1KEZA 1PD0A 3WLAA 1IZZA 3TAHA 5GADl 1Z34A 4X8LA 4FYYA 5REQA 1ZLXA 2B2NA 1CQZA 2PA3A 1WA5A 3WIUA 2WEKA 1Z47A 1E6WA 4GBJA 3L6BA 2Q1UA 3IAHA 5L4NA 3UK7A 2FUNB 3W9UA 1UCFA 1RC1A 2YBEA 2HBQA 3NQ41 1IE3A 2VXYA 3OURA 4BMZA 4CF5A 4EG3A 3K1AA 3HFGA 4H18A 1R6TA 5D3MA 3ZHYA 1GPMA 1QIJA 4Y2RA 1CEEA 4JI6B 4UOQA 3ILXA 2H52A 1JQBA 3TVDA 2WYVA 4O5AA 4AUNA 5E4FA 4KDFA 2IE8A 5E6SB 4BECA 3IL2A 2HT1A 1H05A 1G5QA 4DRXB 3JVDA 3P27A 1JFVA 3BA6A 2PD6A 1I9GA 1GPAA 2LRHA 2KPOA 4II2A 1TUBB 4FVTA 2WYHA 3VOSA 1W87A 4MQ6A 5WRFA 5A3QA 4LVCA 1RXYA 1KI4A 4B5LA 2NPOA 1JPNA 2Z57A 2ATEA 1LF0A 2CXOA 5AI9A 3QU2A 1FJGB 1CNEA 1XLTA 4MV4A 5TQ2A 3RREA 4JYZA 4JVSB 4AY4A 1XTQA 1G5FA 2KYRA 1EWVA 3N8IA 3PHLA 1GUAA 1U31A 1ULAA 1U90A 4HAUA 5F12A 3LQ4A 4D9JA 4E3ZA 1IL0A 1N9GA 1R50A 2JNWA 1V7PC 1GY8A 1ZJYA 4DYHA 3W8EA 2PQ0A 2HA4A 4YVFA 3UUWA 4C6TB 3E3AA 2CXSA 1OBCA 4XWAA 2IYRA 1XRMA 4RH1A 1TKBA 4HSEA 3O1JC 4WH0A 4K6FA 4CM4A 4D8YA 4EKGA 5BPHA 5JROA 2J3QA 1W0KA 4OYYA 1RM5A 2FG6C 1GGVA 3ICPA 1C9KA 1KJWA 1NI3A 3G7NA 4MI1A 3TJRA 1HNXB 1DX4A 1E2JA 1GFWA 3CLUD 3KB1A 2HHHB 5G1PA 1P61B 4BX8A 1DLJA 4KDEA 1KBOA 3O1IC 2WUFA 3BUSA 3SBOA 3C6KA 2VPZA 4L08A 3JTEA 2IV3A 3NBXX 2YXDA 1JDUA 2FWPA 4LJAA 2SBTA 5EIXA 1PZMA 3NVAA 1M6NA 3GLRA 4W5QA 1KYTA 4WMLA 1TT5B 4KVZA 2QUZA 3ABOB 3K7EA 4OYRA 4WSOA 5F77A 3SMVA 3JQ7B 4DLVA 2HRDA 4MKZA 1G2OA 1X77A 4LVOA 4F38A 5HJ7A 3QG5A 4WKPA 2WWGA 3BXZA 3ORRA 4NXNB 1Q7RA 4KLNA 4M98A 3QE2A 3FAZA 4F3CA 5ENZA 1GA6A 5BYKA 4Q4HA 1OKKD 1QYWA 3O91A 4U63A 4YO7A 3G8YA 4W8OA 1T26A 2EKBA 4Q6BA 1XVLA 4QGGA 1KJZA 1XCJA 4Z0HO 4U02A 3R4VA 1JQLB 3NKVA 1EJ0A 3X2FA 4LE0A 3UMBA 3CUTA 1FF9A 3OTGA 4RIFA 4A0HA 3KQLA 3DV0B 3LV8A 4PGHA 2H0AA 1VLHA 2YHUA 2FF7A 1DRUA 2PNFA 1FPMA 2C4MA 2X2EA 4RGVA 3RT7A 3TAXA 3ZEAA 4EQZA 3DJFA 5G3YA 1ZM9A 2VP9A 4PIMA 1R0YA 1SKAA 4RU1A 3ZWCA 3K0KA 4WZAE 1HDXA 1R6UA 3EYWA 1DWOA 3RFVA 4B4DA 2CVZA 5JFOA 4OH7A 1PHPA 3AHGA 1SBTA 2VYVD 3FMGA 5AKLA 5CFNA 4CM6A 4CFSA 2I4IA 1U0RA 3DBHB 4L74A 3U81A 5H81A 4WGFA 1R3DA 2PKRA 4NCHA 3NHWA 3WKEA 2P8SA 2HEIA 2PUBA 2LKCA 2NZXA 1L1QA 1J9EA 3SY8A 3Q7IA 4P3NA 1M1UA 5G4KB 4DV1B 2Q6VA 1S96A 4DDWA 3OCXA 1ZRMA 2FSGA 2PSFA 2ZWPA 4YUAA 3L7LA 2M6RA 3MS2A 4N6OA 2X1MA 3EQZA 4BMYA 4EGSA 3WLJA 2XMCA 3OQVA 3TUZC 1NYQA 5DWVA 4JWKA 2G88A 3STXA 5JSZB 3B7GA 4IIDA 5TVKA 4HUQA 2IE0A 2SECE 4Q3LA 2PJRA 4R51A 2EL7A 2C4NA 1DAIA 3ETNA 2HEGA 2VZ9A 4QYSA 2P3SA 3B1ZA 3ELYA 3OY2A 3BRWA 3UIEA 1YAHA 4GO1A 4CCSA 3LYLA 4KWIA 3VDMA 2KI5A 4N8SA 3PLRA 2HSGA 1R4MA 5A5GA 4D46A 1ULZA 4ZQIA 3AK4A 1CJTC 5KPJA 5A02A 3EIOA 5E1BA 4UATA 5L3SB 3DDWA 1LU9A 1Z2AA 2FUG6 3I83A 1EP2B 2ZI5A 3CSSA 2JIOA 1JHOA 2BEVB 3KEOA 1NLYA 2JFZA 5B53A 3JQ8A 4TLAA 1KJ9A 3MCZA 4YMVA 2C03A 1SUBA 3KHUA 5KC8A 1Z68A 1OCEA 4AS2A 1PL7A 1Q17A 1FCJA 4GMGA 5EKSA 1K08A 3HVUA 3IVXA 4B79A 4TTSA 4BQPA 3QSYA 3MMZA 2PS0A 1QXSA 2FVYA 4O63O 5JD4A 4KR2A 4GMXA 3DOHA 5EP4A 3RS7A 4C04A 4QDTA 4JSRA 3VUFA 4XE5A 3WIOA 3G6WA 4Q9DA 2ZYSA 1AB5A 5FWNA 3L1VA 4DV0B 1KEVA 2Z3VA 4GH5A 3MAJA 3O3MB 1NW9B 1JALA 1P1JA 1Z3IX 2JG3A 1R64A 2JB9A 3GAAA 1DXYA 2RAPA 3TI7A 4MROA 3G79A 4B48A 1Q3TA 2VK1A 1YHYA 3FLAA 3G9XA 1GG8A 3C3PA 3FWHA 2UYCA 1RAAA 4YAFA 1A8QA 4QUHA 3HZRA 5G40A 3D9QX 1CY7A 4TLMB 3UWKA 1XE3A 5GQSA 3EQ8A 5L7TA 2NQ2C 2QXTA 3TSOA 1WBDA 2FF5A 3EXEA 2WI8A 1UPFA 1AN0A 1JR3E 2XRYA 3DL2A 1GP2A 3O9VA 3HJRA 2Q5QA 4N54A 3G5AA 2R47A 3OQ1A 2LDBA 4KQHA 5AOCA 3RKUA 5HQ3A 5ALWA 4LQCA 2ZZKA 4FR0A 3C5HA 1MEJA 5BQ5A 5JZVA 2R87A 1ACLA 1T9CA 2DWPA 2YUTA 4L6AA 4P2GA 4QVKA 5C31A 5KNCH 2HSEA 1Z2DA 4GU5A 4LNUA 3FYSA 3UNXA 4D3ZA 4MUYA 1U8ZA 1PS8A 1M1ZA 4BQFA 3V4ZA 2WTUA 4F45A 1OLXB 3WB2A 2FR0A 4J7AA 3HJAA 2CNOA 4CN8A 2FN3A 1ZL0A 4IMJB 2EW2A 4AL4A 2ORVA 4J4TA 4D9MA 1BRMA 1F51E 2YRWA 1GL9B 3FETA 2QN9A 1SG0A 3DGFC 3NGXA 4TSKA 1KP9A 4G4SP 4CKYA 5LZ9A 4TKVA 3MIIA 4YP1A 4TT3D 1KXJA 3W78A 1RXVA 2O4CA 4MV1A 4CG1A 2X0FA 1L5YA 3RUHA 1GPNA 3D0QA 1HUQA 2FMXA 3AF2A 3QEMB 1VL5A 1YR2A 3EY9A 3P0RA 2Z43A 4V0KA 4EOGA 3KG2A 4J0CA 5FR1A 4FYPA 2CLSA 3MN1A 4WBNF 4TLBA 2GK7A 4L16A 3TBFA 4LXYA 5FORA 2VJLA 2HJRA 3ESQA 1DPFA 2FYTA 3L7AA 3TO5A 4P5PA 3SQXA 2IXEA 1E79A 2JFGA 2JD2A 2R8PA 3D1JA 3KD2A 4IVPA 3E7DA 4Q9LA 5IDYA 3CLVA 4MH0R 1JKFA 4Q9NA 4X6LA 1NIJA 2C0PA 3DQQA 4FOLA 5BQFA 3NJ8A 3GVHA 1TAQA 4W63A 5K0ZA 4K9DA 1L5QA 4QXAA 3C3WA 4HZUB 4I36A 5K3BA 1LPMA 5DW0A 5CX1B 1D4AA 4WEQA 4P4GA 5ESRA 2QTHA 2IS1A 2XVAA 4QJIA 4RVCA 4KQIA 1ECJA 1OE0A 1T8YA 5AVYA 1XPOA 2WNIA 3LQFA 4DMHA 2QRZA 3LPMA 2LIVA 3O0DA 4KKVA 2FG7C 4M53A 5DHRA 4Y9SA 3C7AA 3N28A 1XQ1A 2VHEA 5AQ1A 1G8KA 5FJJA 5KYXA 1ZL2A 4DREA 4EM6A 1YJXA 4QM6A 3IAM6 3ENWA 4WW0A 3TG8A 2GSWA 1B0PA 1LI4A 1G8MA 1ZN7A 1Y1TA 4JL5A 1GFIA 3OMLA 3CEAA 3P52A 4LGMA 5F64A 5K45A 2WV9A 1E2KA 2C96A 4BMVA 4L1KA 4TWAA 4DOMA 3VR6H 4BUJA 3W4JA 2WT8A 4DF3A 1CF2O 1YNOA 3DZGA 4B6FA 2B8JA 2O5EA 3EG9B 1E1NA 3A6LA 4GLFA 2R86A 3PK0A 4LZLA 1OU4A 4X20A 3V42A 1QRUA 1T6YA 3FPJA 2C59A 4IXNA 4S0ZA 3LHIA 3QFSA 1Z8HA 1X2EA 2VYFA 2WB2A 1XNQB 4MK4A 5HKOA 1FW6A 2VDVE 2O8CA 1T2EA 3CO5A 1WRBA 1ZCBA 3V1KA 4DBZA 1C9YA 1QRRA 1Z38A 4JFAA 1XB2A 2WIJA 1T2NA 3EF0A 4HH4A 4CQMD 1NW8A 4RTRA 1MB2A 5HM6A 3GFGA 3LSYA 2I9KA 2QMOA 3PUHA 3TL3A 4AURA 3D7MA 1DX9A 4IHKA 4B46A 2F1OA 2N47A 1MQ8B 3R23A 4DW8A 5JAUA 3KJZA 4HB4A 3VH2A 4EB8A 2O1EA 1MW9X 1H8HD 3LD9A 4HWGA 1RAGA 2CYBA 2BFBB 3R8FA 1XZQA 3WGMA 2OP1A 4H0NA 1DJQA 2PYIA 3IT0A 3PXAA 3OQ6A 4UARA 5TPWA 2DWCA 2PUWA 4CUZA 1G9SA 2CVOA 1V4VA 1YRAA 4YT4A 4R8SA 3R0XA 2HO4A 3QM1A 3W1EA 3PXBA 1KQOA 2B5VA 2RGAA 3QHAA 4U6QA 3Q2OA 4CG0A 4HP8A 1U0BB 4R84A 4OA8A 4V0QA 4B8WA 5KTSA 2QM8A 5H80A 4Y2JA 1K7EB 4PSVA 5YASA 3Q12A 2V6BA 3KUCA 3C6ZA 4R3NA 3VDQA 1WHTB 4QPZA 2NYUA 2C31A 3OMWA 3PIRA 1RR6A 3ONNA 1FFSA 4S35A 2NM0A 1N6PA 1BCSB 3CPSA 3I09A 9LDBA 1ZNQO 1CUEA 1L7BA 1Q74A 1RYMA 1U94A 2QN2A 3AV3A 1TF2A 1QIEA 3D3JA 3SFZA 4OM7A 3OD5A 1RKBA 4ZU3A 3JQ6A 4DWJA 3A37A 2WYOA 1TUGA 2GRJA 3UICA 1PR4A 2C5AA 4TROA 3Q3GE 4PZUA 1M5TA 4H7EA 2YQ4A 4KQKA 2ZJ6A 2GLUA 4YJHA 4C4XA 1GYQA 1LPNA 4ENRA 3THYA 1XKXA 3STUA 2RHCA 3D4IA 3I9V6 3D64A 3JARB 4UEKA 1L7NA 4PC2A 1TCVA 2I4NA 2V0NA 1DG1G 3RFFA 1Q7CA 3A26A 1TCBA 3GLQA 3H4IA 4OMUA 3SX4A 2XQVA 1ONPA 4DUGA 3G0IA 5BN1A 1IJFA 2IYZA 4MJLA 4TT8A 1PSWA 3WB1A 4X1IA 3IVMA 3SHTA 2HUPA 3WYAA 3HH8A 2H07A 1U4NA 2WILA 3X1JA 2C1ZA 3JYHA 2DFNA 1Y7HA 2QZPA 1VA5A 3HZHA 4KAAA 1L5GB 5EHNA 4F4DA 1RJDA 5AM2A 5JV5A 1BE8A 4D0RA 3PUYA 4IQ4A 2JLWA 3B5JA 3S0JA 1Z0UA 1NSTA 4D99A 3CVVA 2O7NA 4O6VA 5L3ZA 4YPFA 4W7IA 2JEOA 3U0BA 4FGZA 4OUDB 3GMTA 3BWDD 4B17A 4EG4A 5B36A 1HDOA 2Q5LA 2NZJA 3G8BA 1ZXXA 1P2UA 2CEAA 2OAP1 4FDLA 1CQWA 3FD8A 1JR4A 5EPOA 5DMXA 5GMOA 4WE3A 4PZAA 3OZRA 4JMPA 4XPZA 4AWXA 4TLLB 3PD1A 5BT8A 5CEFA 2PXXA 2O3TA 2Q50A 3B2NA 4RLQA 1PLJA 3QPUA 2Q4DA 1HPLA 1UQTA 4XSVA 3ERCA 1Z13A 5HFAA 2H59A 4JU8A 3OQJA 1SUPA 3L0CA 5I4IA 2B25A 1WCV1 3TB4A 5JLAA 1QRDA 3BH6A 4DC1A 1FU7A 2YRFA 1R37A 1HDRA 1WUYA 1LTHR 3SQNA 4HYQA 2DF8A 2OBNA 1RD4A 2CE2X 3SDZA 4EUFA 3EFBA 4YNBA 1XCPA 1E3EA 3D6VA 3G0CA 1Q95A 2VBIA 5EKXA 3VPDA 1A7JA 2YVUA 1DCFA 3VUEA 4YFVA 1PYGA 1X1DA 3L3BA 4NZZA 1RKXA 3G2PA 3H1AA 4H6WA 4C7OB 5JASA 3BWCA 5D6OA 4IPTA 3SX0A 5FNVB 5JCJD 4FDMA 4B3GA 1ZJWA 1T9KA 5CT6A 5KTTA 4LCBA 3TCKA 1H2AS 2Z83A 1WXFA 4Q37A 3JW8A 2UUBB 4XWTA 5GVRA 4G3XA 1A8UA 1ISPA 5ELXA 5J2TA 2EHDA 2BDUA 2J3LA 4X94A 1RLUA 2JH8A 3AKDA 3GGJA 3UJHA 2C95A 3F3MA 4FYJA 4GKBA 5G3ZA 3QVOA 1MHPA 3KBOA 1XXHB 2WLTA 4A6XA 3FG9A 3RLFA 4EHFA 4F2DA 2HW8A 3BMQB 1MQSA 4QULA 2BTEA 1IBSA 1LB1B 1CP3A 2OR3A 1EFKA 2QNRA 3DBVO 5LP1A 4WY5A 2I8AA 4UCQA 3K0FA 2CLOB 2VKQA 3C3MA 1JAYA 3AF1A 3PC8C 3WK6A 4DAOA 1AG9A 1JEJA 1MX3A 3ZQKA 2H1OA 5CGZA 4WOBA 4NG4A 3WL4A 1H6DA 1QO0D 1XMIA 1PZHA 2NTYC 2ZYUX 3OEWA 1CY0A 2REQA 5DOVA 1PRYA 1NX9A 1H93A 3GGDA 1SNYA 3HQ4O 5FPQA 2QSJA 5B58C 3WWYA 1GT6A 4L5IA 2B3TA 1GYRA 1KQFA 1Q1EA 1MIOB 3C14C 1E32A 1DXOA 3IOCA 2BLNA 4U7DA 1SC1A 4FX2A 3DLAA 5BSMA 3A3KA 1PD1A 4RM2A 1LW6E 4I4TF 1NMEA 3U4AA 1J33A 2CYCA 4M9UA 1IU9A 2ZUBA 4PGMA 3QTLA 5F2OA 1V9LA 2SKCA 2Y1KA 3HUEA 4FNAA 1Z4NA 3LP6A 5ALIA 4EHLA 3E9EA 5TSDA 3WNCA 5KTNA 3EMKA 1A2BA 3MWLA 1PWYE 3DDNA 2ODPA 1J2UA 4OBEA 5ERXA 3K1JA 4FYKA 3TQRA 4NBLA 1UFQA 3ZNPA 2ZE6A 2GBIA 4MIYA 3THXB 2G3YA 3IT3A 3M33A 1GGNA 2JHCA 3TTTA 2VNKA 2O54A 1C1DB 2ID8A 1ZH2A 2WM2A 3HYCA 1AMNA 1OJLA 3HLTA 1VOTA 3AR6A 2PNJA 2XNCA 3A6GA 1RIIA 3C87A 2H0RA 2IJGX 4DG9A 1CLEA 1N0IA 1RJ9A 3A31A 5LNK6 5IVIA 4C9BA 3G8DA 5LA6B 3DJYA 4F21A 2ZB3A 2E6KA 3NRBA 3V8MA 3E0XA 4MPTA 3F6SA 4D9BA 3IDFA 3LW7A 4NNOA 4ZRDA 1YI8A 2GYUA 4CM8B 3QHQA 2Y2VA 3QYFA 3RF6A 1BEEA 4HKTA 4WASA 4B6OA 4O1MA 4J6EA 4EELA 5ERYA 4C03A 4HVAA 4DLBA 5JG7A 3DE4X 4C20A 2C78A 1O8CA 3HRHA 1T3TA 5AHXA 1N6NA 3GR6A 1QUFA 2ZREA 4WOJA 3VO1A 3W5HA 1B00A 1Y5MA 2P41A 2ZJ2A 1J2EA 5CLHA 4C5AA 4DEVA 1W75A 4RABA 1ZJ4A 5BW5A 4DDTA 4IG4A 2PGXA 3C7TA 4AY5A 4RZXA 3AHEA 2IEDA 1ABBA 4JD5A 1O4WA 2CVQA 1W49A 2Q1WA 4MVJH 1AKMA 1X7DA 3MMPA 1IH8A 3LVBA 5F1PA 4N5NA 1Y5NA 4F56A 2PVPA 1E62A 4I9UA 2RAVA 1ESCA 3PC4A 1V1RB 1N57A 1P4SA 2JJ1D 2P6MA 4URWR 5BWLA 4Q1FA 4JBWA 2ISQA 4PLPA 5LDHA 5SICE 5IS2A 2O5CA 2IYUA 3H0KA 3WHIA 1N77A 4HD8A 2GO7A 4HTFB 4MHOA 4E3WA 4HV4A 2H5EA 3IURA 1K5GA 4NBSA 5DO9A 1SGWA 3MMSA 4US2R 2ERCA 2POCA 5T3YA 1MUUA 1T2VA 5AJTA 4ZVSA 3G7UA 3AM4A 1FRVA 1UJCA 2H7CA 4R2LA 1Z5PA 2K7FA 2XWSA 1QP4A 2D8AA 2XXBA 1TZBA 4JLMA 4WA8A 1HE2A 4WADA 1THTA 2IOFA 2WU0A 2ZR0A 4PSCA 4F4CA 1EESA 3DEYX 2QLJA 1EBUA 3KDPA 1T5IA 1GZ3A 5JNTA 1WMSA 3HO6A 3NVDA 5BYBA 1PW5A 2WMOB 3IVAA 1UWVA 4JB3A 4TUYB 3MAAC 2BMAA 3UCEA 1C9MA 1JG1A 3L1IA 1YRWA 4Y6SA 2UUAB 1HT0A 4ENSA 5C35A 2JFPA 3AC0A 1N25A 2AMYA 4KAXA 1QH0A 2UZ3A 3P1JA 1SWVA 2C9MA 3B38A 1WKCA 2YFYA 3AZQA 3SC3A 5A5DA 5CAEA 2X6QA 3RVPA 4F9GA 3TW4A 1QR6A 5U1PA 3L7DA 4EQ6B 5KOHB 2PX2A 3ZKWA 1SCUB 3ZHUA 1ZAYA 1MG5A 1NXOA 2YW2A 1G41A 2EDAA 1D2CA 2J45A 4GRDA 3KSMA 2DBVO 3PR2B 1GL7A 4DCNA 5HRAA 5JLJA 2V54A 3FUVA 3R8CA 4ER7A 3AF3A 4IRMA 1BAPA 1W4RA 2CHQA 2ZBFA 5IJAA 1OFGA 4BLRA 4D5EA 3OECA 1U3DA 2AG5A 3A1FA 4A3SA 1PJAA 4QOFA 3L1KA 2XVXA 2EKZA 3L8GA 1WHSB 1QE5A 5BW8A 2V6IA 1YRLA 3OU7A 1OYOA 3H7IA 2Q21A 5CITA 2O2GA 3N2IA 3KAKA 4MB6A 3A3YA 4WN9A 4PHCA 3EXIA 4HDQB 4F6CA 1IC6A 2PSEA 1UBJS 2XMZA 2XB4A 4XIFA 2VS1A 4IJVA 1XQWA 4H6PA 4CTMA 4ZOBA 4GSYA 4HYEA 3Q3VA 3OPVA 3HVIA 3TEFA 1M72A 1WW3A 3GD7A 1XHLA 5EEGA 2XE4A 3C3XA 3RVMA 1DARA 4YFYA 3C1AA 2ZIEA 2N46A 1OBFO 5FBHA 2PV0A 2W0MA 4ZDJA 1F20A 2L2QA 4DFDA 3AY3A 4Y6LA 3SBEA 4DR5B 4GWLA 1NBAA 1PG0A 1DHRA 3GLIA 3CF2A 4WNAA 1LS6A 2FQYA 3RUPA 2EKDA 2QLNA 3BGOS 5BOSB 3OPQA 1DX6A 1T15A 2QL7A 2WSIA 3DW1X 2ID4A 3IIKA 2HK8A 3QELB 1M75A 5CJPA 4KP7A 5CGQB 3EZXA 2F8SA 4P7JA 3LUBA 2V5AA 1P0FA 4H7DA 5JRJA 4XLLA 5AVUA 3B36A 4RMHA 1K8YB 1E1RA 3PX3A 4BE4A 2I22A 5F2KA 4JLOA 1D03A 3NKFA 2PSDA 3R5FA 5ICGA 2CZQA 2AIRA 2E6UX 1V8FA 1SUIA 1K8QA 3RIHA 1B6TA 5BUSA 3X1ZA 3U7HB 3MINA 1P2SA 5FFFA 4HBZA 1OWNA 1PVOA 5EZYB 1X70A 5DLEA 4FN5A 1YCFA 1JR6A 5AKIA 3SWWA 1MQAA 1UBTS 2R65A 1ZMTA 4IHJF 1FDSA 4D3DA 2FUCA 1D0IA 2QLMA 4IW3B 5AIAA 3ECSA 3SYNA 4CKBA 2QS9A 3DTYA 1NYLA 4OYHA 1L7PA 5LQMA 2J30A 2DU8A 3U7QA 4ZYUA 5ECYA 3UGJA 3ECAA 1PV2A 2ZJBA 3S2YA 1MO2A 2ACWA 2FW6A 2FUG1 4KDRA 4URHA 3ROEA 3TDKA 2PGJA 5FEUA 1Y3FE 5FWAA 4F4IA 4PY2A 2O06A 4ZVUA 3C8MA 1A9XA 1WB4A 1YB1A 3FSGD 3P19A 1QF7A 2AXNA 3G17A 4X97A 3WQQA 1QU2A 4CPDA 1RKVA 1MO3A 3GMIA 1IIRA 1XG5A 2IDMA 1CKEA 3SN6A 4YMHA 5ETJA 5AW7A 1IEVA 1AT1A 4QOEA 3BWYA 4KWTA 3RIMA 5TQ0B 2B98A 1TZKA 3B1FA 3SYRA 4V2UA 1XKTA 3GLHA 1DTWA 2DX7A 2POQX 2XCOA 1ZQ9A 4OI4A 5A7FA 3PRKE 1T1GA 4RD3A 4LDQA 1QYVA 4MINA 1EK1A 2N1BA 4QTUB 1BJTA 1G8FA 1SVOA 2JFWA 4GMHA 4HEA6 1NTRA 5JH7A 4AS1A 1MB3A 1P5FA 3FB4A 5EMLA 4H27A 1TEXA 2EFJA 1TCCA 2IELA 2VHCA 3AG5A 1ZP6A 3NFYA 3PEUA 4D8TA 3FPHA 2GN1A 4BVLA 3X2SA 4DXAA 2C04A 1RQ7A 2ANCA 1WQ3A 1NPDA 4IV5A 2ODTX 1L3BA 4OPMA 2GZRA 4MI6A 5KHOC 5IM4F 2IS2A 2HWKA 2PZ8A 2SICE 4MWOA 4HY3A 2GD2A 1UL1X 2GEDA 5AW9A 4GPEA 4DXDA 4WN3A 1OBOA 2X8BA 5FDFA 1CRZA 2IPOA 3C3BA 4NS4A 3PGJA 1GUDA 2Q41A 3AM1A 1CUXA 1UWCA 1KEKA 4L0CA 3I1FA 2UVDA 2VH1A 1KMIY 4YAEA 4E4YA 1OROA 4IMPA 3GLKA 3CS3A 3GZTB 4PLTA 1Y4SA 1E0SA 5LOVB 1LBQA 4UVDA 4EWLA 1BS9A 3CPHA 1MAVA 5AK5A 1IRIA 1P73A 2FGJA 2PD3A 2Q28A 1IEQA 2WHPA 4FP9A 4PAWA 4RJTA 5K05A 2BKEA 3QUBA 2H2AA 6ABPA 2IYXA 1U28A 2K87A 2JRCA 4X8MA 4DHWA 5BSEA 2XCRB 4ZCTA 1CUCA 2IEBA 2PKWA 2X8JA 1A9OA 2ZT6A 2P69A 1VBMA 4WI1A 2V9CA 2YV2A 1HBJA 4Q15A 3UK1A 4JLDA 3RHTA 1JIVA 3FPBA 1KEEA 1TQDA 1ONSA 2OLKA 3KXLA 1XRSB 4K9SA 4MZXA 1TEVA 3R4CA 3RKRA 2JLBA 3IP8A 4I55A 1MGOA 1VMEA 3FDJA 3RLIA 3ZY5A 5C4IA 3FOBA 2DPGA 4KIGA 1M2KA 2ZXEA 3TZ6A 1UT6A 1SR8A 1GGKA 1TUIA 1TZ2A 2IUEA 1DTEA 3FROA 4WZBB 2XKJE 3B6IA 5EJ9A 4TX1A 3L8YA 1Z6AA 3JY6A 1FTNA 1KC3A 1YRYE 1LBHA 1O2DA 3R9KA 3UGTA 2XA9A 3Q8XB 1JVNA 2P7HA 2H6EA 3EQ9A 3D6MA 3DSRA 3DO8A 3IO3A 3CH6A 4KN5A 1IVNA 2H48A 2G1KA 3ZW7A 1T4CB 4E70A 3GCWA 3SSAA 2DPXA 2RDMA 3B1VA 3IJRA 1C81A 3P4XA 1L7OA 2DHRA 3LK6A 2VJOA 4PFSA 3WXBA 3ZY4A 1FRFS 1U4OA 3AEYA 3BGIA 3K72B 4PRKA 4TS4A 3OC0A 3SIRA 3QYJA 3FNFA 1FP4B 1ZD2P 3ABSB 1M6VA 1MR3F 4OQ4A 4BVHA 3AU8A 3IAM1 5JPIA 3ENKA 1JP7A 2OOSA 1WXDA 3O9MA 2GAIA 4L6CA 5F4ZA 3IALA 5ITZB 5MN4A 5IWCA 4HNSA 2O1WA 1XAIA 4UPEA 1U0HC 4FN4A 4G1UC 1GXSB 4ND5A 3EVBA 3O3NB 2HA7A 1WXEA 3PNPA 3VR3D 3LA8A 1T3GA 4QATA 2PM8A 4O3MA 1FUIA 1BYIA 2H57A 1YS1X 1LC0A 2DYKA 3FSRA 1NZDA 3GEEA 5B2EA 2BMJA 2CNDA 3BK2A 3M6XA 4MEJA 4OHRA 4OHKA 3IP7A 3L9WA 3R3JA 5DCWA 8ATCA 4AIIA 3CKMA 2VA8A 2JFOA 4BDTA 2JDIA 3S68A 1QAOA 3AHJA 4ZYXA 3RVNA 2WRZA 5GY7A 4WEOA 3ILHA 3O8LA 4LJRA 2GN6A 5CIQA 4LF5B 1AUQA 4ZGGA 3K8OE 3M81A 4KXYA 1W4CA 2NTJA 1W35A 3OJFA 3TGPA 2NLOA 1P29A 4DNQA 2GD6A 2A8YA 3FPAA 5EQFA 1AMOA 3A3NA 2ZAIA 3GPIA 4JDUA 2BGRA 3HVJA 3QPVA 1ZMOA 2VT2A 3JALB 4ON9A 4YDHB 2QZZA 3K09C 1RWVA 1EWQA 2PH7A 4L6IA 4MB2A 3ZHBA 1EHIA 1E5VA 3BHNA 1UM9B 1WO8A 3UAWA 4QZVA 4XWWA 1O5TA 3KKLA 1HTWA 1T9AA 4RFSA 4QUEA 4WNYA 4YRBA 5ABPA 2XCUA 3IOMA 3L7YA 1IBKB 3ZDDA 1THMA 3KLNA 1M34E 3GUVA 4RHXA 4YR9A 2FWJA 3T3EA 1QHGA 1S3SA 4GI1A 1WXIA 2WWWA 3ANSA 2W2PA 3WB9A 2GPYA 3LZCA 2MWMA 4RHEA 2V0GA 2O23A 1H5UA 1UPCA 3N2LA 2ZZNA 4KQFA 3D8SA 3MGBA 3PC8A 5F9MA 9LDTA 1SU4A 2GKSA 2Y0PA 1WW2A 4CLHA 5BWBA 2DP4E 2R8OA 2ZVJA 5DHPA 3MK31 5SZHB 4ARAA 2DRIA 2V3VA 2UYQA 5DBHX 5CVTA 4INPA 3GLGB 2VPTA 2ZROA 5FA6A 4B2IA 2X1HA 1WKVA 2AN5A 2H4ZA 2WYIA 1KMHA 1WP4A 4X92A 2QYHA 3U1BA 4DT1A 4IWYA 3GGOA 4LRSB 3SFTA 3EEOA 2HWYA 3FWKA 2OSBA 1F2TA 4J7XA 3RRXA 5DHSA 4FMPA 3PQ8A 2W4IA 1RYZA 5I9BA 3H5WA 1K4MA 4TLCA 4GS5A 4RHTA 4ZREA 3SLKA 5CLJA 1BU5A 1MZVA 3KR2A 3QVJA 1LSUA 5FWXA 3KK0A 3ZJYA 3DTTA 2PR7A 3A1EA 1ZCJA 2UZ1B 5LWQA 5ICMA 4UHDA 1NN5A 1JG4A 2GK6A 1EK0A 1ZIPA 4L8VA 2TSYB 5FKJA 3JAMA 3JZMA 5JMWA 4YRCA 1Q0QA 3LX4A 4I0WB 1MJFA 4RIHA 1L5HA 2V3CC 1QIIA 3A28A 5JAOA 1Y6FA 2JLCA 3AR9A 3EIQA 2M98A 5HQJA 1DOHA 5FX2A 5AJYA 1LLQA 3LHSA 3Q4GA 4NK5A 5JVDA 4D4IA 4GM0A 4UAUA 2PX8A 3ZXYA 3OOHA 2EKPA 2F1KA 4PZ0A 4RZIA 4WBNA 1Y6ZA 2C42A 1KBZA 1A1SA 2G4LA 3QYPA 3VU1A 4F3YA 1FNBA 2RHLA 3IODA 1L8XA 2ODAA 4ID3A 5C32A 5FWYA 1D4ZA 2FU5C 1O58A 5JZ9A 3TCNA 4LC9A 3O8NA 4JC5A 1AGNA 3ZV3A 4LKRA 3QWBA 1D2AA 3VNRA 5IK2A 1TTQB 1WDKA 3ZCXA 1JHUA 3S1AB 2Y1FA 5KQPA 1APBA 2HR1A 4NJEB 3HCNA 4NRDA 2IYYA 2F00A 2QJRA 2AL7A 2P5SA 3PFFA 4MVYA 5KVSA 1HK7A 1VE1A 2GOYA 1JFSA 4Y1GA 1KSGA 1A98A 1DMRA 3VPCA 1DBWA 4EJ2A 1PVVA 4JUDX 1OAAA 1STOA 4B1FA 721PA 3OZGA 4AQYB 2O05A 3O9ZA 1JDJA 4Q12A 2EJUA 1PJBA 2ZQZA 2R96A 1QYRA 2EFHB 4FD2A 1UXGA 2QY6A 5ITWA 3I0MA 2WKRA 1KAMA 3DP9A 4HQNA 5ECWA 1SC9A 3VYUB 1PWHA 2LGJA 1ZRSA 3R3YA 1XMXA 2XBLA 2CLIB 2Q2QA 2J7PA 5U9CA 1E2LA 1LX6A 2ZJ5A 1ZMXA 4FZVA 3VHXA 1B6SA 1XU9A 4YAWA 4OJTA 4MP3A 1Q83A 4NESA 4UKDA 1H0HA 2C29D 1JKIA 1BDIA 4KYUA 2DR3A 1DHTA 4OQFA 1S3GA 1ZKMA 1P6QA 2R1VA 3CVJA 4YDSA 2WJAA 4EG8A 3QWAA 4X7RA 1A04A 1RM4A 2J9GA 2GCGA 2VCHA 3ENZA 5AJWA 1UJBA 2XCLA 3P45A 1DCTA 4EMUA 2EL9A 1K6EA 1S1CA 3T1NA 2IBMA 1XFAA 4L5BA 5KNBA 4UHBA 3H2HA 3L8DA 5IVHA 3B82A 2G40A 3I1YA 3RYCB 1KK3A 5BXYA 4J94A 1XUOA 3RRJA 1VMDA 1BWRA 3ROTA 1F0KA 2Z5FA 4AKIA 3HKCB 3LTEA 5CR9A 3H1GA 3BJZA 1WTAA 4Q7JB 3W1VA 1V7ZA 2N42A 3SU8A 1JJAA 4MJ3A 4YGYA 1L7VC 2A7XA 2GXUA 3I45A 1X80B 4JENA 1PI3A 1KAEA 4NCBA 3N2KA 1QTIA 1PFWA 3BWXA 2G5TA 3HGMA 3QBEA 3RAJA 3GPDG 3SEAA 3ZY6A 4F8EA 3EY4A 3U6BA 4M1WA 2R1TB 2E2WA 3LO8A 4E2YA 3K96A 2QENA 3M89A 1ND6A 4NI5A 5DCUA 5B7PA 1K5HA 2B78A 1XCGB 2RBEA 3PGA1 2AN1A 3HBLA 3MSCA 4PBTA 5E9JA 2IX3A 1RE0A 4TKUB 2OCKA 2IDJA 1OB5A 4R40A 2EDCA 5IBQA 3AF0A 5FFNA 4NE2A 3C3AA 3QJ5A 3F3SA 3P94A 1ACJA 4BEJA 1JLHA 1R4NA 2P67A 4IIXA 3G0OA 2IT1A 3P9RA 3RR2A 1CU1A 1PR5A 3O3OB 1P17A 1QIHA 2BFNA 4QRIA 2ODNA 3NWEA 4RF2A 4URZR 3SDBA 3LNCA 3GZNB 3TIVA 2FPPA 3AUUA 5LNK1 4ZTZB 1DOAA 4YCMA 3PPWA 1HDCA 1NXWA 2I4TA 3WGKA 4EBBA 3MS7A 4XARA 2IYLD 4IH4A 4EKEA 5DT9A 3OTQA 4OOFA 1T8PA 2WHXA 2ZSEA 3I9NA 4DYVA 3HP1A 5GPBA 1C1YA 2XF8A 4NG5A 2UXCB 4C0BA 4QXPA 1Z74A 3KEMA 4PGAA 4WNCA 1U0GA 1GQFA 2Q3BA 4PZ9A 4XCQA 3WQRA 1Z33A 2BFEA 1TYBE 4PO9A 4CV3A 2AJDA 3DHEA 2JVJA 4IIGA 3V00A 4KFUA 3W77A 2CBZA 1CCWA 2HCJB 3PDIA 4HMQA 4LWQA 3O5AA 5ALQA 2J6HA 1Q0LA 2ERXA 1BKYA 4GNRA 2WKWA 2AI2A 1RI1A 3GQBA 3N6RA 2BFFA 4BZPA 3EWAA 3KQSA 5DH9A 3KTFA 1E94E 1C7QA 1GPDG 4FKMA 4RH3A 3GT0A 4W1PA 4CM7A 2JLQA 3OPNA 4E94A 3BSSA 4IUBS 4FB4A 2XADA 3DE5X 3K9BA 3UB4A 4ITUA 2UYHA 2PLRA 2QBYB 4NF2A 4MW1A 1HT3A 4HXFB 2QD2A 5JEEA 3FYCA 4MRVA 3OFNA 3WJ1A 2ZB8A 2PMFA 3FIJA 5EMKA 1Q7TA 5TLSA 1EZ4A 1N8NA 2EZ4A 3N2GB 4P3YA 4PPNA 2YHSA 4ZI5A 1V2GA 1W8IA 3V8PA 4HFJA 3JCZA 4E0BA 1I7SB 3W5AA 1CS0A 2M1XA 3LCCA 3FCAA 4ZOLF 3UUGA 2Q5CA 3S8YA 1KOLA 4BNTA 4C2AA 2VF5X 2JK0A 2WJ6A 4EB0A 1BA2A 3E81A 3OP1A 4ENVA 3K9LA 4BLQA 4TRNA 4EHNA 3BULA 3UOGA 1F0YA 1JNYA 2HLHA 4ZVKA 1PEDA 1VRCA 1XTPA